2GZAA

Crystal structure of the virb11 atpase from the brucella suis type iv secretion system in complex with sulphate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
334
structure length
324
Chain Sequence
ASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIEDVPELFLPDHPNHVHLFYPVTAATLLRSCLRMKPTRILLAELRGGEAYDFINVAASGHGGSITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTKRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Type IV secretion system protein VirB11
publication title A Large Domain Swap in the VirB11 ATPase of Brucella suis Leaves the Hexameric Assembly Intact
pubmed doi rcsb
source organism Brucella suis
molecule tags Hydrolase
total genus 90
structure length 324
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2gzaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gzaA02
2I4IA 4DIEA 4FMCF 5GJCA 2B92A 3GLGA 1P2SA 2G88A 2OCAA 1H8HD 3LVRE 1KI2A 2OAQ1 5GJVC 4M9SA 1UFQA 5KSZA 4XD7D 4TQ9A 2F55A 2VP4A 2DHRA 4TMXA 4URZR 2ZJAA 3PUZA 4GPTA 1P7CA 1P3JA 2CLSA 1CU1A 1OW3B 4NONA 4IOMA 4UNRA 3R9IA 2IYTA 1XRJA 3DZ8A 3FYHA 1MABA 1QF9A 1E9FA 2QMEA 2PEYA 4B76A 2XXAA 5KSPA 1UBGA 2L0XA 4A36A 5B57C 4V0OA 3WHLA 1TQ6A 1CEEA 2WJIA 2QPAA 1TF2A 2GJ9A 1GFIA 3U7FB 1G20E 4LJ5A 4WXRA 4GBMA 5DO9A 1XBTA 1J7KA 3GJ6A 4B3GA 5CM8B 4Z51A 3EC2A 4HB2A 4PO8A 1NL3A 1T3SA 3BFVA 3LLUA 1E9SA 2AR7A 4Q1AA 3R20A 2WOJA 1ELOA 5F9HA 4GSYA 1E2QA 3TR0A 4MDEA 4UNQA 2J5XA 2JIZA 3SU8A 3UK6A 3MJRA 3KXLA 4KFRA 2WWXA 1CJTC 4AK9A 1E1QD 2CL0X 1Q3HA 4UNNA 1KHTA 3PVSA 4B3DA 3SN6A 2J59A 3I3SR 1EESA 3H4MA 4FMDB 1E2MA 4MA4A 2W58A 2XNSA 3BGWA 1E2EA 1LVGA 1W46A 2BMDA 1E4VA 1MKYA 4N0DA 1JXMA 2C99A 4P4UA 4RJLA 3X1DA 2W6ID 4ZV4A 3IILA 4OK6A 1KO5A 3E1SA 5IK2D 3WNBA 4Q5IA 3NKVA 3H84A 4TL6A 2XTNA 1JEDA 1U98A 2SHKA 4AKEA 4Q1EA 4BGDA 2OO7A 2REOA 3RDPA 4II7A 4BQSA 3SJZA 4BUJA 3HWSA 1UKYA 5B30A 4KCGA 3RS5A 1UKEA 4W5WA 1TUEA 4M53A 3GLIE 1GNPA 4PPNA 1OIXA 1UEJA 2CK3D 3N5CA 4ZIRB 4HYYA 3LLMA 3N2EA 4RKFA 2X77A 4EJSC 3B6EA 4BLPA 5HR5A 4LYHA 2O0KA 5B2ZA 1Z0AA 3CRMA 3LX8A 5D3QA 3UATA 1G5PA 1W7AA 3OZXA 1W4BA 1FOEB 1FUKA 4DKXA 4HLQB 3EC1A 1KI3A 1Z5ZA 4QGHA 4A1FA 4BLTA 3QXSA 4BZXA 4TYNA 5DI9A 2VHCA 4DCVA 4DLWA 5E7IA 3LW8A 2ZM5A 2Z83A 4NYMQ 4RFSA 3U44B 4CZ2A 4D0NA 1X8LA 3TKLA 1OV4A 1TNDA 3NWJA 3FVQA 1HTWA 4QJ4A 1KK3A 2A78A 4IFEA 1ZBDA 1ZCBA 2QBYB 1EFRA 2CLCX 3CRRA 3AKCA 1YVDA 3B8HA 2WVJA 3RHFA 4ZIRA 2ZI5A 2ZRLA 2ZRPA 3KL4A 3SE0A 2RGBA 3EARA 3SYLA 4RD0A 3I61A 4FMBB 4Y0AA 1N2CE 2CVFA 1Z47A 2GDJA 5HZHA 1UBCA 5CITA 2JDIA 3VNUA 3I73A 3IPYA 1SKQA 2IS1A 1MO6A 2ZS7A 1PUJA 4WZBE 1N6HA 5JZVA 3MMPA 3AVWA 2F1IA 5FL7A 3R7WB 1CJVC 4D82A 3QF4B 5C4MA 2ZREA 2FPLA 3ZDQA 3LDAA 4ZKDA 4LWZA 2JGNA 4DHEA 5DN6D 5HCNA 3HU3A 3U44A 5CIWA 2ZAOA 5FBLB 1JI0A 1IY1A 1CXZA 4RZUA 4V0ME 1PV4A 1J8YF 4G5GA 1XXHA 2QP3A 3DL0A 1G4AE 2RGXA 2OV2A 3QE0A 3IQXA 2GXQA 3KKPA 4HEJA 2Z4SA 4TYPA 5DIFA 5SZHB 3FOZA 2IUUA 3UANA 4DC9A 2R62A 1ZMXA 4CW7A 2G83A 4GMXA 2IYQA 3W6NA 2KBEA 1XNJA 1YE8A 1YRBA 4EAQA 2FV8A 3BH0A 3GLHE 1XWIA 4G01B 5FUXA 4MRVA 3TJZA 3W8NA 3AVVA 4AG5A 4PPQA 2VEDA 1FMLA 4RY2A 5FBRB 2WTUA 5DI3A 1P9WA 1GSIA 2NMVA 4YONB 1NIJA 4IFBA 4XWKA 2VP5A 1BOFA 3K09A 4NYJR 2WJYA 1N5JA 3QF4A 2FU5C 1A1VA 3GD7A 2G9NA 1C9KA 1VG1A 3LA6A 1JR3D 1NVUQ 1UBEA 3K53A 3T61A 3UWOA 1W48A 2PT7A 4JSYA 3D6TB 1DO0A 2QE7D 4I1VA 4AC9A 3VTKA 3LQRA 3ND9A 5G40A 3VU9A 4F4CA 1F5NA 4ARZA 1NNEA 2DR3A 2DWOA 3TBKA 4QBHA 4Z8YA 2ZE7A 1I2MA 1KSHA 3W9YA 1FL9A 3AF2A 1E4YA 2QM8A 1E79D 4JBXA 5KUTA 2FPMA 2GEUA 4LZZA 4KHZA 2QMOA 1M74A 2ONKA 4CEIB 1KK1A 5JWHA 1D2MA 4Q1DA 2WOOA 2ORIA 1A82A 1NY5A 1ZIOA 4MDFA 2YWFA 3M6AA 4TLDA 3QKTA 4Z54A 2JLSA 4PO1A 4PQRA 4OI1A 3IO3A 1G19A 1E2PA 2HCJB 4IDQA 4AG6A 4KI0A 3WXMA 4EQ6B 2PLFA 2J7PD 4PZLA 3KUCA 5TMPA 5AJZA 4NZYA 3AF1A 1Q1BA 1T0HB 3EZFA 2OLJA 2FE4A 5GJWC 1UAAA 3WMGA 1RFLA 4L8GA 2BBOA 2HT1A 4GMDA 4DSOA 5KNCA 1XTKA 4PC6A 1C4OA 2VF8A 4FMDF 2W00A 3PUYA 4CEIA 1V43A 4M1TA 4ZKEA 1EX7A 1EK0A 4AKHA 1Z6YA 4YLGA 4B47A 4GT1A 4LY6A 1GRRA 5H70A 4GOKA 5AJVB 1E2KA 3PG5A 1HT2E 5K8LA 1OPXA 4OI0A 4NYIR 4GRAA 4I4LA 4BASA 4K8OA 4PFSA 4LCBA 3PR1A 3U3MA 5BN4A 3NVAA 2R6FA 2QN6A 4EQ6A 3UIEA 1ZIPA 5G41A 1E94E 1R0YA 1XD2A 2HLDA 1XMSA 5BWMA 1DOAA 1P61B 2FX3A 3A36A 3CF6R 3CF2A 5CLLA 5L8VA 3S1AA 5JJLA 2FPKA 1G3UA 2BEJA 2N1BA 2MSDB 4IVPA 4AYTA 4A6XA 4Z1MD 1NN1A 1PJRA 5TARA 2HV8A 1A2BA 4IOLA 1JR3E 2NIPA 1I2DA 4DDTA 3ZVLA 1E3MA 3K0EA 3QEJA 3BORA 3QKRB 4R2HA 2CE7A 1T91A 2WAXA 4ZDIA 2YZ2A 5K8UA 1KKLA 2IF2A 3AV0B 4LJ4A 1TTTA 1OHHA 2V54A 2GVDC 4TYWA 2ZRBA 2X2FA 3UMSA 1S9HA 2OFWA 3T1TA 2Q3MA 4QBIA 2GILA 4DBLC 1G17A 1IN6A 5JWOA 2I1QA 3Q7PA 3CNLA 5DHAA 3LBNA 5CJPA 3THWB 5J4YA 4BFSA 2XSZA 1VYVA 4URWR 1WRBA 2GVZC 1PUIA 3SNHA 1IXRC 3PEUA 4LBWA 1NLYA 3K0FB 4TMTA 2QTFA 4TL8A 2G6BA 3BC1A 3K9LA 3IIKA 1IXSB 2ZU0C 3QKUA 4Q21A 5FTNA 5F9FA 1DAGA 4Q66C 4OKSA 4N0EA 2PEZA 4KFSA 2FZ4A 4Q9HA 5F2EA 3SQWA 4QJ3A 4MYUA 4BRUA 5CIQA 3QKRA 3Q5DA 4V03A 1CIPA 1E0KA 4ILEA 2OXRA 3U3KA 2CL7X 2VTKA 2RGCA 4M1OA 4GOXA 4W5HA 1RJ9B 3PUXA 3CPHA 1GUAA 3IHLA 4OQFA 1Q1ZA 2V7QA 2WWWA 4MRRA 3AVPA 2ZR9A 2BC9A 3DMDA 1NMXA 1HQCA 3TLXA 121PA 2DFLA 1GL6A 1NKTA 2B7CA 3FPAA 3GCGA 5FTKA 2JLYA 4OHYA 2BVNA 4D0GA 2XZOA 3THWA 2PZEA 2QMUA 2C77A 3U3OA 1KAGA 1OKKD 2FSHA 4G0NA 3K0FA 4P31A 3RYTC 2ZRHA 2G0NA 5K8TA 1U99A 1Z6TA 5FUWA 3ZIAD 4BLRA 3L0OA 3DOEA 2MSCB 3V4FA 4CEHA 1E2GA 3EWAA 3C5CA 2PJRA 2QL6A 1UKZA 1ZU4A 1FP6A 4JKIA 4O2LA 3WRYC 4DUGA 5B58C 2J46A 4OL0A 3BOSA 1UM8A 3L0PA 1EG7A 1RJ9A 2AFIE 1DBSA 1E0AA 4TWZA 1X3SA 4Q7JB 1W1WA 4Z8XA 3U3RA 2NG1A 1U0JA 3GPLA 4DLYA 3SS8A 2YHSA 3CR8A 3PFIA 2IK8A 3OEEA 1BKDR 3ICQB 4HAUA 4DLSA 1DEKA 4UQOA 4JLPA 1VTKA 3WMFA 1KY2A 2ATVA 2VRWA 4ABYA 1B0UA 3U5ZB 3WMEA 1R5NA 1E32A 1W0KD 2AFHE 1QHNA 3VR1A 2O8FB 2Z5FA 3BE4A 1ZM4A 3LNCA 4KBGA 5EXXA 2DCUA 3A1VA 1BYUA 1KTVA 1DADA 2QI9C 4MRSA 3TNFA 3UG7A 4DDUA 2CJWB 4YDHB 1B23P 4TLCA 2PBRA 3GEIA 3L0IB 3PUVA 3W5IA 3WY9A 4WVFA 4DZZA 3EZ9A 2PZGA 5KSOA 2WSSA 3G0HA 4QL3A 1YR8A 4B32A 2GETA 1HA3A 2W6JD 2XOKA 4IDOA 1N0WA 1G64A 1KI9A 3OFND 4Q9JA 4BFTA 1ZNYA 2OAP1 1JAHA 3GLFA 2WHXA 1NI3A 4EPRA 5HPYB 3T1VA 3GJ3A 5L3VA 1U9IC 3W5JA 4B3CA 1II0A 4AWXA 1II8A 1DARA 3EIQA 3ASYA 1E6CA 1N6OA 1EWRA 4URVR 1XD9A 3MJHA 2XZPA 4P32A 1NSFA 2AD5A 4KLNA 2O52A 4ZCIA 2FG5A 5CB6A 3RANA 3RRNA 3DPUA 3CUEF 2H18A 1UBFA 5EE5B 2ZVPX 1MH1A 2EQBA 4RD3A 2W0MA 3UMRA 1P72A 1I4LD 3OIWA 3QXCA 3HPRA 3HR8A 1I4DD 2BBWA 5HE9A 5SZIA 4AKGA 2JJ2D 4KU4A 4P33A 4NYMR 4XWAA 2O8DB 2NOAA 2ZRGA 3CRVA 3EIEA 3KB1A 2FWRA 2ZXUA 4B2LA 2AK2A 1OIWA 2V55B 2EW1A 3ZJYA 1CP2A 1W0JA 4PANA 2E87A 3G82C 3T15A 1T9HA 2RMKA 3IGFA 3BAFA 3TGPA 3F3YA 2J1LA 4UNSA 1KSGA 2J0QA 1A4RA 1Z6XA 4XVUA 1Z6GA 1GOTA 3ETLA 1ZM2A 3NBXX 5E95A 2CXXA 5TV2A 3M4YA 2D2EA 1P73A 1U8ZA 2O0HA 2QGZA 3B5JA 3RC8A 1OFTA 1E9CA 5L3QB 3AF0A 1Z0DA 2C96A 4ZDWA 5LD2C 4PR0A 1SGWA 1KO8A 4HSEA 3TVDA 1RYHA 3IQWA 2YKGA 2DY1A 3DDCA 4N1AA 3EA5A 2CCKA 2GBLA 1F6BA 3AF4A 4RD6A 2VSOA 4B48A 1P4SA 4EDHA 1ZNWA 4B3FX 4I81A 4BFZA 1KO4A 4TLBA 1GVNB 3CH4B 1XX6A 4XWOA 1KK0A 1OT3A 1S9DA 3DM9B 4JLJA 1K5GA 1WE2A 4D4KA 1R5BA 3H86A 1NIPA 4C7OA 1KDPA 1J2JA 2ZE5A 3QKSB 4HDOB 3B60A 3D31A 2B7BA 1XEXB 3MLEA 1JQJC 1ZUNB 4TTQA 2F1JA 4PSAA 4WOPA 2GA8A 4G5RA 4JSTA 3I1FA 4M1MA 1ZINA 4US1R 1COWA 4U00A 4B3BA 1AGPA 3B2EA 3HR7A 4RSGA 4DLRA 4FW9A 1BIFA 4D2IA 5L3QA 5AJWA 1LY1A 1ZM9A 1EGAA 1N3BA 1ZM7A 3BB1A 2RHMA 3MWYW 1VECA 3CBQA 4KO8A 5DGXA 2D2FA 2ZJOA 1E2IA 4IKEA 1Z06A 1X6VA 4TSFA 3TSZA 1HY3A 1AKYA 3L8YA 1XEWX 1JXOA 2FEOA 1GZSA 5KPJA 3A4LA 2IS4A 4JL6A 3OEHA 2H8KA 1W4CA 5DE3A 2GCPA 3NH6A 4I1UA 3RS3A 3QKSA 5FPYA 2GJ8A 3K70C 1N5IA 4QM7A 3B1VA 3FFBA 3OIYA 3ZS9A 3B9PA 1R0WA 1MABB 2H5EA 2QT1A 3ZQJA 4KAXA 4NTZA 5EP2A 4D80A 3O47A 1OB2A 3BB4A 2JIZD 2BWJA 5K8IA 4AURA 4ZPXA 1WP9A 2OESA 4H9GA 4KYUA 3EASA 4QJ5A 2G0TA 4JYCA 3K0CC 4LJ6A 3SFVA 1Z0JA 2XGJA 4TQUS 1OXSC 1CKEA 1XJ0A 1NG9A 5HKKA 1IN4A 1F2UA 4GI7A 4US2R 3THXA 4C3ZA 2PZFA 4G1UC 1JR6A 3F0TA 2OM2A 4GDFA 2VSXA 3FKSA 1CF4A 1J8MF 4NDZA 1Q1QA 1VIYA 4G5QA 5DH9A 3LD9A 1NY6A 2V1UA 1WB9A 2DFTA 4NCHA 2G3YA 4TMZA 4L5BA 1SVWA 4PTLA 4TL9A 4X8MA 2OXCA 3UKDA 1ZRHA 5DHFA 4E03A 4EUNA 1FTNA 2H1LA 3EAQA 4IDNA 2P3SA 4LBZA 2ZROA 4Q9KA 3QPUA 2O8BA 1HH4A 3NHBA 4Q01A 2ZJYA 5JFGA 3KUDA 4OHVA 3GLGE 2ORVA 3A8TA 1T0JB 1ZD1A 1ESNA 5HTKA 2D3WA 4LOAA 1SXJD 2YWHA 3OIUA 2KB0A 4V0KA 1OFHA 3LRPA 4HZUA 3RS2A 1S1CA 1OJLA 2Y8EA 4RZXA 1VKJA 4Q02A 1L2TA 521PA 1VDZA 5TDHA 3QG5A 4LHZA 3KX2A 1G3QA 1W49A 1QHGA 3N2IA 3UWKA 1NN3A 4ACAA 821PA 2GXUA 1T3LA 1T8TA 2EYUA 1JPNA 2AWOA 5J4HA 3PXGA 4CT5A 5L3RA 1K5DA 721PA 2O0JA 4QXAA 3AP1A 1U8YA 3P26A 2JCSA 2YVUA 4NCKA 3WRXC 2BEKA 3AGQA 2CE2X 2IHYA 2VO1A 3GLIA 5H1YA 1TQ2A 1GRNA 1TUIA 3G5UA 1G5TA 2BKUA 4HAZA 5JJIA 2ZR7A 1YZUA 4QOSA 4RFSB 4AIIA 1FP7A 2ZUCA 1YRAA 2JDID 2GF0A 1S3GA 2V9PA 3AQ4A 5KO2A 1EX6A 4EPVA 5AJXA 5J4VA 1DELA 5G53C 5JJKA 1ZUHA 4MKHA 3CRW1 2P6UA 4TYYA 2WMNB 1DPFA 5JWRA 5KNBA 2ZRAA 4QKQA 2WPDA 3D7MA 3IBYA 1R7RA 4B74A 3EPLA 4L9WA 4UXJA 5EJEA 5ELXA 2IBMA 2WJGA 4HDCA 4Q9LA 1U94A 1GNQA 4PC7A 2ZE6A 1JBKA 2MMCA 2ZQ5A 5BN3A 4POAA 2WIAA 3KJHA 4LJYA 2Q9AA 4BWYA 4M21A 1G4UR 2GJAA 4DSTA 4NE2A 2VP6A 4IDHA 3PCRB 4X8OA 1P2UA 2V4ZA 3HU1A 5M04A 2KBFA 3LH5A 4WW0A 1D6JA 4GFDA 2A5JA 1U2RA 4IVRA 3QENA 4HLUC 2F3TA 4MGYR 2OFOA 2YNMA 4QG7A 2VP0A 2QM7A 2B21A 2PX3A 3LXXA 1E9EA 4UJ5A 2IWHA 4DCNA 3CX8A 1R10A 4F38A 1XXHB 1YZKA 3I62A 1LS6A 2EFCB 1AIPA 4ZCMA 2IYZA 2OT3B 2WMOB 2J7KA 3L2OB 4LBYA 2EFDB 1IM2A 3SJAA 3LY5A 1E1QA 2E1RA 4TMWA 4LBVA 2C95A 1SXJE 3TVTA 3O8BA 4HATA 4A8JC 5JSZB 2V3CC 4M1SA 4X8HA 5H68A 5AUPB 1Z8FA 4YMSA 3PEYA 3CPJB 2PL3A 3M0EA 4BLSA 3PEVA 2R9VA 5DI3B 1LF0A 1G16A 3IUYA 3SYKA 4V0MA 2P5TB 4HDQB 1WDTA 1E2HA 2PJZA 2W6IA 5BYKA 3U6KA 5JECA 2F9MA 2FZLA 5J40A 5EUQB 1FMJA 1T5IA 4Q00A 4F93B 1G291 1SKYE 4YXWD 4BEJA 1E9RA 1QZXA 1VYTA 1GKYA 2CCJA 2O8EA 4LV8B 4DLZA 5IF9A 3JVUA 2XNDD 1CTQA 5FR1A 2FFBA 4URUR 1G7CA 3B78A 5LB2A 3VU9B 4ARZB 4ZI3A 1KI8A 1YHNA 1IQPA 3BXZA 4FN5A 5L3SB 3EPKA 4PHHA 5J47A 5TY0A 4ACBA 3FKQA 2CK3A 1U0HC 8OHMA 2OBNA 2IYRA 2OCPA 1BS1A 3BK7A 2JJ1D 1OXXK 4TTRA 5JSZA 3PUWA 5FFMA 1G7TA 4D81A 1G18A 1TEVA 2QQ0A 3CRQA 4QNRA 3FTQA 3SZRA 2P6NA 2QG6A 4AYWA 3IIJA 2WV9A 4HZIA 4MGZR 1Q44A 1W5SA 2G77B 2DYKA 3X2SA 4DCSA 4E22A 1DAKA 2HXYA 3TMKA 2A3RA 3PIRA 1OH8A 3K9HA 4JLBA 2QENA 5FI1B 3PV0A 3B1ZA 5AUQA 1SVSA 3H2YA 1KMQA 1UPTA 2ZEJA 2IA5A 4LX0A 3CNNA 4KXFB 1KI6B 5C1BA 2FFHA 4RD4A 4QHYA 2WIBA 1ZC3A 1SHKA 1G8FA 4MGIR 1JJVA 1KKMA 4OQXA 4B2PA 3FGNA 5JEEA 1W36B 4N3NA 2JJ8A 5L3SA 2BM0A 3CNOA 1R6BX 4B33A 3ND8A 2V6IA 3U60B 4EPXA 1KZ7B 4ERNA 4PX9A 2BJVA 3BBPA 2R6AA 4CIDA 2QGNA 4QGFA 5H8WA 5FOXA 1EFHA 1Q3TA 3ECCA 5FPTA 2HT6A 3THYB 2WWIA 2IXGA 3QOFA 1SULA 2FMXA 4FWIB 1GKUB 4DT1B 1QHHB 2H92A 4JT4A 1JJ7A 4K46A 2FSIA 3AVYA 4OK5A 2VL7A 2JEOA 2C9CA 4LRWA 4LJ9A 1SXJC 3FB4A 2IYSA 4UNPA 5JEDA 1XPUA 1GM5A 1NBMD 1CLUA 4FINA 5CK5A 4A0HA 3ADBA 3W34A 2QORA 3QUSA 4PHTA 3W90A 3P20A 3OIVA 4YQFA 1KI6A 1T6NA 1UDXA 2AD1A 4GOJA 2AX4A 421PA 3KFXA 3NBFA 2XB4A 4XTRA 1XD2B 3MD0A 2IWRA 1OHHD 2DWQA 2VIIA 1Q20A 3TRFA 3S1AB 2NO7A 1G9XA 1CR0A 1LTQA 3SBEA 1VCMA 1J70A 2ZS8A 4NCJA 3FHOA 4KODA 3QXJA 2F3RA 2JASA 3THYA 5G3YA 1OLOA 1UF9A 3AVXA 1M7BA 2RH5A 1W4AA 5FPHA 1RYFA 4W5JA 3HP1A 5LB4A 1QHHA 4DT1A 4KFUA 1KAOA 1G3RA 4U5XA 2P67A 2W2XA 4TYQA 3I8XA 5AUNB 3T34A 2FGKA 2GXAA 5J4LA 3ZZTA 1LFDB 1VG8A 1F2TA 4KJZA 1F48A 4PC1A 3EWSA 4BZPA 1FQKA 2A30A 3R9WA 2W0SA 3VQTA 1NLZA 1OXUA 4Q7LA 3WHKA 5P21A 5FOUA 1GNRA 3LQQA 1JR3A 2IS2A 3RVBA 1D2EA 2X8AA 5JRZA 1UKVY 2C9OA 4DDWA 1K6MA 2QE7A 4MKIA 2H7VA 4O0MA 3AM1A 2V7QD 2WWFA 4IXMA 2FA9A 1NMYA 1QDEA 3RWOA 2ZANA 4AY2A 2NGRA 3DOFA 3F5FA 1Z07A 4DCUA 3EG5A 4DLVA 5DYGA 3K0AA 2GK6A 4DLTA 1SVLA 3KKNA 4DLUA 1E79A 1SVMA 5JRJA 3R8FA 3AVTA 3CWZA 2QTHA 1XEFA 1DAFA 4LSGA 1Z22A 2ZYTX 3NDBB 2I3BA 1S1MA 3BH7A 5JCZA 1CJMA 4M9QA 1XTSA 2YWGA 1BYIA 3NBZC 5GVSA 4URYR 4B2IA 3VR5A 3T12A 2EFEB 4DUGD 2ONJA 5E3HA 3E2IA 2DPXA 4NCNA 1XFAA 3O8CA 2J7PA 4C2UA 1HURA 2QU8A 3PITA 2P6RA 3QXHA 3EXAA 3AF3A 4IEEA 1NBME 1ANKA 1NLFA 5C2JB 2ZETA 2ODWA 2J3EA 2ZS9A 3P27A 3K0SA 4CEHB 2C78A 3H0KA 1SZPA 2R44A 5FTMA 1CR1A 3O8DA 4TMVA 1N6KA 4MRNA 4URXR 4GP6A 3WP1B 1E2LA 2CNWD 2OUKA 4K81B 4MYCA 2QAGC 4MRPA 3UG6A 3LWNA 4PAOA 4BLQA 2HCBA 4RZ2A 1E2FA 3RLFA 3FMIA 2Q9CA 3AUYA 2JLZA 2A5FA 2IW3A 3GFPA 2REBA 2PX0A 5C46F 1AZTA 1NKSA 1IN8A 4QBFA 3HU2A 2BOVA 2UVQA 3W6OA 3AKEA 3L82B 1US8B 2JA1A 1IN7A 1VMAA 2ZRCA 4Q47A 1VCNA 5EE3A 3O8RA 3U7EB 2ZSAA 4M0LA 1D9ZA 4JMPA 4LPSA 2XOKD 1KDTA 4LC1A 1M7GA 1TQDA 3BJIC 4U02A 2FDCA 3WYFA 3KJIA 1NVWQ 3NC0C 1N5LA 2OZEA 4Z1MA 4ZDKA 3KTAB 2ATXA 1HV8A 2ERXA 3CM0A 2KWIA 3TH5A 4M4SA 2V6JA 4PZZA 3I4LA 3DKPA 2A9KA 4JBYA 1G8GA 1Q22A 2P65A 3IDQA 4Q4JA 2CLDX 4R2IA 2LKCA 3QVVA 5EZ6B 4YMTA 5J4KA 2XTMA 5CB8A 3ZS8A 2CEAA 3RRZA 3LAWA 1XZPA 5CDFE 5JS7A 2UZ3A 4F92B 4H1UA 1XEWY 2NO0A 2OCBA 2ECKA 4M1YA 3GLFB 3EZ2A 5AJYA 2JLXA 4A2WA 1YZLA 4R71A 3KQUA 2ZRNA 3A1SA 3A58B 3CLVA 1US8A 4M8NE 4CEJB 1TF5A 3GJ4A 5DYIA 4LC0A 2IF0A 5CYPA 2XITA 1Z3IX 2Q3HA 1II8B 2B6HA 2FEMA 1DTSA 4ITRC 4PSVA 4DSNA 3DHWC 2JLVA 1UJ2A 3J81k 3RABA 3LBIA 2VP2A 3X1WA 4XSHA 2VPPA 4CVNA 4TZ6A 1KK2A 2F1RA 2BCGY 3T06B 2WWHA 3K70B 4EPWA 1FTSA 3KTAA 4LYAA 4QGAA 3BRWD 4C0HA 2WKPA 1G7RA 1CBUA 3QBVA 3WNCA 4PAMA 4ASUD 3HJNA 1FX0A 4QGGA 2AN9A 4NP6A 5BW8A 2IXFA 2BIFA 4LPKA 4JLVA 2CHGA 1R8QA 4O3MA 4TT3D 1ZP6A 1J99A 4XVRA 3IEVA 2JAQA 1Q0UA 1ODFA 3AKDA 4R98A 5F3WB 3A1WA 1X86B 2ZPTX 3AVQA 3P4XA 5F98A 4GP7A 4D6PA 2LWIA 2KSQA 4S2EA 1WA5A 4D25A 4I99A 1P75A 4TMKA 2ANBA 3B13B 2XTZA 1P9RA 5KDLA 3GEEA 1Y3AA 3QXXA 2YOGA 4C0QC 4J0QA 3U7HB 4XTCS 1OKKA 3KQLA 2NO6A 1DS6A 1N6NA 1E0SA 2GCNA 5JLJA 1L4UA 1PZNA 4A15A 5EQTA 2HF8A 3ZVRA 4JL8A 2R2AA 2HUPA 1LNZA 4OQNA 5EE0A 2ZSBA 1KOFA 4ZCLA 2OFXA 4DDVA 2PT5A 2IXEA 1KO1A 2FOLA 3QF7A 3KZ1E 1D8TA 1SHZA 5BYJA 4FCVA 3IO5A 4NPHA 1W4RA 3VNVA 2BMEA 5E7JA 4KVGA 3PQCA 3KB2A 5FUYA 2VHQA 4NH0A 1COWD 4FCWA 3K1JA 3FFAA 3VR6A 2VH5R 1KJZA 1T3HA 1GTVA 3U2QA 4DXAA 4Q1CA 4A4DA 3FWYA 1HEIA 1AN0A 2D7DA 3ICEA 4C7OB 4KSCA 3K0CA 3U61B 3C8UA 1G8HA 4NCIA 2PCLA 3HYRA 2C5LA 4TSFD 1QG2A 1XTRA 2OILA 1E2JA 1W0KA 4LHVA 2QRNA 5D3MA 1G5RA 2GK7A 1S96A 1KDOA 1R0XA 5FOSA 3ZD6A 2AK3A 4V0NA 2Z0MA 2VHUA 4CT4B 3VKGA 4US0R 2HF9A 2PLRA 3WBJA 1VPLA 5FH9A 2ODBA 2F7SA 4P4SB 2ZI6A 4P0TA 3Q85A 4Q1BA 4ZI2A 5IDVA 3SQXA 1YKSA 2VHTA 3U4QA 4UXIA 1U8AA 5HCIA 4L16A 1I4TD 1EFCA 2A5YB 2QPTA 4QFMA 3TAUA 3OE7A 1NN5A 1ZNXA 4HB4A 2G1JA 1ZC4A 1BMFD 3PJRA 1RRPA 2OLKA 2ZYVX 2QSYA 2W6JA 3CF0A 4PPGA 3LO5A 3D3QA 5FR2A 1U81A 3KQNA 2GZAA 2C98A 3OFNA 2CMKA 4OK3A 3A1TA 1KMHB 2K5UA 5JI2E 3VR2A 5KPDA 4X8LA 1NG1A 3OF5A 3ZVNA 4ESVA 3K9NA 2RKOA 2ZJ8A 4JVNA 1CRQA 1GWNA 3K9GA 2GRJA 4IHQA 4M9ZA 1R8SA 4AI6A 4B35A 3SEAA 4Q1FA 4P4SA 221PA 1XMJA 2PCJA 4HUQB 3FKSD 1E9AA 1V5WA 2F43B 2O5VA 3JZAA 4LJAA 1E98A 4OJQA 4QHSA 2QAJA 3EA0A 4EJSB 3SHWA 1AZSC 1N0VC 3MSXA 5C4GB 1XCPA 3B7GA 1S4QA 4MH0R 5EP3A 3BFKA 4JVLA 4D4JA 4ZDJA 1PLLA 4OQLA 1OH6A 4GZMA 2IC5A 2ZJBA 5HZKA 3OAAA 4Q4AB 1HYQA 4I1OA 4LYJA 1F2UB 1ZM3A 4TLAA 3THXB 3SFZA 3VKWA 4P3YA 1DAEA 2JJ2A 3TQCA 1FUUA 4DEXA 1XPOA 1KMHA 4LK2A 1XU4A 3RWMB 1SVKA 2QUZA 1TAGA 1AK2A 4P4TA 5BN5A 4EKDA 1D9XA 1H8EA 1YJ5A 4AKIA 4DWJA 3U6BA 2ZIAA 3T35A 4DJTA 4HUQA 3IKJA 2F43A 2CHQA 3QQ5A 4EJSA 3B82A 2OG2A 4JIMA 3RNLA 2FFQA 4E09A 1A5TA 2Q3FA 2O8BB 3UPUA 3AH8A 1M8PA 4HAWA 4JS0A 1A7JA 2A7QA 1UDWA 2DFNA 4U7DA 4B6FA 1QHXA 1FFHA 4LHXA 1TX4B 4WIAA 4Q4AA 2DWPA 2TMKA 2XAUA 2ZI3A 3Q7QA 4G5OA 4GNKA 5ANRB 3C4JA 3VMFA 2GWHA 2IYUA 2ZUBA 4KITB 4HZUB 2F6RA 4EIWA 3LFUA 4HLUA 2WWYA 1XTIA 1P62B 1R4AA 2AHOA 1IOZA 1BO6A 4KV9A 1OXVA 3TIFA 1NSTA 5KSYA 1WMSA 3TUJC 2FJUA 1MOZA 3CO5A 1DO2A 4JYBA 4PC3A 3I92A 1OYWA 4LJ8A 1Z28A 1TF7A 1TL7C 1VG9B 5BXQC 1X8KA 2J0UA 3X1YA 3GJ0A 3QJYA 1YR9A 4JLDA 4HAXA 1VYUA 2GJSA 5EUMA 4O2RA 1G6HA 1NP6A 2QQEA 5EP1A 3P4YA 3AUXA 3BH6A 2WPDD 1E1RA 4KYIB 4A8JA 3GLIB 1Q12A 4IRUB 4JJZA 3FDIA 3QBTA 3GJ7A 4GZLA 2J0VA 2BBTA 3ADCA 1NRJB 4YDSA 1D2NA 3CX7A 2ZRDA 1E2DA 1OH7A 3TQFA 3T1OA 1TQ4A 1PVOA 2GBLC 1G8PA 3GJ8A 2ZVQX 1ONBA 1E96A 1LV7A 1R2QA 4QRHA 1GL9B 2FN4A 5CJ2A 2OBLA 2EWWA 5FL3A 3Q8XB 4F7WA 3KXKA 3MCAA 3NXSA 3PENA 1P2VA 2XJ4A 1CULC 2JATA 4TQAA 4D4MA 2O8CB 1GITA 3JVVA 5TXGA 4MITA 4IW3B 2XEXA 2JLQA 1JNYA 4D4LA 5FPSA 3L43A 2IHBA 2AWNA 2ZRIA 4XJXA 2C8VA 1YR6A 2ZR0A 1RW4A 1DG1G 2R6CA 4FXPA 1J90A 4ZO4A 4C0AC 1EFRD 5KYKA 2ZU6A 1A2KC 3KJGA 2I1VB 2IEYA 2C03A 2RGNC 1NJFA 2AXNA 2X1VA 4RD1A 4F4IA 1AA9A 1E69A 3KJEA 1JALA 5EE1A 2D4HA 3ZZ0A 5TVKA 1CJKC 4Q7MB 2GTPA 2VBCA 1DAIA 3NH9A 3AP2A 1L7VC 2WKQA 4Q48A 2D06A 1SXJB 2WKRA 1Z6AA 2WAYA 3MG9A 3I5YA 1H8HA 5FL7D 4RVCA 3GFTA 1S0UA 5LDDC 4XD7A 4LYFA 1N0UA 2ANCA 1KY3A 1KJWA 4LDJA 1KIMA 2QZ4A 4B44A 2O8CA 4QM6A 4HLDA 1RIFA 1TEXA 1Z2CA 4HLCA 1G21E 3BWDD 1G3IA 1U0LA 2QA5A 1HT1E 5CM9C 3RAPR 4DVGA 3WYGA 1SKYB 1N5KA 3FE2A 5A5GA 1CS4C 5JHGB 2JLUA 2ODNA 4OHXA 4UJ3A 4LV6A 1DAMA 3REFA 2E9SA 3E70C 4KLZA 4B6EA 2AXPA 4BLOA 2ZRMA 1XZQA 4C0SA 4W7SA 1AS0A 2QMHA 2ZI9A 5KU1A 3GFOA 3FHTA 3EW9A 2NO1A 3E5HA 4IDPA 3KDSE 4QBGB 5FBQB 1G7SA 1OE0A 5FTLA 1Z83A 1WXQA 1KJYA 5BQ5A 2O8EB 2NQ2C 2QTVB 1SXJA 3EPJA 4RCYA 3GLHB 1G8YA 4CDGA 2NZ8A 1MRNA 1NVVQ 1SQ5A 2YJTD 4TZ0A 1JPJA 5FPKA 3BB3A 4MYTA 4TLEA 1XCGB 2C04A 1ZYUA 2CDNA 3UXMA 3W8RA 4MGKR 4QNMA 2WJJA 4UKDA 1RC8A 4GL2A 3QSYA 1G41A 3D8BA 1M2OB 3C41J 4L4UA 1QVRA 3EZ6A 2KE5A 3RRMA 1UADA 3QY0A 3A37A 3IPXA 2W2TA 2ASEA 3A4MA 2GXSA 2J41A 1MT0A 3VX3A 5FTJA 5IK2A 2UKDA 1TADA 3C15C 2RGAA 4DLXA 4G5SA 3VKHA 3CR7A 3T5DA 2HYDA 2VP9A 1KDRA 4O25A 4Q4HB 3CPEA 1TPZA 3KKMA 1XTJA 2AL7A 3GLHA 1LS1A 3M1IA 2EFGA 2GZHA 1KNXA 3NIBA 5EP4A 2R6GA 4L9SA 4AD8A 4OJKA 4LV5B 5C18A 2R6DA 3TW4A 4A9AA 2ZITA 4KVAA 1YR7A 4HAVA 1HE1C 1BH2A 1XF9A 2ZJ2A 4JBWA 3IIMA 4RKEA 2BM1A 2VA8A 4A92A 3MAAC 1IONA 4IJMA 1IY2A 1N6IA 2Q9BA 3DM5A 1EFUA 4MQBA 3I72A 1DG3A 4F91B 1W36D 3C14C 5DLQC 3RS7A 2QBYA 3GJ5A 4C2TA 2EVWX 2D74A 3GMTA 4JLMA 4BFYA 3VR3A 4DRZA 4EFLA 1WBDA 1XP8A 1KSJA 1L8QA 1GIAA 3B1XA 2QNRA 5HE8A 2JLRA 3EIHA 3MRSA 3SJBA 4BECA 4HAYA 4Q4HA 2P0EA 2QAGB 5J5CA 1XXHE 2BBSA 2IUTA 3Q72A 3B9QA 4OHZA 1FNMA 3PEWA 3LVQE 2QT0A 2V8OA 2P2LA 3QI2A 4LHYA 1NN0A 4HI0E 5SZJA 2JLWA 4BFVA 3CWQA 4H1VA 1E0JA 3WNDA 4XH9B 3CONA 1KO7A 2QEQA 2R8RA 2MSEB 3R7WA 3AKYA 1T4GA 1FQJA 5FBWB 3CX6A 2C2HA 3MWLA 1XB2A 3ONWA 1DVRA 2RCNA 3A6PC 5GADl 4M22A 1QBKC 2CCGA 2CHVA 2HYIC 3ZGXA 3ADDA 4PAQA 2N42A 2D62A 2ZSFA 5AUOB 1YZGA 4NMMA 2HLDD 4YC7A 1JECA 4C30A 4EPTA 2ODEA 2CVHA 1JB1A 1N6PA 3ASZA 2RHDA 4PQYA 3I32A 2GJKA 2NZJA 4BE7B 4C4PA 1II9A 1ZNZA 2PMDA 3L8ZA 1F2TB 2OE2A 4IVQA 4YMWA 1LB1B 2LCFA 3B85A 2EWVA 2GHIA 2DFKB 3W3AA 2QAGA 2BMJA 4YXWA 3Q3JB 5DN6A 4Q7KA 4MUAA 3UMFA 1M7HA 3TR5A 5AK0A 1XD8A 2OBMA 4LGMA 1KSFX 1PLKA 1T8UA 2XNDA 2XZLA 4OYHA 3CB4A 1AJEA 2J45A 3NEYA 2IX3A 2A5DA 1AQYA 3TK1A 1YZQA 1P6XA 3GJXC 2ZI4A 2RGDA 4JLNA 1JEEA 2IEZA 1DE0A 3K0AB 4FI3C 1MO5A 2H16A 2WZQA 2JJ1A 2RAPA 3ZQ6A 2XSZD 3AVOA 2WWGA 1ZCAA 1GG2A 1Z0IA 3QEOA 2W2VA 1S3SA 1XJCA 2GEDA 2YWEA 1Z08A 3A1UA 3IHWA 3VR4A 3ZH9B 4MKGA 4Y0VA 2A2ZA 3CH5A 4PC2A 2X19A 5KNDA 5FBVB 3TUIC 1XPRA 3BIFA 3X1XA 4TN1A 1OFUX 1ZJ6A 2ZJZA 5TB5A 2ZE8A 4QC2A 1P5ZB 4HUTA 3P32A 2G1KA 3OHMA 2IYXA 2XX3A 3RSOA 3IEUA 6Q21A 5EXSA 4MYHA 1G3MA 2N46A 4JLOA 4JT2A 2HJVA 4RFVA 1Z0KA 3MWJA 3TW8B 3QPWA 2REXB 1X1RA 3MGCA 3SYNA 2QSZA 2VQSA 4IEIA 3VAAA 4BFWA 4MKFA 1YQTA 1OF1A 2VF7A 4A82A 1D5CA 4ON9A 2WICA 1ZD9A 4JL5A 1XDBA 2RB4A 3CZQA 3HPQA 1XCMA 1PLJA 2GAAA 1CRPA 2Q6TA 1W47A 4DSUA 5LPNA 3K8YA 5JBQA 1CR4A 3NHAA 1YZTA 2IYVA 2KI5A 4FD2A 4R7ZA 1CR2A 2GEVA 1RRFA 4ESHA 3I5XA 4LI0A 3GQBA 1NBMA 1XTQA 3K09C 3NEJA 3R8CA 4G3XA 1FZQA 4D0LB 4UXHA 5E7MA 3CZPA 1F3OA 5CYOA 1P9NA 1G6OA 1N6RA 1O87A 2HXSA 1MRSA 1VIAA 3I8SA 1P60A 4WA7A 1N25A 1EFTA 3OEED 2VHJA 2YINC 1U9IA 5KHOC 3NTUA 4JVSB 3ZD7A 3RS0A 3ZZUA 4DIDA 2XJ9A 1GKIA 3TAHA 2KJQA 1OB5A 2OSBA 2ZRKA 4Q4JB 4Q03A 5GJBA 2HDNB 1ZUIA 3THOA 4NL4H 2X2EA 4C0JA 2Q21A 3RC3A 5LD2B 2IYYA 3FMOB 1MR3F 2ZI7A 5KDOA 1W5TA 2IYWA 2ZYUX 1SVOA 1KI7A 4BRWA 3KKQA 3REGA 1G1MA 4LHWA 2BDTA 5DISB 3VFDA 4A2PA 2WSSD 3P1JA 4JZKA 2QP4A 1VCIA 3DZDA 1C1YA 1Z29A 3W6PA 1QHSA 1P2TA 3RRYA 2RGGA 2RGEA 4OQMA 4C0BA 3V00A 1Y63A 3NBYC 1MO3A 3EPHA 5CDFA 2GESA 3DVLA 4W9MC 1W36C 3LV8A 1R5OA 1WF3A 2WSMA 4Q4LA 2WM9B 1FX0B 1U90A 2ZRJA 3A4NA 1HQYE 2ZTSA 5DSZA 1M1YE 1GDDA 4CYMA 4BFXA 4BEBA 2GZDA 2NO9A 5EXPA 2F1HA 3QIAA 2EYQA 2ZAMA 4DEYA 3K70D 2W83A 1M6NA 1QVAA 4FIDA 4RCZA 3C5HA 1OSNA 2QROA 4AYXA 3KQKA 1NF3A 1RE0A 3DMNA 3Q9LA 1AQUA 1KYIA 4I1SA 4DCTA 4JLKA 5SZKB 1R0ZA 2VYFA 5AWFC 1GAJA 2YC2C 3HYTA 1VCOA 2NPIA 3VHXA 2WBLC 4FMCB 4A0RA 3ADKA 2YV5A 4A6PA 4JVMA 3WP0A 4B73A 1RRGA 3Q5EA 5IT5A 5JCPA 2DBYA 4HB3A 2UZIR 1IJEA 3FHCB 3NG1A 3SBDA 4OI4A 3QVUA 3SHFA 2Z43A 2QP9X 4E5UA 1LF5A 4NBSA 1RRCA 2DB3A 3JZMA 1W0JD 2YC4C 4B43A 1XMIA 4D26A 2IYLD 1KGDA 3CIOA 3CKLA 1WCV1 3T5GA 5FOVA 2CNWA 4CGZA 1YZNA 4M2LA 3SR0A 4IXNA 4WZ6A 2A5GA 2BKEA 5A0FA 2D7CA 2J9RA 2HEIA 2QRZA 4B3XA 3BS4A 4XOIA 1IHUA 3WBKA 4S35A 2Z4RA 4PZYA 2IL1A 2BV3A 5FI0B 4B75A 2IS6A 4M1WA 1KZGB 1S2MA 4BPBA 3V4RA 3QNUA 2ZSDA 4XIGS 1W44A 1W2HA 1ZAKA 1TU3A 1KI4A 5IRCD 1QHYA 1Z0FA 5FOTA 3OE7D 2PMKA 3B1YA 5A4JA 3DO6A 4NYJQ 5D3MB 5EZ5A 5DNYB 1ZW6A 1WQ1R 4YMVA 4FCTA 1Q21A 1NJGA 3LW7A 3AGPA 4TTPA 4C9BA 3EX7C 3ZIAA 3DKVA 4MUBA 4EFNA 1EWQA 3BD9A 3FMPB 1IXZA 1JQLB 1M34E 3KKOA 4LJ7A 4HB0A 1OH5A 1X8JA 2ZSEA 4M9XA 2VSFA 3HDTA 4DB2A 3KQHA 2GNOA 3ZYCA 3U4QB 5KOYA 4FWTA 2V1XA 2WJVA 2Q0HA 3GP8A 4WAUA 3KXIA 3NDPA 1CJUC 3ZVMA 2GAOA 3SDZA 2O8FA 5CLQA 2NPFA 2ERYA 3GLFE 4M1KA 4WXPA 3OESA 4A2QA 2OEPA 4Q9IA 4V02A 2F9LA 1FPMA 3TE6A 3AB3A 1X1SA 2CJWA 1KI1A 2P5SA 4L15A 3WYAA 4B34A 3T1QA 3LBHA 4PO9A 1LW7A 1OYYA 2AKYA 4R9UC 5KTYA 1RPZA 1NVVR 4QHTA 3NC1C 2CL6X 1Z2AA 1L4YA 2Z6VA 3LX5A 1HE8B 2BCJQ 3OAAD 4KSBA 4PHGA 5E4FA 1QRAA 3BERA 3FMFA 4CF7A 1ZD8A 4OHWA 4BZQA 2C9YA 2CBZA 4PXAA 3C7KA 3OEHD 2EFHB 4KBFA 1K8RA 2B8WA 3RS4A 4OI2A 3MWKA 5EE9A 4NKRA 3W3ZB 1QG4A 4PSKA 4RZ3A 5AR1A 1N6LA 3SJCA 4E07A 4ASUA 4B71A 3AVUA 1RVDA 2IT1A 5G3ZA 3VHLB 3VX4A 1H8ED 2OCYC 4F4JA 4TT3A 1Z63A 4C0KA 4EFMA 1IY0A 2ZYWX 1GILA 1Q1EA 2FH5B 4YMUA 4V0LA 1IAQA 2XB2A 1JAIA 1WBBA 4BFUA 2LKDA 1O3YA 1RZ3A 2GF9A 4Q18A 2ZJ5A 4NHOA 1NVXQ 4CRWB 4NU0A 1IJFA 1NMZA 1SVIA 5EXTA 621PA 2R65A 5FUVA 1FW6A 3MUFA 2BMFA 1ZVQA 1E99A 1XMVA 2FSFA 2FSGA 4Q19A 3DEFA 3SC3A 2NTYC 4EPYA 5HKKD 1VHLA 4NYIQ 5GVRA 4OBEA 3KFVA 4IOKA 2O8DA 3QPVA 1VHTA 3RSLA 2FGJA 1GP2A 3EZ7A 2ZUDA 1KNQA 3LXRA 4KFTA 3ZLJA 2WJHA 1W2GA 2B8TA 1AS2A 1UEIA 2FNAA 2ORWA 4RD2A 1E9BA 2H17A 2ZRFA 2J0SA 1AGRA 1IN5A 1H65A 4LUCA 5KDDA 4XVQA 4XSGA 5JS8A 2RGNA 3F8TA 2MMGA 3TSWA 1DAHA 3U7GA 1RKBA 2AKAB 1VG0B 4PQFA 5JHHB 4JKYA 1IBRA 1YU9A 4JLAA 2GCOB 1E1RD 1MV5A 4A0FA 2GKSA 4PHFA 5CK4A 1TMKA 3C16C 4CEJA 3R9XA 3U3JA 2PH1A 1ETUA 2FF7A 3IBGA 2VLIA 5LBIA 2IUSA 3GLGB 2BHRA 3X1ZA 3V9PA 3CW2A 2J0UB 1HUQA 2J87A 5UKDA 2BJWA 3L0SA 2QY9A 1TU4A 4WBSA 4PPFA 3TSOA 1OIVA 1EXMA 3SOPA 4DB4A 1AS3A 1OFIA 1S8FA 1T5LA 2YOHA 2YYZA 5JI3E 1Q57A 2EU8A 2OHFA 3BFXA 3QG1A 4WZAE 1OXTA 1ZU5A 1XEXA 3B1WA 3AEZA 4A8JB 5FOWA 1E2NA 2HJGA 4JJKA 1GRQA 1MO4A 2XXAB 2H57A 2YOFA 1ESMA 3GEHA 3TUZC 5JMTA 3H1TA 1AM4D 1GL7A 2FFAA 1BMFA 3SI7A 4C0LA 5B64A 1E9DA 3MFYA 4TL7A 1FNNA 1F60A 1AKEA 4A0GA 2GCOA 2QPOA 5IHPA 3N70A 1XJQA 1QHIA 4IOJA 3AP3A
chains in the Genus database with same CATH superfamily
3MRTA 4UMFA 3RSHA 2C1ZA 3M1YA 2GBIA 4XD7D 1OWNA 4URZR 5IN5A 1BWPA 4XVCA 1LI4A 1CU1A 1Z16A 5JC1A 5EVEA 3QU5A 3W5VA 1WKBA 2GJ9A 3QMMA 4GBMA 1XBTA 3FF1A 3FJYA 4FQ8A 4CFSA 3PQ7A 5HRUA 3BFVA 3TNJA 3R20A 3D1VA 2ZB8A 4O08A 4HX9A 4LF6B 5EIWA 3UK6A 1PJCA 1WW3A 4AAYA 1WR8A 2FN9A 4MJ3A 1OZ0A 2EGHA 1RLTA 4RL4A 2DJIA 1J0EA 1WVMA 1E4VA 4P4UA 1H4TA 3UB5P 2VRCA 2VDRB 5CDHA 1NURA 1CY6A 1RM0A 4ZT4A 4XASA 3HWSA 3LCUA 4NH4A 1RHUA 4M53A 3HS3A 1GTSA 4YJ3B 3MTJA 2WZBA 3PQ2A 5JY6A 4BLPA 3IL2A 4ETZA 3VJRA 2CXQA 1FUKA 1JLMA 1RLMA 3QXSA 4CU2A 5CR9A 4NYMQ 5JARA 2A92A 1HTWA 2H7YA 4FGWA 1SRQA 1YL5A 2WHPA 2IHUA 2HR1A 4ZIRA 1FRNA 2ZRPA 4EW6A 4TTVA 2C00A 2ZVJA 4I9FA 4IHKA 4KRFA 2IS1A 3G2PA 2F1IA 2PNFA 3ZHSA 2FWBA 3L4KA 2IXAA 2ZREA 3ZDQA 4DHEA 1L5HB 2I6XA 2PNJA 2IV2X 1GPH1 1JSRA 4ZBEA 1HE5A 1ZIDA 3BMOB 1QGDA 3UANA 4F6RA 1ZMXA 4X97A 4ME6A 4LZAA 3W6NA 2AZDA 4M7OA 4IQGA 4WWHA 4D43A 3O1HB 3CBGA 5FD8A 4QTUB 2BM8A 1LPPA 4D44A 3FC7A 3UC9A 1W48A 1IU9A 2IHJA 3TF5A 5ES3A 1K97A 5ADVA 4QBHA 1FMTA 3IBJA 1SXPA 2ZWAA 4DV1B 4DVJA 2FG6C 4P7KA 5DEOA 4K1XA 4AZTA 4KHZA 1RQGA 1MWUA 4UHUA 1NY5A 4NBRA 1OGJA 1ADBA 4CCYA 2UYYA 4NZYA 1KBOA 1G9TA 5IW8A 5C0OE 1HRKA 4LISA 1RRVA 1BGVA 1Z2NX 3WB1A 4BO6A 3RF7A 2HT1A 4REOA 2I4OA 4LDNA 1V1MB 2ZVDA 3PSAA 1ETHA 1F8FA 2OPBA 3ADOA 1TMYA 4GOKA 1HT2E 4OI0A 1IXKA 2FPOA 2HUNA 4GRAA 3DV0B 1R0YA 4KZBA 1R37A 2FX3A 2JB9A 3CF6R 4KB5A 3U13A 3DHVA 4IVPA 3WL8A 4PR3A 1MX3A 1G59A 4WEJA 3SR4A 2C94A 5COAA 5IMBA 3S22A 4P36A 3AGEA 4IIFA 1TTTA 1XQVA 5DLDA 2H6EA 4QBIA 3HLEA 4ZOLF 4E33A 3HO6A 3H9CA 2BSXA 2OFFA 3DL2A 2PGJA 1XA7A 5K9ZA 2FZ4A 4OHPA 4AO8A 1Y9AA 1X39A 3WDKA 2B4QA 3LVFO 1LSXA 4I4CA 4UQIM 3HFRA 3I2KA 2V7QA 4KR2A 1TDGA 5F21A 2B7CA 2NAPA 5MN4A 5CVTA 5E9AA 1DJCA 3D6JA 2HJRA 4KLCA 1K56A 1KMCA 2GZ2A 3BD6A 4E3LA 5CLFA 3MQ0A 2HN9A 3WRYC 1GZ4A 2QLTA 3VR6D 5JCJD 2RB5A 4EHBA 4UEKA 3ICQB 1L0GA 5TGTA 3U5TA 1ZM4A 3MOSA 1JFTA 3EVBA 3FN4A 4P7GA 5FF9A 3UG7A 4KENB 3P97A 3GEIA 1FBTA 1NF9A 3ZU5A 1XTVA 2B18A 1S5PA 4YRLA 1LLBA 1IH8A 5GIOE 2Q5EA 4MV9A 5AVYA 4AP9A 2AUTA 2X76A 2CLIB 3UKJA 7AT1A 4UCFA 4P32A 4B4DA 1CNEA 2INWA 2BELA 5I9MA 3K5IA 2WU8A 3E1GA 2D0OB 3FFTA 1UBRS 3DBRB 5JG7A 3QV1A 1JG3A 2G28A 3QFRA 2FUEA 5C7YA 4AKGA 4XWAA 4FHGA 2ZRGA 4LRYA 1BFKA 3S7TA 4R0NA 4CMCA 2J1LA 1KSGA 5EM0A 5LCXA 2B4YA 5E95A 2AR9A 2O0HA 2ZTVA 3B5JA 3TG9A 1AB5A 5EUCA 4RBNA 3EGDB 2VJDA 3IQWA 1F6BA 5KVAA 3P8ZA 1ZNWA 1L7NA 2BZSA 3D6UA 3KDAA 3NOXA 5KYWB 4OCZA 4I9HA 5BWNA 1R8XA 1PZFA 4B6RA 3QE9Y 4EUSA 3BXFA 1HGXA 3BHJA 3VFHA 3V2UA 4Y2GA 5AESA 4NG2A 3N8IA 4DCCA 3SVTA 5AJWA 1LY1A 4U4AA 3E7XA 5H3HA 1IBLB 5DGXA 4D9CA 1Y1PA 3CLUC 4PLWA 4TSFA 1HY3A 4TV8A 2CXSA 4REMA 2VWPA 3BJNA 1T5BA 3KYIB 2G4LA 3T4QA 4WOCA 2DY0A 3GX1A 1ES9A 3N53A 2DHQA 3G8YA 2LV8A 3PL1A 3WKEA 3Q3CA 4H18A 5E2IA 1G1AA 4K9NA 2RGRA 4IJUA 4DA7A 3ZY2A 1SCBA 3E9YA 3SFVA 3ABZA 3TPFA 2ET6A 4N92A 4C3ZA 1A9ZA 2VSXA 4U7JA 3WGGA 4J4BA 3DLPX 4TMZA 1SVWA 1TS8A 4TL9A 1TK3A 1VQ1A 5DTQA 2WUWE 1KHHA 3FETA 2IUEA 3EZLA 3LIAA 4PV7A 3L9KA 3WS5A 1PSDA 4NJEA 4XQ9A 4ZREA 4GU5A 1C1DA 2Y8EA 1DC6A 1JQEA 4EBBA 1PL0A 2QX9A 5EJMA 1G3QA 1DP4A 1T3LA 3OURA 1D6NA 3KVOA 2YIMA 1PFKA 3O4RA 3AHJA 2P5YA 1NRJA 2JNWA 1O9HA 1Q2XA 5KO2A 4X24A 5ALZA 4L9GA 3RRJA 5EJEA 1IYOA 3Q15C 4WACA 5TPZA 1BTLA 5EIOA 2MMCA 2WIAA 4X8OA 4WW0A 4EYSA 2VV7A 3DP9A 2YNMA 1OV6A 4PXSA 3PEEA 3SZUA 3L2OB 5I9SA 4ZHQA 1EZZA 2R7NA 3STUA 1WOMA 1PAUA 3DDOA 2I65A 3GLVA 4V0MA 1P2BA 3BWMA 3ZHHA 3PICA 3NVKI 4CU5A 3V5NA 5CX1A 3FYCA 1BXZA 3AG6A 4V0RA 3RF6A 4JEUA 3W1WA 2Z2LB 2BI4A 2OBNA 4XGRA 2C7QA 1B6SA 2HGVA 1OJ7A 2JEYA 4LGYA 2PS3A 4R2JA 5AUQA 1KMQA 2IA5A 2HRZA 4QYSA 3I64A 2PJDA 4XGKA 2WIBA 5IC4A 4D02A 4EBLA 1Y1RA 1NBHA 6REQB 5L3SA 5EKUA 1NW7A 4PX9A 3K2NA 3CH6A 2Q1TA 2QGNA 1SULA 1W88B 2H92A 1E8MA 2WQ6A 3K30A 2WM2A 4FINA 1U3FA 2WJ4A 4QYXA 3N7UA 3O4JA 1RACA 1A72A 2WILA 2LR0A 4XTRA 5A6SB 1DJNA 1OHHD 3HJRA 1LTQA 5FA8A 5BSMA 3MHTA 1GQQA 3FHOA 3AVXA 2RH5A 3R3VA 3VYRB 1JHYA 3LHFA 1WCYA 4W7IA 1NRIA 3VQTA 3QYFA 5TQJA 1A2OA 5JTTA 5JRZA 1K6MA 1O97D 4NCAA 4X3CA 4TS9A 4AJ2A 5B4VA 1CERA 3PNLA 1PNVA 3AVTA 3R5HA 4NECA 1HLGA 3GGGA 3U39A 2NXJA 3ILYA 3K35A 3WLPA 3DEYX 1ECGA 3A9SA 4KYTA 3BULA 1E1NA 4DUGD 4MROA 1ZO8A 3PRHA 2J7PA 2ZJ1A 4Q3OA 1O95D 2P6RA 1I3KA 1C8KA 5D5PA 3JPYA 4QUBA 4OSEA 2OB2A 5C1PA 1QS0B 1GG5A 2ZWIA 3C1OA 3LBFA 1KP3A 1IN7A 1QVWA 4MZXA 1D9ZA 2C58A 1NVWQ 3JRXA 4DQXA 5ILOA 3MLBA 1W30A 4JK3A 2IBTA 5ESDA 3NIGB 1LFAA 2ATCA 1RTTA 3FZQA 1GGJA 3ZNQA 1XEWY 2IV7A 4KPUA 4DBZA 4MV4A 2JKZA 1YZLA 4RJJA 4CMIB 5ALQA 5E2GA 3L0CA 1GDHA 1T10A 4Y2YA 4DSNA 5BWCA 3RK4A 4ER6A 5KC8A 3DLCA 3D0KA 1CUFA 2FPSA 3FWZA 4LPKA 4DPLA 3EXEA 1Q0UA 2PX6A 1GG9A 3WTCA 1E5TA 4YXFA 4GP7A 4OH1A 5JUWA 4ZAYA 4F1JA 4I99A 2PGNA 2ANBA 2ZATA 4R1GA 5AVVA 4CT0A 2XTZA 5E0OA 4DIOA 5KDLA 1OTBA 4KOAA 1IHXA 5H9WA 1XAHA 4A15A 2HF8A 2R2AA 1CB7A 1RQ2A 1ST2A 3OG9A 4BMDA 1NSYA 4MS1B 4NPHA 5E7JA 4MW1A 5EIBD 4DY4A 4I3IA 3O38A 5CT9A 1GTVA 3RU2A 2J4DA 2ZQCA 2ERCA 1FS5A 4KSCA 4HH1A 2OILA 2B25A 3NIAA 3JQQA 4IV8A 1RMYA 1YVPA 5L2FA 4FSDA 3W5DA 4X6XA 2IGTA 3U4QA 3SMQA 1RR6A 5LDHA 3HXQA 1NUAA 1Y4DE 2XGOA 3V34A 3TZBA 3PFCA 3LO5A 4DDYA 1FCJA 5EINA 3BMQB 1P2FA 2K5UA 4YJFA 3OF5A 4JVNA 4IHQA 3PTZA 2GTIA 1EAYA 3VTZA 4DXHA 2HJEA 4EJSB 3N8RA 1JL3A 3QELA 3WAGA 3F3MA 2V20A 1SBNE 2ZBRA 3AR4A 3IVCA 4LRQA 4DEXA 3GB9A 4IS3A 4IJVA 2YRWA 3KEOA 1G0OA 1G2PA 1FDVA 3C43A 4WV3A 1BFUA 4XT2A 3SWWA 2D1RA 4HRXA 2QDXA 4HUQA 3O1IC 4EW1A 4B9EA 4JIMA 3SH8A 4J07A 3CEAA 1I7LA 4UHFA 4WIAA 1LXCA 3EQVA 3B12A 4WNIA 3UOGA 4D79A 2BFAA 3WV5A 5A9SB 4JX8A 1UOOA 3EVCA 4KV9A 1DOHA 1CC1S 3I92A 5DGHA 1Z28A 3TMYA 1DOZA 3E2MA 3X1YA 5CXQA 3MBKA 1G6HA 2I6SA 2WPDD 4P7BA 1MBZA 4UVIA 2BBTA 3JYHA 4UBLA 4N5LA 2JK0A 1ONBA 1GL9B 2AIRA 2OBLA 2EWWA 4B7ZA 1VA4A 4MITA 2FRVA 4HEA1 5KQGA 3W78A 2CVOA 2C03A 2Q7OE 2RGNC 3H5RA 2B8NA 2P9FA 1Y98A 1D1SA 4CLCB 1BWRA 1V4BA 1BGXT 4RIIA 1B6GA 2XYVA 1C4WA 1L1FA 2NACA 3VU3A 4KQWA 4HLDA 4BV9A 5GPBA 3V7WA 1QNLA 5DBIA 5JXHA 5AIAA 3TRDA 1Q0QA 4DM3A 1QV9A 2QSUA 2PSHA 3L79A 3BQAA 2FUCA 3EW9A 3T9CA 2YWCA 3KDSE 4OX9Y 2QRGA 2HSGA 2AVXA 3B3GA 2NQ2C 2AJDA 3FBWA 2DCMA 1Q0ZA 2NZ8A 4BJ6A 2XA7M 1PGQA 2CDNA 3Q5GA 2RI1A 2QTAA 1NQWA 1VL2A 3EZ6A 1TYAE 3RBVA 4UDXX 4EATA 2WP0A 5HM6A 3VX3A 3NZEA 2UVDA 3FOFC 3EYWA 3ZD8A 3C0KA 1DFIA 2QT9A 5DU2A 4J3FA 3IWOA 4DM4A 1I36A 1O8CA 2PGAA 5LMCA 5F3DA 3TOZA 3M89A 3ORQA 1W73A 4WVLA 1TJNA 1WMAA 3E9CA 4IVNA 1G6KA 1AGNA 4EFLA 1WBDA 3HBAA 4S1VA 5HE8A 4M1QA 3HZOA 1QANA 3H16A 3ABQB 5CCXA 3U62A 3L7HA 4XH9B 2D54A 1RXVA 2MSNA 4O4HA 3ONWA 5BSRA 2YZKA 1JQAA 1S0WA 1VE7A 1GLNA 1SCAA 3ORHA 2WUVA 3R3ZA 2GJKA 1EI9A 3EWNA 4Z9YA 4H15A 3TE8A 1LB1B 4C07A 2DFKB 4P5DA 2HDRA 3QU2A 3NASA 1STZA 5LLDA 2XZLA 1U3TA 3Q2KA 1P6XA 1FLNA 1FTGA 1DE0A 1JWBB 4FI3C 1T1AA 4B0OA 3V42A 4FYWA 3LUPA 1P4HA 2YWEA 1Z08A 3IHWA 5C3UA 2FLWA 3IVXA 4F3RA 1J00A 3L04A 3PJEA 3O2QB 2LW7A 3BWXA 1Q2PA 1WPXA 2W71A 1DC4A 2VQSA 5ITSA 4RYEA 4BFWA 3DMRA 3UB4A 2C2KA 1CV2A 2CVPA 3BSFA 4L9EA 2KI5A 4U0XA 2Y79A 1BE0A 1DRUA 2VSYA 5TMDA 3OFSA 2H11A 4RKQA 3O92A 3ULKA 5L45A 1UXJA 3NBKA 2HO4A 2HHLA 4EMTA 2HTEA 2WAFA 2YFKA 5GJBA 4E3OA 3L1HA 5LD2B 5I94A 3I01A 2V9ZA 3VH1A 2YV1A 2I1LA 3TEMA 3DZDA 1W5EA 1V95A 5B37A 2RI0A 2AFIA 3DZKA 3T9FA 3LV8A 1TTPB 2GKGA 4Q8IA 5L4NA 1YXMA 2HSZA 2RCXA 3KQKA 4K8RB 1H0RA 3LR3A 3QZUA 3WKCA 3PWZA 4O2BA 4P4GA 4ZICA 3HYTA 2NPIA 1XYVA 2H9YA 2DX7A 4JVMA 4BN5A 4MS3B 1GA9A 4WZ5C 3LWBA 1TZ2A 1LF5A 4KG7A 3JZMA 1NMEA 3NGLA 2IYLD 3A6ZA 4FSHA 3K20A 3RH0A 3G9XA 2IL1A 1TFRA 2IS6A 3NU1A 3BFJA 2AVDA 1AA6A 1KH2A 3CE9A 3B5IA 1FEZA 3EZNA 3ISJA 1XWFA 2G80A 1E1CB 2WD9A 1EWQA 4OFXA 2ZSEA 3AUSA 2VGLS 4PM7A 1S2DA 3GU3A 4TXMA 3NRCA 2G7MC 3SDZA 1H2FA 1GKLA 2UUPA 2CUZA 4B6PA 2PX2A 1A71A 3A2MA 4R9UC 3A3NA 3PQ6A 5TQ2B 5DLPA 3WGTA 4ZN6A 5CEFA 3FMFA 1CIVA 1JJFA 4OHWA 3MMXA 1O8BA 4A6DA 5KOIA 1KEVA 1V41E 1JP7A 3W7VA 3PXCX 1XZEA 2RH9B 5FBHA 3EXHB 3ON5A 4BMPB 1N34B 2Y0BA 5KTKA 1EJBA 2V7TA 2XKBA 1O3YA 2RHOA 1D06A 1NYQA 1B00A 2PDRA 3H19A 3R9XB 1FW6A 2HJHA 3DBVO 2NV2B 2X42A 2W2OA 3B42A 1PT5A 1DQYA 3EZ7A 2PSFA 3WS7A 1AS2A 4X3PA 2BFMA 2H17A 2E89A 4YNRA 1EX9A 1IHOA 3UK2A 1OTXA 2B7LA 1EXWA 3QNWA 3OOJA 1JKJB 2H4WA 5JHHB 4WA8A 3HGTA 2XCQA 3OBFA 2IOQA 2PV7A 1PGNA 2QY9A 1HDOA 3LZDA 3HB4X 3W79A 1JF8A 4B8YA 3WNQA 2DH6A 1U9YA 5J1SB 2CJXA 1AM4D 4ZU6X 4EG8A 4ZGBA 1QAOA 5LQKA 1NF8A 2WTBA 1Y5NA 3IAUA 3DDWA 1QHIA 4KQDA 5KJ6A 1MXHA 4TRMA 4IJ5A 3OPVA 1WMFA 2O9BA 2FWAA 5KSZA 2F55A 1XF1A 3ZCUA 1P3JA 2NYUA 1OW3B 1BLPA 3LUAA 1JBQA 1MABA 3O21A 3L4BC 2GX6A 3R44A 3LEZA 4LJ5A 4JJAA 3BTOA 2HM7A 4CLCD 1HYBA 3R3XA 1NL3A 3LF2A 3ZU4A 1BU8A 4BCDA 2PA0A 2C3PA 3MJ4A 1MRZA 2FR8A 4MCIA 4EJ0A 4G8DA 3DJFA 3KTDA 3V3SA 4Q5IA 3F6YA 1E5LA 4I3FA 1UFKA 1CRLA 1HDRA 5DYTA 4EB0A 3PUJA 3JV7A 1TUEA 3G34A 1GNPA 4CI9A 2WMYA 3FUVA 3KUUA 4WL9A 1M6YA 1Z0AA 1GU7A 1XZAA 3RBZA 2VRBA 1FOEB 2X1HA 3FCUB 2DXIA 1X74A 3F5DA 3G9UA 3JAWA 1TNDA 1R4MA 4EUZA 1ZCBA 4FJ0A 5G2OA 4E21A 1Z3CA 4WERA 1RXIA 1ZW1A 2PUAA 4F11A 3I73A 5GOZA 2Q27A 4BQNA 2ZS7A 1IE3A 5FL7A 2ZZMA 4PICA 5C4MA 2Q1WA 2OBBA 3W3AD 4ZKDA 4MQ4A 1FFBA 2O6LA 4V0ME 5EMJA 2XV1A 4G5GA 1XXHA 3A6KA 3L06A 4I46A 2RHWA 2CJYA 4Y1GA 1RM4A 4G01B 4MRVA 5DI3A 4HEHA 2FU5C 1YUMA 3W2GA 5C37A 4HPJB 3GLKA 1L6RA 4N40A 3RUHA 3H5IA 4NNJA 3RSFA 3AOEA 2ZIXB 1LGYA 3GUCA 4MJ7A 1W8YA 1U8CB 2VUUA 1IG3A 2QTBA 1A82A 1B8NA 3MWEB 2ZYIA 2W1RA 2P6PA 2JLSA 3T1YB 1MJHA 4IDQA 3K4HA 3HYCA 1QTRA 4YFVA 3NBQA 4S2OA 4WT7A 2Q4OA 4C43A 3CCCA 2G5CA 5KNCA 4EO4A 3NUGA 2O23A 3EXG1 3VH3A 3R5XA 4DE1A 1UXHA 2VDPB 2EG5A 4GT1A 2XD4A 1E7WA 2PD7A 3L8GA 4QJIA 1UFOA 5M2QA 5BN4A 2W2LA 1ZIPA 2AN1A 1E94E 4Z0NA 4LC9A 1BRMA 3CUYA 4A6XA 5AVEA 3PHLA 1A2BA 4J3JA 1JZQA 1LT0A 1CUJA 2IF2A 1KRHA 3SKYA 2ICAA 1WUJS 3E9QA 4RIFA 4DBLC 3IQAA 4D98A 2XSZA 3E4OA 1OZFA 4HESA 2WK0A 4TL8A 4Q21A 2YJ5A 1RAIA 3C3MA 1YRHA 2I3GA 1ZG6A 3U3KA 4EHFA 2H3EA 5AMXA 2VNSA 4B83A 5GHYA 1NMXA 3OQHA 2BFEA 4K6MA 4EY8A 3BLMA 4J94A 1KAGA 4KXWA 4HXYA 3TXYA 1AV6A 5FUWA 4QULA 2YDYA 3QP2A 3E18A 5E8RA 1UM8A 4WOKA 1KDVA 4WLUA 1PZGA 4DLYA 1NV8A 3QHPA 2BTEA 3SD7A 4JLPA 3ESCA 1OLSB 1O96A 1XA3A 4JP3A 2VJMA 2P74A 3H6KA 3C97A 4DJ5X 3D6AA 3LNCA 1I0LA 1REQB 1TFUA 1VE1A 4F0JA 1K57A 1Y3CE 1VEUB 1PE0A 2PBRA 1M34A 1DTEA 4IGFA 1IAVA 3FAZA 3WY9A 2UZ1A 3REQB 1CS0A 3SDSA 2XOKA 3RUAA 3IUBA 1AZWA 1JAHA 4G0UA 1EVEA 1VHQA 1I2BA 2WGWB 3M2KA 1VPDA 4OBBA 2AD5A 3H4IA 4UD6A 4RX3A 4M55A 4RCVA 3RRNA 3FNFA 4FYVA 2PFGA 1BDJA 3COVA 2IWCA 1ZISA 1Z4KA 2OZVA 4M3KA 1Z4OA 2ACGA 3HXPA 4XXRA 2NAFA 3GGSA 1UIRA 2QW0X 1DJMA 4G67A 5KSWB 3DB2A 4TS1A 2DPYA 5AOVA 4KQIA 1C7JA 4JY7A 2IY7A 4IDAA 4XVUA 1Z6GA 1ZM2A 5ALIA 2CXXA 1RHKA 3RC8A 1KYYA 1E9CA 3IURA 2Z58A 1LRKA 3KSBC 3KHUA 3UFXB 3NOTC 3RWBA 4B48A 1XZIA 4TLBA 4XWOA 1S9DA 4C4YA 2G9QA 1PV1A 1R5BA 1Z4NA 1NIPA 1KDPA 5LWHA 3ONNA 1XPBA 2B7BA 4QOEA 3L1KA 3VHRA 3F2VA 3ZBTA 5A2GA 4Z7QB 1AGPA 3TBHA 1GPYA 2Q50A 1ZM7A 4TTSA 4XUDA 4YREA 1QMPA 1C50A 3OPYB 4GNRA 1Y80A 3CF4G 3LUHA 1ZQ9A 3AESA 3DNPA 3CFYA 4BLWA 1YULA 5CM2Z 5KZHA 4W7HA 1UFVA 2R7KA 1CWUA 4LJ6A 5I9LA 2PBLA 4ZQIA 4PKYA 1OXSC 5C7OO 4R6LA 4ES6A 5EKSA 4JFAA 2E6UX 5HNKA 1JHZA 1T8RA 2KM1A 3EFHA 4G1EB 2DFTA 1DEHA 2QRVB 2EKLA 4Y2UA 3UNXA 2JI8A 3UKDA 3CU5A 4NVRA 4A73A 4HMPA 1QSGA 2ZJYA 2AG8A 4WDRA 3RIGA 1Z18A 1ESNA 4LOAA 1NHGA 1ZOPA 2Z2ZA 3V7UA 5KYTA 2X0RA 4HZUA 6ABPA 1VKJA 2DLDA 521PA 1UDRA 3GZNA 3HFSA 3UWKA 3FYTA 3U7QB 1QIFA 3SVZA 1YLTA 1IUPA 4J75A 3GLIA 4C6HA 4DA6A 5BOHA 4QBKA 3NDRA 2ZR7A 3K0BA 4RFSB 2FN7A 1YRAA 4K9MA 1H8MA 4U39A 1ZD5A 1Z5NA 3IH9A 2QE6A 4WFQA 2JKGA 4ZVTA 4JITA 3UT6A 4LJYA 3KJHA 3RVSA 4DSTA 3SF8B 2FSUA 1P2UA 1YD7A 3RROA 4GFDA 1N78A 3ACBA 2WYXA 3IE1A 1GQ2A 3LF1A 1NF2A 5DTJA 2MTBA 5J2UB 5DBEX 1J5PA 3EY4A 1CPYA 3NHPA 2Z30A 4S3MA 3PXBA 3M6BA 2YWRA 3KSGA 5HRCA 1KZYC 3P9IA 1C1HA 1HQDA 1YVUA 5ICSA 4PO3X 2FZLA 4F93B 3MCUA 1UMBA 3H6GA 1YQQA 1H9AA 2WI8A 1GZHB 1CTQA 4ZEMA 5NLLA 1NOJA 1A50B 1QMFA 4PHHA 2CK3A 5MFPA 2RHGB 3BK7A 4OJMX 2V4UA 1U7HA 2C61A 2DKFA 1AUQA 5JJ5A 3TD6A 1GTZA 4MGZR 2CLKB 3CLRC 4E22A 4FUTA 3EXFB 3H2YA 3BWEA 4RD4A 4QHYA 3D6VA 1CZNA 5JEEA 1W36B 1USVA 4FWBA 1YBMA 3CNOA 4GX2A 3WLOA 2FMIA 1IZYA 1Y7LA 5FOXA 3ECCA 3VZSA 1Z4IA 2YHAA 2LDBA 3R7AA 5CK5A 1RWBA 3H13A 4R1MA 1KI6A 2JVKA 1ECCA 1ZWKA 1DP6A 1JVBA 2EBWA 3MD0A 4RE5A 3SBEA 1J70A 5KTRA 4AP5A 3HP1A 2FZGA 4KWIA 2A59A 2HFKA 3EWSA 1OC2A 2YTZA 3PRJA 3WHKA 1KAEA 4WZ5A 1FP2A 3RVBA 3B2NA 2IPMA 2AT1A 1HO3A 1PBTA 3QNMA 1NMYA 2IWBA 2F8TA 2VAXA 1RQRA 3BXXA 1TF1A 2GK6A 3KKNA 1TIBA 1M1YB 3NI9A 1KJIA 5IZ4A 2X8LA 3AL2A 2ZIGA 3KYQA 1RCTE 3IDAA 5DJUA 1ANKA 3PDCA 4F8JA 3LEQA 2ZS9A 3L8HA 4CCSA 1KJQA 1FNBA 2QIOA 2JD1A 3T50A 3S55A 1MWSA 4WYYA 4MRPA 1P5FA 1K27A 1DZIA 1HMYA 1E2FA 2JLZA 4G9EA 3HU2A 1PR9A 2JA1A 5J23A 3RE1A 3RFVA 3TW0A 4K03A 4NEGA 4LPSA 3I2GA 3FDFA 4KX3A 4QASA 4BO3A 4EY5A 3NC0C 3IQIX 4Z1MA 1TS7A 2ATXA 3S8MA 4CM8B 3C6ZA 3TH5A 1I6KA 3KZMA 1X15A 3QFCA 4XM1A 1EIWA 2LKCA 4MWCA 3SHTA 5AXAA 2OCBA 1M6VA 3RQSA 5AJYA 4HYTA 3RSSA 2IF0A 4ENQA 3LC7O 4UUQA 2UYQA 3K4PA 3TAXA 4JI4B 3PZRA 4DUPA 3QVOA 4YP0A 2L42A 4NP6A 1A5SB 4JLVA 3CW9A 2IELA 4TT3D 5LJLA 3KEMA 3TOXA 5JAQA 1C8BA 1E0DA 5BVHA 3VZDA 4QNNA 3OA2A 4CIAA 4MHTA 3O0DA 4I08A 5HL6A 3DHYA 1PS9A 4NFHA 2H59A 1BD3A 5EQTA 4ZCLA 3Q81A 4G3VA 1LPMA 1KO1A 3BFFA 4DM7A 1WX1A 3KZ1E 5TIIA 5EVIA 3UO8B 3PQCA 1EP1B 4DXAA 1WPRA 2ZYDA 2NZXA 1HRDA 1V16A 3PJDA 4X1IB 2V7VA 1QG2A 2Y2KA 2H1WA 1QH8B 1S96A 5AVKA 5AQAA 1STOA 1LDBA 1V37A 5AW4A 1UP4A 3EJWA 4MQEA 2EKZA 3KM0A 3TAUA 3Q12A 4PNHA 4F9EA 4B4KA 4RY9A 4ENRA 1RKXA 3D6NB 5IFKA 4KXYA 4JGRA 2BGGA 3GG2A 1E9AA 2F43B 4RPGA 3JZAA 1E6UA 1OJ5A 4DV2B 3HO1A 5HF5A 2FW9A 4ZDJA 3KETA 3SE7A 4DMHA 3AHDA 5IBPA 3I9JA 1F2UB 4BB5A 4C06A 4QT0A 3IAXA 3ZC3A 3SH9A 4DRTA 1G20B 3LU1A 1DUVG 1MC5A 4EK9A 1AMOA 1ISSA 5DHQA 2X9VA 4U3TA 1J09A 3CN7A 3LX4A 3B82A 4PWZA 3IUEA 2AOTA 4RDXA 3PF8A 1JHQA 2ZI3A 4RENA 1UPFA 5JMOA 2P9ZA 5TGFA 4HLUA 2WWYA 5IASA 5IVPA 2IH2A 1NSTA 1ACMA 4MWTA 1TL7C 1U7WA 3UAYA 3VZBA 4BVEA 5KNBD 1E1RA 3EIWA 4PZEA 5HW0A 3DZJA 4BMZA 3OOYA 2J9GA 4IGKA 1Y3DE 3L7MA 4B2YA 4NG4A 2FW1A 4Q93A 4N5HX 3NTLA 1IOWA 4GGOA 1LKZA 2R6CA 1CT9A 2VK3A 2I6GA 2NVUB 4M99A 1W581 1TVMA 2VBCA 2YV4A 4PGAA 2KOIA 3DS8A 5DF1A 1VHMA 2ANCA 5HGXA 1K3FA 4QUIA 3RYFA 5C32A 4CQJA 5FI6A 3QVGA 5ECWA 3DEJA 1Y1TA 4HLCA 5AH0A 1A27A 3AHEA 2BT4A 1KE3A 4R83A 1RLOA 3WYGA 2Y1KA 3JQGA 4RELA 3WS4A 3T3MB 3A0RA 1U9JA 4KZ8A 2Y2HA 2QN2A 1A7UA 3L7CA 3E8SA 4QVIA 1ES3A 4L07A 4TZ0A 4ZRDA 2BDEA 2C04A 4KAAA 5E6SB 4M60A 1GPAA 5IS2A 1FJGB 2XQKA 1K4MA 4Q4HB 5KSHA 5A3VA 3KKMA 1Y9EA 4OJKA 2VHYA 2A0KA 2IDJA 4W8GA 4B4WA 1WAMA 1W36D 3GMTA 3JQFC 1GPBA 2GT1A 3OPHA 4YQZA 3A3JA 3B1XA 1A8SA 4BECA 16PKA 2QAGB 5CGZA 1XXHE 4RMGA 1PNTA 3E15A 3QI2A 3BMCB 4BFVA 3RYIB 5FBWB 1PU2A 3BXHA 2Z1MA 1XVTA 4UU8A 2HDWA 4PLFA 1R50A 3ITBA 3NB0A 5EMLA 4EPTA 2ODEA 3HSSA 2PSSA 5E3IA 4PQYA 1U2EA 3PC8A 3O95A 2XK1A 2XIQA 3GEGA 2LCFA 5FNVA 2CZGA 5CCBA 2Z2MB 2HI0A 2W4MA 1VL8A 3HP7A 3PD0A 3UCEA 2F00A 5U47A 3TK1A 2C9ZA 4PCLA 2HY7A 2JJ1A 3EG9B 3AVOA 3BQMB 5FO1A 1LDNA 3WHIA 4RABA 1A7KA 4QU5A 1XZBA 3WADA 1XPRA 3X1XA 4MNRA 1ZJ4A 2VWGA 3N05A 2G1KA 2H1VA 4JT2A 3DFUA 3E9MA 5HCUA 3PE6A 1VJGA 1ISPA 4QDOA 1NDHA 4HPXB 4TM7A 3CZ4A 2R78A 3R77A 1MAHA 2RB4A 4XARA 5DM2A 4Y0UA 3K8YA 1PHRA 1D0VA 4FD2A 3CUKA 1UJBA 4WBNF 4G65A 2XQFA 1P60A 3RU9A 1EFTA 5PGMA 1EXNA 4JVSB 3ZD7A 1VI6A 1SQFA 4UBJA 2EDAA 3NBLA 3NY4A 5ALWA 4FNMA 3W2ZA 2VKQA 2KLBA 3JALA 4OQ4A 3HJFA 1VCIA 3HDVA 5B1EA 5JNWA 1FFEA 1YM1A 4H6JB 5JDCA 1MO3A 4EECA 1MENA 1WF3A 2ZTSA 3WZ2A 1OUMA 1ST3A 2J85A 1M2VA 4LE1A 4BEBA 4KQFA 3FDXA 4YRBA 4AYXA 3WXBA 2X3FA 2Z6DA 1OCEA 3VP4A 4NFYA 5AKLA 5JNRA 4HFMA 1DAOA 4A6PA 4UFOA 2F3UA 1P1FA 3WSVA 3A32A 5JCPA 4G0QA 3RSCA 3JSAA 4C05A 2FUG6 2CNWA 1POXA 2X71A 3W8DA 4BPBA 1ECLA 1ZAKA 4GOMD 3I04A 3BWVA 1E4EA 1QHYA 5FOTA 1L0BA 3B1YA 5FQIA 5DTRA 2PT6A 3RUFA 3VNQA 5FFNA 1Q21A 4C9BA 1B76A 2AJCA 1M0SA 1M34E 1EP9A 3P9YA 1W85A 2OTCA 2FQWA 2PQMA 4OHUA 2ZAYA 2XLNA 3BQNB 4G4GA 4D3FA 1KL7A 4G86A 2Q6OA 5H16A 4GR9A 3UV6A 3COSA 4DMRA 1OYYA 1SN7A 5I9IA 4RY0A 3IAM6 1Z2AA 3LX5A 4PHGA 1QRAA 1LK7A 4F3TA 4NENB 4RVAA 3VVBA 1RHRA 3KWMA 4B71A 5M1AA 1WUYA 4JZYA 4EF4A 2HPAA 4CG2A 3DBHB 5FV4A 1TQ8A 1SHJA 3CLHA 3PKIA 1ZVQA 2I2BA 4NYIQ 3NIDB 3WK5A 1HEUA 4C5CA 1N9KA 2C2GA 3AF5A 4XB2A 1UEIA 5AM5A 3HA7A 4YHHB 1CW2B 4CIVA 2Z1DA 2QN8A 4BMWA 2V7BA 2NLOA 4CEJA 1FQGA 3IBGA 1UJMA 2G17A 2FEKA 4PPFA 3M3DA 4D3XA 1OFIA 2JIRA 2HMAA 3L8CA 1ZUNA 3UWMA 2ODTX 4JJKA 3UGKA 5JMTA 3H1TA 1UKAA 4RF3A 4TL7A 4Y15A 2R7MA 4B31A 3IH8A 4LX8A 5IJ9B 3GLGA 3G2NA 2O2DA 5GJVC 2HIHA 2IYEA 4N0MA 3V8PA 3WQRA 3TTWA 1O6CA 1Q91A 3FRJA 2W3FA 3ZEIA 5LZ7A 5JAZA 2QMEA 4CPKA 4YR7A 3WWOA 2QTWB 2F64A 1J7KA 1BTOA 5FNZA 1BCSA 3UOWA 2VVTA 5F9HA 2Z57A 3TZLA 3NANA 3MZEA 4UNQA 2Y9PB 4IAOA 2PS1A 2AN4A 1V47A 4OKPA 3BE5A 2ONYA 3ZV6A 4IEFB 2R00C 3EE6A 1W46A 4ZV4A 3ANXA 2EIXA 3V80A 5IK2D 3QLTA 3NKVA 2HP5A 3UBMA 5KTPA 1U9CA 3G85A 1M33A 4OPMA 1DCMA 3WFZA 1O89A 3ETNA 1V8ZA 3ONDA 3GLIE 4RVUA 4PPNA 3QYPA 5DKLA 1P33A 1WHTA 3FUXA 3WGHA 4M49A 2RHHA 4GGMX 4RVOA 1H2AS 2WJPA 1W7AA 2WD8A 1T13A 5TF0A 5K0GA 5C5IA 4I6JA 2IYOA 2D00A 4F3NA 4ZCQA 4DLWA 5E7IA 4JLUA 3CRRA 4FKZA 4OQPA 1KGGA 4RD0A 2VTBB 3VSEA 1QK5A 3UUFA 4ZHSA 1Z47A 1A4IA 1Y5MA 3MMPA 2HSDA 1DY6A 2QRPA 2DFDA 2QVXX 3HU3A 4PPRA 4XGNA 5F51A 5A92A 3KKPA 3EC7A 3LP6A 1U60A 2IH5A 1XYGA 1WSWA 3GCZA 2IQ5A 3D7SA 2VEDA 3F1OA 2WTUA 3N39C 5CBKA 2D8MA 1TT7A 2WJYA 2G9NA 2GO7A 4CTJA 2Y2LA 2DWOA 2WYIA 4MWOA 3QEMA 1MW8X 1P18A 4EG6A 3CPTB 5DHPA 2ECQA 5TMEA 2B1IA 2Y2GA 3KAQA 4RXMA 1V3UA 3M6AA 2HU5A 4Z54A 2AFVA 2R6R1 3DTIA 4XSVA 4KQEA 5AVXA 3KUCA 4JI6B 5FRDA 3JR7A 4G5HA 3RAEC 1T1GA 1Y3FE 1QCZA 4L8GA 5KHLB 3S27A 1J1IA 4O4IF 5G0UA 3T4SA 2P40A 1OYOA 4K0RA 4I3AA 2JZOA 1E25A 2FEAA 4YUZA 2C7PA 2G09A 4EQ6A 1Z12A 1EU1A 3DKRA 2B5VA 2PE5A 2QMQA 1AQLA 2DPGA 2JAOA 4MJXA 3IV6A 1CJFA 1LLQA 2X9QA 4