2GZAA

Crystal structure of the virb11 atpase from the brucella suis type iv secretion system in complex with sulphate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
334
structure length
324
Chain Sequence
ASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHLISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKHVRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIEDVPELFLPDHPNHVHLFYPVTAATLLRSCLRMKPTRILLAELRGGEAYDFINVAASGHGGSITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTKRAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Type IV secretion system protein VirB11
publication title A Large Domain Swap in the VirB11 ATPase of Brucella suis Leaves the Hexameric Assembly Intact
pubmed doi rcsb
source organism Brucella suis
total genus 90
structure length 324
sequence length 334
chains with identical sequence B, C
ec nomenclature ec 3.6.1.34: Transferred entry: 7.1.2.2.
pdb deposition date 2006-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00437 T2SSE Type II/IV secretion system protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.90 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2gzaA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2gzaA02
4HUQB 821PA 1HE1C 4HYYA 1HV8A 2ZRPA 3HYRA 3DHWC 2XJ9A 2VSOA 4OI1A 2ZJOA 3TH5A 1X8LA 4A6XA 2IYRA 1JR6A 1FX0A 1TF5A 1Z6GA 1CRQA 2CLCX 2WJJA 2OHFA 1NJGA 3R9IA 4B3XA 4Q7KA 4B75A 2IL1A 4DEYA 4A92A 4FCVA 4NYJR 3AKEA 3LW8A 5FOXA 3ZS8A 2WZQA 1M2OB 3CLVA 3AP2A 4WW0A 1HEIA 1MO6A 1N5KA 1OW3B 4NMMA 4QFMA 5KNCA 3TUZC 2DBYA 2QM7A 4TZ0A 2JLZA 3KFVA 1E32A 1SKYB 5FUWA 4TLDA 1Z2AA 2B7BA 1DS6A 2A5JA 2WICA 2O0KA 1W46A 1NVVR 2MSDB 3B85A 421PA 3M4YA 1GL6A 5C4MA 3W3ZB 3H4MA 1G3QA 1A82A 3LDAA 1OIXA 3BH0A 1QVAA 4TQUS 3TAUA 1HY3A 4XH9B 1P2SA 3FMOB 4BEJA 1Y3AA 2H57A 1P7CA 2QPAA 3ADBA 3RABA 3C14C 3BIFA 1R0YA 4E03A 2VHQA 2GNOA 5EZ5A 3UATA 3R7WA 2XXAA 3PJRA 3KKNA 2YYZA 1E2HA 3KUCA 2LKCA 2Z83A 1KAOA 2DCUA 1E2GA 1MABB 2GJKA 5M04A 3KQKA 1WMSA 1QG2A 3VFDA 1PV4A 3CX6A 1M34E 1U81A 3RS4A 2X2FA 1E0JA 4WXRA 4R7ZA 1DO2A 1UPTA 3F5FA 3TUIC 4Q7MB 4C0AC 2ZIAA 2IS2A 2GXQA 2OAP1 1G8PA 1UKZA 2CJWB 2ZRJA 1EWRA 1EFHA 2F43A 4QJ3A 1ESNA 1HQYE 5JCPA 4M1WA 2DFKB 4E07A 1UAAA 1XTQA 2FZ4A 1D9ZA 4RD2A 2IS4A 3D6TB 1XEXA 3PEVA 1KK2A 2QG6A 3CX7A 4NZYA 4AURA 4PO9A 3IIKA 5LB4A 4BGDA 4B2IA 4GPTA 5D3QA 4XWAA 5AUNB 3WHLA 5J47A 3IO3A 4HI0E 4RCZA 2DB3A 3Q72A 2ZR0A 1NKTA 4IOJA 4DB4A 4GP6A 3JVVA 4Q4JB 1D8TA 3VR4A 1U90A 1M1YE 1Z0DA 4CYMA 4ESVA 3QKUA 5KNDA 2RGBA 3A4MA 2ATVA 3VR1A 3SJCA 4TMWA 4PSKA 3SC3A 4YXWD 1ANKA 3NEYA 3AVVA 2GEVA 2ZYVX 1SXJA 2RMKA 3BRWD 4IOLA 2J0UA 4M2LA 3OE7A 2NG1A 4R98A 2XGJA 3IPXA 1N0VC 3GMTA 2IXGA 1E9EA 2IYLD 3GJ7A 2UZ3A 2YOGA 1S3GA 3EZ2A 2PEYA 1IHUA 2UVQA 1CR4A 1ZD1A 4HB2A 1ZM3A 4EQ6A 2QUZA 1P4SA 2BM1A 3ICQB 3QSYA 2P5SA 4Z8YA 5C4GB 3FMPB 2CE7A 2R65A 1JR3D 5A4JA 3PCRB 4PZLA 2ZRBA 2PX0A 1ZM9A 2KSQA 3B82A 2MSEB 2QN6A 2D7CA 2Q9CA 4PTLA 1QVRA 4P4UA 3VR5A 4A15A 3L43A 2C9OA 2ZSEA 2XJ4A 2FA9A 4LHXA 1IXZA 4R2HA 1D9XA 4HAZA 1OLOA 4IVQA 5EP4A 4KFRA 3PUZA 3C16C 3GPLA 5DNYB 3N70A 1KI6A 1Z08A 5E7IA 1XEFA 4IRUB 1L2TA 2H17A 3KUDA 2IT1A 1OH7A 2ZSDA 4GSYA 3OEEA 2H7VA 3GLFE 1MH1A 2YJTD 2ZJYA 1CJMA 3PG5A 3W8RA 1GM5A 1JNYA 3GLGA 2JJ2D 4UNRA 5KDLA 1RW4A 1NG9A 4DKXA 2J7PA 1PLJA 4BASA 3MWYW 1RE0A 4Q21A 5HZKA 5DSZA 2A7QA 1XFAA 1RJ9A 4KO8A 1KO5A 1AGRA 2H1LA 2W6JD 4I1VA 1SVLA 5CM9C 4P33A 5AUPB 2HLDA 2VIIA 1W5SA 3Q7QA 5FTMA 4NYJQ 4BZPA 1MKYA 2BMJA 4P4SA 4UQOA 1GIAA 4ON9A 2WMNB 2Z6VA 5GJCA 1T5LA 2V55B 1WE2A 3KX2A 1NVUQ 4CRWB 2FDCA 1L7VC 2QMOA 4U00A 2DFTA 5CB6A 2OBNA 1E98A 4Z8XA 4BRWA 5FBLB 2OCBA 3JZAA 1GKIA 4IOKA 1UDXA 4A0FA 1T8UA 3ZGXA 1VECA 1ZNWA 2EFCB 2NOAA 5EE5B 4YMUA 1LS1A 1QHXA 4FXPA 4TYYA 1NBMD 2RGDA 3AF3A 2WSSA 2ZJBA 1T5IA 4DLXA 4XOIA 3U7HB 5KTYA 1N0WA 2X1VA 1KSHA 2IYTA 2PT7A 3B8HA 1WQ1R 4JYCA 4K81B 1N6PA 4JVMA 3A36A 1S9DA 3REGA 1VCIA 3OEHD 1WBBA 1G19A 1W2GA 1A2BA 4QGFA 4BWYA 2R6FA 2BBWA 3PENA 1XEWY 4LPSA 3C5CA 1P3JA 3SI7A 4ARZB 1JQJC 4XSGA 5DYGA 3GLHE 3CH5A 5L3RA 4LPKA 1JEEA 3QPUA 4MKGA 3IDQA 3AUXA 2ORWA 5JEDA 1DBSA 3P27A 1XTRA 2MMGA 4DDWA 2GJ9A 3ZD7A 3K9GA 1OH6A 1ZM2A 4FCTA 1Q1QA 1VHLA 4HLCA 4AKGA 2QNRA 4G5GA 2QT0A 3FE2A 4EDHA 2IS6A 4TL7A 2QTFA 3BB3A 1G3RA 1XTSA 2W0SA 1RYFA 2BWJA 3C15C 2J5XA 4M8NE 1IAQA 1XD2A 1Z3IX 3HYTA 3X1ZA 5FOTA 3RHFA 5HKKD 1TX4B 4MYCA 1OIWA 5GJBA 2C99A 1D2MA 4JLNA 4Q4HB 3ZJYA 2IEZA 4OI4A 4GBMA 5JMTA 3G0HA 2FSFA 4IDQA 4OKSA 1OJLA 2FN4A 1JJVA 3WRXC 4LV8B 5J4LA 1QHNA 4LZZA 4WBSA 3RWOA 3UG7A 2V8OA 2XTMA 3KJEA 1UFQA 1VIYA 2JDID 3K0FA 4LJ9A 3B78A 2JLUA 1ZIPA 2ZYWX 2VHTA 3WYGA 1G16A 3LWNA 5K8UA 1ZNXA 3U61B 5JEEA 1IXRC 1SKQA 3HR8A 5FR2A 3SEAA 3HPQA 3PUYA 2VHCA 1UF9A 1YVDA 4KFSA 2NZJA 2AKYA 4GP7A 1G6HA 2GXUA 2OZEA 4G1UC 1V5WA 3FFBA 4HDOB 3CR8A 3CF2A 3ZIAA 1AA9A 1Z2CA 3BFKA 4OQNA 1AS0A 3DOEA 4B35A 1R4AA 3FKSD 4ASUD 5EXPA 2QP9X 4DLWA 3BWDD 5BWMA 1XMJA 5KSPA 1RRCA 2Z43A 4B6EA 5CK5A 5DO9A 3A4LA 1EFUA 3CH4B 3EZ6A 3U3RA 2HYIC 3WHKA 1GRRA 1T8TA 3THWA 3NKVA 3B6EA 4US0R 1KZGB 2RGCA 4QGHA 3VKGA 4L16A 2XB2A 2H5EA 1ZINA 3LNCA 1DELA 3E70C 3UG6A 4LC1A 2Z4RA 1ZNYA 2R62A 3VKHA 5F98A 1U0LA 2J0SA 3KKOA 1LW7A 4POAA 1DO0A 5DE3A 4Q1AA 2QL6A 4PQRA 2PX3A 1J90A 5L8VA 1HURA 3P1JA 1P60A 1WCV1 2C95A 4ZIRA 2ONJA 4FMBB 1PZNA 2YWFA 5F3WB 1CIPA 5JLJA 4GOJA 1W2HA 1IN8A 4WA7A 2NO1A 1M8PA 3NBZC 4MDEA 4GRAA 3HWSA 3OAAA 4HZIA 4JJKA 1DAHA 1FNMA 3THOA 1G9XA 2CE2X 2C96A 2R8RA 4B73A 1KI8A 4MRVA 3OIYA 4OHZA 4HATA 4KU4A 5JSZA 1GUAA 3ETLA 2E9SA 4DJTA 3N5CA 2GAAA 3VNUA 3L0PA 1A4RA 2YWHA 3A58B 3U3JA 4RY2A 2F55A 3W8NA 2NTYC 3RRMA 5JS7A 3QPVA 4KI0A 1D6JA 1OYWA 4URZR 5L3QB 1QHIA 2W83A 3GLIB 5GVSA 2G1JA 2GETA 3W9YA 1US8B 2BCGY 1F3OA 4Q9LA 3S1AA 1U9IC 2O0HA 1DEKA 3L0SA 2DPXA 4WXPA 5JWOA 1GITA 3QKSB 1G20E 2O0JA 1KMQA 2GZAA 5EP1A 1CF4A 2EYUA 1EFCA 5JWHA 3B60A 1SHZA 3O47A 4LDJA 4CZ2A 4D80A 4DLSA 4LC0A 3P26A 4UJ5A 5AR1A 4KCGA 2P0EA 4M1MA 3QOFA 1I2DA 5L3VA 1J2JA 2C8VA 5EUMA 5GJVC 1UM8A 3I8XA 4JBYA 1W0KD 3GD7A 4JL8A 3MJRA 3L8ZA 4B48A 3NHAA 3BK7A 5EE0A 3TKLA 1LTQA 4QBGB 2BBSA 2NO7A 2UKDA 3QQ5A 1SVMA 5BQ5A 5E3HA 1E1RA 1OXUA 3AQ4A 5EE1A 4C0HA 2ZYTX 3NTUA 1IY1A 2GXSA 2ZSFA 4NHOA 5C1BA 5KYKA 2O8CA 1W0JA 1NLFA 5SZKB 1SVIA 3THYA 5AJYA 1G41A 1GNQA 1XXHE 5DISB 4OK6A 3W5IA 4TLAA 1NP6A 4DXAA 4FINA 2XNSA 4KSBA 2HCBA 1Z6TA 4A6PA 4D4MA 4JS0A 3B1YA 5B30A 4Q19A 3RS5A 4OYHA 3K9NA 3DO6A 5LD2B 5DGXA 2KI5A 1FX0B 4ILEA 3ZQJA 5KHOC 1CS4C 1TF7A 5JCZA 1UEJA 2F3RA 4M1OA 3EZFA 2JLQA 3NH6A 3ZQ6A 2OXCA 4JL6A 2C9CA 2FGJA 1NN3A 4D82A 3MAAC 1R0WA 2EW1A 3LBIA 1P75A 1UKVY 4QGAA 4EFNA 3TGPA 2WWFA 4M22A 5ELXA 1DAFA 2IYVA 3B9QA 2BM0A 4MRPA 3WYAA 2OV2A 5FUYA 2F3TA 2PBRA 1DAGA 4IXMA 4D2IA 1HTWA 3FDIA 3L0IB 1NKSA 3QG5A 4OHWA 2PT5A 1OHHD 5CLQA 4MRNA 4NKRA 3KQHA 3A1WA 3I4LA 4CEHA 4PXAA 1YZQA 1RC8A 1QRAA 3HPRA 4JT2A 3UIEA 4GDFA 3K09C 3QENA 1Q12A 2DWQA 3CNLA 2VP0A 3T61A 4OHXA 2FJUA 3TNFA 2FFBA 4DVGA 2DWOA 4KVGA 2NMVA 3TR0A 3R7WB 1GNRA 2QPOA 1FMLA 5EJEA 1GSIA 1ZCAA 1SXJD 2XXAB 4Q9KA 3ND8A 4QC2A 5BYKA 4ZCLA 1LVGA 2RCNA 4RD0A 2PCJA 2D2EA 4HAWA 3OE7D 1KO7A 2C04A 4BLOA 3AB3A 2O8FA 1RVDA 1T91A 1OXTA 3BS4A 5AJZA 4DCVA 3CRRA 3TQFA 1XCGB 1DG1G 5FPTA 4FMDB 3VKWA 1AS2A 3QUSA 1XTKA 3VMFA 1YZGA 2PL3A 3K53A 1P72A 4XD7A 2AR7A 3DL0A 5G41A 2FSGA 4Q1DA 1G7CA 2FU5C 1YHNA 1G7TA 4QKQA 2XTZA 3Q5EA 1NVXQ 3BORA 1WA5A 3EXAA 4M9ZA 4C4PA 5LPNA 1UKYA 1YZNA 3SFVA 2GBLA 2F43B 2CNWA 2GCPA 4IDOA 4LJAA 1Z47A 3T5GA 1GRQA 1XEXB 3TJZA 1XZPA 121PA 2FV8A 5KUTA 2EVWX 4N0EA 4RJLA 2WWYA 2GCOA 4B2PA 2DFNA 2ZRLA 4LV6A 3R9XA 2ZRIA 4MKHA 2VLIA 4V0MA 2XOKA 4KBGA 4TZ6A 2FFHA 4N0DA 1XD8A 1OXVA 1KNQA 5FL3A 3B13B 1L8QA 2PLFA 3EARA 4Q1EA 4AIIA 3WMEA 3CRQA 3BXZA 4D6PA 2YNMA 2ZROA 3TR5A 4V02A 1CP2A 4IFBA 1KO1A 2FSIA 4NCNA 4Q1BA 1JECA 4C0SA 2YC2C 4RCYA 4AD8A 4EJSA 1E0SA 1ZW6A 6Q21A 1SXJB 2ZVPX 3CZQA 1TU4A 4Q1FA 2J0UB 1BOFA 2K5UA 3O8CA 5F9HA 1S9HA 4RD4A 4MITA 3K70D 4URVR 2IXEA 1NLYA 2NO0A 1DAMA 1P9NA 3CWZA 4NCKA 4Y0AA 2WSMA 4KLNA 5KDOA 4EQ6B 2HLDD 4BFWA 3G82C 4LK2A 1HE8B 2QAJA 1OPXA 1ZD9A 4PC3A 1DOAA 3W90A 1TQDA 2ZUDA 4A0GA 1W48A 2A2ZA 2D06A 2VHUA 4BE7B 1COWA 4C0QC 2IYXA 1E2JA 1MRNA 1NRJB 1QHSA 1V43A 4FMCF 4TQAA 3ZVNA 2ATXA 1KJYA 2QM8A 4LJ6A 4JVLA 2GRJA 1G8GA 2BDTA 3PFIA 4NCHA 1QG4A 4TTQA 2YWEA 1QHHA 521PA 1E69A 1VCNA 2WKPA 3VAAA 2WSSD 4LHZA 3W6NA 5JI3E 1EX6A 2I1QA 1KI6B 1S2MA 3LV8A 2FEOA 4FN5A 3EIHA 4M9SA 3ZLJA 1NF3A 2R6CA 1AKEA 1BH2A 4M1YA 3SJAA 2FF7A 1VDZA 2OE2A 1T0JB 2VP4A 3MGCA 4KLZA 2RH5A 4XTRA 2ZI9A 4MRRA 3VR3A 4TLEA 3GLGB 2OUKA 3CPHA 3AEZA 4Q01A 3AV0B 3WP0A 2LCFA 1RJ9B 2OG2A 1KSJA 4V0OA 1R7RA 3RWMB 2ZM5A 1MOZA 1XZQA 3K70B 1RZ3A 3QXXA 5LD2C 2BEKA 5FPKA 1YRAA 3R8CA 4FWTA 3SOPA 3I1FA 2ZS7A 1IN7A 1SHKA 2L0XA 1J8MF 1UEIA 2OILA 1UBEA 2ZETA 3Q3JB 4P4SB 2B7CA 1TQ4A 1FNNA 3BC1A 2P65A 2GHIA 1OT3A 3BE4A 5HTKA 1RRGA 2ZI7A 1K5DA 4AKHA 3W5JA 2ECKA 2FG5A 3AF1A 1DPFA 3B7GA 4MUAA 2E87A 1CULC 4D4LA 4P4TA 4L9WA 1XCMA 1AQUA 1NIPA 3CNOA 3H1TA 3KTAA 3WXMA 4LHVA 2IWRA 4TMTA 2YOFA 2JJ8A 2XSZA 1YRBA 2Z4SA 2RGNA 2BOVA 3AGQA 3L82B 1L4YA 5TDHA 3TW8B 4GFDA 2RGXA 5FBVB 4X8LA 1OB2A 2GJ8A 2A5YB 3KZ1E 4B44A 1TF2A 2MMCA 1KKMA 1E4YA 1NN0A 3EIQA 1BMFD 4WOPA 2SHKA 2BKUA 1T3LA 5JS8A 2QSYA 1E0AA 5AUQA 3HU2A 4XVUA 1KO8A 2CCKA 3U3MA 2GVDC 2CHQA 1KJZA 4GOXA 1KIMA 3LXRA 2NO6A 1ZP6A 2FOLA 5J40A 4NTZA 3IPYA 4JIMA 3CRMA 1J8YF 1EFRA 1P9RA 5CYOA 3GFOA 2A5GA 4DLVA 4X8HA 2OESA 2AKAB 4WAUA 1VPLA 3WNCA 1KHTA 1XD2B 1LY1A 1ZUNB 2ZJ5A 2FPLA 1TMKA 1OKKA 2WWIA 1DAEA 2ANCA 3QF4B 2QE7D 3QXHA 1C9KA 2BC9A 3CW2A 2N46A 3FWYA 4YC7A 5KPJA 3SQWA 4F7WA 2J45A 5TVKA 3A8TA 3CO5A 4LBWA 2QAGA 2W00A 5K8LA 2TMKA 4DSTA 1XMVA 1RFLA 5DHFA 1VG0B 2JJ1A 3KJHA 1KKLA 1IY2A 1R5OA 4Q4LA 3MG9A 4TL8A 5IK2A 3K0FB 4B32A 4XWOA 2N42A 3V4FA 4H1UA 4UXJA 3E2IA 3MUFA 1D5CA 1P2TA 3T15A 5CIWA 1SKYE 2BEJA 4DT1A 4CW7A 3I72A 3OIWA 1SXJC 4RZXA 4A2WA 1U2RA 1BYIA 2DHRA 3X2SA 2OCAA 1X1SA 2HV8A 3RS7A 2IYYA 2WM9B 1GP2A 1G18A 5CLLA 2C03A 3K0CA 1E2LA 1II8A 4QBIA 3OAAD 3QXCA 1KMHA 5DIFA 2EQBA 1XDBA 4Z1MA 1RYHA 5DN6D 3GJ6A 5K8TA 2GDJA 1ZIOA 4PAOA 4B3GA 1J7KA 1XX6A 1W1WA 5C46F 3C5HA 4OQMA 3X1WA 5FOVA 3IGFA 3ONWA 1RIFA 1Q44A 2P2LA 2HXSA 2BBTA 1F5NA 3H84A 3U7FB 1Z0JA 2KBFA 1G6OA 4UXHA 3T35A 4JLVA 2QU8A 3THWB 3SJBA 5FBQB 2ZAOA 1YU9A 1U8ZA 3TUJC 2JATA 2XTNA 4PANA 4TMVA 2A5FA 1E2FA 2AXPA 1BS1A 1ZNZA 2W2XA 2RHDA 2ZU0C 5KOYA 2GILA 3LLMA 4ZKDA 5KSOA 3ZZ0A 1EG7A 1TU3A 4HB4A 2CLSA 3M0EA 3ZZTA 2HYDA 3SFZA 2RHMA 3EPKA 1TTTA 1ONBA 2ODBA 5FPHA 4WZ6A 2OLKA 3MCAA 2BHRA 2G0TA 2X77A 5EE9A 2LKDA 2ZR9A 2G0NA 4LBVA 2UZIR 4ZIRB 2WWGA 4AKEA 2IS1A 1WDTA 1CLUA 1E2KA 4OJKA 3K70C 4CT4B 1VHTA 5FOSA 4BLQA 2GKSA 3AF4A 2J0VA 5IHPA 1ODFA 2ZRDA 3NDPA 1E94E 1P9WA 1E2DA 3DEFA 4KAXA 5E4FA 4LBYA 1W0JD 3A6PC 1FP6A 2ZRMA 1Z22A 2JAQA 2O8DA 2W6IA 2WKQA 3KJIA 3OFND 5CIQA 4ACBA 5JSZB 3SHWA 3C7KA 5AJWA 1YKSA 1N3BA 1X86B 2ZJ8A 2X8AA 4URYR 4FMCB 1XPUA 2EWVA 1E0KA 4KBFA 4A82A 4EUNA 3ADCA 1N6HA 4F4JA 3CUEF 1YE8A 4A0RA 4QL3A 2VF8A 2ZS8A 2WJIA 2ZITA 3NC1C 3CX8A 4MGZR 2WPDA 4PAMA 4MRSA 3S1AB 3F8TA 5DH9A 1ZYUA 2AK3A 4I1SA 4C9BA 2JLSA 5FPYA 4TMZA 1G8HA 2ZREA 2EFGA 5KO2A 4MDFA 2FZLA 4X8MA 3NHBA 1OFTA 5H8WA 2CHGA 2V54A 3U7EB 4TTRA 3EG5A 4O0MA 3T34A 4E22A 1S3SA 1P5ZB 3BD9A 3BBPA 3DKPA 4CIDA 2CLDX 4M21A 4DIDA 2B6HA 2C2HA 4PHFA 3SR0A 4AYWA 4B34A 1W4RA 1N6IA 3AVXA 2QMHA 3KXLA 5B57C 1KTVA 4IOMA 4NL4H 2ZXUA 4WZAE 3KQLA 2GZHA 3X1YA 5LB2A 2F6RA 2D62A 3LRPA 1U8AA 4R9UC 1IJFA 1G7SA 3GLFA 2O8CB 4LCBA 3CIOA 3IILA 4TYPA 4DLZA 3THYB 2ZJAA 1E1QA 3RRZA 4PZYA 5L3SA 1ZUIA 3EC1A 1Z0IA 3CBQA 4Q7LA 3F3YA 3B1XA 5CDFE 1Q1ZA 2RAPA 2WAXA 3D3QA 1JXMA 4LJ7A 2ZU6A 4PHHA 3U5ZB 4DCTA 2ZI6A 4IDNA 4RSGA 3LQQA 5AWFC 2GEDA 3RRNA 4DDVA 2PZGA 4XD7D 3GQBA 3QEOA 2IXFA 2YWGA 4LYHA 4JZKA 2ZRFA 3T1QA 1KGDA 4DLRA 4EPYA 3CWQA 1E79D 1Z83A 2OFXA 2ZRGA 3MSXA 2IX3A 1JR3E 4I1UA 2IEYA 2OBMA 5EUQB 4C0BA 1VYUA 3NXSA 1OE0A 4Q4JA 1ZM4A 4GT1A 4HB3A 4L9SA 4EFMA 4YMSA 1NN5A 4W5HA 4DSOA 1FFHA 3HJNA 4LHWA 1E2EA 3FOZA 1CRPA 2BV3A 4YQFA 1H8EA 3CKLA 2G6BA 2XOKD 4QRHA 4ZO4A 2R2AA 4FW9A 3WNBA 2PJRA 4BFXA 4AKIA 4CEHB 4ITRC 2B92A 3ASYA 4TMXA 3UK6A 1XMSA 1XTJA 1J99A 1GTVA 5HCNA 1CJUC 5IDVA 2G9NA 4Q00A 3WY9A 1OH8A 2GK7A 4IW3B 1WF3A 2FE4A 3UANA 1XTIA 4LUCA 3EA5A 3JZMA 3NH9A 1FUKA 1KO4A 2J1LA 4P0TA 1W4CA 1D2EA 4E09A 3OESA 5EXSA 3EIEA 3GLHA 4ACAA 3GJ0A 2R9VA 3P20A 4M0LA 4URUR 2O8FB 3P4XA 4AI6A 1S96A 2IK8A 4V0KA 1ZM7A 1DADA 4Q9IA 3W34A 4BZQA 4M1KA 3FMFA 2WBLC 1Z6AA 2EWWA 1VYVA 4TLBA 2REBA 4HZUA 4I1OA 1FP7A 4RFVA 4G3XA 2QQ0A 3FPAA 4FCWA 4LYFA 4M4SA 4TLCA 4DLTA 621PA 2HT1A 3DM9B 4D26A 1EGAA 1GKYA 2W0MA 4G5OA 4Q9HA 3PXGA 3HU3A 1COWD 1A2KC 2I1VB 5J4KA 3KJGA 2ZE6A 4GOKA 4E5UA 3A1VA 4NPHA 3IBGA 5IT5A 1R8SA 3UKDA 1O87A 2F9LA 2GCOB 1XJ0A 1F2UA 4OQLA 3DDCA 5FL7D 2IUTA 4FIDA 4O2LA 2OCPA 3LAWA 2CVHA 2AFHE 2YC4C 3AKYA 4UKDA 3ICEA 2P6RA 4RD1A 4UNQA 1XPRA 1S1CA 1NBME 4CT5A 3WRYC 2QRNA 2KJQA 2J7KA 1T6NA 3B1WA 3X1XA 2XZLA 4YMWA 2WVJA 2BKEA 2CL0X 5GJWC 1SULA 3FB4A 4EJSB 2VP2A 4A2QA 1HYQA 1NJFA 1QHYA 4XTCS 5A0FA 4FWIB 1Z28A 1H8HA 5JECA 1NY6A 5BN4A 1G3MA 4JMPA 4KXFB 4X8OA 5IF9A 2Y8EA 8OHMA 4PPFA 4RD6A 3NBYC 4JLPA 1PJRA 4JLKA 1W49A 3GEIA 5D3MA 4GI7A 1OYYA 4PZZA 2HDNB 4JL5A 3I73A 3TVTA 2FGKA 3LX5A 4CVNA 5BW8A 3KKPA 5F2EA 4PC7A 4NYIR 2AFIE 1W5TA 3O8BA 1G5RA 4D81A 2QSZA 2W2VA 3KXKA 3LQRA 1T4GA 3AVUA 2C5LA 2DYKA 3WBKA 1P73A 4JT4A 3LO5A 3UMFA 4J0QA 4C3ZA 3JVUA 3KB2A 2ZVQX 2PEZA 3LFUA 4OI0A 3GJ4A 3LVQE 2G77B 2X19A 1TADA 1WBDA 4BLRA 3T1VA 1XB2A 1RPZA 3QI2A 4NU0A 2HT6A 1UBFA 2XSZD 3KXIA 1T3SA 2PCLA 2GXAA 1WP9A 2H18A 1QHHB 4ZDIA 5ANRB 2QORA 4KHZA 3ZDQA 3AVQA 5G40A 4RZUA 2A30A 4N3NA 3SNHA 3H2YA 1Q1EA 4S35A 3EZ9A 3T1TA 3SU8A 2G83A 5KDDA 1R5BA 1UBCA 2AWNA 2O52A 3FHOA 4AG5A 1W36D 3SBDA 1Z0FA 4DB2A 3U60B 1JPNA 3D8BA 5IRCD 3GFPA 3QF7A 4TTPA 4B3DA 3GEHA 4QNMA 3IBYA 1CR2A 1NSFA 1ZCBA 4YDHB 4DUGA 3BERA 4QHYA 4KJZA 3GJ5A 4BFSA 3FHCB 2ZUBA 1VMAA 3A1SA 4QBHA 1NI3A 3RSLA 2QEQA 2RGAA 4OHVA 3U3OA 1LV7A 3DZ8A 1KJWA 1VIAA 3I3SR 2ANBA 4IJMA 4OBEA 4AG6A 3LW7A 4L8GA 4C0JA 1GAJA 1F2TA 4PHGA 1EFRD 2QY9A 5JRZA 1P2UA 4PC6A 4LJYA 1DG3A 1GNPA 4BLSA 2F7SA 1Q3HA 1VYTA 3CF6R 4JLBA 1Y63A 5GADl 2WJYA 1SVKA 3RLFA 2BIFA 1GRNA 3U3KA 1NSTA 1XD9A 3KTAB 3Q85A 1IM2A 4IVRA 1KI1A 1OFUX 1OKKD 3LA6A 5TARA 1E2PA 1EX7A 2C78A 4C2TA 2OLJA 1XP8A 4QHSA 2GZDA 4A9AA 3CZPA 4G5SA 2OSBA 4II7A 3GLIE 4JJZA 1CEEA 2A78A 1LFDB 4XSHA 3T06B 5CM8B 3RS0A 2JJ1D 2AWOA 1RRFA 2IC5A 3C41J 3U6BA 1JPJA 3PV0A 1OF1A 1W36B 4LYJA 2FWRA 1Z0AA 1T9HA 4JVNA 5TMPA 5KSZA 2NQ2C 2ZSBA 1YZKA 4OK3A 3W6PA 2I3BA 5FOWA 4YMVA 4EIWA 4C2UA 3QXSA 4HLUC 2JCSA 3RC8A 3VX4A 4O25A 1U98A 1ZUHA 3L0OA 2GCNA 3K0EA 1E2NA 4LGMA 2XZOA 3A37A 2WTUA 4A8JA 3FGNA 5HCIA 4A4DA 1HT1E 2BMEA 2J9RA 4Z1MD 3KFXA 1E9DA 2EFDB 3I62A 3LLUA 1K8RA 2KE5A 4LHYA 3L2OB 4A36A 2JLVA 5FTKA 2Q9AA 1OIVA 1XXHA 3QKRA 4GL2A 3ECCA 4PQFA 1M7BA 2ORVA 2GBLC 2P6NA 2AHOA 3Q7PA 3T12A 4CGZA 4Q02A 4PO1A 5DI9A 2QZ4A 4YLGA 3P4YA 3G5UA 4B3FX 3VNVA 3N2IA 4G5QA 4WZBE 5HR5A 4IVPA 3SYKA 3UWKA 2V6JA 2ZPTX 5KSYA 1WXQA 1QBKC 1OFIA 2QAGB 1E96A 1JBKA 3DOFA 3OEED 2JLXA 1EK0A 2OFWA 3VHXA 4MA4A 2J7PD 4HAVA 4QBFA 4TSFA 5K8IA 1JAHA 2QT1A 4LY6A 221PA 3GJ3A 4EJSC 3TIFA 1HQCA 4ZI3A 4PC1A 2IF2A 1TUIA 4DT1B 3CB4A 4DEXA 3FKSA 4RFSA 2IBMA 1SVWA 2WWWA 3I92A 2VP6A 1UKEA 4IXNA 3EZ7A 4MGYR 4JYBA 1ZAKA 3IEUA 2XZPA 3PR1A 2J3EA 3R8FA 4G01B 1C1YA 2F1IA 4AYTA 4NE2A 1E9AA 2IYZA 2QTHA 4HAXA 5FTJA 1II8B 4I4LA 2QPTA 1KMHB 4A1FA 1UDWA 1II9A 1XWIA 4M1SA 1PVOA 4N1AA 3KL4A 2W2TA 4NYIQ 2PH1A 2I4IA 4BUJA 4GNKA 2QGNA 4GMXA 4L15A 2W6ID 2AD5A 3BGWA 4M9QA 4WIAA 5FR1A 4JLJA 3NEJA 1YR6A 1KI4A 2VF7A 1X1RA 3KKQA 2WOOA 4ZPXA 1I4TD 4HDCA 2RGGA 1ZJ6A 2GTPA 1P2VA 2OEPA 2PMKA 1KDPA 1IY0A 1LNZA 3D31A 4EPRA 3J81k 1CU1A 4US2R 1NMZA 2IUUA 1PUJA 1PLKA 2QMUA 2BMFA 3SYNA 1K6MA 2QGZA 4BFZA 4D4JA 1G8FA 4DDUA 1OH5A 5JJKA 2WPDD 4BEBA 1A5TA 3W3AA 1ETUA 4BFUA 3VHLB 1N5JA 4TYQA 1E9FA 1Q3TA 1B23P 2D74A 1F6BA 1F48A 3EAQA 4HLQB 2YINC 3VTKA 2C98A 2CEAA 4OHYA 3EPLA 2NGRA 2VL7A 3FFAA 4LJ4A 5FFMA 3TMKA 1W4AA 1ZD8A 4CEIA 1AZSC 3LH5A 1AZTA 5B58C 1G21E 2ZQ5A 5JHGB 4K46A 2F1RA 4QGGA 3TBKA 4B6FA 2J0QA 2IF0A 2VRWA 2WJHA 2BJVA 4Q18A 2KWIA 2WOJA 1ZMXA 2XNDA 3CF0A 4OQXA 2ZRKA 4QXAA 3I5YA 4M1TA 3K0AA 5G3ZA 1KY2A 3OZXA 4DHEA 3IHWA 4M53A 4K8OA 3TK1A 4F93B 2O8DB 4URXR 2IYUA 1E1QD 2ZI4A 4DLUA 4HB0A 1IONA 4CEJA 3EWAA 1AM4D 1G291 1Z5ZA 4HEJA 1X6VA 4B43A 3TVDA 1GL7A 1SXJE 3AF2A 4Q48A 1Q57A 1KK0A 4ZV4A 1WRBA 3DMDA 3P32A 2O8BA 4DCNA 3QVUA 1P62B 4Q9JA 2CDNA 2ZSAA 2W58A 4ZCIA 3QBTA 1DARA 1TUEA 1JXOA 2JASA 3I61A 3QY0A 2RGNC 5JHHB 1W0KA 2H92A 2VO1A 1OB5A 3NBFA 4RKEA 4F4CA 2EYQA 1NMXA 1E4VA 1G5PA 5H1YA 2IYQA 4AC9A 3U44A 3TW4A 1BO6A 4KFUA 2R6GA 4OK5A 3K1JA 1G3UA 3AVOA 3EASA 1KDRA 3QXJA 1W36C 5EE3A 3PQCA 3QG1A 1P61B 2ZAMA 3ZVLA 3RANA 2XAUA 2ODEA 4ZKEA 2DFLA 1MO5A 2GVZC 2Q3MA 3FHTA 2OCYC 1H8ED 4FD2A 4JLMA 4M9XA 4G0NA 3EW9A 2GESA 3OIVA 3PUXA 3ADKA 5AJVB 1G8YA 1OFHA 3ZIAD 3ADDA 2PZEA 4XVRA 4BRUA 3AVWA 4Y0VA 4MKFA 4XIGS 5CJ2A 1TAGA 5FOUA 2PJZA 1SGWA 4JSYA 1TQ6A 1Q21A 4FI3C 4A0HA 1UJ2A 1R0ZA 4EFLA 3GLFB 2V6IA 1E2MA 2QBYA 1E9SA 4MKIA 4C7OA 2J41A 1G4UR 3IQWA 5TB5A 1X3SA 4LJ5A 3ZYCA 4PR0A 2EU8A 2IW3A 5L3SB 4OL0A 1LF0A 2EFEB 4QNRA 5SZHB 3FMIA 3AUYA 4HAYA 3GLGE 4U7DA 3MMPA 3TQCA 3LX8A 3R20A 2IA5A 3DM5A 4KVAA 3ZH9B 1XMIA 2VSFA 3TRFA 1EXMA 1KZ7B 3SN6A 4LI0A 1NG1A 2ZJ2A 2HF9A 4F4IA 2F9MA 2OM2A 1CR0A 2QAGC 1OHHA 3T1OA 1KDOA 3QIAA 3C8UA 4W5WA 5HZHA 2HJGA 1N0UA 2FPKA 3U4QA 1N6KA 4F38A 2O8EA 5AJXA 4Q4AA 5FUXA 4MGKR 4P31A 3CRVA 2ZI3A 3VU9A 2GF9A 2JLYA 2QTVB 4TL6A 3O8RA 2HJVA 2WIBA 4JLAA 2IWHA 4CF7A 1AGPA 1Z29A 2D2FA 2JIZA 1G64A 2ASEA 2XEXA 3DPUA 1KOFA 1KAGA 2ZE5A 4IKEA 1E3MA 1N6LA 3QEJA 1ZVQA 4QG7A 2CMKA 4JSTA 3SHFA 2GJSA 1BKDR 2OXRA 3K0CC 5EQTA 2VYFA 5JRJA 3AVPA 5FUVA 1BIFA 3RRYA 1MT0A 1QZXA 2ZTSA 3ZVMA 4V0NA 1N5IA 1CBUA 3TSWA 1II0A 4NCIA 3T5DA 2GK6A 2G1KA 1ZBDA 1TEXA 5KNBA 1OXXK 1AQYA 2CK3A 1H8HD 5FBWB 2ZANA 1S4QA 4H9GA 5JWRA 4HDQB 4LOAA 3GLHB 3CNNA 1EWQA 2V7QA 2A9KA 4QJ5A 4DSNA 5DI3A 3H86A 3QE0A 4U02A 4AWXA 3SDZA 5C18A 1J70A 2FEMA 1GILA 3REFA 4B47A 3BB1A 2AX4A 4JBXA 5FPSA 1R8QA 1CTQA 4HZUB 1Z6XA 1XRJA 2CVFA 3PVSA 1E9RA 4GZLA 4C0KA 3Q9LA 3THXA 1VTKA 2ZRAA 3LXXA 4IDPA 5B2ZA 4TT3A 4PPGA 3QNUA 4HUQA 1CKEA 2D4HA 1RRPA 4QM7A 5EP3A 4DRZA 4PFSA 1UBGA 1WB9A 1I4DD 1ZC3A 1AK2A 1F2UB 1CXZA 1E1RD 3ZVRA 4WVFA 4AYXA 1DVRA 1RKBA 2X2EA 3A1UA 5CK4A 3RAPR 1GL9B 2AXNA 4DCUA 2P67A 5AUOB 5DHAA 1YR8A 3DVLA 1MO3A 5JI2E 4PO8A 3EPJA 4ESHA 3GCGA 1M74A 3BH6A 1TL7C 2R44A 4IHQA 4OQFA 1XEWX 3WMFA 3AF0A 2WWXA 4HUTA 4B71A 2ZS9A 4DSUA 5SZJA 3UPUA 4PSAA 1D2NA 1KI3A 1G17A 1TPZA 3IIJA 5EP2A 721PA 3K0SA 2VHJA 2V3CC 2AD1A 4DUGD 2FX3A 3UXMA 1GG2A 1MV5A 2B8TA 2HF8A 2NO9A 3TLXA 4DWJA 2GA8A 5JBQA 1KYIA 3MD0A 1NVVQ 1N2CE 4BPBA 4MYUA 3MLEA 1GKUB 4EPWA 5D3MB 2XITA 4BECA 4KODA 1U0HC 1VCOA 3VQTA 1JAIA 2IYSA 3E5HA 3KQNA 1G5TA 3Q8XB 1XBTA 4V0LA 4NP6A 2Z0MA 4BFTA 2GWHA 3MWJA 4GZMA 4PSVA 1FTSA 3PITA 4O2RA 2O5VA 3FKQA 1GWNA 4IEEA 2V1UA 2J46A 4KYUA 2NIPA 1F60A 4TYNA 1FTNA 3CR7A 5FTLA 1MABA 1M7HA 2C77A 2Q6TA 2RKOA 2QI9C 2PLRA 2REXB 4V03A 1FQKA 5FBRB 3TE6A 1IN6A 2HUPA 2V1XA 2FNAA 4NH0A 1L4UA 2VA8A 4UNNA 4LJ8A 3SQXA 2V4ZA 3LD9A 5E7JA 1EESA 1QDEA 5TV2A 4U5XA 1KI9A 2CJWA 2CL6X 1U99A 2HCJB 1FQJA 2V9PA 3NWJA 1XJCA 5A5GA 5B64A 4ABYA 2BCJQ 3DMNA 2AK2A 2BMDA 1OXSC 5CB8A 3I5XA 2CBZA 2ERXA 4B74A 4DDTA 4Z54A 3BAFA 3X1DA 4NBSA 1E9CA 4BQSA 1HH4A 4RVCA 4UXIA 3BFVA 3RSOA 5HE8A 4LV5B 2YVUA 3M6AA 3O8DA 4FMDF 1NLZA 2Q21A 3QF4A 2IHBA 3U2QA 4F91B 2CNWD 1PUIA 1F2TB 1C4OA 4ERNA 3V00A 4PX9A 1DE0A 4NYMR 4AK9A 3NBXX 4R71A 3AVTA 1KDTA 4PC2A 1A7JA 4B2LA 1XPOA 4BFVA 4IEIA 1NN1A 1R6BX 4PPQA 3E1SA 5EXXA 1ELOA 5JJLA 4QM6A 1DAKA 2RB4A 4LX0A 3PUVA 2YKGA 4D4KA 1BMFA 1KSGA 1S0UA 2VSXA 4DLYA 4UJ3A 5KU1A 1GOTA 4RD3A 3BOSA 2OBLA 1YR7A 2B21A 4Q66C 3HP1A 2NPIA 2A5DA 2ZE7A 1LF5A 4W5JA 4D0GA 3WNDA 2JLWA 4OI2A 3N2EA 1W7AA 1IQPA 1N6OA 1NL3A 2FSHA 3EC2A 3M1IA 4Z51A 1W4BA 3CPJB 4HSEA 2ZR7A 1S8FA 1KNXA 1AIPA 4PAQA 4TSFD 5EXTA 3PIRA 5JFGA 5P21A 4TL9A 2HXYA 5UKDA 3UWOA 2CCJA 3DZDA 3LBNA 4A2PA 4NONA 1GDDA 4Q7JB 2WJVA 4B76A 3WBJA 3BH7A 3BFXA 4MUBA 3TSOA 4MGIR 3NVAA 4TQ9A 1DAIA 2NPFA 3SBEA 3AGPA 4A8JB 2QA5A 2VTKA 3EPHA 5J4HA 3QBVA 2QE7A 3GFTA 4B3CA 4S2EA 4JLOA 1JB1A 2ODWA 1Q0UA 2CXXA 1XXHB 3QKRB 3AKCA 2QROA 1FL9A 2RGEA 4YDSA 3VR2A 4YXWA 4EAQA 4IDHA 5EZ6B 1R10A 2XX3A 2VPPA 4D25A 4KV9A 5CDFA 3LBHA 2REOA 4I99A 2FFAA 2ORIA 4L5BA 4LSGA 3CM0A 2NZ8A 2DR3A 1AN0A 3A4NA 1FZQA 4PQYA 2OFOA 4MYTA 3D7MA 4LYAA 4BLPA 1FMJA 4MQBA 1O3YA 2IYWA 1IOZA 2B8WA 2DWPA 2FH5B 1E2QA 1GZSA 1NY5A 3RC3A 1JR3A 1HT2E 1IBRA 1YJ5A 1KI7A 4HLDA 2H16A 5DLQC 2A3RA 5KPDA 4P32A 3ASZA 4C30A 5DN6A 3RVBA 1MRSA 5SZIA 4RFSB 1UADA 3FTQA 1R5NA 5G53C 1SZPA 1Q20A 2ZRCA 2JA1A 2OAQ1 3IHLA 2XNDD 3RS3A 2ZRNA 1IJEA 1SVOA 1E2IA 2ZRHA 2BBOA 2G88A 1N25A 4TMKA 1U9IA 4KYIB 4DC9A 5CITA 1E99A 3AVYA 3LY5A 3B1ZA 4QHTA 1YQTA 3SYLA 3BJIC 4JKIA 5FI0B 1ZU4A 1A1VA 1CJTC 4Q47A 1R2QA 2WIAA 4D0NA 1IN5A 4EPTA 4JBWA 4MH0R 3KQUA 4KFTA 2JJ2A 1CJKC 4H1VA 4KSCA 3GJXC 1FOEB 3OF5A 2EFHB 3ND9A 4ARZA 2Q3FA 4IFEA 2GAOA 1YR9A 3W6OA 1M6NA 1JEDA 1G7RA 2Q3HA 4D0LB 1G3IA 3K9HA 1E6CA 2W6JA 5FI1B 4NDZA 2CHVA 4Q5IA 1NMYA 2VBCA 4R2IA 2VP5A 3KB1A 5G3YA 3SE0A 1XJQA 3I8SA 5HPYB 1P6XA 4Q1CA 2YHSA 2F1HA 1N6RA 4TYWA 3AP1A 3RNLA 1KI2A 5JJIA 1Q1BA 3C4JA 3NIBA 4CEIB 3IIMA 2G3YA 4JKYA 2D7DA 3TAHA 1YZUA 3HR7A 3TSZA 2QQEA 4LRWA 3DKVA 3OFNA 3ZZUA 3IKJA 3AP3A 2AN9A 3CONA 1VKJA 2GJAA 1JALA 1XF9A 4Q4HA 2ZYUX 4V0ME 3K0AB 1NBMA 4BLTA 2ZUCA 1MR3F 4DIEA 1QHGA 3PUWA 5TXGA 4F92B 4G5RA 2KB0A 2J87A 1Z6YA 1I4LD 3HU1A 5HE9A 2ZEJA 5BYJA 4XWKA 2ZE8A 5JZVA 5AK0A 3L8YA 2Q9BA 3V4RA 4UNSA 4NYMQ 2WV9A 2YOHA 3MRSA 4XVQA 3IO5A 5J5CA 3OEHA 4ZDKA 5CYPA 5J4VA 5CJPA 4CEJB 2WKRA 1N6NA 4BFYA 5E95A 1AKYA 1CR1A 3FVQA 4NCJA 4DBLC 5C2JB 1KK3A 2O8BB 3U7GA 3MWLA 3OHMA 3AKDA 3SZRA 1AS3A 2P3SA 2HEIA 1ZRHA 2QP4A 4AY2A 2P6UA 2XB4A 3K09A 5IK2D 2BJWA 2QENA 2YZ2A 1K5GA 4I81A 2VP9A 3B5JA 3IUYA 2CCGA 5BXQC 2LWIA 2H8KA 1YZLA 5TY0A 4ZI2A 5DYIA 4KITB 3U44B 4W9MC 4YMTA 2ZJZA 4BZXA 1OV4A 1G1MA 5J4YA 1W47A 3Q5DA 1JJ7A 1QF9A 4B33A 3B1VA 3GP8A 1LS6A 1HA3A 2R6DA 2JIZD 4ZCMA 4LWZA 4ZDJA 3PEWA 2MSCB 3CRW1 3WYFA 3UMSA 5HKKA 2OT3B 2C9YA 1X8JA 3SS8A 3I32A 4HLUA 1G4AE 1VG8A 5H68A 3RS2A 1XCPA 2Z5FA 3WMGA 2WHXA 2F1JA 3UMRA 3EX7C 4RZ2A 2YV5A 1GFIA 3PEUA 4A8JC 1TEVA 1CJVC 3MWKA 2N1BA 4B3BA 1FPMA 3F0TA 3WP1B 3EWSA 1FUUA 1NVWQ 1XNJA 3HDTA 5GVRA 3B9PA 4ZDWA 1TQ2A 2QBYB 4C7OB 3H0KA 1X8KA 3K9LA 3R9WA 2JDIA 1TNDA 1NNEA 2J59A 4JVSB 2CK3D 3NDBB 4JLDA 3IQXA 1E79A 2IUSA 5E7MA 1Z06A 3LVRE 4DCSA 1OSNA 4QOSA 2WWHA 3NG1A 1XU4A 4DZZA 2QRZA 2V7QD 4RKFA 2D3WA 3VX3A 5BN3A 1NIJA 1SVSA 2VH5R 4MYHA 4OJQA 1Z63A 1I2MA 2QP3A 3QJYA 2JGNA 3CPEA 4PHTA 4YONB 2WMOB 3AM1A 4L4UA 2P5TB 3U4QB 2O8EB 1T3HA 4Q4AB 3QPWA 1IN4A 4ASUA 4C0LA 3VU9B 3EA0A 3NC0C 2AL7A 1U94A 1VG9B 4TT3D 2ZI5A 4XJXA 2WAYA 1MO4A 3GJ8A 5FTNA 4Q03A 4EPXA 2BVNA 2ERYA 5L3QA 4PPNA 3SJZA 2VQSA 1LB1B 3U6KA 3GLIA 1VG1A 1Z0KA 5LBIA 4EPVA 1ESMA 1US8A 1Z07A 4US1R 3RDPA 3MJHA 2GEUA 3IEVA 4GMDA 3V9PA 4QJ4A 1E9BA 5BN5A 2JLRA 4URWR 3KDSE 2R6AA 3QKSA 2VEDA 3ZS9A 1ZC4A 3PEYA 3MFYA 1T0HB 1KSFX 3A1TA 4RZ3A 1Z8FA 1IXSB 2IHYA 1ZU5A 4HAUA 4TWZA 1KK1A 4W7SA 4CDGA 2KBEA 4LBZA 4EKDA 1SQ5A 1B0UA 3OIUA 2DY1A 1W44A 2FFQA 5FH9A 3VR6A 1JQLB 1R0XA 3AH8A 1JI0A 1GVNB 1VCMA 4UNPA 1FW6A 3ZD6A 1YZTA 2JEOA 1H65A 2Q0HA 1EFTA 5DI3B 1DTSA 3QKTA 4O3MA 1Q22A 1BYUA 1U8YA 1U0JA 2QMEA 2ONKA 2WJGA 5FL7A 2PMDA 5F9FA 2ODNA 1HUQA 1PLLA 2FPMA 4TN1A 3GEEA 3KKMA 4P3YA 1AJEA 3QVVA 2PZFA 2CL7X 2E1RA 3BB4A 2OO7A 3RYTC 5H70A 1N5LA 5LDDC 2GF0A 3K8YA 1S1MA 1M7GA 3B2EA 3THXB 2FMXA 1KY3A 3FYHA
chains in the Genus database with same CATH superfamily
1NTRA 5DLEA 5E6UB 2ZJOA 2MT9A 2I03A 1SA0A 2CLCX 3DLIA 1SCNE 3SQNA 1I2BA 2V0CA 2I1WA 2IL1A 3IOYA 4A92A 5G4YA 4Z9AA 4WXEA 4QFMA 3LCUA 2B4YA 1Z2AA 1W46A 1JFSA 3M4YA 1XEAA 4ID4A 1EXWA 2JFVA 5ICGA 1YWGO 1EXNA 3RV3A 3KPJA 4Y1RB 5MN5A 3ZWYA 1SCAA 5EVID 3DTVD 3JPUA 1NVGA 4D0SA 3IAXA 4XWTA 3NGXA 1M34E 1PI3A 4E1VA 3KLPX 4R7ZA 1UPTA 1EFPB 4E07A 2D13A 2FZ4A 1D9ZA 1UZAA 2QG6A 2O9BA 4BGDA 3WHLA 4OSPA 4Q9NA 2HD4A 1RRKA 2CGEA 4DB4A 3ZLTA 1U90A 4ESVA 3DUWA 2ZGVA 4FJ2A 1C41A 2IZ6A 3FZGA 3VR2D 1MIOB 1MLDA 5EVIB 5HFJA 4YHHB 4YH1A 4R98A 3HZHA 1EVYA 5EEHA 2RDMA 1S3GA 4I3IA 1ZM3A 1MFPA 3WB0A 3ICQB 4Z8YA 5C4GB 3SYTA 2ZDQA 2BDEA 2CF6A 2MSEB 3FMGA 1ZWLA 4RU1A 3D2BA 3L43A 1P2FA 4C5AA 3MELA 4G3KA 4NG5A 1OLOA 5EP4A 1GQRA 3FFWA 3C16C 4CQNA 2C59A 3PG5A 3ELBA 3TLMA 1MUUA 3LVFO 3ZJUA 4KZPA 1YLWA 3ULFA 1YQSA 4K0WA 4BZPA 2BMJA 5FBZA 5EM0A 1Q7CA 1Y7HA 1S02A 2VWQA 4U00A 4IOKA 1T8UA 3P0HA 5A04A 4Z0PA 1RCTE 2HBRA 1A1SA 2ZJBA 2ODAA 3H1PA 4DLXA 4OBXA 2DPHA 2YV2A 1FYEA 1P3JA 4JX9A 3P27A 2GJ9A 1GPJA 2DFPA 1BGWA 3RFTA 4RULA 3C6XA 4MP8A 4EK9A 1I30A 3KEGA 3GZTB 1Z3IX 3NEPX 3I9NA 4NZOA 4JLNA 1PJSA 4OKSA 5KVSA 4H35A 1DDOA 2VZEA 5ECDA 2PYDA 1QHNA 1CEFA 3BCUA 3OCJA 5GOZA 1C7EA 2WZDA 5DEOA 1QH0A 1K0FA 3KCQA 3IAAA 3PNLA 4M87A 4NI5A 4DV4B 4XUXA 2YHUA 3PXEA 5KSPA 1GQQA 3K3CA 3EZ6A 1I6KA 2FMHA 1KZGB 3HLYA 4CIWA 3LNCA 5GONF 3AUJB 4LXGA 3G6OA 3LLSA 5DF9A 1SKAA 3T4EA 1C80A 1MP0A 4PQRA 4ZHSA 1U0FA 2XYQA 2C95A 1A9TA 4J0CA 2HMUA 1P6QA 1XQXA 4MHTA 1CIPA 3NDJA 4BIIA 3KQPA 1M8PA 2VDQB 5E2IA 2CHFA 1DKLA 1FNMA 5BOSB 4AO6A 2GBIA 5BMOA 2CUNA 5AVKA 3FKWA 2AEMA 4DJTA 4JQOA 3I9JA 2A9FA 5ALRA 3PEEA 5FYQA 3K6JA 1ENYA 4DQXA 1QHIA 3U49A 3RV4A 2X5JO 1H85A 3PFHA 2ACGA 5BN5B 5EP1A 2O48X 1Y6QA 2HZ7A 5EHGA 5KHLB 2ORED 1UM8A 5EHNA 5KTSA 2W8BB 1T5DX 1Z4MA 4LY9A 3KB6A 3I34X 4X64B 1T1GA 1G41A 1YCHA 1SPBS 2A9VA 2WF5A 3NQ41 1EVJA 5HOEA 3MTGA 4RPJA 1KU0A 3D5EA 4LZOA 4HXEB 4M1OA 3EZFA 3HVFA 5G2OA 2X6TA 2EW1A 3EEIA 1JVJA 3Q82A 1EINA 4MR8A 3G6WA 2J3WA 3TGPA 5J7EA 1YRLA 3UYKA 2JVIA 1GSAA 5FUYA 1AH2A 3L0IB 1NKSA 1FY2A 2H2AA 5CLQA 5TF4A 1GQSA 1BH6A 4JT2A 1DRKA 1VPEA 1Q12A 2DWQA 3VR4D 4M0DA 4W1QA 1V96A 2FFBA 2EKZA 2OHJA 1GNRA 5KS2A 3OE7D 2IA2A 2UU9B 1DG1G 5G1PA 1S66L 2KOIA 4RFLA 3W2GA 1SQSA 4Q1DA 5I9NA 4M9ZA 2JEYA 1E1CA 5EJ8A 3OFVA 3IKVA 2XUJA 3HBJA 5C7IO 1XEXB 4LQ4A 3OSUA 4RJLA 2GCOA 2ZDHA 2CV1A 2XUHA 3HL4A 1L8QA 4CIAA 2ZROA 3EGWA 3OQHA 2NTNA 3L1UA 1W85B 3KSMA 4RTLA 4BO7A 4YO7A 3E5MA 2WF9A 3DW3X 5F9HA 1JF8A 4BBTA 3GA5A 1M2GA 4Y5FA 4ETZA 1R9GA 4PM7A 4CG2A 4ZOQI 1JGTA 4PC3A 3W90A 2Q5IA 1A0KA 3FTNA 2BDTA 1NOKA 1T6XA 2YMMA 3A70A 3LBAA 3A6HA 1CUJA 1SU8A 4WKCA 3DE7X 4M1YA 4KR2A 1NAIA 4MRRA 4TLEA 4F3TA 4GR5A 1K54A 1ECCA 1IWBB 1YC5A 2LCFA 1PZGA 4V0OA 5HDBB 4PM8A 1RZ3A 1Z45A 4FWTA 1KIAA 1SHKA 2OILA 4JB0A 3S7PA 5C8ZA 4FT4A 2FRVA 2AC7A 1I0LA 3DD1A 3DEYX 5TQ2A 3A1CA 2WT8A 4ZZ0A 1U0BB 5M2QA 1KH2A 3UT6A 3RT7A 1JWBB 1E5TA 1VL1A 2NUTA 4FTXA 4Q3EA 4X8LA 5LKRA 4M38A 4IIEA 4DIFA 3WDSA 1BULA 4WOPA 2PL9A 3I0NA 5DB4A 2PUCA 1ULTA 3F8WA 2VHXA 3GGJA 2KX6A 3ZXXA 4QFBA 4H7DA 4S24A 5IEJA 1PVVA 3OU6A 4RYLA 1QJCA 3CRMA 4G0WA 1FJ2A 5JMPA 1ML4A 1BKSB 5HCUA 4J76A 2XWJI 1N75A 3QXHA 1C9KA 4BE9A 3T8YA 1I4WA 4GOOD 1WHTB 3G35A 3MG9A 1GU7A 5JT1A 4XWOA 1P2TA 1SXJC 4L73A 1U2RA 4KACA 3X2SA 2PL5A 4IJGA 2ZYIA 3U1TA 5EHZA 4HEFA 3H7IA 3BMXA 4BMDA 1B8OA 1XVLA 4BVHA 5LZ2A 2BBTA 4H3HB 2XBMA 5CT8A 1Z0JA 2ZJ0A 2WKWA 1X9IA 3C3AA 4GWLA 3THWB 1U8ZA 2JRCA 2NYVA 1DBVO 1DT5A 3TAXA 1Y1PA 5GTDA 4J6EA 1J33A 4HEHA 2EA9A 2IS1A 3BMQA 1X92A 2Q1XA 4HHDA 2XGSA 1H8MA 4HYQA 3NDPA 5HAPA 1E2DA 1SUCA 2D1RA 3V4LA 3OFND 5JSZB 3HUMA 4URYR 2YQ4A 1YE8A 4A0RA 2VF8A 4P54A 2CF5A 4P7GA 3FYZA 2WPDA 2B4RO 1N8SA 5FPYA 4OQQA 4EO9A 5KO2A 1DMSA 4ENPA 3PGVA 1S3SA 4QUAA 1P1BA 3FYSA 4AYWA 4BLVA 4CN8A 2FPOA 2XQJA 5TSDA 4BMPB 1U8AA 2IV2X 4URHA 4UMEA 3D6VA 3ZY4A 2P11A 2WE8A 5AW8A 2P91A 4IV0A 4X54A 4BL3A 4DLLA 1WETA 1P4RA 5DNWA 2PUBA 1EDDA 4QU0A 1GPLA 4GT1A 1TCBA 3AWDA 3UOAB 2P9CA 3MF0A 3RQIA 2CMFA 3DTVA 3QXGA 4D4IA 4CEHB 3ASYA 2FVYA 2X0KA 1ZA2A 3WY9A 2AOUB 4LUCA 3RBZA 3OESA 3V8BA 2HAEA 2VXBA 4U2DA 1JPVA 4DG8A 3ZE7A 2REBA 1EG2A 1ZZGA 2QTGA 4I19A 1GKYA 1L4HA 4MWBA 5DNCA 5JQGB 4G5OA 4ND3A 2Y2MA 3TDKA 1A2KC 3KYIB 1AKNA 2HK9A 1AQLA 1JU4A 1NATA 4TS4A 2OCPA 3I0MA 4JI0B 2BFFA 4FFVA 5TQJA 2KJQA 2XZLA 1KRWA 3V6MA 3N58A 3WLHA 5I7EA 4LX8A 1Z28A 2ZYDA 6AT1A 4E2WA 4FS8A 3LHFA 2PZMA 4EHLA 3V3TA 4DJEC 3IS2B 3OO1A 5H0IA 1VGRA 5K0GA 2AG0A 7REQA 1LLCA 1LI9A 3QELA 5IZCA 4MUYA 3OT1B 5EJIA 4IIXA 3MCWA 3RB8A 1RPZA 2FG7C 1Z6FA 1UBFA 4DA9A 5I51A 1QHHB 3B70A 3JQFC 2QORA 1YIAA 1K89A 1LDNA 4FSHA 3ZGOA 4Y17A 2PGOA 4AM8A 2G83A 2FVXA 1X7DA 2DSTA 3NOOA 4OOFA 3OQBA 5EQJB 4BNDA 4FYKA 1VMAA 3KQSA 3DG9A 1YJQA 4FKZA 3ZKWA 3HUNA 3GNSA 2O1WA 4FX2A 3FPBA 2HR1A 2R66A 1V16B 3EUWA 1I3OA 2IGTA 2C78A 1NURA 2PKXA 4YI5A 1RRFA 2M7VA 2CJXA 4CCSA 5KSZA 3R3XA 1BDMA 4C21A 3UHJA 3BA6A 1LX7A 2XDWA 1BS2A 2PR2A 5DYYA 4A8JA 1KJ8A 2ZSIA 4BYMA 4MW6A 5DLYA 3KOOA 2H11A 4GL2A 1X2EA 4RW0A 4J07A 3GMIA 3T12A 1MD9A 2Z04A 3TJZC 3RYFB 1GV1A 3VC7A 5HR5A 2V6JA 1CPYA 4KKVA 1YAJA 3GWZA 2RJNA 3GRCA 3C8CA 4DT1B 3RYHB 3K2EA 2ZUVA 1C81A 4RTRA 3D6AA 3DNPA 5IYZF 1OU4A 5AKKA 3VKUA 5JSFA 1OTEA 3D8HA 1FC0A 1XCJA 3DVAB 3LHKA 4LHSA 4RVDA 5C3MA 2P7HA 5KJCA 2CMNA 1QZTA 4TXJA 1CZHA 5JJKA 2P90A 3W3AA 3TG2A 3PHJA 3VTKA 5B7GA 4ID3A 3FFAA 3RFCA 1WD7A 4LIPD 5AK3A 3Q7SA 3KK0A 2MR6A 2EHDA 4M1TA 2C7RA 1QS0B 3F6SA 2FUCA 4WJLA 2QTNA 1I2WA 3N8RA 2IYUA 4HB0A 1DSSG 5K45A 1BX3A 1PWXA 3I05A 5IJ0A 3P32A 4JC0A 4X7PA 5A71A 4KPGA 2ZSAA 5TT0A 3UPTA 3DCNA 4NENB 1DKUA 4MX8A 5KTRA 1OZAA 3CW8X 1RGZA 3VSDA 3KSHA 4RA6B 5ER6A 2CN1A 2UDPA 2HDOA 4ROSA 1H8ED 1S7GA 2M32A 1G8YA 4RJTA 4MKFA 3OA0A 3NR2A 3HY6A 4LMRA 1TQ6A 3HBNA 2FJ0A 4HF7A 2V0UA 3Q87B 3UV6A 3CMCO 3IVGA 4U0JA 2IZ0A 2MOKA 3LX8A 3R20A 5LJLA 3FSGA 1NG1A 1TM1E 3GQBB 4CR6A 3T1OA 4W5WA 2EERA 5AJXA 1XLTC 4BKQA 1RVV1 1LSWA 2JIZA 1E1KA 1XDZA 3TRHA 4NH4A 4QJIA 1S3IA 5LYYA 1O0CA 2A9QA 1WXWA 2ZLBA 3RRYA 3J7TA 4CKZA 4OG2A 1FOFA 1WP4A 4GUDA 1HYBA 2YZGA 4ND4A 1W4LA 4HSGA 2PGJA 4KMOA 4AQYB 3ORYA 4AJNA 5ADHA 5DYNA 4L57A 2W2NA 4FB4A 4MW5A 3ZI0A 1J5XA 4JZYA 1U8XX 1PZFA 5DJUA 4NXNB 1UAYA 5A93A 2EARA 2VYVD 2CWDA 3PC3A 1JDPA 2X2PA 4IHQA 4YRPA 4XGNA 1R50A 3K6KA 2WJ3A 3PRHA 2AZXA 1E7QA 3EEYA 5JBQA 1F06A 1DG9A 1N2CE 4D9BA 1Y8QB 1L5VA 3HCDA 2PZJA 1X9GA 2B61A 5IH7A 3HWWA 1PHRA 1G5TA 1K86A 2GM4A 3K94A 3QWAA 1TD5A 2A57A 1FW8A 5ALNA 4P7BA 4V03A 1SC3A 4E4YA 3N2GA 2WFLB 4QYWA 2IV7A 2FW6A 1U99A 1XF1A 1E7MA 1GNVA 1ZTUA 4CL3A 5A5GA 3PHIA 2NYRA 3X1DA 4HTAA 4R2KA 2YVUA 1YK1A 4BBPA 2P9VB 1ZN2A 4ERNA 2GPTA 4DQDA 3V00A 5DTJA 1ZC2A 1DE0A 4KDFA 2D1TA 1LJLA 4N48A 1HNNA 3H2KA 1QX3A 4EB6A 2RB4A 3B9BA 3T7AA 3SPXA 5BR8B 4MV7A 3LI2A 4HEA6 3UUWA 2QR2A 4R3WA 2NPIA 4EGFA 3AIOA 2L42A 3M1IA 5EXTA 1HMPA 3OLQA 2M6RA 4MDHA 4I8DA 4YJ2A 1ONGA 4I46A 4PYIA 3PC4A 3QGMA 3ECSA 4IS2A 1Q2QA 4S2EA 4WYYA 3I4FA 2ENUA 4ZBEA 2EFYA 2CXXA 4J2OA 1TIPA 1X80A 5T3YA 2MSLA 3TRIA 4PWYA 2ORIA 5L3ZA 1PSZA 4R6WA 4JOQA 1RLOA 3W0LB 4X68A 3CEHA 5DNAA 1T26A 3V2UA 1HT2E 1W5AA 4BO8A 5GP1A 3C6QA 3CRNA 4N8SA 2OGUA 4L9RA 1IK4A 4D8TA 3PGKA 5HMLA 3TZLA 2JD1A 1LJ8A 5I9LA 1ISMA 2B2XA 1F8XA 4NBUA 5ALVA 2P8JA 1I3NA 4A5OA 4RESA 2W48A 4KSCA 3OF5A 4MQLA 1REQA 1M6NA 3EIUA 4IIDA 3UDIA 3M49A 3O3VA 4AJIA 2IITA 4S2PA 5PNTA 3D3EA 1PSWA 2Q4RA 3TAHA 3DKVA 3OFNA 1F0YA 2AN9A 1CY6A 1QMFA 4I36A 2V1ZA 2DP4E 4JT9A 3RJ5A 2WUFA 5K3OA 2WKRA 4BFYA 1POXA 3WGGA 1UOQA 5ITWA 5M34A 3KKLA 2IVFA 1T29A 4FZ5A 3S99A 2HEIA 4KR9A 2P6UA 1PG0A 2BFBA 2CCGA 5JZ9A 1O5OA 2ZJZA 4CQJA 1FZTA 3S68A 3B1VA 3DHNA 2VBFA 4TV8B 2X9QA 3RC7A 3X43A 4FILA 2EW2A 1TVMA 3ST7A 4HLUA 4J1TA 1K7XB 3KXPA 3UUFA 3WP1B 4EAAA 3O8QA 1XNJA 1TQ2A 3G5LA 3B6KA 2J59A 2HLNA 5JXHA 3IC5A 3LF1A 4UHUA 2JD0A 3WGHA 4L4UA 4ZOLA 4M8LA 4C0LA 3NC0C 1NPYA 3OQMA 1E5DA 4PPNA 4WN9B 2C0PA 4Y1EA 3DHEA 3TSCA 3FAKA 4EY6A 1NONA 1ZC4A 1ZU5A 4TWZA 1M1NA 3CEPB 1SQ5A 3R5FA 3TCKA 2QN2A 3KSBC 1LPBB 2WAOA 1PBNA 5GLCA 5KC8A 2FKNA 3L84A 3V8RA 5FDHA 5K6AC 1BXRA 1N5LA 5T4EA 3B33A 1X19A 4ER7A 3E53A 4KRXA 1C2YA 4L2IA 4EA6A 3DHWC 4OI1A 3TH5A 2II6A 2WGWB 4J4TA 3MC1A 4RE6A 1UMDB 2C9DA 4WW0A 4IJ6A 4G0QA 3AHGA 2B8JA 3X0DA 2J4FA 2WICA 1PNOA 2DULA 1SD2A 4EW2A 2ISCA 4QOIA 1OLXB 1P2SA 2HQOA 4CPKA 2H57A 1G5QA 4KUHA 1ZH2A 4GD3Q 2IOYA 3C3PA 3HK2A 1G5FA 3UUGA 3F1LA 1PV4A 3P7NA 2ILTA 3QRWA 5H9WA 3B1KA 2OAP1 1YTLA 4ZPJA 2Q3JA 1EWRA 1T0IA 3DR5A 4QODA 3SXPA 3MMHA 1YDWA 4GECA 2D0OB 5GQSA 1SIUA 4FFWA 4G0YA 5M18A 3E4QA 3GFGA 3JVVA 4GBJA 3F8SA 2NXEA 2VH1A 5J2UB 4DTIA 4BB0A 4BMWA 4LK3A 1CF9A 1I2AA 3FMPB 3AINA 1EJ0A 2RBGA 2A94A 1NVMB 1XIVA 1QIHA 4QYXA 3FPHA 4JLWA 5K0NA 3WGTA 3COZA 4ZMSA 1TA0A 3O0DA 5IWAB 4ZAFA 4ETIA 4IFIA 4LGCA 4HQAA 1A97A 1ICEA 5JZMA 2W2MA 3BWEA 2HDUA 1HD8A 3H0CA 4GLLA 1KO5A 1NW7A 1CUCA 2H1FA 2INWA 5FAPA 3CEJA 3W8FA 4P4SA 1IZ0A 1UJCA 5AOVA 4PG7A 4HH0A 1Y82A 1E98A 2RHTA 2OCBA 2QM0A 3OTOB 3FFTA 3ZG0A 1C3LA 1TS8A 4GMKA 2MR5A 4EBBA 1C1HA 3NXKA 4I5FA 2GMWA 2PT7A 5BSGA 2ZUWA 4L8YA 3VC1A 3IIIA 1U5AA 3SZUA 3OEHD 2QTWB 4HY3A 3P9CA 2ZP1A 1JQJC 1B76A 3DVSX 3I01M 4KZ7A 1HL7A 4UE2A 2JVKA 3AUXA 1SUPA 1J8QA 2PHZA 1CY2A 2PKQP 3CURA 4TL7A 5HARA 1UWCA 4EG6A 1IAQA 2OCKA 2AFHB 3PU6A 3BZWA 5GJBA 1YQWA 3KFLA 2FSFA 4IDQA 1JG1A 3GYBA 1UP4A 1L4EA 1O08A 1RPAA 3C74A 3FZYA 4LJ9A 1SWVA 2GBCA 4FC7A 4F1JA 3GUCA 2UXBB 1CQPA 3SEAA 3O91A 3PB3A 5JCOC 2GXUA 3I12A 5EIBD 1DTEA 4FLEA 1ODCA 4NEHB 3Q98A 4JLSA 1XMJA 1RRCA 1YRWA 5JC8A 4HNHA 3LEQA 3I42A 2HYIC 4MRMA 1L1EA 2NZUG 4US0R 1NFRA 2YX1A 4G5FA 1XVVA 4OA5A 1S5PA 2Q2OA 5AKIA 2MTBA 1LW7A 3V4SA 4IX9A 1GXSB 5FHQA 3TTXA 1XL1A 3T9CA 1YJAA 4FMBB 1B2LA 1PZNA 2AI1A 3DDZX 3NRBA 3QUBA 5E2FA 3THOA 2C96A 1KFKB 4H6JA 3H0EA 2I54A 1DIOB 4XCQA 3GG2A 4TKUB 4BXOA 1U0SY 2OHVA 3SHQA 1LKZA 1MPXA 2V4UA 4R1NA 3S1AA 2O0HA 4D8XA 2QG9A 4KO1S 5C7LO 1EFCA 3PWTA 5DFXA 4PV7A 2FWPA 4LC0A 4LVOA 3H2GA 3TFQA 4M0FA 3DEAA 4QBGB 2BMWA 1L5SA 2NO7A 5DM2A 5AW3A 3V1MA 3E22B 2I2AA 2ZYTX 3C70A 5KSCA 4HWTA 2IDMA 2OTCA 2KDKA 1UR5A 3IP5A 1Z6TA 2J5BA 4MPDA 4D4MA 2LIPA 2A4MA 5CTNA 5EGSA 1SA0B 2PUTA 2GH1A 2PGXA 3OKPA 1J23A 5LC1A 4R0NA 3DEKA 5KJEA 2PZAA 1KDYA 2V8FA 4PXYA 1PT5A 4LWPA 5IT0A 3MS4A 1QIDA 1KERA 1VGVA 1E6LA 3LLCA 5LN1A 3WAJA 3QENA 4DMLA 2VP0A 3T61A 5FRDA 3T52A 4Z4CA 1LDMA 4IIBA 2XR1A 3MGKA 2D2EA 4FOTA 2FUEA 2XODA 2LE0A 3K9FC 4MBKA 3ACCA 3VMFA 4GPAA 1PV1A 2FU5C 2OAEA 1EUDA 1G7TA 3VA7A 3M9WA 2YIVX 1LVUA 4GS9A 2B37A 4PPYA 4NQRA 3BY8A 4LJAA 3CUKA 1K57C 4BD1A 2AUNA 4IFTA 4NK3A 4FGKA 1KNQA 1UBOS 2YNMA 3U40A 5MN4A 2YMLA 4UW9A 3T99A 3ONFA 3WLPA 1CG6A 5AVOA 3N87A 5LWQA 4L0LA 5L6LB 3RCBA 4NCKA 4B93A 3GH3A 1T9AA 4EUEA 2O23A 1D1TA 1HE8B 1OPXA 3BCHA 1WYCA 4A0GA 2J3TD 2D06A 2V1AA 3LKVA 4FMCF 2P2SA 2P75A 3QHQA 4JROA 3FI9A 1YMQA 3DE4X 1QG4A 2Y2LA 5FIUA 1WMEA 2I1QA 3AM4A 2FW9A 4ED9A 1AKEA 1BH2A 3SJAA 1U02A 1NHWA 1QGUA 2O2CA 3PE6A 4IG4A 3CPHA 3B51X 4UUPA 2O9AA 4QU5A 2ZM5A 3V1YA 3C30A 4G0OA 4YBZA 5F12A 1I4EB 1J56A 3JQCA 2GHIA 1OT3A 5LM3A 1QZZA 4KV7A 1FFXA 3B7GA 5ALDA 1CULC 2G70A 3H1TA 3RKRA 3WXMA 4O4LF 5ERYA 1WKCA 1YRBA 4FCFA 1Z39A 4CKXA 3U62A 4IXWA 2HHCA 4KRFA 4WOJA 1NN0A 3C87A 3Q2OA 3STVA 4XT2A 1BWPA 1VI5A 3LIEA 1LBQA 2F1OA 1LLBA 2GVDC 3ZDEA 4YPVA 5CDYA 3IPYA 4Y2QA 1RXIA 2XCRB 2Q0SA 1CDOA 2PGLA 1ISIA 1A5ZA 2B99A 1SVNA 4DV5B 3CLRC 5LKAA 5BOHA 2ANCA 2QE7D 2DT8A 4L6IA 1FQGA 1Q1NA 1Z35A 1W59A 2X2OA 4TL8A 4YCDA 4YCBA 2JGLA 3KR9A 3GLQA 2P9JA 4EXOA 2WK1A 3HB5X 5EE8A 4G1EB 3RUHA 4LTMA 5DIFA 5DN6D 3ZXYA 4WT7A 4KE7A 3X1WA 2QJFA 2FZCA 1DJLA 2VJQA 2Z58A 5JAIA 1F5NA 1Q0SA 5J5AA 2VZ8A 3A0UA 3A31A 2WYXA 4QDOA 1XWWA 5KOYA 2GARA 2D0IA 2A2LA 3SOZA 3ZKAA 3JQ7A 4KPYA 3M0EA 2PO5A 2B82A 3E4CA 1YQUA 4NHEA 5CCEA 4I3GA 2VRBA 1AHHA 4B9EA 2E6KA 1J0EA 5T6BA 1ABEA 1P9WA 2IHUA 3AIKA 3DSRA 3JQGA 4HYTA 4I5DA 4YAEA 2OBYA 5EOVA 4GMGA 1X86B 2ZJ8A 4HL6A 2N47A 1I3KA 5AQEA 5A9RA 4QL3A 3UY6A 5IF3A 5E2HA 3MHPA 1G6Q1 3OZ7A 5CCBA 1A8IA 3D1LA 1WDWB 2E6UX 5TBMA 1P5ZB 1V4BA 2B0CA 2C2HA 4PHFA 4UHHA 3SYMA 1H2WA 3ZPXA 3KXLA 3CSDA 2YN4A 1FJHA 4F2DA 3DXXA 4L72A 5ARCA 2H4FA 5L3SA 2EL9A 2W11A 2JPDA 3L7BA 4EHKA 1QR2A 4EX6A 2OQRA 2XCQA 1BG6A 1ZIXA 3A6FA 2HJSA 4DDVA 3LR3A 5EMLA 3CWQA 3OCNA 4ZRMA 1RU3A 1UBUS 4D9CA 1Q74A 4ZO4A 1Y80A 3IT1A 5CXXA 4AJEA 3GBSA 1P97A 1GTVA 1M8GA 1J8FA 4ITVA 2M98A 4UVGA 4B3JA 4Q00A 2ZIVB 2Y2KA 3OTHA 3VSCA 1UBKS 3LY3A 1W4CA 5BT9A 1QIIA 4JC5A 4FHFA 4ETXA 3FMFA 3V34A 1SMKA 3TRKA 2W1TA 2Y1GA 1E1CB 2JD2A 3CC8A 3F7OA 2UYCA 2I1VB 3EZYA 5LQUA 3A1VA 4U7WA 2FFFB 2GCOB 5K8VA 1U28C 4O2LA 5IJAA 3TOCA 1NBME 3WRYC 1JILA 2QW1A 1O9GA 5K4AA 4WKNA 3N2YA 4NXGA 1A9PA 1G3MA 4JMPA 4J0FA 1X9HA 2GQ0A 1NXWA 3QVTA 3SIRA 4EGJA 1PJRA 2OD7A 4CIVA 3I73A 3P9KA 1YTUA 2FGKA 3LX5A 4KWHA 4NYIR 2PU5A 3DLPX 4M0MA 1P73A 1YI8A 2P4SA 4H16A 4L76A 3GI1A 2GXAA 2PCLA 1LDBA 3EXIA 3UB2A 4XSVA 5G40A 3WB2A 4S0ZA 1JHUA 3C3MA 2NLOA 3WLJA 3JARA 2R60A 1OZ0A 1GZ6A 1QG6A 3EMBA 4DUGA 1JA0A 1YZYA 2AV6A 3FHCB 4QBHA 4E1BA 1NI3A 4R8VA 1A4UA 3I3SR 4AS3A 2DBQA 2VBGA 4L8VA 5GADl 5TQ2B 1T10A 3O9VA 2WQ7A 1D0VA 1OYOA 2ZB8A 2NUTB 4E5KA 2QL5A 4M7PA 3HKDB 1STZA 1GA6A 3W5CA 1UBMS 3DDWA 4S2JA 1OGIA 3W6PA 5FOWA 3GA0A 1FEZA 4LVCA 1TIKA 4KZ5A 4JGQA 4FK8A 1NQOA 3UK0A 1DBPA 2KE5A 3H6HA 2N1MA 2ZQDA 3QKRA 1QQ7A 3ZHBA 8AT1A 5DNEA 6REQA 5AI9A 2QZ4A 2XMCA 3AC0A 4DANA 2LBPA 3G5UA 3MAGA 2BUAA 3KTOA 4YNBA 1V5IA 4RVUA 1FDIA 1QFYA 3N8SA 3OP4A 3ITNA 3HS3A 3VFFA 4UU0A 4NNJA 2EKDA 3COWA 5F78A 3EZ7A 4B8WA 2XZPA 2F1IA 4BRZA 3C2WA 3V67A 2C3MA 1FUEA 3ZGVA 4TTIA 2H1OA 3P2EA 4EUFA 4BD0A 4P5EA 3Q8MA 2RGGA 2RIPA 5HYVA 2GJ4A 3D3JA 2QMUA 4DDUA 1MT3A 1Q0PA 1QRTA 1K55A 4GD8A 2HJ9A 2WPDD 3A3DA 3K92A 3QVMA 1N5JA 3IQHX 3H5LA 1EROA 3H9JA 2ZQ5A 4B6FA 3BRCA 4RMIA 3BMQB 1JLSA 1ZMXA 4JA0A 3CZCA 3K0AA 1DJQA 1RQGA 3IHWA 3I28A 4D9JA 1KP3A 2Q5OA 3KD2A 1UT5A 4F93B 3IJEB 1RLUA 4F8JA 1G291 4TRRA 1Z56C 1Q57A 4ZV4A 1WRBA 1ORWA 3I1IA 4Q9JA 4ZOCA 1YOBA 4U7JA 3DFMA 1XDDA 4MA5A 5H1YA 4UNIA 3IMKA 3PBQA 3GSGA 3ZVLA 4RQ9A 4FD2A 2QHXA 5IUJC 3ADKA 4Z3KA 4JOCA 4LE2A 3C3EA 2VXCA 1JUDA 7MHTA 2O8VA 3TD2A 3HI6A 5JFOA 5B4VA 4M9RA 3LIDA 4G0ZA 1TKRA 3NI2A 3W77A 2FETA 4C7OA 5CA1F 3W5HA 2E49A 4OOLA 3AUYA 4HAYA 4YFMA 2ZBBA 5LLDA 1YR1A 4ENUA 5KZHA 3ZH9B 1KZ7B 5IC4A 4ESEA 1N0UA 1IIBA 2QXTA 2UZAA 2Y0CA 3GDGA 3DTVB 1TA4A 3R0JA 3K0CC 4IIGA 2ATIA 5DCUA 2FR1A 4H3KB 1KQ3A 1L7PA 4F4HA 2DHEA 1XAGA 5DI3A 2QK4A 2EP5A 3BPSA 4PINA 4YT4A 1VSTA 1YQQA 2Z56A 4GPD1 3PVSA 3LY8A 3NV7A 1JKXA 4CMEC 1X94A 3A6ZA 1GL3A 1LSUA 1B0PA 1RKBA 4JEUA 4DCUA 1HO3A 2BFFB 2XGGA 4YP7A 2C3PA 1M2OA 4UHKA 2C2OA 3AF0A 1GDHA 3FR8A 721PA 1VL2A 5FASA 4DWJA 1MV5A 3EVAA 1SKFA 2JHAA 4C7VA 1QJ4A 1SNYA 1POWA 5LP6C 1FIUA 4X66B 7REQB 3MWJA 3QELB 2Z2KA 5FTLA 4S1OA 3QP8A 4ZYWA 4CG0A 1JXQA 1BHSA 1FQKA 2ZT8A 4UNNA 3ZWAA 3SQXA 3KB8A 4XFDA 2QOEA 1RYNA 2ZB3A 3KWLA 2AK2A 3I5XA 4QSHA 1AT1A 3U13A 4FDLA 4BNDB 5EKDA 4PS1A 5ECWA 3ZKWB 1AQJA 2NUPC 1UC5B 4ARCA 1KRXA 3FPLA 3LKBA 4N7MA 1ZEMA 5F73A 1THZA 4Q66C 2J9FA 4GKVA 3GPCA 3WNDA 4XI9A 3H2SA 4PAQA 4UOEA 3LBNA 3V8VA 1BJTA 1FS4A 3D9YA 1VLMA 2PXHA 2R7NA 2BE7A 4CODB 1PCXA 3NVAA 4IDFA 4A8JB 1MOSA 1R0KA 2JGAA 2VTKA 4N47A 5J4HA 3KR1A 3WK4A 2QE7A 2H4ZA 1YS2X 2ZTLA 2FFYA 2A1TS 4RELA 3UN1A 1J0DA 3T12B 1BEEA 4LSGA 1AN0A 3MM4A 4Y2TA 2OMKA 3W3AD 1E2QA 3O94A 2AJ8A 1KI7A 1YV9A 5KPDA 3I23A 3GLTA 4TV9F 5DN6A 2FZVA 3TMAA 1ZWKA 4Z5XA 4BVFA 3ZU2A 3TGLA 4PLZA 3VP4A 4M36A 5EJ7A 1ISSA 3QLUC 4ZP1A 5EMJA 1LI7A 1UQTA 2W22A 2R8XA 3HBFA 4II3A 3JXEA 1XCLA 3I8OA 4C4SA 3LNTA 1RWOA 3WL5A 3INYA 2YZNA 4J0GA 3T3DA 1G3IA 3K9HA 5GV8A 3IEXA 4ZHQA 1NMYA 4RK1A 3VKVA 2HLHA 3E9CA 4PX2A 1Q19A 4D44A 4PX3A 1NZDA 2QQEA 3ZN2A 3MTDA 3IURA 3AP3A 3PTAA 1XF9A 3MT8A 3PAGA 1XL0A 1TI7A 3O2JA 4NYMQ 2YOHA 2OKGA 3FD8A 4FYXA 1KGEA 1FQWA 1IUKA 1XMPA 2AVDA 5IJ0B 2Q5QA 3L7AA 3U7GA 3FSGD 2PQMA 4AF7A 3VBCA 4UHJA 1AXEA 3IBSA 3IUYA 1YZLA 3DZKA 1O4VA 4B7ZA 3T94A 2PWYA 3MSCA 4WDQA 1W47A 2CLEB 4QAJA 3WLSA 2JIZD 4UPDA 1G6KA 1W8IA 4RSRA 5H68A 2QZSA 1JKIA 1FPMA 5AW4A 3G7NA 3HDTA 4ZDWA 1YFLA 4LQCA 1BX1A 1F1BA 5BWNA 2JGDA 1SZDA 3IR6A 2GI4A 2PJDA 1XALA 4HQ0A 5TX7A 3A4YA 3CX3A 2JK1A 5EFOA 1WXGA 5K0CA 2OXIA 1ID1A 3LLVA 3DJYA 3G9XA 4HH4A 2XYPA 3T1XA 4K6HA 4MQ5A 3W8DA 1E4EA 5ELLA 4W8GA 2CC1A 4ZXPA 2PXAA 4RZ3A 1TRHA 1DAOA 1B0UA 2DY1A 1H8YA 2Z98A 4BNFA 2JEOA 3I30X 3HCCA 4C3VA 3MT0A 3WS0A 1Q22A 2EAUA 2O2HA 3CMMA 1F8FA 1UWKA 1KL7A 2FPMA 1O7EA 3AM3A 5AKGA 4M1EA 3ENZA 3FCEA 2O2ZA 3R75A 1KFJB 3MS6A 4EUSA 3RYIA 4JASB 4OX9B 1NVKA 3QNBA 2IYRA 4Q4DA 1JR6A 1M5UA 4WZBA 1FX0A 1TMOA 1QYWA 5AK5A 4NYJR 3PPWA 3P9XA 3RK0A 3CLVA 3S5JA 3GDFA 1TZKA 4C07A 1S4SA 5CGQB 1ODVA 2A5JA 3KSFA 421PA 3RH0A 1GL6A 1A82A 1XRRA 4MI3A 5AI8A 2GS9A 4XYEA 4KSYA 2Q0QA 1CS0A 3FG8A 1E3DA 4F9EA 2PDRA 2B83A 1GU0A 3IESA 3RHTA 1NXSA 3HKDA 4MW9A 3KUCA 1XRSB 3R40A 1GFWA 3NWPA 1RKVA 2W4QA 3R3VA 4LXHA 2R8EA 4RV5A 1P0QA 3IJ5A 3N2GB 5ETJA 4QU8A 3KVYA 4Q7MB 1G8PA 3HEBA 3UAXA 2ID7A 2GD2A 3IULA 1HQYE 4RLSA 5FQ9A 4TSRA 3VI3B 1L6IA 4QFDA 3ZNTA 4KVZA 5COBA 4B2IA 3CG4A 2B5RA 3IXQA 4GP6A 2DFDA 2GA9A 5FTWA 4EB6B 4TUYF 1W1IA 2VK4A 4O2AA 4PGHA 4X6LA 2IYLD 4KX5A 4XUEA 1KBQA 1IHUA 4NAVA 2XRYA 4XASA 1I6LA 4R1QA 3H9GA 2R65A 2PS1A 4G37A 1GAXA 3TSAA 4YJ2B 4BO6A 3UJ6A 2IPMA 4J3FA 1ZGHA 5KNCH 1X80B 4DQ0A 1YJXA 2QW0X 1FUIA 1PLJA 2JZCA 2Q9UA 4I55F 4YWHA 4K1LA 3L9WA 5CNKA 2Y1CA 4K08A 2GYUA 4UEKA 3MTEA 2VKTA 4CRWB 1U6JA 2DFTA 1J8VA 1GKIA 2EFCB 5CB4A 3C7TA 4F45A 2Z3WA 2X5XA 1K8QA 2GCEA 2E4YA 3W4QA 1V9YA 2J8YA 1KF0A 4QASA 4ZVUA 1S9DA 2HPVA 2VNIA 1EI5A 5IZ4A 4IM7A 3CF4G 4FYYA 4MDZA 3WNQA 4CMGA 1REQB 3W5SA 3CH5A 2ORWA 4RF4A 4ZAXA 8LDHA 3MQ0A 3BW6A 3K9GA 4FCTA 4AICA 5E6SA 5LQDA 3FE2A 2ODTX 2IS6A 3RTGA 4RACA 4GBED 3TEMA 1XTSA 5FF9A 4YJ3F 4UPVA 2XT9A 5E4TA 1TM4E 3DBHA 2BGGA 2VJLA 4BS9A 4DNXA 2HSZA 1MAHA 4YRAA 1A9SA 1YIDA 5K8UA 5K05A 3JX9A 1RKQA 4LOIA 1IBKB 4QVGA 2BFBB 3FKJA 3BFKA 3WAKA 4DLBA