3G31A

Ctx-m-9 class a beta-lactamase complexed with compound 4 (gf1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
b'TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g31A00
3QNBA 4K0WA 4KZ7A 1FOFA 4OP5A 1MKIA 4MBFA 1CI8A 1IYQA 2J9PA 2ZJ9A 3UPNA 1K38A 2GDNA 5FSRA 3CJMA 4JF4A 4BL2A 1LL9A 4Y0UA 1PWGA 5CRFA 1LL5A 1S0WA 2IWDA 1FCMA 5EUAA 4E3NA 4MEZA 5D3OA 4E3IA 4EV4A 3FKVA 1IYOA 3VFHA 4KZ8A 4EBNA 4PM5A 2JC7A 2Y2OA 3ZFZA 5DTKA 1SDEA 4S2MA 2XFSA 3S1YA 3PBOA 1S6RA 5EVIB 2ZC4B 1FSYA 1K4EA 4QB8A 3UE0A 1CEGA 1CK3A 5GHYA 3PTEA 1YQSA 1E25A 2Q9NA 5FQKA 5M1AA 4BLMA 2HP9A 1PW8A 2QPNA 2HP6A 1K6SA 1EI5A 1J9MA 1IKIA 4YFMA 1W8YA 4KZ6A 1XA7A 1K55A 4KQRA 4OPQA 4X53A 3VP0A 1L0FA 4S2LA 3IHAA 1MWRA 4HESA 1JWPA 3C5AA 4GDBA 3MFDA 2WZZA 4S2KA 5DTSA 3HLGA 2EX2A 3PAEA 1EWZA 3PBNA 1FR6A 4U0TA 5FASA 4MBHA 5TR7A 4GKUA 5FATA 1K57A 1MPLA 4WMCD 3C7VA 3VSKA 3IXDA 4UA9A 5DTTA 3WRZA 3BEBA 3BFEA 1TDLA 2ZQ8A 3LEZA 1TVFA 4WM9A 1XP4A 4B4XA 4BD1A 4GNUA 2P9VB 4OQHA 5M19A 1GHPA 2EXAA 5I94A 3HREA 4E6WA 2WK0A 2Y2QA 4JXGA 3C7UA 3Q7VA 2UWXA 1GCEA 3HUOA 4DE0A 3WS4A 5FA7A 1ES4A 2QZ6A 3HVFA 1LLBA 2WGVA 3GV9A 3ZCZA 3NDEA 3LY3A 4KZAA 3ZG0A 1YLWA 3PBTA 2EX9A 2WGIA 1E4DA 3MZEA 1ONGA 2VGJA 2Z2LB 3ZGAB 4K91A 4Y0TA 4OQIA 3MKFA 1CI9A 4JXVA 3SS5A 2H0TA 4BL3A 3GRJA 1XGIA 1NJ4A 1TEMA 3M6BA 3FZCA 3PBRA 1C3BA 1W7FA 4UA7A 5DF7A 2XEPA 2XDMA 3DTMA 4GD6A 4HEFA 5M18A 1QMFA 5E43A 3G2ZA 2J8YA 2JBFA 1KVMA 1N4OA 3VOYA 2Y2LA 3HLDA 3FYZA 5F1GA 5HARA 2BG1A 2WGWB 3CMZA 4KG2A 3IF6A 3OC2A 3GQZA 4QU3A 3DWZA 4ZJ3A 1VQQA 4JF6A 3QNCA 4IBRA 1YMXA 3IF6C 1ALQA 3ZVWA 1HD8A 3M2KA 1ZC2A 1XXMA 1DJCA 4LV1A 5EVID 2C5WB 4DDYA 2Q9MA 3FKWA 4X6TA 4EUZA 4KZ4A 5EPHA 3TOIA 3BECA 1MWSA 1OMEA 3MXRA 3UN7A 1G6AA 5CGSA 5FI6A 3MZDA 3ZVTA 4OH0A 2EXBA 3IWOA 2A49A 3M2JA 5HAQA 3ZDJA 1O7EA 2ZC6B 5AQ9A 2Y2KA 4Z9QA 1KE0A 4ZTKA 3NC8A 5FI7A 2ZQ9A 3AGFA 2WAFA 5FQQA 1N9BA 4ZDXA 3HBRA 3GSGA 3VP2A 4N1XA 3UNWA 4OQ0A 1IELA 2VGKA 5J8XA 3MBZA 1I5QA 3OPHA 3UO9A 1PZPA 4JPMA 5CEBA 1H8YA 3HUMA 4BD0A 5E2GA 3ITBA 1MXOA 2XK1A 4QD4A 3O3VA 2B5RA 4FH4A 3G35A 2EFUA 2HDUA 4BJPA 1H8ZA 1YLTA 4E3KA 3BRMA 3NCKA 3B3XA 2A3UA 3IQAA 1KGFA 3NBLA 2R9WA 3VSLA 4EQIA 1DJBA 1KGEA 3A3EA 1M40A 2Y2HA 2DCFA 5CTMA 5IHVA 2Y4AA 1SCWA 4PM9A 3UDFA 3UPPA 2PBYA 3SS3A 1PWCA 1QMEA 2OSUA 3M6HA 1MY8A 3MZFA 1YLPA 1YLJA 4KENB 2XGNA 1W8QA 3MKEA 4N92A 5GHZA 1SHVA 5HX9A 5F1FA 3OPPA 3ZG7B 4LV3A 3V50A 2EX8A 4GB7A 1FQGA 1PI4A 5FAQA 2R9XA 3FWLA 2Y2GA 5EVIA 2OV5A 1K55C 4OKPA 2WKHA 5CHUA 1MWTA 4E3LA 2QMIA 4YINA 1BLCA 4DE1A 3W4QA 1VM1A 2H5SA 2XF3A 2Y2PA 5TGFA 3OCLA 4Y7PA 5F82A 1RP5A 1XX2A 5HFOA 5A92A 5FQMA 4A5RA 2J9OA 1FCNA 1HTZA 3JYIA 4UA6A 4E6XA 5L2FA 1ESUA 1NYMA 3WS0A 1L0GA 3P98A 4C75A 4DF6A 3HLFA 1NY0A 2H0YA 1K57C 4GDNA 4OP8A 4EBPA 1M6KA 1WYBA 4UAAA 4XUZA 4BQMA 3RXWA 3DW0A 1BTLA 4E3OA 3PAGA 4N9LA 4OQGA 4U3TA 5AQ7A 3UDXA 1KE3A 1ONHA 1CEFA 1IEMA 4FH2A 5HAPA 4WZ5A 4KZ3A 1AXBA 3IH8A 1NRFA 4N9KA 4NK3A 4C6YA 4DE2A 2ZM2A 2JE5A 4E3MA 4FD8A 4DKIA 3N7WA 4NETA 4RA7A 2P9VA 4CJNA 2X71A 3O88A 1K4FA 1JTDA 4R4SA 1ES2A 4JKTA 3VFFA 2ZM0A 3OPRA 3N6IA 3UE1A 3SH7A 3V5MA 3GR2A 3VP4A 4DE3A 4FSFA 3GMWA 3BYDA 3RJUA 3UPOA 2H10A 1RGZA 2X01A 4S2PA 1YM1A 2Y2NA 1FSWA 2HDSA 5DF9A 1EROA 2Y59A 4O7DA 4P87A 3SS4A 5BOHA 1IYSA 3S22A 1NZUA 2G2WA 5F83A 3GVBA 3EQVA 4JF5A 1K6RA 5GLAA 3G30A 3UY6A 4QY5A 1SDNA 3RXXA 3N4IA 5EE8A 1FCOA 4OLDA 1H5XA 2X02A 4PM8A 3IWQA 1NYYA 2Y2JA 2WZXA 5CGWA 2IWBA 3A3DA 3ZNTA 2XFTA 2DRWA 5CHJA 4DXCA 2Z2MB 2WGWA 2HDQA 1IKGA 5GLDA 4DDSA 4QJGA 4OONA 1YLYA 2ZLYA 2ZQ7A 5EVLA 4X69A 3N8LA 2J7VA 2V1ZA 3IF5A 4RYEA 1K25A 2FFYA 2ZQCA 3BFDA 2WKIA 1ZG4A 1BZAA 2Y55A 4WMCA 3Q82A 5KSCA 4PM6A 1YMSA 4PPRA 4RX3A 4HBTA 1HVBA 3BLSA 2WAEA 1JWZA 3HL9A 5GLCA 5U47A 2ZC5B 1YT4A 1GA9A 4ID4A 2HPBA 2ZD8A 3N8SA 4MBKA 4WZ4A 3ISGA 2ZC3B 4WEJA 1IYPA 4JBFA 3IT9A 3G2YA 3HLEA 4Y0OA 1WYCA 3E2LA 1XGJA 5KZHA 1MWUA 2ZM8A 1BULA 4XXRA 4IVKA 2HP5A 4KG5A 1PW1A 1DJAA 4IEDA 5FQIA 3W4PA 4GOGA 4N1HA 3OZHA 4LCMA 4P6BA 1K54A 4S2NA 3GTCA 2RL3A 1BLHA 1LHYA 4JXSA 1PZOA 4OOYA 5CHMA 3AGEA 5G18A 2WKEA 1FR1A 3BM6A 3Q1FA 4LV0A 1RCJA 1U60A 2OLUA 1JTGA 3A3JA 3FV7A 4OOMA 4F94A 3ZG5A 4KQQA 1W5DA 5FI2A 4LENA 1GHIA 1PWDA 3VOZA 2WADA 1XKZA 3IXHA 4BENA 1L0DA 4DRTA 1I2WA 3HUNA 4QY6A 1NZOA 1PYYA 4OLGA 5KSHA 2C6WB 1JVJA 4S2OA 4OPYA 1BT5A 5HAIA 2XR0A 3NDGA 2PU4A 4R4RA 1Q2QA 5EOEA 3I7JA 4P0MA 2BLSA 1YLZA 4FCFA 1W79A 4GZBA 4R23A 5EVIC 3TSGA 4ZBEA 2ZC7A 3LO7A 2HDRA 3E2KA 3G31A 3O87A 2ZMAA 4RX2A 3EQUA 3G4PA 3WS5A 4R1GA 4R3BA 4U0XA 4R0QA 3W4OA 2G2UA 1K56D 4X68A 3ZNYA 3NIAA 1LI0A 3IXBA 3QHYA 4LV2A 4S2JA 5A93A 4R3JA 5E2FA 3NI9A 3VMAA 1BLSA 3MXSA 4XUXA 5GLBA 2XD1A 3V39A 1Q2PA 3LCEA 4IBXA 5FAOA 4KG6A 5A91A 4P85A 3SH9A 3VP1A 3Q7VB 3CG5A 3OCNA 5CEDA 3IXGA 3P09A 2ZQDA 4WZ5C 3VP3A 1JWVA 1KE4A 3HLBA 4EBLA 1ZKJA 4KZ9A 5AQBA 3Q81A 3UE3A 4KQOA 4GN2A 2CC1A 3ZHHA 1NXYA 4JLFA 4D2OA 5E2EA 1ZG6A 5GL9A 3Q07A 4X55A 5FAPA 1ERQA 3IH9A 4WBGA 5DF8A 2JCHA 3HLCA 2V20A 5HW3A 4HBUA 3LY4A 5HL1A 4OPZA 3HLWA 1E3UD 4WYYA 2P74A 4H8RA 3CZDA 5CXWA 5CERA 1SKFA 3S4XA 2XLNA 5CECA 1KDWA 2WUQA 5KMWA 3G32A 2IWCA 5CGXA 4CPKA 3W8KA 3BFCA 1ES5A 4X56A 4B88A 4WELA 5A90A 1HZOA 1Z6FA 4ZAMA 4MLLA 3IF6B 4KZBA 3SOIA 2Y2MA 5FQJA 1GA0A 3D4FA 1PIOA 2XD5A 5EOOA 1KVLA 1ES3A 3V3SA 3G34A 3BFGA 2Y91A 3ITAA 1WE4A 1DY6A 3ZG9B 3TG9A 2EFXA 3WS1A 4GD8A 2EX6A 1L2SA 2V2FF 2RCXA 4OVDA 4E3JA 2E8IA 1PI5A 1KDSA 4KZ5A 5DVAA 4ZJ2A 1MBLA 4JXWA 3C4PA 2WYXA 1LI9A 3A3FA 4OOLA 1BSGA 3WS2A 5JYPA 3PBSA 2XH9A 1I2SA 1K56A 3Q7ZA 5GHXA 3WRTA 3N8RA 4S2IA 4C3QA 1ERMA 4QHCA 4K0XA 5TFQA 3V3RA 5CTNA 1XA1A 2Y2IA 3AGDA 3IHBA 4LCLA 4UHUA 4EWFA 2DNSA 4MNRA 3PBQA 3C4OA 2OLVA 1BUEA 2PU2A 3IWIA 1Y54A 1KGGA 2XQZA 4L0LA 2I72A 4PM7A 5E2HA 2FFFB 3BLMA 3NY4A 3ZG8B 4WEKA 4Q8IA 4B4ZA 4M3KA 4RVAA 1RGYA 3BFFA 1BLPA 4DXBA 3O86A 2ZQAA 5JYOA 3UDIA 4ZJ1A 3DWKA 1GHMA 5FDHA 3A3IA 1TDGA 1XPBA 5EECA 5FQ9A 1K54C 1ESIA 4PMAA 4S2NC 5AQAA 4IVIA 1O07A 1L0EA 3WWXA 3SH8A 4OPRA 1G68A 1E3UA 3OPLA
chains in the Genus database with same CATH superfamily
4K0WA 4PKYG 1MZUA 3EOIA 4P6ZS 4NXBA 3UPNA 4Q0JA 5FSRA 2W27A 4CQHA 2UV0E 5CRFA 5HD3A 4WN5A 5DFYA 5EUAA 2HJ9C 3BY9A 5CX7A 1UGUA 1IYOA 5KIZA 2Y2OA 2YKHA 1S6RA 5EVIB 2ZC4B 3PTEA 3C2WA 2VEAA 2HP9A 4XT2B 2QPNA 2HP6A 2V1BA 1K0KA 1VETA 1J9MA 1IKIA 1NLZA 3F1NA 4HJ6A 1P9WA 1YKDA 4KQRA 4KZ6A 3NOTC 1L0FA 3IHAA 4EQ1A 2K7SA 3MFDA 3IX3A 3HLGA 2NUTC 3PBNA 5TR7A 4GKUA 5FATA 4UA9A 3WRZA 2MJ6A 4WM9A 2ACGA 3HREA 4I3JA 4JXGA 4BMWA 2UWXA 1TS8A 2PD8A 2JKRM 4KZAA 3ZG0A 2VGJA 3SS5A 3GRJA 1NJ4A 1T1CA 3M6BA 4M4XA 3E4PA 3PBRA 4GD6A 5L10A 3KYEA 3E4QA 4KG2A 3IF6A 3IS2B 3CPTB 3QNCA 2OOLA 3IF6C 1HD8A 1XXMA 1DP6A 1OTDA 3LYXA 4DJ2A 4KZ4A 1J3WA 4ZRRA 3BECA 1MWSA 1OMEA 3UN7A 5FI6A 3MZDA 2EXBA 3IWOA 5AQ9A 2Y2KA 3EGDC 4ZTKA 3S7PA 2ZQ9A 4ZDXA 1UWPX 3GSGA 2D02A 4NEED 2B95A 3UNWA 4OQ0A 5J8XA 1I5QA 3OPHA 1T1AA 4MN6A 2HDUA 4BJPA 4G3WA 2V1AA 1H8ZA 3D9YA 3BRMA 3NCKA 4MN5A 4EQIA 1KGEA 5CTMA 2DCFA 2Y4AA 3UDFA 1PWCA 4N92A 5GHZA 3OPPA 4LV3A 2EX8A 4GB7A 5FAQA 1OTBA 2Y79A 4WF0A 1W63M 5CHUA 3CWFA 4YINA 2M7UA 3OCLA 1FIKA 1RP5A 2JN7A 5FQMA 2J9OA 1HTZA 4UA6A 1NYMA 1L0GA 4DF6A 2H0YA 2XA7M 4UAAA 3T1QB 3RXWA 3G6OA 1BTLA 3PAGA 3UDXA 1KE3A 3PYPA 1IEMA 3U2AA 4R3AA 4KZ3A 1AXBA 3IH8A 4DE2A 4NK3A 3BQ8A 2PHYA 3KSFA 4E3MA 2OAQ1 3S7QA 2P9VA 4WUJA 5IT5A 5EVEA 1JTDA 2W3EA 1S1ZA 2ZM0A 3UE1A 3R4KA 3GR2A 3GMWA 3T4LA 2FZ0A 4S2PA 2W1RA 4P6ZM 1OJGA 3UB5P 3SS4A 1IYSA 3EQVA 4JF5A 5GLAA 2WKQA 4Y3IA 2X02A 2Y2JA 4RQ9A 2XFTA 3E0YA 3T12B 5GLDA 4OONA 4HH2A 1YLYA 1S66L 3R7WA 4X69A 1G28A 3QP4A 2W1TA 1K25A 2WKIA 1ZG4A 1BZAA 4HP9A 5KSCA 4RX3A 1HVBA 2WAEA 2ZC5B 4O01A 2D01A 3MF0A 1YT4A 2JKTM 2ZMFA 3N8SA 1ACFA 2PDRA 3HLEA 1WYCA 3U4LP 1XGJA 5KZHA 1G5UA 2HP5A 4KG5A 1DJAA 3OZHA 3P7NA 1BLHA 1LHYA 4JXSA 3B42A 3AGEA 5G18A 2VX8A 5FEGA 4MN7A 3BM6A 4LV0A 5FDSA 1RCJA 2OLUA 1JTGA 3A3JA 3FV7A 4OOMA 4KQQA 3JVVA 5FI2A 1PWDA 3KO6A 4KQDA 3TE8A 2WADA 1L0DA 3HUNA 1MKMA 4S2OA 3A0SA 1BT5A 2XR0A 3NDGA 4EEUA 2BLSA 1VETB 1YLZA 3F1NB 4R23A 5EVIC 1P9RA 4ZBEA 2ZC7A 3LICA 1V9ZA 5HWVA 3L7HA 4RX2A 3EQUA 5L8MA 1OT6A 2QKPA 4HJ4A 4NXEA 3NULA 3EEHA 3LCEA 4IBXA 3IXGA 2ZQDA 4QWOA 1JWVA 1KE4A 4L9FA 1ZKJA 3LIDA 5AQBA 3P01A 4KQOA 5HWWA 2VGLM 5E2EA 3VE4A 3IH9A 2JCHA 2V20A 3F1OA 3LY4A 1IFQA 5HL1A 4Q0HA 4FTXA 4WYYA 3LR5A 5CXWA 5EV0A 3GDIA 2IWCA 4CPKA 3BFCA 4UQIM 2VKSA 4HH3A 4B88A 1HZOA 4MLLA 3IF6B 2Y2MA 3D4FA 2XD5A 1D7EA 1ES3A 3BFGA 1DY6A 1LSWA 3ZG9B 5IS1A 1S1YA 3TG9A 2EX6A 1KDSA 4ZJ2A 2JHEA 1MBLA 2WYXA 1BSGA 3WS2A 3PBSA 3H7WA 4NXGA 3N8RA 1YSQA 3VOLA 2YKFA 2DNSA 3C4OA 5BOHA 1KGGA 4M3KA 2B18A 1BLPA 4ZJ1A 3DWKA 4I3IA 1GHMA 5FDHA 5FEFA 4HQAA 1K54C 4S2NC 3LEQA 4LRZE 3WWXA 1D06A 4KZ7A 4OP5A 1F98A 4Y5FA 3NJAA 1K38A 4HY8A 1FCMA 3BWLA 3L9KA 4MEZA 4E3NA 4R70A 5D3OA 4E3IA 1W63Q 4KZ8A 4EBNA 4PM5A 1SDEA 2XFSA 3S1YA 1FSYA 3UE0A 2I9VA 1CK3A 5GHYA 1YQSA 4EW7A 1SKOA 1E25A 4BLMA 5FQKA 1PW8A 1EI5A 1W8YA 4X53A 4OPQA 2JKRI 1F2KA 4CLCD 4O8GA 4HESA 2WZZA 4BBVA 4ETXA 4HOIA 2XSSA 1K57A 4WMCD 3C7VA 4LRYC 3BFEA 3CLOA 1XP4A 3E4OA 1Z09A 4B93A 2P9VB 4E6WA 3TJZC 4BBUA 1GCEA 3WS4A 1LLBA 1YLWA 4NKPA 4Z1WA 2CMNA 1S67L 3ZGAB 4Y0TA 4K91A 3MKFA 1CI9A 3S7NA 1XGIA 1OJ5A 3FZCA 1C3BA 4UA7A 3DTMA 4HEFA 1QMFA 5E43A 1N4OA 3ICYA 5K5BA 2VA0A 2KOIA 5F1GA 2W3DA 1NRJA 3OC2A 3GQZA 1EW0A 4JF6A 3R7WB 1YMXA 1ALQA 5HDSA 1NWZA 5J3WA 1DP8A 2W1TB 1DJCA 4F3LA 2PRFA 1HLUP 4DDYA 1XFQA 1TS6A 3UMDA 2HF6A 4EUZA 1TF1A 5C5KA 1PFLA 5IU1A 3TOIA 2KDKA 1WA9A 1G6AA 3ZVTA 4OH0A 4LGWA 1H0MA 1O7EA 1KE0A 3NC8A 5FI7A 5F5YA 1SZVA 5FQQA 1N9BA 3HBRA 3DAVA 5HWTA 4L9EA 2KLIA 5HPFA 4G3VA 4X25A 2OWJA 4JPMA 5CEBA 3HUMA 3IX4A 2K31A 2V8FA 4ETZA 1YLTA 3B3XA 2A3UA 3IQAA 1KGFA 3LGOA 3NBLA 3SS3A 3MZFA 3M6HA 4I38A 2A24A 4KENB 3C38A 1FQGA 1PI4A 3FWLA 2Y2GA 2OV5A 3VE3A 1P0ZA 2PT7A 3NHQA 2WKHA 4DE1A 3W4QA 1VM1A 1XFNA 2H5SA 2Y2PA 5HPIA 5A92A 4A5RA 5L2FA 1FCNA 3JYIA 1ESUA 4C75A 3OBFA 3P98A 3HLFA 4EBPA 1M6KA 3MJQA 4IUKA 4U3TA 4OQGA 1ONHA 3DTEA 3F1OB 4WZ5A 4N9KA 2ZM2A 3BQAA 2Z6DA 4DKIA 4RA7A 4CJNA 3O88A 4O0PA 4G3KA 3OPRA 3V5MA 3D72A 3CUEA 4Y2FA 3BYDA 1OTIA 3UPOA 2H10A 1YAXA 1YM1A 1FSWA 3CUEC 4BWIA 5DF9A 4P87A 4AFIA 1NZUA 3GVBA 3B47A 3UY6A 2JKTI 3N4IA 3LR4A 1FCOA 3LI9A 1H5XA 3T4KA 3QP1A 3ZNTA 2WZXA 3H7WB 2GJ3A 3RTYA 4NXFA 2PBDP 4K08A 1VB6A 2GNXA 2Z2MB 4R6LA 2WGWA 5G4YA 2L0WA 2J3TD 3EWKA 2LB9A 2ZLYA 2ZQ7A 2J7VA 3OLOA 5A8BA 4RYEA 3NOPC 3Q82A 1YMSA 3HL9A 4WLAA 5GLCA 3S7OA 3BJNA 3ZYTA 1DP9A 1GA9A 1V9YA 2HPBA 2ZD8A 4WZ4A 4EU0A 3ISGA 4WEJA 3IT9A 3KSIA 3W2ZA 3E2LA 4BBTA 4IVKA 2L1MA 3W4PA 3T1XA 2JKGA 4FOFA 4P6BA 4DN0A 3GTCA 3MFXA 1NLYA 1FR1A 3KX0X 3Q1FA 3ZG5A 3UB6A 4LENA 3IXHA 4BENA 2QJ5A 2C6WB 4OPYA 1SKOB 3NOUC 5EOEA 4GZBA 5HZHA 4GCZA 3D3OA 3G31A 3O87A 2JKFA 2PYRA 1K56D 3NIAA 3IXBA 4LV2A 4S2JA 5A93A 3VMAA 3ULFA 5HD5A 1Q2PA 4KG6A 5CEDA 3VP3A 4IHQA 1F5MA 2ZBBA 4I5SA 3UB9A 3ZHHA 4D2OA 1ERQA 4EUVA 2IA2A 3HLWA 1E3UD 2P7JA 2P74A 2WUQA 5KMWA 3G32A 5CGXA 3EEAA 4X56A 4ZAMA 1XJ4A 5DKLA 5FQJA 3G34A 3ITAA 4F3LB 2ZL1A 2EFXA 3WS1A 2V2FF 1L2SA 3C30A 2ZOIA 4LLOB 1PI5A 4KZ5A 1GSWA 4JXWA 3C4PA 4OOLA 1K56A 5GHXA 3WRTA 4ARZA 4S2IA 2A2LA 3CHWP 1H8MA 4MMNA 2VV7A 1XA1A 2Y2IA 4GW9A 2GX5A 4NG2A 3IWIA 4L0LA 4PM7A 4Q8IA 5E2HA 3BLMA 2AVXA 1XJ6A 1RGYA 3IBJA 2ZQAA 3UDIA 3T4OA 5F6AA 3MS6A 5EECA 5FQ9A 1ESIA 4PMAA 1CQAA 2P04A 4D60A 1E3UA 5LBRA 1TD5A 3QNBA 1FOFA 4MBFA 1CI8A 2ZJ9A 2GDNA 4YWZA 1LL9A 1PWGA 1LL5A 1S0WA 2K2NA 2A24B 3VFHA 2JC7A 3UE6A 4S2MA 3PBOA 4QB8A 1CEGA 4IJGA 2Q9NA 1MC0A 4LPZA 1DRMA 1K55A 4HIAA 4LRXC 3C5AA 4GDBA 2HV1A 4I39A 5MC7A 1BYWA 1EWZA 1FR6A 4EESA 5FASA 1L3LA 3VSKA 3BEBA 5HAPA 1TDLA 2ZQ8A 3LEZA 1TVFA 4BD1A 2OAP1 4OQHA 5M19A 1GHPA 5I94A 3CI6A 2WK0A 4EXOA 1ES4A 3HVFA 2WGVA 3GV9A 3NDEA 3LY3A 2VJWA 3PBTA 2EX9A 2WGIA 4UEYA 1E4DA 5AVEA 2O9AA 2KX6A 2XEPA 4H6JA 3SW1A 3DTIA 2J3WA 3G2ZA 2JBFA 3VOYA 4GLQA 5F69A 3FYZA 2WGWB 4ZJ3A 4IBRA 2O9BA 1ZC2A 3A0RA 2C5WB 4WL9A 3LIAA 2Q9MA 4X6TA 4YNRA 5CGSA 3LIBA 2ZC6B 4PAUA 2WAFA 3IX8A 1IELA 3MBZA 3UO9A 1PZPA 1H8YA 2VV6A 5E2GA 3ITBA 1MXOA 2XK1A 3O3VA 2B5RA 4GS9A 3JVUA 2R9WA 1VHMA 1M40A 5IHVA 3MQQA 1SCWA 4PM9A 2BASA 3UPPA 2PBYA 1QMEA 1MY8A 1YLJA 5F1FA 2XGNA 3MKEA 1SHVA 5HX9A 3ZG7B 2BTFP 2R9XA 1LL8A 3T1RA 4E3LA 3KSHA 2J80A 3GECA 2V0WA 5TGFA 3MQ0A 5F82A 1T18A 2EWVA 1NY0A 1K57C 3KSGA 2O99A 1WYBA 4XUZA 4N9LA 5AQ7A 3T50A 1CEFA 4JGOA 1IOUA 1NRFA 4FD8A 3N7WA 4NETA 1CJFA 2X71A 1K4FA 4JKTA 3RH8B 3HJIA 3VP4A 4DE3A 4FSFA 3RJUA 1RGZA 2X01A 2QJ7A 3JPUA 2HDSA 5AJGA 1EROA 2Y59A 1STZA 4O7DA 3O5YA 3ZQ5A 2ZL1B 2PYPA 2QYBA 3QP5A 3DBAA 2G2WA 5F83A 1ZTUA 3G30A 4QY5A 1N9OA 4PM8A 4JGRA 1XJ2A 2IWBA 3PHYA 4CLCA 4ARZB 5TBMA 4DXCA 4CLCC 4HNBA 1IKGA 4DDSA 5EVLA 4WMCA 3BFDA 2ZQCA 2NUPC 1N9NA 4PPRA 4HBTA 3BLSA 3HJKA 3T4TA 1JWZA 4YOFA 2W3GA 4ID4A 4MBKA 4HJ3A 2Q0OA 3LR0A 3G2YA 4Y0OA 1MWUA 4IEDA 5FQIA 4N1HA 1UWNX 3T4QA 1PZOA 5CHMA 2R78A 1U60A 4F94A 2GZAA 1GHIA 1I2WA 4QY6A 1PYYA 5KSHA 1VEUA 1JVJA 2L4RA 2PU4A 3K2NA 3FG8A 4R4RA 3I7JA 4P0MA 4R38A 3TSGA 2HDRA 2ZMAA 2PR6A 3G4PA 3WS5A 4R3BA 3B33A 3W4OA 1LI0A 1LT0A 4KUKA 3QHYA 2O0YA 4R3JA 2W3HA 5E2FA 4II7A 3NI9A 3SH9A 4P85A 4WZ5C 3P09A 3HLBA 4EBLA 3VV4A 3LIEA 2HJEA 3UE3A 4DMZA 4GN2A 3TW8A 2CC1A 3Q07A 3OOVA 5FAPA 4WBGA 5HW3A 3HLCA 4HBUA 4OPZA 2HZ5A 3FPVA 4H6JB 1KDWA 3EGXC 3W8KA 1ES5A 2G7UA 4WELA 2FH5A 4HHDA 3SOIA 3CAXA 1GA0A 3SZTA 3V3SA 1WE4A 1PRQA 5EM0A 4GD8A 2E8IA 3H82A 5JYPA 2O9CA 3K3CA 4JGPA 4C3QA 1ERMA 4QHCA 5CTNA 4UHUA 3IHBA 4LCLA 2QHKA 3PBQA 2PU2A 2FFFB 3NY4A 3UMEA 3CITA 4WEKA 4B4ZA 2V0UA 4RVAA 2WKRA 3O86A 5JYOA 2EA9A 5FL3A 3MSHA 4LFUA 3A3IA 1TDGA 5F68A 1AWIA 3LIFA 5AQAA 4IVIA 2VGLS 1O07A 1L0EA 3SH8A 1G68A 4GS9B 3OPLA 1MKIA 1N9LA 4Y13A 1IYQA 2J9PA 3CJMA 2M7VA 1T19A 4JF4A 4BL2A 4Y0UA 2H28A 2IWDA 3BY8A 4UQIS 4EV4A 3FKVA 3ZFZA 1P97A 5DTKA 1K4EA 2B02A 5M1AA 1XJ3A 2J3TC 1K6SA 4YFMA 1XA7A 3VP0A 4S2LA 1MWRA 1JWPA 2QWSA 4S2KA 5DTSA 2EX2A 3PAEA 4U0TA 4MBHA 4EETB 1MPLA 4HP4A 3IXDA 5DTTA 4B4XA 1TS0A 3MQOA 4GNUA 1LSXA 1FILA 2Y8HA 2EXAA 4MCWA 1G6OA 2Y2QA 3QP6A 3T4JA 3C7UA 3E98A 3Q7VA 3HUOA 4DE0A 2PAVP 2QZ6A 5FA7A 3ZCZA 3MZEA 3F1PA 1ONGA 2Z2LB 3QP2A 4OQIA 4JXVA 2H0TA 4BL3A 3UB7A 1TEMA 5EFWA 2XROA 4KUOA 1W7FA 5DF7A 5AVFA 2XDMA 4Y15A 5M18A 4PKYA 3C8CA 1F9IA 2J8YA 1KVMA 4CLCB 2Y2LA 3HLDA 5TBMB 5TJJA 4MDZA 5HARA 2BG1A 3CMZA 4QU3A 3DWZA 1VQQA 4FUWA 3ZVWA 3M2KA 4LV1A 5EVID 2VV8A 4GJ4A 3FKWA 5EPHA 2V8CA 3MXRA 1LSVA 2A49A 3M2JA 5HAQA 3ZDJA 4Z9QA 4GHIA 1ZHHB 3AGFA 2E8JA 3VP2A 4N1XA 5I5LA 2VGKA 3MR0A 4BD0A 4QD4A 1Y28A 3PR6A 4FH4A 3G35A 1VEUB 2EFUA 4E3KA 2VK3A 3VSLA 1DJBA 1CF0A 3A3EA 2Y2HA 2OSUA 3BW6A 1YLPA 1W8QA 3IBRA 3V50A 5EVIA 1K55C 4OKPA 1MWTA 3LFVA 2QMIA 1BLCA 2XF3A 1GSXA 4XT2A 4Y7PA 3H9WA 1XX2A 5HFOA 4ESPA 4E6XA 3K3DA 3WS0A 4GDNA 4OP8A 4EEPA 3QP8A 4BQMA 3KYQA 3DW0A 4E3OA 3FC7A 1T1BA 4FH2A 5DJUA 2W0NA 4C6YA 2JE5A 3TRCA 3VFFA 4R4SA 1ES2A 3N6IA 1YSPA 3SH7A 3RFBA 2Y2NA 3MMHA 3UB8A 4L9GA 4PHTA 3S22A 5EM1A 1K6RA 3RXXA 1SDNA 5EE8A 3H82B 4OLDA 3IWQA 1NYYA 5CGWA 3A3DA 2DRWA 5CHJA 2HDQA 4JGQA 1H3QA 3IS2A 4QJGA 3CPTA 3KYZA 3A0VA 3N8LA 3IF5A 2V1ZA 5L09A 2FFYA 2Y55A 4I3AA 4PM6A 5G4ZA 2WKPA 5U47A 2VLGA 1TS7A 2EWWA 1OT9A 2ZC3B 1IYPA 4JBFA 2ZM8A 1BULA 4XXRA 1PW1A 3V67A 4GOGA 3LUQA 4LCMA 1KOUA 1K54A 4S2NA 2RL3A 4OOYA 1ODVA 2WKEA 1JNUA 5HDDA 1W5DA 4X1MA 2Z6CA 3VOZA 1XKZA 4DRTA 1S4SA 1NZOA 4OLGA 5HAIA 3MXQA 1Q2QA 2OWHA 3FPWA 4EERA 4FCFA 1W79A 3LO7A 3E2KA 5L07A 2VZWA 4R1GA 4U0XA 4R0QA 2G2UA 4X68A 3ZNYA 2XRNA 1BLSA 5HDCA 3MXSA 4XUXA 5GLBA 2XD1A 3V39A 5HL6A 5A91A 5FAOA 3VP1A 3Q7VB 3CG5A 3OCNA 1YPRA 4QPRA 4KZ9A 3Q81A 4CLCE 5J4EA 2HGVA 1NXYA 3F1PB 4JLFA 1ZG6A 5GL9A 4X55A 3T1SA 5DF8A 3NECA 3DTKA 2V9AA 4ME4A 4H8RA 3CZDA 5CERA 2INWA 1SKFA 3S4XA 2XLNA 5CECA 1PNEA 1S4RA 1Y4OA 5DKKA 3PXPA 4Q0IA 5A90A 1Z6FA 4KZBA 1OTEA 2ZMVA 5EOOA 1PIOA 2ZOHA 4E04A 5HSQA 1KVLA 1X0OA 2Y91A 3LI8A 1OTAA 4HI4A 2RCXA 4OVDA 3T4SA 4E3JA 5DVAA 4Y17A 2PD7A 1LI9A 3A3FA 5DFXA 2XH9A 1I2SA 3Q7ZA 2W3FA 3LR3A 5DJTA 4K0XA 5TFQA 3V3RA 2XA7S 3AGDA 4EWFA 4MNRA 2M1CA 4GHIB 2PR5A 5J7EA 2OLVA 1BUEA 2LB5A 1Y54A 2XQZA 2I72A 3ZG8B 3HCYA 4DJ3A 1D1JA 3BFFA 2P08A 4DXBA 2DMWA 1OPXA 4X1LA 1XPBA 4IUHA 1GSVA 4B9OA 1A0KA 4OPRA
chains in the Genus database with same CATH topology
3QNBA 4K0WA 4KZ7A 1FOFA 4OP5A 1MKIA 4MBFA 1CI8A 1IYQA 2J9PA 2ZJ9A 3UPNA 1K38A 2GDNA 5FSRA 3CJMA 4JF4A 4BL2A 1LL9A 4Y0UA 1PWGA 5CRFA 1LL5A 1S0WA 2IWDA 1FCMA 5EUAA 4E3NA 4MEZA 5D3OA 4E3IA 4EV4A 3FKVA 1IYOA 3VFHA 4KZ8A 4EBNA 4PM5A 2JC7A 2Y2OA 3ZFZA 5DTKA 1SDEA 4S2MA 2XFSA 3S1YA 3PBOA 1S6RA 5EVIB 2ZC4B 1FSYA 1K4EA 4QB8A 3UE0A 1CEGA 1CK3A 5GHYA 3PTEA 1YQSA 1E25A 2Q9NA 5FQKA 5M1AA 4BLMA 2HP9A 1PW8A 2QPNA 2HP6A 1K6SA 1EI5A 1J9MA 1IKIA 4YFMA 1W8YA 4KZ6A 1XA7A 1K55A 4KQRA 4OPQA 4X53A 3VP0A 1L0FA 4S2LA 3IHAA 1MWRA 4HESA 1JWPA 3C5AA 4GDBA 3MFDA 2WZZA 4S2KA 5DTSA 3HLGA 2EX2A 3PAEA 1EWZA 3PBNA 1FR6A 4U0TA 5FASA 4MBHA 5TR7A 4GKUA 5FATA 1K57A 1MPLA 4WMCD 3C7VA 3VSKA 3IXDA 4UA9A 5DTTA 3WRZA 3BEBA 3BFEA 1TDLA 2ZQ8A 3LEZA 1TVFA 4WM9A 1XP4A 4B4XA 4BD1A 4GNUA 2P9VB 4OQHA 5M19A 1GHPA 2EXAA 5I94A 3HREA 4E6WA 2WK0A 2Y2QA 4JXGA 3C7UA 3Q7VA 2UWXA 1GCEA 3HUOA 4DE0A 3WS4A 5FA7A 1ES4A 2QZ6A 3HVFA 1LLBA 2WGVA 3GV9A 3ZCZA 3NDEA 3LY3A 4KZAA 3ZG0A 1YLWA 3PBTA 2EX9A 2WGIA 1E4DA 3MZEA 1ONGA 2VGJA 2Z2LB 3ZGAB 4K91A 4Y0TA 4OQIA 3MKFA 1CI9A 4JXVA 3SS5A 2H0TA 4BL3A 3GRJA 1XGIA 1NJ4A 1TEMA 3M6BA 3FZCA 3PBRA 1C3BA 1W7FA 4UA7A 5DF7A 2XEPA 2XDMA 3DTMA 4GD6A 4HEFA 5M18A 1QMFA 5E43A 3G2ZA 2J8YA 2JBFA 1KVMA 1N4OA 3VOYA 2Y2LA 3HLDA 3FYZA 5F1GA 5HARA 2BG1A 2WGWB 3CMZA 4KG2A 3IF6A 3OC2A 3GQZA 4QU3A 3DWZA 4ZJ3A 1VQQA 4JF6A 3QNCA 4IBRA 1YMXA 3IF6C 1ALQA 3ZVWA 1HD8A 3M2KA 1ZC2A 1XXMA 1DJCA 4LV1A 5EVID 2C5WB 4DDYA 2Q9MA 3FKWA 4X6TA 4EUZA 4KZ4A 5EPHA 3TOIA 3BECA 1MWSA 1OMEA 3MXRA 3UN7A 1G6AA 5CGSA 5FI6A 3MZDA 3ZVTA 4OH0A 2EXBA 3IWOA 2A49A 3M2JA 5HAQA 3ZDJA 1O7EA 2ZC6B 5AQ9A 2Y2KA 4Z9QA 1KE0A 4ZTKA 3NC8A 5FI7A 2ZQ9A 3AGFA 2WAFA 5FQQA 1N9BA 4ZDXA 3HBRA 3GSGA 3VP2A 4N1XA 3UNWA 4OQ0A 1IELA 2VGKA 5J8XA 3MBZA 1I5QA 3OPHA 3UO9A 1PZPA 4JPMA 5CEBA 1H8YA 3HUMA 4BD0A 5E2GA 3ITBA 1MXOA 2XK1A 4QD4A 3O3VA 2B5RA 4FH4A 3G35A 2EFUA 2HDUA 4BJPA 1H8ZA 1YLTA 4E3KA 3BRMA 3NCKA 3B3XA 2A3UA 3IQAA 1KGFA 3NBLA 2R9WA 3VSLA 4EQIA 1DJBA 1KGEA 3A3EA 1M40A 2Y2HA 2DCFA 5CTMA 5IHVA 2Y4AA 1SCWA 4PM9A 3UDFA 3UPPA 2PBYA 3SS3A 1PWCA 1QMEA 2OSUA 3M6HA 1MY8A 3MZFA 1YLPA 1YLJA 4KENB 2XGNA 1W8QA 3MKEA 4N92A 5GHZA 1SHVA 5HX9A 5F1FA 3OPPA 3ZG7B 4LV3A 3V50A 2EX8A 4GB7A 1FQGA 1PI4A 5FAQA 2R9XA 3FWLA 2Y2GA 5EVIA 2OV5A 1K55C 4OKPA 2WKHA 5CHUA 1MWTA 4E3LA 2QMIA 4YINA 1BLCA 4DE1A 3W4QA 1VM1A 2H5SA 2XF3A 2Y2PA 5TGFA 3OCLA 4Y7PA 5F82A 1RP5A 1XX2A 5HFOA 5A92A 5FQMA 4A5RA 2J9OA 1FCNA 1HTZA 3JYIA 4UA6A 4E6XA 5L2FA 1ESUA 1NYMA 3WS0A 1L0GA 3P98A 4C75A 4DF6A 3HLFA 1NY0A 2H0YA 1K57C 4GDNA 4OP8A 4EBPA 1M6KA 1WYBA 4UAAA 4XUZA 4BQMA 3RXWA 3DW0A 1BTLA 4E3OA 3PAGA 4N9LA 4OQGA 4U3TA 5AQ7A 3UDXA 1KE3A 1ONHA 1CEFA 1IEMA 4FH2A 5HAPA 4WZ5A 4KZ3A 1AXBA 3IH8A 1NRFA 4N9KA 4NK3A 4C6YA 4DE2A 2ZM2A 2JE5A 4E3MA 4FD8A 4DKIA 3N7WA 4NETA 4RA7A 2P9VA 4CJNA 2X71A 3O88A 1K4FA 1JTDA 4R4SA 1ES2A 4JKTA 3VFFA 2ZM0A 3OPRA 3N6IA 3UE1A 3SH7A 3V5MA 3GR2A 3VP4A 4DE3A 4FSFA 3GMWA 3BYDA 3RJUA 3UPOA 2H10A 1RGZA 2X01A 4S2PA 1YM1A 2Y2NA 1FSWA 2HDSA 5DF9A 1EROA 2Y59A 4O7DA 4P87A 3SS4A 5BOHA 1IYSA 3S22A 1NZUA 2G2WA 5F83A 3GVBA 3EQVA 4JF5A 1K6RA 5GLAA 3G30A 3UY6A 4QY5A 1SDNA 3RXXA 3N4IA 5EE8A 1FCOA 4OLDA 1H5XA 2X02A 4PM8A 3IWQA 1NYYA 2Y2JA 2WZXA 5CGWA 2IWBA 3A3DA 3ZNTA 2XFTA 2DRWA 5CHJA 4DXCA 2Z2MB 2WGWA 2HDQA 1IKGA 5GLDA 4DDSA 4QJGA 4OONA 1YLYA 2ZLYA 2ZQ7A 5EVLA 4X69A 3N8LA 2J7VA 2V1ZA 3IF5A 4RYEA 1K25A 2FFYA 2ZQCA 3BFDA 2WKIA 1ZG4A 1BZAA 2Y55A 4WMCA 3Q82A 5KSCA 4PM6A 1YMSA 4PPRA 4RX3A 4HBTA 1HVBA 3BLSA 2WAEA 1JWZA 3HL9A 5GLCA 5U47A 2ZC5B 1YT4A 1GA9A 4ID4A 2HPBA 2ZD8A 3N8SA 4MBKA 4WZ4A 3ISGA 2ZC3B 4WEJA 1IYPA 4JBFA 3IT9A 3G2YA 3HLEA 4Y0OA 1WYCA 3E2LA 1XGJA 5KZHA 1MWUA 2ZM8A 1BULA 4XXRA 4IVKA 2HP5A 4KG5A 1PW1A 1DJAA 4IEDA 5FQIA 3W4PA 4GOGA 4N1HA 3OZHA 4LCMA 4P6BA 1K54A 4S2NA 3GTCA 2RL3A 1BLHA 1LHYA 4JXSA 1PZOA 4OOYA 5CHMA 3AGEA 5G18A 2WKEA 1FR1A 3BM6A 3Q1FA 4LV0A 1RCJA 1U60A 2OLUA 1JTGA 3A3JA 3FV7A 4OOMA 4F94A 3ZG5A 4KQQA 1W5DA 5FI2A 4LENA 1GHIA 1PWDA 3VOZA 2WADA 1XKZA 3IXHA 4BENA 1L0DA 4DRTA 1I2WA 3HUNA 4QY6A 1NZOA 1PYYA 4OLGA 5KSHA 2C6WB 1JVJA 4S2OA 4OPYA 1BT5A 5HAIA 2XR0A 3NDGA 2PU4A 4R4RA 1Q2QA 5EOEA 3I7JA 4P0MA 2BLSA 1YLZA 4FCFA 1W79A 4GZBA 4R23A 5EVIC 3TSGA 4ZBEA 2ZC7A 3LO7A 2HDRA 3E2KA 3G31A 3O87A 2ZMAA 4RX2A 3EQUA 3G4PA 3WS5A 4R1GA 4R3BA 4U0XA 4R0QA 3W4OA 2G2UA 1K56D 4X68A 3ZNYA 3NIAA 1LI0A 3IXBA 3QHYA 4LV2A 4S2JA 5A93A 4R3JA 5E2FA 3NI9A 3VMAA 1BLSA 3MXSA 4XUXA 5GLBA 2XD1A 3V39A 1Q2PA 3LCEA 4IBXA 5FAOA 4KG6A 5A91A 4P85A 3SH9A 3VP1A 3Q7VB 3CG5A 3OCNA 5CEDA 3IXGA 3P09A 2ZQDA 4WZ5C 3VP3A 1JWVA 1KE4A 3HLBA 4EBLA 1ZKJA 4KZ9A 5AQBA 3Q81A 3UE3A 4KQOA 4GN2A 2CC1A 3ZHHA 1NXYA 4JLFA 4D2OA 5E2EA 1ZG6A 5GL9A 3Q07A 4X55A 5FAPA 1ERQA 3IH9A 4WBGA 5DF8A 2JCHA 3HLCA 2V20A 5HW3A 4HBUA 3LY4A 5HL1A 4OPZA 3HLWA 1E3UD 4WYYA 2P74A 4H8RA 3CZDA 5CXWA 5CERA 1SKFA 3S4XA 2XLNA 5CECA 1KDWA 2WUQA 5KMWA 3G32A 2IWCA 5CGXA 4CPKA 3W8KA 3BFCA 1ES5A 4X56A 4B88A 4WELA 5A90A 1HZOA 1Z6FA 4ZAMA 4MLLA 3IF6B 4KZBA 3SOIA 2Y2MA 5FQJA 1GA0A 3D4FA 1PIOA 2XD5A 5EOOA 1KVLA 1ES3A 3V3SA 3G34A 3BFGA 2Y91A 3ITAA 1WE4A 1DY6A 3ZG9B 3TG9A 2EFXA 3WS1A 4GD8A 2EX6A 1L2SA 2V2FF 2RCXA 4OVDA 4E3JA 2E8IA 1PI5A 1KDSA 4KZ5A 5DVAA 4ZJ2A 1MBLA 4JXWA 3C4PA 2WYXA 1LI9A 3A3FA 4OOLA 1BSGA 3WS2A 5JYPA 3PBSA 2XH9A 1I2SA 1K56A 3Q7ZA 5GHXA 3WRTA 3N8RA 4S2IA 4C3QA 1ERMA 4QHCA 4K0XA 5TFQA 3V3RA 5CTNA 1XA1A 2Y2IA 3AGDA 3IHBA 4LCLA 4UHUA 4EWFA 2DNSA 4MNRA 3PBQA 3C4OA 2OLVA 1BUEA 2PU2A 3IWIA 1Y54A 1KGGA 2XQZA 4L0LA 2I72A 4PM7A 5E2HA 2FFFB 3BLMA 3NY4A 3ZG8B 4WEKA 4Q8IA 4B4ZA 4M3KA 4RVAA 1RGYA 3BFFA 1BLPA 4DXBA 3O86A 2ZQAA 5JYOA 3UDIA 4ZJ1A 3DWKA 1GHMA 5FDHA 3A3IA 1TDGA 1XPBA 5EECA 5FQ9A 1K54C 1ESIA 4PMAA 4S2NC 5AQAA 4IVIA 1O07A 1L0EA 3WWXA 3SH8A 4OPRA 1G68A 1E3UA 3OPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNB A;  4K0W A;  4KZ7 A;  1FOF A;  4OP5 A;  1MKI A;  4MBF A;  1CI8 A;  1IYQ A;  2J9P A;  2ZJ9 A;  3UPN A;  1K38 A;  2GDN A;  5FSR A;  3CJM A;  4JF4 A;  4BL2 A;  1LL9 A;  4Y0U A;  1PWG A;  5CRF A;  1LL5 A;  1S0W A;  2IWD A;  1FCM A;  5EUA A;  4E3N A;  4MEZ A;  5D3O A;  4E3I A;  4EV4 A;  3FKV A;  1IYO A;  3VFH A;  4KZ8 A;  4EBN A;  4PM5 A;  2JC7 A;  2Y2O A;  3ZFZ A;  5DTK A;  1SDE A;  4S2M A;  2XFS A;  3S1Y A;  3PBO A;  1S6R A;  5EVI B;  2ZC4 B;  1FSY A;  1K4E A;  4QB8 A;  3UE0 A;  1CEG A;  1CK3 A;  5GHY A;  3PTE A;  1YQS A;  1E25 A;  2Q9N A;  5FQK A;  5M1A A;  4BLM A;  2HP9 A;  1PW8 A;  2QPN A;  2HP6 A;  1K6S A;  1EI5 A;  1J9M A;  1IKI A;  4YFM A;  1W8Y A;  4KZ6 A;  1XA7 A;  1K55 A;  4KQR A;  4OPQ A;  4X53 A;  3VP0 A;  1L0F A;  4S2L A;  3IHA A;  1MWR A;  4HES A;  1JWP A;  3C5A A;  4GDB A;  3MFD A;  2WZZ A;  4S2K A;  5DTS A;  3HLG A;  2EX2 A;  3PAE A;  1EWZ A;  3PBN A;  1FR6 A;  4U0T A;  5FAS A;  4MBH A;  5TR7 A;  4GKU A;  5FAT A;  1K57 A;  1MPL A;  4WMC D;  3C7V A;  3VSK A;  3IXD A;  4UA9 A;  5DTT A;  3WRZ A;  3BEB A;  3BFE A;  1TDL A;  2ZQ8 A;  3LEZ A;  1TVF A;  4WM9 A;  1XP4 A;  4B4X A;  4BD1 A;  4GNU A;  2P9V B;  4OQH A;  5M19 A;  1GHP A;  2EXA A;  5I94 A;  3HRE A;  4E6W A;  2WK0 A;  2Y2Q A;  4JXG A;  3C7U A;  3Q7V A;  2UWX A;  1GCE A;  3HUO A;  4DE0 A;  3WS4 A;  5FA7 A;  1ES4 A;  2QZ6 A;  3HVF A;  1LLB A;  2WGV A;  3GV9 A;  3ZCZ A;  3NDE A;  3LY3 A;  4KZA A;  3ZG0 A;  1YLW A;  3PBT A;  2EX9 A;  2WGI A;  1E4D A;  3MZE A;  1ONG A;  2VGJ A;  2Z2L B;  3ZGA B;  4K91 A;  4Y0T A;  4OQI A;  3MKF A;  1CI9 A;  4JXV A;  3SS5 A;  2H0T A;  4BL3 A;  3GRJ A;  1XGI A;  1NJ4 A;  1TEM A;  3M6B A;  3FZC A;  3PBR A;  1C3B A;  1W7F A;  4UA7 A;  5DF7 A;  2XEP A;  2XDM A;  3DTM A;  4GD6 A;  4HEF A;  5M18 A;  1QMF A;  5E43 A;  3G2Z A;  2J8Y A;  2JBF A;  1KVM A;  1N4O A;  3VOY A;  2Y2L A;  3HLD A;  3FYZ A;  5F1G A;  5HAR A;  2BG1 A;  2WGW B;  3CMZ A;  4KG2 A;  3IF6 A;  3OC2 A;  3GQZ A;  4QU3 A;  3DWZ A;  4ZJ3 A;  1VQQ A;  4JF6 A;  3QNC A;  4IBR A;  1YMX A;  3IF6 C;  1ALQ A;  3ZVW A;  1HD8 A;  3M2K A;  1ZC2 A;  1XXM A;  1DJC A;  4LV1 A;  5EVI D;  2C5W B;  4DDY A;  2Q9M A;  3FKW A;  4X6T A;  4EUZ A;  4KZ4 A;  5EPH A;  3TOI A;  3BEC A;  1MWS A;  1OME A;  3MXR A;  3UN7 A;  1G6A A;  5CGS A;  5FI6 A;  3MZD A;  3ZVT A;  4OH0 A;  2EXB A;  3IWO A;  2A49 A;  3M2J A;  5HAQ A;  3ZDJ A;  1O7E A;  2ZC6 B;  5AQ9 A;  2Y2K A;  4Z9Q A;  1KE0 A;  4ZTK A;  3NC8 A;  5FI7 A;  2ZQ9 A;  3AGF A;  2WAF A;  5FQQ A;  1N9B A;  4ZDX A;  3HBR A;  3GSG A;  3VP2 A;  4N1X A;  3UNW A;  4OQ0 A;  1IEL A;  2VGK A;  5J8X A;  3MBZ A;  1I5Q A;  3OPH A;  3UO9 A;  1PZP A;  4JPM A;  5CEB A;  1H8Y A;  3HUM A;  4BD0 A;  5E2G A;  3ITB A;  1MXO A;  2XK1 A;  4QD4 A;  3O3V A;  2B5R A;  4FH4 A;  3G35 A;  2EFU A;  2HDU A;  4BJP A;  1H8Z A;  1YLT A;  4E3K A;  3BRM A;  3NCK A;  3B3X A;  2A3U A;  3IQA A;  1KGF A;  3NBL A;  2R9W A;  3VSL A;  4EQI A;  1DJB A;  1KGE A;  3A3E A;  1M40 A;  2Y2H A;  2DCF A;  5CTM A;  5IHV A;  2Y4A A;  1SCW A;  4PM9 A;  3UDF A;  3UPP A;  2PBY A;  3SS3 A;  1PWC A;  1QME A;  2OSU A;  3M6H A;  1MY8 A;  3MZF A;  1YLP A;  1YLJ A;  4KEN B;  2XGN A;  1W8Q A;  3MKE A;  4N92 A;  5GHZ A;  1SHV A;  5HX9 A;  5F1F A;  3OPP A;  3ZG7 B;  4LV3 A;  3V50 A;  2EX8 A;  4GB7 A;  1FQG A;  1PI4 A;  5FAQ A;  2R9X A;  3FWL A;  2Y2G A;  5EVI A;  2OV5 A;  1K55 C;  4OKP A;  2WKH A;  5CHU A;  1MWT A;  4E3L A;  2QMI A;  4YIN A;  1BLC A;  4DE1 A;  3W4Q A;  1VM1 A;  2H5S A;  2XF3 A;  2Y2P A;  5TGF A;  3OCL A;  4Y7P A;  5F82 A;  1RP5 A;  1XX2 A;  5HFO A;  5A92 A;  5FQM A;  4A5R A;  2J9O A;  1FCN A;  1HTZ A;  3JYI A;  4UA6 A;  4E6X A;  5L2F A;  1ESU A;  1NYM A;  3WS0 A;  1L0G A;  3P98 A;  4C75 A;  4DF6 A;  3HLF A;  1NY0 A;  2H0Y A;  1K57 C;  4GDN A;  4OP8 A;  4EBP A;  1M6K A;  1WYB A;  4UAA A;  4XUZ A;  4BQM A;  3RXW A;  3DW0 A;  1BTL A;  4E3O A;  3PAG A;  4N9L A;  4OQG A;  4U3T A;  5AQ7 A;  3UDX A;  1KE3 A;  1ONH A;  1CEF A;  1IEM A;  4FH2 A;  5HAP A;  4WZ5 A;  4KZ3 A;  1AXB A;  3IH8 A;  1NRF A;  4N9K A;  4NK3 A;  4C6Y A;  4DE2 A;  2ZM2 A;  2JE5 A;  4E3M A;  4FD8 A;  4DKI A;  3N7W A;  4NET A;  4RA7 A;  2P9V A;  4CJN A;  2X71 A;  3O88 A;  1K4F A;  1JTD A;  4R4S A;  1ES2 A;  4JKT A;  3VFF A;  2ZM0 A;  3OPR A;  3N6I A;  3UE1 A;  3SH7 A;  3V5M A;  3GR2 A;  3VP4 A;  4DE3 A;  4FSF A;  3GMW A;  3BYD A;  3RJU A;  3UPO A;  2H10 A;  1RGZ A;  2X01 A;  4S2P A;  1YM1 A;  2Y2N A;  1FSW A;  2HDS A;  5DF9 A;  1ERO A;  2Y59 A;  4O7D A;  4P87 A;  3SS4 A;  5BOH A;  1IYS A;  3S22 A;  1NZU A;  2G2W A;  5F83 A;  3GVB A;  3EQV A;  4JF5 A;  1K6R A;  5GLA A;  3G30 A;  3UY6 A;  4QY5 A;  1SDN A;  3RXX A;  3N4I A;  5EE8 A;  1FCO A;  4OLD A;  1H5X A;  2X02 A;  4PM8 A;  3IWQ A;  1NYY A;  2Y2J A;  2WZX A;  5CGW A;  2IWB A;  3A3D A;  3ZNT A;  2XFT A;  2DRW A;  5CHJ A;  4DXC A;  2Z2M B;  2WGW A;  2HDQ A;  1IKG A;  5GLD A;  4DDS A;  4QJG A;  4OON A;  1YLY A;  2ZLY A;  2ZQ7 A;  5EVL A;  4X69 A;  3N8L A;  2J7V A;  2V1Z A;  3IF5 A;  4RYE A;  1K25 A;  2FFY A;  2ZQC A;  3BFD A;  2WKI A;  1ZG4 A;  1BZA A;  2Y55 A;  4WMC A;  3Q82 A;  5KSC A;  4PM6 A;  1YMS A;  4PPR A;  4RX3 A;  4HBT A;  1HVB A;  3BLS A;  2WAE A;  1JWZ A;  3HL9 A;  5GLC A;  5U47 A;  2ZC5 B;  1YT4 A;  1GA9 A;  4ID4 A;  2HPB A;  2ZD8 A;  3N8S A;  4MBK A;  4WZ4 A;  3ISG A;  2ZC3 B;  4WEJ A;  1IYP A;  4JBF A;  3IT9 A;  3G2Y A;  3HLE A;  4Y0O A;  1WYC A;  3E2L A;  1XGJ A;  5KZH A;  1MWU A;  2ZM8 A;  1BUL A;  4XXR A;  4IVK A;  2HP5 A;  4KG5 A;  1PW1 A;  1DJA A;  4IED A;  5FQI A;  3W4P A;  4GOG A;  4N1H A;  3OZH A;  4LCM A;  4P6B A;  1K54 A;  4S2N A;  3GTC A;  2RL3 A;  1BLH A;  1LHY A;  4JXS A;  1PZO A;  4OOY A;  5CHM A;  3AGE A;  5G18 A;  2WKE A;  1FR1 A;  3BM6 A;  3Q1F A;  4LV0 A;  1RCJ A;  1U60 A;  2OLU A;  1JTG A;  3A3J A;  3FV7 A;  4OOM A;  4F94 A;  3ZG5 A;  4KQQ A;  1W5D A;  5FI2 A;  4LEN A;  1GHI A;  1PWD A;  3VOZ A;  2WAD A;  1XKZ A;  3IXH A;  4BEN A;  1L0D A;  4DRT A;  1I2W A;  3HUN A;  4QY6 A;  1NZO A;  1PYY A;  4OLG A;  5KSH A;  2C6W B;  1JVJ A;  4S2O A;  4OPY A;  1BT5 A;  5HAI A;  2XR0 A;  3NDG A;  2PU4 A;  4R4R A;  1Q2Q A;  5EOE A;  3I7J A;  4P0M A;  2BLS A;  1YLZ A;  4FCF A;  1W79 A;  4GZB A;  4R23 A;  5EVI C;  3TSG A;  4ZBE A;  2ZC7 A;  3LO7 A;  2HDR A;  3E2K A;  3G31 A;  3O87 A;  2ZMA A;  4RX2 A;  3EQU A;  3G4P A;  3WS5 A;  4R1G A;  4R3B A;  4U0X A;  4R0Q A;  3W4O A;  2G2U A;  1K56 D;  4X68 A;  3ZNY A;  3NIA A;  1LI0 A;  3IXB A;  3QHY A;  4LV2 A;  4S2J A;  5A93 A;  4R3J A;  5E2F A;  3NI9 A;  3VMA A;  1BLS A;  3MXS A;  4XUX A;  5GLB A;  2XD1 A;  3V39 A;  1Q2P A;  3LCE A;  4IBX A;  5FAO A;  4KG6 A;  5A91 A;  4P85 A;  3SH9 A;  3VP1 A;  3Q7V B;  3CG5 A;  3OCN A;  5CED A;  3IXG A;  3P09 A;  2ZQD A;  4WZ5 C;  3VP3 A;  1JWV A;  1KE4 A;  3HLB A;  4EBL A;  1ZKJ A;  4KZ9 A;  5AQB A;  3Q81 A;  3UE3 A;  4KQO A;  4GN2 A;  2CC1 A;  3ZHH A;  1NXY A;  4JLF A;  4D2O A;  5E2E A;  1ZG6 A;  5GL9 A;  3Q07 A;  4X55 A;  5FAP A;  1ERQ A;  3IH9 A;  4WBG A;  5DF8 A;  2JCH A;  3HLC A;  2V20 A;  5HW3 A;  4HBU A;  3LY4 A;  5HL1 A;  4OPZ A;  3HLW A;  1E3U D;  4WYY A;  2P74 A;  4H8R A;  3CZD A;  5CXW A;  5CER A;  1SKF A;  3S4X A;  2XLN A;  5CEC A;  1KDW A;  2WUQ A;  5KMW A;  3G32 A;  2IWC A;  5CGX A;  4CPK A;  3W8K A;  3BFC A;  1ES5 A;  4X56 A;  4B88 A;  4WEL A;  5A90 A;  1HZO A;  1Z6F A;  4ZAM A;  4MLL A;  3IF6 B;  4KZB A;  3SOI A;  2Y2M A;  5FQJ A;  1GA0 A;  3D4F A;  1PIO A;  2XD5 A;  5EOO A;  1KVL A;  1ES3 A;  3V3S A;  3G34 A;  3BFG A;  2Y91 A;  3ITA A;  1WE4 A;  1DY6 A;  3ZG9 B;  3TG9 A;  2EFX A;  3WS1 A;  4GD8 A;  2EX6 A;  1L2S A;  2V2F F;  2RCX A;  4OVD A;  4E3J A;  2E8I A;  1PI5 A;  1KDS A;  4KZ5 A;  5DVA A;  4ZJ2 A;  1MBL A;  4JXW A;  3C4P A;  2WYX A;  1LI9 A;  3A3F A;  4OOL A;  1BSG A;  3WS2 A;  5JYP A;  3PBS A;  2XH9 A;  1I2S A;  1K56 A;  3Q7Z A;  5GHX A;  3WRT A;  3N8R A;  4S2I A;  4C3Q A;  1ERM A;  4QHC A;  4K0X A;  5TFQ A;  3V3R A;  5CTN A;  1XA1 A;  2Y2I A;  3AGD A;  3IHB A;  4LCL A;  4UHU A;  4EWF A;  2DNS A;  4MNR A;  3PBQ A;  3C4O A;  2OLV A;  1BUE A;  2PU2 A;  3IWI A;  1Y54 A;  1KGG A;  2XQZ A;  4L0L A;  2I72 A;  4PM7 A;  5E2H A;  2FFF B;  3BLM A;  3NY4 A;  3ZG8 B;  4WEK A;  4Q8I A;  4B4Z A;  4M3K A;  4RVA A;  1RGY A;  3BFF A;  1BLP A;  4DXB A;  3O86 A;  2ZQA A;  5JYO A;  3UDI A;  4ZJ1 A;  3DWK A;  1GHM A;  5FDH A;  3A3I A;  1TDG A;  1XPB A;  5EEC A;  5FQ9 A;  1K54 C;  1ESI A;  4PMA A;  4S2N C;  5AQA A;  4IVI A;  1O07 A;  1L0E A;  3WWX A;  3SH8 A;  4OPR A;  1G68 A;  1E3U A;  3OPL A; 
#chains in the Genus database with same CATH topology
 4K0W A;  4PKY G;  1MZU A;  3EOI A;  4P6Z S;  4NXB A;  3UPN A;  4Q0J A;  5FSR A;  2W27 A;  4CQH A;  2UV0 E;  5CRF A;  5HD3 A;  4WN5 A;  5DFY A;  5EUA A;  2HJ9 C;  3BY9 A;  5CX7 A;  1UGU A;  1IYO A;  5KIZ A;  2Y2O A;  2YKH A;  1S6R A;  5EVI B;  2ZC4 B;  3PTE A;  3C2W A;  2VEA A;  2HP9 A;  4XT2 B;  2QPN A;  2HP6 A;  2V1B A;  1K0K A;  1VET A;  1J9M A;  1IKI A;  1NLZ A;  3F1N A;  4HJ6 A;  1P9W A;  1YKD A;  4KQR A;  4KZ6 A;  3NOT C;  1L0F A;  3IHA A;  4EQ1 A;  2K7S A;  3MFD A;  3IX3 A;  3HLG A;  2NUT C;  3PBN A;  5TR7 A;  4GKU A;  5FAT A;  4UA9 A;  3WRZ A;  2MJ6 A;  4WM9 A;  2ACG A;  3HRE A;  4I3J A;  4JXG A;  4BMW A;  2UWX A;  1TS8 A;  2PD8 A;  2JKR M;  4KZA A;  3ZG0 A;  2VGJ A;  3SS5 A;  3GRJ A;  1NJ4 A;  1T1C A;  3M6B A;  4M4X A;  3E4P A;  3PBR A;  4GD6 A;  5L10 A;  3KYE A;  3E4Q A;  4KG2 A;  3IF6 A;  3IS2 B;  3CPT B;  3QNC A;  2OOL A;  3IF6 C;  1HD8 A;  1XXM A;  1DP6 A;  1OTD A;  3LYX A;  4DJ2 A;  4KZ4 A;  1J3W A;  4ZRR A;  3BEC A;  1MWS A;  1OME A;  3UN7 A;  5FI6 A;  3MZD A;  2EXB A;  3IWO A;  5AQ9 A;  2Y2K A;  3EGD C;  4ZTK A;  3S7P A;  2ZQ9 A;  4ZDX A;  1UWP X;  3GSG A;  2D02 A;  4NEE D;  2B95 A;  3UNW A;  4OQ0 A;  5J8X A;  1I5Q A;  3OPH A;  1T1A A;  4MN6 A;  2HDU A;  4BJP A;  4G3W A;  2V1A A;  1H8Z A;  3D9Y A;  3BRM A;  3NCK A;  4MN5 A;  4EQI A;  1KGE A;  5CTM A;  2DCF A;  2Y4A A;  3UDF A;  1PWC A;  4N92 A;  5GHZ A;  3OPP A;  4LV3 A;  2EX8 A;  4GB7 A;  5FAQ A;  1OTB A;  2Y79 A;  4WF0 A;  1W63 M;  5CHU A;  3CWF A;  4YIN A;  2M7U A;  3OCL A;  1FIK A;  1RP5 A;  2JN7 A;  5FQM A;  2J9O A;  1HTZ A;  4UA6 A;  1NYM A;  1L0G A;  4DF6 A;  2H0Y A;  2XA7 M;  4UAA A;  3T1Q B;  3RXW A;  3G6O A;  1BTL A;  3PAG A;  3UDX A;  1KE3 A;  3PYP A;  1IEM A;  3U2A A;  4R3A A;  4KZ3 A;  1AXB A;  3IH8 A;  4DE2 A;  4NK3 A;  3BQ8 A;  2PHY A;  3KSF A;  4E3M A;  2OAQ 1;  3S7Q A;  2P9V A;  4WUJ A;  5IT5 A;  5EVE A;  1JTD A;  2W3E A;  1S1Z A;  2ZM0 A;  3UE1 A;  3R4K A;  3GR2 A;  3GMW A;  3T4L A;  2FZ0 A;  4S2P A;  2W1R A;  4P6Z M;  1OJG A;  3UB5 P;  3SS4 A;  1IYS A;  3EQV A;  4JF5 A;  5GLA A;  2WKQ A;  4Y3I A;  2X02 A;  2Y2J A;  4RQ9 A;  2XFT A;  3E0Y A;  3T12 B;  5GLD A;  4OON A;  4HH2 A;  1YLY A;  1S66 L;  3R7W A;  4X69 A;  1G28 A;  3QP4 A;  2W1T A;  1K25 A;  2WKI A;  1ZG4 A;  1BZA A;  4HP9 A;  5KSC A;  4RX3 A;  1HVB A;  2WAE A;  2ZC5 B;  4O01 A;  2D01 A;  3MF0 A;  1YT4 A;  2JKT M;  2ZMF A;  3N8S A;  1ACF A;  2PDR A;  3HLE A;  1WYC A;  3U4L P;  1XGJ A;  5KZH A;  1G5U A;  2HP5 A;  4KG5 A;  1DJA A;  3OZH A;  3P7N A;  1BLH A;  1LHY A;  4JXS A;  3B42 A;  3AGE A;  5G18 A;  2VX8 A;  5FEG A;  4MN7 A;  3BM6 A;  4LV0 A;  5FDS A;  1RCJ A;  2OLU A;  1JTG A;  3A3J A;  3FV7 A;  4OOM A;  4KQQ A;  3JVV A;  5FI2 A;  1PWD A;  3KO6 A;  4KQD A;  3TE8 A;  2WAD A;  1L0D A;  3HUN A;  1MKM A;  4S2O A;  3A0S A;  1BT5 A;  2XR0 A;  3NDG A;  4EEU A;  2BLS A;  1VET B;  1YLZ A;  3F1N B;  4R23 A;  5EVI C;  1P9R A;  4ZBE A;  2ZC7 A;  3LIC A;  1V9Z A;  5HWV A;  3L7H A;  4RX2 A;  3EQU A;  5L8M A;  1OT6 A;  2QKP A;  4HJ4 A;  4NXE A;  3NUL A;  3EEH A;  3LCE A;  4IBX A;  3IXG A;  2ZQD A;  4QWO A;  1JWV A;  1KE4 A;  4L9F A;  1ZKJ A;  3LID A;  5AQB A;  3P01 A;  4KQO A;  5HWW A;  2VGL M;  5E2E A;  3VE4 A;  3IH9 A;  2JCH A;  2V20 A;  3F1O A;  3LY4 A;  1IFQ A;  5HL1 A;  4Q0H A;  4FTX A;  4WYY A;  3LR5 A;  5CXW A;  5EV0 A;  3GDI A;  2IWC A;  4CPK A;  3BFC A;  4UQI M;  2VKS A;  4HH3 A;  4B88 A;  1HZO A;  4MLL A;  3IF6 B;  2Y2M A;  3D4F A;  2XD5 A;  1D7E A;  1ES3 A;  3BFG A;  1DY6 A;  1LSW A;  3ZG9 B;  5IS1 A;  1S1Y A;  3TG9 A;  2EX6 A;  1KDS A;  4ZJ2 A;  2JHE A;  1MBL A;  2WYX A;  1BSG A;  3WS2 A;  3PBS A;  3H7W A;  4NXG A;  3N8R A;  1YSQ A;  3VOL A;  2YKF A;  2DNS A;  3C4O A;  5BOH A;  1KGG A;  4M3K A;  2B18 A;  1BLP A;  4ZJ1 A;  3DWK A;  4I3I A;  1GHM A;  5FDH A;  5FEF A;  4HQA A;  1K54 C;  4S2N C;  3LEQ A;  4LRZ E;  3WWX A;  1D06 A;  4KZ7 A;  4OP5 A;  1F98 A;  4Y5F A;  3NJA A;  1K38 A;  4HY8 A;  1FCM A;  3BWL A;  3L9K A;  4MEZ A;  4E3N A;  4R70 A;  5D3O A;  4E3I A;  1W63 Q;  4KZ8 A;  4EBN A;  4PM5 A;  1SDE A;  2XFS A;  3S1Y A;  1FSY A;  3UE0 A;  2I9V A;  1CK3 A;  5GHY A;  1YQS A;  4EW7 A;  1SKO A;  1E25 A;  4BLM A;  5FQK A;  1PW8 A;  1EI5 A;  1W8Y A;  4X53 A;  4OPQ A;  2JKR I;  1F2K A;  4CLC D;  4O8G A;  4HES A;  2WZZ A;  4BBV A;  4ETX A;  4HOI A;  2XSS A;  1K57 A;  4WMC D;  3C7V A;  4LRY C;  3BFE A;  3CLO A;  1XP4 A;  3E4O A;  1Z09 A;  4B93 A;  2P9V B;  4E6W A;  3TJZ C;  4BBU A;  1GCE A;  3WS4 A;  1LLB A;  1YLW A;  4NKP A;  4Z1W A;  2CMN A;  1S67 L;  3ZGA B;  4Y0T A;  4K91 A;  3MKF A;  1CI9 A;  3S7N A;  1XGI A;  1OJ5 A;  3FZC A;  1C3B A;  4UA7 A;  3DTM A;  4HEF A;  1QMF A;  5E43 A;  1N4O A;  3ICY A;  5K5B A;  2VA0 A;  2KOI A;  5F1G A;  2W3D A;  1NRJ A;  3OC2 A;  3GQZ A;  1EW0 A;  4JF6 A;  3R7W B;  1YMX A;  1ALQ A;  5HDS A;  1NWZ A;  5J3W A;  1DP8 A;  2W1T B;  1DJC A;  4F3L A;  2PRF A;  1HLU P;  4DDY A;  1XFQ A;  1TS6 A;  3UMD A;  2HF6 A;  4EUZ A;  1TF1 A;  5C5K A;  1PFL A;  5IU1 A;  3TOI A;  2KDK A;  1WA9 A;  1G6A A;  3ZVT A;  4OH0 A;  4LGW A;  1H0M A;  1O7E A;  1KE0 A;  3NC8 A;  5FI7 A;  5F5Y A;  1SZV A;  5FQQ A;  1N9B A;  3HBR A;  3DAV A;  5HWT A;  4L9E A;  2KLI A;  5HPF A;  4G3V A;  4X25 A;  2OWJ A;  4JPM A;  5CEB A;  3HUM A;  3IX4 A;  2K31 A;  2V8F A;  4ETZ A;  1YLT A;  3B3X A;  2A3U A;  3IQA A;  1KGF A;  3LGO A;  3NBL A;  3SS3 A;  3MZF A;  3M6H A;  4I38 A;  2A24 A;  4KEN B;  3C38 A;  1FQG A;  1PI4 A;  3FWL A;  2Y2G A;  2OV5 A;  3VE3 A;  1P0Z A;  2PT7 A;  3NHQ A;  2WKH A;  4DE1 A;  3W4Q A;  1VM1 A;  1XFN A;  2H5S A;  2Y2P A;  5HPI A;  5A92 A;  4A5R A;  5L2F A;  1FCN A;  3JYI A;  1ESU A;  4C75 A;  3OBF A;  3P98 A;  3HLF A;  4EBP A;  1M6K A;  3MJQ A;  4IUK A;  4U3T A;  4OQG A;  1ONH A;  3DTE A;  3F1O B;  4WZ5 A;  4N9K A;  2ZM2 A;  3BQA A;  2Z6D A;  4DKI A;  4RA7 A;  4CJN A;  3O88 A;  4O0P A;  4G3K A;  3OPR A;  3V5M A;  3D72 A;  3CUE A;  4Y2F A;  3BYD A;  1OTI A;  3UPO A;  2H10 A;  1YAX A;  1YM1 A;  1FSW A;  3CUE C;  4BWI A;  5DF9 A;  4P87 A;  4AFI A;  1NZU A;  3GVB A;  3B47 A;  3UY6 A;  2JKT I;  3N4I A;  3LR4 A;  1FCO A;  3LI9 A;  1H5X A;  3T4K A;  3QP1 A;  3ZNT A;  2WZX A;  3H7W B;  2GJ3 A;  3RTY A;  4NXF A;  2PBD P;  4K08 A;  1VB6 A;  2GNX A;  2Z2M B;  4R6L A;  2WGW A;  5G4Y A;  2L0W A;  2J3T D;  3EWK A;  2LB9 A;  2ZLY A;  2ZQ7 A;  2J7V A;  3OLO A;  5A8B A;  4RYE A;  3NOP C;  3Q82 A;  1YMS A;  3HL9 A;  4WLA A;  5GLC A;  3S7O A;  3BJN A;  3ZYT A;  1DP9 A;  1GA9 A;  1V9Y A;  2HPB A;  2ZD8 A;  4WZ4 A;  4EU0 A;  3ISG A;  4WEJ A;  3IT9 A;  3KSI A;  3W2Z A;  3E2L A;  4BBT A;  4IVK A;  2L1M A;  3W4P A;  3T1X A;  2JKG A;  4FOF A;  4P6B A;  4DN0 A;  3GTC A;  3MFX A;  1NLY A;  1FR1 A;  3KX0 X;  3Q1F A;  3ZG5 A;  3UB6 A;  4LEN A;  3IXH A;  4BEN A;  2QJ5 A;  2C6W B;  4OPY A;  1SKO B;  3NOU C;  5EOE A;  4GZB A;  5HZH A;  4GCZ A;  3D3O A;  3G31 A;  3O87 A;  2JKF A;  2PYR A;  1K56 D;  3NIA A;  3IXB A;  4LV2 A;  4S2J A;  5A93 A;  3VMA A;  3ULF A;  5HD5 A;  1Q2P A;  4KG6 A;  5CED A;  3VP3 A;  4IHQ A;  1F5M A;  2ZBB A;  4I5S A;  3UB9 A;  3ZHH A;  4D2O A;  1ERQ A;  4EUV A;  2IA2 A;  3HLW A;  1E3U D;  2P7J A;  2P74 A;  2WUQ A;  5KMW A;  3G32 A;  5CGX A;  3EEA A;  4X56 A;  4ZAM A;  1XJ4 A;  5DKL A;  5FQJ A;  3G34 A;  3ITA A;  4F3L B;  2ZL1 A;  2EFX A;  3WS1 A;  2V2F F;  1L2S A;  3C30 A;  2ZOI A;  4LLO B;  1PI5 A;  4KZ5 A;  1GSW A;  4JXW A;  3C4P A;  4OOL A;  1K56 A;  5GHX A;  3WRT A;  4ARZ A;  4S2I A;  2A2L A;  3CHW P;  1H8M A;  4MMN A;  2VV7 A;  1XA1 A;  2Y2I A;  4GW9 A;  2GX5 A;  4NG2 A;  3IWI A;  4L0L A;  4PM7 A;  4Q8I A;  5E2H A;  3BLM A;  2AVX A;  1XJ6 A;  1RGY A;  3IBJ A;  2ZQA A;  3UDI A;  3T4O A;  5F6A A;  3MS6 A;  5EEC A;  5FQ9 A;  1ESI A;  4PMA A;  1CQA A;  2P04 A;  4D60 A;  1E3U A;  5LBR A;  1TD5 A;  3QNB A;  1FOF A;  4MBF A;  1CI8 A;  2ZJ9 A;  2GDN A;  4YWZ A;  1LL9 A;  1PWG A;  1LL5 A;  1S0W A;  2K2N A;  2A24 B;  3VFH A;  2JC7 A;  3UE6 A;  4S2M A;  3PBO A;  4QB8 A;  1CEG A;  4IJG A;  2Q9N A;  1MC0 A;  4LPZ A;  1DRM A;  1K55 A;  4HIA A;  4LRX C;  3C5A A;  4GDB A;  2HV1 A;  4I39 A;  5MC7 A;  1BYW A;  1EWZ A;  1FR6 A;  4EES A;  5FAS A;  1L3L A;  3VSK A;  3BEB A;  5HAP A;  1TDL A;  2ZQ8 A;  3LEZ A;  1TVF A;  4BD1 A;  2OAP 1;  4OQH A;  5M19 A;  1GHP A;  5I94 A;  3CI6 A;  2WK0 A;  4EXO A;  1ES4 A;  3HVF A;  2WGV A;  3GV9 A;  3NDE A;  3LY3 A;  2VJW A;  3PBT A;  2EX9 A;  2WGI A;  4UEY A;  1E4D A;  5AVE A;  2O9A A;  2KX6 A;  2XEP A;  4H6J A;  3SW1 A;  3DTI A;  2J3W A;  3G2Z A;  2JBF A;  3VOY A;  4GLQ A;  5F69 A;  3FYZ A;  2WGW B;  4ZJ3 A;  4IBR A;  2O9B A;  1ZC2 A;  3A0R A;  2C5W B;  4WL9 A;  3LIA A;  2Q9M A;  4X6T A;  4YNR A;  5CGS A;  3LIB A;  2ZC6 B;  4PAU A;  2WAF A;  3IX8 A;  1IEL A;  3MBZ A;  3UO9 A;  1PZP A;  1H8Y A;  2VV6 A;  5E2G A;  3ITB A;  1MXO A;  2XK1 A;  3O3V A;  2B5R A;  4GS9 A;  3JVU A;  2R9W A;  1VHM A;  1M40 A;  5IHV A;  3MQQ A;  1SCW A;  4PM9 A;  2BAS A;  3UPP A;  2PBY A;  1QME A;  1MY8 A;  1YLJ A;  5F1F A;  2XGN A;  3MKE A;  1SHV A;  5HX9 A;  3ZG7 B;  2BTF P;  2R9X A;  1LL8 A;  3T1R A;  4E3L A;  3KSH A;  2J80 A;  3GEC A;  2V0W A;  5TGF A;  3MQ0 A;  5F82 A;  1T18 A;  2EWV A;  1NY0 A;  1K57 C;  3KSG A;  2O99 A;  1WYB A;  4XUZ A;  4N9L A;  5AQ7 A;  3T50 A;  1CEF A;  4JGO A;  1IOU A;  1NRF A;  4FD8 A;  3N7W A;  4NET A;  1CJF A;  2X71 A;  1K4F A;  4JKT A;  3RH8 B;  3HJI A;  3VP4 A;  4DE3 A;  4FSF A;  3RJU A;  1RGZ A;  2X01 A;  2QJ7 A;  3JPU A;  2HDS A;  5AJG A;  1ERO A;  2Y59 A;  1STZ A;  4O7D A;  3O5Y A;  3ZQ5 A;  2ZL1 B;  2PYP A;  2QYB A;  3QP5 A;  3DBA A;  2G2W A;  5F83 A;  1ZTU A;  3G30 A;  4QY5 A;  1N9O A;  4PM8 A;  4JGR A;  1XJ2 A;  2IWB A;  3PHY A;  4CLC A;  4ARZ B;  5TBM A;  4DXC A;  4CLC C;  4HNB A;  1IKG A;  4DDS A;  5EVL A;  4WMC A;  3BFD A;  2ZQC A;  2NUP C;  1N9N A;  4PPR A;  4HBT A;  3BLS A;  3HJK A;  3T4T A;  1JWZ A;  4YOF A;  2W3G A;  4ID4 A;  4MBK A;  4HJ3 A;  2Q0O A;  3LR0 A;  3G2Y A;  4Y0O A;  1MWU A;  4IED A;  5FQI A;  4N1H A;  1UWN X;  3T4Q A;  1PZO A;  5CHM A;  2R78 A;  1U60 A;  4F94 A;  2GZA A;  1GHI A;  1I2W A;  4QY6 A;  1PYY A;  5KSH A;  1VEU A;  1JVJ A;  2L4R A;  2PU4 A;  3K2N A;  3FG8 A;  4R4R A;  3I7J A;  4P0M A;  4R38 A;  3TSG A;  2HDR A;  2ZMA A;  2PR6 A;  3G4P A;  3WS5 A;  4R3B A;  3B33 A;  3W4O A;  1LI0 A;  1LT0 A;  4KUK A;  3QHY A;  2O0Y A;  4R3J A;  2W3H A;  5E2F A;  4II7 A;  3NI9 A;  3SH9 A;  4P85 A;  4WZ5 C;  3P09 A;  3HLB A;  4EBL A;  3VV4 A;  3LIE A;  2HJE A;  3UE3 A;  4DMZ A;  4GN2 A;  3TW8 A;  2CC1 A;  3Q07 A;  3OOV A;  5FAP A;  4WBG A;  5HW3 A;  3HLC A;  4HBU A;  4OPZ A;  2HZ5 A;  3FPV A;  4H6J B;  1KDW A;  3EGX C;  3W8K A;  1ES5 A;  2G7U A;  4WEL A;  2FH5 A;  4HHD A;  3SOI A;  3CAX A;  1GA0 A;  3SZT A;  3V3S A;  1WE4 A;  1PRQ A;  5EM0 A;  4GD8 A;  2E8I A;  3H82 A;  5JYP A;  2O9C A;  3K3C A;  4JGP A;  4C3Q A;  1ERM A;  4QHC A;  5CTN A;  4UHU A;  3IHB A;  4LCL A;  2QHK A;  3PBQ A;  2PU2 A;  2FFF B;  3NY4 A;  3UME A;  3CIT A;  4WEK A;  4B4Z A;  2V0U A;  4RVA A;  2WKR A;  3O86 A;  5JYO A;  2EA9 A;  5FL3 A;  3MSH A;  4LFU A;  3A3I A;  1TDG A;  5F68 A;  1AWI A;  3LIF A;  5AQA A;  4IVI A;  2VGL S;  1O07 A;  1L0E A;  3SH8 A;  1G68 A;  4GS9 B;  3OPL A;  1MKI A;  1N9L A;  4Y13 A;  1IYQ A;  2J9P A;  3CJM A;  2M7V A;  1T19 A;  4JF4 A;  4BL2 A;  4Y0U A;  2H28 A;  2IWD A;  3BY8 A;  4UQI S;  4EV4 A;  3FKV A;  3ZFZ A;  1P97 A;  5DTK A;  1K4E A;  2B02 A;  5M1A A;  1XJ3 A;  2J3T C;  1K6S A;  4YFM A;  1XA7 A;  3VP0 A;  4S2L A;  1MWR A;  1JWP A;  2QWS A;  4S2K A;  5DTS A;  2EX2 A;  3PAE A;  4U0T A;  4MBH A;  4EET B;  1MPL A;  4HP4 A;  3IXD A;  5DTT A;  4B4X A;  1TS0 A;  3MQO A;  4GNU A;  1LSX A;  1FIL A;  2Y8H A;  2EXA A;  4MCW A;  1G6O A;  2Y2Q A;  3QP6 A;  3T4J A;  3C7U A;  3E98 A;  3Q7V A;  3HUO A;  4DE0 A;  2PAV P;  2QZ6 A;  5FA7 A;  3ZCZ A;  3MZE A;  3F1P A;  1ONG A;  2Z2L B;  3QP2 A;  4OQI A;  4JXV A;  2H0T A;  4BL3 A;  3UB7 A;  1TEM A;  5EFW A;  2XRO A;  4KUO A;  1W7F A;  5DF7 A;  5AVF A;  2XDM A;  4Y15 A;  5M18 A;  4PKY A;  3C8C A;  1F9I A;  2J8Y A;  1KVM A;  4CLC B;  2Y2L A;  3HLD A;  5TBM B;  5TJJ A;  4MDZ A;  5HAR A;  2BG1 A;  3CMZ A;  4QU3 A;  3DWZ A;  1VQQ A;  4FUW A;  3ZVW A;  3M2K A;  4LV1 A;  5EVI D;  2VV8 A;  4GJ4 A;  3FKW A;  5EPH A;  2V8C A;  3MXR A;  1LSV A;  2A49 A;  3M2J A;  5HAQ A;  3ZDJ A;  4Z9Q A;  4GHI A;  1ZHH B;  3AGF A;  2E8J A;  3VP2 A;  4N1X A;  5I5L A;  2VGK A;  3MR0 A;  4BD0 A;  4QD4 A;  1Y28 A;  3PR6 A;  4FH4 A;  3G35 A;  1VEU B;  2EFU A;  4E3K A;  2VK3 A;  3VSL A;  1DJB A;  1CF0 A;  3A3E A;  2Y2H A;  2OSU A;  3BW6 A;  1YLP A;  1W8Q A;  3IBR A;  3V50 A;  5EVI A;  1K55 C;  4OKP A;  1MWT A;  3LFV A;  2QMI A;  1BLC A;  2XF3 A;  1GSX A;  4XT2 A;  4Y7P A;  3H9W A;  1XX2 A;  5HFO A;  4ESP A;  4E6X A;  3K3D A;  3WS0 A;  4GDN A;  4OP8 A;  4EEP A;  3QP8 A;  4BQM A;  3KYQ A;  3DW0 A;  4E3O A;  3FC7 A;  1T1B A;  4FH2 A;  5DJU A;  2W0N A;  4C6Y A;  2JE5 A;  3TRC A;  3VFF A;  4R4S A;  1ES2 A;  3N6I A;  1YSP A;  3SH7 A;  3RFB A;  2Y2N A;  3MMH A;  3UB8 A;  4L9G A;  4PHT A;  3S22 A;  5EM1 A;  1K6R A;  3RXX A;  1SDN A;  5EE8 A;  3H82 B;  4OLD A;  3IWQ A;  1NYY A;  5CGW A;  3A3D A;  2DRW A;  5CHJ A;  2HDQ A;  4JGQ A;  1H3Q A;  3IS2 A;  4QJG A;  3CPT A;  3KYZ A;  3A0V A;  3N8L A;  3IF5 A;  2V1Z A;  5L09 A;  2FFY A;  2Y55 A;  4I3A A;  4PM6 A;  5G4Z A;  2WKP A;  5U47 A;  2VLG A;  1TS7 A;  2EWW A;  1OT9 A;  2ZC3 B;  1IYP A;  4JBF A;  2ZM8 A;  1BUL A;  4XXR A;  1PW1 A;  3V67 A;  4GOG A;  3LUQ A;  4LCM A;  1KOU A;  1K54 A;  4S2N A;  2RL3 A;  4OOY A;  1ODV A;  2WKE A;  1JNU A;  5HDD A;  1W5D A;  4X1M A;  2Z6C A;  3VOZ A;  1XKZ A;  4DRT A;  1S4S A;  1NZO A;  4OLG A;  5HAI A;  3MXQ A;  1Q2Q A;  2OWH A;  3FPW A;  4EER A;  4FCF A;  1W79 A;  3LO7 A;  3E2K A;  5L07 A;  2VZW A;  4R1G A;  4U0X A;  4R0Q A;  2G2U A;  4X68 A;  3ZNY A;  2XRN A;  1BLS A;  5HDC A;  3MXS A;  4XUX A;  5GLB A;  2XD1 A;  3V39 A;  5HL6 A;  5A91 A;  5FAO A;  3VP1 A;  3Q7V B;  3CG5 A;  3OCN A;  1YPR A;  4QPR A;  4KZ9 A;  3Q81 A;  4CLC E;  5J4E A;  2HGV A;  1NXY A;  3F1P B;  4JLF A;  1ZG6 A;  5GL9 A;  4X55 A;  3T1S A;  5DF8 A;  3NEC A;  3DTK A;  2V9A A;  4ME4 A;  4H8R A;  3CZD A;  5CER A;  2INW A;  1SKF A;  3S4X A;  2XLN A;  5CEC A;  1PNE A;  1S4R A;  1Y4O A;  5DKK A;  3PXP A;  4Q0I A;  5A90 A;  1Z6F A;  4KZB A;  1OTE A;  2ZMV A;  5EOO A;  1PIO A;  2ZOH A;  4E04 A;  5HSQ A;  1KVL A;  1X0O A;  2Y91 A;  3LI8 A;  1OTA A;  4HI4 A;  2RCX A;  4OVD A;  3T4S A;  4E3J A;  5DVA A;  4Y17 A;  2PD7 A;  1LI9 A;  3A3F A;  5DFX A;  2XH9 A;  1I2S A;  3Q7Z A;  2W3F A;  3LR3 A;  5DJT A;  4K0X A;  5TFQ A;  3V3R A;  2XA7 S;  3AGD A;  4EWF A;  4MNR A;  2M1C A;  4GHI B;  2PR5 A;  5J7E A;  2OLV A;  1BUE A;  2LB5 A;  1Y54 A;  2XQZ A;  2I72 A;  3ZG8 B;  3HCY A;  4DJ3 A;  1D1J A;  3BFF A;  2P08 A;  4DXB A;  2DMW A;  1OPX A;  4X1L A;  1XPB A;  4IUH A;  1GSV A;  4B9O A;  1A0K A;  4OPR A; 
#chains in the Genus database with same CATH homology
 3QNB A;  4K0W A;  4KZ7 A;  1FOF A;  4OP5 A;  1MKI A;  4MBF A;  1CI8 A;  1IYQ A;  2J9P A;  2ZJ9 A;  3UPN A;  1K38 A;  2GDN A;  5FSR A;  3CJM A;  4JF4 A;  4BL2 A;  1LL9 A;  4Y0U A;  1PWG A;  5CRF A;  1LL5 A;  1S0W A;  2IWD A;  1FCM A;  5EUA A;  4E3N A;  4MEZ A;  5D3O A;  4E3I A;  4EV4 A;  3FKV A;  1IYO A;  3VFH A;  4KZ8 A;  4EBN A;  4PM5 A;  2JC7 A;  2Y2O A;  3ZFZ A;  5DTK A;  1SDE A;  4S2M A;  2XFS A;  3S1Y A;  3PBO A;  1S6R A;  5EVI B;  2ZC4 B;  1FSY A;  1K4E A;  4QB8 A;  3UE0 A;  1CEG A;  1CK3 A;  5GHY A;  3PTE A;  1YQS A;  1E25 A;  2Q9N A;  5FQK A;  5M1A A;  4BLM A;  2HP9 A;  1PW8 A;  2QPN A;  2HP6 A;  1K6S A;  1EI5 A;  1J9M A;  1IKI A;  4YFM A;  1W8Y A;  4KZ6 A;  1XA7 A;  1K55 A;  4KQR A;  4OPQ A;  4X53 A;  3VP0 A;  1L0F A;  4S2L A;  3IHA A;  1MWR A;  4HES A;  1JWP A;  3C5A A;  4GDB A;  3MFD A;  2WZZ A;  4S2K A;  5DTS A;  3HLG A;  2EX2 A;  3PAE A;  1EWZ A;  3PBN A;  1FR6 A;  4U0T A;  5FAS A;  4MBH A;  5TR7 A;  4GKU A;  5FAT A;  1K57 A;  1MPL A;  4WMC D;  3C7V A;  3VSK A;  3IXD A;  4UA9 A;  5DTT A;  3WRZ A;  3BEB A;  3BFE A;  1TDL A;  2ZQ8 A;  3LEZ A;  1TVF A;  4WM9 A;  1XP4 A;  4B4X A;  4BD1 A;  4GNU A;  2P9V B;  4OQH A;  5M19 A;  1GHP A;  2EXA A;  5I94 A;  3HRE A;  4E6W A;  2WK0 A;  2Y2Q A;  4JXG A;  3C7U A;  3Q7V A;  2UWX A;  1GCE A;  3HUO A;  4DE0 A;  3WS4 A;  5FA7 A;  1ES4 A;  2QZ6 A;  3HVF A;  1LLB A;  2WGV A;  3GV9 A;  3ZCZ A;  3NDE A;  3LY3 A;  4KZA A;  3ZG0 A;  1YLW A;  3PBT A;  2EX9 A;  2WGI A;  1E4D A;  3MZE A;  1ONG A;  2VGJ A;  2Z2L B;  3ZGA B;  4K91 A;  4Y0T A;  4OQI A;  3MKF A;  1CI9 A;  4JXV A;  3SS5 A;  2H0T A;  4BL3 A;  3GRJ A;  1XGI A;  1NJ4 A;  1TEM A;  3M6B A;  3FZC A;  3PBR A;  1C3B A;  1W7F A;  4UA7 A;  5DF7 A;  2XEP A;  2XDM A;  3DTM A;  4GD6 A;  4HEF A;  5M18 A;  1QMF A;  5E43 A;  3G2Z A;  2J8Y A;  2JBF A;  1KVM A;  1N4O A;  3VOY A;  2Y2L A;  3HLD A;  3FYZ A;  5F1G A;  5HAR A;  2BG1 A;  2WGW B;  3CMZ A;  4KG2 A;  3IF6 A;  3OC2 A;  3GQZ A;  4QU3 A;  3DWZ A;  4ZJ3 A;  1VQQ A;  4JF6 A;  3QNC A;  4IBR A;  1YMX A;  3IF6 C;  1ALQ A;  3ZVW A;  1HD8 A;  3M2K A;  1ZC2 A;  1XXM A;  1DJC A;  4LV1 A;  5EVI D;  2C5W B;  4DDY A;  2Q9M A;  3FKW A;  4X6T A;  4EUZ A;  4KZ4 A;  5EPH A;  3TOI A;  3BEC A;  1MWS A;  1OME A;  3MXR A;  3UN7 A;  1G6A A;  5CGS A;  5FI6 A;  3MZD A;  3ZVT A;  4OH0 A;  2EXB A;  3IWO A;  2A49 A;  3M2J A;  5HAQ A;  3ZDJ A;  1O7E A;  2ZC6 B;  5AQ9 A;  2Y2K A;  4Z9Q A;  1KE0 A;  4ZTK A;  3NC8 A;  5FI7 A;  2ZQ9 A;  3AGF A;  2WAF A;  5FQQ A;  1N9B A;  4ZDX A;  3HBR A;  3GSG A;  3VP2 A;  4N1X A;  3UNW A;  4OQ0 A;  1IEL A;  2VGK A;  5J8X A;  3MBZ A;  1I5Q A;  3OPH A;  3UO9 A;  1PZP A;  4JPM A;  5CEB A;  1H8Y A;  3HUM A;  4BD0 A;  5E2G A;  3ITB A;  1MXO A;  2XK1 A;  4QD4 A;  3O3V A;  2B5R A;  4FH4 A;  3G35 A;  2EFU A;  2HDU A;  4BJP A;  1H8Z A;  1YLT A;  4E3K A;  3BRM A;  3NCK A;  3B3X A;  2A3U A;  3IQA A;  1KGF A;  3NBL A;  2R9W A;  3VSL A;  4EQI A;  1DJB A;  1KGE A;  3A3E A;  1M40 A;  2Y2H A;  2DCF A;  5CTM A;  5IHV A;  2Y4A A;  1SCW A;  4PM9 A;  3UDF A;  3UPP A;  2PBY A;  3SS3 A;  1PWC A;  1QME A;  2OSU A;  3M6H A;  1MY8 A;  3MZF A;  1YLP A;  1YLJ A;  4KEN B;  2XGN A;  1W8Q A;  3MKE A;  4N92 A;  5GHZ A;  1SHV A;  5HX9 A;  5F1F A;  3OPP A;  3ZG7 B;  4LV3 A;  3V50 A;  2EX8 A;  4GB7 A;  1FQG A;  1PI4 A;  5FAQ A;  2R9X A;  3FWL A;  2Y2G A;  5EVI A;  2OV5 A;  1K55 C;  4OKP A;  2WKH A;  5CHU A;  1MWT A;  4E3L A;  2QMI A;  4YIN A;  1BLC A;  4DE1 A;  3W4Q A;  1VM1 A;  2H5S A;  2XF3 A;  2Y2P A;  5TGF A;  3OCL A;  4Y7P A;  5F82 A;  1RP5 A;  1XX2 A;  5HFO A;  5A92 A;  5FQM A;  4A5R A;  2J9O A;  1FCN A;  1HTZ A;  3JYI A;  4UA6 A;  4E6X A;  5L2F A;  1ESU A;  1NYM A;  3WS0 A;  1L0G A;  3P98 A;  4C75 A;  4DF6 A;  3HLF A;  1NY0 A;  2H0Y A;  1K57 C;  4GDN A;  4OP8 A;  4EBP A;  1M6K A;  1WYB A;  4UAA A;  4XUZ A;  4BQM A;  3RXW A;  3DW0 A;  1BTL A;  4E3O A;  3PAG A;  4N9L A;  4OQG A;  4U3T A;  5AQ7 A;  3UDX A;  1KE3 A;  1ONH A;  1CEF A;  1IEM A;  4FH2 A;  5HAP A;  4WZ5 A;  4KZ3 A;  1AXB A;  3IH8 A;  1NRF A;  4N9K A;  4NK3 A;  4C6Y A;  4DE2 A;  2ZM2 A;  2JE5 A;  4E3M A;  4FD8 A;  4DKI A;  3N7W A;  4NET A;  4RA7 A;  2P9V A;  4CJN A;  2X71 A;  3O88 A;  1K4F A;  1JTD A;  4R4S A;  1ES2 A;  4JKT A;  3VFF A;  2ZM0 A;  3OPR A;  3N6I A;  3UE1 A;  3SH7 A;  3V5M A;  3GR2 A;  3VP4 A;  4DE3 A;  4FSF A;  3GMW A;  3BYD A;  3RJU A;  3UPO A;  2H10 A;  1RGZ A;  2X01 A;  4S2P A;  1YM1 A;  2Y2N A;  1FSW A;  2HDS A;  5DF9 A;  1ERO A;  2Y59 A;  4O7D A;  4P87 A;  3SS4 A;  5BOH A;  1IYS A;  3S22 A;  1NZU A;  2G2W A;  5F83 A;  3GVB A;  3EQV A;  4JF5 A;  1K6R A;  5GLA A;  3G30 A;  3UY6 A;  4QY5 A;  1SDN A;  3RXX A;  3N4I A;  5EE8 A;  1FCO A;  4OLD A;  1H5X A;  2X02 A;  4PM8 A;  3IWQ A;  1NYY A;  2Y2J A;  2WZX A;  5CGW A;  2IWB A;  3A3D A;  3ZNT A;  2XFT A;  2DRW A;  5CHJ A;  4DXC A;  2Z2M B;  2WGW A;  2HDQ A;  1IKG A;  5GLD A;  4DDS A;  4QJG A;  4OON A;  1YLY A;  2ZLY A;  2ZQ7 A;  5EVL A;  4X69 A;  3N8L A;  2J7V A;  2V1Z A;  3IF5 A;  4RYE A;  1K25 A;  2FFY A;  2ZQC A;  3BFD A;  2WKI A;  1ZG4 A;  1BZA A;  2Y55 A;  4WMC A;  3Q82 A;  5KSC A;  4PM6 A;  1YMS A;  4PPR A;  4RX3 A;  4HBT A;  1HVB A;  3BLS A;  2WAE A;  1JWZ A;  3HL9 A;  5GLC A;  5U47 A;  2ZC5 B;  1YT4 A;  1GA9 A;  4ID4 A;  2HPB A;  2ZD8 A;  3N8S A;  4MBK A;  4WZ4 A;  3ISG A;  2ZC3 B;  4WEJ A;  1IYP A;  4JBF A;  3IT9 A;  3G2Y A;  3HLE A;  4Y0O A;  1WYC A;  3E2L A;  1XGJ A;  5KZH A;  1MWU A;  2ZM8 A;  1BUL A;  4XXR A;  4IVK A;  2HP5 A;  4KG5 A;  1PW1 A;  1DJA A;  4IED A;  5FQI A;  3W4P A;  4GOG A;  4N1H A;  3OZH A;  4LCM A;  4P6B A;  1K54 A;  4S2N A;  3GTC A;  2RL3 A;  1BLH A;  1LHY A;  4JXS A;  1PZO A;  4OOY A;  5CHM A;  3AGE A;  5G18 A;  2WKE A;  1FR1 A;  3BM6 A;  3Q1F A;  4LV0 A;  1RCJ A;  1U60 A;  2OLU A;  1JTG A;  3A3J A;  3FV7 A;  4OOM A;  4F94 A;  3ZG5 A;  4KQQ A;  1W5D A;  5FI2 A;  4LEN A;  1GHI A;  1PWD A;  3VOZ A;  2WAD A;  1XKZ A;  3IXH A;  4BEN A;  1L0D A;  4DRT A;  1I2W A;  3HUN A;  4QY6 A;  1NZO A;  1PYY A;  4OLG A;  5KSH A;  2C6W B;  1JVJ A;  4S2O A;  4OPY A;  1BT5 A;  5HAI A;  2XR0 A;  3NDG A;  2PU4 A;  4R4R A;  1Q2Q A;  5EOE A;  3I7J A;  4P0M A;  2BLS A;  1YLZ A;  4FCF A;  1W79 A;  4GZB A;  4R23 A;  5EVI C;  3TSG A;  4ZBE A;  2ZC7 A;  3LO7 A;  2HDR A;  3E2K A;  3G31 A;  3O87 A;  2ZMA A;  4RX2 A;  3EQU A;  3G4P A;  3WS5 A;  4R1G A;  4R3B A;  4U0X A;  4R0Q A;  3W4O A;  2G2U A;  1K56 D;  4X68 A;  3ZNY A;  3NIA A;  1LI0 A;  3IXB A;  3QHY A;  4LV2 A;  4S2J A;  5A93 A;  4R3J A;  5E2F A;  3NI9 A;  3VMA A;  1BLS A;  3MXS A;  4XUX A;  5GLB A;  2XD1 A;  3V39 A;  1Q2P A;  3LCE A;  4IBX A;  5FAO A;  4KG6 A;  5A91 A;  4P85 A;  3SH9 A;  3VP1 A;  3Q7V B;  3CG5 A;  3OCN A;  5CED A;  3IXG A;  3P09 A;  2ZQD A;  4WZ5 C;  3VP3 A;  1JWV A;  1KE4 A;  3HLB A;  4EBL A;  1ZKJ A;  4KZ9 A;  5AQB A;  3Q81 A;  3UE3 A;  4KQO A;  4GN2 A;  2CC1 A;  3ZHH A;  1NXY A;  4JLF A;  4D2O A;  5E2E A;  1ZG6 A;  5GL9 A;  3Q07 A;  4X55 A;  5FAP A;  1ERQ A;  3IH9 A;  4WBG A;  5DF8 A;  2JCH A;  3HLC A;  2V20 A;  5HW3 A;  4HBU A;  3LY4 A;  5HL1 A;  4OPZ A;  3HLW A;  1E3U D;  4WYY A;  2P74 A;  4H8R A;  3CZD A;  5CXW A;  5CER A;  1SKF A;  3S4X A;  2XLN A;  5CEC A;  1KDW A;  2WUQ A;  5KMW A;  3G32 A;  2IWC A;  5CGX A;  4CPK A;  3W8K A;  3BFC A;  1ES5 A;  4X56 A;  4B88 A;  4WEL A;  5A90 A;  1HZO A;  1Z6F A;  4ZAM A;  4MLL A;  3IF6 B;  4KZB A;  3SOI A;  2Y2M A;  5FQJ A;  1GA0 A;  3D4F A;  1PIO A;  2XD5 A;  5EOO A;  1KVL A;  1ES3 A;  3V3S A;  3G34 A;  3BFG A;  2Y91 A;  3ITA A;  1WE4 A;  1DY6 A;  3ZG9 B;  3TG9 A;  2EFX A;  3WS1 A;  4GD8 A;  2EX6 A;  1L2S A;  2V2F F;  2RCX A;  4OVD A;  4E3J A;  2E8I A;  1PI5 A;  1KDS A;  4KZ5 A;  5DVA A;  4ZJ2 A;  1MBL A;  4JXW A;  3C4P A;  2WYX A;  1LI9 A;  3A3F A;  4OOL A;  1BSG A;  3WS2 A;  5JYP A;  3PBS A;  2XH9 A;  1I2S A;  1K56 A;  3Q7Z A;  5GHX A;  3WRT A;  3N8R A;  4S2I A;  4C3Q A;  1ERM A;  4QHC A;  4K0X A;  5TFQ A;  3V3R A;  5CTN A;  1XA1 A;  2Y2I A;  3AGD A;  3IHB A;  4LCL A;  4UHU A;  4EWF A;  2DNS A;  4MNR A;  3PBQ A;  3C4O A;  2OLV A;  1BUE A;  2PU2 A;  3IWI A;  1Y54 A;  1KGG A;  2XQZ A;  4L0L A;  2I72 A;  4PM7 A;  5E2H A;  2FFF B;  3BLM A;  3NY4 A;  3ZG8 B;  4WEK A;  4Q8I A;  4B4Z A;  4M3K A;  4RVA A;  1RGY A;  3BFF A;  1BLP A;  4DXB A;  3O86 A;  2ZQA A;  5JYO A;  3UDI A;  4ZJ1 A;  3DWK A;  1GHM A;  5FDH A;  3A3I A;  1TDG A;  1XPB A;  5EEC A;  5FQ9 A;  1K54 C;  1ESI A;  4PMA A;  4S2N C;  5AQA A;  4IVI A;  1O07 A;  1L0E A;  3WWX A;  3SH8 A;  4OPR A;  1G68 A;  1E3U A;  3OPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...