2GZAA

Crystal structure of the virb11 atpase from the brucella suis type iv secretion system in complex with sulphate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
334
structure length
324
Chain Sequence
ASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIEDVPELFLPDHPNHVHLFYPVTAATLLRSCLRMKPTRILLAELRGGEAYDFINVAASGHGGSITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTKRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type IV secretion system protein VirB11
publication title A Large Domain Swap in the VirB11 ATPase of Brucella suis Leaves the Hexameric Assembly Intact
pubmed doi rcsb
source organism Brucella suis
molecule tags Hydrolase
total genus 90
structure length 324
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2gzaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gzaA02
4DZZA 3RS2A 1F2TB 2BDTA 2F43A 3EXAA 1Z0FA 1N6HA 4JT2A 2J0UA 4QXAA 5GJVC 1II8A 4RKFA 4QM6A 1VCMA 1DAKA 2BEKA 2R9VA 3BE4A 4OI4A 4LC0A 5G40A 3PUVA 2WJJA 4LHZA 2VF8A 5GJWC 2GDJA 4OJQA 4WOPA 4BZXA 3LVQE 5KPJA 4S2EA 4C3ZA 2ZETA 1NVWQ 3BJIC 4QM7A 1VG8A 1DARA 1EXMA 2IEYA 3SQXA 2DFLA 3IKJA 4PO1A 4Q9KA 4ZKEA 3RVBA 4URVR 1E2PA 4M9SA 1AN0A 1II9A 3IILA 4HB0A 5AUOB 1NIPA 3RHFA 4NBSA 5EE1A 1ONBA 2FSGA 3FMFA 4IOKA 2W6JA 3B1WA 1GFIA 3IQWA 2CK3D 2WIAA 3OIUA 2ASEA 1II0A 821PA 3CM0A 1COWD 1KI8A 1Z06A 4M8NE 1T0JB 4P33A 3BB3A 4TQ9A 2O8DA 2IYVA 2GBLA 5JI2E 4U00A 4MYUA 3G82C 3CW2A 3L43A 3MWJA 4JLAA 2REOA 3NEYA 4KJZA 4KFTA 2YOGA 4TMXA 1J2JA 1OF1A 2ONKA 2PCJA 4NYJQ 5KUTA 2XTNA 1NBMA 2FZ4A 2IBMA 5FUYA 3W8NA 4B3CA 2AWNA 4CRWB 3FMIA 1AIPA 1P5ZB 3DOFA 1M7HA 5SZJA 2XNDD 5CLQA 2H1LA 1M8PA 2HXYA 5DI9A 1CJVC 2IUSA 4B3XA 3W9YA 2WWIA 4G5RA 2IS6A 1KI3A 1SVLA 3TUJC 4DCTA 4KITB 1W4RA 3ND8A 3P27A 2P2LA 2V54A 2EFCB 1KJWA 5GADl 1DE0A 4A0FA 2RGXA 1E98A 4B33A 5L3QA 1GITA 4UNQA 3VR4A 1S0UA 2PZFA 4IKEA 2IYWA 5L8VA 4PAMA 3UIEA 1E94E 3KQHA 3MSXA 2YWHA 4B3BA 4OKSA 4C0BA 3PEWA 1R0YA 4JJKA 3K1JA 2VPPA 3QKSB 5AUQA 3LA6A 2ZS8A 2XSZD 1RRPA 5G3YA 1X86B 2IYZA 1W7AA 1Q1ZA 1YJ5A 4AG6A 3RAPR 1TF7A 1SVMA 2VEDA 4JL8A 2Q3HA 2Q0HA 4B43A 5AJYA 3SJZA 3ZYCA 4DB2A 5A4JA 2ZRGA 1JAHA 1IM2A 1Z0AA 1DTSA 4M4SA 4WZBE 2IYLD 2NZ8A 3EASA 2SHKA 1T3SA 3ZGXA 5M04A 2W83A 1WMSA 3AKYA 2RGNC 2ZJYA 3CRRA 3IBGA 3W6PA 1Z8FA 3GLHE 3S1AB 2OBMA 1FL9A 1DPFA 4PC2A 5LDDC 5EZ6B 1W5SA 2PMDA 5FOWA 3QEOA 4I1VA 4N0DA 3TQFA 2PJRA 1ZP6A 2C9OA 2RGDA 3A4MA 1KDPA 5FTJA 3RWMB 2AK3A 3TBKA 2F1IA 1ZNZA 2IYSA 4ITRC 3SJAA 4DLWA 1E1QA 5L3VA 2EFGA 4BUJA 3AB3A 3CX7A 1W1WA 4AYXA 1R10A 3TSWA 1D2NA 4ZCIA 2P67A 3GLHA 4YDSA 3OIVA 4BQSA 1NY6A 2QORA 2VF7A 4LZZA 2O0HA 4Q48A 3LFUA 3MJRA 4TLEA 3KJHA 3LXRA 2ZSFA 4BFZA 4W5JA 5D3MA 2RGAA 2ZRHA 3EC2A 3MAAC 1SXJC 1XMVA 2BWJA 3Q8XB 4FMBB 3AVVA 4MGZR 4WXRA 2ZJZA 3B1XA 4JT4A 4CGZA 3KX2A 4DLSA 1KI7A 3I5XA 1YZGA 2QRNA 1JPNA 4RCYA 4ZCLA 4LUCA 4UNSA 5TDHA 2PT5A 1IN5A 2VBCA 1OJLA 2P5SA 2B8WA 2ZRLA 1SXJB 3QENA 4V0ME 5E7MA 4TYYA 4EPVA 1Y3AA 2ZS9A 4JKIA 2B92A 4OHZA 2P6RA 3MD0A 3N2IA 2OXCA 3BH7A 3KKPA 5DHAA 5FOSA 2WICA 5FUVA 1I2DA 3A4LA 3AVPA 1JJ7A 3ZS9A 1G7CA 3TE6A 1IQPA 3F3YA 4C2UA 3BK7A 4BFSA 4D0GA 1E2FA 4HATA 3HPQA 2WM9B 3K0FB 2P6NA 4MGKR 3ZJYA 4PC3A 1Z22A 5BYKA 4O0MA 3CRW1 5KDLA 4P0TA 3FWYA 4LBWA 4HAZA 2BJWA 3C14C 1NLZA 5FOXA 4HAYA 1UBCA 3PXGA 5FI0B 4EKDA 2ZRFA 3E1SA 5FR2A 1XEWY 2WSSA 2QSYA 5DN6A 2F6RA 1R5NA 2WIBA 3LQQA 2C96A 2VSFA 1ZC3A 3GCGA 4KSBA 4RKEA 5IHPA 4X8HA 5KPDA 3LW8A 1CULC 1YR6A 5J4YA 1C9KA 2OZEA 2D06A 4YDHB 1TU3A 3B60A 4AG5A 3CNOA 3WBJA 3SJCA 4NDZA 3U4QA 2NO9A 3Q7PA 2KBEA 4NCHA 1AQYA 1Z2AA 3K0AA 4U5XA 2PZEA 4IOMA 2CL7X 4Q9LA 5LBIA 2FEOA 3BB4A 4GP7A 1GDDA 4P32A 4TTRA 1Z0DA 3B85A 4M9QA 3LD9A 3T5GA 3GFPA 2R62A 3BOSA 5FFMA 3VR1A 3QKTA 5DH9A 2A2ZA 4DLRA 5GVSA 2CEAA 2L0XA 2O8BB 3GLFB 4Q1AA 2ZE8A 4EQ6A 1UKYA 1YE8A 2HDNB 1S3GA 3E5HA 3EIHA 3KUDA 1G7SA 2WPDD 4HSEA 4I1SA 4QRHA 4Z8YA 4ABYA 4D4MA 4CIDA 2KJQA 1QHSA 2QROA 1FMJA 4D25A 3PV0A 3X1XA 2VSXA 2V1XA 1R6BX 1ZIOA 2PEZA 3THOA 3TNFA 1MV5A 2A5DA 1F3OA 3PJRA 4BLQA 4LHYA 2OV2A 3AKDA 4OHVA 1R7RA 3GJ8A 1ZUNB 4BEJA 4X8OA 5KDDA 2G88A 5BWMA 1G4AE 2HYDA 3SDZA 2OM2A 3LAWA 2R2AA 1XJCA 3CO5A 4EPWA 4OJKA 4N3NA 3R8FA 4WW0A 2QEQA 2PZGA 1E2JA 2NG1A 4LBZA 1W0JA 3SOPA 4HLQB 4CEIA 1P4SA 3ZD7A 4PSVA 3U3RA 5CK5A 2PMKA 3SNHA 1QHHB 4AYWA 3VFDA 4Z1MD 1G6OA 3BERA 4NYMR 4MH0R 1Q3HA 3X1ZA 2A9KA 4Q4AB 1YZLA 3GP8A 1PV4A 2AR7A 3X1YA 1G3QA 3U44A 3BRWD 4Z54A 5HPYB 1E0SA 1N5IA 4PFSA 3ZVLA 2Q9AA 1OFHA 5G41A 4R9UC 5DSZA 5DI3B 1F2TA 3VKHA 2RGGA 2G1KA 1QZXA 5EP3A 1TMKA 3D7MA 4N1AA 1VKJA 2OO7A 3P26A 4ZDIA 2QTHA 1P75A 2ZI9A 1TQ2A 1VCIA 2JAQA 4U7DA 3AVQA 3K9LA 1CIPA 2J0UB 1MR3F 1II8B 3B1VA 4HLUA 5TVKA 1M7BA 2NZJA 2JIZA 5FOTA 1E0JA 3J81k 3I61A 1GVNB 2XB2A 4KVAA 5K8UA 3NTUA 5J40A 1TL7C 2WSSD 1A7JA 1N0UA 4LOAA 3ZIAA 4MRSA 5J4KA 3T12A 1KNXA 1RRFA 1PJRA 4HZUB 5FBWB 2V7QA 3K0EA 1W36C 2P5TB 3VMFA 1G18A 1GL6A 3G0HA 2GZDA 2R44A 2YVUA 3QBTA 2IWRA 4HAWA 4B44A 1OW3B 5H70A 4KVGA 4QBGB 1NKSA 1P6XA 5BQ5A 2FDCA 4OQLA 2P65A 5IK2D 3M4YA 1I4LD 1W36B 4C7OB 3LBHA 5LB4A 3UG6A 1AZTA 4FWTA 2O8DB 1IN7A 2ZI7A 4ZDWA 1E9EA 2Z4RA 3NC1C 4QGAA 4BRUA 1LNZA 1ZJ6A 2ZR9A 1I4DD 1KO5A 2VP5A 1ZRHA 1GKIA 3IQXA 3W3ZB 1E9AA 3L82B 2IXFA 4FCVA 4Q02A 4ASUD 3RS5A 2QPOA 3I32A 4TTQA 4XD7A 5LB2A 2PBRA 1IXZA 3AUXA 1E9RA 5CITA 3AV0B 1ZM7A 1G5RA 4E22A 1RE0A 4G3XA 4YC7A 2GZAA 2H7VA 4Q18A 2JLXA 4ZI3A 1X8JA 4MGYR 1OHHA 1UJ2A 1ZCBA 5CM9C 1TTTA 2HF8A 1AK2A 2WKPA 3EWAA 4Q9JA 3BORA 3CNLA 3TQCA 3UK6A 1NSFA 2B6HA 2CHVA 2IX3A 2J9RA 1FPMA 1NN5A 1OV4A 4HDQB 1M74A 4WZ6A 2FV8A 4JIMA 1U90A 2XB4A 4QFMA 4Q4HB 2ZSEA 1XPUA 1W0JD 5L3QB 4PC6A 1X6VA 3QKSA 2PX3A 2OG2A 3LY5A 1G8GA 1S3SA 2DR3A 4WIAA 2GAAA 4KO8A 4EDHA 4MDFA 2AX4A 1P61B 2JJ2D 5FTMA 3REFA 1XB2A 1GRNA 1TF5A 5HZHA 2HXSA 2A78A 1KK3A 4BLPA 1HE1C 3OE7D 4HAUA 1FP6A 4DLXA 5FUXA 4US0R 4BPBA 3EZ6A 3LV8A 4NMMA 4Q21A 4QOSA 3CIOA 3B8HA 3CPHA 3SFZA 3QUSA 4MUBA 1LY1A 1K5DA 3EIQA 4J0QA 2HUPA 1Z3IX 3MLEA 1JPJA 1HV8A 1SVOA 1OH6A 1GTVA 2ZAMA 1RW4A 3NH9A 1VYTA 4MUAA 1DVRA 3T1OA 4PANA 3U7HB 1ZU4A 4C0KA 4HYYA 3IO5A 3C7KA 2NO7A 2J0VA 4CZ2A 2XJ9A 3Q85A 1G16A 4LJ8A 2GJKA 4LBYA 3CWZA 3H1TA 3W8RA 2XITA 4DC9A 1L4YA 1GG2A 2GXQA 3GLIA 2YWGA 1G3RA 2IYRA 4L16A 1DAEA 2ZJ8A 4LV5B 4YMTA 1SXJE 1VYVA 1N5LA 3KB1A 3AP1A 1KYIA 2WWYA 4LJYA 5FI1B 5HKKA 4CEHA 3DKPA 3ZIAD 2EFDB 1P73A 2FSIA 4DSOA 1XXHE 1Z0KA 1FQKA 1XP8A 1FUKA 1XU4A 1JJVA 1OH5A 5C2JB 3PIRA 1XD9A 3TUZC 3B13B 3QJYA 4GP6A 1NY5A 4V0LA 5D3QA 3TKLA 3FE2A 3WYFA 2QGZA 4I81A 1OB2A 2J46A 3HWSA 1SXJA 2R65A 5HR5A 2Q6TA 2VO1A 4Y0VA 2ZI3A 1U0LA 2D2EA 1VG1A 2WHXA 2PX0A 3W34A 2Y8EA 1KO7A 1BMFA 2J45A 1KDOA 4EJSC 3QSYA 1LS1A 2IYQA 3SR0A 3PUXA 1XXHA 1AKYA 3TVTA 3NKVA 2QPTA 2VIIA 3P4YA 1E79D 3A1SA 3K0FA 1FMLA 5E7JA 3D6TB 4ON9A 1D9XA 4XD7D 4BECA 4E07A 2FSFA 4EJSB 2CXXA 2ANCA 3MWYW 1VIAA 2IHBA 3A1UA 3CKLA 2ZJ5A 4DHEA 5J4HA 5EP1A 2CNWD 2FJUA 3AH8A 5TARA 2YYZA 3EARA 5B57C 4MDEA 1OHHD 2WOJA 1F60A 1HQCA 3H86A 2JDIA 1L2TA 1S9DA 1T9HA 1WXQA 3C4JA 4UNNA 5FBVB 3GLFE 5JJIA 4F91B 3TAUA 5C1BA 1U0JA 2EFHB 3DEFA 1XPOA 1FX0B 2QGNA 3JVVA 3B7GA 3L8YA 1T8UA 1KOFA 1SHZA 1WBBA 4G0NA 2WTUA 2OFXA 3QPUA 3BWDD 1KDRA 4TYPA 1D2MA 2AHOA 2AWOA 2NOAA 1NNEA 2F1RA 3KTAB 4JYCA 1JR3E 4DCUA 3RSLA 3CB4A 3ZDQA 3P4XA 3KKNA 4WA7A 3SYLA 4C0SA 1NSTA 5JCZA 3K0AB 1K6MA 1CJKC 3B9PA 1YHNA 3EIEA 2DHRA 3EW9A 2ORIA 1E9SA 3OHMA 5BW8A 3QXCA 3P32A 5BN3A 4MGIR 1OYWA 1P9WA 1XEXB 4WAUA 2J7PA 4G5GA 4Z51A 2GCNA 1AM4D 3IIKA 1KK2A 2Z83A 3FFBA 2IEZA 3WNDA 4EQ6B 3EPLA 3ZVNA 5JLJA 1VG0B 4QHSA 3UG7A 4GOJA 2F7SA 4WXPA 1Z6YA 1JR3A 1WB9A 3QF7A 2RGEA 5J5CA 3TH5A 3U7FB 4UNRA 3FTQA 1LS6A 2GJAA 4QGFA 5JJLA 1AGPA 2ZSBA 4ESHA 3LX8A 5K8TA 1VECA 2C5LA 2H18A 2EYQA 3K70C 3N70A 4ERNA 2WJHA 2ZREA 1V5WA 1BYIA 2C03A 2Q21A 5EXPA 3QXSA 4JKYA 3U60B 1XD2B 4ZCMA 2HYIC 3RS4A 4DUGA 1QG4A 3UMFA 3X2SA 4LHVA 1VHTA 2NMVA 3K70B 1J7KA 1KO8A 3A37A 2W6ID 1RJ9B 3V00A 4CEIB 1KK1A 2R6DA 3GEHA 2C78A 2QQEA 4W9MC 3EZ2A 2ZRKA 2EWWA 2QT1A 3BC1A 1JR6A 3VX3A 3HU2A 3OEEA 4IFBA 2YZ2A 1RYHA 4QNMA 4II7A 2DWPA 5DI3A 1T3LA 4N0EA 4X8LA 2P0EA 2VSOA 2J0QA 4JZKA 2C04A 4TL6A 1SXJD 1SVIA 3SS8A 1P62B 2MSCB 3SZRA 1AS2A 4HDCA 3D31A 5KNBA 1RPZA 1BMFD 1MT0A 1DELA 2J7KA 5EJEA 3HR7A 3CZQA 2F55A 1PUIA 1UEIA 4HLUC 4MKFA 5KSYA 2QP3A 3W6NA 2WWHA 2MMCA 4BGDA 5LD2C 4TYQA 3CPEA 2I1QA 1KNQA 3Q9LA 4L5BA 1E2QA 1QHNA 2ZRAA 1KIMA 1Q3TA 1W2GA 4LWZA 1LV7A 1NLFA 2YWFA 2FU5C 3IDQA 3QXHA 1FNNA 3KXIA 2AD1A 2FGKA 4ARZA 4XVUA 1ZIPA 1H8HA 3SBDA 1G8HA 2R6CA 4HZUA 2JDID 3FFAA 1YQTA 3FKQA 4US1R 3WMGA 1G8FA 2FF7A 1P9RA 3W3AA 4AD8A 2ZXUA 1ESMA 4GI7A 2IYYA 1P9NA 3OZXA 3T61A 2KSQA 1NBME 1M34E 4TL8A 3R7WA 3I8SA 3TVDA 3R20A 1CKEA 3O8DA 2XZPA 4OK6A 5AUPB 4C7OA 4LRWA 4BASA 8OHMA 3HP1A 1GZSA 1SVWA 3C41J 4FI3C 1GNRA 4E09A 1GSIA 1N6KA 1OXUA 5FOUA 4JVLA 3B82A 3QVUA 5JSZB 1FTNA 4V0KA 3F8TA 4AK9A 1KSHA 3CH5A 5CB8A 1DEKA 4JS0A 1U8YA 4NHOA 5EP2A 1G3IA 3Q3JB 3LLUA 5EUMA 2C2HA 3EG5A 3LXXA 4IEEA 4BFWA 4AKHA 5E7IA 4KBFA 1E9FA 5JWRA 5FUWA 4LJ7A 3GPLA 2IHYA 3KZ1E 2GK7A 3HR8A 2JJ8A 1G5PA 1W47A 4YXWD 3MWLA 1OXSC 3EZ7A 1GL9B 2ZU0C 1EFUA 1W46A 2A5YB 4UKDA 4KHZA 5LPNA 1J90A 4PO8A 5DNYB 2BBWA 1JR3D 2ZE6A 4Q7JB 3VU9A 1P2UA 4EPXA 1NKTA 4V0NA 1YZQA 4Q4HA 2FN4A 1E2NA 1W49A 3E2IA 4M9ZA 5KSPA 4AYTA 1OH8A 4JLJA 3OAAA 2QMUA 2QG6A 4TSFA 4DUGD 1QRAA 1MRSA 4QHYA 3FKSA 3T06B 2AK2A 1G41A 2WAYA 4W7SA 4DIDA 2JLUA 2HCBA 4RD4A 3EPKA 1KI4A 3LVRE 1KY2A 1FOEB 3SC3A 2LCFA 4M0LA 1NVVR 3VKWA 4A4DA 1Z29A 3AVYA 3QOFA 2IS4A 4PHTA 3OEED 1DAGA 2FG5A 1Q22A 2OCYC 2P3SA 2VHTA 3UPUA 2VLIA 4GT1A 1BOFA 4URWR 3TUIC 1C4OA 4LHWA 3QG5A 1ZUIA 3RDPA 1BS1A 4JLNA 1XMJA 2PLFA 3KB2A 2AL7A 4F4CA 1CR4A 2WJYA 3A58B 4TT3A 1G6HA 4PQRA 2ZJAA 4JBYA 3EX7C 5DYGA 5G53C 4QGHA 3M1IA 5SZHB 4DLTA 1IY2A 1ZM3A 2ANBA 4V03A 4YONB 1N6PA 3SJBA 4XSHA 5JRZA 4C9BA 2O8EA 4BFYA 1UF9A 4B35A 1U0HC 1UKZA 2C8VA 3A1TA 3ZS8A 5EXSA 1XPRA 4Q9IA 5FPYA 4DEXA 3L8ZA 1F2UA 1OE0A 2ZI4A 2HT6A 1JEDA 4M1MA 4C4PA 4F93B 3OEHA 3NHAA 3GLIB 4A8JC 3U3JA 3K9HA 2YJTD 4MA4A 4OK3A 3ZH9B 3NC0C 1CU1A 1HY3A 1OXVA 2IXGA 1L7VC 2OHFA 2ZE7A 1R5OA 2VHJA 3U6KA 2C98A 2ZUBA 1DS6A 1Q1BA 4IFEA 4U02A 3T34A 2KWIA 1FP7A 4CEHB 1XJ0A 2MSEB 4OQXA 4B74A 4A8JB 2JLZA 2W6JD 2CMKA 3O8BA 1TUEA 3QE0A 3IHLA 3BAFA 4FINA 3KL4A 1G5TA 1W36D 5AJWA 2YWEA 3BD9A 2J1LA 1S1CA 2ZR7A 1T0HB 1AA9A 4CVNA 4QNRA 1IXRC 3CR8A 4D80A 1YR8A 2AFHE 5JRJA 4YMWA 4NH0A 1WA5A 3C8UA 2QY9A 2FMXA 3TRFA 4CT4B 4NP6A 3TSOA 2B7CA 1Z6XA 4EJSA 5CB6A 2X2FA 1NBMD 1W4CA 5TY0A 1XXHB 2GA8A 3V4RA 4RFSA 4TYNA 4E03A 2JJ1A 4W5HA 1EGAA 1R8QA 4MRVA 4JSYA 1NJGA 2XTMA 1OFTA 1VDZA 4LPSA 4Q5IA 4TMZA 3TMKA 1XFAA 4EFMA 3KQKA 2YV5A 4B32A 1KSJA 1W0KA 3TAHA 1LFDB 3NVAA 2G83A 1FX0A 3GJ7A 1N2CE 4Q01A 1TUIA 3ZZ0A 1RC8A 3ZZUA 221PA 1MOZA 3AF1A 3EA0A 1I4TD 2NO0A 2WJIA 3RRYA 4IHQA 1CS4C 3DPUA 3OAAD 3RS7A 1DAMA 4TSFD 1G8YA 3CLVA 2ORVA 3KTAA 3AM1A 4IOLA 2OEPA 3GMTA 2OILA 3DMNA 4A6XA 4BEBA 3RC8A 2CDNA 5A0FA 3RNLA 3QQ5A 5BXQC 1SZPA 3ADDA 2EFEB 4DRZA 1XBTA 4NYMQ 5KU1A 1W4BA 5FL3A 3DZ8A 3EAQA 4FCTA 4C30A 1TNDA 3A36A 5KNDA 4ZI2A 1NG9A 1HH4A 5GJBA 1XEXA 4OHWA 4HB4A 1QVAA 3WBKA 1ZC4A 2YC4C 1YZUA 3MRSA 2FNAA 1OKKA 3B6EA 1XDBA 1H65A 1U98A 4JLKA 4KV9A 2OESA 2QAJA 5CYPA 3CX8A 1W44A 5F3WB 4O25A 3WYAA 2Z5FA 1XJQA 4A82A 2CCJA 3AKCA 4XH9B 2FFBA 3NEJA 3CNNA 2XTZA 5B64A 3AUYA 1OXXK 5J4LA 3BH0A 3QF4B 1Q20A 2ODWA 3U7EB 1GIAA 4QL3A 3C16C 4Z8XA 3I8XA 1XD2A 3CF2A 2ZRCA 1BKDR 3NBXX 3RSOA 3UKDA 4EAQA 3PEYA 1ZBDA 3Q72A 2IWHA 1FW6A 2BVNA 1E1QD 1EFTA 1M2OB 1YZNA 1XTIA 3BFVA 4RZXA 4A2QA 4LYAA 1O87A 4KAXA 4PQFA 4URUR 1RJ9A 3L0PA 2GILA 1RIFA 2BHRA 1HA3A 1AQUA 1M1YE 5FR1A 4TZ0A 3EPHA 1XTJA 4RZ2A 2CLSA 4Q1BA 1F48A 4TMWA 1OFUX 1HTWA 3WRYC 3CR7A 3NWJA 1EFCA 2PJZA 2V6IA 2OFOA 1T5IA 5FPKA 2CE7A 2UKDA 1RRCA 2ZRBA 4BFXA 3CRMA 3UANA 1E2GA 1NMXA 2MMGA 3VQTA 1GKUB 3DO6A 2YINC 4NYIR 3TGPA 3KQUA 2K5UA 4DEYA 1IAQA 2ZE5A 2BEJA 4GMDA 5B2ZA 1A82A 1S1MA 4A92A 4L4UA 1NP6A 4ILEA 4PR0A 4O2LA 2CLCX 2RHMA 2QP9X 3H2YA 1RFLA 1G1MA 5AJXA 5HE8A 3Q5DA 1WCV1 2LKDA 1DG1G 4MKGA 2B21A 3JZAA 2IT1A 2JJ1D 4OI0A 1GNPA 2DY1A 1CEEA 2NPIA 3U3MA 2KBFA 2VL7A 2QRZA 1KTVA 3VX4A 1OB5A 1UADA 3NHBA 3HYRA 3L0IB 3EC1A 3HDTA 2OLKA 4M1YA 1W0KD 5DN6D 3UWOA 1UBEA 1NJFA 4LHXA 3LX5A 2DYKA 3GJ0A 5CIQA 4ARZB 1YRBA 2GHIA 2C77A 5EE9A 2NPFA 1OYYA 2QL6A 2XGJA 2WOOA 2FPMA 2FWRA 2GZHA 4HEJA 1XNJA 1ZD8A 1GOTA 1E3MA 3R7WB 1IN4A 5JSZA 1R5BA 2ODNA 4I4LA 5FBRB 4ZIRA 3T15A 1SKYB 4DDVA 2J0SA 1XF9A 4PPFA 2V3CC 4I1UA 4R71A 4WZAE 2OAQ1 5L3SA 1V43A 1UFQA 4B71A 2OT3B 4M1TA 5DE3A 4BZPA 1N0VC 4RD0A 4CDGA 4L15A 1OKKD 4A2WA 1T6NA 2GJSA 3L0OA 3DHWC 4O3MA 1XTQA 2O0JA 1WE2A 4HAXA 1KK0A 4LYFA 3B1YA 2WKRA 2GEDA 2ZQ5A 5EE3A 3U7GA 3EA5A 2DWQA 4H1VA 5F98A 3CZPA 3FB4A 2JLVA 4AI6A 2V6JA 5CYOA 3SYKA 2X19A 2GVZC 5DIFA 2ZVPX 4IDNA 1WQ1R 4IXNA 1XCGB 3VU9B 1N25A 1S2MA 4RCZA 1P2SA 4NE2A 2AKYA 2BIFA 1XWIA 2OCAA 3MCAA 2VHUA 2QMOA 5CJPA 1R4AA 2FFQA 5HTKA 3K70D 2VRWA 1SKQA 4UXIA 2QNRA 2XJ4A 3IEVA 4FCWA 2IYUA 4DLVA 4GRAA 5HZKA 2DFKB 1TU4A 4LC1A 1IONA 4UJ5A 2BCGY 4RD3A 3TK1A 3THYB 1E0AA 3F5FA 4OI1A 3ICEA 1NIJA 1VYUA 2WMNB 1X8LA 3OFNA 1LB1B 1N6LA 1W2HA 1A4RA 4LDJA 3AGPA 3WNBA 4B48A 3VNUA 1JALA 3M6AA 4BWYA 4DDWA 4NU0A 4TQAA 1W4AA 3GLIE 3SQWA 1P72A 3KUCA 3IIMA 3VNVA 1U94A 1KZGB 1Q1QA 1NRJB 2HLDA 2XXAA 3V9PA 3RWOA 1VG9B 5B58C 4LV6A 5KO2A 3WMFA 4ZKDA 1NVUQ 3OIWA 5KOYA 5A5GA 3QG1A 2QQ0A 3W5IA 2ZROA 4HZIA 121PA 3GJXC 3PITA 4YLGA 3B1ZA 2JLSA 1FTSA 4IOJA 4A9AA 1IN8A 2D3WA 1KDTA 3PFIA 1GILA 3CRQA 4HUQA 2ZRNA 3RRNA 1Z63A 4ACAA 3T35A 4A0GA 2O8FA 1MH1A 2JIZD 4G1UC 2O8EB 1EFRA 4OQNA 4H9GA 4LGMA 2QZ4A 1F2UB 4GZMA 1G7TA 2QAGC 4A8JA 3C15C 3H0KA 4MKHA 4DCSA 2ERYA 4EPTA 1E2EA 2WMOB 1DOAA 4R7ZA 5AJZA 3QKRA 4C0QC 2EWVA 4TMVA 1LW7A 2V7QD 1JECA 2ODEA 3HU1A 1HEIA 1KO4A 3DL0A 3IGFA 3NBYC 2ATVA 1M7GA 2J41A 2QAGB 1N3BA 1U8ZA 3FMOB 2F3RA 4PQYA 3ADKA 3VHLB 4DBLC 2E87A 2BBSA 5KYKA 3I92A 3RRMA 2XOKA 2RAPA 3SHFA 4CYMA 4KYIB 1CF4A 4OBEA 1HYQA 1XMSA 3VR2A 1DG3A 2ZAOA 1ZCAA 4FXPA 1EX6A 5JWOA 4MRPA 2BKUA 2BMEA 2O0KA 1OPXA 4D0NA 5JS8A 2JA1A 3NBFA 2VP0A 4KBGA 4AY2A 1AGRA 2ZTSA 4QJ5A 3TIFA 4BRWA 2H8KA 1SHKA 2FEMA 1PLKA 1N6NA 2WJGA 3CF6R 2IYXA 4QHTA 4XVRA 3GEIA 1IOZA 2D7CA 3BGWA 4LK2A 4Q4JB 4BFVA 4G5OA 3O8RA 2GK6A 5EZ5A 3A4NA 4RFSB 2OCPA 4KU4A 3N2EA 3PUZA 4M1KA 3GQBA 2YC2C 1U9IA 1NVXQ 1AS3A 2P6UA 4LJ6A 4ESVA 3THXB 3RANA 4DCVA 4EIWA 2CCKA 2JGNA 4Q1EA 1DO2A 1KI6B 2V4ZA 4QC2A 3I72A 1XTKA 4WVFA 3U61B 3ASYA 4BE7B 4Q47A 4R2HA 1HT2E 4H1UA 4TZ6A 2VP4A 3T1QA 4OI2A 2IS1A 521PA 1GWNA 2ZSAA 3F0TA 3RS3A 1U99A 2KB0A 2QU8A 3RLFA 3OESA 2WSMA 4GFDA 4M1OA 4XJXA 1Z5ZA 3EZFA 1D5CA 2V8OA 2FPKA 4IJMA 5B30A 2R8RA 2G0TA 3RC3A 3DOEA 4URXR 4D26A 2EQBA 2JASA 1FUUA 1G17A 4ZO4A 3FHCB 2GCPA 2YHSA 1KSGA 2I4IA 4DIEA 2CK3A 4C0LA 3E70C 5UKDA 2V1UA 4TL9A 4F7WA 3ADBA 3ICQB 1COWA 3UMRA 2MSDB 1D9ZA 1VIYA 1CJMA 4Q1FA 4B75A 5CDFE 5F9FA 2GF9A 1GRRA 3K09C 3QF4A 3C5HA 2FX3A 3B9QA 1XCMA 2ZIAA 2BMJA 3U3OA 1TQDA 3ONWA 4F38A 1HQYE 1ZNWA 2EVWX 2H57A 2GNOA 3N5CA 1M6NA 3T1TA 3AP3A 5C46F 2F9MA 1IY1A 4TN1A 1VCOA 4NCJA 2OSBA 3GLGB 1G21E 2CHQA 3I62A 3GEEA 1LF5A 1N5KA 3AVWA 5FPTA 5SZKB 1KI2A 1KJZA 4BLRA 1XTSA 1JNYA 3R9XA 1X8KA 3B5JA 3T1VA 1CLUA 2G77B 1RVDA 4LBVA 2PT7A 1UPTA 4OK5A 1ZM4A 2FFHA 3MWKA 4WBSA 1NL3A 4D4JA 1MO4A 2ECKA 5CDFA 5HKKD 2A5GA 4TMKA 3DZDA 1S96A 2IC5A 3CH4B 4E5UA 2PH1A 1US8B 4DLYA 2X8AA 5EP4A 2CE2X 1W5TA 1UDXA 1AJEA 3UXMA 4A0HA 2X2EA 2W2TA 4OL0A 1Q21A 5HCIA 3QVVA 4Q7MB 2ZRMA 1XEFA 1G4UR 2XOKD 721PA 2UVQA 1PLJA 2CJWA 5IDVA 4BFUA 5HE9A 5L3RA 2XSZA 4OYHA 4P4TA 2A30A 1J99A 1N6OA 1TADA 2PL3A 1GAJA 3KJEA 4C0JA 5KDOA 4UNPA 4Q9HA 3CONA 2GEVA 1MO5A 4Q4LA 1H8EA 3U2QA 3DDCA 5AK0A 3HYTA 1Q57A 1SKYE 1TEXA 1XZPA 4M53A 4B47A 2JLRA 1Q1EA 1UEJA 2VQSA 3A1WA 3CRVA 2PEYA 4I1OA 1Q12A 1G3UA 4R2IA 1CR2A 1FQJA 2CVFA 2J87A 3GJ3A 4IRUB 5FBLB 3EWSA 3TSZA 4EPRA 5LD2B 2R6AA 2CLDX 2G6BA 3BFKA 4DB4A 4PSKA 4IDPA 2YOHA 3GJ6A 3VHXA 3WP1B 1L8QA 5H68A 2Z6VA 1R0XA 4NCNA 2ZRDA 4GDFA 4B2LA 4URZR 4JL6A 2BC9A 3THWA 4BFTA 4AKIA 3PENA 1Z47A 2Q3MA 4M2LA 3KFVA 5ANRB 3KKOA 5AUNB 1ZAKA 4M9XA 4AC9A 3PEVA 4D4KA 4F92B 4OHYA 2A3RA 2B8TA 2GCOB 4M21A 1IY0A 1R2QA 2ERXA 4POAA 5G3ZA 2D7DA 2BCJQ 1MKYA 1VTKA 5DGXA 1HURA 4PPQA 1TQ6A 2DFNA 2IW3A 4KCGA 5CLLA 5CJ2A 1RYFA 2OAP1 4ZIRB 4DDTA 1L4UA 2AXPA 2FH5B 4Q7LA 1E1RA 3A8TA 1AZSC 3TW8B 1E2MA 1NVVQ 4M1WA 2RMKA 5GVRA 4DJTA 1QVRA 3WNCA 2VHQA 3NH6A 4MKIA 5L3SB 1OXTA 4PO9A 4KLNA 3KXKA 2XNSA 3T5DA 2J7PD 4PAOA 2ZS7A 4MITA 1E96A 1SVSA 2GTPA 2FPLA 2JATA 2GKSA 4JJZA 4K8OA 4LYJA 2NIPA 1F6BA 2V55B 3AP2A 4HI0E 5CIWA 3ZVMA 1EWRA 3TJZA 2JLYA 1YU9A 1XZQA 4BLSA 2DBYA 4LJ4A 3PVSA 2D4HA 2DFTA 1XRJA 2QE7A 3KQNA 3EPJA 1TPZA 2VP6A 2ZI6A 1ZINA 4Q1CA 4F4IA 2W0SA 2Z4SA 3K0CC 2AD5A 3RS0A 3PCRB 3PUYA 2QMEA 4URYR 1GRQA 1N0WA 4GZLA 3X1DA 3IIJA 3L0SA 3AF0A 1P2TA 1QF9A 3WP0A 2IK8A 5KNCA 5AR1A 5E95A 4A6PA 3THYA 3KFXA 4V02A 1YR9A 3AVXA 5EUQB 1CRQA 1I2MA 5JCPA 2G0NA 5F2EA 1ZD1A 1OLOA 2QBYB 2JEOA 4EFNA 4JLMA 1E0KA 3SHWA 4HB2A 2REBA 5FTNA 2PCLA 2BV3A 1T4GA 4P4SA 4IVQA 1J8YF 1B23P 2FZLA 2J59A 1KKMA 2AXNA 4JBXA 1KSFX 1R8SA 3QY0A 1EG7A 1UBGA 4IDQA 3M0EA 4B3DA 1TQ4A 2NGRA 1NG1A 3LW7A 3L2OB 4GL2A 3UWKA 1YVDA 1ODFA 2ZJOA 1JBKA 2XXAB 1A1VA 2WJVA 2LKCA 3HPRA 1DAHA 2DCUA 3R9IA 2DB3A 2ODBA 4NCKA 1OFIA 1MABB 3IBYA 4DXAA 4NYJR 1A2BA 1H8ED 2IF2A 2AKAB 2AFIE 1P7CA 2A7QA 2WPDA 3P20A 1FFHA 2GXSA 4ZV4A 2WKQA 4HUQB 4PC1A 3WHLA 1KGDA 3VAAA 2O8FB 1ZYUA 1H8HD 5JECA 1XX6A 1TAGA 2HJGA 3FGNA 3FOZA 4LJAA 1P3JA 2ZYVX 1EWQA 4CW7A 4PZYA 4CT5A 4YQFA 3I5YA 4FW9A 5AWFC 3LBIA 2N42A 2QAGA 2ZRPA 3B2EA 4MRRA 2EYUA 2ZUDA 4QGGA 3QKRB 3LLMA 2J5XA 2YNMA 5JEEA 421PA 4JLPA 4P31A 2EW1A 1KAOA 1N6IA 4D2IA 1BO6A 2JLWA 3V4FA 1HUQA 1NI3A 4NONA 1O3YA 3ZZTA 1QG2A 4HB3A 1VHLA 3Q5EA 1N6RA 5K8LA 4Z1MA 3QI2A 1E1RD 2WZQA 2OCBA 2ORWA 1JEEA 2H17A 2GWHA 1T5LA 4M22A 4LSGA 1AKEA 4DCNA 5DISB 4JMPA 2BJVA 2O8CA 4GMXA 4RY2A 3KDSE 3R8CA 4B76A 1CR0A 4Q4JA 1R0ZA 4L9SA 5JJKA 4JLVA 4G5SA 1EX7A 5CM8B 3PG5A 1D8TA 2FGJA 2GVDC 4K81B 4RSGA 5IF9A 1E9CA 1U9IC 3AKEA 2E9SA 2VP2A 3GD7A 1HE8B 3W90A 3THXA 3ETLA 4JLOA 4NKRA 5JHGB 1G7RA 1MO6A 1NMZA 4TTPA 3U6BA 1KI6A 4BLTA 2QE7D 5EE5B 2X77A 2WVJA 4P3YA 2XEXA 4QG7A 4TLCA 4C0HA 4YMUA 1P2VA 4PZLA 3U3KA 1OIXA 1QDEA 2WV9A 3D8BA 4DSUA 1MRNA 2HF9A 1E4VA 3B78A 1XCPA 5E3HA 5TXGA 3AF2A 1KMQA 4MYTA 1E9DA 3CUEF 2IUTA 3FKSD 2GJ9A 2NO6A 3MJHA 1NN0A 3CF0A 3GLGE 4L8GA 4NCIA 2QT0A 1YKSA 4V0MA 2H5EA 1T8TA 1CJTC 2RGCA 4LYHA 4L9WA 4F4JA 4CEJA 1U81A 4D0LB 2IUUA 4JSTA 4EUNA 1GL7A 4AURA 621PA 4XWKA 1KAGA 1U8AA 3OF5A 1S9HA 4TLDA 4PPNA 4IDHA 4LX0A 4RFVA 1UAAA 1ZUHA 4NYIQ 5JEDA 2FA9A 2QM7A 4TT3D 5K8IA 1S4QA 2D62A 5IK2A 1IJFA 4XOIA 3GFOA 4V0OA 3GLGA 3LNCA 4XWAA 3LQRA 2FFAA 3NBZC 3K09A 4JL5A 4MYHA 5BN4A 2IYTA 5JHHB 2GXAA 1ZD9A 5DHFA 1NN3A 2WWGA 1UKVY 4NPHA 4QBIA 2NQ2C 4LPKA 1OT3A 3K9GA 4ACBA 4ASUA 3GJ5A 3ZQ6A 1TF2A 1KMHA 4B3GA 3MG9A 4US2R 4Q00A 2BBOA 1FNMA 2OUKA 4Y0AA 1Z07A 2GJ8A 2X1VA 3OEHD 4IXMA 4JVMA 4LI0A 4PC7A 4ZPXA 3FYHA 4TL7A 4QBFA 3BBPA 4B6FA 5C4MA 3BXZA 3KKMA 1KHTA 4RJLA 3CBQA 3PUWA 3U5ZB 1US8A 2DPXA 4LY6A 4ZDJA 2G1JA 2BBTA 4A0RA 2OBNA 5P21A 2CCGA 3QIAA 4PHFA 1Z0JA 1Z2CA 2Q3FA 1R0WA 4RZ3A 3UMSA 2F9LA 4KXFB 3CWQA 4DVGA 2VYFA 2QENA 3ZQJA 1DADA 1VPLA 4KLZA 4RD1A 1QHXA 5BN5A 2UZ3A 3VR5A 4DT1B 2RGBA 4LJ5A 4PHGA 3AVOA 4AKEA 4DDUA 4TQUS 5EE0A 4D4LA 3W5JA 1ZNYA 2JJ2A 2C99A 3AF4A 2ZYTX 5BYJA 2YOFA 2C95A 2QUZA 3LRPA 4DWJA 4GPTA 1Q0UA 2QN6A 4GSYA 2JCSA 5JFGA 2ZRIA 2CJWB 1WP9A 2IA5A 4GOKA 2IL1A 1N5JA 3OE7A 3WY9A 2G3YA 2GETA 3MFYA 4IVPA 4ZDKA 4M1SA 2ZVQX 1KKLA 1PUJA 5ELXA 4KFSA 4S35A 4UXJA 1UKEA 1E2IA 1Z28A 2I1VB 1JXOA 1ZM2A 3O8CA 4A36A 1E4YA 3AF3A 1NF3A 1QHIA 2W00A 3BFXA 4KODA 3BIFA 4A1FA 1E69A 4P4UA 1DAIA 3NXSA 4DKXA 4A15A 2B7BA 4JLBA 2F3TA 1IHUA 4DSTA 3JZMA 3ZLJA 1NLYA 2HEIA 2XX3A 4B2IA 3H84A 3PR1A 4TWZA 1PLLA 2F43B 6Q21A 4JLDA 2GCOA 2ONJA 1CP2A 2QTFA 4NZYA 1KI1A 4PX9A 2N1BA 3THWB 4FWIB 3LDAA 3SE0A 4LJ9A 1T3HA 1OIWA 3UATA 1W48A 2VA8A 4OHXA 1Z6AA 4HLDA 3I1FA 3KKQA 1C1YA 1E2HA 4GOXA 3NIBA 1DAFA 1CXZA 2OBLA 3SN6A 2PLRA 2ZANA 1DO0A 1FZQA 1QHYA 2D2FA 4PHHA 2ZR0A 2YKGA 2V9PA 3ND9A 2BOVA 3IUYA 3WRXC 4UQOA 2CL6X 3Q7QA 2ZEJA 4TLBA 2W58A 1PZNA 2GBLC 3GFTA 3RRZA 4RD2A 2FSHA 5FL7A 2RCNA 3A1VA 3SBEA 2GF0A 2DWOA 4FIDA 4JYBA 3VTKA 3VR3A 1OH7A 1XD8A 4XSGA 3AVTA 1D2EA 1ESNA 4CF7A 3BS4A 5TV2A 2VTKA 3H4MA 3FPAA 3QBVA 3WXMA 2F1HA 1S8FA 4YMSA 1BYUA 1Z0IA 1AS0A 1E79A 3PQCA 1U2RA 3CX6A 2QPAA 2ZYWX 3WYGA 1LF0A 3LH5A 4XVQA 4B2PA 2Q9BA 4Q1DA 4RVCA 3QKUA 3VKGA 3AVUA 2NO1A 3K0CA 5FL7D 2LWIA 3CPJB 2QA5A 1Z83A 3OIYA 4D81A 4DSNA 3ZD6A 5E4FA 4XTRA 2CNWA 5C18A 2QBYA 1XEWX 5SZIA 5KSOA 4MYCA 1LTQA 2HJVA 3NG1A 1EESA 3QXJA 3NDBB 5IRCD 3TR5A 5TB5A 5FBQB 1G19A 3BH6A 3A6PC 4W5WA 2RHDA 4I99A 2H16A 1BH2A 2WWXA 2RKOA 1WDTA 2CBZA 4P4SB 1VMAA 4O2RA 1E6CA 3BB1A 3KXLA 3P1JA 3SFVA 2R6FA 2OE2A 4Q7KA 5AJVB 2HT1A 4NL4H 5EQTA 1OSNA 3R9WA 2VP9A 4B3FX 1CBUA 1WRBA 1MABA 1XMIA 3I3SR 4QJ4A 5J4VA 4AWXA 5EXXA 2WWFA 2IS2A 2Z0MA 2N46A 1JAIA 2GAOA 4A2PA 2C9CA 3HJNA 5IT5A 1GUAA 2GRJA 4KFRA 2WWWA 1ETUA 4GNKA 1E32A 4IEIA 3D3QA 2RB4A 3AGQA 1G64A 3IEUA 4G5QA 3S1AA 4AKGA 1BIFA 2XZOA 3ASZA 3ZVRA 1IBRA 2IXEA 4FD2A 2A5JA 3K53A 3RYTC 2UZIR 2W2XA 2GEUA 2J3EA 5EXTA 2RGNA 3QPWA 4G01B 2WBLC 1CTQA 1ZVQA 1PVOA 4JVNA 2RH5A 4TYWA 5C4GB 1J8MF 2CVHA 4X8MA 2GXUA 3KJIA 1WBDA 5KTYA 1E2DA 1YZTA 1A2KC 1ANKA 1B0UA 1NMYA 2KE5A 4HDOB 2FOLA 2QSZA 3MGCA 3DVLA 3GJ4A 4C0AC 2H92A 4C2TA 2QTVB 3VR6A 3DM5A 5TMPA 1ZM9A 5J47A 2W6IA 3RABA 5FTKA 1SULA 4LV8B 5DLQC 2Q9CA 2BMDA 1Q44A 4GBMA 5KHOC 1UDWA 2IF0A 3GLHB 4LCBA 2G9NA 5JWHA 1EFHA 1JQLB 3IPXA 4PPGA 3IPYA 1VCNA 4Q03A 1G291 3I4LA 2QP4A 1D6JA 5D3MB 2O8CB 1YZKA 4PZZA 4EPYA 4PAQA 1MO3A 3K9NA 4HLCA 1SQ5A 5FPSA 3QPVA 1KO1A 4RZUA 3C5CA 1TEVA 1YRAA 1JB1A 1NN1A 4YMVA 4UXHA 3QXXA 3TW4A 1RZ3A 1JI0A 1KI9A 2ZPTX 1RKBA 2O5VA 4JVSB 1Y63A 3QEJA 4D82A 2ZM5A 1ZMXA 4D6PA 2ATXA 1X1SA 1F5NA 4PXAA 4IVRA 2AN9A 2BM0A 5CK4A 2XAUA 3LWNA 1E99A 1IN6A 3QNUA 1GKYA 1G20E 1Z6GA 2ZRJA 1A5TA 1KJYA 2CHGA 2ZI5A 2QMHA 3NDPA 4IDOA 2WAXA 3DMDA 5JMTA 5JZVA 4IW3B 2BMFA 5KSZA 2TMKA 1G9XA 3OFND 3ADCA 2W2VA 2QI9C 4FMCF 2BM1A 4PTLA 2EU8A 1CJUC 1QBKC 4B6EA 1ZW6A 1JQJC 4CEJB 4FMCB 3IHWA 4HAVA 4XTCS 5DO9A 2OFWA 4PSAA 2FE4A 1UBFA 1ZNXA 5HCNA 4NTZA 2OXRA 1CR1A 3SI7A 2GESA 1K8RA 2HLDD 4B73A 2NTYC 2HCJB 1E2LA 1X1RA 2VHCA 4TLAA 2ZSDA 5FH9A 4DLUA 1P60A 2W0MA 1OIVA 1ZU5A 4KYUA 4MQBA 3U4QB 1SGWA 2O8BA 3GLFA 2CL0X 2A5FA 3TR0A 1UM8A 1Z08A 4BZQA 2KI5A 2R6GA 3AQ4A 4FN5A 5FPHA 4XWOA 3PEUA 4OQMA 3EZ9A 2JLQA 4TMTA 1X3SA 1J70A 2I3BA 5FOVA 3SEAA 3G5UA 3K0SA 3WHKA 2O52A 1E9BA 2F1JA 4YXWA 1T91A 2XNDA 1GNQA 1EFRD 1WF3A 2ZU6A 1KMHB 1E2KA 4Q66C 3SU8A 5GJCA 2OLJA 4QJ3A 2D74A 3DM9B 1KY3A 3FDIA 5FTLA 4AIIA 1XTRA 4Q19A 2ZYUX 1HT1E 3I73A 4KSCA 3WMEA 1IJEA 1TX4B 4K46A 4XIGS 3REGA 1YR7A 4BLOA 5H8WA 4HUTA 3HU3A 1G3MA 1EK0A 4DT1A 4OQFA 1KZ7B 4JBWA 4RD6A 1LVGA 1G8PA 2XZLA 1QHHA 3JVUA 4DLZA 2C9YA 2E1RA 2ZJBA 4QBHA 5H1YA 3FHTA 4KI0A 1JXMA 1Z6TA 2Z43A 1RRGA 3DKVA 3O47A 2REXB 2ZUCA 1GM5A 5F9HA 4UJ3A 4MRNA 2BKEA 4Q4AA 2QM8A 4B34A 3FVQA 3ECCA 3IO3A 3FHOA 2VH5R 3TLXA 1DBSA 3FMPB 1ELOA 3MUFA 3KJGA 1K5GA 3W6OA 3LBNA 2ZJ2A 4KFUA 1IXSB 1GP2A 1CRPA 3MMPA 1QHGA 4EFLA 3AEZA 5JBQA 2ZITA 4QKQA 5JI3E 5DYIA 3K8YA 3U44B 2HV8A 5JS7A 1SVKA 4FMDF 4R98A 3SYNA 3KQLA 3LO5A 3X1WA 4FMDB
chains in the Genus database with same CATH superfamily
1QSGA 4JASB 4B31A 2AI1A 4WCDA 2UZ4A 5JZBA 1FFBA 3KPYA 3E8XA 3CZDA 4HWKA 4II3A 2PSEA 3U26A 2HM7A 2IRWA 3SQXA 1UPUA 3IILA 4JDUA 2DPMA 3V4OA 4E88A 2DUWA 3MF0A 1JLHA 2CK3D 4LRXA 3QEMA 5KWVA 4O8CA 3H2HA 3ENKA 3HNRA 2NX2A 1H4VB 2A67A 4ZTBA 1R3DA 2YOGA 4B3CA 3LM8A 4DCTA 2C8JA 2EFCB 3T0FA 4A0FA 2OO3A 3ICYA 3CU5A 4UNQA 2IYWA 5L8VA 4PAMA 1WU7A 5C35A 3OCXA 2YVAA 3K1JA 4BXOB 2EZ8A 4R0QA 3QWAA 4EY5A 1RRPA 4EU0A 4JL8A 4X64B 3EHDA 1YL5A 1LV8A 3A1CA 2EFJA 2ZJYA 3D3JA 2VN8A 1LSJA 1GUZA 5FTJA 2CZCA 2EG5A 1SC3A 2WFLB 4KR0A 3T38A 2WGWB 1NPTO 4NZ9A 1PGJA 1SKFA 4BAZA 4B81A 2HPHA 1RXSA 1XWWA 2P67A 1E1CA 5EHNA 4W5JA 2HDSA 3TZEA 1VL1A 2UYYA 1JWBB 1U0OC 3ICPA 3FRIA 3MXTA 2QVZX 3DXFA 4UNSA 1W6UA 3WLOA 3OMWA 3CH6A 2P5SA 1EVJA 1XLWA 1Y3AA 3N2KA 1NWZA 4XPZA 4C7XA 3PQ8A 2M7VA 4C2UA 1GGMA 4BFSA 4D0GA 2WM9B 4AP9A 3RTEA 1Z22A 4E6PA 4O0MA 3X2FA 3TRDA 3Q7IA 3G89A 3KJFA 1A04A 3L0CA 3LW8A 3RRFA 3G02A 2Q1WA 2FP4A 3DZFA 4AMYA 1MB2A 4JOSA 2WAEA 3RJTA 4Q8IA 2KBEA 2I8AA 4DCOA 3MT7A 1F2KA 1MJFA 1Z3CA 2A2ZA 5F9MA 2O8BB 4JH0A 3EIHA 3IT2A 4D25A 4HT3B 2D5AA 3UE6A 2PXHA 2WU4A 2GJ3A 5EV0A 4B80A 2GCEA 2BRUA 3D1JA 4J0EA 4JC8A 1M73E 3C45A 5DWQA 2OECA 1GTSA 2YASA 4LBZA 1P4SA 3H9GA 2H31A 4M98A 3OQVA 1U5BA 4X56A 1I0IA 5KMGB 3D2LA 4MH0R 4UE2A 2PFSA 1T4MA 2AR7A 1Z8HA 2OV5A 1BNCA 3MTBA 3QNMA 5EUBA 2Q9AA 2GUGA 2E18A 2XADA 2FOIA 3UJDA 4FHFA 1KYWA 1RFGE 2YHBA 1L8LA 5EJ6A 3GLVA 3ROZA 3RPEA 3I61A 1GZ5A 2PR7A 4TVKA 5A5VA 2CD9A 3ZIAA 1G5FA 2O7SA 4NK5A 4Q6BA 4HZUB 2R86A 4AO6A 2VRCA 2YVUA 4KVGA 4QBGB 3H5NA 4AUNA 1LPBB 3Q9NA 4CGYA 2ZI7A 1V6SA 3Q1LA 2Z8ZA 3FDXA 1UWLA 2I2XB 3KQVA 4KXWA 5HJ5A 5LB2A 1IXZA 4DILA 1I9GA 2X8LA 3EGXB 1EWTA 2D0PB 2CUKA 3R7FA 4KR3A 3EWAA 3M89A 1U04A 5C7LO 2GBFA 2H29A 3IXGA 1S2NA 4G5YA 1TZ2A 4XEUA 1X7YB 2AX4A 3WL5A 3RQSA 3LFVA 2ZTUA 3QSGA 3UN7A 1OI7A 5HKAA 1IG0A 3S55A 2HA0A 3HA2A 4S0ZA 3UUEA 4MUAA 3T1OA 3LF2A 4R38A 3VR6H 3UICA 4JI1B 1PDWA 2GXQA 1CZNA 2ZJ8A 4MV3A 5HA5A 1PJ4A 2AJDA 5KOJA 4P4NA 3O1LA 2EV9A 2D1FA 4CHTA 4GGMX 1MWTA 1J9MA 5CHJA 2FCRA 2WUVA 1ZD4A 4NC9A 3PFKA 3MKFA 3K0FA 5I3CA 1E8MA 1GARA 3A1UA 1BLPA 5EP1A 1UK9A 1H8ZA 1UH5A 3AHJA 4OFBA 3Q6MA 4F6LA 3PRJA 5DBHX 4NEHB 4INPA 3AESA 3EY4A 4YP9A 1NNEA 3QPAA 2M6LA 4X63A 4E0BA 2G82A 3NWBA 1WZNA 3M9XA 3AR9A 2FPXA 3AT1A 4ZDXA 1P9WA 2EKBA 2Z09A 1L5HB 4Q24A 1YV9A 3HYCA 1O77A 3JQDA 1TLFA 2JHAA 1BDJA 3MLAA 4G89A 1BDBA 5IG2A 2TYSB 5L6MB 2QN2A 4DR3B 1YZFA 4LHVA 2VJQA 1T25A 4FE4A 1ZFNA 4BN4A 5FADA 2PFKA 4FZRA 5LP6F 3DGEC 1WSAA 3VYSB 3HU2A 3OVMA 4KGVA 5EWMA 1S4RA 5D5HA 3R3SA 4EF4A 4JP1A 5BMVB 8ADHA 3MW8A 3JARA 1KE1A 2V5AA 4K2AA 3EQ9A 4PFQA 4L1KA 2P40A 3BULA 3RAGA 4M0MA 4YLYA 1G8FA 5DBIA 4GI7A 2J4FA 4CQMB 2ONYA 3ZE6A 1W76A 4DQ0A 4YS6A 4GJ4A 2WM8A 5HMLA 5FAXA 3LLUA 4X20B 2J3QA 1TGYA 1BW9A 1E9FA 4MUJA 3VTZA 1BHSA 5JANA 1PFKA 2ZU0C 2VCYA 4R3WA 3AK4A 1QVWA 1VJDA 3NV9A 2YVLA 3OZAA 4EUHA 2WP8J 4PPRA 3ZE2B 2VSQA 3EXG2 5CMLA 3G5MA 2RHGB 3F98A 4W7SA 2OZLB 2BKVA 4BVKA 2H85A 1BVYF 2PDAA 3TF5A 3TUIC 1ZBQA 5EHGA 2C2YA 2FW9A 4H7DA 3L4SO 2HBRA 3JWJA 1X7XB 2JFHA 4YONB 1NVGA 3WI7A 3FYTA 4F3LB 1ISHA 3KV1A 5FPYA 1CY8A 1WA9A 4Q3NA 1MZUA 4ESOA 1Y5MA 4MA4A 1KYZA 1W8IA 1SRQA 3BMCA 1O97C 2OHFA 1GXSB 4UARA 4AX8A 3KU4A 4RPJA 1COZA 1JG6A 1RWWA 1Y8QB 4HYQA 5TQ0A 3ZDBA 1G5TA 5SYMA 2J1LA 3GX1A 4QNRA 1QH8A 7GPBA 3MT8A 4YMWA 4C22A 5AOBA 5JVDB 4PZ9A 5AHOA 4LW8A 1LDNA 2FWAA 1Y82A 2XTAA 1XXHB 3FPBA 4W5HA 4RX3A 1FP4A 3KLOA 1JFFB 1KSJA 5SYAA 3S2UA 4ZQGA 2ORVA 2CGEA 3V1TC 4A6XA 5F77A 1DKNA 1XLTA 4NIMA 3RNLA 1FFWA 2OCKA 2PKXA 4N4AA 4YUYA 1K38A 2N3ZA 1D1PA 2HRZA 3GEMA 3HJIA 1CK3A 2I6XA 1GAEO 4PRYA 1L1FA 2Z5FA 2PBLA 4KZ7A 4QY5A 4X85A 5U47A 4AG3A 2UYCA 2Q0OA 5AW6A 5C1DA 5HL1A 1F3LA 4GPZA 1NRXA 4QL3A 4RANA 1E1QD 2DULA 1KF0A 3PNKA 4M88A 2XK1A 2CF6A 3DZHA 5FR1A 1WM1A 5B3LA 1SCJA 4TMWA 4JEUA 4QSMA 1Q0QA 3CR7A 1WO8A 1CR6A 4RL6A 3TLAA 2V6IA 3QU2A 1NUHA 3M5PA 4RXTA 1E2GA 2BP7B 3DO6A 3QVGA 2YINC 4BP3A 4PYOA 2GPJA 2D5CA 4JGBA 4G1VA 1TAUA 3Q5DA 1WZIA 5CB4B 1W4ZA 1P1BA 1U60A 4LLOB 1F8GA 1NJFA 1V5FA 3EDQA 3HGQA 4J7XA 3PIDA 3CJTA 2FPMA 4CMGA 4UVIA 1GOTA 4MXDA 4LF5B 3LOUA 2JEZA 2W0NA 4WE3A 5GQSA 1O57A 4YNRA 2ZATA 1XF9A 3BG5A 3TQQA 4CIBA 3HLYA 2XEDA 3G79A 3VFHA 4U7TB 3UJPA 4G5FA 4L15A 2H0TA 4OKNA 3PVZA 4DE2A 4DCPA 3UWPA 4XIJA 2WKRA 1PT6A 4MB2A 3INGA 2VV6A 3II6X 3I9FA 3B1JA 2X19A 2W7TA 1PYYA 4L28A 5I7AA 3UB8A 1BXKA 3QX3A 2XNCA 1P2DA 2UYGA 4TTAA 2A8YA 3G85A 3LRXA 1PR9A 1XI2A 5JD4A 4PLVA 2Z8XA 5A5GA 4AWBA 4RA6A 5IVDA 1P8AA 2OV1A 3I04A 4B0PA 4GBJA 121PA 3Q9SA 3PITA 2YIMA 2CNNA 5F7XA 1N34B 3TQOA 3BICA 4K6KA 4A9AA 3TQTA 7REQB 1Z63A 3RFCA 4ACAA 4AO7A 3ZLTA 1X0VA 3VPSA 4TWBA 3BECA 4HHEA 3PHJA 4CQMD 3PQ2A 3ZR4B 1J0DA 1QO0A 4M0PA 3VOSA 4DXDA 3JVIA 5JBNA 5HFOA 3MTGA 2ATVA 2OHOA 3D8HA 1PSWA 1BGVA 2BBSA 1CF4A 1NPDA 3EXHC 3CBGA 4BRWA 1N9BA 4DV2B 3L0DA 1DL5A 1FPQA 4PQEA 4QYTA 1SG0A 5E9AA 3L8DA 4B9OA 3RANA 4X1IA 4TZ6A 3HZOA 2WYOA 4G1MB 4LY0A 4J75A 4QQFA 4M1OA 3O2QB 3FOFC 5B30A 3CEJA 3DOEA 2A1UA 1KEEB 4EB6A 2IYOA 4I4TF 3H6KA 3VMMA 1EIWA 3W2TA 1RCFA 1TQDA 4F38A 1GHIA 4NCJA 3E0XA 4AY5A 4KZ3A 4DMHA 2B2CA 5I7WA 1PEKE 2D5IA 4WBSA 3D4PA 1IVNA 4RHTA 5HKKD 2NWQA 3H7IA 3PK0A 3CH4B 4R8VA 2BM9A 4LFUA 3ZY4A 3OPYB 3SQLA 4RQ9A 2ZIFA 5ALRA 4R01A 4WECA 1J99A 2R1VA 4TM8A 5LQDA 1GAJA 3BL5A 1EPUA 5IMBA 2P8SA 3L79A 4KGXA 2NVBA 1TEXA 3OCCA 2A1TS 4B47A 2V1BA 3EGCA 1FQJA 3GJ3A 2R6AA 2FI1A 1UFKA 1YBMA 1P0MA 5JXWA 2OQ2A 4DQLA 3ILXA 4M2LA 1HKHA 2B0CA 2JIRA 5HQTA 1BGXT 1QIJA 3M3DA 4ARCA 1AUPA 5CLLA 5HAPA 1RGZA 2EF0A 4A3SA 1U9CA 3A8TA 1E2MA 3OJ0A 3AEKB 2EEPA 1D03A 1UP4A 3NH6A 1HLUP 3HRKA 3ZGAB 4KLNA 1NBWB 3GEGA 4K1XA 1IUOA 1IPFA 4QXMA 1MZPA 2Y92A 1SOMA 3TJZA 3IIEA 3PFGA 1MCZA 2G80A 3AFIA 3L7JA 2HDOA 3FNFA 1DRMA 5F68A 3AF0A 4KSYA 4DCGA 4A6PA 5MN6A 3T1YB 4AROA 1Y8AA 1BZAA 2INWA 4HB2A 4WPGA 3S2SA 2BV3A 4IVQA 3SHTA 2PJUA 3K2BA 3AB7A 5J2UA 4M55A 3DFIA 5ALNA 5DV9A 4OOEA 4YP1A 1WXGA 1BD4A 1EUDB 4IQFA 2OXTA 1Y98A 1MB9A 2LV8A 2ODBA 3UC9A 1WOYA 4LWPA 2AFIE 3K1YA 4F4DA 1PL8A 4PC1A 2E8JA 2FZCA 4MWOA 1EWQA 3GJSA 3HM2A 2PUBA 3G23A 2P2CA 2FUKA 3BGSA 3KB6A 4C07A 1Y1LA 4ZP1A 1C80A 1PWHA 1P29A 3QUTA 3ZZTA 1F7VA 1EQ2A 4ZVOA 3MPUA 4GMXA 3FCSB 1CR0A 4Q4JA 1TC1A 4MCJA 3IKVA 1ZQ1A 1U9IC 4Y9DA 4L02A 3L05A 1EIZA 1YDFA 1HLFA 3KQWA 1QFSA 1CUXA 4MWSA 4D74A 4MRMB 2XEXA 3C1TA 3CXUA 3VDXA 1RM3A 5E3HA 3VV4A 3SYRA 5IWAB 3GRAA 1N9OA 1QU2A 4MQEA 3Q81A 4NCIA 1M5RA 3NIDB 4L9WA 3KT8A 3IMKA 3D7NA 4JSTA 4J2OA 2P4SA 1C7EA 1P0FA 1ORWA 1TD9A 2E82A 1S9HA 1ICEA 3T3PB 4NQRA 3G0BA 2IVZA 1NN3A 4NPHA 1KMHA 2DCMA 3C6ZA 3VOTA 4QBFA 4G0QA 1WLSA 3I37X 2HU7A 1JL3A 4FH2A 4DE0A 1ACJA 4PHFA 1CUVA 5C32A 4FGKA 2R00C 2VYFA 4BATA 1NBHA 2C61A 1MX9A 1NE7A 4RD1A 4RC9A 2UZ3A 5AVFA 5FWDA 3ETNA 4TQUS 5EE0A 3UQYS 2QN6A 2IL1A 4DABA 4Q0HA 1XQ9A 3SR4A 1M0SA 3JQFC 1CQZA 5KYGA 4YP5A 3LL4A 2EGHA 4DKXA 4AZVA 2H52A 1L5GB 4N54A 4QU5A 1Q91A 2XGOA 4LENA 1C7JA 1J06A 4Q12A 3E22A 2P77A 4FBLA 4FWIB 4Y17A 4D9HA 3HCYA 4LCEA 1UBHS 3PEFA 1KMMA 1NJ2A 3ZHBA 4Y2XA 4DARA 4LRXC 1JILA 2VZWA 2E48A 4EHKA 2VJCA 4RPLA 2RCNA 3VR3A 3F1LA 5JYCA 2VHXA 4NFLA 3R8XA 2JZCA 2DFDA 4Q3CA 1YI1A 1Z12A 4AFIA 4RVCA 3RO7A 3OIYA 4IYRA 4ARBA 4KQJA 4MYCA 3V4LA 5J59A 3GHHA 5K3DA 2G8LA 4O7DA 1AKQA 4HMOA 1ACMA 4X5OA 2CMFA 1E6CA 2DWUA 5AJVB 4NL4H 3TWOA 1FCNA 2ZVDA 1FDOA 2N46A 2E4UA 1MW9X 3D59A 1ZO8A 2PV7A 2RB4A 1BIFA 3ZVRA 3SVZA 2GEUA 1KVLA 4JVNA 2WVHA 2YNMC 3VM6A 2FWMX 2GXUA 3QELB 5ALIA 2EOAA 2NZVG 2GR9A 1D8AA 5AM4A 4C0AC 3VH3A 3UO8B 2QTVB 4OBXA 3E7PA 3NUGA 4B3IA 4M7PA 3C3MA 1WDKA 2BMDA 2BUCA 3UAWA 3IMGA 4YMGA 2EX4A 2J3TD 1FFGA 4Q03A 4MVJI 1FVHA 1UZUA 4PAQA 5L9AA 2SKCA 4FE3A 1N5DA 2AUTA 3A31A 1OTBA 2OORC 3VE3A 4WN9A 1VSUA 3SKXA 1ZCZA 4JJ6A 1J21A 1GKYA 2GTIA 4NNPA 1ZVJA 4BU0A 4RUKA 3DD1A 4ARAA 3HP7A 4B6EA 2FE4A 1UBFA 3M82A 5F5YA 4Q0IA 4B88A 4WMCD 2F62A 1STOA 3GJQA 4R23A 3KETA 3R7LA 3G5UA 4FKBA 4CKWA 4YXWA 2ZU6A 4WSOA 4PRZA 4L3OA 4PCVA 3MXSA 5DCUA 2BRUC 5ENVA 1AHNA 3I6YA 3LLSA 1TX4B 5E43A 3LCVB 3HU3A 2W11A 4RD6A 3DVAA 1JHMA 1TO1E 4DLZA 2Y6VA 2C9YA 3ZWBA 1GM5A 1OTXA 1RRGA 2C94A 4ZWNA 3LTNC 4KQIA 1HF3A 1EZ1A 4WZ4A 1DBSA 3FMPB 3S6JA 3SLRA 4DL9A 5KZHA 1Y8RA 3K5PA 1U80A 3PVCA 3AEZA 4MUFA 2VDMB 3U44B 4RMGA 4F06A 5JCJA 3B3FA 1V3QE 3LDGA 4UUMA 4EYKA 1UCFA 3QW2A 4UPVA 5GJVC 1GZ7A 2I3DA 1U2QA 3AI7A 4QM6A 2BEKA 1DAKA 3QM1A 4A03A 5C5EA 1MDFA 4DN0A 1ORVA 3BKXA 3ONFA 2V6BA 3T3IA 4URVR 2JGLA 3M6IA 3HXQA 2H4HA 1HC7A 4IOKA 4DMRA 821PA 3W4JA 4QXQA 1Z06A 4X7BA 1W2WB 2X7XA 4KO3S 1OGYA 1N8TA 3BDVA 1O0SA 1OF1A 4NYJQ 4E15A 1PUXA 2LW7A 3P19A 3LPCA 3HRHA 2FXVA 1Q2QA 4NHEA 4KBYA 4N3BA 3RRXA 3NC8A 2P2LA 1ZPDA 2YL2A 3HN6A 3WGNA 1JA1A 3EEOA 4ZICA 3H97A 3KQHA 3MSXA 3SYTA 3UO9A 1YRHA 4ZALA 4IQ4A 5D87A 4IZ6A 2KLIA 4J94A 4ZHQF 1K63A 2YWDA 3BIWA 2XMCA 2HFJA 1MJHA 5KKAA 4P5DA 1NRWA 3O1JC 3DNFA 1XCJA 3JATB 1FUIA 2VH1A 2H3HA 1DZIA 3TRIA 4I9UA 2Y91A 3SJAA 3B8EA 1M2EA 1E7YA 4UEWA 3WLKX 4LI3X 4PM8A 1PZMA 5ALHA 2Z2IA 2VF7A 4LZZA 4CMIA 4TRMA 4Q48A 3MIZA 5CYFA 3O8QB 2LIVA 2BWJA 2HA4A 4EY8A 4C21A 3QENA 3GMWA 2B8WA 1Y5NA 4TYYA 1GCGA 3W2ZA 3KS9A 4IMJB 3NHMA 2JKTI 2QG4A 4ZEVA 1RLJA 3LCEA 4ZAWA 3C14C 1YOVB 3IP9A 3N59A 3N7UA 1B7GO 3OE4A 1LBIA 5J4YA 2D06A 5D00A 4DY6A 1YAJA 2ZJ3A 1MVLA 1L1QA 2V7TA 4U5XA 4IOMA 5CLHA 1V11A 5FFMA 3SIPA 3IF5A 4J6EA 2XKJE 2IFTA 3DTKA 2ZE8A 2JAPA 4GHIB 4D4MA 1I7SB 4AUMA 1T6BY 3FUCA 3PJRA 5DJ5A 3SEZA 4K5QA 3SQMA 5M34A 4OJKA 4ZA2A 3ZCUA 4BLMA 1PW5A 4LY9A 1LRLA 1E2JA 4ZAZA 2XE8A 4ZYXA 5EKXA 1QHHB 3S7TA 5D51S 2KX6A 4NSNA 5CCDA 1YZLA 3ZVLA 2TECE 5AO9A 2DWCA 2GM3A 3ILSA 2XA2A 3DPIA 2XRZA 1I2ZA 4F9EA 2Q1YA 1RQNA 4OTZA 2Z9CA 5B4VA 2HWXA 1VCIA 1IK6A 1RMYA 1CIPA 1H6BA 3ROQA 1ZESA 1RLUA 4H6PA 3N2YA 3C3WA 3ETGA 1LI9A 3UAYA 4R4RA 1OI2A 2DPYA 3GA5A 3RARA 3FSGA 1R37A 2V7QA 3PLNA 1G18A 2GZDA 4OEHA 1UZMA 5E2IA 3BLMA 3V8NA 3TL2A 1E9EA 5JAUA 4QGAA 1GPH1 2A9VA 2NTNA 2P9FA 5EKDA 3IQXA 4KQRA 1X19A 3U9LA 5CPBA 4MA5A 2JEYA 1J2RA 2Q1UA 4O2BF 1O96B 2H7VA 3CNLA 2YHIA 3TQCA 4GWKA 1GPLA 3QYFA 4DAEA 1OV4A 4DBZA 2IXDA 4HDQB 5J43A 4WZ6A 4Y9RA 1RWNA 4PC6A 5DF9A 1S3SA 3UT5A 4BQMA 1C3BA 2JJ2D 1TEZA 2FKAA 5I01A 4CL8A 3SK0A 3UNXA 4QVIA 1PYOA 3IT3A 3O87A 3BDAA 4H2DA 2HUPA 1RWKA 3MLEA 1YJQA 5IXSA 2HK6A 5C31A 2PBZA 2WTNA 1X7ZB 4MWBA 4GMHA 3GIDA 3TECE 3P0HA 4L16A 1LX6A 1SKOA 3D4IA 3RKRA 1ZKDA 2Y79A 2IZ5A 2YWJA 1I3CA 1K6IA 1JQEA 3UCFA 1E7RA 3RUPA 5FEFA 3TKLA 1CERA 4F1JA 4KUGA 3HWSA 4OUDA 2ZI3A 1D06A 4WWHA 4OHRA 4BWVA 1GRVA 3ZU6A 4OKIA 2VTBA 1YSQA 1LSSA 4JP5A 3OOEA 4NG5A 3SDSA 5KYXB 1A97A 1X3LA 2UUOA 3PNLA 3GLFE 3AFMA 4UNNA 3DEFA 2B4AA 2XCSB 4KR6A 3FSEA 1Y0BA 1XLTC 5FA7A 5ALKA 1IBCA 3DQPA 1N9GA 1M6WA 3Q88A 3NRCA 3RSLA 1SD1A 4EVQA 4I1YA 4OP3A 4OHPA 3PXUA 3OHMA 5BN3A 5FWYB 4GS9B 3M2TA 1K66A 1KK2A 1ZUNA 1F12A 4WXPA 4URHA 5CEFA 3FTQA 5AJTA 4EBPA 2WIFA 3H8VA 1IQUA 5DRTA 1VECA 1DXQA 4GOOD 2ZYGA 2C03A 3TSGA 1Y9JA 4MCIA 3A6JA 4PLTA 3X2SA 2QW0X 2ZJ0A 3O82A 3DCIA 3A37A 3TO5A 4KZBA 1IZ9A 5LP6B 2YUTA 1V26A 4AMVA 1SU8A 2J0QA 2F8LA 1YC2A 1PVDA 1KZ1A 3D31A 5ECYA 4NBUA 4GYKA 1QNLA 1DELA 1BVHA 2H2FA 1T1IA 1MG0A 1RMQA 1LW6E 1E4OA 1W96A 3VTFA 2VZ0A 3RSZA 1WYCA 2ZAIA 3BW6A 1TI7A 1E6EA 3W3AA 3DAFA 1M34E 2R66A 1J97A 4G26A 2EL9A 2DR0A 4ZVNA 4TXJA 4X92A 5FOUA 1KGFA 1QX4A 2XSSA 4WEKA 5JSZB 4B3HA 1KSHA 3V4PB 2EX9A 3K1AB 1R8YA 3LIEA 3LXXA 4IEEA 4J9UE 5E7IA 1ODSA 4UHFA 2GK7A 5H3HA 3RXWA 3EZXA 1LSWA 1W46A 1Y1QA 4OSOA 4KHZA 4NBTA 2BBWA 3T9BA 2ZE6A 5BWLA 1MZVA 3E2MA 3RIMA 3DLTA 2WZZA 2E4VA 2R47A 3IHAA 1EVZA 5C9ZA 4FYHA 2DKFA 5K05A 3QTTA 1ZCJA 2P3SA 2B3DA 3RIXA 4P85A 3QG5A 4FYJA 3QU5A 2JGEA 1DIHA 2VJWA 2O3SA 4M89A 2AE2A 1L3IA 3ND7A 3RBXA 2XCOA 4P7KA 4KQKA 4AMGA 4WGFA 1NAIA 5IJ9A 3DAPA 2HP5A 3A7DA 2G36A 4XX1A 5KX5A 1DT5A 2V0CA 3OIFA 3K6RA 4BL5A 1XA3A 2B25A 3O8BA 5T8KC 3FLAA 5AJWA 3KOMA 1AA9A 3Q5GA 3BWBA 4CMEA 2AFHE 4V0RA 2BGKA 3C70A 2WPNA 2QY9A 4L7QA 1N9LA 4G3VA 3EXHA 1XG5A 2GA8A 5T6BA 4E3WA 4RW0A 4JSYA 1NJGA 2Z08A 2YV5A 1CZOA 3UH1A 3S5UA 3PZRA 2R84A 1SJ9A 3A4IA 1IM5A 2OILA 4EW6A 5B7GA 3QPCA 2ZIZA 3A36A 1N2CA 5M7EA 4M87A 3VC3A 4L8VA 4EH1A 4LEIA 2HU8A 3N5KA 1XCOA 1W88B 2RGUA 2Y1LA 4XH9B 3JD3A 1RHRA 3UMJA 4DWOA 3UKDA 1YLWA 2Y1CA 1V16A 1PRQA 2Y76A 3N9IA 2BKLA 1Q95A 4HXGA 5ARDA 2XOXA 1CDOA 1AHPA 4DLNA 2OGSA 2PJZA 1FBTA 1T5IA 4IM7A 1RRCA 1G21B 4BFXA 1SXHA 3F9CA 3RJ5A 3DEAA 4Y3IA 5DFYA 2CLCX 5DYYA 4UDYX 3U80A 2JAHA 3D4BA 1VLVA 5A9SB 2DY1A 2FE1A 1N75A 1VP3A 3UB6A 3GIWA 4M1YA 5AQ9A 5ED0A 1XTBA 5K6RA 5JD5A 4RM2A 3E0YA 1OBCA 3MBZA 4AZ3A 2F3SA 1K86A 2QVYX 2AZXA 2ODNA 4WN5A 4RHYA 4AECA 3T15A 3D7LA 1T9BA 4QPCA 1PJ8A 2MSNA 3WTCA 2PUFA 1B8PA 4F2PA 3TJZC 4MW1A 4FFBA 4LYFA 5G0SA 3ZIDA 3B47A 3DJYA 4E6EA 3V48A 3EA5A 1AGXA 1TS7A 2J6IA 2HSZA 4YPFA 1XCGB 3JU3A 3GVIA 5T3UA 4RLFA 3WZLA 4UEOA 1B73A 4UJ5A 4RD3A 2RJNA 3OFNA 4Y30A 3NR2A 1U6KA 1MVOA 4FEAA 4QJGA 3LWZA 4UM9B 2E21A 1I9CA 2JFQA 2Z30A 4R9NA 2XXAA 4ZKDA 5EI5A 5A90A 4CL0A 1JG2A 1JDNA 2BHTA 4RTMA 4R41A 1PEDA 1IN8A 1OY1A 1NZFA 1U7ZA 2JIZD 4BJ3A 1J42A 1U7TA 4O1HA 3H0KA 2YYYA 3BYDA 4D9GA 4HDAA 1N2SA 3LQ4A 3U4CA 4C3UA 3LP6A 3DBRA 1YBFA 1T4CB 4E1BA 3N2ZB 4HY8A 4QZVA 2OWJA 4IF4A 3UK1A 4CYMA 4WKPA 3D8RA 3KLNA 1AMOA 1RRVA 1DG3A 4BKRA 4ZXPA 3BRCA 2X4DA 1OPXA 3MQOA 2H8KA 4R0MA 4DF3A 4YRFA 1TJYA 3HN7A 3OJXA 3N2EA 1U9IA 5ESWA 4EIWA 1UUFA 1E25A 3LLCA 1HT2E 4H1UA 5CA0F 3VOLA 3RS3A 2XRFA 3VSLA 4CKCB 4HZGA 3MBIA 1D0IA 1FXWF 2BLLA 3ZYZA 6REQA 5EWLB 4IJMA 2A33A 2F90A 3I2KA 2OC4A 3NOOA 3BHJA 3GJRA 4P2BA 2V1UA 1T36A 4I4TB 4CCWA 5HILA 1CJMA 1BX0A 1GYRA 4NZOA 1PJLA 2X5JO 1L6IA 1XMPA 3QP6A 3GLGB 5FRDA 3VH2A 3SQOA 3AVWA 3MJSA 4BMVA 5CEJA 1UOQA 1JZQA 4DA7A 2OKCA 3TZQA 2FFHA 3MWKA 2WINI 2A5GA 4ZU1X 4TMKA 4PVDA 3WXBA 2WG2A 2Z2KA 3IQEA 1UFVA 1Q21A 4Q7MB 2B94A 2ZJ9A 4D9NA 5KVVA 3KCNA 1X87A 2PMEA 2HPBA 2W2LA 4KPFC 3A0VA 1QGUA 2FUEA 3MD9A 5DOZA 2OAGA 3WGQA 3EWSA 1PL0A 3E53A 3QTLA 1BU5A 5DNDA 2Z6VA 5I3ZA 1IUKA 4GZ6A 4BFTA 2DLDA 3L40A 3OOSA 4MULA 1TYBE 4OHYA 2Q4DA 2QL7A 3FDZA 4OYRA 2D7DA 1VTKA 1U7PA 2JBFA 4QULA 4K9PA 1M2GA 4RNDB 1NVVQ 2RMKA 3CUWA 1U3TA 3FNRA 2DCFA 5I6DA 3KQTA 3ZXYA 4FC6A 1XDDA 3UXYA 3INNA 4HS4A 2WM2A 4IQ8A 4PX2A 4LYJA 4H3VA 3AP2A 5CIWA 1DJPA 1JJIA 2WE8A 3KSBC 2D4HA 3I4FA 2NU8B 5C7OO 1VL2A 1YJXA 1GRQA 2G70A 2ZIVB 2P78A 1F20A 1L7MA 1OX5A 1ZD1A 1G8SA 3GPBA 1CF9A 2JFWA 1M33A 2DBRA 3QY0A 3G9QA 4IDQA 2IHNA 4KDCA 3CHYA 1AGYA 3A1EA 3PPXA 3AHFA 1TE2A 3ROMA 4BLUA 4NMLA 1IUPA 1DAHA 2OV3A 3RU9A 5HZGA 1MABB 1C3LA 1YUNA 2IDKA 5TGZA 3GR2A 4HUQB 2VAXA 1JHYA 1H8HD 2IGBA 3S2EA 3H1PA 1WZEA 2N42A 2YNMA 4JLPA 1V8FA 5BSHA 1BKYA 1RWVA 1BO6A 2PXCA 4XQCA 5K8LA 5K3FA 2GLTA 2J8ZA 1XFDA 4IIJF 4JMPA 3CMMA 3KDSE 2Q49A 3V4ZA 1SH7A 5DT2A 1E9CA 3VZSA 3HVKA 3B6JA 1DC4A 1LSXA 1K56D 1NMZA 3U6BA 3IXBA 1W94A 2RAVA 4G1CA 3B3JA 2JKZA 3GSGA 3RQIA 4B8ZA 2OORA 3T4TA 4JJ8A 4IPTA 2NO6A 3MJHA 3CF0A 1OVMA 1K7SN 3GRFA 2H5EA 3ASVA 4BMPB 4UM9D 3TZLA 1NRIA 1B0AA 3V8BA 2WHYA 1ZUHA 3AEQB 1WMEA 4M0UA 3MYRA 3B9RA 4WFQA 1GADO 2WFMA 1H0HA 4ZT2A 3ZQ6A 4E2XA 3TMAA 1SQ0A 2Z58A 4B6FA 1GTRA 3CBQA 2Y2OA 3QIAA 2IUYA 1R4NA 1T8PA 1YCDA 4YJ3A 1H4TA 1KR5A 4LJ5A 4C5CA 3WHIA 3BD7A 1VFPA 3KWFA 3KJQA 5BYJA 2HP6A 5AJHA 2Q6OA 1I30A 1WW8A 3LIIA 4PM6A 4M1SA 2ZVQX 4EG6A 2B20A 4Y1GA 1E4YA 1F8UA 4BNVA 2HZ5A 2HA3A 4B2IA 3HXTA 1SZVA 2HA7A 2F43B 3ADPA 4JLDA 1CEQA 2BDEA 1AB5A 1ZHFA 2AXQA 1F8XA 1DAFA 5DBGA 4QB8A 1FZQA 2D2FA 3R9KA 4MTCA 1Q15A 2W58A 2VV8A 5ALDA 2DFVA 2XIQA 1R8JA 1QYVA 3BK2A 1YS2X 3D4OA 2FPPA 3T5TA 4XPIB 2QQ5A 1GU0A 5I7SA 3TG9A 5AQAA 2CLOB 3HUTA 3ORQA 4BQNA 3ED5A 4HFMA 3ZD6A 4RHUA 4ZI7A 3VNRA 1NOIA 3ZGYA 5LMNB 3MWFA 1PN3A 4G5XA 2H16A 5IAKA 5JQGF 3VR5D 3KXLA 3SHQA 1J5PA 2C00A 3BSFA 3I30X 2EBWA 1DDGA 4F85A 1T2NA 2WWWA 3M2KA 3OKFA 4OGGA 1IBRA 1YLJA 1P7VA 2PA0A 3KLBA 3HYSA 4RMIA 2E85A 1A7AA 3RFBA 4DWWA 4ZN6A 4RS3A 3H5LA 1A2KC 3WE7A 1QWOA 3JPWA 1TIPA 1QOZA 1U1DA 1H42A 4G2TA 3U7RA 1J8VA 2HV1A 5AK5A 3T7AA 3IB3A 3FUWA 3LICA 5C80A 3DE3X 5IH7A 2O8CB 3ZJVA 1QP0A 2RHJA 4BGVA 2CXPA 4HC4A 2BFEB 3V8EA 2H07A 3GK3A 3PCXA 3CVOA 3KQPA 5LZ7A 3JVDA 4PGGA 3V34A 2ATXA 4LNUA 3L7AA 3GDIA 2C9BA 3OCUA 5I7UA 2I1WA 1KAMA 3I6IA 3HBJA 1Z6QA 4HAVA 1KMNA 1P31A 4YRLA 2GESA 2PSFA 3VAYA 1Z75A 3C4PA 2W0MA 1SUCA 3TR0A 1U0FA 3EA4A 2G40A 3NUQA 1H2AS 2VDOB 5HM8A 3P0RA 1J24A 2H11A 1KY3A 1FMFA 4AIIA 1XTRA 3ORFA 4DQKA 2H28A 3FNHA 4YECA 3DWZA 4K46A 2XUKA 2I2AA 3OOWA 1LVGA 1FYFA 1QV6A 2E1RA 5FD8A 4TM7A 4J0IA 3GRVA 3O8OB 3VJMA 2RFLA 3V5NA 5CB0A 1K5GA 4YN3A 4YRNA 1X9HA 3NTXA 2HI0A 3QYAA 3MELA 5DYIA 4O2AF 3JYPA 2I7TA 2P9EA 1PQUA 4HDSA 2PR5A 5EJAA 1K8YB 3W05A 4QXAA 4QUDA 3P2YA 2XCLA 4RKFA 5IEJA 1C3VA 2ZYDA 1KR2A 1PW7A 2A58A 2PBYA 1JZSA 3LUHA 2WNIA 2GUWA 1II9A 2ID8A 2WABA 4N3CA 5EVEA 4DCJA 4ETNA 2ZIGA 2W6JA 4K91A 4LISA 3QHQA 1V2GA 3GT4A 4LRSB 2A6PA 2YXBA 3KT0A 4Z4QA 1W30A 3ZQKA 2B36A 1BH6A 1XZBA 1J2JA 4IDFA 4E08A 2PH7A 1Y1KE 3NRBA 4B46A 4K6GA 3W8NA 1YHZA 1AIPA 5BQOA 1HD8A 2J0EA 1C50A 2HXYA 4AWAA 4AXBA 3KAQA 3F7NA 1H2EA 2Q5CA 4I1RA 4WVLA 3LGSA 2OMKA 4WNYA 3FVRA 3VPXA 2XVMA 5C3MA 4NH4A 3FIUA 3PEWA 4EHHA 3WGVA 4HTAA 3UKJA 1Q1ZA 4ISBA 1NR1A 1IZ7A 4ZHQB 2WTXA 4ISCA 3GGCA 3IBGA 3E84A 3RROA 2APJA 4HJ6A 1FVOA 1FL9A 5DM70 5DNWA 4AU1A 3E9RA 3EEQA 5K3EA 3UK7A 3MVEA 1NUAA 3EPPA 1M2VB 3M3PA 3AF6A 4L8WB 3MQ4A 4YV2A 2ECFA 3LXRA 5REQB 3HJKA 4I1IA 4Y2QA 3H82A 2XXBA 3NDJA 1SDNA 3D43A 1SQGA 2WIGA 3CUVA 1AF7A 5H5JA 2L82A 2B92A 5FQ9A 1VXOA 2LB5A 3KKPA 5DHAA 5FOSA 3KE8A 3HL4A 3L1JA 5FUVA 5F83A 3GGOA 4HATA 1PHPA 4IUHA 2AGVA 1VI5A 2H2DA 2IHVA 5AM1A 3BK1A 1AURA 2C57A 2QGFA 4CDNA 4ZZ1A 2ZQDA 1C9KA 4G6ZA 1CUJA 2IBSA 2UWXA 3HWX1 4NCHA 1WZCA 3OTQA 4Q9LA 4Z7OB 1Y1RA 2SNIE 4P32A 2CXOA 5DH9A 2RIPA 2CEAA 1CY7A 1T0PA 1EH5A 3K32A 3KUDA 3MWEB 2WPDD 2Y99A 4ZFNA 1ZIOA 2PWZA 2OV2A 3PX3A 2QTGA 1JQBA 3OP1A 1EUCB 1ILEA 3KHKA 3NB0A 4F21A 1DEOA 4YYEA 1IFXA 3UE3A 1MV8A 4R5HA 3ZJ4A 3SNHA 1RADA 4IMPA 3DE6X 3GJZA 4Q4AB 6YASA 5HF9A 1HMPA 2PZLA 4ENPA 3