2GZAA

Crystal structure of the virb11 atpase from the brucella suis type iv secretion system in complex with sulphate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
334
structure length
324
Chain Sequence
b'ASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIEDVPELFLPDHPNHVHLFYPVTAATLLRSCLRMKPTRILLAELRGGEAYDFINVAASGHGGSITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTKRAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type IV secretion system protein VirB11
publication title A Large Domain Swap in the VirB11 ATPase of Brucella suis Leaves the Hexameric Assembly Intact
pubmed doi rcsb
source organism Brucella suis
molecule tags Hydrolase
total genus 90
structure length 324
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2gzaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gzaA02
4M53A 2PT7A 2GILA 2QT1A 4G0NA 4HB3A 3SNHA 1MOZA 3K0FA 3KB2A 4LJ5A 4B3BA 2J0UB 3QPVA 3BWDD 3A4MA 2XX3A 3AUYA 4Q9LA 4OHVA 2EYQA 3TH5A 1FZQA 1T5LA 4G5OA 4BEBA 1RPZA 1XCMA 521PA 4EPWA 4IXMA 1E99A 3DKPA 1OJLA 1OIWA 4PC2A 1ZU4A 2LCFA 5L8VA 1FPMA 1NLFA 5DIFA 3WHLA 5JS8A 2WHXA 4M9QA 4OHWA 5J4LA 1IXRC 3TSZA 4AG6A 2CK3A 1E69A 1F2TB 1FP6A 3QQ5A 2FF7A 3U3OA 3QVVA 4IVPA 3THOA 2HJVA 3NBYC 4TMKA 2G83A 1U98A 2VO1A 4AYWA 4FWIB 2MMCA 1WE2A 4GP7A 3FKSA 5TMPA 3I1FA 5HZKA 4OI4A 1B0UA 4V03A 1KKMA 1PLJA 1PV4A 1CKEA 4RZ2A 2ZSBA 2QN6A 2W2VA 4G3XA 4QBGB 3TIFA 4POAA 1Q1EA 1YR6A 1IY1A 3CO5A 4HAZA 4DZZA 2CL7X 1Q1QA 3O47A 1KI3A 2PLFA 4B34A 4O3MA 2QSYA 1CJVC 4BLSA 1W2GA 2F3RA 4KYUA 5E95A 4B32A 5DISB 3MLEA 4B6FA 1HH4A 3PITA 1YRBA 3R8CA 4MUBA 1LFDB 2C99A 2PJZA 2QT0A 2FFBA 3D31A 1SULA 4JBXA 3MD0A 4W9MC 1SHZA 4EQ6A 2VRWA 3EA5A 4YMUA 2ZSEA 4A0HA 5DE3A 4AKEA 1S3GA 4WZ6A 2IYSA 5L3QB 4A92A 1SVKA 2G0TA 3AF2A 4TWZA 2F3TA 4TYQA 5DH9A 4DDVA 4CRWB 121PA 1CJTC 1Z08A 2JDID 5DHFA 1SVIA 1IAQA 4A6XA 3AUXA 3F8TA 1Z28A 2FE4A 5E7JA 3U7GA 4HLQB 1S3SA 3K0EA 1UBCA 3SBDA 2RB4A 1FFHA 1T3LA 2FSIA 5KSYA 2JJ2A 4LPKA 4GOJA 4Q4JA 1NBME 1YZKA 2UVQA 3DM5A 2PX3A 4H1VA 4W5HA 4ERNA 3U3RA 3M1IA 3LY5A 4YMTA 5DN6A 4A8JA 3CKLA 3ADBA 2QM8A 4LBWA 1P60A 2OLKA 2Z4SA 2GWHA 5GJCA 3T34A 1ZBDA 3IIMA 2PJRA 4KI0A 2KJQA 2ZRLA 4LUCA 1XP8A 3CUEF 2ANBA 3QF4B 2Q9CA 3THYA 2EFEB 3NVAA 1R6BX 2HXSA 3LX5A 4C0LA 1K5DA 1OH7A 2GEVA 1JI0A 4A4DA 4DLXA 4R9UC 2WKQA 4ESHA 2X19A 3A4NA 1G3RA 3PJRA 3KJGA 2C9YA 2OBMA 3OAAD 1YZNA 3FHOA 1DO2A 1HEIA 3CRW1 2V9PA 4MDFA 2PEZA 2XJ4A 4PZYA 1RIFA 2X77A 3IBGA 5G53C 2CVFA 4B3DA 5JJKA 1O87A 4JBWA 1NG1A 4HB0A 3QXXA 5AK0A 2ZUDA 2PL3A 2I1VB 3U3MA 1VHTA 4QC2A 2G9NA 3CRMA 1RRPA 1AS3A 1PUIA 4PQYA 1ZUIA 4ZV4A 2J59A 1SXJD 4L4UA 2CEAA 4GBMA 3ICEA 3V4RA 5E7IA 5DI9A 4OQMA 1U9IA 2G0NA 4TYPA 2BEJA 1KJYA 3RAPR 3UKDA 4ESVA 4K81B 4JVSB 3DPUA 5J4VA 2WJGA 5H70A 3UWOA 2IK8A 2NO0A 5JFGA 3RSLA 4AYXA 4TQUS 2PEYA 2AKAB 3WMGA 4DB4A 3W34A 1AM4D 1WA5A 3EW9A 1XEXA 3G82C 4PZZA 4LYFA 5B58C 1C4OA 2EQBA 4JLAA 3SDZA 3VU9A 2HYIC 4CF7A 4NYJQ 1RW4A 1JALA 2H8KA 3OFND 3QKRA 2DWQA 1IN8A 1KKLA 3SN6A 1OB2A 3NBZC 3GLHE 3SU8A 2BEKA 4IDPA 4MYCA 1E1QD 4LV6A 4TLCA 4FW9A 2AX4A 3LBHA 3X1XA 2FMXA 4D0NA 2OM2A 3OHMA 4ZPXA 3UPUA 2GKSA 5EZ5A 4RCZA 2ZRDA 2JIZA 3AVPA 1Z06A 3JVUA 1G16A 4X8HA 2H17A 2WJJA 4B48A 4CW7A 3Q5EA 2GXQA 3B8HA 4Q1EA 5JWRA 1NY6A 4N0DA 1PVOA 5E7MA 3LVQE 1KI4A 4U7DA 5KPJA 1EFHA 5KPDA 3LD9A 1WDTA 3EASA 4M9ZA 3U6BA 4ZCMA 1Q44A 2W2TA 1TNDA 4BFZA 3CRQA 1I4DD 1GNRA 2ZJBA 5FL7D 3K0SA 3AEZA 3R9IA 1FL9A 2PH1A 2CNWD 1JJVA 3C5CA 5FOUA 3EZ2A 3GP8A 3IBYA 2QRZA 4Y0VA 5BYJA 1L4UA 2F43B 2QMEA 4B3FX 1VCMA 1VG9B 1Z6AA 3VX4A 3T1TA 4TMXA 3WBJA 2XAUA 3QXCA 3CNLA 2NG1A 2GXUA 1EXMA 1CU1A 1HA3A 2MSCB 3DZDA 4EPRA 2JLUA 2YHSA 4YLGA 1FMJA 3IIJA 1PLLA 1VHLA 3K09C 3CM0A 2FV8A 3C16C 4DRZA 2ZRHA 3NIBA 2IWRA 1BOFA 4BFSA 4PC1A 5L3SB 3GLIB 1OH5A 4RD4A 2FJUA 2VP6A 3CWQA 3H4MA 3LWNA 1UDXA 2EU8A 4NZYA 3NH6A 3NXSA 4EPTA 3ZH9B 5JLJA 3FB4A 2D62A 3QPUA 1EWQA 4I81A 3U2QA 2G88A 4AG5A 5TB5A 1XPUA 4C0BA 2C03A 3VMFA 2WSSA 2IS2A 3L0IB 2ERYA 2B21A 3LQRA 2RHDA 4PO1A 5EXSA 4QBHA 2ZI3A 4F91B 2EW1A 1N6LA 1S9HA 3DL0A 3QXHA 2VSFA 3MWJA 3EZ6A 5FPHA 4AIIA 4B33A 1C9KA 1ZNWA 2O52A 2DR3A 1KIMA 4LZZA 3ADCA 3FTQA 2O8EA 4DLWA 1W5SA 1RRCA 1BYUA 1NMYA 3ZQ6A 2J3EA 5DI3A 3GLGB 4KFTA 1MH1A 4IKEA 2MSDB 4YQFA 1WBBA 4OJQA 2XZOA 1CF4A 1E2GA 1N0UA 3SJAA 4I1SA 5BW8A 3U7HB 1UPTA 4US2R 1FX0A 4FCVA 4IFBA 3U44A 1G8PA 1XJ0A 1IN5A 2D2FA 2ZSDA 4R2IA 3RANA 4D80A 1P7CA 4DIDA 5TARA 1M6NA 3AKEA 3HU2A 3EPJA 1E2QA 1TU3A 1O3YA 1E9EA 1F5NA 3TAUA 2W0MA 3EC2A 4MRRA 4PR0A 1S96A 5J5CA 5FI1B 3ZZ0A 3MG9A 2J0QA 1JJ7A 1QHHA 1J99A 2ORIA 2YWGA 1XD9A 2A5DA 3M4YA 5HTKA 3NG1A 4GPTA 2CHGA 3LX8A 5IHPA 3BFXA 1NSTA 3CLVA 3GLHA 3VR4A 4KYIB 3MJHA 1G291 2WM9B 2BM0A 1HY3A 2WIBA 3FMFA 3SBEA 4Q48A 4NYIR 5AJVB 3CF2A 2YINC 5JI2E 5CITA 1W4BA 5KNCA 1OFTA 4DSUA 4B76A 2DYKA 3RS4A 1GRNA 2HYDA 1E2MA 4B2PA 4UNSA 4GRAA 2XXAB 4QG7A 5JCPA 4OK5A 1Z63A 2J46A 2XTNA 2WKRA 4Q1AA 2WICA 2VTKA 4B47A 3K0CC 2QPTA 4NCHA 5FBVB 2KE5A 4L16A 2L0XA 4Q7JB 2HDNB 1GKIA 5JBQA 4EFMA 3BFVA 1VIAA 5FOTA 2CVHA 2NZJA 3EPKA 3HPQA 1DG1G 1TEVA 2DY1A 2FPKA 3FMOB 221PA 3SYLA 4PTLA 3D8BA 1P2VA 3CONA 1SQ5A 3VHXA 4O2RA 1G8YA 3B85A 1E4VA 3ASYA 4GFDA 1JBKA 3CZPA 4CT4B 4PAOA 4CT5A 1CJUC 2J9RA 5IF9A 4AD8A 5CB8A 2FA9A 4HDQB 1QRAA 4RVCA 3AP2A 1R10A 1KDTA 3TJZA 1J7KA 3I5XA 1OH6A 4B6EA 5FI0B 2BIFA 2FPLA 3VNUA 4DLYA 4FMCB 2D4HA 2VP0A 1Z47A 2YV5A 2IS6A 5KDLA 2FWRA 3WNDA 4HLDA 2RGEA 2BVNA 3BD9A 4QGGA 4NONA 2CDNA 4A0FA 2ZAOA 3BC1A 1TQ4A 2ECKA 2EWWA 3TQCA 4X8MA 3K9GA 3CBQA 3GLIE 1BH2A 3U7EB 4P0TA 3IKJA 2ORVA 1ZIOA 5AJYA 2O0HA 3AQ4A 4X8LA 4TYNA 3I32A 5CJPA 1LS1A 1ZINA 2X2EA 4DJTA 1R5NA 1RRFA 1FQJA 2FEMA 4FMCF 2FZ4A 1VPLA 5FPTA 3ZVMA 1T6NA 4TMZA 4AK9A 1M7HA 1MO5A 3CZQA 4LC1A 4LCBA 1P2SA 4OL0A 1NIPA 1ZCBA 2BCGY 4IHQA 4XD7D 4D81A 2NTYC 5CM8B 1RZ3A 1AQYA 2EFGA 3VKHA 3QE0A 2DBYA 1P62B 2QBYA 2HXYA 5FBLB 1A82A 2VHUA 2XNDD 3K70C 2ZQ5A 5J47A 1OIXA 5EE0A 3FYHA 4RD2A 2VH5R 2V55B 4IOJA 2ZRKA 3EPLA 1JQLB 2ZJAA 3ZVRA 4CEHB 3CH4B 3P26A 2HCBA 2BOVA 2C9CA 3IDQA 2IUUA 4DT1A 1E2EA 1W4CA 1G8HA 3OE7D 1QHSA 4EKDA 3GLFE 3SYKA 4DDTA 2AXPA 2QMHA 4A2PA 3HPRA 5C4GB 1R8QA 4OHXA 3QPWA 1E2FA 3HU3A 1OPXA 1KO5A 1JXMA 2OESA 5H1YA 1M7BA 1D8TA 1XTSA 2NO6A 1Y3AA 1ZM9A 1XXHA 1Z5ZA 2RGNC 3O8DA 2YOHA 4NU0A 2CE2X 4Y0AA 3RHFA 721PA 4WZBE 3QG5A 2R6GA 2OAQ1 2CE7A 1KO4A 4NL4H 1LS6A 3H86A 3OAAA 1IONA 2RMKA 1XTIA 2HUPA 1J70A 1IN7A 1MABB 1A1VA 3UXMA 4P4UA 1W4AA 4JLJA 1D2NA 3V4FA 4UNRA 2QE7D 1W36B 1R5OA 1GTVA 1OW3B 3RABA 1E6CA 1EX7A 4QJ5A 3SFVA 3UMSA 2D2EA 3T1OA 3BGWA 1CRQA 1X8LA 3O8CA 1OIVA 1NL3A 3E5HA 4JT4A 4EIWA 2BBWA 3LH5A 2N42A 1HURA 4BPBA 3EWAA 4C2TA 2ZAMA 2B7CA 1SXJA 3CR7A 1X86B 2J0VA 3WBKA 421PA 4D4MA 3KJHA 5F2EA 1GILA 4KLZA 4IVQA 2VP4A 1IXZA 2ATVA 2Q3HA 1KO1A 1LNZA 3HYRA 2FX3A 2QP4A 2RGGA 3I8SA 3X1YA 3AVTA 2NPFA 2GEDA 5B57C 1TAGA 2PMDA 5JWOA 5FUWA 4JLNA 1NBMD 2C78A 1K8RA 1E2IA 2MMGA 2OG2A 4MGKR 4MRNA 1IQPA 1M34E 1Z0KA 4M22A 5FUVA 5JSZB 5G3ZA 4TMTA 2OXRA 3OFNA 4YC7A 3QKSA 4QHSA 1N6PA 1QHXA 1II8B 3A1WA 4KODA 1IBRA 2V1XA 1E1QA 1KI7A 1TF5A 3AKDA 3QXSA 1SVOA 5K8LA 4IXNA 1DAEA 4F92B 1QVRA 1Z2CA 4WBSA 1AK2A 3WRYC 3MJRA 4ARZA 4Q5IA 1KDRA 2OFWA 1HE1C 3CR8A 1P72A 3NEJA 4ZDKA 1BYIA 1VG1A 4FMBB 2NOAA 1E0AA 4XJXA 2WJHA 1YHNA 3A1UA 5JI3E 4B73A 1T4GA 3E70C 1Q0UA 3NHAA 4V02A 3BB4A 3RWOA 5K8UA 3PVSA 1PUJA 5EXTA 3A4LA 2GK6A 3TQFA 3BH0A 2ZUBA 3LVRE 5FL7A 1F2UB 1YZGA 1ZW6A 4DKXA 1E2DA 2CNWA 4NCKA 2V1UA 2IYQA 2IYYA 1M8PA 3RWMB 1II0A 1Z6YA 3CB4A 2GCPA 4HUQA 4MDEA 3TNFA 1XF9A 1KK3A 2GBLA 4AYTA 4NCNA 1ZC4A 1Z83A 1SGWA 3ADDA 2D06A 5FBQB 4Q4HB 1L8QA 3WMEA 2A3RA 5G40A 4HDOB 1OXVA 5H68A 3A58B 2J1LA 2QM7A 1UEIA 4KV9A 4QJ4A 3RVBA 3K70B 2GJ8A 4TLDA 2HV8A 1R8SA 4HSEA 1KYIA 4OBEA 4OK3A 1DO0A 5IT5A 5FOWA 4EPXA 1RKBA 4BFYA 1XD2B 1UDWA 2FGKA 4URYR 1TL7C 2ZJ2A 3RRMA 2HJGA 4DHEA 3VR5A 2REBA 2JLZA 5C18A 5DLQC 1G41A 4D4KA 5GJVC 2ZE8A 3GLFA 4GP6A 3ECCA 1ETUA 3U3KA 2R2AA 3QBVA 4OI0A 5AJWA 2J7PD 4J0QA 4NBSA 2J45A 4M9SA 3AKCA 1X8KA 3L0SA 2RGDA 4JVNA 4DCTA 1U2RA 3U5ZB 4B3CA 2CCJA 3GFOA 4HYYA 3ZIAD 4Q47A 1ESMA 2ZI4A 2ATXA 2GA8A 3Q3JB 2GHIA 2ZE6A 2ZANA 3ZLJA 2YVUA 4PC7A 3ZQJA 3GJ7A 2C98A 1G7SA 2WBLC 4I99A 4IRUB 4O25A 5M04A 5JJLA 1NN5A 3X1WA 1GOTA 4RD3A 5FR1A 3FHTA 1GRRA 3UANA 1CEEA 4MKIA 2GJKA 4UXJA 5FOXA 3X2SA 1NKTA 1U94A 1CP2A 2ASEA 3OIYA 4BECA 1TUEA 1CJKC 3HU1A 3CX7A 5CDFA 1CRPA 4L8GA 1IJEA 3THXB 2HLDD 2ZRBA 3BH6A 4EFLA 5ELXA 4C7OA 2WPDD 1E9SA 4Q1CA 4LPSA 4P4SA 1W7AA 1Z8FA 4YONB 2ZJYA 5IK2A 4B74A 2W83A 3SI7A 2WIAA 5H8WA 2H7VA 3LO5A 1VCIA 4TQAA 1FNNA 3ADKA 2OCBA 3KKQA 4PPFA 3K1JA 2GAAA 3Q5DA 1OHHD 2O0KA 4JLKA 3R7WB 2ZI7A 4JS0A 4CEIB 2F9MA 1XZPA 1QVAA 2ZYTX 3LV8A 1T8TA 4LBYA 1XRJA 1E1RD 1GIAA 4F7WA 3AV0B 1T9HA 2B7BA 2OE2A 4Q02A 5P21A 1Y63A 1ZIPA 3P32A 2IYUA 1E79D 4JL8A 4LYHA 1W49A 3K8YA 1S9DA 2CJWB 1GKUB 2ZSFA 1PJRA 1QHIA 2BHRA 4KSBA 5JECA 2AFIE 2QROA 1CR2A 1G4AE 2H18A 2OXCA 2Z43A 2ZSAA 4GDFA 4RJLA 2CCGA 2GCOA 4II7A 5HKKA 4M4SA 4HAYA 5E3HA 2QAGA 1V43A 2GVDC 4F4CA 1KI6A 1N5LA 1GP2A 1N6OA 2BBTA 1JAHA 4NE2A 3A8TA 1UBEA 5UKDA 1XEWY 2V54A 1Z0JA 5EZ6B 5IDVA 1P3JA 2FPMA 3KXLA 1L4YA 1T91A 1XEWX 2IL1A 3RS3A 3SHFA 3QF7A 5J4KA 3U7FB 1UJ2A 3AF4A 3IGFA 4JLDA 3GJ4A 1NVVQ 1TQDA 3C4JA 3HWSA 3IUYA 1G17A 4A82A 2ZVPX 4MYUA 2REOA 2G6BA 4QBIA 3TUZC 3VTKA 1I4LD 1KI9A 4Q00A 4E03A 3DOFA 2FN4A 5F9FA 1N6KA 5FTJA 2WWXA 2C96A 3MMPA 3L82B 3PEYA 3THWA 3T12A 3B1YA 5KUTA 2P3SA 2EVWX 3V00A 3BBPA 1ZU5A 1GNQA 1UBFA 5FTLA 3PQCA 2A5GA 5KTYA 4B44A 3EWSA 4QXAA 3EZ9A 2QGNA 5KDOA 2GF0A 4URVR 4M1MA 4UNNA 2YOGA 4M21A 4LJ6A 4LJAA 1ZVQA 3S1AB 3BORA 1KMHA 1ZCAA 4UJ5A 3TLXA 1X1SA 4TN1A 1QF9A 2NPIA 3DMDA 1OXXK 2H16A 2QP3A 1ZD9A 1P2UA 1II9A 2ZR9A 1X6VA 4UQOA 2WSMA 2ZRCA 4UNQA 3VHLB 1OH8A 2XEXA 5BN4A 1G7TA 2A5FA 1JR3A 4ILEA 4LBVA 1KOFA 3T5DA 5JCZA 5AUQA 4DC9A 1I2MA 2C2HA 1P9WA 3B60A 4N3NA 4CZ2A 5FUYA 2R6DA 4BZQA 4KLNA 1US8A 2ZU0C 4DCUA 1SVWA 3B7GA 4V0ME 5GADl 2VSOA 3MSXA 1WCV1 4GMDA 2RGBA 3HYTA 4AWXA 2HCJB 1L7VC 4B2LA 5FPSA 4BASA 2ZS7A 4O2LA 4RFSA 3GEEA 2ZI6A 4KHZA 4WXRA 2FU5C 5LDDC 1OF1A 3HP1A 2E9SA 1EFTA 1GFIA 1XJCA 4DLTA 4K8OA 3W8NA 3LXRA 1TADA 4LHYA 2H1LA 1AZSC 5FBRB 2QQEA 2QL6A 2VSXA 3UMRA 3GJ3A 2C95A 1G1MA 2HF8A 2XNDA 2FFHA 4NP6A 1CJMA 1DBSA 5CK4A 5D3MA 3VR1A 4H1UA 5CB6A 4HI0E 1VMAA 2W6ID 2IUSA 1NLYA 1VYTA 1Z6GA 2ZRIA 3IIKA 4FMDB 4Q1FA 1GAJA 1XX6A 4JYCA 4NYIQ 1ZC3A 1UAAA 3TE6A 1WQ1R 2BJVA 2CLDX 1ZNYA 2FGJA 1KO7A 4YMWA 1Q22A 3T61A 3MWLA 2VHTA 3OE7A 3RLFA 4EJSA 1N6RA 2QMOA 1OFUX 2B8WA 2Q3MA 2ZE5A 3AVVA 1Q3TA 3MRSA 3OIUA 5SZIA 2A5YB 2IYZA 3TR0A 3D3QA 2R62A 4KCGA 2NZ8A 1NG9A 2RKOA 3L0PA 2IC5A 5HPYB 1Z29A 4EPYA 1RRGA 2RGXA 4Q03A 4M1TA 4FMDF 1G20E 2FFQA 4NDZA 2ZXUA 4D4JA 4RSGA 5FFMA 1VIYA 2JJ1D 5FBWB 5F3WB 3QVUA 1UM8A 2XB4A 1MR3F 8OHMA 2VYFA 1M1YE 2H5EA 3CPHA 3MWYW 5CLLA 1EFRD 2QE7A 3Q85A 4YDHB 2FFAA 1P4SA 4Q7LA 1E9RA 5HCNA 1SKYB 4LYJA 4TT3D 2ZYWX 1NVUQ 1N5KA 1FUUA 2AK3A 4NCJA 3BRWD 1GG2A 5EP2A 3A6PC 1TQ6A 2ZRPA 2OCYC 1U99A 5TV2A 1GL9B 2IEYA 4C0AC 2VHJA 1E9FA 3WP1B 621PA 2AWOA 1DAMA 3SR0A 1G9XA 4L15A 5FTNA 4PSVA 1UKZA 4MRPA 4BWYA 3TVTA 1CXZA 4HAVA 4WIAA 2AXNA 3QSYA 2OUKA 3RS7A 2PZGA 1LVGA 4GOKA 4TSFD 1S1MA 4Q4AB 2ZRFA 4JKYA 5DHAA 2KSQA 3DHWC 2RAPA 4RKEA 3REGA 1NBMA 2QP9X 4I1UA 3SS8A 1N2CE 5EE5B 2HEIA 1CLUA 5FTKA 1N0VC 1IOZA 3M6AA 2GTPA 3DO6A 4LBZA 4URUR 3T5GA 4XTRA 2GETA 3AGQA 4PPQA 1T8UA 4B71A 1HYQA 2VP5A 3K0AA 4XWKA 3RYTC 2ERXA 3F0TA 1OT3A 2VBCA 2IBMA 5KSZA 1E32A 1DE0A 3NEYA 2HT1A 2QORA 3VR2A 3PFIA 3W5JA 5B2ZA 2V8OA 1D2EA 1EX6A 2OHFA 4ZKEA 1A7JA 2ZJZA 1KGDA 2OCAA 4V0KA 1XPOA 2EYUA 3UK6A 2QUZA 3I8XA 3AVUA 3EG5A 3PEVA 4KBFA 3QUSA 1Z3IX 4ARZB 1Q1BA 2D74A 1OFHA 4BZXA 1GL6A 4BRUA 5FOVA 1DG3A 1EG7A 1IY2A 2ZROA 2ZJOA 2YYZA 1CIPA 1FUKA 2R8RA 4BEJA 4UJ3A 1Q12A 3PV0A 5LPNA 4V0MA 2GEUA 4P31A 2VP9A 4HDCA 4DLSA 1G7CA 2C04A 3CNOA 5KNBA 3PEWA 4W5JA 1W0KD 3VFDA 1DPFA 3V9PA 4RZXA 3WRXC 4DEXA 1AA9A 2O8DB 2GF9A 2ZRNA 4QBFA 3TBKA 3C14C 2BBOA 5K8TA 2GZHA 4DSTA 4HZIA 3SFZA 4B2IA 1A4RA 2QMUA 1KK0A 2JASA 3IO3A 4QHYA 5J40A 4MUAA 3Q7PA 4GZLA 2J0UA 1GZSA 4BLQA 2B6HA 3ICQB 2O8BA 3C41J 3T15A 1ZM7A 3EXAA 2JLYA 2XTZA 5DYIA 4B3GA 1NN1A 3KKPA 5ANRB 4TMVA 1NY5A 2X2FA 4NCIA 1KSFX 4C0JA 2MSEB 1HT2E 1MO3A 2NMVA 4IDQA 2WJIA 1AN0A 2ZVQX 5A4JA 4BRWA 5FTMA 1F2TA 5EE3A 2ZR7A 4OYHA 1RVDA 2J7PA 4PXAA 5J4HA 3IPYA 5DGXA 4HLUA 2PCJA 4JMPA 1DS6A 2XGJA 4N1AA 1M7GA 4B3XA 1XB2A 3GPLA 2OCPA 3N5CA 4MKHA 3ZIAA 1W36C 1I2DA 1LV7A 4KAXA 4R71A 5JEDA 1DTSA 1ESNA 5JZVA 1KJZA 3L8ZA 5C4MA 3KTAB 2Q0HA 2QY9A 1ZP6A 2V7QA 5JJIA 2K5UA 2Y8EA 4DSNA 5JHGB 1U9IC 3RS0A 4JJKA 3K0FB 4NYJR 1R2QA 2WOOA 3AF1A 1E2LA 4XSHA 5B30A 2UKDA 1FMLA 4DUGD 5AUOB 1ZMXA 4DIEA 2IHYA 3TW8B 1R0ZA 1YZQA 2IW3A 2P6NA 5BWMA 3NDPA 2NQ2C 2HLDA 1K6MA 2YWHA 3B82A 2WPDA 2NIPA 3MAAC 2F9LA 3NWJA 1YR7A 4FXPA 5L3QA 3H1TA 1RJ9A 1JEEA 2IS4A 5JHHB 5KHOC 3B13B 1UADA 1Z22A 4Z51A 4LJ8A 4RZUA 5KYKA 1OHHA 2XOKD 1N25A 2QQ0A 2J0SA 5EP4A 4LOAA 2A7QA 2D7CA 4TMWA 5A5GA 1UBGA 4G5GA 1DVRA 4TL7A 4LGMA 1QHYA 1E1RA 5EJEA 1U8ZA 1RYHA 5J4YA 1G7RA 4US0R 1E79A 3AGPA 3BOSA 1PZNA 2XB2A 3P4YA 5DN6D 4M1YA 3N2EA 4F38A 3U61B 4JSYA 2VP2A 2XZLA 3B6EA 1E4YA 2F6RA 2KBFA 3QF4A 2GCOB 2RH5A 4IW3B 3KJIA 5FPYA 4AC9A 4CIDA 1AZTA 2WWFA 2IF2A 1NIJA 4EQ6B 4C2UA 3K53A 4LRWA 1M74A 2QNRA 3O8RA 4KITB 5EXXA 3GEIA 4R7ZA 2BJWA 2JDIA 4BUJA 2AN9A 4LJ9A 5SZHB 3EPHA 1NKSA 1OSNA 3GJXC 4CVNA 2IXEA 4XVUA 3G5UA 4P33A 4JYBA 1Q20A 3ZD6A 1W36D 3FMPB 5SZJA 2I1QA 3GLGE 4W5WA 3WY9A 3VKGA 3GJ6A 4Q4JB 2YNMA 1KHTA 1XDBA 2AD5A 3B1ZA 2QAJA 1W46A 4DXAA 3THWB 4A8JB 3ZS8A 1YQTA 4M9XA 4TL9A 1N5JA 1N6NA 2IYWA 4FCTA 2IT1A 2EFDB 4JZKA 4DWJA 4LY6A 3TR5A 5CM9C 2Z5FA 1N6HA 2O8FA 1WXQA 3MUFA 4IEIA 4RKFA 2FEOA 3OIWA 4BFXA 3K9NA 4BFWA 4HAWA 3THYB 4GI7A 1W47A 2PBRA 3KQKA 1BO6A 4URXR 1SKQA 1YRAA 1A2KC 3C15C 4L9WA 1XPRA 1NP6A 1AIPA 2P6RA 4H9GA 4IOMA 2WKPA 3EA0A 1YR8A 2BBSA 2OZEA 1YU9A 1F60A 1FQKA 2I3BA 2VQSA 2X8AA 2GNOA 3PCRB 3GCGA 4RCYA 4ZCLA 5LB2A 4YMVA 2BKUA 1P75A 2DCUA 4L5BA 2NO7A 4URZR 3TUIC 3CW2A 2FSHA 4ZDIA 5BN5A 2IYTA 2IHBA 5HE8A 5F98A 4BLPA 5F9HA 1TX4B 1N6IA 1KI1A 4BFTA 4PANA 2FH5B 2JIZD 3NC0C 4M8NE 3W6PA 5JRZA 4IEEA 1TEXA 3KJEA 4DBLC 2PMKA 4A2QA 2SHKA 1G5PA 3NTUA 5GJWC 3HDTA 4D0LB 1TF2A 2IYXA 3AP3A 3RS2A 4D6PA 4LX0A 3P1JA 1COWD 2OEPA 1NF3A 1MV5A 4M1WA 5EUMA 2OO7A 2AL7A 1MKYA 2AD1A 4PPGA 4WA7A 3RDPA 2W6IA 4PSKA 3AVQA 4XH9B 2DWOA 2OT3B 4IVRA 3P27A 2P5TB 3X1ZA 1XEXB 3KXIA 3DEFA 3VU9B 1QHGA 1LB1B 3QKRB 4ABYA 5JS7A 4BFVA 4HZUA 4NYMR 1NN3A 1ZYUA 1OFIA 4EJSB 2F1RA 3ETLA 4RD0A 5DYGA 4O0MA 1S0UA 2PX0A 1SHKA 1E2JA 2VHCA 3EAQA 5TVKA 5JWHA 1R4AA 2Z83A 3AVXA 4JJZA 1K5GA 3K70D 4AY2A 4D25A 1OKKD 1BIFA 2ZEJA 4C3ZA 1H8HD 2E87A 2WWGA 3ZGXA 2P67A 1S1CA 1KNQA 1G18A 2JJ1A 1Z6XA 5L3SA 2WJYA 3GLIA 1KSJA 2VHQA 4CEJA 3P20A 4KO8A 4AI6A 4DLZA 4E09A 1WMSA 3U4QB 1E94E 4TLEA 2B92A 4MA4A 4U00A 3KQUA 1EFRA 1YVDA 4RD1A 2P5SA 1JPNA 4IDOA 4YXWD 2OSBA 3HR7A 4TT3A 2O8CA 2AHOA 4LHZA 2GESA 2ODNA 5C1BA 4LDJA 2GXSA 2J87A 3IQXA 3ZVNA 1G19A 4A2WA 3IHWA 3VKWA 3AVWA 3JZMA 3NDBB 1NRJB 2VA8A 4QFMA 2JLXA 2V3CC 4Q9KA 1G3QA 3A1SA 3TRFA 821PA 3MCAA 2E1RA 4TSFA 2W0SA 4XVRA 1PLKA 3ND8A 2GJAA 3AH8A 4V0OA 3W5IA 3A1TA 3BS4A 1P73A 3GLGA 2D3WA 2F1IA 3NHBA 4YDSA 2WOJA 4FN5A 3WMFA 1YZLA 3I4LA 2PT5A 4LJ7A 5HR5A 3LRPA 4M1OA 3PXGA 2FSFA 4OK6A 1P2TA 1XFAA 1GKYA 4IJMA 2YWEA 2WMOB 2KBEA 5L3RA 1G21E 1U8YA 4YMSA 1FOEB 5BQ5A 1Z0IA 2F7SA 4LSGA 4QNMA 4TTQA 4PHGA 1NMXA 3UATA 1FTSA 4Z1MD 3SZRA 1S8FA 4MKGA 4HATA 3FFAA 4HUTA 2QI9C 1OYYA 2H92A 3DM9B 4NMMA 1U8AA 3Q8XB 3LA6A 1XBTA 2R6FA 3UIEA 4BE7B 4BLTA 4AKHA 3LLMA 1XWIA 1E3MA 1HQCA 1G5RA 3FDIA 1NNEA 4NH0A 3OF5A 3WYAA 4HB2A 4U02A 2DFLA 1VECA 4G01B 3TW4A 1RC8A 3QKUA 2O8EB 3RSOA 4XSGA 4E5UA 1Q1ZA 3BE4A 4ZDJA 4QM6A 3F5FA 3GEHA 5DI3B 3TKLA 1MO6A 4LHXA 1AKYA 3BH7A 4OKSA 4Q1BA 3AF3A 3QEOA 2WJVA 4OHZA 2QTFA 1VDZA 2NO1A 2V4ZA 1W0KA 2JJ8A 1Q57A 4JLOA 3WP0A 2WWHA 3LNCA 4DCSA 1FX0B 2W6JD 4DLRA 4US1R 3U44B 2XXAA 1OXSC 3TGPA 1U0LA 3CF6R 1W5TA 2LKCA 4WVFA 4EFNA 4D82A 1N3BA 3EX7C 1VTKA 1ANKA 1D9ZA 2G1JA 1T0HB 3BERA 1E2NA 2BWJA 1CR1A 3P4XA 4LV5B 2QGZA 3TAHA 2O8BB 1QHHB 1S4QA 3OEHD 1WF3A 1LF0A 3W6NA 2ZJ5A 1H8ED 2QPOA 3WHKA 4ACAA 1YE8A 2VEDA 4KFUA 3GLHB 4Z8YA 4ON9A 2LKDA 1ZM4A 3RS5A 3I5YA 1W0JD 4M1KA 2WWYA 2IYVA 4S2EA 3LXXA 4Q9JA 3Q72A 1AKEA 1S2MA 3RNLA 3ZS9A 4BLOA 4ZIRA 3PR1A 1E9AA 1R0XA 1T5IA 1ODFA 1YR9A 3GQBA 2LWIA 4E22A 2BKEA 3N70A 5E4FA 1ZD8A 3B9QA 1OLOA 1QDEA 1UKVY 2A5JA 2ZITA 3FKQA 3K09A 3NKVA 4JL6A 1QG2A 4Q18A 2G77B 3W3ZB 4DCVA 2ZM5A 4ZDWA 5EE9A 2REXB 1JB1A 2W2XA 4PHHA 3AKYA 1SXJC 5FPKA 1HQYE 1MRNA 1XTJA 1E98A 2W58A 3FGNA 2XNSA 4OHYA 2ZYUX 3T1VA 4DDWA 1RYFA 4KSCA 4P3YA 4DUGA 4TQ9A 2DFTA 1R0WA 4A9AA 4D2IA 3SEAA 3FWYA 2F1JA 4WAUA 3BJIC 4PQRA 1TQ2A 1QZXA 2JCSA 3FFBA 3KUDA 4FCWA 1UF9A 1W1WA 4HB4A 2EFCB 1IN4A 1JXOA 3ZD7A 1J90A 1RJ9B 5LD2B 4D4LA 3CF0A 3H84A 2A78A 2XOKA 4Q21A 2WWIA 1KTVA 3KUCA 3W8RA 3SHWA 4DEYA 1OE0A 4OI2A 4CDGA 2WAYA 4UKDA 1SZPA 3QEJA 4QGFA 4BZPA 1XCPA 1W48A 3PEUA 3EC1A 3SQXA 5D3QA 3BAFA 5L3VA 1ZM2A 4CEHA 4IOKA 1G3MA 1OXTA 3DDCA 4QNRA 4KBGA 4HAXA 2UZIR 2PCLA 4KU4A 1MO4A 2EFHB 3QOFA 3WNCA 1E96A 4V0NA 2DPXA 3QNUA 3LAWA 2FG5A 4MKFA 1XMJA 1MRSA 3QXJA 1DOAA 1KSHA 3KKNA 3FVQA 2OAP1 3KL4A 4B35A 5K8IA 3C8UA 2IF0A 1B23P 3SJZA 3ZJYA 4C9BA 2OFXA 1X8JA 1XTKA 1EFCA 5A0FA 1I4TD 1V5WA 4I1VA 1E2HA 3AB3A 4XD7A 3ONWA 1XCGB 2I4IA 5B64A 1LTQA 2GDJA 1VCNA 4FWTA 1JQJC 2GBLC 5BN3A 1WP9A 3R9XA 2PZFA 3RC8A 1CTQA 1MABA 4DLUA 2IYLD 1XZQA 1JECA 2QBYB 2XTMA 2JLVA 4C0SA 2OFOA 5HCIA 4FD2A 3EARA 3IPXA 1AJEA 4QOSA 3A37A 4MQBA 4URWR 1EESA 2ZTSA 2A2ZA 3BB1A 4I1OA 1OB5A 1J8MF 1IN6A 3ZYCA 3GFTA 3K0CA 1HE8B 4PZLA 4DT1B 1UKYA 1BKDR 2XZPA 2QRNA 3UWKA 3WYFA 2JLRA 2OBLA 3CPJB 3B1VA 4G1UC 2CL0X 2BV3A 2BMDA 2IYRA 1ZD1A 3QKTA 4M2LA 4WOPA 5LBIA 3IILA 2O8FB 2B8TA 4Z54A 2GK7A 2VLIA 1GRQA 4ZCIA 2ZJ8A 3CRVA 2QTHA 2N1BA 4M1SA 5CYOA 5DSZA 1SVMA 2P65A 2KWIA 3L0OA 5JSZA 3RRNA 4JIMA 3T1QA 2RGAA 1XXHB 3LBIA 5TDHA 2G1KA 2OILA 2G3YA 1KI8A 3OESA 1OXUA 1P61B 1Z2AA 1QBKC 2J7KA 4KFRA 5FUXA 5G41A 2H57A 3B1XA 1E9CA 1II8A 3QG1A 4MGIR 3VR3A 2D7DA 3CNNA 4JT2A 5AWFC 2VL7A 3BXZA 3ZZTA 4B75A 4XWOA 2UZ3A 4F93B 2VF7A 2DB3A 5FR2A 2BCJQ 4JLMA 1CS4C 1VYUA 3PUXA 4R2HA 2AFHE 1VG0B 2QSZA 4ASUD 2YKGA 4G5SA 1LW7A 2XSZD 2Q21A 3W3AA 3PUYA 2QENA 2V6IA 1SXJB 2CL6X 2JLQA 3GJ8A 4PO8A 5JRJA 1KI2A 1COWA 3B5JA 4TZ6A 4LYAA 3B2EA 1IY0A 3CH5A 5TXGA 1KZGB 1NJGA 1G64A 1FTNA 2F1HA 2JGNA 4JBYA 4JLBA 4LWZA 4XIGS 4LHWA 2ZRMA 3R20A 3EIHA 3PG5A 1LY1A 1F2UA 4NKRA 4ZI2A 4FIDA 5C46F 1KMQA 4U5XA 1W2HA 4PHFA 1XTQA 4EPVA 2ZE7A 4P4TA 1YJ5A 2R6CA 3NBXX 3H2YA 1X3SA 4RD6A 4OJKA 1H65A 4HZUB 4K46A 3QKSB 4F4IA 4A0RA 5SZKB 1KK1A 3QENA 1KSGA 5AR1A 4Q4HA 3KXKA 5KOYA 2IXGA 1G6OA 4C4PA 4V0LA 1OKKA 2PZEA 2HT6A 4NTZA 1NMZA 3EZ7A 3SJCA 2JA1A 1H8HA 4CYMA 3W9YA 1SVSA 1G8FA 1GUAA 1XD2A 2OLJA 1KY2A 2QAGC 3W6OA 3WXMA 2KI5A 3IEUA 2QPAA 3SE0A 2OV2A 4A36A 2RCNA 3NH9A 1NVVR 3EIQA 3TMKA 5KDDA 3R9WA 4CEJB 2XITA 2WTUA 1KDPA 4UXIA 4DVGA 3QY0A 1JNYA 4Q01A 3KKOA 4YXWA 2BDTA 1EWRA 1TUIA 2O8CB 1JR6A 2R65A 3AF0A 4XVQA 2IXFA 4OI1A 2ONKA 5C2JB 3L43A 1Q3HA 1T3SA 1CBUA 2RGNA 2GZAA 3OEED 4HUQB 4D26A 2IS1A 3U60B 3BB3A 5AJXA 3U4QA 1BMFD 1DEKA 2BC9A 4A8JC 3PIRA 3B1WA 2WZQA 3TVDA 2BMFA 1RE0A 2JLWA 2O0JA 2WAXA 3ZVLA 2HF9A 3TUJC 2C5LA 1E0KA 4DCNA 3FE2A 1WB9A 4Q66C 4BLRA 4BGDA 2QZ4A 1TMKA 3THXA 2QTVB 5JMTA 4LJ4A 1GWNA 5EXPA 3REFA 3B78A 1XNJA 2GRJA 1D5CA 1UEJA 3ASZA 3K9HA 3ND9A 3D6TB 4QKQA 3GLFB 3C7KA 3N2IA 2DHRA 1IM2A 3SOPA 4MGZR 2CK3D 4Z1MA 5IK2D 4PHTA 4S35A 4GL2A 4AKGA 4TZ0A 3R7WA 2WMNB 4QJ3A 5KO2A 5FOSA 1F3OA 4CEIA 4OQLA 1NVWQ 4NPHA 3FKSD 5KSPA 2ZRGA 1X1RA 5CYPA 1XU4A 1U0HC 3QI2A 2ZI5A 5HZHA 3IO5A 3RRZA 4A15A 4P32A 2CJWA 1XXHE 3IHLA 2OBNA 2TMKA 5AUPB 4LV8B 1KY3A 1WRBA 1XEFA 3CX8A 2ZR0A 1XJQA 1HT1E 3KKMA 2Q9AA 2BMJA 2IA5A 3O8BA 2FDCA 1E9DA 4C0QC 4ITRC 1G6HA 5EE1A 3AP1A 5EQTA 3JVVA 5HKKD 3KB1A 4NYMQ 1SKYE 1KDOA 2PLRA 3LQQA 2W6JA 3UG6A 5LB4A 3G0HA 4C7OB 4MYTA 1NJFA 3J81k 4PC6A 4EDHA 1JAIA 3LW7A 4PPNA 2O5VA 3CWZA 1TPZA 4P4SB 4TTRA 4ZO4A 2Q9BA 5EP1A 3A36A 4EJSC 1SXJE 4N0EA 3BK7A 1AGPA 1KAOA 4TLBA 1G3IA 1TU4A 1DELA 2XJ9A 3AM1A 3VX3A 5KNDA 1JEDA 1T3HA 4XWAA 3W90A 4ACBA 1GNPA 3OEHA 2YOFA 4UXHA 2IX3A 5BYKA 3WNBA 2CCKA 2J5XA 1H8EA 2F55A 1ZNXA 1RFLA 3ZZUA 2ODWA 2JJ2D 1IHUA 3TSOA 3FPAA 3JZAA 2GJSA 1A2BA 4Q7MB 3LLUA 2YC4C 3M0EA 1W0JA 2FZLA 5JEEA 1HV8A 5FL3A 2IEZA 1GITA 1AS2A 1G5TA 4NHOA 3SC3A 4ZIRB 4HLCA 1Z0AA 3A1VA 1DAFA 3LBNA 3S1AA 1Z0FA 4PQFA 4Q1DA 1U90A 3NC1C 3OZXA 2N46A 2QAGB 4MYHA 1Z6TA 1VKJA 4Q4LA 4LHVA 3LDAA 4XTCS 1KI6B 2Z0MA 4Z8XA 4FINA 5EP3A 3EIEA 4PAQA 3IEVA 1G3UA 2YWFA 1JR3D 1HUQA 2NGRA 4RY2A 5TY0A 2ZPTX 4PC3A 4TYWA 3D7MA 1CR0A 4JLVA 4WZAE 1KK2A 2ZS8A 3DOEA 3F3YA 4HEJA 3I92A 1GSIA 1OV4A 3KDSE 3QBTA 2VIIA 3L2OB 3I61A 3LFUA 4PFSA 4LC0A 2W00A 4Q7KA 4JKIA 1J2JA 1DADA 2FSGA 3I73A 3GJ0A 3KQLA 3T35A 4PX9A 1E2PA 3CIOA 3TK1A 1C1YA 1F6BA 2CMKA 2ZRAA 3GFPA 5IRCD 4PO9A 2GVZC 1E0JA 1AQUA 3KQHA 1DAKA 3UG7A 1L2TA 3U3JA 1NLZA 1KMHB 2VF8A 2R6AA 1G8GA 4Q19A 1IXSB 2CXXA 4GSYA 2AR7A 5HE9A 1CR4A 1FNMA 3C5HA 3SJBA 3KX2A 4GMXA 1FP7A 1QHNA 3GJ5A 4EUNA 2QEQA 2CLCX 1Q21A 4JVMA 3KQNA 2P0EA 3PUWA 2FOLA 3EZFA 2C8VA 2P6UA 4B43A 1YZTA 1DAHA 1HTWA 1NVXQ 2NO9A 2Q6TA 3GMTA 1U81A 4W7SA 3WYGA 2EWVA 1NI3A 4BQSA 4JSTA 5CIQA 4C0HA 1VG8A 1KAGA 3DVLA 1WBDA 4OQXA 1ZAKA 2ANCA 1DARA 4F4JA 2VPPA 2CLSA 5CIWA 4IOLA 4KVGA 1US8B 4IDNA 1MT0A 5CLQA 1P9NA 2JATA 1SVLA 2ODEA 2ZETA 3GD7A 3K9LA 4WXPA 1ELOA 2ZIAA 4Q9IA 4DDUA 3T06B 4R98A 2DWPA 2QU8A 4A0GA 4E07A 3VNVA 5KU1A 4RFSB 4QM7A 3FMIA 2DFKB 2BMEA 1ZJ6A 4OQFA 2V6JA 4XOIA 4KJZA 1LF5A 3VQTA 1P5ZB 2ZRJA 3PENA 3I62A 4A1FA 4IDHA 3HR8A 5D3MB 5BXQC 2CHQA 4I4LA 1N0WA 5G3YA 3FOZA 2QG6A 3VAAA 4ZI3A 3LW8A 1VCOA 4AKIA 4GNKA 3BIFA 1E2KA 1EGAA 1KO8A 4G5RA 5CJ2A 5AUNB 5CDFE 1BS1A 4TTPA 5GVSA 3ZDQA 2A9KA 1UFQA 3L8YA 1N5IA 4QRHA 2F43A 1W4RA 3AVYA 1KNXA 1J8YF 5DNYB 1R5BA 3QJYA 1EK0A 4Q4AA 4HLUC 4PAMA 4MRSA 2ZU6A 1JPJA 4C0KA 3AVOA 2CBZA 1CULC 1XTRA 2RGCA 1GM5A 1F48A 4MRVA 2IUTA 4C30A 4CGZA 1A5TA 1YKSA 2RHMA 1KZ7B 1AS0A 2P2LA 2KB0A 4X8OA 2AK2A 3VR6A 1D2MA 1P6XA 3SQWA 2AWNA 1NSFA 1VYVA 1TF7A 2JEOA 1Z07A 3E1SA 2QA5A 2GXAA 2X1VA 3Q7QA 1U0JA 1XMVA 1DAGA 2GJ9A 3IQWA 3X1DA 4GZMA 1NN0A 1ZRHA 1TTTA 1R7RA 2FNAA 3DKVA 1KJWA 5GJBA 4ZKDA 4L9SA 3QIAA 4WW0A 2GZDA 1M2OB 3DZ8A 2WV9A 4DSOA 4BFUA 2GCNA 1Z0DA 2WSSD 1GL7A 4ASUA 4RZ3A 3KZ1E 1AGRA 1ZM3A 2XSZA 3KFXA 3SYNA 1R0YA 2YZ2A 4DLVA 3BFKA 3R8FA 4GOXA 1EFUA 2CHVA 4TL8A 3RRYA 5LD2C 3PUVA 3PUZA 2ZS9A 4MGYR 3RC3A 1GVNB 3DMNA 4QL3A 3CX6A 4JVLA 4A6PA 1OYWA 2DFNA 5EUQB 4TYYA 1XMSA 1IJFA 2R9VA 2JLSA 4MITA 3H0KA 3MFYA 4LJYA 5FH9A 2GAOA 2AKYA 5GVRA 1DAIA 2ZYVX 2Z4RA 2BM1A 4TLAA 1UKEA 3FHCB 3MWKA 2YC2C 2O8DA 2ODBA 2WWWA 2ZUCA 3CRRA 1D6JA 3Q9LA 3UMFA 3KFVA 5AJZA 2ONJA 4G5QA 3E2IA 3K0AB 4KVAA 4FI3C 4UNPA 2Q3FA 3MGCA 2IWHA 4KFSA 1QG4A 2YJTD 4JL5A 1ZUHA 2C77A 4Q9HA 2WVJA 5DO9A 4HAUA 1XD8A 3I3SR 1GDDA 1E0SA 1YZUA 2A30A 4GT1A 3OIVA 5CK5A 2JAQA 4OQNA 4IFEA 1FW6A 4JLPA 1E9BA 4AURA 3HJNA 3TSWA 4EAQA 1G4UR 2C9OA 4TL6A 3CPEA 1XMIA 1ZNZA 6Q21A 1JR3E 4QHTA 3B9PA 3U6KA 4QGHA 1D9XA 1ONBA 4RFVA 4LK2A 4KXFB 2ZI9A 1T0JB 5KSOA 4D0GA 4M0LA 2J41A 4QGAA 1P9RA 3NBFA 4PSAA 4DB2A 1ZUNB 3OEEA 1W44A 2ORWA 4LI0A 2R44A 3KTAA 2ZREA 4MH0R 2Z6VA 1BMFA 3I72A 2V7QD
chains in the Genus database with same CATH superfamily
3K8OE 1LL9A 1F9IA 4FUTA 3OLWA 3QUAA 3IAM6 1U31A 2Q4TA 4EB8A 4JASB 3ZDYB 4JC0A 1OX4A 5LDGA 1NLFA 2WHXA 3TSZA 4AG6A 1PEYA 1E69A 3FZYA 3QQ5A 1QRRA 1TIPA 2G83A 1BHSA 1C0IA 3P52A 5JATA 3I1FA 1EROA 1GHIA 3S68A 5DK4A 5EIFA 3GMDA 4E15A 1ENYA 5I45A 4R4RA 1IY1A 2HCTA 4K9NA 4I2VA 4DZZA 2CL7X 3VAYA 1KI3A 4TS1A 1H93A 3G6OA 4WN9B 4FB4A 2XCOA 4NMXB 3DE3X 3D31A 3RWBA 4QYIA 3LIBA 5CH3A 3FPGA 1NI4A 4EGFA 3H3JA 4TWZA 1U11A 1O5OA 4FOPA 1X9GA 1U1CA 1RC0A 1ZCJA 4OLDA 2B8EA 3WRXA 2PX3A 4W5HA 2BMWA 5A91A 4IHKA 2WILA 5GJCA 1F2VA 2D2VA 4NAVA 5FA5A 4UZEA 2JFOA 3VPAA 4C0LA 4S0ZA 2H3HA 4EYQA 4QYSA 4HPJB 3G2JA 4JEUA 4HXGA 3PL1A 3QXXA 3PHHA 4FFMA 2YY7A 2XOXA 5CB4A 3RAPR 1WHSB 3DPUA 3FR7A 5J4VA 3MOIA 3RSLA 4WZ5C 1BE6A 1WA5A 5TQ0B 2L17A 4NYJQ 1KC3A 1QYVA 3KQVA 1Z18A 4I9GA 3H82B 2E2WA 3JALA 3OHMA 3D3NA 3AM3A 3CF4G 2GXQA 4UBNA 3FZGA 5F1GA 3W1EA 4UBIA 5BVGB 2WJ6A 3LD9A 1K0FA 2J0EA 1OBHA 4D60A 1I3MA 2RHBA 2WJZB 2PH1A 1TM1E 4Y0VA 3VX4A 5IDYA 4EY5A 1MKMA 4MKRA 1IXYA 4HDNB 3WHPA 1B6SA 3R76A 4X1LA 1BHQ1 3AESB 1JE0A 2Q41A 3FYZA 4DE3A 2C5SA 3AEQA 4Y2VA 2GCIA 3RT7A 3CYFA 3KOXA 3H17A 3ZTTA 3FBGA 2GAJA 3DZCA 2O48X 1EQAA 1W5SA 1GQYA 1R18A 1E2GA 1QS0A 1RZUA 2V3VA 2P40A 4EW7A 3E23A 2W0MA 3FV7A 5CERA 3RRXA 3GXOA 3WIBA 4E2WA 3BFXA 2AQ8A 2I34A 3QXGA 2A7XA 5EJ4A 4Q48A 4NYIR 3LHDA 2IBTA 4O4JF 3COWA 3I12A 2PKQP 2HYDA 2PWYA 2Y2QA 1VL0A 4O08A 4POOA 5CW1A 2B8NA 1E3WB 1RFGE 3NCKA 1CZOA 1EAMA 1QVVA 3HPQA 2V9AA 1RKVA 4WX2B 5A3QA 3ASYA 1O95A 4PAOA 3I39X 1M3SA 3SZOA 2C9DA 1BA2A 1HOTA 2QTTA 3VNUA 4FDVA 2FWRA 3G8BA 1KWKA 2X8LA 3DMYA 4GDBA 4P34A 4ITUA 3BQNB 3P0HA 1X39A 3PC8A 3BTUA 1ZIOA 5LJIA 4HFNA 5A6SB 3PNPA 2Y2MA 4JFRA 2FZ4A 4HQ0A 4CTKA 3CUWA 1RZ3A 5BSRA 2QBYA 3LXUX 4Z4GA 2BTFP 1QIIA 4MTLA 3KZCA 3JPYA 3G35A 1UQTA 3ENNA 2V55B 4H3HB 4EVIA 3DVSX 3RIMA 3EGDA 4DT1A 3VP1A 3MS7A 1PFQA 4XCVA 4TRJA 3LC7O 2NO6A 3PS9A 3QU9A 2CE7A 1QX3A 3ZE2B 5IAOA 4GKBA 2QE7D 1SOWA 3RABA 3T1OA 4MDHA 4EIWA 4G4SO 3R41A 4EEKA 1JZQA 4J3JA 2G82A 3X1YA 1J0CA 1PSWA 2G5PA 2AYZA 1NBMD 4X85A 4HH3A 4UVIA 5JSZB 4LJSA 2CT8A 5IVHA 3PQ8A 1X1DA 4WJZA 2X6TA 2HIAA 1IIRA 5CB4F 1K8QA 4N9LA 2IJGX 1JH9A 2QX4A 2HM7A 2PV0A 4XJXA 4W99A 1FUEA 4JXVA 2XUGA 3VP3A 5ALHA 2GWRA 4RBNA 4J9VA 3T7AA 5FQQA 4MDEA 1FRZA 4K91A 1Q1GA 2GN2A 3U4MA 4G1FA 5FOWA 3FLMA 4FFOA 3ECCA 4PW0A 3BJEA 4FZJA 3UMJA 5EJ6A 3GUUA 5K5EA 4B3CA 4FSDA 3UFBA 3M49A 5K3CA 3ZLJA 1XDZA 1BXGA 5JVDB 1KH1A 4QARA 1E5QA 3D8TA 4EKNB 4X1KA 3OZBA 4JXSA 2GZ1A 1HKUA 5ALGA 3EE6A 5HQ3B 2DTXA 5BORA 4R51A 4INZA 1L3LA 2RAFA 5B58T 2GBIA 1Z4NA 4WELA 2X5NA 2YQZA 4TWJA 2IYUA 5AXCA 5DLDA 1FP4B 2AFIE 2P9ZA 4O8CA 5FAXA 5I3CA 4KV7A 3FDZA 3PZBA 2DF8A 2HJ9A 2C4NA 2DVMA 3ZFZA 5AW3A 4ZAZA 3P0RA 2OP1A 3EAGA 2IL1A 4R1NA 1H5UA 4P6ZS 3C4JA 4B6JA 2ZVPX 4PYOA 4Q0JA 2PIDA 1TM5E 1Z7GA 3AR3A 5KTYA 4QXAA 4C4OA 2Z2MB 3TPFA 3D1LA 2WM3A 1FQOA 4J9UE 4I50B 4D9JA 4ILEA 1N1EA 3PC4A 3CWFA 3QVWA 4N3NA 1MF7A 2C7GA 2F8SA 4BZQA 4K6FA 3IF6A 3QWBA 4V0ME 2VTVA 4R3WA 3OLOA 2FU5C 3K2BA 3W8NA 1KEKA 2A14A 4BP3A 2O2DA 5J8XA 1CJMA 1DBSA 1RAAA 3LIAA 5LYJA 1PG0A 4OLFA 2QZ6A 2I0FA 3D4NA 1IK4A 2BJVA 4DXDA 4TS3A 3TECE 1Q22A 3ONDA 1N6RA 1OFUX 1P2BA 5K4AA 3BECA 3MRSA 4QVGA 3K3DA 4ND1A 3L0PA 1M2NA 1G20E 2GEKA 1CZHA 2BM8A 2JI7A 4CLCA 3WS1A 2XB4A 2BP7B 1N0HA 4MEZA 4Z49A 1PP4A 4F5ZA 5HCNA 1QIMA 2ZRPA 3BGSA 3HO1A 2IEYA 1DAMA 4PSVA 1CUJA 1YDEA 4WIAA 2SICE 2OUKA 2B5RA 3GHHA 4Q4AB 2FEXA 3NQ41 4P4LA 2KSQA 3F6CA 3V7UA 4I1UA 4HLNA 1N2CE 3OZHA 2LR0A 4Y6QA 4TXLA 1H2HA 4XTRA 1LI9A 4YJ3B 1O6GA 1T8UA 5EJ8A 1QGZA 1DE0A 3E9RA 3LHFA 1ICEA 5EVJA 3JWEA 5AM5A 2RAVA 4R2JA 4G67A 4J4HA 1U7PA 4B7UA 5H4GA 5ER9A 2ZJOA 4CKWA 1Q0QA 3GEDA 4DLSA 4X1MA 1KDVA 3FZCA 1XPBA 4RZXA 2Y55A 2PR2A 4QBFA 2RFLA 5EWLB 2GZHA 4QHYA 2NT3A 4RF2A 1YZFA 1NF9A 4KYVA 2X40A 4TMVA 2UUBB 4ZZ2A 4YMGA 3HDQA 2MSEB 1ECJA 3T4SA 3HLKA 4TWIA 4NICA 5BUZA 3BVPA 4ZOBA 3ETDA 4G3WA 5F33A 3WFZA 2XRFA 2VYND 1J00A 4QQKA 13PKA 4X6LA 2C97A 4L85A 3NIGB 5HXAA 3ESAA 1G5UA 1LSOA 1SCWA 3IT9A 4JP5A 2JAUA 3PQDA 3FCSB 4TRNA 2BR3A 1TVMA 1JDSA 1QC5B 5B4UA 1K63A 2OCGA 4WE3A 4NOJA 1FPQA 2FX5A 4GR5A 2AT1A 1M6VB 3ESRA 3AGPA 4J0EA 3P4YA 3ITDA 1H2AS 4D45A 4AG3A 4JELA 2GN9A 3SNKA 3MQFA 5EVIA 2BELA 1M74A 3GUVA 2ZSUA 4MNTA 1XQWA 5D3OA 1UM9A 5SZHB 4XVUA 3S2SA 2I2WA 3FMPB 3BK2A 1TT7A 4FXOA 2DCMA 2AD5A 3GJZA 4URHA 1U2GC 4MXDA 1GU0A 1ZHFA 3OZAA 3KQKA 1SKQA 2QJOA 4RESA 3N0RA 1GSWA 5AVYA 2GJ4A 1VZ2A 1Z68A 4Q9NA 4L5BA 5EJIA 2VA0A 3CW2A 1PJCA 4H0NA 2QJWA 2D1RA 2I4MA 1HYEA 4UFNA 3PXCX 1WB6A 5CTNA 1T3GA 1D6MA 1LT0A 1U4NA 2XIJA 2E6UX 2PUHA 3ZU3A 3DEFA 3HY3A 1BLSA 1DIHA 3RYCA 4ZJPA 4HZUA 4W82A 1ZYUA 1PO7A 2A67A 1A8IA 1MJGM 2PX0A 2VHCA 3G13A 1HVBA 1XKLA 4N5IX 2ZEJA 1M2VA 2E87A 3UAGA 3IALA 1F0KA 5LYJF 1GZ4A 4RVHA 1Z6XA 5L3SA 3AL0C 3FOEC 4F9EA 4E09A 5E38A 1E94E 4TLEA 1T9AA 4Y5FA 2XMRA 3C3YA 3ILXA 3C1TA 2V7PA 3NHFA 3VKWA 2DX7A 3D8RA 1Z7EA 2A0KA 1JMKC 3EGIA 3OZRA 2J08A 4CL0A 2F67A 2I55A 4C3OB 1U9JA 2QRUA 1BLHA 2X9QA 4BDSA 4BNDA 5IAKA 3LL7A 3GGDA 4TTQA 5FQKA 2PM8A 5IHXA 1XBTA 1F8XA 3S44A 4DR7B 5AVEA 4U02A 3G5TA 3MTQA 1K7EB 4MUKA 3N76A 2M1XA 1K6SA 2V4ZA 2JJ8A 2VZWA 2WWHA 3UE0A 2DMWA 1I3NA 3A3PA 4HNAA 1WSBA 4F12A 4AO7A 3EX7C 1VTKA 3KOYA 2GEBA 4QULA 5JDCA 4JMLA 4CTOA 3RFFA 1ILWA 3EBPA 4KFUA 1XZ8A 1PEDA 1RYNA 3QFSA 3IUSA 2PAVP 3DNPA 4PNPA 1ODFA 2BKEA 5KWVA 4HNRA 2IPNA 5L95A 4RHTA 4BO6A 1AXGA 5TGZA 4DUGA 3DGEC 3GVXA 5HUQA 4Q3DA 4MEAA 3E5RA 2AGVA 2OQVA 1H9CA 1SKOA 3F46A 1DXQA 3O2SB 1GUZA 1GR0A 3L79A 2O0LA 3NECA 4UKDA 3QUCA 3BAFA 2ZJ1A 2W6QA 4IOKA 2EV9A 2DPXA 2FG5A 1M1UA 4Z9XA 3VJLA 3FVQA 2OAP1 2Y1OA 3BDVA 2MR6A 1J07A 2VHVA 1LDNA 3N87A 3L1IA 3KXDA 4K1LA 1G2IA 3RC8A 4CXMA 1BQEA 1IVNA 1UAYA 1R4NB 4D3ZA 3GRPA 1JMVA 1J8MF 3FCEA 5SY9A 5BP7A 2HF6A 2BHTA 2OBLA 3QX7A 2BV3A 4GLLA 3QKTA 2GK7A 4DMKA 5CYOA 1E4EB 1Q2PA 4DTIA 4TUYA 4TXJA 3FAZA 4S1TA 4Z4EA 4RMJA 3KX0X 4MGIR 1L7DA 5HQTA 3L1VA 4F93B 4ASUD 1IQRA 2O1SA 5CNIA 5KX5B 3AOGA 2AG8A 3UGJA 2XKJE 2ZCJA 4LYAA 1KZGB 3NBUA 3OPXA 4QSMA 3NBXX 4RD6A 4EFDA 3RSHA 1KKUA 1C4XA 4BHTA 1KSGA 3LS2A 3OPNA 1W63Q 3KYIB 3UXEA 3W6OA 2NU8B 2X22A 4AZWA 4F85A 4IEDA 1DWPA 2Y1FA 4DG8A 4OJMX 4RTMA 3RIXA 3O9MA 4Q01A 1NQWA 2MSLA 2O8CB 4GC9A 4FQ8A 1Q3HA 1BE8A 1XCJA 3KETA 1QV9A 5IU6A 5AJXA 2WGIA 1JKJB 3C87A 2H85A 4EL5A 1SOUA 1QIFA 1W581 4ZAYA 4F4UA 2JAPA 4M3NA 3FE2A 5DFXA 1TMKA 3W4IA 1P91A 1XWWA 4BB0A 2RGRA 4QKQA 3F7NA 1FS6A 4DMUB 1T2CA 1YAXA 3ZHTA 1KFBB 3V39A 4HG2A 3AHHA 4Z0HO 2CHEA 3LGAA 1E9VA 1C9EA 3JD4A 1KY3A 1JIIA 4EB3A 2XKKA 1GFSA 3FG8A 4ZYWA 5EQTA 1IN1A 3OZSA 2VK3A 3LKVA 3HMQA 2PA3A 4ZO4A 5K0BA 4UM8B 1EUDB 3QFFA 4LE1A 3LY9A 1BLCA 1KE0A 5K4HA 2FZLA 3W78A 1VMEA 1RMTA 1X13A 4QU0A 5ALFA 2V6MA 5CVUA 5LZ8A 3M6UA 4UBMA 4BO8A 4Z8XA 4IFTA 2DETA 3EIEA 1TDLA 4PAQA 1H8ZA 1GUYA 3WYDA 3H2GA 3F5SA 4U8HA 3S5JA 4UD2A 5G0VA 3PTLA 4CQMD 5CG1A 4PYKA 4PX9A 1A9XB 1E2PA 1Z39A 3GQZA 4WK0B 2WAEA 1F6BA 1SDNA 2XQVA 1RKQA 1GCIA 1G8GA 4O2BA 1INLA 2J5QA 3DE5X 3GJ5A 1LBEA 3WMRA 3ZWPA 1DAHA 1HTWA 2EWVA 2A8YA 2XD1A 3IP8A 2Z1NA 2ANCA 4ZO6A 1Z38A 2VPPA 1QBGA 1DQPA 1QOZA 1S1YA 1ZN2A 3E4QA 2X15A 4X5OA 2EP7A 3PI6A 4Y2FA 1IU9A 4M0UA 1UBJS 1EE9A 1PX2A 5BSGA 5CDFE 1BS1A 2GM9A 1GLVA 4XYGA 1ZN8A 2F43A 1W4RA 3E8SA 5KVAA 1NRWA 2N0SA 2JBAA 4BGUA 3SQWA 3T94A 3I6YA 5FAQA 3CZDA 3FC7A 1P7WA 4B83A 4TPKA 2XDYA 2WV9A 4BFUA 1OWLA 1O9GA 3KM0A 3G2MA 1SJ9A 3ULKA 4DA7A 5LD2C 5KQSA 2BFEA 1M2KA 2R86A 1PJLA 2O9BA 2ZDQA 4DV3B 3H0KA 5LMUB 1Q1NA 2O54A 1ZKDA 4BVFA 1FU4A 5F2NA 1CR6A 2ONJA 3Q7VA 3OJFA 4KVAA 1Y81A 1Z12A 1ZLYA 2PUTA 3OMXA 1IXKA 4FCFA 4XD2A 1E0SA 4GT1A 1ZMBA 3O2QB 4OQNA 4JI1B 4OKIA 2ZUUA 4BBTA 1TZ2A 3B9PA 4RFVA 3PF9A 3RF6A 4LK2A 5KNCD 2VAXA 2P30A 2K7ZA 1WXHA 1XA1A 1PWDA 5TGDA 1EVZA 1T2AA 5BSTA 3AJRA 2PSJA 1NOKA 3QPVA 5CYGA 3P0JA 2CXTA 2LCFA 4M36A 2VFAA 1FP6A 1UZLA 2B5VA 2F4NA 1SK8A 4O0LA 4WNIA 1ZAYA 3DBLB 1VKRA 2JGFA 1TXGA 3BW6A 4HKTA 4PLWA 3RE1A 2X9VA 1PS9A 3UNXA 4FNAA 5DE3A 4DC1A 2W6MA 1SVKA 5CU7A 4DDVA 1Y8AA 4FHDA 4KN8A 1TA4A 4A6XA 3AUXA 5ICSA 3QLUA 2QXYA 2FSIA 1C9DB 4G25A 3THSA 5E2BA 4RQ9A 4A8JA 3ADBA 4LBWA 2ZM0A 3L7LA 4M8LA 2I6GA 4RPHA 2R97A 1OFVA 1GKLA 5TQ2A 1R00A 4M54A 1OH7A 2GEVA 4IVKA 2X19A 4RACA 3B9BA 1N7JA 5EEHA 3DAVA 1DO2A 2K2WA 3SIRA 4D1YA 1RIFA 2VN8A 2PLWA 4P4NA 2CVFA 1IBLB 2ARKA 2I1VB 3M6IA 5LMCA 4DBLE 2VOJA 4K81B 4Z6KA 2Q5CA 5H70A 1JEYB 3WZ2A 5JFGA 2YUIA 5EERA 2WVAA 3BCHA 3IQEA 5AOAA 4ZGBA 2BEKA 1PKXA 4FW9A 1U60A 4D0NA 4YGYA 4ZPXA 2BFFB 2F62A 1IRIA 3LA8A 4B48A 2WJJA 4HEHA 2BONA 2PUBA 1LTHR 4YK7A 1L5SA 1NQOA 4PBSA 2W2TA 4N5NA 2GPYA 1I4DD 3E3OA 4NX2A 1T8PA 1WDMA 3EH2A 3EZ2A 4L50A 4CF4A 5BYJA 1BZYA 1Z7YA 1L4UA 4TMXA 1POXA 2IV3A 2OXIA 1HA3A 1NUTA 4FNGA 1USKA 4BX2A 1CIVA 2WRZA 2FV8A 3BLSA 1JWBB 3VR5D 4OPYA 3EIOA 3GLIB 3HEMA 3RFBA 2D0PB 4CL2A 5CECA 4TTIA 2RHDA 1S9HA 1SBHA 3MOGA 2VSFA 3MWJA 3PWZA 1K54C 4L7QA 5K3FB 6GPBA 4B93A 3DUFA 1Q7EA 2D0IA 5FLXA 4EH1A 4GMFA 1JHVA 4IFBA 1X7XB 5DM60 4LY9A 1SBYA 5K0JA 3E2MA 3E6AA 1JJ7A 5JSYA 4BCBA 3BCSA 4HZGA 4RE6A 2BM0A 3PTAA 1ODIA 1PL7A 3I1IA 3COPA 3O1IC 2IKSA 1SVUA 1DWUA 2Y2JA 1C80A 1M34B 4JUAA 3FPJA 1CY1A 2Z6UA 2CKDA 1LFAA 2JBWA 2KDKA 3HV0A 3OC6A 1PGNA 2RKWA 2OHIA 3R23A 2JA2A 4R2MA 5FI0B 5BQOA 3G2IA 2YV5A 2CUNA 3R75A 1CUCA 3Q3EA 4MR7A 2EGGA 1WKCA 4X8MA 2QR3A 1D04A 3DWZA 2JARA 3VKFA 3FDXA 2FMIA 1TFRA 1ES2A 1NMQA 4NPCA 4LC1A 4S0XA 4GR4A 1P2SA 4D81A 2C6WB 1CRZA 3FM9A 2AOWA 2DBYA 3QPBA 4Y1RA 2I4NA 1NU8A 4FFWA 1B0ZA 1I2WA 1Z73A 1RHMA 3V33A 4TMYA 2C29D 1W4CA 1G8HA 3GLFE 3HRKA 2DG2A 1GVHA 3NJ4A 2EG9A 5H1YA 2OESA 1Q7RA 1XZBA 2YOHA 4R3JA 3H5WA 2R6GA 3W8EA 4YECA 2RMKA 3DA8A 2GERA 4C43A 4OAOA 3NT4A 2LW7A 3GO4A 3H9QA 5KS2A 4KXWA 3MRXA 4PLYA 4F60A 4DJDC 3H2IA 4RPCA 4L8VA 5F2EA 5I9TA 4G0PA 2JI6A 4CM9A 3I2YX 2MMGA 2J3WA 1H8MA 2HA4A 1KETA 3BD6A 1IY9A 1K3TA 4DUZB 2OK7A 1O1YA 1PD0A 1P1JA 3ZWBA 4BQMA 1ND6A 4Q5IA 1KDRA 3RTCA 2NOAA 1NXSA 2I7TA 2XF3A 1QZ3A 1YHNA 3A1UA 4HY8A 1U3CA 2ZJFA 3RWOA 5A90A 4UHEA 1UJMA 3OO1A 1II0A 2DP4E 2JFUA 1KK3A 4AYTA 4QB8A 1SGWA 1E62A 3LCRA 4LYDA 3EXEB 3OOWA 4D3YA 4Z5XA 1K7YA 2P3QA 5HZGA 1XKTA 2FGKA 3RRMA 3OQIB 3T5TA 1VFNA 4DCTA 5JYPA 3WGUA 4Q47A 3FROA 1KFEB 3LE8A 5JJLA 3P2JA 4NH4A 4UXJA 5FOXA 3A6ZA 3HNOA 3BJRA 1TUEA 2H5LA 4WF0A 1CE8A 3ZXSA 3BH6A 4O5OA 3OFJA 4BMYA 3Q3CA 4B74A 4AMYA 2NUTA 1KJQA 5KKCA 1GQQA 2OCBA 3JXEA 1OHHD 3A27A 2ZBVA 5DM4A 2CY0A 3OUZA 1QRSA 3EOAI 1GKUB 4J3FA 1N8TA 3ZGZA 4KSBA 5DT9A 4JXGA 4RSHA 1WS6A 4UTVA 4FGLA 3JYHA 4IL5A 5HKKA 2JFWA 2Q6LA 3V67A 1CZRA 2ISSD 5BMVA 2LCQA 2IU4A 3NYQA 1Z0JA 3DJYA 2PRSA 1XEAA 5D8DA 5K0FA 5FRDA 1ULSA 2CDCA 2REOA 1KI9A 3PEYA 3FZNA 3O4VA 3DAPA 9ATCA 2J8YA 5F5NA 5LQDA 4M21A 3S1AB 1ODKA 4RMHA 2AB0A 2YTZA 2YS6A 2H16A 1DDOA 4HOIA 2A24B 4Y2UA 1OTYA 4M7PA 3KP1A 2FWNA 1FFCA 4Y6PA 2I2DA 2Q4RA 3KALA 5GADl 4MEBA 1X77A 3ME5A 3E82A 1UMCB 4XUEA 5KBYA 4L22A 1SH7A 2HNBA 2C7PA 1TADA 4PRYA 3ZJTA 2YN4A 4FU0A 2VSXA 2FFHA 4NP6A 4XYBA 1SXIA 2IUSA 3ET4A 2ZRIA 4WRRA 4DCCA 3FGPA 3DWKA 3OE7A 4BQQA 1YB7A 4JEHA 1Q7GA 2YVLA 5AJUA 1ZJ4A 1O8BA 4J4BA 2IYFA 3JAWA 1VIYA 2QN7A 3CPHA 3EG9A 4GB7A 4YDHB 4Y18A 2X0RA 1SKYB 4PSDA 4TT3D 4PXSA 1TEMA 1TQ6A 3NHRA 1ULTA 3OCVA 621PA 2YVQA 5TSDA 2FSUA 2WZCA 5L40A 1J4AA 1N57A 5I4BA 3GAZA 2EGUA 1QFZA 3OCJA 1LVGA 3IAUA 3P94A 3WLKX 5K6TA 2XKAA 3KYZA 1EVQA 4AJ4A 1LH0A 4ZVKA 1XL0A 2Q6KA 4Y9TA 1U1IA 4XWKA 2OHFA 3E2KA 1KQ3A 4ALKA 4V0KA 3QBEA 4B5LA 3I8XA 5G0UA 3BGIA 3DZKA 2A9PA 5PNTA 2GBGA 1B8PA 5FOVA 4J90A 3OLYA 4UQIM 2FKNA 2OTCA 1FUKA 5DHQA 5KOJA 3SM9A 5EAIA 1ZSYA 4ZCTA 3G8AA 3BE6A 1V5FA 2OQIA 1ZISA 4FCCA 3QFRA 1OU4A 3D3KA 3WIEA 1SELA 3EQ8A 3LWZA 3WS7A 4PIMA 5DYIA 5IVKA 2VHZA 2WF8A 2Q2NA 1KSFX 4C0JA 4C06A 2IZ1A 4R7TA 3IRUA 4IDQA 3ZEIA 1HBJA 5C9ZA 2BFAA 5E2EA 2O8VA 5FWXA 5J4HA 5DJUA 5DGXA 2ZR8A 1LV7A 5JO9A 2PR7A 3BMXA 3QOWA 1QK3A 4IYJA 3ZZ1A 5M5BA 2QW8A 5I4CA 2Y8EA 2JGEA 4BV9A 3ZWDA 1WLYA 1XELA 5AD1A 3GDIA 3E8MA 1VLHA 5CEFA 1DBPA 3PEEA 4AXXA 2HLDA 2F9LA 1UPBA 5DTTA 4QEDA 2I33A 2VDPB 3MXSA 1MH9A 2X7JA 4ID3A 5HF8A 3JQFA 3TTUA 3T4QA 2QIPA 1E1RA 4MWOA 2JGJA 2CXHA 2WTXA 2RHGB 1MENA 3NDGA 4J0IA 4HDMB 3UFXB 1G59A 3AG5A 4UUNA 5CURA 4AUMA 2I91A 4RQTA 5JAUA 1DUSA 1OFUA 2GFHA 3GLGE 2HJHA 3B1ZA 4DV5B 4H31A 3DT8A 2E55A 2PZAA 3ZS8A 3HB4X 1N6NA 3MUNA 3GZ4A 4QJGA 3TG2A 3THYB 1RXEA 1XPRA 1U0EA 1Y42X 5J59A 1ZMTA 4HI4A 1MTZA 3IUPA 1WMAA 1YU9A 4DKJA 4RCYA 1U0BB 1EVIA 4JP3A 4UBOA 4YV2A 4A2CA 4XXRA 3QNWA 1UWLA 2IIQA 4EMTA 4HBGA 2GASA 4U7PB 2IYXA 2IEIA 3RS2A 3OQHA 4OAQA 3KQPA 3WKEA 4GOND 2EJBA 4HEA1 3HXQA 5IJ0A 2I6UA 1WEKA 5AHOA 1J8DA 4BO9A 4Z1OA 3V80A 1GZDA 1TE2A 2P9YA 3QUTA 1LB1B 2H63A 6NULA 2YKHA 4BO7A 4IF6A 4RD0A 5DYGA 5LQCA 1HOXA 3T9FA 3C5WP 2FG7C 4KZ6A 5L51A 2JFFA 2GLUA 1L7MA 4QPJC 4YNBA 2P5SA 2SECE 4KR0A 1MQ8B 3HR7A 2AHOA 4C7VA 1KMNA 2V7WA 3IEPA 3MFDA 3VJKA 1EBUA 2I4LA 2EATA 1WXEA 4Q9KA 3MCAA 1PTKA 2GJAA 3AH8A 3W5IA 1L7AA 1Z7WA 4DCOA 1HO3A 2B0JA 3W2FA 2WOJA 5E9JA 3CVXA 3LRPA 4TRRA 4IWXA 3GNQA 1F6DA 2NAFA 2WZZA 3ZV4A 1OLSB 1XFAA 3U3ZA 1X2EA 1IVSA 5BQ5A 1J06A 1NMXA 4OPQA 4MR8A 1WMFA 2FZCA 1FQGA 1XK6A 4D9NA 4CMKA 1U8AA 3QEBZ 1X14A 2CVPA 3PNYA 1NZFA 1QYRA 2GO1A 4AKHA 4AY4A 2IODA 1NNEA 3WYAA 4G01B 1T4CA 1RC8A 3PNMA 4INAA 5BR1A 1FFEA 3GEHA 2EDAA 4CKEA 1NFFA 3AF3A 2E37A 4DC0A 3RV4A 4ZYXA 4DLRA 1M5TA 4OSPA 5ALTA 4CIBA 1JHPA 2HMUA 1W5TA 5EIWA 3PXEA 4MS4B 4OH7A 2D5IA 2Z2JA 4G56A 2GBFA 3W6NA 1CPYA 4RF3A 5HK8A 3RS5A 3UJ7A 4WCFA 3ZVKA 3NOXA 1T0PA 3M1AA 2REXB 4WLOA 3RJTA 4PYQA 5F7XA 1DX4A 2ZYUX 1NVDA 5EWMB 2QL5A 2VDOB 4FVTA 3WYEA 3GVBA 2YIJA 1YBHA 4WTOA 1KTVA 2EJCA 2R25B 3NGXA 1SZPA 2W3GA 4WACA 1U6IA 4KXYA 3HL9A 3T7SA 5E8JA 1FFBA 3ZPXA 4EUKA 1YRWA 4L72A 1SUWA 1RTTA 4WUJA 4ZI7B 1RADA 3CH7A 3SJZA 1U7TA 4EZBA 5NULA 3ORFA 3LPLA 2CC1A 1CD5A 5AK6A 2J4CA 1GA0A 3W5DA 1JN0A 2IYLD 4IIBA 2XTMA 2PXCA 2A9VA 1XVIA 2OFOA 5I9NA 5EPHA 4TXHA 2J32A 4URWR 2ZTSA 3JSXA 3C6ZA 2H2AA 4GVPA 3C24A 5B2EA 2WF9A 5DSZA 5AQBA 2RGAA 4YP9A 4ZZ0A 3VV2A 3HCEA 4KFRA 4AJKA 1TZKA 3CURA 4H6WA 2WF5A 5JFOA 4XWOA 2VF7A 4R83A 3AL3A 4YRBA 3FNGA 4PX3A 2Y2LA 3X43A 4LMPA 2FEWB 4YPOA 3B12A 3OJXA 4PRZA 1WMBA 5CT9A 3TL2A 5IT4A 4J49A 1YCFA 3M82A 3AFOA 3K6SB 2BZSA 3QKSB 2Y0BA 2WSBA 1H4VB 2NNWB 3RFTA 3FB1A 3HXPA 4A36A 3EIQA 1XZCA 2UXBB 3R0QA 3KT8A 4UXIA 1H0MA 4IH4A 1KRHA 1FLNA 4HRXA 1T3SA 3K5IA 5AM1A 4D2OA 1U0OC 2QLMA 1UC8A 3V5NA 4D9IA 4O1MA 4JGOA 3QUQA 3J80A 4R8LA 2XUZA 2YWJA 4LJ4A 3SIWA 3WO1A 1QH8A 1LBSA 1EAYA 5KO2A 1BWQA 4BKOA 4I4TB 4BVKA 3KHUA 4RV4A 4N40A 4ZTZB 3IHLA 1YQEA 1CS0B 4BAZA 4K08A 1XJQA 5K03A 2IA5A 4PYJA 5EE1A 1JTEA 3T3GA 3UG6A 2YR0A 5ICFA 4E3OA 3CWZA 2XQFA 4TM7A 4V39A 4D8XA 2KLHA 5KSWB 5DTQA 2ODWA 2PTHA 3UMBA 1F0YA 2G5GX 1Z4OA 2CEKA 4DA9A 3HB9A 2YHIB 1HV8A 2HSZA 3NBQA 3A4TA 4JQZA 3HUTA 3HUDA 3B51X 4K3UA 4CIVA 4FINA 4GDNA 4G9EA 5J2UB 3T1YB 2FR8A 4EHHA 1BHO1 3BFPA 5AKHA 3T5CA 2IZZA 8GPBA 2RHHA 3OPYI 4TV9A 4ID4A 3IV7A 3GJ0A 2J3MA 4KMRA 1C3OB 3QW4B 3THRA 4Q19A 1FNMA 3KQNA 4P85A 3M6WA 3SQLA 3IOCA 4R8SA 4PS1A 4OJYA 3MAJA 5CGWA 2D0OB 1VG8A 3H05A 1Q95A 4IOLA 3R40A 3GD7A 1Q83A 4R98A 3O92A 1RKUA 2BMEA 4OQFA 3NM6B 3A0VA 5T5QA 2ZRJA 5I7EA 2OK8A 2O57A 1S0WA 1K55C 4YWZA 4FDLA 4I1RA 2HP9A 3EVAA 3JZDA 4IBOA 4J0GA 1EK0A 4MRSA 1JPJA 1YQSA 1KZ7B 3PC7A 4X8OA 3ESZA 1XN4A 4QXMA 1EFVB 2AIRA 2XYVA 4BLUA 3UUGA 4MK4A 3LGOA 2RAUA 3IQDB 4MLLA 4HP9A 4WW0A 2GCNA 1OGYA 3SVTA 4TKUA 2WAOA 1EFUA 4UTPA 1PAUA 1GVNB 3IB3A 5EUQB 1Y1RA 2EX1A 3EVGA 3GHYA 4OB7A 3MTEA 4FOFA 4I6EA 3DLBA 5E4TA 3NI2A 2ODBA 4MHOA 3Q9LA 1HFJA 1XZHA 2IYEA 1ETHA 3FYTA 2ZWPA 2VUUA 3IXHA 3EXFB 4ZO8A 3HJFA 3NY4A 2A30A 3JQ7A 4B7ZA 5LWQA 1E9BA 2R1TB 3WSWA 4AY5A 6Q21A 3INGA 3HVRA 1V47A 1D2GA 4M0LA 1LA2A 2I9VA 1L5NA 3AR4A 1JS1X 2P4HX 4MH0R 4ZQGA 1LNSA 2VLBA 3IYLW 4G0NA 3U0VA 5LZ2A 4LJ5A 2Y68A 4U7GA 3BIWA 2XX3A 5C8ZA 3AUYA 4M0PA 1ESDA 4L73A 1OJLA 1NQTA 1OIWA 2O1XA 1QAQA 4ENPA 2C31A 1AWIA 3L6BA 4TMKA 3LVBA 4FWIB 1T34A 4GHIA 5CFRA 4A0QA 2XXJA 2E4UA 5TLSA 4HAZA 4V2IA 3L8DA 3F8WA 1RWPA 3PR3A 2CFIA 2Y8HA 4MVWA 2CJXA 4ZVMA 3NS7A 4YHHB 1FX1A 2AF4C 3OTWA 2XFTA 2IYSA 5K6AA 2FUG1 121PA 2GA9A 5DHFA 5CNJA 4KRFA 2MTBA 4MVCA 1NW3A 4LXUA 2CKMA 1VEUB 4ZEXA 4FSFA 5HMLA 1P4RA 3HJIA 3D64A 1CZUA 4BBZA 2PHZA 4LZNA 4A4DA 1RQPA 2C9YA 4KNWA 4ENRA 3PPVA 4YYEA 4D9EA 2B1JA 2G9NA 1RRPA 2AFRA 3U7RA 5E7IA 1XU7A 4JVSB 4WKNA 2VTBB 4GZ5A 1QMEA 2GNAA 2HPBA 3G82C 5CX7A 1RW4A 4Y2XA 4TV9F 2RHWA 3MPUA 4MB0A 1GHMA 5E2HA 2OM2A 5BOSB 1T43A 1JDUA 4WFKA 2XWPA 3K96A 1PFLA 1B93A 5AKKA 5KTRA 3LVQE 4ZYZA 4U7DA 4ZDXA 1E89A 2INGX 1RACA 4M98A 2XCUA 3E27A 3TSGA 4UHCA 5JNSA 1XJWA 2NACA 3EVDA 5BNZA 4F8YA 1T2FA 2X8JB 4BXOB 3N8KA 3UDFA 1P7PA 2R8OA 2NG1A 4OBWA 3SYMA 3UDIA 1Z6ZA 1IB0A 3F5MA 1N2EA 4K9KA 3HYCA 3CVJA 4I6JA 1MTOA 4KXUA 1R8JA 1UDXA 3NXSA 4PMAA 5JLJA 4L5CA 3NFRA 2WUQA 2WSSA 1E5DA 3ZYZA 1XK7A 3DMTC 2H1WA 3CZCA 2VT2A 1V45E 5EIBC 4CDRA 3IBRA 2HADA 1GAWA 4C0WA 1S8AA 3EQ6A 3ENZA 4R2IA 2OLVA 4DIDA 3AKEA 1E9EA 4U2DA 2R4TA 3EC2A 3HA2A 4IGAA 4U2FA 3B53X 5GOTA 2IP4A 4EO7A 3U9TA 2Z2ZA 4GPTA 3UENA 3SMQA 1SQ0A 4OOMA 1MIOA 4EETB 1GT6A 3IBTA 3ZNTA 1PW7A 2QY6A 2JHAA 1GTL1 1ZFNA 2AFHA 3RS4A 1EWYA 2J46A 4Q1AA 2EDCA 2VTKA 3FSGD 2GHQA 3MELA 4OFBA 1IHYA 5LLDA 4BVJA 1DINA 4QEZA 1XVVA 4GFDA 1OVMA 5FSRA 1Z4MA 4OXRA 1VGVA 5LMNB 2AMFA 4HUJA 2NXEA 1IHXA 3LIEA 3HZRA 1S67L 5A9SB 4CM4B 2XKBA 3B6MA 1YKGA 2EWWA 5I7VA 4TYNA 1GAEO 4BY9E 2R1VB 2A5LA 2BFWA 2VEOA 2YY5A 4GL4A 4REQA 5CDUA 4RVNA 1JB9A 1VM6A 3PE6A 1PU2A 1KDWA 3K70C 2Q6IA 1LHYA 2R9XA 3PNVA 2VX8A 4G3KA 4RD2A 2GN4A 5F7ZA 1W4LA 2OZPA 1Y8CA 3PFHA 3W8DA 2ZBPA 4BCCA 1KO5A 1J49A 1BKSB 5E6RB 5A5DA 1XTSA 3D8NA 1WUJS 1V8ZA 2CE2X 4YRQA 3RVLA 4F2PA 2BFCB 1LJLA 3GEPA 3R3UA 3IUMA 2WWVD 1PFKA 3E5HA 3DZJA 4E5NA 1LC0A 4D8WA 4MB2A 3HYRA 2ZIZA 2GEDA 4UCXA 4DMMA 5FUWA 4JI8B 3G1TA 4E2XA 1H3NA 1YOBA 1IBRA 4WUTA 2OGZA 1ONSA 4IXNA 3OZIA 1BS2A 4L5YA 5JAZA 1MHTA 4NXBA 1P72A 1BXZA 4XPZA 3NC8A 4FMBB 2ZLYA 4N6OA 1S89A 2KQUA 1OZHA 4UASA 3IEXA