1VETB

Crystal structure of p14/mp1 at 1.9 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDSLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/protein binding
molecule keywords Mitogen-activated protein kinase kinase 1 interacting protei
publication title Crystal structure of the p14/MP1 scaffolding complex: How a twin couple attaches mitogen- activated protein kinase signaling to late endosomes
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1vetB00
3T1QB 2JKFA 2PBDP 3U4LP 4D60A 2PAVP 1CQAA 3D9YA 2ZL1B 1FIKA 1F2KA 2V8FA 2ACGA 2ZL1A 3T12B 3CHWP 2VK3A 3L7HA 2JKGA 2B95A 1Z09A 5EM0A 3UB5P 1AWIA 1A0KA 5FEGA 3KYEA 1VEUB 1FILA 2V8CA 5FDSA 4QWOA 1SZVA 1VEUA 5FEFA 1K0KA 2BTFP 1J3WA 4FUWA 1D1JA 3NECA 1ACFA 1SKOB 1PFLA 3CPTB 2HZ5A 3NULA 1G5UA 1PNEA 1VETB 3L9KA 4FTXA 1SKOA 3CPTA 4X1LA 2PRFA 3LGOA 4ESPA 5EVEA 1VETA 1YPRA 3DAVA 5EV0A 1CF0A 5EM1A 3MS6A 4X1MA 2E8JA 3LEQA 1Y4OA 3T1XA 4X25A 3MSHA 3T1SA 1HLUP 1CJFA 1PRQA 3T1RA
chains in the Genus database with same CATH superfamily
4L0LA 3FG8A 4GS9B 1LSVA 1PWCA 4OPYA 3R7WB 1BYWA 4HHDA 1YSPA 4QJGA 4B9OA 3IF6B 4C75A 3A0SA 4HBTA 1OJ5A 4S2JA 5A93A 3B47A 2O9CA 4R0QA 1GSWA 3UN7A 3O88A 2ZC7A 2V20A 4DN0A 4GLQA 1FR6A 4DXCA 5EM0A 3BFGA 2R9XA 2V9AA 1DJAA 4S2OA 1XPBA 2DNSA 4BBUA 2ZMAA 4EESA 5LBRA 5HWVA 4EETB 2Y2MA 3HBRA 3HCYA 2HDQA 3MXRA 1MY8A 5FEFA 5HPFA 5E2HA 3ULFA 1K55C 3MQ0A 4JXVA 3BYDA 1PI5A 1E4DA 2Y79A 4MBFA 3CAXA 4IUKA 2VLGA 4UQIS 2IWBA 4Y17A 2PU4A 3F1PB 2WKIA 4OLGA 1FCNA 4OQ0A 5BOHA 5CXWA 3UDIA 4EUZA 2IWDA 3S4XA 1G28A 2C5WB 4Y0OA 4ZJ3A 3ZVWA 3FPVA 3NI9A 3P09A 5DTKA 3NBLA 4XT2B 1D7EA 4NXBA 4PM8A 2ZQAA 3A3IA 4R23A 1TF1A 1J9MA 2G2UA 3T1QB 2ZJ9A 5GLDA 1IELA 4KUOA 1GCEA 3UB9A 5GLCA 2LB5A 4E3JA 4E3MA 3G4PA 4Y5FA 5L8MA 1JVJA 4H6JB 3VSKA 2XQZA 4RVAA 4WLAA 3QP1A 1K4FA 2HPBA 5TR7A 3WWXA 1YQSA 4LV0A 4WZ5A 4S2NA 3HL9A 5IHVA 4NETA 1P9RA 1ZTUA 3FC7A 2VGJA 5I94A 1W63M 3N8LA 2EWWA 4L9GA 4Q0IA 3CITA 5AQ9A 4NG2A 4PMAA 5MC7A 2ZM0A 4AFIA 3JVUA 3W4OA 3ZNTA 4S2MA 4E3KA 2QYBA 1NLYA 4Y13A 1DRMA 3G2ZA 4UQIM 2BG1A 5DTTA 3EWKA 4MBKA 1MWRA 4MEZA 2XA7M 4FSFA 2WUQA 3LY3A 3SH7A 4R4RA 5E2GA 2P08A 4UA7A 4KZ6A 3MJQA 3GTCA 3V67A 4XUZA 5EV0A 1CI8A 1KVLA 2DRWA 1YLPA 1MKIA 5F1GA 4LGWA 1HLUP 3MZEA 5I5LA 2KX6A 2JKFA 4E6WA 4CLCE 4P87A 2AVXA 3OOVA 2PBYA 3D9YA 2ZL1B 2PD8A 5HDDA 2JCHA 4G3VA 3UMDA 1YMSA 5DJUA 2ZD8A 1P97A 2QJ7A 1GHIA 5GHYA 1CEGA 1K25A 1LSXA 5F68A 2J7VA 1VQQA 2Y2QA 2O0YA 1JNUA 3OCLA 2Y2PA 1BSGA 4BD1A 1MWSA 3IH8A 3ZG7B 2CMNA 3DBAA 2OV5A 3KYEA 5DFXA 4YFMA 3Q7VB 4IEDA 5JYOA 4WYYA 3OPHA 4I3IA 1V9YA 5A92A 2W1TA 4PHTA 1STZA 4JGRA 2GX5A 4ME4A 3AGDA 2P04A 3TW8A 3NY4A 2V1AA 1IYOA 2V2FF 1WA9A 1FSWA 3VP2A 1PFLA 4KUKA 5FAQA 1YMXA 2M7VA 1KE4A 5FATA 3C4OA 1PNEA 3VP1A 4P85A 3CPTA 3LIAA 5EVEA 1W5DA 1K6RA 3LR3A 1S67L 3T4KA 3B33A 5CERA 4GS9A 4BL3A 1EI5A 2E8JA 1HD8A 3PHYA 4K91A 1W8YA 5TBMB 2EWVA 3IF6A 4BQMA 3BJNA 4NK3A 3AGEA 2ZQ8A 3PBRA 5FI7A 4HNBA 3BFEA 2IA2A 4L9EA 3PBOA 4MCWA 5GHXA 3G34A 1ZKJA 3RXXA 4JF6A 1MXOA 1IKGA 3T50A 3F1NA 2RCXA 3EQVA 5HW3A 1Z09A 2JKRM 4ZTKA 4PKYA 1Y54A 3KYZA 5L10A 1JWPA 3VE4A 1F5MA 3MMHA 5HDCA 1VEUB 4S2NC 5FQ9A 4LFUA 3HLWA 1W63Q 4Q8IA 1S4RA 5HWWA 1XA1A 2YKFA 2XRNA 4MN7A 3F1PA 1W8QA 5CHUA 3HJIA 5KSHA 4GCZA 2O99A 5J7EA 4KZ7A 2W3EA 2A3UA 5AQAA 4RX2A 5M19A 3FYZA 1SKFA 1LI9A 4MLLA 3BLMA 4XT2A 2ZQCA 2QPNA 4QB8A 1BT5A 1Q2QA 4HJ6A 2Y2GA 4A5RA 4R70A 3E2KA 5J3WA 3LY4A 4LV1A 3TOIA 1Z6FA 4Y3IA 4R3BA 3LEQA 3T4JA 4F3LA 2PU2A 1GHPA 3ZGAB 4LENA 3VFHA 1MZUA 4ZJ1A 1ES5A 4E3NA 4FCFA 1CQAA 4CJNA 3E4QA 2H10A 3WS4A 4ARZB 3IS2B 4K0WA 3VOYA 2XD5A 4PPRA 4G3WA 3N8SA 4DKIA 5CEBA 3EEAA 4KZBA 3IH9A 2WGVA 3EGXC 5EVIA 4DJ3A 1YM1A 4M3KA 1AXBA 2VK3A 3JPUA 5CGSA 4GD6A 3LIFA 1L0DA 1XP4A 3FV7A 3CWFA 2K2NA 3OBFA 3UNWA 5E43A 2XDMA 3M2KA 2FH5A 3UDXA 1JTGA 3MQQA 4Y7PA 2PT7A 2XFTA 3V50A 2ZBBA 3KSIA 1D1JA 4KZ4A 1YLYA 3O87A 3MBZA 4GD8A 3FPWA 1PW1A 4HH3A 3TG9A 4E6XA 2WGWA 5F6AA 1KGFA 3Q1FA 3ZFZA 4HIAA 2D02A 1L2SA 1NZUA 1T19A 5FI6A 2K7SA 3T4TA 4ESPA 1T1BA 3IX8A 3T4OA 4IVKA 4ZRRA 1MWUA 5HD5A 4I3JA 3T4SA 4EXOA 2HP9A 2LB9A 2HJ9C 3OZHA 2G7UA 4MNRA 4NKPA 4FD8A 4HH2A 2OLVA 4OPZA 2O9AA 3ICYA 4LRXC 5CECA 3IF6C 3UDFA 3HLEA 2XFSA 1EWZA 2ZC3B 3LR0A 4EV4A 4OPQA 3H82B 4BD0A 5EECA 5FQIA 5HL1A 3Q82A 3V39A 3A3EA 2VJWA 3Q7VA 3IXGA 2JKRI 3E0YA 4N1HA 3F1OA 1OTDA 4GB7A 3UB7A 4JGQA 2H28A 3WS2A 1G6OA 1ESIA 4MN6A 2Z2LB 4OOLA 2V8CA 2XD1A 4QWOA 4JGPA 2DMWA 3BECA 1RCJA 2J3TD 2EX2A 5KIZA 4R6LA 3NECA 1SDEA 3C38A 1P9WA 3N6IA 1ZHHB 1ZG6A 4BMWA 3BEBA 3BM6A 4C3QA 4GDBA 4FTXA 1NYMA 4HESA 4DJ2A 4P0MA 3VOZA 2EXAA 5FSRA 3U2AA 3IWOA 3MS6A 4X1MA 1NRJA 1PW8A 3LYXA 2UWXA 4X25A 4GN2A 4IVIA 2GZAA 2OWJA 3HUNA 4QY5A 1XJ2A 1GA9A 3NDGA 3CG5A 1IFQA 3H7WB 2PAVP 4JBFA 2A2LA 4NXGA 1F2KA 2EX9A 1XXMA 4N1XA 2Q9NA 5CHJA 4HP4A 2Y59A 1TS0A 3E2LA 1N9BA 4ETZA 1S1ZA 2W3DA 2E8IA 5EVIC 3ZG0A 4EBPA 4UA9A 1S1YA 2Y55A 3UB5P 1LT0A 1GHMA 4GNUA 5E2FA 4DE2A 3G2YA 4DF6A 3B42A 2A24B 5J4EA 3K2NA 1LL8A 4EU0A 4U0XA 1DP6A 3CUEA 4OOYA 2XGNA 4BWIA 2QHKA 1VHMA 4QHCA 5TJJA 5HZHA 3NULA 3C30A 2R9WA 2ZMFA 3DW0A 5KMWA 2WADA 2FFYA 4UAAA 4KG6A 2JN7A 3K3DA 4PAUA 4YINA 4I39A 1VETA 3HJKA 3UE3A 3MKEA 3GV9A 3HREA 1IKIA 4PM6A 2VEAA 2W3GA 4R1GA 2P7JA 3MXSA 2J80A 5FA7A 4KQDA 3ITBA 1OTIA 4WUJA 2Z2MB 3BQ8A 4FH2A 1EW0A 4GJ4A 5EVLA 4PM9A 1L0FA 5E2EA 4N9KA 3FKWA 4EEUA 1E25A 3LFVA 2X01A 1K4EA 1LLBA 1P0ZA 4NEED 2WAFA 4HI4A 3I7JA 3BQAA 3BFDA 2XH9A 2OLUA 5HARA 3MFXA 5HWTA 4E3OA 4N9LA 3GECA 3IXHA 1IYSA 5HSQA 2W3FA 3UMEA 3C5AA 3RXWA 5FL3A 2NUPC 5FQJA 3PAEA 1L3LA 3HUMA 3DWKA 2IWCA 4NXEA 4R38A 1YLJA 5DTSA 5A91A 2Y2IA 3IX4A 1JWZA 3TRCA 1C3BA 1K57A 4BBVA 3H9WA 5EE8A 1OPXA 3GDIA 1BZAA 5CX7A 3OLOA 1YSQA 3O5YA 5TFQA 3WRTA 3ZDJA 3S7OA 4PM7A 1SKOA 5HPIA 3O3VA 3MKFA 4OP8A 3K3CA 1WYBA 4OP5A 3VSLA 1RP5A 1YAXA 5A90A 1CF0A 4EUVA 2J3WA 5HAPA 4X68A 1O7EA 1H3QA 3MSHA 3LR5A 3NC8A 2XLNA 1CEFA 1YT4A 3VP0A 4II7A 4PM5A 5FAPA 1UWPX 2VGKA 5TBMA 2H0YA 4RQ9A 2B18A 4LPZA 4U0TA 4WM9A 3R7WA 2JHEA 2UV0E 4JXWA 1G6AA 1ALQA 3OCNA 4LV3A 2XF3A 3G35A 3NIAA 4MBHA 4EWFA 5CRFA 2EA9A 2I72A 1ESUA 3CMZA 4EQ1A 1H8ZA 3OPPA 3GRJA 4DE3A 1HZOA 3JVVA 1FILA 1KGGA 4FH4A 3IHBA 4O01A 1BTLA 5L07A 3MFDA 1DJBA 5FAOA 4WEKA 2V0WA 1S6RA 3NOTC 3P7NA 5AVFA 1NRFA 3IHAA 1FQGA 1T18A 1FCOA 4KQQA 3CUEC 4IBRA 2VV7A 4WZ5C 2FZ0A 4DDYA 2K31A 4OH0A 3LI9A 3L9KA 3E4PA 2ZOHA 5CTMA 3LIBA 4R3AA 3W8KA 4PKYG 1FSYA 1OTEA 4X1LA 1NWZA 3MXQA 2WKRA 4H8RA 3BFFA 3P98A 4YOFA 3ZVTA 1BLCA 4E04A 3UB8A 3D72A 3OPRA 1BLHA 3H7WA 1L0EA 2EFXA 4BLMA 4B88A 5JYPA 3T1SA 3GMWA 2YKHA 2WKEA 4KZ3A 2X71A 3WS0A 4D60A 1H8YA 2EXBA 5TGFA 4LRYC 3SS3A 2OWHA 2KOIA 5G4YA 2WKPA 1CI9A 1K55A 4GHIB 1K54A 1F98A 1XGIA 1E3UA 2PR5A 2JKGA 4H6JA 2Q0OA 5M1AA 3HLGA 1CK3A 1UWNX 1TS7A 1TS8A 1E3UD 2HDRA 2VZWA 3FWLA 3LO7A 4HOIA 1T1CA 4S2KA 1FCMA 4OVDA 3LR4A 3QP8A 3VP4A 1DP8A 2V1BA 2DCFA 1ONHA 4LV2A 1MWTA 1TDGA 3MZFA 1H8MA 3EQUA 1K57C 5FQMA 2HZ5A 3GQZA 3ZHHA 1PYYA 4IHQA 4XUXA 3V3SA 2ZQ9A 4KZ5A 3RJUA 5GLBA 3LCEA 5EOEA 3UE6A 3VV4A 4DRTA 4FOFA 3GR2A 3GSGA 2W3HA 1XFNA 5G18A 4HJ3A 3BY9A 3M6BA 3JYIA 1N4OA 1BUEA 2J9OA 1DJCA 1H5XA 3MR0A 2Y2JA 4X6TA 1FIKA 1S66L 4KZ8A 3HLFA 1N9LA 2ZL1A 4JLFA 5AVEA 3T12B 2Y4AA 4S2PA 1K38A 4WMCA 4HQAA 5HD3A 3PTEA 4B93A 3S22A 5DJTA 2WK0A 3BWLA 3S7PA 3KO6A 3UO9A 3IXDA 4UHUA 2WYXA 2WKQA 5AQBA 5IU1A 3TJZC 3W4QA 2VV6A 4WMCD 3OPLA 4OPRA 5HAQA 2HDUA 2W1TB 1VM1A 2OAP1 1MBLA 5L2FA 3HLCA 4QU3A 3E98A 3DTKA 3WS5A 4Y2FA 2OOLA 4CLCB 3IBRA 1T1AA 3LUQA 3C7VA 2L0WA 1OT9A 3FKVA 1ONGA 1X0OA 4WZ4A 5GL9A 3ZG8B 3CLOA 3QHYA 2ZM2A 4P6ZS 1DP9A 2JKTM 2INWA 3CPTB 3IXBA 2W0NA 1KVMA 4BJPA 4Y0UA 3LICA 3V5MA 2KLIA 1EROA 1K56A 2O9BA 3G6OA 4JF4A 1PI4A 2V1ZA 3BFCA 3IT9A 3DAVA 5IS1A 3DTEA 2EX6A 5EM1A 5CGXA 1ES4A 3ITAA 1K56D 2EX8A 1Y4OA 3A3JA 1OMEA 2P9VB 3C7UA 1NLZA 3PBNA 3KX0X 1PRQA 4EERA 2B5RA 4E3IA 3BW6A 5A8BA 2Y2HA 4M4XA 4G3KA 1PWGA 2R78A 5G4ZA 4O8GA 4GDNA 1FOFA 4DE0A 2V8FA 2GDNA 3OC2A 3F1NB 4RYEA 2ZC4B 3G31A 5DF9A 1VB6A 3EEHA 4ID4A 2XR0A 1OTAA 2ZMVA 1WYCA 4OONA 1K54C 2QZ6A 2H5SA 2ZC6B 4Z9QA 4C6YA 4DDSA 3ZYTA 5FEGA 2OAQ1 3KSGA 4ZBEA 3LIDA 1GSVA 3N8RA 3O86A 5C5KA 2HP6A 3R4KA 2M1CA 1LHYA 1SZVA 1VEUA 1K0KA 2XA7S 4S2LA 1ERMA 1KE0A 3IWQA 4KG2A 4N92A 2WAEA 2GNXA 4P6ZM 4Y15A 4YNRA 3IX3A 2ZQDA 2MJ6A 3D4FA 1XJ3A 3WRZA 2WGIA 3PAGA 3PBQA 1L0GA 2J8YA 2X02A 1HTZA 3BRMA 3RFBA 3CI6A 1YPRA 1TD5A 3SOIA 4F3LB 1W79A 3ZQ5A 3Q7ZA 1ERQA 3KSFA 2L1MA 2WKHA 2JBFA 3CZDA 4U3TA 3QP5A 2XEPA 1D06A 3FZCA 3TE8A 4DE1A 2XSSA 4ETXA 1GA0A 4GHIA 4WL9A 1TDLA 3D3OA 5HFOA 3N7WA 1QMFA 2OSUA 4B4ZA 1XKZA 5EVIB 2XK1A 2HDSA 1JTDA 2PYRA 4WBGA 5J8XA 3MF0A 4WF0A 5CTNA 4ARZA 3IS2A 4BBTA 5FASA 4HJ4A 1LL5A 2B95A 1YLTA 4B4XA 3VFFA 2G2WA 3S7NA 5F5YA 5DVAA 3KSHA 4JKTA 2C6WB 5D3OA 2W27A 4K08A 1NYYA 1ES2A 2WZZA 4JXSA 5DF7A 5AQ7A 4BENA 4JXGA 4UA6A 2PYPA 2VKSA 1M40A 2RL3A 2BTFP 2WGWB 1XGJA 5EFWA 1IOUA 1ODVA 4JF5A 4JPMA 2JKTI 3QP4A 3ZNYA 1WE4A 2WZXA 4L9FA 3G30A 3C2WA 2PHYA 2A49A 4QY6A 1ES3A 1O07A 2J3TC 2PRFA 3LGOA 4MMNA 3DWZA 2W1RA 3W2ZA 3HVFA 2Z6DA 4UEYA 2B02A 4LLOB 3PR6A 5FI2A 4EQIA 3Q81A 2HF6A 3T4LA 3RTYA 5HL6A 4NXFA 4KQRA 5GHZA 4LRZE 2HJEA 3B3XA 4DMZA 4KQOA 1PZOA 3U4LP 3ZCZA 5GLAA 2ZQ7A 4Q0HA 1S4SA 4MDZA 5CHMA 1BLPA 2JE5A 4MN5A 3NCKA 3SS5A 3EGDC 1NZOA 4F94A 4CPKA 4X56A 4ZJ2A 5DF8A 4HEFA 4LCMA 4EEPA 4JGOA 4X53A 3P01A 3CHWP 1SCWA 1KDWA 3H82A 5CGWA 3F1OB 4OQGA 5CEDA 5KSCA 1LSWA 3QP2A 3SH8A 4RX3A 4CLCA 2J9PA 5HX9A 1AWIA 1N9OA 2XROA 2PD7A 1OT6A 5M18A 1JWVA 1UGUA 3UE1A 4KG5A 4CLCD 5DKKA 3WS1A 2VGLS 2Y91A 4HP9A 3W4PA 4P6BA 4BL2A 3UPPA 3VP3A 2KDKA 1MC0A 1XA7A 3HUOA 4KZ9A 3DTIA 1TS6A 2EFUA 4KENB 3UB6A 5EOOA 1KGEA 4CQHA 4GW9A 1I2WA 2Y2KA 3C8CA 2P9VA 3QNBA 1Y28A 4GZBA 1NY0A 1DY6A 3CJMA 4Y0TA 2M7UA 2HV1A 3NOPC 5FQKA 2HGVA 4I3AA 1S0WA 1SDNA 1N9NA 2ZLYA 3A3FA 1XX2A 1K6SA 3BLSA 4WEJA 1XFQA 4EBLA 2P74A 2PBDP 3QNCA 4X55A 3VE3A 4QPRA 2H0TA 4E3LA 3A3DA 3LIEA 2GJ3A 3LEZA 3V3RA 3PBSA 3BY8A 1M6KA 4IJGA 1IYQA 1QMEA 1IEMA 3L7HA 2NUTC 4R3JA 4IBXA 1MPLA 1RGZA 2ZOIA 4YWZA 1KDSA 2D01A 1U60A 5U47A 3IBJA 2ZM8A 1G68A 5DFYA 5FQQA 2Y2NA 3SW1A 3E4OA 1YLWA 2VGLM 3NOUC 5AJGA 3TSGA 4DXBA 2L4RA 5EUAA 1KE3A 1NJ4A 4Z1WA 1I2SA 1F9IA 1HVBA 5HDSA 3VOLA 1J3WA 1I5QA 1Q2PA 4Q0JA 2A24A 4S2IA 1ACFA 1XJ4A 1TVFA 5IT5A 3SH9A 1W7FA 1FR1A 3M2JA 1KOUA 4X69A 2BLSA 1GSXA 2VV8A 3ZG9B 1H0MA 4ZAMA 1G5UA 4OQHA 1VETB 3T4QA 1OTBA 2QKPA 1PWDA 3NHQA 5DKLA 3A0VA 3HLDA 3RH8B 4EBNA 2VX8A 4OKPA 1MKMA 3Q07A 4HBUA 2BASA 4WELA 3UY6A 3ISGA 5EPHA 3G32A 3MQOA 3SZTA 3IF5A 2Y8HA 3T1XA 3AGFA 4RA7A 3M6HA 4R4SA 4ZDXA 3PBTA 3A0RA 3MZDA 4XXRA 3T1RA 2HP5A 1TEMA 5L09A 4GOGA 2Y2OA 4K0XA 3VMAA 5F69A 5EVID 2PDRA 2QMIA 1LL9A 2ACGA 3GVBA 4D2OA 3C4PA 4WN5A 4LCLA 1XJ6A 1IYPA 1YLZA 4I5SA 3UPNA 3PXPA 5KZHA 3NDEA 4O7DA 4HY8A 1SHVA 3N4IA 5HAIA 1ZC2A 2CC1A 1OJGA 1A0KA 4CLCC 1PIOA 5FDSA 4KZAA 2ZC5B 4QD4A 4OLDA 4IUHA 2I9VA 3KYQA 4FUWA 2Q9MA 2JC7A 5F1FA 5K5BA 4O0PA 3UE0A 3UPOA 1SKOB 3DTMA 1YKDA 4OQIA 3HLBA 2Y2LA 1BULA 1NXYA 1ZG4A 4OOMA 3QP6A 1RGYA 1V9ZA 4EW7A 3SS4A 3IQAA 4GKUA 5F83A 5F82A 2FFFB 1LI0A 3EOIA 1BLSA 2V0UA 2Z6CA 4I38A 2VA0A 2QWSA 1PZPA 2QJ5A 5FDHA 3IWIA 3ZG5A 3S1YA 1CJFA 2PR6A 3NJAA 3PYPA 3LI8A 3S7QA
chains in the Genus database with same CATH topology
3T1QB 2JKFA 2PBDP 3U4LP 4D60A 2PAVP 1CQAA 3D9YA 2ZL1B 1FIKA 1F2KA 2V8FA 2ACGA 2ZL1A 3T12B 3CHWP 2VK3A 3L7HA 2JKGA 2B95A 1Z09A 5EM0A 3UB5P 1AWIA 1A0KA 5FEGA 3KYEA 1VEUB 1FILA 2V8CA 5FDSA 4QWOA 1SZVA 1VEUA 5FEFA 1K0KA 2BTFP 1J3WA 4FUWA 1D1JA 3NECA 1ACFA 1SKOB 1PFLA 3CPTB 2HZ5A 3NULA 1G5UA 1PNEA 1VETB 3L9KA 4FTXA 1SKOA 3CPTA 4X1LA 2PRFA 3LGOA 4ESPA 5EVEA 1VETA 1YPRA 3DAVA 5EV0A 1CF0A 5EM1A 3MS6A 4X1MA 2E8JA 3LEQA 1Y4OA 3T1XA 4X25A 3MSHA 3T1SA 1HLUP 1CJFA 1PRQA 3T1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Q B;  2JKF A;  2PBD P;  3U4L P;  4D60 A;  2PAV P;  1CQA A;  3D9Y A;  2ZL1 B;  1FIK A;  1F2K A;  2V8F A;  2ACG A;  2ZL1 A;  3T12 B;  3CHW P;  2VK3 A;  3L7H A;  2JKG A;  2B95 A;  1Z09 A;  5EM0 A;  3UB5 P;  1AWI A;  1A0K A;  5FEG A;  3KYE A;  1VEU B;  1FIL A;  2V8C A;  5FDS A;  4QWO A;  1SZV A;  1VEU A;  5FEF A;  1K0K A;  2BTF P;  1J3W A;  4FUW A;  1D1J A;  3NEC A;  1ACF A;  1SKO B;  1PFL A;  3CPT B;  2HZ5 A;  3NUL A;  1G5U A;  1PNE A;  1VET B;  3L9K A;  4FTX A;  1SKO A;  3CPT A;  4X1L A;  2PRF A;  3LGO A;  4ESP A;  5EVE A;  1VET A;  1YPR A;  3DAV A;  5EV0 A;  1CF0 A;  5EM1 A;  3MS6 A;  4X1M A;  2E8J A;  3LEQ A;  1Y4O A;  3T1X A;  4X25 A;  3MSH A;  3T1S A;  1HLU P;  1CJF A;  1PRQ A;  3T1R A; 
#chains in the Genus database with same CATH topology
 4L0L A;  3FG8 A;  4GS9 B;  1LSV A;  1PWC A;  4OPY A;  3R7W B;  1BYW A;  4HHD A;  1YSP A;  4QJG A;  4B9O A;  3IF6 B;  4C75 A;  3A0S A;  4HBT A;  1OJ5 A;  4S2J A;  5A93 A;  3B47 A;  2O9C A;  4R0Q A;  1GSW A;  3UN7 A;  3O88 A;  2ZC7 A;  2V20 A;  4DN0 A;  4GLQ A;  1FR6 A;  4DXC A;  5EM0 A;  3BFG A;  2R9X A;  2V9A A;  1DJA A;  4S2O A;  1XPB A;  2DNS A;  4BBU A;  2ZMA A;  4EES A;  5LBR A;  5HWV A;  4EET B;  2Y2M A;  3HBR A;  3HCY A;  2HDQ A;  3MXR A;  1MY8 A;  5FEF A;  5HPF A;  5E2H A;  3ULF A;  1K55 C;  3MQ0 A;  4JXV A;  3BYD A;  1PI5 A;  1E4D A;  2Y79 A;  4MBF A;  3CAX A;  4IUK A;  2VLG A;  4UQI S;  2IWB A;  4Y17 A;  2PU4 A;  3F1P B;  2WKI A;  4OLG A;  1FCN A;  4OQ0 A;  5BOH A;  5CXW A;  3UDI A;  4EUZ A;  2IWD A;  3S4X A;  1G28 A;  2C5W B;  4Y0O A;  4ZJ3 A;  3ZVW A;  3FPV A;  3NI9 A;  3P09 A;  5DTK A;  3NBL A;  4XT2 B;  1D7E A;  4NXB A;  4PM8 A;  2ZQA A;  3A3I A;  4R23 A;  1TF1 A;  1J9M A;  2G2U A;  3T1Q B;  2ZJ9 A;  5GLD A;  1IEL A;  4KUO A;  1GCE A;  3UB9 A;  5GLC A;  2LB5 A;  4E3J A;  4E3M A;  3G4P A;  4Y5F A;  5L8M A;  1JVJ A;  4H6J B;  3VSK A;  2XQZ A;  4RVA A;  4WLA A;  3QP1 A;  1K4F A;  2HPB A;  5TR7 A;  3WWX A;  1YQS A;  4LV0 A;  4WZ5 A;  4S2N A;  3HL9 A;  5IHV A;  4NET A;  1P9R A;  1ZTU A;  3FC7 A;  2VGJ A;  5I94 A;  1W63 M;  3N8L A;  2EWW A;  4L9G A;  4Q0I A;  3CIT A;  5AQ9 A;  4NG2 A;  4PMA A;  5MC7 A;  2ZM0 A;  4AFI A;  3JVU A;  3W4O A;  3ZNT A;  4S2M A;  4E3K A;  2QYB A;  1NLY A;  4Y13 A;  1DRM A;  3G2Z A;  4UQI M;  2BG1 A;  5DTT A;  3EWK A;  4MBK A;  1MWR A;  4MEZ A;  2XA7 M;  4FSF A;  2WUQ A;  3LY3 A;  3SH7 A;  4R4R A;  5E2G A;  2P08 A;  4UA7 A;  4KZ6 A;  3MJQ A;  3GTC A;  3V67 A;  4XUZ A;  5EV0 A;  1CI8 A;  1KVL A;  2DRW A;  1YLP A;  1MKI A;  5F1G A;  4LGW A;  1HLU P;  3MZE A;  5I5L A;  2KX6 A;  2JKF A;  4E6W A;  4CLC E;  4P87 A;  2AVX A;  3OOV A;  2PBY A;  3D9Y A;  2ZL1 B;  2PD8 A;  5HDD A;  2JCH A;  4G3V A;  3UMD A;  1YMS A;  5DJU A;  2ZD8 A;  1P97 A;  2QJ7 A;  1GHI A;  5GHY A;  1CEG A;  1K25 A;  1LSX A;  5F68 A;  2J7V A;  1VQQ A;  2Y2Q A;  2O0Y A;  1JNU A;  3OCL A;  2Y2P A;  1BSG A;  4BD1 A;  1MWS A;  3IH8 A;  3ZG7 B;  2CMN A;  3DBA A;  2OV5 A;  3KYE A;  5DFX A;  4YFM A;  3Q7V B;  4IED A;  5JYO A;  4WYY A;  3OPH A;  4I3I A;  1V9Y A;  5A92 A;  2W1T A;  4PHT A;  1STZ A;  4JGR A;  2GX5 A;  4ME4 A;  3AGD A;  2P04 A;  3TW8 A;  3NY4 A;  2V1A A;  1IYO A;  2V2F F;  1WA9 A;  1FSW A;  3VP2 A;  1PFL A;  4KUK A;  5FAQ A;  1YMX A;  2M7V A;  1KE4 A;  5FAT A;  3C4O A;  1PNE A;  3VP1 A;  4P85 A;  3CPT A;  3LIA A;  5EVE A;  1W5D A;  1K6R A;  3LR3 A;  1S67 L;  3T4K A;  3B33 A;  5CER A;  4GS9 A;  4BL3 A;  1EI5 A;  2E8J A;  1HD8 A;  3PHY A;  4K91 A;  1W8Y A;  5TBM B;  2EWV A;  3IF6 A;  4BQM A;  3BJN A;  4NK3 A;  3AGE A;  2ZQ8 A;  3PBR A;  5FI7 A;  4HNB A;  3BFE A;  2IA2 A;  4L9E A;  3PBO A;  4MCW A;  5GHX A;  3G34 A;  1ZKJ A;  3RXX A;  4JF6 A;  1MXO A;  1IKG A;  3T50 A;  3F1N A;  2RCX A;  3EQV A;  5HW3 A;  1Z09 A;  2JKR M;  4ZTK A;  4PKY A;  1Y54 A;  3KYZ A;  5L10 A;  1JWP A;  3VE4 A;  1F5M A;  3MMH A;  5HDC A;  1VEU B;  4S2N C;  5FQ9 A;  4LFU A;  3HLW A;  1W63 Q;  4Q8I A;  1S4R A;  5HWW A;  1XA1 A;  2YKF A;  2XRN A;  4MN7 A;  3F1P A;  1W8Q A;  5CHU A;  3HJI A;  5KSH A;  4GCZ A;  2O99 A;  5J7E A;  4KZ7 A;  2W3E A;  2A3U A;  5AQA A;  4RX2 A;  5M19 A;  3FYZ A;  1SKF A;  1LI9 A;  4MLL A;  3BLM A;  4XT2 A;  2ZQC A;  2QPN A;  4QB8 A;  1BT5 A;  1Q2Q A;  4HJ6 A;  2Y2G A;  4A5R A;  4R70 A;  3E2K A;  5J3W A;  3LY4 A;  4LV1 A;  3TOI A;  1Z6F A;  4Y3I A;  4R3B A;  3LEQ A;  3T4J A;  4F3L A;  2PU2 A;  1GHP A;  3ZGA B;  4LEN A;  3VFH A;  1MZU A;  4ZJ1 A;  1ES5 A;  4E3N A;  4FCF A;  1CQA A;  4CJN A;  3E4Q A;  2H10 A;  3WS4 A;  4ARZ B;  3IS2 B;  4K0W A;  3VOY A;  2XD5 A;  4PPR A;  4G3W A;  3N8S A;  4DKI A;  5CEB A;  3EEA A;  4KZB A;  3IH9 A;  2WGV A;  3EGX C;  5EVI A;  4DJ3 A;  1YM1 A;  4M3K A;  1AXB A;  2VK3 A;  3JPU A;  5CGS A;  4GD6 A;  3LIF A;  1L0D A;  1XP4 A;  3FV7 A;  3CWF A;  2K2N A;  3OBF A;  3UNW A;  5E43 A;  2XDM A;  3M2K A;  2FH5 A;  3UDX A;  1JTG A;  3MQQ A;  4Y7P A;  2PT7 A;  2XFT A;  3V50 A;  2ZBB A;  3KSI A;  1D1J A;  4KZ4 A;  1YLY A;  3O87 A;  3MBZ A;  4GD8 A;  3FPW A;  1PW1 A;  4HH3 A;  3TG9 A;  4E6X A;  2WGW A;  5F6A A;  1KGF A;  3Q1F A;  3ZFZ A;  4HIA A;  2D02 A;  1L2S A;  1NZU A;  1T19 A;  5FI6 A;  2K7S A;  3T4T A;  4ESP A;  1T1B A;  3IX8 A;  3T4O A;  4IVK A;  4ZRR A;  1MWU A;  5HD5 A;  4I3J A;  3T4S A;  4EXO A;  2HP9 A;  2LB9 A;  2HJ9 C;  3OZH A;  2G7U A;  4MNR A;  4NKP A;  4FD8 A;  4HH2 A;  2OLV A;  4OPZ A;  2O9A A;  3ICY A;  4LRX C;  5CEC A;  3IF6 C;  3UDF A;  3HLE A;  2XFS A;  1EWZ A;  2ZC3 B;  3LR0 A;  4EV4 A;  4OPQ A;  3H82 B;  4BD0 A;  5EEC A;  5FQI A;  5HL1 A;  3Q82 A;  3V39 A;  3A3E A;  2VJW A;  3Q7V A;  3IXG A;  2JKR I;  3E0Y A;  4N1H A;  3F1O A;  1OTD A;  4GB7 A;  3UB7 A;  4JGQ A;  2H28 A;  3WS2 A;  1G6O A;  1ESI A;  4MN6 A;  2Z2L B;  4OOL A;  2V8C A;  2XD1 A;  4QWO A;  4JGP A;  2DMW A;  3BEC A;  1RCJ A;  2J3T D;  2EX2 A;  5KIZ A;  4R6L A;  3NEC A;  1SDE A;  3C38 A;  1P9W A;  3N6I A;  1ZHH B;  1ZG6 A;  4BMW A;  3BEB A;  3BM6 A;  4C3Q A;  4GDB A;  4FTX A;  1NYM A;  4HES A;  4DJ2 A;  4P0M A;  3VOZ A;  2EXA A;  5FSR A;  3U2A A;  3IWO A;  3MS6 A;  4X1M A;  1NRJ A;  1PW8 A;  3LYX A;  2UWX A;  4X25 A;  4GN2 A;  4IVI A;  2GZA A;  2OWJ A;  3HUN A;  4QY5 A;  1XJ2 A;  1GA9 A;  3NDG A;  3CG5 A;  1IFQ A;  3H7W B;  2PAV P;  4JBF A;  2A2L A;  4NXG A;  1F2K A;  2EX9 A;  1XXM A;  4N1X A;  2Q9N A;  5CHJ A;  4HP4 A;  2Y59 A;  1TS0 A;  3E2L A;  1N9B A;  4ETZ A;  1S1Z A;  2W3D A;  2E8I A;  5EVI C;  3ZG0 A;  4EBP A;  4UA9 A;  1S1Y A;  2Y55 A;  3UB5 P;  1LT0 A;  1GHM A;  4GNU A;  5E2F A;  4DE2 A;  3G2Y A;  4DF6 A;  3B42 A;  2A24 B;  5J4E A;  3K2N A;  1LL8 A;  4EU0 A;  4U0X A;  1DP6 A;  3CUE A;  4OOY A;  2XGN A;  4BWI A;  2QHK A;  1VHM A;  4QHC A;  5TJJ A;  5HZH A;  3NUL A;  3C30 A;  2R9W A;  2ZMF A;  3DW0 A;  5KMW A;  2WAD A;  2FFY A;  4UAA A;  4KG6 A;  2JN7 A;  3K3D A;  4PAU A;  4YIN A;  4I39 A;  1VET A;  3HJK A;  3UE3 A;  3MKE A;  3GV9 A;  3HRE A;  1IKI A;  4PM6 A;  2VEA A;  2W3G A;  4R1G A;  2P7J A;  3MXS A;  2J80 A;  5FA7 A;  4KQD A;  3ITB A;  1OTI A;  4WUJ A;  2Z2M B;  3BQ8 A;  4FH2 A;  1EW0 A;  4GJ4 A;  5EVL A;  4PM9 A;  1L0F A;  5E2E A;  4N9K A;  3FKW A;  4EEU A;  1E25 A;  3LFV A;  2X01 A;  1K4E A;  1LLB A;  1P0Z A;  4NEE D;  2WAF A;  4HI4 A;  3I7J A;  3BQA A;  3BFD A;  2XH9 A;  2OLU A;  5HAR A;  3MFX A;  5HWT A;  4E3O A;  4N9L A;  3GEC A;  3IXH A;  1IYS A;  5HSQ A;  2W3F A;  3UME A;  3C5A A;  3RXW A;  5FL3 A;  2NUP C;  5FQJ A;  3PAE A;  1L3L A;  3HUM A;  3DWK A;  2IWC A;  4NXE A;  4R38 A;  1YLJ A;  5DTS A;  5A91 A;  2Y2I A;  3IX4 A;  1JWZ A;  3TRC A;  1C3B A;  1K57 A;  4BBV A;  3H9W A;  5EE8 A;  1OPX A;  3GDI A;  1BZA A;  5CX7 A;  3OLO A;  1YSQ A;  3O5Y A;  5TFQ A;  3WRT A;  3ZDJ A;  3S7O A;  4PM7 A;  1SKO A;  5HPI A;  3O3V A;  3MKF A;  4OP8 A;  3K3C A;  1WYB A;  4OP5 A;  3VSL A;  1RP5 A;  1YAX A;  5A90 A;  1CF0 A;  4EUV A;  2J3W A;  5HAP A;  4X68 A;  1O7E A;  1H3Q A;  3MSH A;  3LR5 A;  3NC8 A;  2XLN A;  1CEF A;  1YT4 A;  3VP0 A;  4II7 A;  4PM5 A;  5FAP A;  1UWP X;  2VGK A;  5TBM A;  2H0Y A;  4RQ9 A;  2B18 A;  4LPZ A;  4U0T A;  4WM9 A;  3R7W A;  2JHE A;  2UV0 E;  4JXW A;  1G6A A;  1ALQ A;  3OCN A;  4LV3 A;  2XF3 A;  3G35 A;  3NIA A;  4MBH A;  4EWF A;  5CRF A;  2EA9 A;  2I72 A;  1ESU A;  3CMZ A;  4EQ1 A;  1H8Z A;  3OPP A;  3GRJ A;  4DE3 A;  1HZO A;  3JVV A;  1FIL A;  1KGG A;  4FH4 A;  3IHB A;  4O01 A;  1BTL A;  5L07 A;  3MFD A;  1DJB A;  5FAO A;  4WEK A;  2V0W A;  1S6R A;  3NOT C;  3P7N A;  5AVF A;  1NRF A;  3IHA A;  1FQG A;  1T18 A;  1FCO A;  4KQQ A;  3CUE C;  4IBR A;  2VV7 A;  4WZ5 C;  2FZ0 A;  4DDY A;  2K31 A;  4OH0 A;  3LI9 A;  3L9K A;  3E4P A;  2ZOH A;  5CTM A;  3LIB A;  4R3A A;  3W8K A;  4PKY G;  1FSY A;  1OTE A;  4X1L A;  1NWZ A;  3MXQ A;  2WKR A;  4H8R A;  3BFF A;  3P98 A;  4YOF A;  3ZVT A;  1BLC A;  4E04 A;  3UB8 A;  3D72 A;  3OPR A;  1BLH A;  3H7W A;  1L0E A;  2EFX A;  4BLM A;  4B88 A;  5JYP A;  3T1S A;  3GMW A;  2YKH A;  2WKE A;  4KZ3 A;  2X71 A;  3WS0 A;  4D60 A;  1H8Y A;  2EXB A;  5TGF A;  4LRY C;  3SS3 A;  2OWH A;  2KOI A;  5G4Y A;  2WKP A;  1CI9 A;  1K55 A;  4GHI B;  1K54 A;  1F98 A;  1XGI A;  1E3U A;  2PR5 A;  2JKG A;  4H6J A;  2Q0O A;  5M1A A;  3HLG A;  1CK3 A;  1UWN X;  1TS7 A;  1TS8 A;  1E3U D;  2HDR A;  2VZW A;  3FWL A;  3LO7 A;  4HOI A;  1T1C A;  4S2K A;  1FCM A;  4OVD A;  3LR4 A;  3QP8 A;  3VP4 A;  1DP8 A;  2V1B A;  2DCF A;  1ONH A;  4LV2 A;  1MWT A;  1TDG A;  3MZF A;  1H8M A;  3EQU A;  1K57 C;  5FQM A;  2HZ5 A;  3GQZ A;  3ZHH A;  1PYY A;  4IHQ A;  4XUX A;  3V3S A;  2ZQ9 A;  4KZ5 A;  3RJU A;  5GLB A;  3LCE A;  5EOE A;  3UE6 A;  3VV4 A;  4DRT A;  4FOF A;  3GR2 A;  3GSG A;  2W3H A;  1XFN A;  5G18 A;  4HJ3 A;  3BY9 A;  3M6B A;  3JYI A;  1N4O A;  1BUE A;  2J9O A;  1DJC A;  1H5X A;  3MR0 A;  2Y2J A;  4X6T A;  1FIK A;  1S66 L;  4KZ8 A;  3HLF A;  1N9L A;  2ZL1 A;  4JLF A;  5AVE A;  3T12 B;  2Y4A A;  4S2P A;  1K38 A;  4WMC A;  4HQA A;  5HD3 A;  3PTE A;  4B93 A;  3S22 A;  5DJT A;  2WK0 A;  3BWL A;  3S7P A;  3KO6 A;  3UO9 A;  3IXD A;  4UHU A;  2WYX A;  2WKQ A;  5AQB A;  5IU1 A;  3TJZ C;  3W4Q A;  2VV6 A;  4WMC D;  3OPL A;  4OPR A;  5HAQ A;  2HDU A;  2W1T B;  1VM1 A;  2OAP 1;  1MBL A;  5L2F A;  3HLC A;  4QU3 A;  3E98 A;  3DTK A;  3WS5 A;  4Y2F A;  2OOL A;  4CLC B;  3IBR A;  1T1A A;  3LUQ A;  3C7V A;  2L0W A;  1OT9 A;  3FKV A;  1ONG A;  1X0O A;  4WZ4 A;  5GL9 A;  3ZG8 B;  3CLO A;  3QHY A;  2ZM2 A;  4P6Z S;  1DP9 A;  2JKT M;  2INW A;  3CPT B;  3IXB A;  2W0N A;  1KVM A;  4BJP A;  4Y0U A;  3LIC A;  3V5M A;  2KLI A;  1ERO A;  1K56 A;  2O9B A;  3G6O A;  4JF4 A;  1PI4 A;  2V1Z A;  3BFC A;  3IT9 A;  3DAV A;  5IS1 A;  3DTE A;  2EX6 A;  5EM1 A;  5CGX A;  1ES4 A;  3ITA A;  1K56 D;  2EX8 A;  1Y4O A;  3A3J A;  1OME A;  2P9V B;  3C7U A;  1NLZ A;  3PBN A;  3KX0 X;  1PRQ A;  4EER A;  2B5R A;  4E3I A;  3BW6 A;  5A8B A;  2Y2H A;  4M4X A;  4G3K A;  1PWG A;  2R78 A;  5G4Z A;  4O8G A;  4GDN A;  1FOF A;  4DE0 A;  2V8F A;  2GDN A;  3OC2 A;  3F1N B;  4RYE A;  2ZC4 B;  3G31 A;  5DF9 A;  1VB6 A;  3EEH A;  4ID4 A;  2XR0 A;  1OTA A;  2ZMV A;  1WYC A;  4OON A;  1K54 C;  2QZ6 A;  2H5S A;  2ZC6 B;  4Z9Q A;  4C6Y A;  4DDS A;  3ZYT A;  5FEG A;  2OAQ 1;  3KSG A;  4ZBE A;  3LID A;  1GSV A;  3N8R A;  3O86 A;  5C5K A;  2HP6 A;  3R4K A;  2M1C A;  1LHY A;  1SZV A;  1VEU A;  1K0K A;  2XA7 S;  4S2L A;  1ERM A;  1KE0 A;  3IWQ A;  4KG2 A;  4N92 A;  2WAE A;  2GNX A;  4P6Z M;  4Y15 A;  4YNR A;  3IX3 A;  2ZQD A;  2MJ6 A;  3D4F A;  1XJ3 A;  3WRZ A;  2WGI A;  3PAG A;  3PBQ A;  1L0G A;  2J8Y A;  2X02 A;  1HTZ A;  3BRM A;  3RFB A;  3CI6 A;  1YPR A;  1TD5 A;  3SOI A;  4F3L B;  1W79 A;  3ZQ5 A;  3Q7Z A;  1ERQ A;  3KSF A;  2L1M A;  2WKH A;  2JBF A;  3CZD A;  4U3T A;  3QP5 A;  2XEP A;  1D06 A;  3FZC A;  3TE8 A;  4DE1 A;  2XSS A;  4ETX A;  1GA0 A;  4GHI A;  4WL9 A;  1TDL A;  3D3O A;  5HFO A;  3N7W A;  1QMF A;  2OSU A;  4B4Z A;  1XKZ A;  5EVI B;  2XK1 A;  2HDS A;  1JTD A;  2PYR A;  4WBG A;  5J8X A;  3MF0 A;  4WF0 A;  5CTN A;  4ARZ A;  3IS2 A;  4BBT A;  5FAS A;  4HJ4 A;  1LL5 A;  2B95 A;  1YLT A;  4B4X A;  3VFF A;  2G2W A;  3S7N A;  5F5Y A;  5DVA A;  3KSH A;  4JKT A;  2C6W B;  5D3O A;  2W27 A;  4K08 A;  1NYY A;  1ES2 A;  2WZZ A;  4JXS A;  5DF7 A;  5AQ7 A;  4BEN A;  4JXG A;  4UA6 A;  2PYP A;  2VKS A;  1M40 A;  2RL3 A;  2BTF P;  2WGW B;  1XGJ A;  5EFW A;  1IOU A;  1ODV A;  4JF5 A;  4JPM A;  2JKT I;  3QP4 A;  3ZNY A;  1WE4 A;  2WZX A;  4L9F A;  3G30 A;  3C2W A;  2PHY A;  2A49 A;  4QY6 A;  1ES3 A;  1O07 A;  2J3T C;  2PRF A;  3LGO A;  4MMN A;  3DWZ A;  2W1R A;  3W2Z A;  3HVF A;  2Z6D A;  4UEY A;  2B02 A;  4LLO B;  3PR6 A;  5FI2 A;  4EQI A;  3Q81 A;  2HF6 A;  3T4L A;  3RTY A;  5HL6 A;  4NXF A;  4KQR A;  5GHZ A;  4LRZ E;  2HJE A;  3B3X A;  4DMZ A;  4KQO A;  1PZO A;  3U4L P;  3ZCZ A;  5GLA A;  2ZQ7 A;  4Q0H A;  1S4S A;  4MDZ A;  5CHM A;  1BLP A;  2JE5 A;  4MN5 A;  3NCK A;  3SS5 A;  3EGD C;  1NZO A;  4F94 A;  4CPK A;  4X56 A;  4ZJ2 A;  5DF8 A;  4HEF A;  4LCM A;  4EEP A;  4JGO A;  4X53 A;  3P01 A;  3CHW P;  1SCW A;  1KDW A;  3H82 A;  5CGW A;  3F1O B;  4OQG A;  5CED A;  5KSC A;  1LSW A;  3QP2 A;  3SH8 A;  4RX3 A;  4CLC A;  2J9P A;  5HX9 A;  1AWI A;  1N9O A;  2XRO A;  2PD7 A;  1OT6 A;  5M18 A;  1JWV A;  1UGU A;  3UE1 A;  4KG5 A;  4CLC D;  5DKK A;  3WS1 A;  2VGL S;  2Y91 A;  4HP9 A;  3W4P A;  4P6B A;  4BL2 A;  3UPP A;  3VP3 A;  2KDK A;  1MC0 A;  1XA7 A;  3HUO A;  4KZ9 A;  3DTI A;  1TS6 A;  2EFU A;  4KEN B;  3UB6 A;  5EOO A;  1KGE A;  4CQH A;  4GW9 A;  1I2W A;  2Y2K A;  3C8C A;  2P9V A;  3QNB A;  1Y28 A;  4GZB A;  1NY0 A;  1DY6 A;  3CJM A;  4Y0T A;  2M7U A;  2HV1 A;  3NOP C;  5FQK A;  2HGV A;  4I3A A;  1S0W A;  1SDN A;  1N9N A;  2ZLY A;  3A3F A;  1XX2 A;  1K6S A;  3BLS A;  4WEJ A;  1XFQ A;  4EBL A;  2P74 A;  2PBD P;  3QNC A;  4X55 A;  3VE3 A;  4QPR A;  2H0T A;  4E3L A;  3A3D A;  3LIE A;  2GJ3 A;  3LEZ A;  3V3R A;  3PBS A;  3BY8 A;  1M6K A;  4IJG A;  1IYQ A;  1QME A;  1IEM A;  3L7H A;  2NUT C;  4R3J A;  4IBX A;  1MPL A;  1RGZ A;  2ZOI A;  4YWZ A;  1KDS A;  2D01 A;  1U60 A;  5U47 A;  3IBJ A;  2ZM8 A;  1G68 A;  5DFY A;  5FQQ A;  2Y2N A;  3SW1 A;  3E4O A;  1YLW A;  2VGL M;  3NOU C;  5AJG A;  3TSG A;  4DXB A;  2L4R A;  5EUA A;  1KE3 A;  1NJ4 A;  4Z1W A;  1I2S A;  1F9I A;  1HVB A;  5HDS A;  3VOL A;  1J3W A;  1I5Q A;  1Q2P A;  4Q0J A;  2A24 A;  4S2I A;  1ACF A;  1XJ4 A;  1TVF A;  5IT5 A;  3SH9 A;  1W7F A;  1FR1 A;  3M2J A;  1KOU A;  4X69 A;  2BLS A;  1GSX A;  2VV8 A;  3ZG9 B;  1H0M A;  4ZAM A;  1G5U A;  4OQH A;  1VET B;  3T4Q A;  1OTB A;  2QKP A;  1PWD A;  3NHQ A;  5DKL A;  3A0V A;  3HLD A;  3RH8 B;  4EBN A;  2VX8 A;  4OKP A;  1MKM A;  3Q07 A;  4HBU A;  2BAS A;  4WEL A;  3UY6 A;  3ISG A;  5EPH A;  3G32 A;  3MQO A;  3SZT A;  3IF5 A;  2Y8H A;  3T1X A;  3AGF A;  4RA7 A;  3M6H A;  4R4S A;  4ZDX A;  3PBT A;  3A0R A;  3MZD A;  4XXR A;  3T1R A;  2HP5 A;  1TEM A;  5L09 A;  4GOG A;  2Y2O A;  4K0X A;  3VMA A;  5F69 A;  5EVI D;  2PDR A;  2QMI A;  1LL9 A;  2ACG A;  3GVB A;  4D2O A;  3C4P A;  4WN5 A;  4LCL A;  1XJ6 A;  1IYP A;  1YLZ A;  4I5S A;  3UPN A;  3PXP A;  5KZH A;  3NDE A;  4O7D A;  4HY8 A;  1SHV A;  3N4I A;  5HAI A;  1ZC2 A;  2CC1 A;  1OJG A;  1A0K A;  4CLC C;  1PIO A;  5FDS A;  4KZA A;  2ZC5 B;  4QD4 A;  4OLD A;  4IUH A;  2I9V A;  3KYQ A;  4FUW A;  2Q9M A;  2JC7 A;  5F1F A;  5K5B A;  4O0P A;  3UE0 A;  3UPO A;  1SKO B;  3DTM A;  1YKD A;  4OQI A;  3HLB A;  2Y2L A;  1BUL A;  1NXY A;  1ZG4 A;  4OOM A;  3QP6 A;  1RGY A;  1V9Z A;  4EW7 A;  3SS4 A;  3IQA A;  4GKU A;  5F83 A;  5F82 A;  2FFF B;  1LI0 A;  3EOI A;  1BLS A;  2V0U A;  2Z6C A;  4I38 A;  2VA0 A;  2QWS A;  1PZP A;  2QJ5 A;  5FDH A;  3IWI A;  3ZG5 A;  3S1Y A;  1CJF A;  2PR6 A;  3NJA A;  3PYP A;  3LI8 A;  3S7Q A; 
#chains in the Genus database with same CATH homology
 3T1Q B;  2JKF A;  2PBD P;  3U4L P;  4D60 A;  2PAV P;  1CQA A;  3D9Y A;  2ZL1 B;  1FIK A;  1F2K A;  2V8F A;  2ACG A;  2ZL1 A;  3T12 B;  3CHW P;  2VK3 A;  3L7H A;  2JKG A;  2B95 A;  1Z09 A;  5EM0 A;  3UB5 P;  1AWI A;  1A0K A;  5FEG A;  3KYE A;  1VEU B;  1FIL A;  2V8C A;  5FDS A;  4QWO A;  1SZV A;  1VEU A;  5FEF A;  1K0K A;  2BTF P;  1J3W A;  4FUW A;  1D1J A;  3NEC A;  1ACF A;  1SKO B;  1PFL A;  3CPT B;  2HZ5 A;  3NUL A;  1G5U A;  1PNE A;  1VET B;  3L9K A;  4FTX A;  1SKO A;  3CPT A;  4X1L A;  2PRF A;  3LGO A;  4ESP A;  5EVE A;  1VET A;  1YPR A;  3DAV A;  5EV0 A;  1CF0 A;  5EM1 A;  3MS6 A;  4X1M A;  2E8J A;  3LEQ A;  1Y4O A;  3T1X A;  4X25 A;  3MSH A;  3T1S A;  1HLU P;  1CJF A;  1PRQ A;  3T1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...