1F2KA

Crystal structure of acanthamoeba castellanii profilin ii, cubic crystal form
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
SWQTYVDTNLVGTGAVTQAAIIGHDGNTWATSAGFAVSPANGAALANAFKDATAIRSNGFELAGTRYVTIRADDRSVYGKKGSAGVITVKTSKAILIGVYNEKIQPGTAANVVEKLADYLIGQGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROFILIN II
publication title A Comparative Structural Analysis of Profilins
rcsb
source organism Acanthamoeba castellanii
molecule tags Structural protein
total genus 37
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1f2kA00
1A0KA 3T1SA 1PNEA 1CJFA 1D1JA 3CPTB 1K0KA 1SKOB 4FUWA 3NULA 5EM0A 3UB5P 4X1LA 3DAVA 4D60A 1F2KA 4FTXA 1HLUP 1PFLA 2PAVP 1VEUA 4X1MA 1PRQA 2ZL1A 1VEUB 4X25A 3L9KA 2JKGA 1ACFA 3T1RA 5FDSA 5EV0A 3T1XA 2V8FA 1VETA 3T12B 1CF0A 4ESPA 4QWOA 3CHWP 2PBDP 1J3WA 2JKFA 2HZ5A 2VK3A 5EM1A 5FEGA 5FEFA 1Z09A 2ACGA 2ZL1B 3D9YA 2BTFP 3CPTA 2E8JA 1FIKA 1SKOA 3MSHA 1SZVA 5EVEA 2B95A 3U4LP 3T1QB 1YPRA 1AWIA 3KYEA 1CQAA 1VETB 3MS6A 1FILA 2PRFA 3NECA 1G5UA 3L7HA 3LEQA 2V8CA 1Y4OA 3LGOA
chains in the Genus database with same CATH superfamily
4ZAMA 5GLCA 1LHYA 1L0GA 5JYPA 3H82A 2CMNA 1GA0A 4U0TA 1P0ZA 3UPNA 2OLUA 5EVIC 1XJ4A 3ZG8B 5JYOA 4X1LA 3LI8A 4MEZA 1H8YA 1YLPA 1XA7A 2Y2LA 2Y2MA 5CHJA 2VGLM 2EWVA 3HUOA 4EBLA 4X1MA 3LY4A 4O0PA 1YT4A 2WGWA 4HJ4A 2XGNA 1P9RA 4MN7A 2A49A 1EWZA 4PM9A 1FQGA 1L0FA 4I3JA 2G2WA 5EV0A 1O07A 3PTEA 1IKGA 2EXAA 4X56A 3TRCA 3ZFZA 3FG8A 4N1HA 3UMDA 1OJ5A 4IEDA 5FI2A 5EVLA 3FWLA 1MY8A 1NLZA 5EVID 1YSQA 4E6WA 5FAPA 4LV2A 4HP9A 4MNRA 1S1YA 5HWTA 2E8JA 2PYRA 5CHUA 2ZQDA 3NDEA 4N92A 3OZHA 3O5YA 3IXDA 4OLGA 2GJ3A 3EEHA 3Q81A 1YLWA 3P7NA 4Z1WA 3WS0A 5LBRA 5G4YA 5HZHA 4CJNA 3DWKA 4GHIB 1WYBA 3IHBA 5M18A 3LR5A 2VV6A 4DF6A 3FKWA 5TR7A 1OTBA 1LI9A 2DMWA 2UV0E 1LI0A 3KYQA 4GZBA 5DFXA 2E8IA 5J3WA 1VM1A 2VLGA 5AVFA 4KQQA 3IF6A 5HSQA 4EV4A 2P04A 3V3SA 2XDMA 1Z6FA 1DP8A 1IKIA 1MWTA 4QPRA 2XFSA 3S7PA 1OTDA 4X25A 4JGRA 3T1RA 1BULA 3M6HA 2V1BA 1PWCA 4O01A 4Y17A 3CLOA 4DN0A 2XLNA 3I7JA 4BD0A 4E04A 2J3WA 3V5MA 3PHYA 2Y2NA 4LV3A 2QKPA 4I38A 1MWUA 4Y0UA 1YMXA 3QHYA 2OSUA 1TS0A 1MWRA 4WZ5C 1K54C 2FFYA 3UE0A 3CI6A 2W3DA 1FIKA 1NZOA 3RTYA 4EUVA 1KDWA 3LIFA 4LPZA 3C8CA 3GRJA 3MS6A 3HBRA 2FZ0A 3BQ8A 1QMEA 5CX7A 4PAUA 3PR6A 4R6LA 5F69A 3NI9A 5HPIA 2PD7A 2BASA 2V9AA 3IWIA 4P6ZS 4P6BA 4C75A 4KZBA 4Q0JA 2R78A 1C3BA 4MCWA 4R4RA 3VFHA 3Q07A 4KQOA 4BL2A 4WUJA 4MBKA 4B88A 4RQ9A 1LLBA 5FQIA 5FI6A 4PM7A 2V20A 4A5RA 1S6RA 2GX5A 1K57C 3GR2A 1Y54A 4NKPA 3HCYA 5E2GA 4HI4A 5HAIA 1NXYA 3ZG7B 3HL9A 4D2OA 5A93A 1HD8A 1JVJA 3A3FA 3DBAA 5IS1A 1S67L 1WYCA 2HP5A 4JF6A 4WLAA 1ALQA 4E3NA 3T1XA 2VGLS 1NZUA 2V0UA 1MWSA 2KX6A 1LL9A 2K31A 3WS1A 4B4XA 3MQQA 4C6YA 5I94A 3G34A 1FR1A 2H0TA 4X53A 1ODVA 3CPTA 2DRWA 3BY9A 3G31A 3SZTA 1LSXA 2VZWA 2M7VA 1GHMA 2ZJ9A 2JKRM 3W4QA 3ZG0A 5DF8A 3S1YA 4KG6A 1K4EA 3IHAA 2A3UA 3KSFA 2M1CA 2ZMVA 5DTTA 4NXBA 4ME4A 3E0YA 1BTLA 3L7HA 4GD8A 3SS3A 5HL6A 1YLYA 5DF7A 3T1SA 1ZTUA 3V39A 4UA9A 5DTKA 1TS6A 1H8MA 1W5DA 1K25A 2JC7A 2P9VB 4UHUA 3ZG5A 2ZC4B 3VP0A 1MBLA 3MFXA 1DJBA 2HF6A 4WMCD 4I3IA 2Z6DA 1LL5A 1XFQA 2Y2JA 3QNCA 3T4QA 1FSWA 3T4SA 3ZVTA 2VGJA 4HH2A 3CITA 3M2JA 4KZ8A 4S2NA 3LFVA 3N8SA 1GHIA 2H28A 2NUPC 1OPXA 1TS8A 1NY0A 5A8BA 5HDCA 3LIBA 1BUEA 2PR5A 1EI5A 1XJ3A 3CHWP 3DWZA 3LR0A 2PBDP 1OT9A 1I2SA 2W1TB 5F68A 3T50A 3WWXA 1TVFA 1YKDA 4GOGA 4WL9A 2ZL1B 1CI8A 5CECA 4CLCB 5HFOA 2VEAA 3MZDA 2PT7A 4IBXA 4G3KA 4JLFA 3FKVA 4BBTA 5CEBA 4WF0A 1LT0A 3N8RA 4MLLA 1MKMA 1KOUA 3F1OB 1VB6A 1DRMA 4FCFA 2PRFA 3EWKA 4BQMA 5L10A 1IFQA 4DE3A 2OWJA 2WK0A 1G5UA 5D3OA 1XKZA 3AGFA 2WKEA 2B02A 4XT2B 2QYBA 1UGUA 4R0QA 3IXGA 3G2YA 4DXCA 3IF6C 1ES4A 1ZHHB 4B93A 3H7WB 1E3UA 1VHMA 3C38A 1BSGA 1SHVA 3OPRA 4JGOA 3IXHA 2HDQA 1PFLA 3OPHA 4L9GA 4MN6A 2X01A 4KZ5A 3BFFA 1N9LA 3VP3A 5EVIB 3T4TA 2W3EA 4EUZA 4OQGA 3LY3A 5HWWA 3W4PA 3BYDA 4EEPA 1ESUA 4F3LB 2L0WA 2VX8A 2K2NA 1WE4A 5FEGA 4P0MA 1XJ6A 2Y2GA 4OVDA 3MKEA 4WZ4A 1Z09A 2QPNA 3QP5A 3BRMA 5CRFA 1RGYA 1BYWA 2ZOHA 4DJ2A 2WKIA 2A2LA 1G6AA 3VOYA 1LSWA 3IX8A 4BMWA 1KGGA 4L0LA 4DDYA 2GZAA 4E3MA 2ZM0A 5IHVA 2KLIA 4KG5A 5KIZA 4Q8IA 3JVUA 4OLDA 5HL1A 3UB6A 3TG9A 1FILA 2WAEA 4NETA 3NHQA 4R3BA 4OH0A 5AJGA 3HJIA 4U3TA 1ES5A 4KENB 4Y5FA 1K56A 2KOIA 1D1JA 3PBTA 2NUTC 4UAAA 3Q7ZA 3QP2A 1V9YA 4P6ZM 1XP4A 2XH9A 4DJ3A 1GSXA 3PBSA 5G18A 1T19A 3SOIA 4PM8A 2HDUA 2IA2A 3WS5A 3IS2B 4BL3A 5BOHA 2PYPA 4K91A 5F83A 1S4RA 2RCXA 3LIEA 4HESA 4LV1A 4AFIA 2ZQ7A 2IWBA 2XF3A 3IF5A 2ZC6B 5EECA 4JXWA 1M40A 2O0YA 4JGPA 3PAEA 4M4XA 3PBRA 3WS4A 4HQAA 3LCEA 4LENA 4LCLA 3NOPC 3BWLA 3SW1A 2HZ5A 1HTZA 3EGXC 1MPLA 4FSFA 2YKHA 3MJQA 2OWHA 5CGXA 1HVBA 3IX4A 3HVFA 1N9NA 2Y2HA 3PXPA 5TBMB 1UWNX 5CEDA 2O9BA 3UE3A 5FA7A 4S2LA 3KSIA 5U47A 2XD5A 1W63M 5TJJA 3N4IA 4DXBA 1VETB 1K6RA 5IU1A 3K3CA 2PHYA 3MFDA 3BQAA 3TE8A 3NY4A 4E3JA 3CMZA 4GS9B 4Y0OA 5GHYA 4DMZA 2YKFA 1L2SA 3C2WA 1OTAA 4BJPA 4OOMA 3CJMA 3B3XA 4OP8A 4H8RA 5K5BA 3UY6A 1SDNA 2QJ5A 1MXOA 4GDNA 1D7EA 5HW3A 3FPVA 2WZZA 5HD5A 4G3VA 4EBPA 2EX9A 3A0SA 4S2NC 4CQHA 3CUEA 5KZHA 2Y59A 3UPOA 5FSRA 3N8LA 5GHXA 1FSYA 1G6OA 4Y2FA 4LLOB 5KMWA 1S66L 4L9EA 4Q0HA 3KX0X 3C4OA 5FQJA 3BFCA 1W7FA 3DTKA 2LB9A 3VMAA 3MF0A 3AGDA 4OPRA 2DNSA 4QU3A 2Y2KA 3E4QA 1FCMA 5FAOA 1OTEA 1ZKJA 3HUMA 5F1FA 4JF5A 1YMSA 4EXOA 3IWQA 5EM1A 3Q7VB 4DE1A 4K08A 2PDRA 1GA9A 4FH2A 3FPWA 4I3AA 3T4LA 4CLCE 1N9BA 4M3KA 2BTFP 3T4KA 5A90A 4N9LA 3A3EA 3MSHA 1XGJA 2P9VA 4LRZE 4YWZA 3PYPA 4IVIA 5FQQA 3U4LP 1QMFA 3T1QB 1TS7A 1ERMA 3VE3A 4YFMA 5TGFA 3LEZA 3VSLA 4JBFA 2A24B 2G7UA 1XFNA 1SCWA 3GV9A 3S7OA 4DKIA 3QP6A 1EROA 2PU2A 2QJ7A 4PKYA 4EQIA 2B5RA 4PM6A 3MMHA 2FFFB 4ID4A 5J8XA 1SKOB 3W2ZA 2HPBA 2V2FF 3LYXA 3CWFA 2HV1A 5HDDA 3FC7A 3OPPA 2W1TA 1DJCA 1NJ4A 1IOUA 4BENA 1JWVA 4X69A 2ZM8A 2ZL1A 4Y3IA 3B47A 3RXXA 4CLCA 3BM6A 3LO7A 3P01A 3QP1A 1XGIA 1E3UD 1BLPA 1STZA 1BLSA 3IWOA 3F1OA 4H6JB 3T12B 1D06A 1OTIA 4IBRA 3GVBA 1PZPA 1W63Q 3UDFA 1Q2QA 2Y55A 2V1AA 2GDNA 2Y91A 1HZOA 2QMIA 2W3HA 1JTDA 4XT2A 3EEAA 1SDEA 1T1CA 5C5KA 2VJWA 4PMAA 1OJGA 2ACGA 4OQIA 1IELA 4R38A 4UA7A 1MC0A 3H7WA 5KSHA 2HDRA 2JHEA 1U60A 2K7SA 5AVEA 4DDSA 4QY5A 4IUHA 1YM1A 2O9AA 3LR4A 4S2KA 3PBNA 3BFDA 1ONHA 3BFGA 1RP5A 2I72A 4QJGA 2GNXA 1LSVA 2ZQCA 3NDGA 5EVIA 4WEJA 4B9OA 4K0WA 2INWA 3R4KA 1ZG6A 3UDXA 2UWXA 3E4PA 4KZ6A 4EETB 3S4XA 2M7UA 4B4ZA 4R23A 4F3LA 4XUZA 4WM9A 3HJKA 4NK3A 4HBTA 4S2MA 5HWVA 2D02A 3HLWA 4I39A 5E43A 4HY8A 1VEUA 1TEMA 4EEUA 5F1GA 4KUKA 2J9OA 1YLTA 3R7WB 3O87A 3O3VA 2ZQAA 2Q9NA 3BJNA 2ZC7A 4HHDA 2C5WB 3JVVA 1ZC2A 4E3OA 5J4EA 4IJGA 2V0WA 3F1PB 1T1AA 3C7VA 2OAQ1 1CF0A 2WZXA 3A0VA 4FH4A 3IX3A 4MBFA 5M1AA 3HLCA 3EQUA 3MXRA 3PBQA 5E2HA 4LCMA 3VV4A 5FATA 4GB7A 5FEFA 4E3KA 4MN5A 3HLEA 4XUXA 2QHKA 1NYMA 3UNWA 3KSGA 4E6XA 5E2EA 3IS2A 3QNBA 1H8ZA 3OCLA 1V9ZA 5GHZA 1GHPA 4ZDXA 3FZCA 3WRTA 2EFUA 1BZAA 2JKTI 3NECA 3NBLA 3LEQA 5CHMA 2ZQ8A 3G4PA 5G4ZA 1K6SA 4BBVA 3KO6A 1PNEA 2Z2LB 1W8QA 2VV8A 1YSPA 4E3IA 2WGVA 1OMEA 5F82A 3NULA 4JKTA 5DJTA 1ONGA 2PR6A 1XX2A 1F2KA 1DJAA 4Q0IA 5KSCA 1GSWA 3EQVA 5E2FA 2PAVP 3VP1A 4KZ7A 3VSKA 2H5SA 2WKRA 5TBMA 3V50A 4BWIA 3IBJA 4ZTKA 5EE8A 1T1BA 3HLDA 4HP4A 1XPBA 2WADA 1VETA 2V1ZA 4OKPA 5EUAA 4GS9A 1K54A 1SKFA 2PBYA 4Y15A 2IWDA 4ZRRA 4K0XA 1E25A 2W3GA 1IYOA 1PWGA 1ES3A 5IT5A 3DTIA 2PU4A 5HAPA 2Q9MA 3A3JA 1AXBA 1PW1A 4JGQA 3P98A 3RH8B 2B95A 4QB8A 5CGWA 1AWIA 1FOFA 4GHIA 1T18A 2EX8A 2WAFA 4ETZA 3KYZA 1TDLA 1PI5A 4KQRA 2H0YA 1YLZA 2XFTA 3KSHA 1FR6A 4OQHA 1ERQA 4S2PA 4DE0A 4JXGA 1BLHA 1BLCA 2FH5A 4IUKA 4GD6A 4X55A 3MBZA 3OBFA 1MKIA 3UB5P 1H5XA 1CEFA 5AQBA 1K57A 3T4JA 3SH8A 3G30A 1S4SA 1PW8A 4O7DA 3Q7VA 2QWSA 3ZQ5A 3S7QA 1DY6A 2J7VA 4NXFA 2Y2IA 2VV7A 2WGIA 1J9MA 2HGVA 1MZUA 3ICYA 1PYYA 4GDBA 1TD5A 1G68A 2D01A 2EA9A 3IT9A 4KZ9A 3SS5A 4X6TA 2A24A 5CERA 3C7UA 3DW0A 3U2AA 2O9CA 2W27A 1TDGA 1L0DA 2J9PA 4FOFA 2ZOIA 3ZHHA 4OP5A 1SKOA 1K55A 3O88A 2OV5A 4JXVA 3C30A 4HJ3A 2XRNA 4R1GA 1F5MA 3N7WA 1RGZA 4DRTA 3MXSA 4ARZB 3F1NB 3RXWA 3NCKA 3ZGAB 4NG2A 3JPUA 2R9WA 1KE4A 1X0OA 2G2UA 1CJFA 1L0EA 4GCZA 5A92A 4KZAA 4P87A 1PZOA 3OCNA 3D72A 2P7JA 4GW9A 4OOLA 3H9WA 4JPMA 4H6JA 3AGEA 3NOTC 1ES2A 2MJ6A 5F5YA 3NIAA 1IYPA 3K3DA 4FTXA 2Y2PA 3IH8A 5EOOA 3G35A 5CTMA 5DKKA 5DF9A 1O7EA 3BLMA 4LRYC 4R70A 5DKLA 1PRQA 5A91A 1ZG4A 4KUOA 1JTGA 5FQ9A 4JXSA 3VFFA 5CXWA 4I5SA 5CGSA 2ZC3B 1N4OA 1K4FA 3UDIA 5FDSA 1RCJA 4HJ6A 4PM5A 1CEGA 5FDHA 3BW6A 2H10A 5L07A 3TSGA 1H0MA 4MMNA 3MQ0A 3OLOA 1L3LA 3ITAA 2B18A 1JWZA 3E98A 3DTMA 4OPZA 2ZMAA 1NYYA 1H3QA 3G2ZA 1YQSA 2Y79A 4N9KA 3HLBA 3HREA 3P09A 4O8GA 2VA0A 4UQIM 2JCHA 1DP6A 4GKUA 4PPRA 3LIAA 4Y13A 4WBGA 1NLYA 2LB5A 1KE0A 2Z2MB 3FYZA 3G32A 3GDIA 3R7WA 2Q0OA 1Y4OA 1F9IA 1K38A 4LFUA 2PD8A 5FASA 2JBFA 1GSVA 3WRZA 1K0KA 4NXGA 3F1PA 3MKFA 1P97A 5HX9A 3Q82A 3E2KA 3C5AA 4MDZA 3IH9A 4PHTA 1I2WA 3Q1FA 1FCNA 2KDKA 1YLJA 1HLUP 4YINA 3UB8A 3O86A 1JNUA 5J7EA 3NJAA 4U0XA 5FQKA 3ULFA 2WKPA 1PIOA 2JKTM 3H82B 3B42A 1XA1A 4X68A 1Y28A 3IBRA 4KZ4A 2ZC5B 4QD4A 4UEYA 2HJ9C 4II7A 5HPFA 5L2FA 5I5LA 5HAQA 2ZQ9A 3N6IA 2V8FA 5AQ7A 4N1XA 3T4OA 2XSSA 3LICA 4L9FA 2RL3A 3V3RA 3UE6A 3W4OA 1CI9A 1NWZA 2XA7M 2WKHA 2ZBBA 5DJUA 2OAP1 2WYXA 4RA7A 3SS4A 1KVLA 4ZJ2A 3GECA 4OOYA 3D4FA 2XD1A 2OLVA 2EXBA 2WGWB 2X02A 4OPQA 1EW0A 4FD8A 3LR3A 5GLBA 1KVMA 3LUQA 1LL8A 1E4DA 3TJZC 3ZYTA 3C4PA 4WEKA 4EW7A 3PAGA 4HOIA 4LV0A 3MXQA 2EFXA 3DTEA 4JF4A 1F98A 4OPYA 3HUNA 5GLAA 4FUWA 2DCFA 3DAVA 3UMEA 3A3IA 1NRJA 1G28A 3IQAA 2VKSA 3WS2A 3UPPA 2J8YA 5DFYA 4YOFA 1UWPX 2L4RA 5FAQA 3E2LA 1KGEA 3D3OA 3OC2A 2J80A 3GTCA 2I9VA 3S22A 4UA6A 5HD3A 2BLSA 3RFBA 3BY8A 3K2NA 1N9OA 5L09A 4PKYG 1XJ2A 2WUQA 5L8MA 2HJEA 4G3WA 3NOUC 3HLFA 1K55C 3MR0A 5EOEA 2EX6A 2W3FA 3IF6B 1K56D 4OONA 1CK3A 3VOLA 4HNBA 3JYIA 4R3AA 3ISGA 1OT6A 2X71A 2JE5A 3MZEA 4BLMA 4EESA 4CPKA 3KYEA 5EFWA 2W1RA 2XEPA 1IYSA 2AVXA 4EU0A 3VE4A 3A3DA 3A0RA 1FCOA 4LRXC 1KE3A 4R4SA 4S2IA 4OQ0A 2ZD8A 1S0WA 4IVKA 4UQIS 3G6OA 4GLQA 2Y4AA 4RVAA 3TOIA 5EM0A 3UB7A 1XXMA 1KDSA 4EWFA 5FI7A 2XROA 2Y2OA 4S2JA 3VP4A 2ZMFA 5GLDA 3CUEC 3PBOA 3GMWA 4NEED 2XQZA 3NC8A 4ZBEA 4YNRA 3E4OA 3TW8A 4KQDA 3SH7A 5MC7A 1BT5A 5F6AA 3L9KA 1ACFA 2IWCA 4HH3A 2EX2A 4Y0TA 1PI4A 1TF1A 4ARZA 1NRFA 2P74A 2VGKA 3F1NA 4HBUA 2J3TC 3IXBA 3HLGA 2EWWA 4LGWA 3ITBA 1KGFA 1JWPA 4R3JA 1W8YA 3OPLA 1VQQA 4Z9QA 3RJUA 3S7NA 4E3LA 2L1MA 4XXRA 2W0NA 2CC1A 5M19A 5EVEA 4WELA 1YPRA 4WZ5A 2XA7S 3ZNYA 4F94A 4NXEA 3M2KA 1IYQA 4QHCA 3GQZA 1M6KA 3BECA 4MBHA 5FQMA 2QZ6A 1I5QA 4KZ3A 3MZFA 1A0KA 4DE2A 2Y2QA 5DVAA 4GNUA 2Z6CA 1P9WA 2BG1A 2J3TD 3EOIA 3CPTB 3ZVWA 2R9XA 4ZJ3A 3LI9A 3UB9A 4RYEA 4D60A 3VOZA 4HEFA 1IEMA 3BLSA 4BD1A 4P85A 3EGDC 5AQ9A 4RX2A 3BFEA 2JN7A 3M6BA 4WN5A 4ZJ1A 2JKRI 3CG5A 4HIAA 1VEUB 3SH9A 2WKQA 5CTNA 1Q2PA 3GSGA 3UE1A 2JKGA 2ZLYA 3UO9A 2HP6A 5FL3A 1WA9A 2C6WB 2O99A 4BBUA 4WYYA 4CLCC 4Y7PA 3B33A 5HDSA 3QP4A 4ESPA 4QWOA 4EQ1A 4GJ4A 1PWDA 1J3WA 2JKFA 2XR0A 3FV7A 3VP2A 1GCEA 4RX3A 2VK3A 3ZDJA 3CAXA 3LIDA 1W79A 4IHQA 2HDSA 5DTSA 5HARA 5TFQA 3ZG9B 3CZDA 1YAXA 4GN2A 1ESIA 3D9YA 3ZCZA 3BEBA 4EBNA 4QY6A 4KG2A 5EPHA 3MQOA 1SZVA 2HP9A 2OOLA 2XK1A 3W8KA 2Y8HA 4S2OA 1DP9A 3ZNTA 2ZM2A 3QP8A 4EERA 4ETXA 1CQAA 3V67A 4C3QA 5AQAA 2P08A 3UN7A 5GL9A 4WMCA 3OOVA 1S1ZA 2V8CA 4CLCD 3LGOA
chains in the Genus database with same CATH topology
1A0KA 3T1SA 1PNEA 1CJFA 1D1JA 3CPTB 1K0KA 1SKOB 4FUWA 3NULA 5EM0A 3UB5P 4X1LA 3DAVA 4D60A 1F2KA 4FTXA 1HLUP 1PFLA 2PAVP 1VEUA 4X1MA 1PRQA 2ZL1A 1VEUB 4X25A 3L9KA 2JKGA 1ACFA 3T1RA 5FDSA 5EV0A 3T1XA 2V8FA 1VETA 3T12B 1CF0A 4ESPA 4QWOA 3CHWP 2PBDP 1J3WA 2JKFA 2HZ5A 2VK3A 5EM1A 5FEGA 5FEFA 1Z09A 2ACGA 2ZL1B 3D9YA 2BTFP 3CPTA 2E8JA 1FIKA 1SKOA 3MSHA 1SZVA 5EVEA 2B95A 3U4LP 3T1QB 1YPRA 1AWIA 3KYEA 1CQAA 1VETB 3MS6A 1FILA 2PRFA 3NECA 1G5UA 3L7HA 3LEQA 2V8CA 1Y4OA 3LGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0K A;  3T1S A;  1PNE A;  1CJF A;  1D1J A;  3CPT B;  1K0K A;  1SKO B;  4FUW A;  3NUL A;  5EM0 A;  3UB5 P;  4X1L A;  3DAV A;  4D60 A;  1F2K A;  4FTX A;  1HLU P;  1PFL A;  2PAV P;  1VEU A;  4X1M A;  1PRQ A;  2ZL1 A;  1VEU B;  4X25 A;  3L9K A;  2JKG A;  1ACF A;  3T1R A;  5FDS A;  5EV0 A;  3T1X A;  2V8F A;  1VET A;  3T12 B;  1CF0 A;  4ESP A;  4QWO A;  3CHW P;  2PBD P;  1J3W A;  2JKF A;  2HZ5 A;  2VK3 A;  5EM1 A;  5FEG A;  5FEF A;  1Z09 A;  2ACG A;  2ZL1 B;  3D9Y A;  2BTF P;  3CPT A;  2E8J A;  1FIK A;  1SKO A;  3MSH A;  1SZV A;  5EVE A;  2B95 A;  3U4L P;  3T1Q B;  1YPR A;  1AWI A;  3KYE A;  1CQA A;  1VET B;  3MS6 A;  1FIL A;  2PRF A;  3NEC A;  1G5U A;  3L7H A;  3LEQ A;  2V8C A;  1Y4O A;  3LGO A; 
#chains in the Genus database with same CATH topology
 4ZAM A;  5GLC A;  1LHY A;  1L0G A;  5JYP A;  3H82 A;  2CMN A;  1GA0 A;  4U0T A;  1P0Z A;  3UPN A;  2OLU A;  5EVI C;  1XJ4 A;  3ZG8 B;  5JYO A;  4X1L A;  3LI8 A;  4MEZ A;  1H8Y A;  1YLP A;  1XA7 A;  2Y2L A;  2Y2M A;  5CHJ A;  2VGL M;  2EWV A;  3HUO A;  4EBL A;  4X1M A;  3LY4 A;  4O0P A;  1YT4 A;  2WGW A;  4HJ4 A;  2XGN A;  1P9R A;  4MN7 A;  2A49 A;  1EWZ A;  4PM9 A;  1FQG A;  1L0F A;  4I3J A;  2G2W A;  5EV0 A;  1O07 A;  3PTE A;  1IKG A;  2EXA A;  4X56 A;  3TRC A;  3ZFZ A;  3FG8 A;  4N1H A;  3UMD A;  1OJ5 A;  4IED A;  5FI2 A;  5EVL A;  3FWL A;  1MY8 A;  1NLZ A;  5EVI D;  1YSQ A;  4E6W A;  5FAP A;  4LV2 A;  4HP9 A;  4MNR A;  1S1Y A;  5HWT A;  2E8J A;  2PYR A;  5CHU A;  2ZQD A;  3NDE A;  4N92 A;  3OZH A;  3O5Y A;  3IXD A;  4OLG A;  2GJ3 A;  3EEH A;  3Q81 A;  1YLW A;  3P7N A;  4Z1W A;  3WS0 A;  5LBR A;  5G4Y A;  5HZH A;  4CJN A;  3DWK A;  4GHI B;  1WYB A;  3IHB A;  5M18 A;  3LR5 A;  2VV6 A;  4DF6 A;  3FKW A;  5TR7 A;  1OTB A;  1LI9 A;  2DMW A;  2UV0 E;  1LI0 A;  3KYQ A;  4GZB A;  5DFX A;  2E8I A;  5J3W A;  1VM1 A;  2VLG A;  5AVF A;  4KQQ A;  3IF6 A;  5HSQ A;  4EV4 A;  2P04 A;  3V3S A;  2XDM A;  1Z6F A;  1DP8 A;  1IKI A;  1MWT A;  4QPR A;  2XFS A;  3S7P A;  1OTD A;  4X25 A;  4JGR A;  3T1R A;  1BUL A;  3M6H A;  2V1B A;  1PWC A;  4O01 A;  4Y17 A;  3CLO A;  4DN0 A;  2XLN A;  3I7J A;  4BD0 A;  4E04 A;  2J3W A;  3V5M A;  3PHY A;  2Y2N A;  4LV3 A;  2QKP A;  4I38 A;  1MWU A;  4Y0U A;  1YMX A;  3QHY A;  2OSU A;  1TS0 A;  1MWR A;  4WZ5 C;  1K54 C;  2FFY A;  3UE0 A;  3CI6 A;  2W3D A;  1FIK A;  1NZO A;  3RTY A;  4EUV A;  1KDW A;  3LIF A;  4LPZ A;  3C8C A;  3GRJ A;  3MS6 A;  3HBR A;  2FZ0 A;  3BQ8 A;  1QME A;  5CX7 A;  4PAU A;  3PR6 A;  4R6L A;  5F69 A;  3NI9 A;  5HPI A;  2PD7 A;  2BAS A;  2V9A A;  3IWI A;  4P6Z S;  4P6B A;  4C75 A;  4KZB A;  4Q0J A;  2R78 A;  1C3B A;  4MCW A;  4R4R A;  3VFH A;  3Q07 A;  4KQO A;  4BL2 A;  4WUJ A;  4MBK A;  4B88 A;  4RQ9 A;  1LLB A;  5FQI A;  5FI6 A;  4PM7 A;  2V20 A;  4A5R A;  1S6R A;  2GX5 A;  1K57 C;  3GR2 A;  1Y54 A;  4NKP A;  3HCY A;  5E2G A;  4HI4 A;  5HAI A;  1NXY A;  3ZG7 B;  3HL9 A;  4D2O A;  5A93 A;  1HD8 A;  1JVJ A;  3A3F A;  3DBA A;  5IS1 A;  1S67 L;  1WYC A;  2HP5 A;  4JF6 A;  4WLA A;  1ALQ A;  4E3N A;  3T1X A;  2VGL S;  1NZU A;  2V0U A;  1MWS A;  2KX6 A;  1LL9 A;  2K31 A;  3WS1 A;  4B4X A;  3MQQ A;  4C6Y A;  5I94 A;  3G34 A;  1FR1 A;  2H0T A;  4X53 A;  1ODV A;  3CPT A;  2DRW A;  3BY9 A;  3G31 A;  3SZT A;  1LSX A;  2VZW A;  2M7V A;  1GHM A;  2ZJ9 A;  2JKR M;  3W4Q A;  3ZG0 A;  5DF8 A;  3S1Y A;  4KG6 A;  1K4E A;  3IHA A;  2A3U A;  3KSF A;  2M1C A;  2ZMV A;  5DTT A;  4NXB A;  4ME4 A;  3E0Y A;  1BTL A;  3L7H A;  4GD8 A;  3SS3 A;  5HL6 A;  1YLY A;  5DF7 A;  3T1S A;  1ZTU A;  3V39 A;  4UA9 A;  5DTK A;  1TS6 A;  1H8M A;  1W5D A;  1K25 A;  2JC7 A;  2P9V B;  4UHU A;  3ZG5 A;  2ZC4 B;  3VP0 A;  1MBL A;  3MFX A;  1DJB A;  2HF6 A;  4WMC D;  4I3I A;  2Z6D A;  1LL5 A;  1XFQ A;  2Y2J A;  3QNC A;  3T4Q A;  1FSW A;  3T4S A;  3ZVT A;  2VGJ A;  4HH2 A;  3CIT A;  3M2J A;  4KZ8 A;  4S2N A;  3LFV A;  3N8S A;  1GHI A;  2H28 A;  2NUP C;  1OPX A;  1TS8 A;  1NY0 A;  5A8B A;  5HDC A;  3LIB A;  1BUE A;  2PR5 A;  1EI5 A;  1XJ3 A;  3CHW P;  3DWZ A;  3LR0 A;  2PBD P;  1OT9 A;  1I2S A;  2W1T B;  5F68 A;  3T50 A;  3WWX A;  1TVF A;  1YKD A;  4GOG A;  4WL9 A;  2ZL1 B;  1CI8 A;  5CEC A;  4CLC B;  5HFO A;  2VEA A;  3MZD A;  2PT7 A;  4IBX A;  4G3K A;  4JLF A;  3FKV A;  4BBT A;  5CEB A;  4WF0 A;  1LT0 A;  3N8R A;  4MLL A;  1MKM A;  1KOU A;  3F1O B;  1VB6 A;  1DRM A;  4FCF A;  2PRF A;  3EWK A;  4BQM A;  5L10 A;  1IFQ A;  4DE3 A;  2OWJ A;  2WK0 A;  1G5U A;  5D3O A;  1XKZ A;  3AGF A;  2WKE A;  2B02 A;  4XT2 B;  2QYB A;  1UGU A;  4R0Q A;  3IXG A;  3G2Y A;  4DXC A;  3IF6 C;  1ES4 A;  1ZHH B;  4B93 A;  3H7W B;  1E3U A;  1VHM A;  3C38 A;  1BSG A;  1SHV A;  3OPR A;  4JGO A;  3IXH A;  2HDQ A;  1PFL A;  3OPH A;  4L9G A;  4MN6 A;  2X01 A;  4KZ5 A;  3BFF A;  1N9L A;  3VP3 A;  5EVI B;  3T4T A;  2W3E A;  4EUZ A;  4OQG A;  3LY3 A;  5HWW A;  3W4P A;  3BYD A;  4EEP A;  1ESU A;  4F3L B;  2L0W A;  2VX8 A;  2K2N A;  1WE4 A;  5FEG A;  4P0M A;  1XJ6 A;  2Y2G A;  4OVD A;  3MKE A;  4WZ4 A;  1Z09 A;  2QPN A;  3QP5 A;  3BRM A;  5CRF A;  1RGY A;  1BYW A;  2ZOH A;  4DJ2 A;  2WKI A;  2A2L A;  1G6A A;  3VOY A;  1LSW A;  3IX8 A;  4BMW A;  1KGG A;  4L0L A;  4DDY A;  2GZA A;  4E3M A;  2ZM0 A;  5IHV A;  2KLI A;  4KG5 A;  5KIZ A;  4Q8I A;  3JVU A;  4OLD A;  5HL1 A;  3UB6 A;  3TG9 A;  1FIL A;  2WAE A;  4NET A;  3NHQ A;  4R3B A;  4OH0 A;  5AJG A;  3HJI A;  4U3T A;  1ES5 A;  4KEN B;  4Y5F A;  1K56 A;  2KOI A;  1D1J A;  3PBT A;  2NUT C;  4UAA A;  3Q7Z A;  3QP2 A;  1V9Y A;  4P6Z M;  1XP4 A;  2XH9 A;  4DJ3 A;  1GSX A;  3PBS A;  5G18 A;  1T19 A;  3SOI A;  4PM8 A;  2HDU A;  2IA2 A;  3WS5 A;  3IS2 B;  4BL3 A;  5BOH A;  2PYP A;  4K91 A;  5F83 A;  1S4R A;  2RCX A;  3LIE A;  4HES A;  4LV1 A;  4AFI A;  2ZQ7 A;  2IWB A;  2XF3 A;  3IF5 A;  2ZC6 B;  5EEC A;  4JXW A;  1M40 A;  2O0Y A;  4JGP A;  3PAE A;  4M4X A;  3PBR A;  3WS4 A;  4HQA A;  3LCE A;  4LEN A;  4LCL A;  3NOP C;  3BWL A;  3SW1 A;  2HZ5 A;  1HTZ A;  3EGX C;  1MPL A;  4FSF A;  2YKH A;  3MJQ A;  2OWH A;  5CGX A;  1HVB A;  3IX4 A;  3HVF A;  1N9N A;  2Y2H A;  3PXP A;  5TBM B;  1UWN X;  5CED A;  2O9B A;  3UE3 A;  5FA7 A;  4S2L A;  3KSI A;  5U47 A;  2XD5 A;  1W63 M;  5TJJ A;  3N4I A;  4DXB A;  1VET B;  1K6R A;  5IU1 A;  3K3C A;  2PHY A;  3MFD A;  3BQA A;  3TE8 A;  3NY4 A;  4E3J A;  3CMZ A;  4GS9 B;  4Y0O A;  5GHY A;  4DMZ A;  2YKF A;  1L2S A;  3C2W A;  1OTA A;  4BJP A;  4OOM A;  3CJM A;  3B3X A;  4OP8 A;  4H8R A;  5K5B A;  3UY6 A;  1SDN A;  2QJ5 A;  1MXO A;  4GDN A;  1D7E A;  5HW3 A;  3FPV A;  2WZZ A;  5HD5 A;  4G3V A;  4EBP A;  2EX9 A;  3A0S A;  4S2N C;  4CQH A;  3CUE A;  5KZH A;  2Y59 A;  3UPO A;  5FSR A;  3N8L A;  5GHX A;  1FSY A;  1G6O A;  4Y2F A;  4LLO B;  5KMW A;  1S66 L;  4L9E A;  4Q0H A;  3KX0 X;  3C4O A;  5FQJ A;  3BFC A;  1W7F A;  3DTK A;  2LB9 A;  3VMA A;  3MF0 A;  3AGD A;  4OPR A;  2DNS A;  4QU3 A;  2Y2K A;  3E4Q A;  1FCM A;  5FAO A;  1OTE A;  1ZKJ A;  3HUM A;  5F1F A;  4JF5 A;  1YMS A;  4EXO A;  3IWQ A;  5EM1 A;  3Q7V B;  4DE1 A;  4K08 A;  2PDR A;  1GA9 A;  4FH2 A;  3FPW A;  4I3A A;  3T4L A;  4CLC E;  1N9B A;  4M3K A;  2BTF P;  3T4K A;  5A90 A;  4N9L A;  3A3E A;  3MSH A;  1XGJ A;  2P9V A;  4LRZ E;  4YWZ A;  3PYP A;  4IVI A;  5FQQ A;  3U4L P;  1QMF A;  3T1Q B;  1TS7 A;  1ERM A;  3VE3 A;  4YFM A;  5TGF A;  3LEZ A;  3VSL A;  4JBF A;  2A24 B;  2G7U A;  1XFN A;  1SCW A;  3GV9 A;  3S7O A;  4DKI A;  3QP6 A;  1ERO A;  2PU2 A;  2QJ7 A;  4PKY A;  4EQI A;  2B5R A;  4PM6 A;  3MMH A;  2FFF B;  4ID4 A;  5J8X A;  1SKO B;  3W2Z A;  2HPB A;  2V2F F;  3LYX A;  3CWF A;  2HV1 A;  5HDD A;  3FC7 A;  3OPP A;  2W1T A;  1DJC A;  1NJ4 A;  1IOU A;  4BEN A;  1JWV A;  4X69 A;  2ZM8 A;  2ZL1 A;  4Y3I A;  3B47 A;  3RXX A;  4CLC A;  3BM6 A;  3LO7 A;  3P01 A;  3QP1 A;  1XGI A;  1E3U D;  1BLP A;  1STZ A;  1BLS A;  3IWO A;  3F1O A;  4H6J B;  3T12 B;  1D06 A;  1OTI A;  4IBR A;  3GVB A;  1PZP A;  1W63 Q;  3UDF A;  1Q2Q A;  2Y55 A;  2V1A A;  2GDN A;  2Y91 A;  1HZO A;  2QMI A;  2W3H A;  1JTD A;  4XT2 A;  3EEA A;  1SDE A;  1T1C A;  5C5K A;  2VJW A;  4PMA A;  1OJG A;  2ACG A;  4OQI A;  1IEL A;  4R38 A;  4UA7 A;  1MC0 A;  3H7W A;  5KSH A;  2HDR A;  2JHE A;  1U60 A;  2K7S A;  5AVE A;  4DDS A;  4QY5 A;  4IUH A;  1YM1 A;  2O9A A;  3LR4 A;  4S2K A;  3PBN A;  3BFD A;  1ONH A;  3BFG A;  1RP5 A;  2I72 A;  4QJG A;  2GNX A;  1LSV A;  2ZQC A;  3NDG A;  5EVI A;  4WEJ A;  4B9O A;  4K0W A;  2INW A;  3R4K A;  1ZG6 A;  3UDX A;  2UWX A;  3E4P A;  4KZ6 A;  4EET B;  3S4X A;  2M7U A;  4B4Z A;  4R23 A;  4F3L A;  4XUZ A;  4WM9 A;  3HJK A;  4NK3 A;  4HBT A;  4S2M A;  5HWV A;  2D02 A;  3HLW A;  4I39 A;  5E43 A;  4HY8 A;  1VEU A;  1TEM A;  4EEU A;  5F1G A;  4KUK A;  2J9O A;  1YLT A;  3R7W B;  3O87 A;  3O3V A;  2ZQA A;  2Q9N A;  3BJN A;  2ZC7 A;  4HHD A;  2C5W B;  3JVV A;  1ZC2 A;  4E3O A;  5J4E A;  4IJG A;  2V0W A;  3F1P B;  1T1A A;  3C7V A;  2OAQ 1;  1CF0 A;  2WZX A;  3A0V A;  4FH4 A;  3IX3 A;  4MBF A;  5M1A A;  3HLC A;  3EQU A;  3MXR A;  3PBQ A;  5E2H A;  4LCM A;  3VV4 A;  5FAT A;  4GB7 A;  5FEF A;  4E3K A;  4MN5 A;  3HLE A;  4XUX A;  2QHK A;  1NYM A;  3UNW A;  3KSG A;  4E6X A;  5E2E A;  3IS2 A;  3QNB A;  1H8Z A;  3OCL A;  1V9Z A;  5GHZ A;  1GHP A;  4ZDX A;  3FZC A;  3WRT A;  2EFU A;  1BZA A;  2JKT I;  3NEC A;  3NBL A;  3LEQ A;  5CHM A;  2ZQ8 A;  3G4P A;  5G4Z A;  1K6S A;  4BBV A;  3KO6 A;  1PNE A;  2Z2L B;  1W8Q A;  2VV8 A;  1YSP A;  4E3I A;  2WGV A;  1OME A;  5F82 A;  3NUL A;  4JKT A;  5DJT A;  1ONG A;  2PR6 A;  1XX2 A;  1F2K A;  1DJA A;  4Q0I A;  5KSC A;  1GSW A;  3EQV A;  5E2F A;  2PAV P;  3VP1 A;  4KZ7 A;  3VSK A;  2H5S A;  2WKR A;  5TBM A;  3V50 A;  4BWI A;  3IBJ A;  4ZTK A;  5EE8 A;  1T1B A;  3HLD A;  4HP4 A;  1XPB A;  2WAD A;  1VET A;  2V1Z A;  4OKP A;  5EUA A;  4GS9 A;  1K54 A;  1SKF A;  2PBY A;  4Y15 A;  2IWD A;  4ZRR A;  4K0X A;  1E25 A;  2W3G A;  1IYO A;  1PWG A;  1ES3 A;  5IT5 A;  3DTI A;  2PU4 A;  5HAP A;  2Q9M A;  3A3J A;  1AXB A;  1PW1 A;  4JGQ A;  3P98 A;  3RH8 B;  2B95 A;  4QB8 A;  5CGW A;  1AWI A;  1FOF A;  4GHI A;  1T18 A;  2EX8 A;  2WAF A;  4ETZ A;  3KYZ A;  1TDL A;  1PI5 A;  4KQR A;  2H0Y A;  1YLZ A;  2XFT A;  3KSH A;  1FR6 A;  4OQH A;  1ERQ A;  4S2P A;  4DE0 A;  4JXG A;  1BLH A;  1BLC A;  2FH5 A;  4IUK A;  4GD6 A;  4X55 A;  3MBZ A;  3OBF A;  1MKI A;  3UB5 P;  1H5X A;  1CEF A;  5AQB A;  1K57 A;  3T4J A;  3SH8 A;  3G30 A;  1S4S A;  1PW8 A;  4O7D A;  3Q7V A;  2QWS A;  3ZQ5 A;  3S7Q A;  1DY6 A;  2J7V A;  4NXF A;  2Y2I A;  2VV7 A;  2WGI A;  1J9M A;  2HGV A;  1MZU A;  3ICY A;  1PYY A;  4GDB A;  1TD5 A;  1G68 A;  2D01 A;  2EA9 A;  3IT9 A;  4KZ9 A;  3SS5 A;  4X6T A;  2A24 A;  5CER A;  3C7U A;  3DW0 A;  3U2A A;  2O9C A;  2W27 A;  1TDG A;  1L0D A;  2J9P A;  4FOF A;  2ZOI A;  3ZHH A;  4OP5 A;  1SKO A;  1K55 A;  3O88 A;  2OV5 A;  4JXV A;  3C30 A;  4HJ3 A;  2XRN A;  4R1G A;  1F5M A;  3N7W A;  1RGZ A;  4DRT A;  3MXS A;  4ARZ B;  3F1N B;  3RXW A;  3NCK A;  3ZGA B;  4NG2 A;  3JPU A;  2R9W A;  1KE4 A;  1X0O A;  2G2U A;  1CJF A;  1L0E A;  4GCZ A;  5A92 A;  4KZA A;  4P87 A;  1PZO A;  3OCN A;  3D72 A;  2P7J A;  4GW9 A;  4OOL A;  3H9W A;  4JPM A;  4H6J A;  3AGE A;  3NOT C;  1ES2 A;  2MJ6 A;  5F5Y A;  3NIA A;  1IYP A;  3K3D A;  4FTX A;  2Y2P A;  3IH8 A;  5EOO A;  3G35 A;  5CTM A;  5DKK A;  5DF9 A;  1O7E A;  3BLM A;  4LRY C;  4R70 A;  5DKL A;  1PRQ A;  5A91 A;  1ZG4 A;  4KUO A;  1JTG A;  5FQ9 A;  4JXS A;  3VFF A;  5CXW A;  4I5S A;  5CGS A;  2ZC3 B;  1N4O A;  1K4F A;  3UDI A;  5FDS A;  1RCJ A;  4HJ6 A;  4PM5 A;  1CEG A;  5FDH A;  3BW6 A;  2H10 A;  5L07 A;  3TSG A;  1H0M A;  4MMN A;  3MQ0 A;  3OLO A;  1L3L A;  3ITA A;  2B18 A;  1JWZ A;  3E98 A;  3DTM A;  4OPZ A;  2ZMA A;  1NYY A;  1H3Q A;  3G2Z A;  1YQS A;  2Y79 A;  4N9K A;  3HLB A;  3HRE A;  3P09 A;  4O8G A;  2VA0 A;  4UQI M;  2JCH A;  1DP6 A;  4GKU A;  4PPR A;  3LIA A;  4Y13 A;  4WBG A;  1NLY A;  2LB5 A;  1KE0 A;  2Z2M B;  3FYZ A;  3G32 A;  3GDI A;  3R7W A;  2Q0O A;  1Y4O A;  1F9I A;  1K38 A;  4LFU A;  2PD8 A;  5FAS A;  2JBF A;  1GSV A;  3WRZ A;  1K0K A;  4NXG A;  3F1P A;  3MKF A;  1P97 A;  5HX9 A;  3Q82 A;  3E2K A;  3C5A A;  4MDZ A;  3IH9 A;  4PHT A;  1I2W A;  3Q1F A;  1FCN A;  2KDK A;  1YLJ A;  1HLU P;  4YIN A;  3UB8 A;  3O86 A;  1JNU A;  5J7E A;  3NJA A;  4U0X A;  5FQK A;  3ULF A;  2WKP A;  1PIO A;  2JKT M;  3H82 B;  3B42 A;  1XA1 A;  4X68 A;  1Y28 A;  3IBR A;  4KZ4 A;  2ZC5 B;  4QD4 A;  4UEY A;  2HJ9 C;  4II7 A;  5HPF A;  5L2F A;  5I5L A;  5HAQ A;  2ZQ9 A;  3N6I A;  2V8F A;  5AQ7 A;  4N1X A;  3T4O A;  2XSS A;  3LIC A;  4L9F A;  2RL3 A;  3V3R A;  3UE6 A;  3W4O A;  1CI9 A;  1NWZ A;  2XA7 M;  2WKH A;  2ZBB A;  5DJU A;  2OAP 1;  2WYX A;  4RA7 A;  3SS4 A;  1KVL A;  4ZJ2 A;  3GEC A;  4OOY A;  3D4F A;  2XD1 A;  2OLV A;  2EXB A;  2WGW B;  2X02 A;  4OPQ A;  1EW0 A;  4FD8 A;  3LR3 A;  5GLB A;  1KVM A;  3LUQ A;  1LL8 A;  1E4D A;  3TJZ C;  3ZYT A;  3C4P A;  4WEK A;  4EW7 A;  3PAG A;  4HOI A;  4LV0 A;  3MXQ A;  2EFX A;  3DTE A;  4JF4 A;  1F98 A;  4OPY A;  3HUN A;  5GLA A;  4FUW A;  2DCF A;  3DAV A;  3UME A;  3A3I A;  1NRJ A;  1G28 A;  3IQA A;  2VKS A;  3WS2 A;  3UPP A;  2J8Y A;  5DFY A;  4YOF A;  1UWP X;  2L4R A;  5FAQ A;  3E2L A;  1KGE A;  3D3O A;  3OC2 A;  2J80 A;  3GTC A;  2I9V A;  3S22 A;  4UA6 A;  5HD3 A;  2BLS A;  3RFB A;  3BY8 A;  3K2N A;  1N9O A;  5L09 A;  4PKY G;  1XJ2 A;  2WUQ A;  5L8M A;  2HJE A;  4G3W A;  3NOU C;  3HLF A;  1K55 C;  3MR0 A;  5EOE A;  2EX6 A;  2W3F A;  3IF6 B;  1K56 D;  4OON A;  1CK3 A;  3VOL A;  4HNB A;  3JYI A;  4R3A A;  3ISG A;  1OT6 A;  2X71 A;  2JE5 A;  3MZE A;  4BLM A;  4EES A;  4CPK A;  3KYE A;  5EFW A;  2W1R A;  2XEP A;  1IYS A;  2AVX A;  4EU0 A;  3VE4 A;  3A3D A;  3A0R A;  1FCO A;  4LRX C;  1KE3 A;  4R4S A;  4S2I A;  4OQ0 A;  2ZD8 A;  1S0W A;  4IVK A;  4UQI S;  3G6O A;  4GLQ A;  2Y4A A;  4RVA A;  3TOI A;  5EM0 A;  3UB7 A;  1XXM A;  1KDS A;  4EWF A;  5FI7 A;  2XRO A;  2Y2O A;  4S2J A;  3VP4 A;  2ZMF A;  5GLD A;  3CUE C;  3PBO A;  3GMW A;  4NEE D;  2XQZ A;  3NC8 A;  4ZBE A;  4YNR A;  3E4O A;  3TW8 A;  4KQD A;  3SH7 A;  5MC7 A;  1BT5 A;  5F6A A;  3L9K A;  1ACF A;  2IWC A;  4HH3 A;  2EX2 A;  4Y0T A;  1PI4 A;  1TF1 A;  4ARZ A;  1NRF A;  2P74 A;  2VGK A;  3F1N A;  4HBU A;  2J3T C;  3IXB A;  3HLG A;  2EWW A;  4LGW A;  3ITB A;  1KGF A;  1JWP A;  4R3J A;  1W8Y A;  3OPL A;  1VQQ A;  4Z9Q A;  3RJU A;  3S7N A;  4E3L A;  2L1M A;  4XXR A;  2W0N A;  2CC1 A;  5M19 A;  5EVE A;  4WEL A;  1YPR A;  4WZ5 A;  2XA7 S;  3ZNY A;  4F94 A;  4NXE A;  3M2K A;  1IYQ A;  4QHC A;  3GQZ A;  1M6K A;  3BEC A;  4MBH A;  5FQM A;  2QZ6 A;  1I5Q A;  4KZ3 A;  3MZF A;  1A0K A;  4DE2 A;  2Y2Q A;  5DVA A;  4GNU A;  2Z6C A;  1P9W A;  2BG1 A;  2J3T D;  3EOI A;  3CPT B;  3ZVW A;  2R9X A;  4ZJ3 A;  3LI9 A;  3UB9 A;  4RYE A;  4D60 A;  3VOZ A;  4HEF A;  1IEM A;  3BLS A;  4BD1 A;  4P85 A;  3EGD C;  5AQ9 A;  4RX2 A;  3BFE A;  2JN7 A;  3M6B A;  4WN5 A;  4ZJ1 A;  2JKR I;  3CG5 A;  4HIA A;  1VEU B;  3SH9 A;  2WKQ A;  5CTN A;  1Q2P A;  3GSG A;  3UE1 A;  2JKG A;  2ZLY A;  3UO9 A;  2HP6 A;  5FL3 A;  1WA9 A;  2C6W B;  2O99 A;  4BBU A;  4WYY A;  4CLC C;  4Y7P A;  3B33 A;  5HDS A;  3QP4 A;  4ESP A;  4QWO A;  4EQ1 A;  4GJ4 A;  1PWD A;  1J3W A;  2JKF A;  2XR0 A;  3FV7 A;  3VP2 A;  1GCE A;  4RX3 A;  2VK3 A;  3ZDJ A;  3CAX A;  3LID A;  1W79 A;  4IHQ A;  2HDS A;  5DTS A;  5HAR A;  5TFQ A;  3ZG9 B;  3CZD A;  1YAX A;  4GN2 A;  1ESI A;  3D9Y A;  3ZCZ A;  3BEB A;  4EBN A;  4QY6 A;  4KG2 A;  5EPH A;  3MQO A;  1SZV A;  2HP9 A;  2OOL A;  2XK1 A;  3W8K A;  2Y8H A;  4S2O A;  1DP9 A;  3ZNT A;  2ZM2 A;  3QP8 A;  4EER A;  4ETX A;  1CQA A;  3V67 A;  4C3Q A;  5AQA A;  2P08 A;  3UN7 A;  5GL9 A;  4WMC A;  3OOV A;  1S1Z A;  2V8C A;  4CLC D;  3LGO A; 
#chains in the Genus database with same CATH homology
 1A0K A;  3T1S A;  1PNE A;  1CJF A;  1D1J A;  3CPT B;  1K0K A;  1SKO B;  4FUW A;  3NUL A;  5EM0 A;  3UB5 P;  4X1L A;  3DAV A;  4D60 A;  1F2K A;  4FTX A;  1HLU P;  1PFL A;  2PAV P;  1VEU A;  4X1M A;  1PRQ A;  2ZL1 A;  1VEU B;  4X25 A;  3L9K A;  2JKG A;  1ACF A;  3T1R A;  5FDS A;  5EV0 A;  3T1X A;  2V8F A;  1VET A;  3T12 B;  1CF0 A;  4ESP A;  4QWO A;  3CHW P;  2PBD P;  1J3W A;  2JKF A;  2HZ5 A;  2VK3 A;  5EM1 A;  5FEG A;  5FEF A;  1Z09 A;  2ACG A;  2ZL1 B;  3D9Y A;  2BTF P;  3CPT A;  2E8J A;  1FIK A;  1SKO A;  3MSH A;  1SZV A;  5EVE A;  2B95 A;  3U4L P;  3T1Q B;  1YPR A;  1AWI A;  3KYE A;  1CQA A;  1VET B;  3MS6 A;  1FIL A;  2PRF A;  3NEC A;  1G5U A;  3L7H A;  3LEQ A;  2V8C A;  1Y4O A;  3LGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...