1F2KA

Crystal structure of acanthamoeba castellanii profilin ii, cubic crystal form
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAIIGHDGNTWATSAGFAVSPANGAALANAFKDATAIRSNGFELAGTRYVTIRADDRSVYGKKGSAGVITVKTSKAILIGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Comparative Structural Analysis of Profilins
rcsb
source organism Acanthamoeba castellanii
molecule tags Structural protein
molecule keywords PROFILIN II
total genus 37
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1f2kA00
1CQAA 1FILA 1VETB 4QWOA 3MS6A 1VEUB 2JKFA 2VK3A 1HLUP 1AWIA 2JKGA 2ZL1B 1VETA 5FEFA 1PRQA 3CPTA 3MSHA 5EM1A 2ACGA 1K0KA 2V8CA 3L7HA 1ACFA 2ZL1A 4D60A 4FTXA 3CPTB 3DAVA 2PBDP 5EM0A 3UB5P 5EV0A 3T1QB 2V8FA 1SZVA 2E8JA 3L9KA 4X1LA 3NECA 1PFLA 1YPRA 1A0KA 4X1MA 1FIKA 5EVEA 3T12B 1Z09A 1CJFA 3LEQA 1J3WA 3NULA 4ESPA 2PAVP 2BTFP 3T1SA 1CF0A 1VEUA 3T1RA 1G5UA 1SKOA 2PRFA 3D9YA 3U4LP 3KYEA 4FUWA 2HZ5A 3CHWP 5FEGA 1F2KA 4X25A 1Y4OA 3T1XA 1SKOB 1D1JA 5FDSA 3LGOA 1PNEA 2B95A
chains in the Genus database with same CATH superfamily
5GLAA 4MDZA 3IX3A 1S6RA 4GLQA 1KE4A 4YNRA 2ZC4B 1D06A 3VP2A 3QNCA 4E3MA 3PHYA 1CI9A 1PWDA 2G2WA 5FQMA 1TDLA 5J4EA 2W3EA 3UB9A 1G68A 2X01A 1L0EA 5FI6A 1D7EA 2WGIA 4Y13A 4N1XA 2ZQDA 5FA7A 4X68A 4LENA 2QWSA 3E98A 3NOPC 3DWZA 4KZBA 1MC0A 3N8SA 2VV6A 1C3BA 2EWVA 4R3JA 5TBMA 1K55C 4OVDA 5EVIA 2ZQ9A 5M1AA 2KOIA 2GJ3A 2ZL1A 3G35A 3BQ8A 1MXOA 1KVMA 5DF7A 2WAFA 4JBFA 5AQAA 4WMCD 1GSXA 2R9XA 4RYEA 3IXHA 3K3DA 3NY4A 5A92A 4JXSA 4GS9A 2P9VB 1RP5A 3ZDJA 2CMNA 2V8CA 4ARZA 2PT7A 3CPTB 4KG6A 1ES3A 4BQMA 1ZHHB 5G4ZA 1Z09A 1DJCA 2WGWA 4Q0HA 2JKRM 3N8RA 2WKIA 5AJGA 3BLMA 5AQBA 1NLZA 2UV0E 3T4LA 4DE2A 1MWTA 2Y2JA 3HLCA 4GN2A 3PXPA 1PWCA 3A3FA 3B3XA 1K6SA 2Y4AA 3NBLA 1H0MA 2VKSA 2Y2NA 1F98A 3ULFA 4Y0OA 1DY6A 3MBZA 1IYOA 1BULA 1NZUA 5GHZA 1G5UA 4FUWA 3EQUA 1FQGA 2GX5A 1TD5A 1LHYA 2ZLYA 1PNEA 1MPLA 3Q07A 3IBJA 4LV0A 3P98A 2VA0A 3ZVTA 3M6HA 1TDGA 2GDNA 3A3EA 1N9OA 5TFQA 3G6OA 4S2PA 4U0TA 4B93A 1SCWA 3E4QA 1S4SA 3HLDA 4MN7A 3BM6A 4QY6A 5GLBA 4UA6A 3OPRA 3F1NA 4BD0A 1PW8A 4HJ3A 4FTXA 3EGXC 4X53A 1J3WA 3ZG0A 1IKGA 1RGYA 1GSVA 1N9BA 3CHWP 4X25A 4G3KA 4IBXA 3QP1A 3M2JA 5M19A 2X02A 3NCKA 3N4IA 4MBKA 3C2WA 4OH0A 3WWXA 1PWGA 5TJJA 4FSFA 3VP3A 5HDCA 3IF5A 1OTAA 3LR3A 4KG2A 4GDNA 3UN7A 3SH7A 1JWPA 2VZWA 1OTBA 3ZG5A 4I3AA 5DJUA 2V20A 4GKUA 3T1QB 3RXXA 1K56D 3T1SA 4S2NC 4O8GA 3GQZA 5DTKA 4Q0IA 2P74A 3H82B 3F1OB 3AGFA 4FD8A 3D4FA 4KQRA 2QHKA 3SOIA 1L3LA 1K57A 5KSCA 4DRTA 2YKFA 3ITBA 4WN5A 3E0YA 1O07A 3VV4A 1KE3A 1H8YA 2PYPA 1I5QA 4QPRA 1LSXA 4OPRA 4S2NA 3ZVWA 1QMEA 1W63M 2ZMAA 3OLOA 1TS0A 1YT4A 2B02A 4S2IA 1T1CA 3WS0A 1IELA 3ZG7B 3N7WA 4JLFA 2ZM8A 4PHTA 1TEMA 3T1XA 2XH9A 4PM6A 3SS3A 5FQ9A 3UNWA 1CQAA 1ONHA 4Y15A 4JKTA 4RQ9A 1JVJA 3CUEC 3V67A 5FSRA 5EE8A 3AGDA 4Y3IA 2Y2HA 2ZMFA 4UAAA 1ZG4A 1AXBA 1BTLA 2HV1A 2V2FF 3KX0X 3NDEA 4GD8A 4R3BA 3IF6C 5FQKA 1RGZA 4DJ3A 4K0WA 1WA9A 5DKLA 2KX6A 1Q2PA 1K6RA 4KZ7A 3C38A 4GJ4A 3KO6A 1BLPA 1GCEA 3Q82A 4B9OA 5HWTA 1H8MA 2YKHA 4BL2A 3UPNA 2W1TA 3MZDA 2WAEA 1S1YA 4IUKA 2A3UA 4I38A 1F5MA 2EXAA 1CEFA 2VV7A 1ES5A 1G6AA 4HBUA 4OOLA 1YPRA 4OPQA 4HP9A 4C6YA 4E3NA 1DJBA 2QKPA 1FOFA 1YQSA 3MMHA 1WYBA 4WZ5A 2JN7A 3LCEA 5DF8A 2RCXA 1VM1A 3PBQA 5G18A 3JYIA 3HLGA 1LL8A 2Y59A 3RH8B 3IX8A 3LYXA 5TBMB 2V0WA 2Y2OA 4HH3A 5L07A 1NYMA 3RJUA 4Z9QA 5L8MA 4WL9A 3G2YA 4EEPA 4KQQA 1XKZA 4XUXA 2HJ9C 2ZM2A 4I39A 1HVBA 2P7JA 4E3JA 1XFNA 2B5RA 3LGOA 2XSSA 5EM0A 3WRTA 2CC1A 2VGLS 2FFYA 3IWOA 1XPBA 3ZHHA 5E43A 1OTEA 1PZOA 1MY8A 5F6AA 1NRJA 4B4XA 4XXRA 2ZC6B 4L9FA 1K4EA 3FKVA 4HBTA 3EQVA 3T4KA 4ZAMA 2GZAA 1K38A 4X55A 2OWHA 3UB7A 2J3WA 3ZG9B 3A3JA 2XDMA 3A0SA 4LRYC 3VE4A 2KDKA 3SH8A 4X69A 3CPTA 2KLIA 3HLBA 1JTDA 3F1PA 4F94A 3GRJA 1GHIA 3V39A 1DP8A 3H9WA 3O88A 3NC8A 2W3FA 1ES4A 3T4QA 4IVKA 2H0TA 3OC2A 5L10A 2JE5A 1FCMA 1ALQA 3ZCZA 1W7FA 4IEDA 2ACGA 3BWLA 3DTMA 4JXGA 2IWBA 2R78A 1W8QA 1PIOA 2VGKA 4N9LA 3Q81A 3A0VA 2PD8A 3VOYA 1KDSA 5F83A 3GSGA 4Z1WA 1XJ2A 4EV4A 3B33A 1SDNA 4MBHA 3N6IA 5F1FA 1E4DA 3OBFA 1GSWA 2XRNA 4K91A 2V9AA 3BQAA 2V1BA 5IT5A 4EQ1A 5FI2A 2V0UA 3UE1A 2G2UA 1Z6FA 4WLAA 1M40A 5CXWA 4OPYA 4S2LA 2DNSA 5EECA 3S7PA 3NIAA 3UDIA 4N1HA 2XR0A 1TS6A 4YFMA 5A91A 2PBYA 1TS7A 5AVFA 1YM1A 4F3LA 3UB8A 3WS4A 1KE0A 4OQHA 2HDSA 4HJ6A 3OPLA 2WUQA 5HL6A 3DTKA 4GOGA 3UB6A 1XJ6A 4I3JA 2WZXA 5FAQA 4FCFA 5E2FA 2HZ5A 5CTMA 3W4QA 4DMZA 5FDSA 3LY4A 1BUEA 2XEPA 5DFXA 2I72A 3S22A 5CEBA 3C4PA 2HDUA 3V3RA 4LFUA 4PM5A 2WADA 3IXBA 3MQOA 1BSGA 3IH9A 4DXCA 3MJQA 5L2FA 2ZMVA 1W63Q 1N4OA 3EOIA 2ZC5B 5DTSA 2Y2GA 3SW1A 3ZG8B 5EUAA 1XJ4A 1K57C 3AGEA 3UMEA 3NECA 3UDXA 4JGRA 2PDRA 3NOUC 3CWFA 3CUEA 1XA1A 5GLDA 4HI4A 1YMXA 3UE6A 4S2KA 3DTIA 1FSWA 1P9WA 4UA9A 3LO7A 1VEUB 5IS1A 4EETB 4H8RA 4LGWA 2XD5A 3QP4A 5DTTA 4P6ZS 1RCJA 1BLHA 4O7DA 2J3TC 3QHYA 3FKWA 2Z2LB 1UGUA 4OKPA 2O0YA 3Q1FA 4RA7A 2JKRI 2DCFA 3L7HA 2J7VA 2Z2MB 3VSKA 2JKTI 1EROA 4KZ5A 3S1YA 3G4PA 3WRZA 4PAUA 3MZFA 2HF6A 2DMWA 1XA7A 5HARA 1ONGA 4KENB 1FILA 3A3IA 2A24A 4OP8A 2HPBA 4E3OA 3LEZA 1VETA 2EFUA 2QZ6A 4P87A 5HPFA 4CLCE 4GNUA 4WF0A 4UA7A 2VJWA 1XP4A 4JPMA 4R3AA 4IHQA 2QMIA 4LRXC 3G30A 4M4XA 1UWPX 2OOLA 3LIAA 2JBFA 1NRFA 5EOEA 3QP8A 3EGDC 2J3TD 4O01A 4M3KA 1XJ3A 3P01A 3BY9A 1S66L 3GTCA 5FAPA 1FR6A 1W5DA 5DF9A 5CRFA 1YLTA 3S7NA 3VSLA 3T12B 4E6XA 3NOTC 4WUJA 3VP1A 5A90A 4Q0JA 4NEED 4EWFA 4P6ZM 2Y2PA 4BBVA 1E25A 1OMEA 4WYYA 3ZNYA 2O9BA 4H6JB 1JNUA 2ZL1B 2Y2IA 1S1ZA 3VOLA 2VX8A 3MXQA 3QP2A 1MZUA 3U2AA 3LIDA 5JYOA 5DFYA 1ZG6A 1A0KA 3VOZA 4L9EA 3H7WA 5CHUA 4PMAA 5F82A 2VGLM 4U3TA 5HWWA 3G2ZA 1Q2QA 1U60A 3G32A 3IBRA 4HESA 3FC7A 4E6WA 2XFSA 5EFWA 1OJ5A 4UQIM 5F1GA 3W4PA 5CEDA 4LCLA 5CHMA 5HD5A 3IT9A 3VE3A 1OTDA 3I7JA 4HP4A 5HFOA 4GW9A 1T1AA 5FEFA 3K3CA 3T50A 3ZFZA 2HP9A 5AQ9A 4E04A 4E3IA 5HL1A 1IKIA 4PM8A 2QJ7A 3UDFA 1KGEA 2XQZA 3B47A 1LSWA 3ZGAB 1ZC2A 1K55A 1Y54A 5FATA 1CF0A 1SKOB 4Y0UA 4HQAA 3S7QA 3IXDA 5I94A 2PR6A 4OLGA 2X71A 2Y55A 4UEYA 3NHQA 2HP6A 1NY0A 1OPXA 4Q8IA 5GHYA 3PBOA 4P6BA 1WE4A 4N92A 3PBSA 4R1GA 4HHDA 3HL9A 1GA9A 3NDGA 5HPIA 2WKEA 5G4YA 5HW3A 1W8YA 4NXBA 3CITA 4YOFA 3ITAA 2H0YA 3CMZA 2EWWA 4X1MA 4I5SA 4LV1A 4JGQA 2NUTC 4R6LA 2P08A 5FASA 4O0PA 3CJMA 4FH2A 3G34A 4S2MA 5EVIB 1L0DA 2C6WB 2OLVA 3LICA 3JVUA 2QJ5A 2BG1A 1BZAA 1BYWA 1S67L 2PHYA 1K54A 3MFXA 1TF1A 4YWZA 3P09A 1JWZA 1IOUA 4B88A 3D9YA 2Q9MA 1I2WA 2OLUA 2UWXA 1XX2A 5KSHA 3M6BA 4NXEA 2PYRA 1MWUA 1DP6A 1VQQA 4BWIA 4CLCC 2EX6A 4IBRA 1PW1A 3LR4A 3BFCA 4GDBA 3C5AA 3R7WA 3OPPA 4QWOA 3F1PB 1TVFA 4MLLA 2A24B 5AVEA 4HNBA 3KYQA 1JWVA 1YKDA 2E8IA 1FIKA 4CJNA 4EW7A 3IHBA 4PPRA 4DJ2A 1VEUA 3KSGA 2EX2A 3TRCA 4S2JA 3C30A 2D01A 2JKFA 4CPKA 2BASA 3HVFA 3RTYA 1O7EA 5E2EA 3CZDA 2G7UA 1EI5A 4Y5FA 1NWZA 3HUNA 4EBPA 4LV2A 4D2OA 1NJ4A 1FR1A 3T1RA 3V50A 3EEHA 1IEMA 1MKMA 1ZTUA 4KQOA 4ZDXA 3V5MA 3LY3A 3KSFA 2BLSA 4ZJ1A 1HZOA 2P9VA 1T19A 1W79A 4JXVA 1MBLA 3IX4A 3GMWA 3HJIA 2O9CA 5GL9A 1XGIA 3BW6A 1ES2A 4ETXA 2L4RA 2ZBBA 1KGGA 2Q9NA 1N9NA 1LLBA 5HAPA 2A49A 4OQ0A 4WM9A 3FWLA 4EERA 4KZ4A 1VHMA 2E8JA 2JKTM 4GS9B 3O5YA 4WEJA 3ISGA 1SKOA 5FQJA 1ESUA 3O86A 4QB8A 4G3WA 3TE8A 3PYPA 4R4SA 4OLDA 5C5KA 4EUVA 2IWCA 3BFEA 4K08A 5HAQA 5U47A 1N9LA 3LR5A 4ZTKA 1NZOA 5E2HA 2ZOHA 1IYSA 3DBAA 4OQIA 5TGFA 4NK3A 4LV3A 4KUOA 3NJAA 4AFIA 4GHIA 4EBLA 4CLCA 3O87A 3TOIA 2W0NA 2WKHA 5DJTA 3ICYA 3HLEA 2ZM0A 5GLCA 3TG9A 4DKIA 4GZBA 5M18A 4IUHA 3NULA 4OOMA 4QU3A 1Y28A 2XF3A 1F2KA 1J9MA 4DE0A 3UE0A 3P7NA 2QPNA 1KOUA 1EWZA 2M1CA 1GHMA 3UE3A 4KZ3A 3UPOA 3UMDA 5EV0A 4KQDA 1PI4A 3VFHA 4Y2FA 5L09A 3SS4A 5CX7A 2BTFP 4WELA 3D72A 3T4SA 2PRFA 5EPHA 5K5BA 4Y17A 4PM7A 1BLSA 5HDDA 5EVIC 4MMNA 2K31A 4EXOA 4JGPA 3VP4A 3MXRA 5J8XA 2WYXA 1L0FA 2OWJA 3E2LA 3BY8A 1XXMA 3T4JA 4PKYG 1S0WA 3W2ZA 5CGSA 4JXWA 5EOOA 1BT5A 3OCNA 1YSPA 3WS1A 3E4OA 1YMSA 3KSHA 3PBRA 3LUQA 1IFQA 1KGFA 3GR2A 2VGJA 3LI8A 4L9GA 2M7VA 4OOYA 2VEAA 1M6KA 3N8LA 3MF0A 3DWKA 4KZAA 2FH5A 3IWIA 2PD7A 4EQIA 4OPZA 3S4XA 2JKGA 3CLOA 2C5WB 1DP9A 3HREA 3L9KA 4QY5A 5EVEA 5FI7A 4XT2B 4GD6A 1CK3A 1ODVA 4WZ5C 3ZNTA 4B4ZA 2EA9A 5MC7A 2B95A 1YLPA 1XFQA 2HJEA 4P85A 4QJGA 5IU1A 1ZKJA 1BLCA 1K0KA 1YAXA 2WK0A 2Y79A 1PYYA 4GHIB 4DF6A 4JGOA 5I5LA 3T4TA 4Y0TA 4GCZA 4GB7A 4I3IA 3BFDA 1VETB 3R4KA 1FCNA 3HCYA 1QMFA 4DDSA 4K0XA 3BFGA 4MEZA 3SZTA 2EFXA 4BENA 2K2NA 4KZ8A 3MKEA 1K25A 4X6TA 3BJNA 4EUZA 5DKKA 2W1RA 3W8KA 1KDWA 3QP6A 2WZZA 3KYZA 2GNXA 3DW0A 1UWNX 1G6OA 2PR5A 1YLJA 3IQAA 2B18A 4YINA 3MKFA 3GECA 1GHPA 1ERMA 2INWA 5J3WA 1PI5A 3FZCA 1SKFA 3OCLA 1LSVA 2XA7M 1CEGA 2HP5A 4NKPA 3QP5A 3LIEA 4DDYA 3PBTA 5GHXA 2EX9A 2PBDP 4IVIA 2ZJ9A 4E3KA 4P0MA 2V1ZA 3MZEA 2H10A 1MWRA 3IXGA 3HBRA 3Q7VA 3U4LP 3M2KA 4UHUA 4BBTA 3C4OA 4WBGA 3EWKA 4KUKA 1SDEA 4JF5A 1MKIA 4ID4A 1L0GA 4FOFA 2VLGA 3OZHA 2WKQA 3GDIA 1LL5A 5FEGA 4RX2A 4LLOB 1T1BA 4S2OA 4ZRRA 4X56A 2PU2A 1V9YA 3IF6B 1TS8A 4HOIA 2J80A 2J9OA 2EX8A 2EXBA 1LI0A 3UPPA 1FCOA 1JTGA 5CGWA 2NUPC 4X1LA 1PFLA 1K56A 3JPUA 4E3LA 1F9IA 5F69A 1CJFA 4WEKA 2PAVP 5A8BA 1LI9A 2DRWA 4R38A 2VV8A 2XGNA 2Y2LA 3JVVA 2ZQCA 3MS6A 1V9ZA 4Y7PA 2XFTA 5EVID 3QNBA 3HUOA 2Y2KA 4EU0A 5CGXA 1CI8A 5HX9A 1LL9A 2IWDA 2OV5A 2OAP1 5J7EA 1WYCA 1ERQA 1YLWA 3IWQA 3ZYTA 5AQ7A 2OAQ1 4MN6A 4OONA 3K2NA 5F68A 1T18A 5EM1A 2D02A 4R70A 4OP5A 3H7WB 2Z6DA 5F5YA 1L2SA 1SZVA 3RXWA 2XD1A 2QYBA 5KZHA 3FPWA 4F3LB 3MXSA 2HDQA 4BJPA 4UQIS 5E2GA 4QHCA 4BD1A 2HDRA 1ESIA 5IHVA 2LB5A 3CAXA 4MBFA 3TJZC 1X0OA 4NG2A 3T4OA 3PBNA 3RFBA 4R23A 3KYEA 4JF6A 4PM9A 4H6JA 5CHJA 4G3VA 2W27A 3Q7VB 1AWIA 4DN0A 1PRQA 3LFVA 1H3QA 3IHAA 2O99A 5FDHA 3OOVA 3LIFA 5A93A 5HWVA 5JYPA 3MFDA 5D3OA 2Y8HA 2W1TB 2K7SA 4LRZE 2PU4A 3BEBA 2Z6CA 1EW0A 5TR7A 1HTZA 3CG5A 2WKRA 3C7VA 4MCWA 1P9RA 3TW8A 4DE3A 3BLSA 3DTEA 1DJAA 5CECA 4II7A 2I9VA 4A5RA 2JCHA 3PAGA 3FYZA 2ZD8A 5CERA 3F1OA 5HAIA 5EVLA 5HDSA 3LR0A 1STZA 2WKPA 4HH2A 3SS5A 1DRMA 3D3OA 2V1AA 4BL3A 5FQIA 2L1MA 3O3VA 2ZC3B 4FH4A 4NXGA 3DAVA 1P97A 4EEUA 4WMCA 4CLCB 4ESPA 1SHVA 3BFFA 4RX3A 2OSUA 3GVBA 2JHEA 3B42A 3W4OA 1E3UA 1H8ZA 4DXBA 2J8YA 1OJGA 3UY6A 3UO9A 3IH8A 2P04A 4KG5A 5KIZA 2H28A 4XUZA 2XROA 3HLFA 2AVXA 2HGVA 3HJKA 5FAOA 2FFFB 4C75A 1K54C 3SH9A 5FL3A 1OT6A 4QD4A 3A0RA 3OPHA 1S4RA 3IS2A 4R4RA 2A2LA 3MQQA 2MJ6A 2XLNA 3MQ0A 3H82A 1FSYA 5CTNA 4LPZA 3R7WB 2ZQAA 3E4PA 4D60A 4PKYA 2H5SA 3UB5P 4HEFA 1NXYA 3BECA 4DE1A 3PAEA 4CLCD 3WS5A 3F1NB 2Q0OA 2Y2QA 1G28A 3FG8A 1YLYA 1I2SA 4N9KA 3BYDA 4JF4A 2VK3A 4WZ4A 3HLWA 4EBNA 3MSHA 2XA7S 3MR0A 4IJGA 3LI9A 4KZ9A 4ZJ3A 1IYPA 2W3GA 1K4FA 3NI9A 1H5XA 4RVAA 2W3HA 4CQHA 2ZQ7A 3IS2B 4R0QA 4BLMA 1GA0A 1KVLA 3VFFA 3VP0A 1D1JA 2RL3A 3CI6A 5HSQA 1HLUP 3WS2A 1ACFA 4OQGA 3VMAA 1IYQA 4ME4A 1PZPA 2M7UA 1OT9A 3C8CA 1YLZA 3LEQA 5FQQA 2ZC7A 4XT2A 5HD3A 3V3SA 2Y91A 2J9PA 4ETZA 2ZOIA 2ZQ8A 5KMWA 1P0ZA 4LCMA 3FV7A 2O9AA 4L0LA 2R9WA 1LT0A 4ARZB 3FPVA 1MWSA 1HD8A 2FZ0A 4C3QA 2L0WA 3C7UA 4U0XA 3TSGA 2W3DA 3Q7ZA 3HUMA 3A3DA 3ZQ5A 3LIBA 4ZJ2A 5LBRA 2IA2A 2WGWB 3E2KA 3PR6A 4NETA 3S7OA 1XGJA 5BOHA 3IF6A 4NXFA 5DVAA 3EEAA 5HZHA 4KZ6A 1E3UD 4MNRA 1YSQA 2Y2MA 1VB6A 2JC7A 1OTIA 4EESA 4ZBEA 2V8FA 3KSIA 3G31A 4BBUA 4BMWA 4HY8A 2LB9A 2XK1A 4MN5A 3GV9A 1NLYA 3BRMA 4HJ4A 4HIAA 2WGVA 1NYYA 1Y4OA 3PTEA
chains in the Genus database with same CATH topology
1CQAA 1FILA 1VETB 4QWOA 3MS6A 1VEUB 2JKFA 2VK3A 1HLUP 1AWIA 2JKGA 2ZL1B 1VETA 5FEFA 1PRQA 3CPTA 3MSHA 5EM1A 2ACGA 1K0KA 2V8CA 3L7HA 1ACFA 2ZL1A 4D60A 4FTXA 3CPTB 3DAVA 2PBDP 5EM0A 3UB5P 5EV0A 3T1QB 2V8FA 1SZVA 2E8JA 3L9KA 4X1LA 3NECA 1PFLA 1YPRA 1A0KA 4X1MA 1FIKA 5EVEA 3T12B 1Z09A 1CJFA 3LEQA 1J3WA 3NULA 4ESPA 2PAVP 2BTFP 3T1SA 1CF0A 1VEUA 3T1RA 1G5UA 1SKOA 2PRFA 3D9YA 3U4LP 3KYEA 4FUWA 2HZ5A 3CHWP 5FEGA 1F2KA 4X25A 1Y4OA 3T1XA 1SKOB 1D1JA 5FDSA 3LGOA 1PNEA 2B95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQA A;  1FIL A;  1VET B;  4QWO A;  3MS6 A;  1VEU B;  2JKF A;  2VK3 A;  1HLU P;  1AWI A;  2JKG A;  2ZL1 B;  1VET A;  5FEF A;  1PRQ A;  3CPT A;  3MSH A;  5EM1 A;  2ACG A;  1K0K A;  2V8C A;  3L7H A;  1ACF A;  2ZL1 A;  4D60 A;  4FTX A;  3CPT B;  3DAV A;  2PBD P;  5EM0 A;  3UB5 P;  5EV0 A;  3T1Q B;  2V8F A;  1SZV A;  2E8J A;  3L9K A;  4X1L A;  3NEC A;  1PFL A;  1YPR A;  1A0K A;  4X1M A;  1FIK A;  5EVE A;  3T12 B;  1Z09 A;  1CJF A;  3LEQ A;  1J3W A;  3NUL A;  4ESP A;  2PAV P;  2BTF P;  3T1S A;  1CF0 A;  1VEU A;  3T1R A;  1G5U A;  1SKO A;  2PRF A;  3D9Y A;  3U4L P;  3KYE A;  4FUW A;  2HZ5 A;  3CHW P;  5FEG A;  1F2K A;  4X25 A;  1Y4O A;  3T1X A;  1SKO B;  1D1J A;  5FDS A;  3LGO A;  1PNE A;  2B95 A; 
#chains in the Genus database with same CATH topology
 5GLA A;  4MDZ A;  3IX3 A;  1S6R A;  4GLQ A;  1KE4 A;  4YNR A;  2ZC4 B;  1D06 A;  3VP2 A;  3QNC A;  4E3M A;  3PHY A;  1CI9 A;  1PWD A;  2G2W A;  5FQM A;  1TDL A;  5J4E A;  2W3E A;  3UB9 A;  1G68 A;  2X01 A;  1L0E A;  5FI6 A;  1D7E A;  2WGI A;  4Y13 A;  4N1X A;  2ZQD A;  5FA7 A;  4X68 A;  4LEN A;  2QWS A;  3E98 A;  3NOP C;  3DWZ A;  4KZB A;  1MC0 A;  3N8S A;  2VV6 A;  1C3B A;  2EWV A;  4R3J A;  5TBM A;  1K55 C;  4OVD A;  5EVI A;  2ZQ9 A;  5M1A A;  2KOI A;  2GJ3 A;  2ZL1 A;  3G35 A;  3BQ8 A;  1MXO A;  1KVM A;  5DF7 A;  2WAF A;  4JBF A;  5AQA A;  4WMC D;  1GSX A;  2R9X A;  4RYE A;  3IXH A;  3K3D A;  3NY4 A;  5A92 A;  4JXS A;  4GS9 A;  2P9V B;  1RP5 A;  3ZDJ A;  2CMN A;  2V8C A;  4ARZ A;  2PT7 A;  3CPT B;  4KG6 A;  1ES3 A;  4BQM A;  1ZHH B;  5G4Z A;  1Z09 A;  1DJC A;  2WGW A;  4Q0H A;  2JKR M;  3N8R A;  2WKI A;  5AJG A;  3BLM A;  5AQB A;  1NLZ A;  2UV0 E;  3T4L A;  4DE2 A;  1MWT A;  2Y2J A;  3HLC A;  4GN2 A;  3PXP A;  1PWC A;  3A3F A;  3B3X A;  1K6S A;  2Y4A A;  3NBL A;  1H0M A;  2VKS A;  2Y2N A;  1F98 A;  3ULF A;  4Y0O A;  1DY6 A;  3MBZ A;  1IYO A;  1BUL A;  1NZU A;  5GHZ A;  1G5U A;  4FUW A;  3EQU A;  1FQG A;  2GX5 A;  1TD5 A;  1LHY A;  2ZLY A;  1PNE A;  1MPL A;  3Q07 A;  3IBJ A;  4LV0 A;  3P98 A;  2VA0 A;  3ZVT A;  3M6H A;  1TDG A;  2GDN A;  3A3E A;  1N9O A;  5TFQ A;  3G6O A;  4S2P A;  4U0T A;  4B93 A;  1SCW A;  3E4Q A;  1S4S A;  3HLD A;  4MN7 A;  3BM6 A;  4QY6 A;  5GLB A;  4UA6 A;  3OPR A;  3F1N A;  4BD0 A;  1PW8 A;  4HJ3 A;  4FTX A;  3EGX C;  4X53 A;  1J3W A;  3ZG0 A;  1IKG A;  1RGY A;  1GSV A;  1N9B A;  3CHW P;  4X25 A;  4G3K A;  4IBX A;  3QP1 A;  3M2J A;  5M19 A;  2X02 A;  3NCK A;  3N4I A;  4MBK A;  3C2W A;  4OH0 A;  3WWX A;  1PWG A;  5TJJ A;  4FSF A;  3VP3 A;  5HDC A;  3IF5 A;  1OTA A;  3LR3 A;  4KG2 A;  4GDN A;  3UN7 A;  3SH7 A;  1JWP A;  2VZW A;  1OTB A;  3ZG5 A;  4I3A A;  5DJU A;  2V20 A;  4GKU A;  3T1Q B;  3RXX A;  1K56 D;  3T1S A;  4S2N C;  4O8G A;  3GQZ A;  5DTK A;  4Q0I A;  2P74 A;  3H82 B;  3F1O B;  3AGF A;  4FD8 A;  3D4F A;  4KQR A;  2QHK A;  3SOI A;  1L3L A;  1K57 A;  5KSC A;  4DRT A;  2YKF A;  3ITB A;  4WN5 A;  3E0Y A;  1O07 A;  3VV4 A;  1KE3 A;  1H8Y A;  2PYP A;  1I5Q A;  4QPR A;  1LSX A;  4OPR A;  4S2N A;  3ZVW A;  1QME A;  1W63 M;  2ZMA A;  3OLO A;  1TS0 A;  1YT4 A;  2B02 A;  4S2I A;  1T1C A;  3WS0 A;  1IEL A;  3ZG7 B;  3N7W A;  4JLF A;  2ZM8 A;  4PHT A;  1TEM A;  3T1X A;  2XH9 A;  4PM6 A;  3SS3 A;  5FQ9 A;  3UNW A;  1CQA A;  1ONH A;  4Y15 A;  4JKT A;  4RQ9 A;  1JVJ A;  3CUE C;  3V67 A;  5FSR A;  5EE8 A;  3AGD A;  4Y3I A;  2Y2H A;  2ZMF A;  4UAA A;  1ZG4 A;  1AXB A;  1BTL A;  2HV1 A;  2V2F F;  3KX0 X;  3NDE A;  4GD8 A;  4R3B A;  3IF6 C;  5FQK A;  1RGZ A;  4DJ3 A;  4K0W A;  1WA9 A;  5DKL A;  2KX6 A;  1Q2P A;  1K6R A;  4KZ7 A;  3C38 A;  4GJ4 A;  3KO6 A;  1BLP A;  1GCE A;  3Q82 A;  4B9O A;  5HWT A;  1H8M A;  2YKH A;  4BL2 A;  3UPN A;  2W1T A;  3MZD A;  2WAE A;  1S1Y A;  4IUK A;  2A3U A;  4I38 A;  1F5M A;  2EXA A;  1CEF A;  2VV7 A;  1ES5 A;  1G6A A;  4HBU A;  4OOL A;  1YPR A;  4OPQ A;  4HP9 A;  4C6Y A;  4E3N A;  1DJB A;  2QKP A;  1FOF A;  1YQS A;  3MMH A;  1WYB A;  4WZ5 A;  2JN7 A;  3LCE A;  5DF8 A;  2RCX A;  1VM1 A;  3PBQ A;  5G18 A;  3JYI A;  3HLG A;  1LL8 A;  2Y59 A;  3RH8 B;  3IX8 A;  3LYX A;  5TBM B;  2V0W A;  2Y2O A;  4HH3 A;  5L07 A;  1NYM A;  3RJU A;  4Z9Q A;  5L8M A;  4WL9 A;  3G2Y A;  4EEP A;  4KQQ A;  1XKZ A;  4XUX A;  2HJ9 C;  2ZM2 A;  4I39 A;  1HVB A;  2P7J A;  4E3J A;  1XFN A;  2B5R A;  3LGO A;  2XSS A;  5EM0 A;  3WRT A;  2CC1 A;  2VGL S;  2FFY A;  3IWO A;  1XPB A;  3ZHH A;  5E43 A;  1OTE A;  1PZO A;  1MY8 A;  5F6A A;  1NRJ A;  4B4X A;  4XXR A;  2ZC6 B;  4L9F A;  1K4E A;  3FKV A;  4HBT A;  3EQV A;  3T4K A;  4ZAM A;  2GZA A;  1K38 A;  4X55 A;  2OWH A;  3UB7 A;  2J3W A;  3ZG9 B;  3A3J A;  2XDM A;  3A0S A;  4LRY C;  3VE4 A;  2KDK A;  3SH8 A;  4X69 A;  3CPT A;  2KLI A;  3HLB A;  1JTD A;  3F1P A;  4F94 A;  3GRJ A;  1GHI A;  3V39 A;  1DP8 A;  3H9W A;  3O88 A;  3NC8 A;  2W3F A;  1ES4 A;  3T4Q A;  4IVK A;  2H0T A;  3OC2 A;  5L10 A;  2JE5 A;  1FCM A;  1ALQ A;  3ZCZ A;  1W7F A;  4IED A;  2ACG A;  3BWL A;  3DTM A;  4JXG A;  2IWB A;  2R78 A;  1W8Q A;  1PIO A;  2VGK A;  4N9L A;  3Q81 A;  3A0V A;  2PD8 A;  3VOY A;  1KDS A;  5F83 A;  3GSG A;  4Z1W A;  1XJ2 A;  4EV4 A;  3B33 A;  1SDN A;  4MBH A;  3N6I A;  5F1F A;  1E4D A;  3OBF A;  1GSW A;  2XRN A;  4K91 A;  2V9A A;  3BQA A;  2V1B A;  5IT5 A;  4EQ1 A;  5FI2 A;  2V0U A;  3UE1 A;  2G2U A;  1Z6F A;  4WLA A;  1M40 A;  5CXW A;  4OPY A;  4S2L A;  2DNS A;  5EEC A;  3S7P A;  3NIA A;  3UDI A;  4N1H A;  2XR0 A;  1TS6 A;  4YFM A;  5A91 A;  2PBY A;  1TS7 A;  5AVF A;  1YM1 A;  4F3L A;  3UB8 A;  3WS4 A;  1KE0 A;  4OQH A;  2HDS A;  4HJ6 A;  3OPL A;  2WUQ A;  5HL6 A;  3DTK A;  4GOG A;  3UB6 A;  1XJ6 A;  4I3J A;  2WZX A;  5FAQ A;  4FCF A;  5E2F A;  2HZ5 A;  5CTM A;  3W4Q A;  4DMZ A;  5FDS A;  3LY4 A;  1BUE A;  2XEP A;  5DFX A;  2I72 A;  3S22 A;  5CEB A;  3C4P A;  2HDU A;  3V3R A;  4LFU A;  4PM5 A;  2WAD A;  3IXB A;  3MQO A;  1BSG A;  3IH9 A;  4DXC A;  3MJQ A;  5L2F A;  2ZMV A;  1W63 Q;  1N4O A;  3EOI A;  2ZC5 B;  5DTS A;  2Y2G A;  3SW1 A;  3ZG8 B;  5EUA A;  1XJ4 A;  1K57 C;  3AGE A;  3UME A;  3NEC A;  3UDX A;  4JGR A;  2PDR A;  3NOU C;  3CWF A;  3CUE A;  1XA1 A;  5GLD A;  4HI4 A;  1YMX A;  3UE6 A;  4S2K A;  3DTI A;  1FSW A;  1P9W A;  4UA9 A;  3LO7 A;  1VEU B;  5IS1 A;  4EET B;  4H8R A;  4LGW A;  2XD5 A;  3QP4 A;  5DTT A;  4P6Z S;  1RCJ A;  1BLH A;  4O7D A;  2J3T C;  3QHY A;  3FKW A;  2Z2L B;  1UGU A;  4OKP A;  2O0Y A;  3Q1F A;  4RA7 A;  2JKR I;  2DCF A;  3L7H A;  2J7V A;  2Z2M B;  3VSK A;  2JKT I;  1ERO A;  4KZ5 A;  3S1Y A;  3G4P A;  3WRZ A;  4PAU A;  3MZF A;  2HF6 A;  2DMW A;  1XA7 A;  5HAR A;  1ONG A;  4KEN B;  1FIL A;  3A3I A;  2A24 A;  4OP8 A;  2HPB A;  4E3O A;  3LEZ A;  1VET A;  2EFU A;  2QZ6 A;  4P87 A;  5HPF A;  4CLC E;  4GNU A;  4WF0 A;  4UA7 A;  2VJW A;  1XP4 A;  4JPM A;  4R3A A;  4IHQ A;  2QMI A;  4LRX C;  3G30 A;  4M4X A;  1UWP X;  2OOL A;  3LIA A;  2JBF A;  1NRF A;  5EOE A;  3QP8 A;  3EGD C;  2J3T D;  4O01 A;  4M3K A;  1XJ3 A;  3P01 A;  3BY9 A;  1S66 L;  3GTC A;  5FAP A;  1FR6 A;  1W5D A;  5DF9 A;  5CRF A;  1YLT A;  3S7N A;  3VSL A;  3T12 B;  4E6X A;  3NOT C;  4WUJ A;  3VP1 A;  5A90 A;  4Q0J A;  4NEE D;  4EWF A;  4P6Z M;  2Y2P A;  4BBV A;  1E25 A;  1OME A;  4WYY A;  3ZNY A;  2O9B A;  4H6J B;  1JNU A;  2ZL1 B;  2Y2I A;  1S1Z A;  3VOL A;  2VX8 A;  3MXQ A;  3QP2 A;  1MZU A;  3U2A A;  3LID A;  5JYO A;  5DFY A;  1ZG6 A;  1A0K A;  3VOZ A;  4L9E A;  3H7W A;  5CHU A;  4PMA A;  5F82 A;  2VGL M;  4U3T A;  5HWW A;  3G2Z A;  1Q2Q A;  1U60 A;  3G32 A;  3IBR A;  4HES A;  3FC7 A;  4E6W A;  2XFS A;  5EFW A;  1OJ5 A;  4UQI M;  5F1G A;  3W4P A;  5CED A;  4LCL A;  5CHM A;  5HD5 A;  3IT9 A;  3VE3 A;  1OTD A;  3I7J A;  4HP4 A;  5HFO A;  4GW9 A;  1T1A A;  5FEF A;  3K3C A;  3T50 A;  3ZFZ A;  2HP9 A;  5AQ9 A;  4E04 A;  4E3I A;  5HL1 A;  1IKI A;  4PM8 A;  2QJ7 A;  3UDF A;  1KGE A;  2XQZ A;  3B47 A;  1LSW A;  3ZGA B;  1ZC2 A;  1K55 A;  1Y54 A;  5FAT A;  1CF0 A;  1SKO B;  4Y0U A;  4HQA A;  3S7Q A;  3IXD A;  5I94 A;  2PR6 A;  4OLG A;  2X71 A;  2Y55 A;  4UEY A;  3NHQ A;  2HP6 A;  1NY0 A;  1OPX A;  4Q8I A;  5GHY A;  3PBO A;  4P6B A;  1WE4 A;  4N92 A;  3PBS A;  4R1G A;  4HHD A;  3HL9 A;  1GA9 A;  3NDG A;  5HPI A;  2WKE A;  5G4Y A;  5HW3 A;  1W8Y A;  4NXB A;  3CIT A;  4YOF A;  3ITA A;  2H0Y A;  3CMZ A;  2EWW A;  4X1M A;  4I5S A;  4LV1 A;  4JGQ A;  2NUT C;  4R6L A;  2P08 A;  5FAS A;  4O0P A;  3CJM A;  4FH2 A;  3G34 A;  4S2M A;  5EVI B;  1L0D A;  2C6W B;  2OLV A;  3LIC A;  3JVU A;  2QJ5 A;  2BG1 A;  1BZA A;  1BYW A;  1S67 L;  2PHY A;  1K54 A;  3MFX A;  1TF1 A;  4YWZ A;  3P09 A;  1JWZ A;  1IOU A;  4B88 A;  3D9Y A;  2Q9M A;  1I2W A;  2OLU A;  2UWX A;  1XX2 A;  5KSH A;  3M6B A;  4NXE A;  2PYR A;  1MWU A;  1DP6 A;  1VQQ A;  4BWI A;  4CLC C;  2EX6 A;  4IBR A;  1PW1 A;  3LR4 A;  3BFC A;  4GDB A;  3C5A A;  3R7W A;  3OPP A;  4QWO A;  3F1P B;  1TVF A;  4MLL A;  2A24 B;  5AVE A;  4HNB A;  3KYQ A;  1JWV A;  1YKD A;  2E8I A;  1FIK A;  4CJN A;  4EW7 A;  3IHB A;  4PPR A;  4DJ2 A;  1VEU A;  3KSG A;  2EX2 A;  3TRC A;  4S2J A;  3C30 A;  2D01 A;  2JKF A;  4CPK A;  2BAS A;  3HVF A;  3RTY A;  1O7E A;  5E2E A;  3CZD A;  2G7U A;  1EI5 A;  4Y5F A;  1NWZ A;  3HUN A;  4EBP A;  4LV2 A;  4D2O A;  1NJ4 A;  1FR1 A;  3T1R A;  3V50 A;  3EEH A;  1IEM A;  1MKM A;  1ZTU A;  4KQO A;  4ZDX A;  3V5M A;  3LY3 A;  3KSF A;  2BLS A;  4ZJ1 A;  1HZO A;  2P9V A;  1T19 A;  1W79 A;  4JXV A;  1MBL A;  3IX4 A;  3GMW A;  3HJI A;  2O9C A;  5GL9 A;  1XGI A;  3BW6 A;  1ES2 A;  4ETX A;  2L4R A;  2ZBB A;  1KGG A;  2Q9N A;  1N9N A;  1LLB A;  5HAP A;  2A49 A;  4OQ0 A;  4WM9 A;  3FWL A;  4EER A;  4KZ4 A;  1VHM A;  2E8J A;  2JKT M;  4GS9 B;  3O5Y A;  4WEJ A;  3ISG A;  1SKO A;  5FQJ A;  1ESU A;  3O86 A;  4QB8 A;  4G3W A;  3TE8 A;  3PYP A;  4R4S A;  4OLD A;  5C5K A;  4EUV A;  2IWC A;  3BFE A;  4K08 A;  5HAQ A;  5U47 A;  1N9L A;  3LR5 A;  4ZTK A;  1NZO A;  5E2H A;  2ZOH A;  1IYS A;  3DBA A;  4OQI A;  5TGF A;  4NK3 A;  4LV3 A;  4KUO A;  3NJA A;  4AFI A;  4GHI A;  4EBL A;  4CLC A;  3O87 A;  3TOI A;  2W0N A;  2WKH A;  5DJT A;  3ICY A;  3HLE A;  2ZM0 A;  5GLC A;  3TG9 A;  4DKI A;  4GZB A;  5M18 A;  4IUH A;  3NUL A;  4OOM A;  4QU3 A;  1Y28 A;  2XF3 A;  1F2K A;  1J9M A;  4DE0 A;  3UE0 A;  3P7N A;  2QPN A;  1KOU A;  1EWZ A;  2M1C A;  1GHM A;  3UE3 A;  4KZ3 A;  3UPO A;  3UMD A;  5EV0 A;  4KQD A;  1PI4 A;  3VFH A;  4Y2F A;  5L09 A;  3SS4 A;  5CX7 A;  2BTF P;  4WEL A;  3D72 A;  3T4S A;  2PRF A;  5EPH A;  5K5B A;  4Y17 A;  4PM7 A;  1BLS A;  5HDD A;  5EVI C;  4MMN A;  2K31 A;  4EXO A;  4JGP A;  3VP4 A;  3MXR A;  5J8X A;  2WYX A;  1L0F A;  2OWJ A;  3E2L A;  3BY8 A;  1XXM A;  3T4J A;  4PKY G;  1S0W A;  3W2Z A;  5CGS A;  4JXW A;  5EOO A;  1BT5 A;  3OCN A;  1YSP A;  3WS1 A;  3E4O A;  1YMS A;  3KSH A;  3PBR A;  3LUQ A;  1IFQ A;  1KGF A;  3GR2 A;  2VGJ A;  3LI8 A;  4L9G A;  2M7V A;  4OOY A;  2VEA A;  1M6K A;  3N8L A;  3MF0 A;  3DWK A;  4KZA A;  2FH5 A;  3IWI A;  2PD7 A;  4EQI A;  4OPZ A;  3S4X A;  2JKG A;  3CLO A;  2C5W B;  1DP9 A;  3HRE A;  3L9K A;  4QY5 A;  5EVE A;  5FI7 A;  4XT2 B;  4GD6 A;  1CK3 A;  1ODV A;  4WZ5 C;  3ZNT A;  4B4Z A;  2EA9 A;  5MC7 A;  2B95 A;  1YLP A;  1XFQ A;  2HJE A;  4P85 A;  4QJG A;  5IU1 A;  1ZKJ A;  1BLC A;  1K0K A;  1YAX A;  2WK0 A;  2Y79 A;  1PYY A;  4GHI B;  4DF6 A;  4JGO A;  5I5L A;  3T4T A;  4Y0T A;  4GCZ A;  4GB7 A;  4I3I A;  3BFD A;  1VET B;  3R4K A;  1FCN A;  3HCY A;  1QMF A;  4DDS A;  4K0X A;  3BFG A;  4MEZ A;  3SZT A;  2EFX A;  4BEN A;  2K2N A;  4KZ8 A;  3MKE A;  1K25 A;  4X6T A;  3BJN A;  4EUZ A;  5DKK A;  2W1R A;  3W8K A;  1KDW A;  3QP6 A;  2WZZ A;  3KYZ A;  2GNX A;  3DW0 A;  1UWN X;  1G6O A;  2PR5 A;  1YLJ A;  3IQA A;  2B18 A;  4YIN A;  3MKF A;  3GEC A;  1GHP A;  1ERM A;  2INW A;  5J3W A;  1PI5 A;  3FZC A;  1SKF A;  3OCL A;  1LSV A;  2XA7 M;  1CEG A;  2HP5 A;  4NKP A;  3QP5 A;  3LIE A;  4DDY A;  3PBT A;  5GHX A;  2EX9 A;  2PBD P;  4IVI A;  2ZJ9 A;  4E3K A;  4P0M A;  2V1Z A;  3MZE A;  2H10 A;  1MWR A;  3IXG A;  3HBR A;  3Q7V A;  3U4L P;  3M2K A;  4UHU A;  4BBT A;  3C4O A;  4WBG A;  3EWK A;  4KUK A;  1SDE A;  4JF5 A;  1MKI A;  4ID4 A;  1L0G A;  4FOF A;  2VLG A;  3OZH A;  2WKQ A;  3GDI A;  1LL5 A;  5FEG A;  4RX2 A;  4LLO B;  1T1B A;  4S2O A;  4ZRR A;  4X56 A;  2PU2 A;  1V9Y A;  3IF6 B;  1TS8 A;  4HOI A;  2J80 A;  2J9O A;  2EX8 A;  2EXB A;  1LI0 A;  3UPP A;  1FCO A;  1JTG A;  5CGW A;  2NUP C;  4X1L A;  1PFL A;  1K56 A;  3JPU A;  4E3L A;  1F9I A;  5F69 A;  1CJF A;  4WEK A;  2PAV P;  5A8B A;  1LI9 A;  2DRW A;  4R38 A;  2VV8 A;  2XGN A;  2Y2L A;  3JVV A;  2ZQC A;  3MS6 A;  1V9Z A;  4Y7P A;  2XFT A;  5EVI D;  3QNB A;  3HUO A;  2Y2K A;  4EU0 A;  5CGX A;  1CI8 A;  5HX9 A;  1LL9 A;  2IWD A;  2OV5 A;  2OAP 1;  5J7E A;  1WYC A;  1ERQ A;  1YLW A;  3IWQ A;  3ZYT A;  5AQ7 A;  2OAQ 1;  4MN6 A;  4OON A;  3K2N A;  5F68 A;  1T18 A;  5EM1 A;  2D02 A;  4R70 A;  4OP5 A;  3H7W B;  2Z6D A;  5F5Y A;  1L2S A;  1SZV A;  3RXW A;  2XD1 A;  2QYB A;  5KZH A;  3FPW A;  4F3L B;  3MXS A;  2HDQ A;  4BJP A;  4UQI S;  5E2G A;  4QHC A;  4BD1 A;  2HDR A;  1ESI A;  5IHV A;  2LB5 A;  3CAX A;  4MBF A;  3TJZ C;  1X0O A;  4NG2 A;  3T4O A;  3PBN A;  3RFB A;  4R23 A;  3KYE A;  4JF6 A;  4PM9 A;  4H6J A;  5CHJ A;  4G3V A;  2W27 A;  3Q7V B;  1AWI A;  4DN0 A;  1PRQ A;  3LFV A;  1H3Q A;  3IHA A;  2O99 A;  5FDH A;  3OOV A;  3LIF A;  5A93 A;  5HWV A;  5JYP A;  3MFD A;  5D3O A;  2Y8H A;  2W1T B;  2K7S A;  4LRZ E;  2PU4 A;  3BEB A;  2Z6C A;  1EW0 A;  5TR7 A;  1HTZ A;  3CG5 A;  2WKR A;  3C7V A;  4MCW A;  1P9R A;  3TW8 A;  4DE3 A;  3BLS A;  3DTE A;  1DJA A;  5CEC A;  4II7 A;  2I9V A;  4A5R A;  2JCH A;  3PAG A;  3FYZ A;  2ZD8 A;  5CER A;  3F1O A;  5HAI A;  5EVL A;  5HDS A;  3LR0 A;  1STZ A;  2WKP A;  4HH2 A;  3SS5 A;  1DRM A;  3D3O A;  2V1A A;  4BL3 A;  5FQI A;  2L1M A;  3O3V A;  2ZC3 B;  4FH4 A;  4NXG A;  3DAV A;  1P97 A;  4EEU A;  4WMC A;  4CLC B;  4ESP A;  1SHV A;  3BFF A;  4RX3 A;  2OSU A;  3GVB A;  2JHE A;  3B42 A;  3W4O A;  1E3U A;  1H8Z A;  4DXB A;  2J8Y A;  1OJG A;  3UY6 A;  3UO9 A;  3IH8 A;  2P04 A;  4KG5 A;  5KIZ A;  2H28 A;  4XUZ A;  2XRO A;  3HLF A;  2AVX A;  2HGV A;  3HJK A;  5FAO A;  2FFF B;  4C75 A;  1K54 C;  3SH9 A;  5FL3 A;  1OT6 A;  4QD4 A;  3A0R A;  3OPH A;  1S4R A;  3IS2 A;  4R4R A;  2A2L A;  3MQQ A;  2MJ6 A;  2XLN A;  3MQ0 A;  3H82 A;  1FSY A;  5CTN A;  4LPZ A;  3R7W B;  2ZQA A;  3E4P A;  4D60 A;  4PKY A;  2H5S A;  3UB5 P;  4HEF A;  1NXY A;  3BEC A;  4DE1 A;  3PAE A;  4CLC D;  3WS5 A;  3F1N B;  2Q0O A;  2Y2Q A;  1G28 A;  3FG8 A;  1YLY A;  1I2S A;  4N9K A;  3BYD A;  4JF4 A;  2VK3 A;  4WZ4 A;  3HLW A;  4EBN A;  3MSH A;  2XA7 S;  3MR0 A;  4IJG A;  3LI9 A;  4KZ9 A;  4ZJ3 A;  1IYP A;  2W3G A;  1K4F A;  3NI9 A;  1H5X A;  4RVA A;  2W3H A;  4CQH A;  2ZQ7 A;  3IS2 B;  4R0Q A;  4BLM A;  1GA0 A;  1KVL A;  3VFF A;  3VP0 A;  1D1J A;  2RL3 A;  3CI6 A;  5HSQ A;  1HLU P;  3WS2 A;  1ACF A;  4OQG A;  3VMA A;  1IYQ A;  4ME4 A;  1PZP A;  2M7U A;  1OT9 A;  3C8C A;  1YLZ A;  3LEQ A;  5FQQ A;  2ZC7 A;  4XT2 A;  5HD3 A;  3V3S A;  2Y91 A;  2J9P A;  4ETZ A;  2ZOI A;  2ZQ8 A;  5KMW A;  1P0Z A;  4LCM A;  3FV7 A;  2O9A A;  4L0L A;  2R9W A;  1LT0 A;  4ARZ B;  3FPV A;  1MWS A;  1HD8 A;  2FZ0 A;  4C3Q A;  2L0W A;  3C7U A;  4U0X A;  3TSG A;  2W3D A;  3Q7Z A;  3HUM A;  3A3D A;  3ZQ5 A;  3LIB A;  4ZJ2 A;  5LBR A;  2IA2 A;  2WGW B;  3E2K A;  3PR6 A;  4NET A;  3S7O A;  1XGJ A;  5BOH A;  3IF6 A;  4NXF A;  5DVA A;  3EEA A;  5HZH A;  4KZ6 A;  1E3U D;  4MNR A;  1YSQ A;  2Y2M A;  1VB6 A;  2JC7 A;  1OTI A;  4EES A;  4ZBE A;  2V8F A;  3KSI A;  3G31 A;  4BBU A;  4BMW A;  4HY8 A;  2LB9 A;  2XK1 A;  4MN5 A;  3GV9 A;  1NLY A;  3BRM A;  4HJ4 A;  4HIA A;  2WGV A;  1NYY A;  1Y4O A;  3PTE A; 
#chains in the Genus database with same CATH homology
 1CQA A;  1FIL A;  1VET B;  4QWO A;  3MS6 A;  1VEU B;  2JKF A;  2VK3 A;  1HLU P;  1AWI A;  2JKG A;  2ZL1 B;  1VET A;  5FEF A;  1PRQ A;  3CPT A;  3MSH A;  5EM1 A;  2ACG A;  1K0K A;  2V8C A;  3L7H A;  1ACF A;  2ZL1 A;  4D60 A;  4FTX A;  3CPT B;  3DAV A;  2PBD P;  5EM0 A;  3UB5 P;  5EV0 A;  3T1Q B;  2V8F A;  1SZV A;  2E8J A;  3L9K A;  4X1L A;  3NEC A;  1PFL A;  1YPR A;  1A0K A;  4X1M A;  1FIK A;  5EVE A;  3T12 B;  1Z09 A;  1CJF A;  3LEQ A;  1J3W A;  3NUL A;  4ESP A;  2PAV P;  2BTF P;  3T1S A;  1CF0 A;  1VEU A;  3T1R A;  1G5U A;  1SKO A;  2PRF A;  3D9Y A;  3U4L P;  3KYE A;  4FUW A;  2HZ5 A;  3CHW P;  5FEG A;  1F2K A;  4X25 A;  1Y4O A;  3T1X A;  1SKO B;  1D1J A;  5FDS A;  3LGO A;  1PNE A;  2B95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...