1F2KA

Crystal structure of acanthamoeba castellanii profilin ii, cubic crystal form
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAIIGHDGNTWATSAGFAVSPANGAALANAFKDATAIRSNGFELAGTRYVTIRADDRSVYGKKGSAGVITVKTSKAILIGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords PROFILIN II
publication title A Comparative Structural Analysis of Profilins
rcsb
source organism Acanthamoeba castellanii
total genus 37
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1f2kA00
4QWOA 1D1JA 3T1QB 5EV0A 5FEFA 1VEUA 3L9KA 1K0KA 3LGOA 2ZL1A 4ESPA 1PRQA 4FUWA 1VEUB 5EM0A 1CJFA 5FEGA 3NECA 1YPRA 1J3WA 3L7HA 2E8JA 3MSHA 2JKGA 2PRFA 3UB5P 4X25A 3T12B 1Y4OA 1ACFA 1FILA 4X1MA 3D9YA 2PAVP 3DAVA 4D60A 3T1SA 5FDSA 1AWIA 3NULA 1HLUP 3MS6A 1Z09A 5EM1A 3T1RA 2V8FA 5EVEA 1G5UA 3CPTA 3T1XA 2B95A 3U4LP 2V8CA 3CHWP 3CPTB 3LEQA 1CF0A 1PFLA 3KYEA 2HZ5A 1VETA 2VK3A 1F2KA 1CQAA 1A0KA 1SKOA 1VETB 4X1LA 1SZVA 1SKOB 2ZL1B 4FTXA 2BTFP 2JKFA 1PNEA 2ACGA 2PBDP 1FIKA
chains in the Genus database with same CATH superfamily
5J4EA 1RGZA 2Z2LB 4G3VA 2VX8A 3FPWA 2ZMFA 1E25A 2G7UA 3HLEA 3HUOA 5E2FA 3N4IA 5J3WA 1XJ6A 2Y2KA 2RL3A 3KX0X 5HSQA 3UB7A 5K5BA 3N7WA 1HTZA 1P9RA 3IQAA 1OTIA 4QB8A 3E98A 3MXQA 2WZZA 1MC0A 5DKLA 1PIOA 3T50A 3G6OA 5M19A 3O86A 3HJKA 4MEZA 4R1GA 3MZDA 4D60A 3IWQA 4BBTA 2XFSA 3UE0A 2ZMAA 5IHVA 4ZDXA 4R38A 2ZC3B 4IUKA 2Z6DA 1BULA 3T1RA 2V8FA 3PBSA 4WEJA 3BQ8A 3W8KA 1XJ4A 3LR3A 3TG9A 3HLGA 4IVIA 4UQIS 4KZAA 1HD8A 4I3AA 3ZGAB 2XGNA 3HLBA 4GCZA 2PYRA 5M18A 1OTAA 3MZEA 3F1NA 4BD1A 4K0XA 3UNWA 3QNBA 5CHUA 3F1NB 2WKIA 5IS1A 3JVVA 3LFVA 1BUEA 2VLGA 3QP6A 4ZJ1A 4DRTA 1K4FA 2WKRA 3MQOA 2PD7A 3FKWA 4GW9A 3WRTA 2Y2NA 4O01A 1XFQA 3UE6A 1YKDA 5TR7A 5J8XA 3T4JA 5DTKA 3NHQA 3UY6A 4IBXA 4BL3A 1OTEA 3MJQA 2H0YA 4Y0OA 4ARZA 4GD6A 5FQQA 3QP1A 4R3JA 3RXWA 3S7QA 5CRFA 3DBAA 3DWZA 4ARZB 3PYPA 4I39A 4JGRA 3SZTA 1Y28A 2O99A 4U0XA 4PKYG 1GHIA 4I3JA 4OQ0A 1BTLA 2VGLS 5E2GA 5CX7A 2Y91A 4LV2A 5A8BA 1EI5A 4II7A 3PR6A 4F94A 2QKPA 5HWTA 1LSVA 5E2HA 5F5YA 4KZ9A 1JWPA 2EA9A 1BLCA 1HVBA 2Y2PA 3MFDA 3G34A 1O7EA 3QHYA 2G2WA 4HJ4A 3KYEA 3HREA 3N6IA 2VK3A 2PDRA 3OZHA 4OPRA 2ZOHA 4JGPA 1ALQA 3M2JA 1P9WA 3FZCA 4JPMA 2QZ6A 4WYYA 1SZVA 4EESA 5HWWA 3S7OA 2BTFP 1YLTA 3JPUA 3H82A 3ZG8B 4Y17A 4D2OA 3H82B 4KZ4A 2ZC5B 2ZD8A 4JBFA 4XXRA 3LR4A 1OJ5A 1LL9A 4FH4A 4UAAA 4M4XA 5CTNA 4IEDA 3T4KA 4OP8A 2VJWA 3BRMA 3VSLA 1TD5A 3FYZA 3BWLA 3HLCA 4HP9A 2KOIA 3G30A 1FCNA 2WADA 2YKFA 4R3AA 1W7FA 4YFMA 3A3IA 4O0PA 2ZQ9A 2NUPC 4GD8A 5FDSA 4F3LA 5EE8A 3KSIA 3OPHA 1ZTUA 3VP3A 4F3LB 5A93A 4HQAA 3DWKA 1RGYA 4OH0A 2J8YA 4DE1A 3Q82A 1VHMA 3BECA 1NZUA 3P09A 4L9GA 3VFFA 3MKEA 5IU1A 3U4LP 4DMZA 1S4SA 2VGJA 1CF0A 2ZOIA 1CI8A 2W3DA 1WYBA 1XJ2A 3NCKA 5HARA 2EX8A 4Y0TA 2P04A 1NWZA 3Q7VA 4DN0A 4I3IA 5FQIA 2M7UA 2X71A 1GHPA 5F69A 3HVFA 3IT9A 3Q7VB 3WS0A 2LB9A 2O9AA 2WGVA 2XDMA 4FTXA 5DJTA 4Y13A 1NLZA 2Y79A 4X69A 1Z6FA 1CEFA 4X55A 1ES3A 2EX6A 2ZMVA 5JYPA 4QJGA 2XQZA 1S1YA 3UB6A 4ESPA 4OQHA 5DTSA 4EUVA 1OMEA 3TRCA 3NECA 4JXGA 3KSFA 5FI6A 3LY4A 1DJAA 1K54C 3HLDA 4YINA 5HL1A 2XD1A 1DY6A 4WMCA 2EWVA 4EV4A 4R4SA 3HJIA 1W63Q 1OT9A 3IH8A 2Y55A 1S6RA 5EPHA 1NJ4A 1BZAA 2P74A 1BLSA 5F6AA 3NULA 3ZQ5A 3GQZA 4BL2A 2PT7A 2ZQ7A 4K91A 2OLVA 3UPOA 1KVLA 3VP2A 4BBVA 2EX9A 5EVIA 3KO6A 1KDWA 3KSGA 4WZ5C 4WZ4A 5EVIB 4HOIA 1K57A 3LEQA 2P9VA 5LBRA 3IWOA 1VETA 3S7PA 2P9VB 4C75A 3TJZC 4DXCA 1VETB 3MQ0A 3VE4A 4FOFA 1FQGA 5F1GA 1K38A 1MWTA 3UDXA 4JF6A 2J3TC 4S2IA 2OSUA 3V67A 4EEUA 2OAP1 2I9VA 2PYPA 2Y2GA 2J9OA 3H7WA 3MFXA 1MXOA 3NI9A 2HGVA 4OVDA 2WGIA 4LPZA 4FD8A 2XSSA 3MXSA 2D02A 3PTEA 4E3JA 5FSRA 3B42A 3VV4A 2OWJA 3RTYA 4NEED 1ES2A 4EQ1A 3NOTC 4DKIA 4GNUA 3IX3A 1FR1A 3V5MA 3W4QA 1K54A 3BEBA 3LR0A 3ZCZA 5J7EA 5DJUA 1I2SA 2JKTM 4CQHA 2OOLA 5FATA 3T12B 4WF0A 1TEMA 5F1FA 3K3CA 1DJCA 5M1AA 4WMCD 3G2YA 3BLSA 1PZOA 4M3KA 1MZUA 5EM1A 5CGWA 1YT4A 2HDQA 1NXYA 5EVEA 3LUQA 4OKPA 2J9PA 2XFTA 1L0FA 3QP4A 3IXBA 2B95A 5L09A 4XT2A 3ZG9B 4C3QA 2HP6A 4R23A 2WZXA 3UE3A 4KENB 1PZPA 1TVFA 2JBFA 4XT2B 3B33A 1IEMA 2ZM0A 2WAEA 4QPRA 5EVID 1ZC2A 1F98A 2XEPA 1PI4A 4Q8IA 3C7VA 1BLPA 2B5RA 3LY3A 1EROA 3P01A 1UGUA 3JYIA 1XPBA 3PAGA 3IS2A 4H8RA 4EXOA 2JN7A 2Q9NA 4QY6A 4ETXA 2XRNA 3LIAA 3VP4A 4FUWA 5HD3A 5DKKA 5HDSA 2HPBA 2W3FA 3LYXA 3NBLA 5I94A 5G4YA 5GHXA 3E2KA 3PBOA 4MNRA 4HY8A 1NZOA 1SDNA 1W63M 5FQKA 5HL6A 5TFQA 2KDKA 3UB5P 3WWXA 2Y2IA 1Y4OA 2W1RA 5L2FA 1TDLA 4ZTKA 4CPKA 3BFFA 3DAVA 2W27A 4KZ8A 2EXBA 3E2LA 4NXGA 2P08A 4WEKA 2INWA 1G6AA 3CITA 3TSGA 1NYYA 2VZWA 3HLWA 3GV9A 3Q1FA 2Y2LA 2MJ6A 4HHDA 4KQDA 3MR0A 4GKUA 4RX3A 3BY8A 3GECA 4N9LA 2M7VA 4KQQA 4WBGA 2UV0E 1LT0A 3NY4A 4LCLA 1CQAA 2KX6A 2PHYA 4PKYA 5G4ZA 2H28A 4KQOA 4P85A 4LV0A 4C6YA 1GA0A 5CGXA 2XK1A 4Y0UA 4Q0JA 1G68A 2JKFA 2M1CA 3W2ZA 4DDSA 1TS7A 3F1OA 2EXAA 1ONGA 3L9KA 3KYZA 5CEDA 3F1OB 2VV8A 4QY5A 5EOOA 3HL9A 3AGDA 5EM0A 2V9AA 1S66L 1KGGA 2A2LA 1L0GA 4Q0HA 2AVXA 2QPNA 4HNBA 4OQIA 2XA7S 1IKGA 5DF9A 5FQ9A 4E6WA 4S2LA 1K4EA 3UB9A 1I5QA 4X1MA 3V3SA 5KSCA 4FH2A 2CMNA 4ZBEA 4NG2A 4JGOA 1VQQA 4I38A 3EGDC 3ICYA 3D3OA 1XP4A 1C3BA 2JKTI 4BBUA 3VE3A 5HPFA 1IYPA 2WGWB 5FAQA 3GR2A 5HZHA 1G5UA 3IH9A 1KDSA 5CTMA 2Q9MA 3U2AA 1KVMA 3K3DA 1OT6A 3BFCA 5EECA 4Z9QA 2WYXA 3E4OA 3ISGA 3SS5A 4GDNA 1F5MA 1YLWA 3C4OA 1GCEA 2OAQ1 1K56A 1IELA 3TOIA 4MBKA 1RP5A 3RXXA 4N9KA 3C4PA 3F1PA 2XD5A 1IYQA 3BJNA 4UEYA 4B4ZA 3IX4A 3MKFA 3F1PB 4LCMA 1Q2PA 4OOLA 3SH7A 2X02A 1L2SA 2R78A 4EEPA 1GHMA 3UN7A 1W8QA 3OCNA 3CWFA 4S2JA 4EW7A 1RCJA 3RFBA 3L7HA 1XGIA 4HH2A 4EQIA 3E4QA 2K7SA 3VFHA 2H0TA 2DCFA 3S4XA 4CLCC 3DTEA 3ZVTA 2VEAA 3UPNA 4PHTA 2IWDA 3WS1A 3ZG5A 2HF6A 1STZA 5HDCA 1LI0A 1YLPA 3M6BA 4DF6A 1T19A 3VOLA 1ESUA 1Z09A 3I7JA 4BLMA 1IFQA 4IUHA 4K08A 1YLJA 1ES4A 1S0WA 3HCYA 3EQVA 3BQAA 4RVAA 4Y3IA 3LO7A 1WYCA 2EWWA 2HDUA 3BFEA 2V8CA 4OLGA 4OOYA 1IYSA 3VSKA 3UDIA 4P6ZS 1BT5A 1QMFA 4HBUA 1T1AA 1T1CA 4X6TA 1A0KA 2W3HA 1KGEA 2P7JA 2BG1A 3FWLA 1MWUA 2QHKA 1K6RA 1VB6A 3G32A 1LSXA 3CUEC 1LL8A 1JTDA 4UHUA 1XXMA 1S1ZA 1YLZA 3E0YA 4HI4A 2ACGA 1N9LA 1MPLA 4LENA 3B3XA 1F9IA 3T1QB 4GS9A 1OJGA 1CK3A 4R3BA 3MBZA 4GS9B 3R7WA 1TDGA 3LEZA 1YSQA 1NRJA 2DNSA 3R7WB 5FI2A 1YPRA 4BENA 4ID4A 3OPRA 1ODVA 2E8JA 3ITAA 4ETZA 5CGSA 1L0EA 3GSGA 4JXVA 4Q0IA 1H3QA 1FILA 3MZFA 1WA9A 2HV1A 2Y4AA 4DJ3A 3OPPA 3DTMA 2Q0OA 3NIAA 3PHYA 1YM1A 4KG6A 3GMWA 4L9EA 1XKZA 3IWIA 5A90A 4KZBA 3LIEA 3MS6A 4S2PA 4IJGA 4KG2A 1H8MA 4B88A 4NETA 4GZBA 3WS4A 3QP8A 2OV5A 4EBLA 1IOUA 5TJJA 2ZM2A 4ZRRA 5AQ7A 4JGQA 4PM9A 2OWHA 1KGFA 4OPYA 3A3JA 3IXGA 2PU2A 3O5YA 3B47A 5F68A 3IBRA 4O7DA 1W79A 3UMDA 3DW0A 3DTIA 2E8IA 1FOFA 1FSYA 3N8RA 4YNRA 1ERMA 2PR6A 1K25A 4I5SA 4UA9A 3UB8A 1IKIA 3D4FA 2O0YA 2ZM8A 2J3WA 2W0NA 2ZL1B 4WN5A 3FG8A 1GSXA 3W4OA 3Q81A 2WAFA 4UA7A 2HP9A 1TS6A 3CUEA 4MMNA 3CAXA 4HIAA 4YWZA 4BD0A 3UMEA 4WM9A 4GHIA 1PI5A 3EEAA 5F83A 4DXBA 2L4RA 3A3EA 1K0KA 1CI9A 4GHIB 4Y15A 3R4KA 1PRQA 3JVUA 1DP9A 4EBPA 4U3TA 1ES5A 3C30A 3EEHA 3IF6C 1SDEA 1G6OA 2LB5A 2IWBA 5KIZA 1XGJA 4IHQA 4EU0A 3MSHA 5KZHA 4MBHA 1PWDA 4EWFA 3T4LA 1SHVA 2IWCA 3EWKA 5CXWA 4H6JA 1HLUP 1E4DA 1T18A 5MC7A 4BJPA 2ZLYA 4G3WA 4WL9A 1DP8A 4H6JB 1X0OA 4B9OA 4OPZA 4S2NC 2XLNA 3LI8A 5FDHA 3T1XA 2O9BA 2Y59A 3NC8A 2ZBBA 1N4OA 1ZG6A 2B18A 4BWIA 2HZ5A 4N1XA 4N1HA 1XA7A 4LFUA 2QJ5A 3N8LA 3LCEA 1W8YA 5HW3A 3G4PA 4X1LA 5BOHA 4NKPA 3NOPC 4DDYA 1S4RA 4GLQA 1GSWA 2R9WA 1FIKA 4X56A 3TE8A 3SS3A 4WZ5A 1I2WA 5EV0A 4HP4A 2NUTC 2ZC4B 2Z6CA 3LIBA 4B4XA 1H8ZA 3C8CA 3OCLA 1CJFA 3NJAA 2WKQA 1V9ZA 4IVKA 1J3WA 3K2NA 4Z1WA 3V3RA 3BY9A 1MKMA 4S2OA 4A5RA 4E3OA 2XH9A 3LI9A 2JHEA 3PBTA 2QWSA 4IBRA 1BSGA 3IHBA 4LGWA 2D01A 2ZQAA 1D7EA 4GJ4A 4E3KA 1AXBA 5GHYA 2GNXA 1AWIA 1XA1A 3CLOA 4Y2FA 3M2KA 3IXHA 5FL3A 3ZG0A 4EUZA 4MLLA 1K55C 4ZJ3A 3C38A 4QD4A 5FASA 4L0LA 3ULFA 1L3LA 3LIFA 4S2NA 3ZNYA 3CG5A 2Y2MA 3CMZA 4MCWA 4JLFA 2VV6A 5A92A 3O88A 3EOIA 2J7VA 1KOUA 2EX2A 2ZC7A 1CEGA 2HDRA 3OLOA 1YAXA 4MN6A 3SH8A 5FI7A 2V20A 4DJ2A 3Q07A 5HD5A 3PBNA 3PAEA 4S2MA 4HJ3A 5A91A 3RH8B 2HP5A 3FPVA 4QWOA 2G2UA 4MN5A 2DRWA 2GX5A 2PD8A 2PR5A 4E3MA 1VEUA 3GVBA 4MN7A 3WS5A 3LGOA 2V1ZA 1VEUB 1Y54A 1SCWA 1E3UA 3ZFZA 4PM7A 2JCHA 3KYQA 1FR6A 2OLUA 3T4TA 4KUOA 2JKGA 2PRFA 2RCXA 4WELA 2V1AA 2V0WA 5AVEA 3UDFA 2L1MA 4LRZE 5C5KA 2PAVP 5GHZA 2XF3A 4OONA 3RJUA 4RX2A 1O07A 1LHYA 4NXBA 2J3TD 2Y8HA 3VOZA 2VGKA 4S2KA 2ZC6B 4BQMA 5AQBA 2V2FF 4HEFA 2WUQA 3FV7A 2GJ3A 4X68A 3A0SA 3LIDA 3AGFA 1K55A 3MMHA 3C7UA 1NRFA 4OLDA 3A0RA 2EFUA 5KSHA 2WGWA 2H5SA 1LSWA 5L10A 4PMAA 2B02A 1SKOA 1DJBA 2QMIA 2K2NA 5AQAA 5TGFA 1SKOB 4RA7A 4LV3A 3LICA 3T4OA 2JC7A 3PBQA 2K31A 3IXDA 4E04A 3OPLA 5AQ9A 1D1JA 1EWZA 4HJ6A 4UQIM 2C6WB 1GA9A 2V1BA 3VP0A 4HH3A 4GDBA 1HZOA 4UA6A 3P7NA 1OTBA 2Y2JA 4KZ3A 3VOYA 4JF5A 2DMWA 3T4QA 2VV7A 2JE5A 3PBRA 1K6SA 4PAUA 1V9YA 4JXSA 3TW8A 1XJ3A 4P0MA 1M6KA 3SS4A 2VA0A 1L0DA 3E4PA 5HAQA 4GOGA 3VP1A 2QYBA 4ZJ2A 2XA7M 4B93A 1BYWA 2BASA 1E3UD 3IF5A 3NDGA 4EBNA 4O8GA 5FQMA 4OPQA 3BW6A 3SH9A 4KZ5A 2J80A 2V0UA 4Y5FA 5D3OA 1TS8A 3DTKA 1M40A 2W3GA 5DFXA 4GB7A 1ZHHB 5DF8A 3SW1A 4PPRA 2L0WA 5AVFA 4L9FA 5L07A 3AGEA 3LR5A 5GLCA 3ZHHA 2VGLM 3W4PA 4NXFA 3T4SA 4KZ6A 5G18A 4R0QA 3NDEA 3D72A 3QP2A 1J9MA 3CJMA 5HDDA 4LLOB 2PBDP 4DE0A 3WRZA 1JTGA 3BLMA 2GDNA 5EFWA 3OC2A 4U0TA 5FEFA 2WKHA 5DFYA 4KZ7A 4DE3A 2A24A 2IA2A 3MXRA 4E3LA 3ZDJA 4BMWA 1JWZA 1TS0A 2O9CA 2A24B 3KSHA 3ZNTA 3NOUC 5EVIC 3G31A 1YMXA 4R4RA 1G28A 3O87A 1KE0A 5HX9A 4XUXA 1H0MA 4P87A 1K57C 1NY0A 1K56D 3PXPA 3T1SA 3ITBA 3BFDA 1KE4A 1VM1A 4P6BA 1IYOA 2FZ0A 5DVAA 5FQJA 3V50A 4E6XA 1PWGA 4K0WA 5F82A 5E43A 3CPTA 1FSWA 1BLHA 4YOFA 4WUJA 4E3IA 4ME4A 3EGXC 3ZG7B 5FAOA 3CPTB 4PM6A 4CLCA 1WE4A 5GLAA 4LRXC 1NLYA 2ZQDA 3HUNA 2XROA 1YMSA 2C5WB 5AJGA 5EOEA 4ZAMA 1MY8A 2JKRM 3UE1A 4CLCB 4P6ZM 4G3KA 2PU4A 4NXEA 3IHAA 4HESA 5CHJA 3GDIA 5TBMA 5HWVA 1PW8A 5GLBA 3WS2A 1NYMA 1YLYA 5DF7A 2HDSA 5JYOA 4DE2A 5HPIA 3M6HA 5TBMB 2VKSA 3HUMA 2WKEA 1ONHA 4EERA 3S7NA 2R9XA 2HJEA 1PW1A 1MBLA 2ZL1A 1TF1A 4EETB 4N92A 2ZQ8A 5FEGA 1YSPA 1S67L 4FSFA 4R70A 3MF0A 5KMWA 4HBTA 4QU3A 1KE3A 4QHCA 4AFIA 1YQSA 5FAPA 3A3DA 1DP6A 1SKFA 5HFOA 2BLSA 5CECA 2KLIA 2X01A 1GSVA 3Q7ZA 3OOVA 3ZVWA 1LLBA 1ZKJA 3EQUA 1JWVA 1ZG4A 4JF4A 1D06A 2HJ9C 2WK0A 3SOIA 5EVLA 1U60A 1LL5A 3UO9A 2XR0A 4Y7PA 4PM5A 1H5XA 1QMEA 4OQGA 3OBFA 1OTDA 2FFYA 2Y2QA 1UWNX 4KG5A 2YKHA 4KUKA 1MWRA 1FCOA 1F2KA 4WLAA 1FCMA 3GRJA 3H7WB 2EFXA 3G2ZA 5CEBA 1P0ZA 3CI6A 3G35A 3ZYTA 5U47A 3GTCA 1PNEA 5CHMA 1OPXA 1H8YA 4CLCD 1ESIA 2PBYA 2W3EA 4OP5A 5GL9A 3HLFA 4GN2A 5EUAA 4X53A 3O3VA 1LI9A 1MKIA 1DRMA 2Y2HA 4OOMA 1UWPX 3MQQA 3A3FA 2CC1A 5GLDA 1MWSA 1Q2QA 4CLCE 3QNCA 3IX8A 4CJNA 3BFGA 1N9NA 1XFNA 5DTTA 4RYEA 2H10A 2A3UA 4X25A 2GZAA 1P97A 1ACFA 3D9YA 3BYDA 4MBFA 4E3NA 4JKTA 5I5LA 2W1TA 3BM6A 3VMAA 5HAPA 2Z2MB 3C5AA 3QP5A 3S22A 1T1BA 2QJ7A 1W5DA 4NK3A 3N8SA 2W1TB 3IF6A 2A49A 2Y2OA 3CZDA 4JXWA 4RQ9A 1ERQA 3FKVA 3S1YA 3IF6B 2ZQCA 1EW0A 1N9BA 1JVJA 4XUZA 3CHWP 4PM8A 2FFFB 3IBJA 1PWCA 1PFLA 3P98A 4R6LA 4KQRA 5E2EA 4LRYC 4LV1A 1XX2A 4MDZA 3H9WA 4FCFA 1JNUA 5FA7A 5IT5A 5HAIA 2FH5A 3IS2B 3HBRA 3V39A 2I72A 2ZJ9A 1PYYA 3UPPA 5L8MA 2JKRI 1N9OA 2WKPA 3C2WA 3FC7A 3A0VA 2UWXA 5CERA
chains in the Genus database with same CATH topology
4QWOA 1D1JA 3T1QB 5EV0A 5FEFA 1VEUA 3L9KA 1K0KA 3LGOA 2ZL1A 4ESPA 1PRQA 4FUWA 1VEUB 5EM0A 1CJFA 5FEGA 3NECA 1YPRA 1J3WA 3L7HA 2E8JA 3MSHA 2JKGA 2PRFA 3UB5P 4X25A 3T12B 1Y4OA 1ACFA 1FILA 4X1MA 3D9YA 2PAVP 3DAVA 4D60A 3T1SA 5FDSA 1AWIA 3NULA 1HLUP 3MS6A 1Z09A 5EM1A 3T1RA 2V8FA 5EVEA 1G5UA 3CPTA 3T1XA 2B95A 3U4LP 2V8CA 3CHWP 3CPTB 3LEQA 1CF0A 1PFLA 3KYEA 2HZ5A 1VETA 2VK3A 1F2KA 1CQAA 1A0KA 1SKOA 1VETB 4X1LA 1SZVA 1SKOB 2ZL1B 4FTXA 2BTFP 2JKFA 1PNEA 2ACGA 2PBDP 1FIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWO A;  1D1J A;  3T1Q B;  5EV0 A;  5FEF A;  1VEU A;  3L9K A;  1K0K A;  3LGO A;  2ZL1 A;  4ESP A;  1PRQ A;  4FUW A;  1VEU B;  5EM0 A;  1CJF A;  5FEG A;  3NEC A;  1YPR A;  1J3W A;  3L7H A;  2E8J A;  3MSH A;  2JKG A;  2PRF A;  3UB5 P;  4X25 A;  3T12 B;  1Y4O A;  1ACF A;  1FIL A;  4X1M A;  3D9Y A;  2PAV P;  3DAV A;  4D60 A;  3T1S A;  5FDS A;  1AWI A;  3NUL A;  1HLU P;  3MS6 A;  1Z09 A;  5EM1 A;  3T1R A;  2V8F A;  5EVE A;  1G5U A;  3CPT A;  3T1X A;  2B95 A;  3U4L P;  2V8C A;  3CHW P;  3CPT B;  3LEQ A;  1CF0 A;  1PFL A;  3KYE A;  2HZ5 A;  1VET A;  2VK3 A;  1F2K A;  1CQA A;  1A0K A;  1SKO A;  1VET B;  4X1L A;  1SZV A;  1SKO B;  2ZL1 B;  4FTX A;  2BTF P;  2JKF A;  1PNE A;  2ACG A;  2PBD P;  1FIK A; 
#chains in the Genus database with same CATH topology
 5J4E A;  1RGZ A;  2Z2L B;  4G3V A;  2VX8 A;  3FPW A;  2ZMF A;  1E25 A;  2G7U A;  3HLE A;  3HUO A;  5E2F A;  3N4I A;  5J3W A;  1XJ6 A;  2Y2K A;  2RL3 A;  3KX0 X;  5HSQ A;  3UB7 A;  5K5B A;  3N7W A;  1HTZ A;  1P9R A;  3IQA A;  1OTI A;  4QB8 A;  3E98 A;  3MXQ A;  2WZZ A;  1MC0 A;  5DKL A;  1PIO A;  3T50 A;  3G6O A;  5M19 A;  3O86 A;  3HJK A;  4MEZ A;  4R1G A;  3MZD A;  4D60 A;  3IWQ A;  4BBT A;  2XFS A;  3UE0 A;  2ZMA A;  5IHV A;  4ZDX A;  4R38 A;  2ZC3 B;  4IUK A;  2Z6D A;  1BUL A;  3T1R A;  2V8F A;  3PBS A;  4WEJ A;  3BQ8 A;  3W8K A;  1XJ4 A;  3LR3 A;  3TG9 A;  3HLG A;  4IVI A;  4UQI S;  4KZA A;  1HD8 A;  4I3A A;  3ZGA B;  2XGN A;  3HLB A;  4GCZ A;  2PYR A;  5M18 A;  1OTA A;  3MZE A;  3F1N A;  4BD1 A;  4K0X A;  3UNW A;  3QNB A;  5CHU A;  3F1N B;  2WKI A;  5IS1 A;  3JVV A;  3LFV A;  1BUE A;  2VLG A;  3QP6 A;  4ZJ1 A;  4DRT A;  1K4F A;  2WKR A;  3MQO A;  2PD7 A;  3FKW A;  4GW9 A;  3WRT A;  2Y2N A;  4O01 A;  1XFQ A;  3UE6 A;  1YKD A;  5TR7 A;  5J8X A;  3T4J A;  5DTK A;  3NHQ A;  3UY6 A;  4IBX A;  4BL3 A;  1OTE A;  3MJQ A;  2H0Y A;  4Y0O A;  4ARZ A;  4GD6 A;  5FQQ A;  3QP1 A;  4R3J A;  3RXW A;  3S7Q A;  5CRF A;  3DBA A;  3DWZ A;  4ARZ B;  3PYP A;  4I39 A;  4JGR A;  3SZT A;  1Y28 A;  2O99 A;  4U0X A;  4PKY G;  1GHI A;  4I3J A;  4OQ0 A;  1BTL A;  2VGL S;  5E2G A;  5CX7 A;  2Y91 A;  4LV2 A;  5A8B A;  1EI5 A;  4II7 A;  3PR6 A;  4F94 A;  2QKP A;  5HWT A;  1LSV A;  5E2H A;  5F5Y A;  4KZ9 A;  1JWP A;  2EA9 A;  1BLC A;  1HVB A;  2Y2P A;  3MFD A;  3G34 A;  1O7E A;  3QHY A;  2G2W A;  4HJ4 A;  3KYE A;  3HRE A;  3N6I A;  2VK3 A;  2PDR A;  3OZH A;  4OPR A;  2ZOH A;  4JGP A;  1ALQ A;  3M2J A;  1P9W A;  3FZC A;  4JPM A;  2QZ6 A;  4WYY A;  1SZV A;  4EES A;  5HWW A;  3S7O A;  2BTF P;  1YLT A;  3JPU A;  3H82 A;  3ZG8 B;  4Y17 A;  4D2O A;  3H82 B;  4KZ4 A;  2ZC5 B;  2ZD8 A;  4JBF A;  4XXR A;  3LR4 A;  1OJ5 A;  1LL9 A;  4FH4 A;  4UAA A;  4M4X A;  5CTN A;  4IED A;  3T4K A;  4OP8 A;  2VJW A;  3BRM A;  3VSL A;  1TD5 A;  3FYZ A;  3BWL A;  3HLC A;  4HP9 A;  2KOI A;  3G30 A;  1FCN A;  2WAD A;  2YKF A;  4R3A A;  1W7F A;  4YFM A;  3A3I A;  4O0P A;  2ZQ9 A;  2NUP C;  4GD8 A;  5FDS A;  4F3L A;  5EE8 A;  3KSI A;  3OPH A;  1ZTU A;  3VP3 A;  4F3L B;  5A93 A;  4HQA A;  3DWK A;  1RGY A;  4OH0 A;  2J8Y A;  4DE1 A;  3Q82 A;  1VHM A;  3BEC A;  1NZU A;  3P09 A;  4L9G A;  3VFF A;  3MKE A;  5IU1 A;  3U4L P;  4DMZ A;  1S4S A;  2VGJ A;  1CF0 A;  2ZOI A;  1CI8 A;  2W3D A;  1WYB A;  1XJ2 A;  3NCK A;  5HAR A;  2EX8 A;  4Y0T A;  2P04 A;  1NWZ A;  3Q7V A;  4DN0 A;  4I3I A;  5FQI A;  2M7U A;  2X71 A;  1GHP A;  5F69 A;  3HVF A;  3IT9 A;  3Q7V B;  3WS0 A;  2LB9 A;  2O9A A;  2WGV A;  2XDM A;  4FTX A;  5DJT A;  4Y13 A;  1NLZ A;  2Y79 A;  4X69 A;  1Z6F A;  1CEF A;  4X55 A;  1ES3 A;  2EX6 A;  2ZMV A;  5JYP A;  4QJG A;  2XQZ A;  1S1Y A;  3UB6 A;  4ESP A;  4OQH A;  5DTS A;  4EUV A;  1OME A;  3TRC A;  3NEC A;  4JXG A;  3KSF A;  5FI6 A;  3LY4 A;  1DJA A;  1K54 C;  3HLD A;  4YIN A;  5HL1 A;  2XD1 A;  1DY6 A;  4WMC A;  2EWV A;  4EV4 A;  4R4S A;  3HJI A;  1W63 Q;  1OT9 A;  3IH8 A;  2Y55 A;  1S6R A;  5EPH A;  1NJ4 A;  1BZA A;  2P74 A;  1BLS A;  5F6A A;  3NUL A;  3ZQ5 A;  3GQZ A;  4BL2 A;  2PT7 A;  2ZQ7 A;  4K91 A;  2OLV A;  3UPO A;  1KVL A;  3VP2 A;  4BBV A;  2EX9 A;  5EVI A;  3KO6 A;  1KDW A;  3KSG A;  4WZ5 C;  4WZ4 A;  5EVI B;  4HOI A;  1K57 A;  3LEQ A;  2P9V A;  5LBR A;  3IWO A;  1VET A;  3S7P A;  2P9V B;  4C75 A;  3TJZ C;  4DXC A;  1VET B;  3MQ0 A;  3VE4 A;  4FOF A;  1FQG A;  5F1G A;  1K38 A;  1MWT A;  3UDX A;  4JF6 A;  2J3T C;  4S2I A;  2OSU A;  3V67 A;  4EEU A;  2OAP 1;  2I9V A;  2PYP A;  2Y2G A;  2J9O A;  3H7W A;  3MFX A;  1MXO A;  3NI9 A;  2HGV A;  4OVD A;  2WGI A;  4LPZ A;  4FD8 A;  2XSS A;  3MXS A;  2D02 A;  3PTE A;  4E3J A;  5FSR A;  3B42 A;  3VV4 A;  2OWJ A;  3RTY A;  4NEE D;  1ES2 A;  4EQ1 A;  3NOT C;  4DKI A;  4GNU A;  3IX3 A;  1FR1 A;  3V5M A;  3W4Q A;  1K54 A;  3BEB A;  3LR0 A;  3ZCZ A;  5J7E A;  5DJU A;  1I2S A;  2JKT M;  4CQH A;  2OOL A;  5FAT A;  3T12 B;  4WF0 A;  1TEM A;  5F1F A;  3K3C A;  1DJC A;  5M1A A;  4WMC D;  3G2Y A;  3BLS A;  1PZO A;  4M3K A;  1MZU A;  5EM1 A;  5CGW A;  1YT4 A;  2HDQ A;  1NXY A;  5EVE A;  3LUQ A;  4OKP A;  2J9P A;  2XFT A;  1L0F A;  3QP4 A;  3IXB A;  2B95 A;  5L09 A;  4XT2 A;  3ZG9 B;  4C3Q A;  2HP6 A;  4R23 A;  2WZX A;  3UE3 A;  4KEN B;  1PZP A;  1TVF A;  2JBF A;  4XT2 B;  3B33 A;  1IEM A;  2ZM0 A;  2WAE A;  4QPR A;  5EVI D;  1ZC2 A;  1F98 A;  2XEP A;  1PI4 A;  4Q8I A;  3C7V A;  1BLP A;  2B5R A;  3LY3 A;  1ERO A;  3P01 A;  1UGU A;  3JYI A;  1XPB A;  3PAG A;  3IS2 A;  4H8R A;  4EXO A;  2JN7 A;  2Q9N A;  4QY6 A;  4ETX A;  2XRN A;  3LIA A;  3VP4 A;  4FUW A;  5HD3 A;  5DKK A;  5HDS A;  2HPB A;  2W3F A;  3LYX A;  3NBL A;  5I94 A;  5G4Y A;  5GHX A;  3E2K A;  3PBO A;  4MNR A;  4HY8 A;  1NZO A;  1SDN A;  1W63 M;  5FQK A;  5HL6 A;  5TFQ A;  2KDK A;  3UB5 P;  3WWX A;  2Y2I A;  1Y4O A;  2W1R A;  5L2F A;  1TDL A;  4ZTK A;  4CPK A;  3BFF A;  3DAV A;  2W27 A;  4KZ8 A;  2EXB A;  3E2L A;  4NXG A;  2P08 A;  4WEK A;  2INW A;  1G6A A;  3CIT A;  3TSG A;  1NYY A;  2VZW A;  3HLW A;  3GV9 A;  3Q1F A;  2Y2L A;  2MJ6 A;  4HHD A;  4KQD A;  3MR0 A;  4GKU A;  4RX3 A;  3BY8 A;  3GEC A;  4N9L A;  2M7V A;  4KQQ A;  4WBG A;  2UV0 E;  1LT0 A;  3NY4 A;  4LCL A;  1CQA A;  2KX6 A;  2PHY A;  4PKY A;  5G4Z A;  2H28 A;  4KQO A;  4P85 A;  4LV0 A;  4C6Y A;  1GA0 A;  5CGX A;  2XK1 A;  4Y0U A;  4Q0J A;  1G68 A;  2JKF A;  2M1C A;  3W2Z A;  4DDS A;  1TS7 A;  3F1O A;  2EXA A;  1ONG A;  3L9K A;  3KYZ A;  5CED A;  3F1O B;  2VV8 A;  4QY5 A;  5EOO A;  3HL9 A;  3AGD A;  5EM0 A;  2V9A A;  1S66 L;  1KGG A;  2A2L A;  1L0G A;  4Q0H A;  2AVX A;  2QPN A;  4HNB A;  4OQI A;  2XA7 S;  1IKG A;  5DF9 A;  5FQ9 A;  4E6W A;  4S2L A;  1K4E A;  3UB9 A;  1I5Q A;  4X1M A;  3V3S A;  5KSC A;  4FH2 A;  2CMN A;  4ZBE A;  4NG2 A;  4JGO A;  1VQQ A;  4I38 A;  3EGD C;  3ICY A;  3D3O A;  1XP4 A;  1C3B A;  2JKT I;  4BBU A;  3VE3 A;  5HPF A;  1IYP A;  2WGW B;  5FAQ A;  3GR2 A;  5HZH A;  1G5U A;  3IH9 A;  1KDS A;  5CTM A;  2Q9M A;  3U2A A;  1KVM A;  3K3D A;  1OT6 A;  3BFC A;  5EEC A;  4Z9Q A;  2WYX A;  3E4O A;  3ISG A;  3SS5 A;  4GDN A;  1F5M A;  1YLW A;  3C4O A;  1GCE A;  2OAQ 1;  1K56 A;  1IEL A;  3TOI A;  4MBK A;  1RP5 A;  3RXX A;  4N9K A;  3C4P A;  3F1P A;  2XD5 A;  1IYQ A;  3BJN A;  4UEY A;  4B4Z A;  3IX4 A;  3MKF A;  3F1P B;  4LCM A;  1Q2P A;  4OOL A;  3SH7 A;  2X02 A;  1L2S A;  2R78 A;  4EEP A;  1GHM A;  3UN7 A;  1W8Q A;  3OCN A;  3CWF A;  4S2J A;  4EW7 A;  1RCJ A;  3RFB A;  3L7H A;  1XGI A;  4HH2 A;  4EQI A;  3E4Q A;  2K7S A;  3VFH A;  2H0T A;  2DCF A;  3S4X A;  4CLC C;  3DTE A;  3ZVT A;  2VEA A;  3UPN A;  4PHT A;  2IWD A;  3WS1 A;  3ZG5 A;  2HF6 A;  1STZ A;  5HDC A;  1LI0 A;  1YLP A;  3M6B A;  4DF6 A;  1T19 A;  3VOL A;  1ESU A;  1Z09 A;  3I7J A;  4BLM A;  1IFQ A;  4IUH A;  4K08 A;  1YLJ A;  1ES4 A;  1S0W A;  3HCY A;  3EQV A;  3BQA A;  4RVA A;  4Y3I A;  3LO7 A;  1WYC A;  2EWW A;  2HDU A;  3BFE A;  2V8C A;  4OLG A;  4OOY A;  1IYS A;  3VSK A;  3UDI A;  4P6Z S;  1BT5 A;  1QMF A;  4HBU A;  1T1A A;  1T1C A;  4X6T A;  1A0K A;  2W3H A;  1KGE A;  2P7J A;  2BG1 A;  3FWL A;  1MWU A;  2QHK A;  1K6R A;  1VB6 A;  3G32 A;  1LSX A;  3CUE C;  1LL8 A;  1JTD A;  4UHU A;  1XXM A;  1S1Z A;  1YLZ A;  3E0Y A;  4HI4 A;  2ACG A;  1N9L A;  1MPL A;  4LEN A;  3B3X A;  1F9I A;  3T1Q B;  4GS9 A;  1OJG A;  1CK3 A;  4R3B A;  3MBZ A;  4GS9 B;  3R7W A;  1TDG A;  3LEZ A;  1YSQ A;  1NRJ A;  2DNS A;  3R7W B;  5FI2 A;  1YPR A;  4BEN A;  4ID4 A;  3OPR A;  1ODV A;  2E8J A;  3ITA A;  4ETZ A;  5CGS A;  1L0E A;  3GSG A;  4JXV A;  4Q0I A;  1H3Q A;  1FIL A;  3MZF A;  1WA9 A;  2HV1 A;  2Y4A A;  4DJ3 A;  3OPP A;  3DTM A;  2Q0O A;  3NIA A;  3PHY A;  1YM1 A;  4KG6 A;  3GMW A;  4L9E A;  1XKZ A;  3IWI A;  5A90 A;  4KZB A;  3LIE A;  3MS6 A;  4S2P A;  4IJG A;  4KG2 A;  1H8M A;  4B88 A;  4NET A;  4GZB A;  3WS4 A;  3QP8 A;  2OV5 A;  4EBL A;  1IOU A;  5TJJ A;  2ZM2 A;  4ZRR A;  5AQ7 A;  4JGQ A;  4PM9 A;  2OWH A;  1KGF A;  4OPY A;  3A3J A;  3IXG A;  2PU2 A;  3O5Y A;  3B47 A;  5F68 A;  3IBR A;  4O7D A;  1W79 A;  3UMD A;  3DW0 A;  3DTI A;  2E8I A;  1FOF A;  1FSY A;  3N8R A;  4YNR A;  1ERM A;  2PR6 A;  1K25 A;  4I5S A;  4UA9 A;  3UB8 A;  1IKI A;  3D4F A;  2O0Y A;  2ZM8 A;  2J3W A;  2W0N A;  2ZL1 B;  4WN5 A;  3FG8 A;  1GSX A;  3W4O A;  3Q81 A;  2WAF A;  4UA7 A;  2HP9 A;  1TS6 A;  3CUE A;  4MMN A;  3CAX A;  4HIA A;  4YWZ A;  4BD0 A;  3UME A;  4WM9 A;  4GHI A;  1PI5 A;  3EEA A;  5F83 A;  4DXB A;  2L4R A;  3A3E A;  1K0K A;  1CI9 A;  4GHI B;  4Y15 A;  3R4K A;  1PRQ A;  3JVU A;  1DP9 A;  4EBP A;  4U3T A;  1ES5 A;  3C30 A;  3EEH A;  3IF6 C;  1SDE A;  1G6O A;  2LB5 A;  2IWB A;  5KIZ A;  1XGJ A;  4IHQ A;  4EU0 A;  3MSH A;  5KZH A;  4MBH A;  1PWD A;  4EWF A;  3T4L A;  1SHV A;  2IWC A;  3EWK A;  5CXW A;  4H6J A;  1HLU P;  1E4D A;  1T18 A;  5MC7 A;  4BJP A;  2ZLY A;  4G3W A;  4WL9 A;  1DP8 A;  4H6J B;  1X0O A;  4B9O A;  4OPZ A;  4S2N C;  2XLN A;  3LI8 A;  5FDH A;  3T1X A;  2O9B A;  2Y59 A;  3NC8 A;  2ZBB A;  1N4O A;  1ZG6 A;  2B18 A;  4BWI A;  2HZ5 A;  4N1X A;  4N1H A;  1XA7 A;  4LFU A;  2QJ5 A;  3N8L A;  3LCE A;  1W8Y A;  5HW3 A;  3G4P A;  4X1L A;  5BOH A;  4NKP A;  3NOP C;  4DDY A;  1S4R A;  4GLQ A;  1GSW A;  2R9W A;  1FIK A;  4X56 A;  3TE8 A;  3SS3 A;  4WZ5 A;  1I2W A;  5EV0 A;  4HP4 A;  2NUT C;  2ZC4 B;  2Z6C A;  3LIB A;  4B4X A;  1H8Z A;  3C8C A;  3OCL A;  1CJF A;  3NJA A;  2WKQ A;  1V9Z A;  4IVK A;  1J3W A;  3K2N A;  4Z1W A;  3V3R A;  3BY9 A;  1MKM A;  4S2O A;  4A5R A;  4E3O A;  2XH9 A;  3LI9 A;  2JHE A;  3PBT A;  2QWS A;  4IBR A;  1BSG A;  3IHB A;  4LGW A;  2D01 A;  2ZQA A;  1D7E A;  4GJ4 A;  4E3K A;  1AXB A;  5GHY A;  2GNX A;  1AWI A;  1XA1 A;  3CLO A;  4Y2F A;  3M2K A;  3IXH A;  5FL3 A;  3ZG0 A;  4EUZ A;  4MLL A;  1K55 C;  4ZJ3 A;  3C38 A;  4QD4 A;  5FAS A;  4L0L A;  3ULF A;  1L3L A;  3LIF A;  4S2N A;  3ZNY A;  3CG5 A;  2Y2M A;  3CMZ A;  4MCW A;  4JLF A;  2VV6 A;  5A92 A;  3O88 A;  3EOI A;  2J7V A;  1KOU A;  2EX2 A;  2ZC7 A;  1CEG A;  2HDR A;  3OLO A;  1YAX A;  4MN6 A;  3SH8 A;  5FI7 A;  2V20 A;  4DJ2 A;  3Q07 A;  5HD5 A;  3PBN A;  3PAE A;  4S2M A;  4HJ3 A;  5A91 A;  3RH8 B;  2HP5 A;  3FPV A;  4QWO A;  2G2U A;  4MN5 A;  2DRW A;  2GX5 A;  2PD8 A;  2PR5 A;  4E3M A;  1VEU A;  3GVB A;  4MN7 A;  3WS5 A;  3LGO A;  2V1Z A;  1VEU B;  1Y54 A;  1SCW A;  1E3U A;  3ZFZ A;  4PM7 A;  2JCH A;  3KYQ A;  1FR6 A;  2OLU A;  3T4T A;  4KUO A;  2JKG A;  2PRF A;  2RCX A;  4WEL A;  2V1A A;  2V0W A;  5AVE A;  3UDF A;  2L1M A;  4LRZ E;  5C5K A;  2PAV P;  5GHZ A;  2XF3 A;  4OON A;  3RJU A;  4RX2 A;  1O07 A;  1LHY A;  4NXB A;  2J3T D;  2Y8H A;  3VOZ A;  2VGK A;  4S2K A;  2ZC6 B;  4BQM A;  5AQB A;  2V2F F;  4HEF A;  2WUQ A;  3FV7 A;  2GJ3 A;  4X68 A;  3A0S A;  3LID A;  3AGF A;  1K55 A;  3MMH A;  3C7U A;  1NRF A;  4OLD A;  3A0R A;  2EFU A;  5KSH A;  2WGW A;  2H5S A;  1LSW A;  5L10 A;  4PMA A;  2B02 A;  1SKO A;  1DJB A;  2QMI A;  2K2N A;  5AQA A;  5TGF A;  1SKO B;  4RA7 A;  4LV3 A;  3LIC A;  3T4O A;  2JC7 A;  3PBQ A;  2K31 A;  3IXD A;  4E04 A;  3OPL A;  5AQ9 A;  1D1J A;  1EWZ A;  4HJ6 A;  4UQI M;  2C6W B;  1GA9 A;  2V1B A;  3VP0 A;  4HH3 A;  4GDB A;  1HZO A;  4UA6 A;  3P7N A;  1OTB A;  2Y2J A;  4KZ3 A;  3VOY A;  4JF5 A;  2DMW A;  3T4Q A;  2VV7 A;  2JE5 A;  3PBR A;  1K6S A;  4PAU A;  1V9Y A;  4JXS A;  3TW8 A;  1XJ3 A;  4P0M A;  1M6K A;  3SS4 A;  2VA0 A;  1L0D A;  3E4P A;  5HAQ A;  4GOG A;  3VP1 A;  2QYB A;  4ZJ2 A;  2XA7 M;  4B93 A;  1BYW A;  2BAS A;  1E3U D;  3IF5 A;  3NDG A;  4EBN A;  4O8G A;  5FQM A;  4OPQ A;  3BW6 A;  3SH9 A;  4KZ5 A;  2J80 A;  2V0U A;  4Y5F A;  5D3O A;  1TS8 A;  3DTK A;  1M40 A;  2W3G A;  5DFX A;  4GB7 A;  1ZHH B;  5DF8 A;  3SW1 A;  4PPR A;  2L0W A;  5AVF A;  4L9F A;  5L07 A;  3AGE A;  3LR5 A;  5GLC A;  3ZHH A;  2VGL M;  3W4P A;  4NXF A;  3T4S A;  4KZ6 A;  5G18 A;  4R0Q A;  3NDE A;  3D72 A;  3QP2 A;  1J9M A;  3CJM A;  5HDD A;  4LLO B;  2PBD P;  4DE0 A;  3WRZ A;  1JTG A;  3BLM A;  2GDN A;  5EFW A;  3OC2 A;  4U0T A;  5FEF A;  2WKH A;  5DFY A;  4KZ7 A;  4DE3 A;  2A24 A;  2IA2 A;  3MXR A;  4E3L A;  3ZDJ A;  4BMW A;  1JWZ A;  1TS0 A;  2O9C A;  2A24 B;  3KSH A;  3ZNT A;  3NOU C;  5EVI C;  3G31 A;  1YMX A;  4R4R A;  1G28 A;  3O87 A;  1KE0 A;  5HX9 A;  4XUX A;  1H0M A;  4P87 A;  1K57 C;  1NY0 A;  1K56 D;  3PXP A;  3T1S A;  3ITB A;  3BFD A;  1KE4 A;  1VM1 A;  4P6B A;  1IYO A;  2FZ0 A;  5DVA A;  5FQJ A;  3V50 A;  4E6X A;  1PWG A;  4K0W A;  5F82 A;  5E43 A;  3CPT A;  1FSW A;  1BLH A;  4YOF A;  4WUJ A;  4E3I A;  4ME4 A;  3EGX C;  3ZG7 B;  5FAO A;  3CPT B;  4PM6 A;  4CLC A;  1WE4 A;  5GLA A;  4LRX C;  1NLY A;  2ZQD A;  3HUN A;  2XRO A;  1YMS A;  2C5W B;  5AJG A;  5EOE A;  4ZAM A;  1MY8 A;  2JKR M;  3UE1 A;  4CLC B;  4P6Z M;  4G3K A;  2PU4 A;  4NXE A;  3IHA A;  4HES A;  5CHJ A;  3GDI A;  5TBM A;  5HWV A;  1PW8 A;  5GLB A;  3WS2 A;  1NYM A;  1YLY A;  5DF7 A;  2HDS A;  5JYO A;  4DE2 A;  5HPI A;  3M6H A;  5TBM B;  2VKS A;  3HUM A;  2WKE A;  1ONH A;  4EER A;  3S7N A;  2R9X A;  2HJE A;  1PW1 A;  1MBL A;  2ZL1 A;  1TF1 A;  4EET B;  4N92 A;  2ZQ8 A;  5FEG A;  1YSP A;  1S67 L;  4FSF A;  4R70 A;  3MF0 A;  5KMW A;  4HBT A;  4QU3 A;  1KE3 A;  4QHC A;  4AFI A;  1YQS A;  5FAP A;  3A3D A;  1DP6 A;  1SKF A;  5HFO A;  2BLS A;  5CEC A;  2KLI A;  2X01 A;  1GSV A;  3Q7Z A;  3OOV A;  3ZVW A;  1LLB A;  1ZKJ A;  3EQU A;  1JWV A;  1ZG4 A;  4JF4 A;  1D06 A;  2HJ9 C;  2WK0 A;  3SOI A;  5EVL A;  1U60 A;  1LL5 A;  3UO9 A;  2XR0 A;  4Y7P A;  4PM5 A;  1H5X A;  1QME A;  4OQG A;  3OBF A;  1OTD A;  2FFY A;  2Y2Q A;  1UWN X;  4KG5 A;  2YKH A;  4KUK A;  1MWR A;  1FCO A;  1F2K A;  4WLA A;  1FCM A;  3GRJ A;  3H7W B;  2EFX A;  3G2Z A;  5CEB A;  1P0Z A;  3CI6 A;  3G35 A;  3ZYT A;  5U47 A;  3GTC A;  1PNE A;  5CHM A;  1OPX A;  1H8Y A;  4CLC D;  1ESI A;  2PBY A;  2W3E A;  4OP5 A;  5GL9 A;  3HLF A;  4GN2 A;  5EUA A;  4X53 A;  3O3V A;  1LI9 A;  1MKI A;  1DRM A;  2Y2H A;  4OOM A;  1UWP X;  3MQQ A;  3A3F A;  2CC1 A;  5GLD A;  1MWS A;  1Q2Q A;  4CLC E;  3QNC A;  3IX8 A;  4CJN A;  3BFG A;  1N9N A;  1XFN A;  5DTT A;  4RYE A;  2H10 A;  2A3U A;  4X25 A;  2GZA A;  1P97 A;  1ACF A;  3D9Y A;  3BYD A;  4MBF A;  4E3N A;  4JKT A;  5I5L A;  2W1T A;  3BM6 A;  3VMA A;  5HAP A;  2Z2M B;  3C5A A;  3QP5 A;  3S22 A;  1T1B A;  2QJ7 A;  1W5D A;  4NK3 A;  3N8S A;  2W1T B;  3IF6 A;  2A49 A;  2Y2O A;  3CZD A;  4JXW A;  4RQ9 A;  1ERQ A;  3FKV A;  3S1Y A;  3IF6 B;  2ZQC A;  1EW0 A;  1N9B A;  1JVJ A;  4XUZ A;  3CHW P;  4PM8 A;  2FFF B;  3IBJ A;  1PWC A;  1PFL A;  3P98 A;  4R6L A;  4KQR A;  5E2E A;  4LRY C;  4LV1 A;  1XX2 A;  4MDZ A;  3H9W A;  4FCF A;  1JNU A;  5FA7 A;  5IT5 A;  5HAI A;  2FH5 A;  3IS2 B;  3HBR A;  3V39 A;  2I72 A;  2ZJ9 A;  1PYY A;  3UPP A;  5L8M A;  2JKR I;  1N9O A;  2WKP A;  3C2W A;  3FC7 A;  3A0V A;  2UWX A;  5CER A; 
#chains in the Genus database with same CATH homology
 4QWO A;  1D1J A;  3T1Q B;  5EV0 A;  5FEF A;  1VEU A;  3L9K A;  1K0K A;  3LGO A;  2ZL1 A;  4ESP A;  1PRQ A;  4FUW A;  1VEU B;  5EM0 A;  1CJF A;  5FEG A;  3NEC A;  1YPR A;  1J3W A;  3L7H A;  2E8J A;  3MSH A;  2JKG A;  2PRF A;  3UB5 P;  4X25 A;  3T12 B;  1Y4O A;  1ACF A;  1FIL A;  4X1M A;  3D9Y A;  2PAV P;  3DAV A;  4D60 A;  3T1S A;  5FDS A;  1AWI A;  3NUL A;  1HLU P;  3MS6 A;  1Z09 A;  5EM1 A;  3T1R A;  2V8F A;  5EVE A;  1G5U A;  3CPT A;  3T1X A;  2B95 A;  3U4L P;  2V8C A;  3CHW P;  3CPT B;  3LEQ A;  1CF0 A;  1PFL A;  3KYE A;  2HZ5 A;  1VET A;  2VK3 A;  1F2K A;  1CQA A;  1A0K A;  1SKO A;  1VET B;  4X1L A;  1SZV A;  1SKO B;  2ZL1 B;  4FTX A;  2BTF P;  2JKF A;  1PNE A;  2ACG A;  2PBD P;  1FIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...