3G31A

Ctx-m-9 class a beta-lactamase complexed with compound 4 (gf1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g31A00
1JTDA 3C7VA 2OSUA 4OPRA 1NJ4A 1KE0A 3EQVA 1FOFA 4JF5A 3HREA 4GKUA 1DY6A 4OQIA 3SOIA 3HLDA 1MWSA 1IYPA 1IEMA 1XX2A 4DDSA 1GA0A 2H0TA 3BECA 1JWVA 1TEMA 3JYIA 4JF4A 1K4FA 3M2KA 5JYPA 5CECA 1JVJA 1I5QA 5CTMA 4S2NC 1L0FA 3UE0A 4LV1A 3G35A 1KDSA 4EBNA 3O88A 3G2ZA 4UA7A 4R4SA 2WYXA 2ZC6B 3HLWA 3BFGA 1GHMA 2ZQ7A 4JPMA 4D2OA 5M1AA 3S4XA 5G18A 5F1FA 1NZOA 3MKEA 4XUXA 3PTEA 4WEKA 3VP4A 3BFCA 1PWDA 4OLDA 5CHUA 2BLSA 2Z2MB 2IWDA 3OCNA 4WELA 5GLCA 3LY3A 2Y2NA 3BFFA 4C6YA 3V3RA 1L0GA 4ID4A 4FH4A 4FSFA 4B4XA 3P09A 5DF7A 1XXMA 5FATA 3Q7ZA 3GTCA 5EVIC 5J8XA 2WGIA 3UDIA 4OQHA 4PM9A 3NI9A 4GD6A 5CTNA 1MWUA 4IBRA 3N4IA 1Y54A 3MKFA 4OPZA 5M18A 1S6RA 4MBKA 1NXYA 3WS1A 3RJUA 2V1ZA 4E3JA 1YLZA 4LV0A 1YLPA 4OH0A 3VOZA 1FR6A 1W7FA 5CXWA 3GRJA 3D4FA 2Y2MA 4K91A 2HDUA 2XD1A 1EROA 4CPKA 1K57C 1CEGA 1RGZA 3ITAA 1FCMA 3VP2A 4RVAA 4HBUA 4BENA 1W8QA 3MZDA 3W8KA 4EWFA 4DE0A 4RYEA 4KZ3A 4GD8A 3UDXA 2A49A 5DTKA 3LO7A 5E2FA 1K55A 3UE3A 4OVDA 3BFDA 3HUOA 4KZ4A 1GA9A 2X02A 4S2PA 2P9VB 2WZZA 2IWBA 4LCMA 1ALQA 1RGYA 4X53A 5CEDA 3IXDA 3OC2A 4RX3A 3BRMA 4IVIA 3G31A 2OV5A 4WM9A 3OCLA 4MEZA 3HLFA 2C6WB 1NRFA 3PBQA 2HDQA 1FSYA 2Y2PA 4KZAA 2ZQCA 4E6XA 1E25A 4Q8IA 1SCWA 4WZ4A 4OP5A 3RXXA 4BJPA 4A5RA 3N7WA 4LV2A 2OLUA 4LV3A 5FQIA 3HLBA 2Y2HA 5F83A 4DE2A 3TG9A 2RCXA 4B88A 1E3UD 2WGWA 1XGIA 1XA1A 2XR0A 3IH8A 2X01A 3MZEA 3VP3A 5E2GA 3UE1A 1TVFA 1IYQA 4N9LA 4BL3A 5FI2A 5DVAA 3IH9A 3LEZA 3UPNA 3WS5A 1Q2QA 3FZCA 4KQRA 4GB7A 1K54A 2WZXA 2ZC3B 4U3TA 3ZNTA 1YQSA 5A93A 3EQUA 1FCNA 1H8ZA 1BZAA 1PW8A 2ZM8A 5GHZA 3N6IA 3ZG5A 3UDFA 4IVKA 3DWKA 2WGVA 1PW1A 4P0MA 5HARA 2Y2QA 4E3KA 1HZOA 1MBLA 3SS5A 3SH8A 2X71A 4QY5A 4B4ZA 1LHYA 4R3JA 3HBRA 4U0XA 4Z9QA 3WS0A 4QY6A 5FI7A 1E4DA 1PIOA 1TDLA 1XPBA 2WKHA 5FAOA 1K55C 1Q2PA 1YT4A 3AGDA 4JKTA 4PM8A 5EVLA 1VM1A 2WGWB 4RA7A 5EUAA 1ZG4A 3GR2A 1ZG6A 3IF6C 2DNSA 4YFMA 2EFUA 1FCOA 1SKFA 5F1GA 2ZMAA 3NBLA 1PYYA 4KZ6A 4JXGA 3BYDA 4DF6A 4NETA 5HAIA 3W4PA 3IQAA 2B5RA 2QMIA 3TSGA 3W4QA 4XXRA 3C4PA 1LL9A 4MNRA 3IHBA 4P87A 3FYZA 1YMSA 2ZC4B 1FR1A 1XP4A 1AXBA 1N4OA 5BOHA 4KZ8A 1IELA 2ZC5B 3LCEA 3UPOA 3OPLA 1CEFA 4S2LA 3IXHA 3FV7A 4R4RA 2PU4A 3OPHA 2P9VA 3O3VA 3NDGA 3SS3A 4DRTA 2EX9A 2ZQDA 2JBFA 1EI5A 5EE8A 5EPHA 3ZG0A 2WKIA 2XEPA 3QNBA 1NYYA 3OZHA 3TOIA 1LI0A 2Y2OA 2Y2JA 3IWOA 4OPQA 4QU3A 5E2HA 3BLSA 4GZBA 2XDMA 3Q7VA 4JXVA 1SHVA 1MWRA 4RX2A 3Q07A 4WBGA 5KSCA 5FQQA 3UY6A 1GHPA 5FQ9A 3O87A 1FQGA 3N8LA 5DF8A 4OOMA 2ZLYA 4QD4A 1KVLA 1M40A 4WEJA 4N92A 3Q81A 4H8RA 4L0LA 1K6SA 4QB8A 1NY0A 4HESA 5FSRA 1MPLA 4IEDA 2J9OA 5GL9A 3G4PA 5GLBA 5FQKA 1GCEA 4R0QA 4M3KA 5AQ9A 3M2JA 1IYOA 2QPNA 4JXWA 4Y7PA 2G2WA 3DW0A 1K56D 3C4OA 2FFYA 5TR7A 3WRTA 4KG5A 4KG2A 1WYCA 3IT9A 2H0YA 2Y59A 2ZM0A 4K0XA 4N1XA 1WE4A 3BEBA 3PBTA 5FI6A 2FFFB 2JCHA 5CGWA 1H8YA 1LL5A 2WK0A 2XFTA 5EVID 3GVBA 4P85A 2GDNA 3AGEA 2H10A 3A3FA 1BUEA 1FSWA 3I7JA 3MFDA 3QNCA 5U47A 4HBTA 2EX8A 2VGKA 3Q7VB 4PM5A 4OONA 4ZJ3A 3PAGA 1DJCA 3FKWA 3ZGAB 1RP5A 2Y91A 4WMCD 4X69A 1ES4A 4DDYA 1BLHA 5A90A 1PZPA 3NIAA 1S0WA 1H5XA 5GHXA 5EOOA 3GSGA 4ZJ2A 1OMEA 3A3JA 3HLGA 2Y2GA 4JLFA 3GQZA 4OP8A 2PBYA 3WRZA 1ERMA 4E3OA 5F82A 3BFEA 2G2UA 1TDGA 2Q9NA 5KSHA 1K38A 4S2MA 3MXRA 2DRWA 1KE4A 5EOEA 1BSGA 4S2NA 3Q1FA 3SS4A 3NY4A 2Z2LB 4GDNA 5I94A 5HAQA 4S2KA 5HX9A 4PPRA 3V39A 1YM1A 3PBOA 4BQMA 1NZUA 5DF9A 4PM7A 3ZG7B 3ZG8B 3NCKA 2R9WA 1K25A 3NDEA 1KVMA 1WYBA 3AGFA 4DE3A 4OOYA 4UA6A 1DJBA 3VSKA 1BULA 1HTZA 4S2OA 4GOGA 4MBHA 5KMWA 1ES3A 4E3LA 3IF5A 2WADA 3UO9A 4JXSA 1ZKJA 2ZD8A 4JBFA 3WS4A 5GLDA 3Q82A 4E3IA 4ZDXA 1ONHA 1LI9A 2WKEA 1BLPA 3E2KA 4S2IA 5EVIA 5TFQA 1XKZA 2HP9A 3VFHA 4FD8A 1YLWA 3A3EA 5E43A 3WWXA 2EXBA 3VMAA 1KGGA 2HPBA 2ZC7A 3ZNYA 1J9MA 4KZBA 3SH9A 3PBSA 2Y2IA 1PI4A 4FCFA 4F94A 5FAQA 2CC1A 4KZ7A 2Y55A 4UHUA 1CK3A 4WMCA 2EFXA 3UNWA 4OPYA 2ZQ8A 4DE1A 1E3UA 4IBXA 3MZFA 2E8IA 4MLLA 3S22A 1U60A 3VOYA 4X68A 3IHAA 3PBRA 2HP6A 3C7UA 1L0DA 3B3XA 3GV9A 3HUMA 1L2SA 3SH7A 3N8SA 4KG6A 1ESIA 4WYYA 2XGNA 3E2LA 2WAEA 4BL2A 4EQIA 5CGXA 4BD0A 2ZQAA 4DKIA 1K54C 1IKIA 1RCJA 2R9XA 2Y2LA 4O7DA 1BT5A 4N9KA 2RL3A 4BLMA 1PWGA 1LLBA 3G30A 4R23A 3VSLA 1PWCA 3ZCZA 1O07A 2J8YA 3ZFZA 4DXCA 3RXWA 1I2WA 5CHJA 4K0WA 1PI5A 1XGJA 3OPRA 5EVIB 1GHIA 3MBZA 1KGEA 3CZDA 5AQAA 4YINA 3DWZA 5GLAA 3VP0A 1N9BA 1MKIA 5A92A 3VP1A 2Y2KA 1L0EA 4KZ5A 3FWLA 1YLJA 5EECA 4BD1A 3PBNA 4Y0UA 5CHMA 3ZHHA 1EWZA 4WZ5A 1CI9A 4KZ9A 1W5DA 4OKPA 1YLTA 4Y0OA 3CMZA 4LCLA 1HVBA 4XUZA 4OQGA 5FAPA 4ZJ1A 3V5MA 3O86A 3HVFA 3NC8A 4PMAA 2WUQA 2XFSA 2BG1A 3BM6A 3V50A 3IWQA 2C5WB 2V2FF 2HDSA 3BLMA 5DTTA 5IHVA 1JWPA 4GN2A 5HL1A 3N8RA 1ERQA 4P6BA 4EV4A 1MWTA 1PZOA 1ZC2A 4MBFA 4ZAMA 4NK3A 5FASA 5M19A 4EBPA 3CG5A 3HLCA 1VQQA 3G32A 1YLYA 2EX6A 3P98A 4EUZA 2Y4AA 1W8YA 2OLVA 2ZM2A 3ITBA 4CJNA 3HLEA 1K4EA 3HUNA 1KDWA 5CEBA 1KE3A 2PU2A 4QHCA 3ZVTA 3ZG9B 2ZJ9A 4KQQA 4UA9A 2V20A 3W4OA 1JTGA 3UPPA 3QHYA 1CI8A 5GHYA 3ZDJA 2VGJA 4R3BA 1I2SA 3IF6A 5FA7A 3V3SA 3CJMA 3A3DA 5CERA 4Y0TA 1MXOA 2QZ6A 2XD5A 3S1YA 2HP5A 1ESUA 3G2YA 4JF6A 1SDNA 1O7EA 2JC7A 1ONGA 3C5AA 4HEFA 2XLNA 4R1GA 2XH9A 5CRFA 1BTLA 1K6RA 5HFOA 5HAPA 4LENA 1IYSA 1Z6FA 2I72A 3DTMA 5D3OA 3IXBA 4QJGA 2P74A 4C75A 4DXBA 1HD8A 1G6AA 4E3MA 1G68A 5HW3A 1JWZA 3MXSA 1IKGA 4PM6A 4ZTKA 1QMFA 3ISGA 4C3QA 2IWCA 4GNUA 4OOLA 1M6KA 3M6BA 4S2JA 2WAFA 3HL9A 1BLSA 2DCFA 4WZ5C 2H5SA 3ZVWA 1W79A 4OLGA 4X55A 4ZBEA 3WS2A 3IWIA 4KENB 5A91A 1BLCA 1QMEA 3PAEA 1K56A 1DJAA 1C3BA 1YMXA 2J7VA 2ZQ9A 5TGFA 3IXGA 2EX2A 5JYOA 4OQ0A 3A3IA 5FDHA 2XK1A 2UWXA 4GDBA 4X56A 5DTSA 3LY4A 3GMWA 5CGSA 3FKVA 2HDRA 5E2EA 2XF3A 2XQZA 3IF6B 5FQJA 3M6HA 3OPPA 4E3NA 3G34A 2A3UA 5FQMA 1MY8A 4E6WA 1NYMA 1XA7A 4FH2A 4KQOA 5L2FA 1SDEA 4N1HA 4X6TA 5AQBA 1ES5A 1KGFA 2EXAA 4UAAA 2Q9MA 3VFFA 2JE5A 5AQ7A 2J9PA 3UN7A 1K57A 4U0TA 4EBLA 1ES2A 5KZHA
chains in the Genus database with same CATH superfamily
3F1OA 4I5SA 3MFXA 4JF5A 3SOIA 1IEMA 4H6JA 2H0TA 4BMWA 3JYIA 1TEMA 1K4FA 3F1PA 1XJ3A 1L0FA 4LV1A 1NWZA 2PAVP 2WYXA 3HLWA 2ZQ7A 5G18A 3VP4A 4WEKA 3KSFA 5CHUA 2Z2MB 2PR5A 1L0GA 4ID4A 4FSFA 3CWFA 2A2LA 3Q7ZA 1OJ5A 2EWWA 3UDIA 2W1TA 3F1OB 3N4IA 1Y54A 3IS2A 4MBKA 2V1ZA 4H6JB 1YLPA 3D4FA 2Y2MA 2HDUA 4CPKA 1K57C 1CEGA 1RGZA 4O8GA 4ETXA 3EEHA 1OT9A 4DE0A 2Z6DA 4RYEA 2A49A 5DTKA 3LIAA 3LO7A 3BFDA 1X0OA 1IOUA 1T18A 2P9VB 2WZZA 4HOIA 2HJ9C 4IVIA 4WM9A 3HLFA 4E6XA 4AFIA 4Q8IA 1SCWA 4WZ4A 3CHWP 3RXXA 2G7UA 2W1TB 1S4SA 1XJ6A 4LV3A 4DE2A 5FQIA 1WA9A 5DKLA 3FC7A 3IS2B 1XA1A 5E2GA 3P7NA 5FI2A 3KYZA 3LEZA 4KQRA 1K54A 2ZM8A 3ZG5A 4QPRA 1DP9A 3UDFA 3LI9A 3NULA 2OWHA 4HHDA 2Y2QA 3NOPC 4E3KA 2X71A 4QY5A 4B4ZA 1GSWA 3LR0A 5G4ZA 3WS0A 1Q2PA 4O0PA 4PM8A 5EUAA 1LSXA 1FCOA 5F1GA 1PYYA 2W3GA 4JXGA 4NETA 3W4PA 2ACGA 3IQAA 2A24A 3OBFA 4X25A 4EQ1A 3HJKA 5BOHA 2ZC5B 3UPOA 4HY8A 3FV7A 2JKGA 3OPHA 2XSSA 3NDGA 5EPHA 2PD8A 2JBFA 2YKHA 4QU3A 3RFBA 4MN6A 2VLGA 3Q07A 1F98A 1EW0A 5FQQA 1GHPA 5FQ9A 2KLIA 3KO6A 3N8LA 5DF8A 4OOMA 2ZLYA 4QD4A 1M40A 1P0ZA 4WEJA 1TS0A 3QP6A 3Q81A 3LI8A 1NY0A 1MPLA 2J9OA 3G4PA 5FQKA 4BBVA 4GS9A 4R0QA 3C4OA 4KG5A 3IT9A 4K0XA 5FI6A 3CUEA 5CGWA 2HV1A 2WK0A 2XFTA 5EVID 3GVBA 1D1JA 1IFQA 1BUEA 1K0KA 1DJCA 3FKWA 4GHIA 1ES4A 2V8CA 4FTXA 1S0WA 2JKTI 5AVEA 3A3JA 1TF1A 3LIDA 1BYWA 4EW7A 3NHQA 4Z1WA 4E3OA 3BFEA 2G2UA 4S2MA 4GS9B 1KE4A 3V39A 5LBRA 1S1YA 4E04A 1FILA 1CF0A 2R9WA 1K25A 1WYBA 1MKMA 1DJBA 3VSKA 1BULA 1HTZA 1XFNA 4E3LA 4JXSA 3UB6A 1OTAA 4GHIB 3WS4A 4LFUA 2IA2A 2Z6CA 4E3IA 4ZDXA 1ONHA 3E2KA 4S2IA 4NKPA 5EVIA 2P7JA 4LRZE 4FD8A 5TBMA 5E43A 2V9AA 3VMAA 2ZC7A 1YSQA 1ZTUA 2W0NA 3PBSA 2M7VA 1PI4A 4F94A 3UB8A 1TS6A 4DE1A 4FOFA 2E8IA 3IHAA 2HP6A 4BBTA 3B3XA 1L2SA 3FPVA 3E2LA 3EWKA 2W3HA 4DKIA 1K54C 2R9XA 4N9KA 5HDSA 1PWGA 1LLBA 3G30A 3ZCZA 2J8YA 3RXWA 1I2WA 1PI5A 1J3WA 4NG2A 5EVIB 1GHIA 3MBZA 1KGEA 5TBMB 3FG8A 1MKIA 3VP1A 1YLJA 2GNXA 4BD1A 5CHMA 5CX7A 1W5DA 3PXPA 3CMZA 4LCLA 1HVBA 3TW8A 3LIBA 1LSWA 2WUQA 2C5WB 5HL1A 3S7NA 1MWTA 3L7HA 1PZOA 4ZAMA 3HLCA 3G32A 4ESPA 1YLYA 4IUKA 4JGOA 2Y4AA 3ITBA 3A0SA 5DJUA 1KDWA 3ZVTA 2ZJ9A 5GHYA 4IUHA 2VGJA 1I2SA 3CJMA 5CERA 2QZ6A 2XD5A 4LRXC 3G2YA 1SDNA 5A8BA 2K31A 2XLNA 1BTLA 5HFOA 3DTMA 3T1RA 1OTIA 5J3WA 4E3MA 4XT2A 4ZTKA 4GNUA 4OOLA 2H5SA 3ZVWA 4X55A 4ZBEA 1CQAA 3LICA 3C8CA 2ZQ9A 3E4PA 3IXGA 3BY9A 2XK1A 2UWXA 1T19A 2EA9A 3CUEC 4LLOB 2HDRA 5FQJA 2D02A 3OPPA 3ZQ5A 5FQMA 4O01A 4KQOA 3D3OA 4PKYA 4B93A 1ES5A 4HJ6A 1V9YA 2J9PA 5F6AA 1K57A 5KZHA 4OPRA 2OSUA 1NJ4A 1FOFA 4XT2B 4GKUA 1DY6A 4OQIA 2QKPA 4L9EA 5EM1A 3UMEA 5HWVA 4G3VA 4JF4A 3M2KA 5CECA 1I5QA 5CTMA 1P97A 3G35A 3TRCA 1MC0A 1KDSA 3O88A 3G2ZA 4UA7A 4R4SA 2ZC6B 1S66L 3MQOA 5M1AA 4G3KA 2BTFP 3S4XA 3BY8A 5F1FA 3MKEA 3PTEA 4R3AA 4K08A 1CJFA 2Y2NA 3BFFA 3V3RA 4FH4A 3P09A 5FATA 3GTCA 5EVIC 5CTNA 4PM9A 1MWUA 3MKFA 2VZWA 5M18A 3MS6A 4OH0A 3GRJA 3LIEA 1EROA 2JN7A 3VP2A 4HBUA 1W8QA 3MZDA 3W8KA 3ZYTA 3KX0X 4GD8A 3UDXA 4LRYC 3HUOA 1GA9A 5CEDA 2YKFA 2OV5A 2W3DA 2C6WB 1NRFA 1DP8A 1FSYA 3BW6A 2ZQCA 3LYXA 1N9NA 4OP5A 4A5RA 3N7WA 3HLBA 4HJ4A 1VHMA 1XGIA 3MZEA 3VP3A 3UE1A 1IYQA 2PRFA 3UPNA 4GB7A 2WZXA 3K2NA 1YQSA 5A93A 4MCWA 1H8ZA 5GHZA 5HDDA 4EETB 2WGVA 4P0MA 5HARA 2KOIA 4I3AA 3JVUA 1LHYA 1TD5A 2Q0OA 3HBRA 4U0XA 1UGUA 5FI7A 5HL6A 2WKHA 1YT4A 2ZMVA 3UB5P 4JKTA 5EVLA 2EFUA 2V1BA 3NBLA 4NXEA 2JKTM 4EUVA 4I3JA 3C4PA 1LL9A 3IHBA 3H7WA 2VKSA 2GX5A 1XP4A 1AXBA 1N4OA 2JKFA 4LPZA 2E8JA 3VE4A 3OPLA 1CEFA 4S2LA 2PU4A 2P9VA 3O3VA 2ZQDA 3QNBA 4EESA 1NYYA 2Y2JA 1TS8A 3BLSA 4Y13A 4WBGA 5KSCA 2M1CA 3A0RA 5FEGA 4YNRA 1VEUA 4CLCD 3DTEA 4L0LA 4QB8A 4HESA 3LEQA 4IEDA 5GL9A 3H7WB 1GCEA 4Q0JA 4M3KA 4HIAA 2QPNA 4Y7PA 4KG2A 2PR6A 2ZM0A 3BEBA 2JCHA 5HD5A 1LL5A 3T4TA 2H10A 4ME4A 4GW9A 3MFDA 1ODVA 5U47A 4JGPA 3RTYA 1JNUA 1T1CA 4L9FA 4Y2FA 3T1QB 5L09A 1PZPA 3NIAA 5GHXA 5EOOA 3GSGA 4ZJ2A 3ULFA 3HLGA 1VEUB 4OP8A 3WRZA 1ERMA 4UQIS 1H8MA 4X1LA 3MQQA 2Q9NA 3MXRA 4II7A 5EOEA 4S2NA 3SS4A 4GDNA 5I94A 2GZAA 4UQIM 5HAQA 4PPRA 1YM1A 3PBOA 4BQMA 4Q0HA 3ZG7B 2WKPA 4R70A 3ZG8B 1MZUA 1ZHHB 3NCKA 3H9WA 4OOYA 4MN5A 1ZKJA 1OJGA 4GJ4A 1LI9A 5TFQA 3VFHA 1YLWA 3A3EA 1OTBA 1KGGA 2P08A 4KZBA 3SH9A 4Y5FA 3MR0A 1LSVA 5FAQA 3QP1A 2CC1A 5KIZA 4KZ7A 3UNWA 4OPYA 2PYPA 4Y15A 5TJJA 4I39A 4CLCB 4WN5A 1ESIA 3E4QA 3KYQA 3JVVA 2WAEA 2AVXA 2ZQAA 1ACFA 1BT5A 2HF6A 1V9ZA 4R23A 2WKQA 1O07A 1YKDA 3ZFZA 4DJ3A 1G5UA 3IX8A 5CHJA 4K0WA 3OPRA 1SZVA 2VV7A 4WF0A 1W63M 5GLAA 1T1BA 1PNEA 4KZ5A 5G4YA 4HNBA 2W27A 1PRQA 4OKPA 3T50A 4Y0OA 4OQGA 5FAPA 3V5MA 4GLQA 3C30A 3VE3A 3PR6A 3R7WB 2BG1A 3BM6A 3E98A 3CPTB 1JWPA 1NRJA 4P6BA 4EV4A 2I9VA 1ZC2A 3CLOA 5FASA 5M19A 4EERA 2O9AA 1W8YA 2OLVA 2ZM2A 4CJNA 3HLEA 1K4EA 3HUNA 4QHCA 3ZG9B 2Y8HA 2V20A 3UPPA 2QWSA 5FA7A 3IF6A 5FDSA 2HP5A 1ESUA 1O7EA 1ONGA 4HEFA 4R1GA 5CRFA 3KSIA 5HAPA 1IYSA 5D3OA 4QJGA 2P74A 1HD8A 1G6AA 3MXSA 4PM6A 3ISGA 4KUOA 2IWCA 3HL9A 1BLSA 1QMEA 1C3BA 5TGFA 3LIFA 5JYOA 5FDHA 5FEFA 2V0WA 5DTSA 3UMDA 5CGSA 3FKVA 3D72A 2XF3A 3IF6B 2ZBBA 3GECA 3M6HA 4E3NA 1XA7A 5L2FA 2Q9MA 2JE5A 5AQ7A 3UN7A 4HP4A 4U0TA 3HUMA 4G3WA 1JTDA 3EQVA 3BWLA 3HREA 5AJGA 3HLDA 1MWSA 1NLZA 4HH2A 1XX2A 4DDSA 2WKRA 3BECA 1JWVA 5JYPA 4ARZB 1JVJA 4S2NC 3UE0A 2VA0A 2JHEA 4EBNA 3BFGA 3CITA 2XA7S 4XUXA 1PWDA 2BLSA 3OCNA 3LY3A 2XA7M 4B4XA 5DF7A 1XXMA 5J8XA 4OQHA 3NI9A 4GD6A 5HPFA 5J4EA 3EGXC 5L07A 4OPZA 1S6RA 1NXYA 3RJUA 4LV0A 4EXOA 1FR6A 5CXWA 2XD1A 3BJNA 1D7EA 1FCMA 4BENA 4EWFA 5AVFA 5E2FA 2B18A 2OAP1 3HJIA 2IWBA 4X53A 1ALQA 1RGYA 3IXDA 3OC2A 3BRMA 3OCLA 5MC7A 4MEZA 3PBQA 2HDQA 2Y2PA 2OLUA 1T1AA 2CMNA 2Y2HA 5EFWA 5F83A 3TG9A 4B88A 1E3UD 2WGWA 2XR0A 3IH8A 3SW1A 1TVFA 4N9LA 4BL3A 2K2NA 3SZTA 1Q2QA 4U3TA 2ZC3B 3ZNTA 2PD7A 1BZAA 3N6IA 4YOFA 3OLOA 4IVKA 1S1ZA 1Y4OA 3DWKA 3VOLA 3F1NA 5HZHA 1MBLA 2HJEA 3SS5A 4Z9QA 2VGLS 1E4DA 1PIOA 1TDLA 1XPBA 1K55C 1TS7A 2W3EA 2VGLM 2WGWB 3GR2A 1ZG6A 3IF6C 1SKFA 2PDRA 3TSGA 2B5RA 2JKRI 2L0WA 3LR4A 2ZC4B 1FR1A 4KQDA 2J3TD 4KZ8A 3EOIA 3F1NB 3MJQA 2OOLA 2LB9A 1EI5A 2WKIA 2XEPA 1UWNX 3TOIA 1H3QA 1LI0A 3JPUA 3IWOA 5E2HA 4GZBA 2XDMA 3Q7VA 4IJGA 1SHVA 1MWRA 1YAXA 2O0YA 2LB5A 4RX2A 4JXVA 5EV0A 3UY6A 3O87A 2DMWA 2MJ6A 4N92A 1K6SA 5FSRA 5GLBA 2PYRA 4L9GA 3M2JA 1IYOA 4JXWA 2G2WA 5TR7A 1K56D 1LT0A 2H0YA 5L10A 1WE4A 1OPXA 4P85A 3AGEA 2KX6A 2L4RA 2HGVA 1FSWA 3I7JA 4HBTA 1UWPX 2VGKA 3Q7VB 4PM5A 3QP8A 4R6LA 4MN7A 2Y91A 2L1MA 4X69A 4Q0IA 1BLHA 1SKOA 3DBAA 3IX4A 1H5XA 3B47A 3K3DA 4GCZA 1OMEA 4JLFA 2W1RA 4EEPA 4Y17A 5K5BA 2PBYA 1FIKA 2B02A 4I3IA 1TDGA 1PFLA 1K38A 2DRWA 1Y28A 4S2KA 4BBUA 3ICYA 3NJAA 5DF9A 3MXQA 1N9OA 5FL3A 3AGFA 4DE3A 1H0MA 4S2OA 4GOGA 3HCYA 5KMWA 1ES3A 3UO9A 2WADA 4NXGA 2ZD8A 5GLDA 2ZOHA 2J3WA 2WKEA 1SKOB 1XKZA 1L3LA 2EXBA 3ZNYA 3QP4A 1J9MA 4UEYA 2Y2IA 5EM0A 1HLUP 4FCFA 3EEAA 3A0VA 4UHUA 4X1MA 1CK3A 2KDKA 2EWVA 2ZQ8A 3MZFA 3LR3A 4X68A 3PBRA 1L0DA 3GV9A 4ETZA 3SH7A 2O9BA 1VETA 2R78A 5CGXA 4BD0A 3R4KA 1RCJA 2Y79A 2INWA 1D06A 1XGJA 3DTKA 3IBRA 3CZDA 4YINA 3OOVA 5IS1A 2Y2KA 5EVEA 3T1SA 2V8FA 3PBNA 4HP9A 4KZ9A 1YLTA 1NLYA 3DAVA 4ZJ1A 4DN0A 1VETB 4MDZA 4PMAA 3LR5A 2V2FF 2HDSA 5IHVA 3F1PB 3N8RA 4Y3IA 3C38A 1VQQA 2EX6A 3T4SA 4EUZA 4UA9A 3W4OA 1JTGA 3QHYA 1CI8A 3ZDJA 4R3BA 5HPIA 4Y0TA 3E0YA 3H82A 3S1YA 2H28A 4JF6A 2ZOIA 5IU1A 4BWIA 2XH9A 4LENA 1Z6FA 4C75A 4DXBA 3EGDC 4CLCA 1G68A 4PHTA 1QMFA 4EEUA 2K7SA 1M6KA 3M6BA 4WZ5C 3IX3A 3T4QA 3WS2A 5F69A 5A91A 3MMHA 4OQ0A 3G6OA 4X56A 4NXBA 3G34A 3S7QA 4CQHA 2J3TC 1MY8A 3H82B 1NYMA 4FH2A 5DFXA 4WLAA 2PHYA 1SDEA 4N1HA 2HZ5A 1KGFA 2EXAA 4UAAA 5L8MA 3VFFA 2GJ3A 1VB6A 4RQ9A 3KYEA 5F68A 1ES2A 3C7VA 5HWWA 1G6OA 2VJWA 1KE0A 3NOUC 3R7WA 1IYPA 1GA0A 3CPTA 4B9OA 3C2WA 3D9YA 3BQAA 4HH3A 1GHMA 4JPMA 4D2OA 1NZOA 3BFCA 4OLDA 3PYPA 2IWDA 4WELA 5GLCA 2FH5A 4C6YA 4NEED 2WGIA 4IBRA 4KUKA 2VX8A 2J80A 3U2AA 3WS1A 4E3JA 1YLZA 5C5KA 2P04A 5HD3A 3VOZA 1DP6A 1W7FA 4K91A 4LGWA 2A24B 3ITAA 2VEAA 4RVAA 2JKRM 1YSPA 4KZ3A 1K55A 3T4OA 3UE3A 1P9RA 2BASA 4OVDA 4KZ4A 2X02A 4S2PA 4LCMA 4RX3A 3G31A 2NUPC 3U4LP 4KZAA 1E25A 4BJPA 3UB9A 4LV2A 2D01A 2RCXA 2X01A 1P9WA 5DVAA 3IH9A 3WS5A 3FZCA 2XRNA 4ARZA 2XROA 3EQUA 1FCNA 3QP2A 4IHQA 1PW8A 1PW1A 1HZOA 3QP5A 3SH8A 1OTEA 4R3JA 4QY6A 1LL8A 3KSHA 5FAOA 3AGDA 3MF0A 2NUTC 1VM1A 4RA7A 1ZG4A 2PBDP 2DNSA 4YFMA 2ZMAA 4KZ6A 3BYDA 4DF6A 3KSGA 5HAIA 2QMIA 3W4QA 4XXRA 4MNRA 4CLCC 4P87A 3FYZA 1YMSA 5DFYA 1IELA 4P6ZS 3LCEA 5IT5A 4DJ2A 3IXHA 4R4RA 3SS3A 4DRTA 1F9IA 2EX9A 4P6ZM 5EE8A 3ZG0A 3OZHA 2M7UA 2Y2OA 4OPQA 3CAXA 1GSVA 1FQGA 1KVLA 1A0KA 1S4RA 3T4KA 4H8RA 3T4JA 2OAQ1 5AQ9A 3S7OA 3DW0A 2FFYA 3WRTA 1WYCA 2Y59A 4N1XA 3UB7A 3PBTA 2FFFB 4ZRRA 1XFQA 1H8YA 4JGRA 1GSXA 2GDNA 3A3FA 3QNCA 4FUWA 2EX8A 4OONA 4ZJ3A 3PAGA 3ZGAB 1RP5A 4WMCD 4DDYA 1XJ2A 5A90A 2QHKA 3BQ8A 2Y2GA 5DJTA 3GQZA 3P01A 3T1XA 4HI4A 4WUJA 5F82A 5KSHA 5I5LA 3MSHA 1BSGA 1XJ4A 3Q1FA 3L9KA 3NY4A 2Z2LB 5HX9A 1NZUA 4PM7A 3V67A 3MQ0A 3GDIA 3NDEA 4M4XA 1KVMA 4UA6A 2PT7A 2VV6A 4MBHA 3LGOA 3IF5A 3TJZC 3TE8A 4JBFA 3LFVA 2VV8A 3B42A 3Q82A 1OT6A 1BLPA 1S67L 2QJ5A 1STZA 3B33A 4DMZA 2QJ7A 2HP9A 3FPWA 3WWXA 2UV0E 2V0UA 2HPBA 2W3FA 4WMCA 2Y55A 2EFXA 1E3UA 4IBXA 3VOYA 4MLLA 3S22A 4EU0A 1U60A 3C7UA 3N8SA 4KG6A 1Z09A 4WYYA 3O5YA 2XGNA 4BL2A 4EQIA 1YPRA 1IKIA 2Y2LA 4O7DA 3CI6A 2O9CA 4HJ3A 3VV4A 1G28A 2RL3A 4BLMA 5HWTA 3VSLA 2QYBA 1PWCA 4DXCA 4WL9A 5DKKA 3K3CA 4JGQA 5AQAA 3DWZA 3VP0A 1N9BA 2B95A 5A92A 1L0EA 4R38A 3PHYA 3FWLA 5EECA 2O99A 4Y0UA 3W2ZA 3ZHHA 1EWZA 4WZ5A 1CI9A 5HDCA 4XUZA 4HQAA 3O86A 3HVFA 3DTIA 3NC8A 2XFSA 3V50A 3UE6A 3IWQA 4F3LA 5DTTA 3BLMA 1KOUA 4GN2A 3T4LA 1ERQA 5HSQA 4YWZA 4MBFA 4QWOA 4NK3A 3IBJA 4EBPA 4PKYG 3CG5A 2VK3A 3P98A 5CEBA 1KE3A 2PU2A 4CLCE 4KQQA 1W63Q 3RH8B 3S7PA 3V3SA 2ZL1A 3A3DA 4I38A 1MXOA 2JC7A 3C5AA 5J7EA 1K6RA 1N9LA 2I72A 4MMNA 3IXBA 5HW3A 1JWZA 4F3LB 1IKGA 4C3QA 3T12B 3NOTC 4S2JA 2WAFA 2DCFA 2FZ0A 1W79A 2ZMFA 4OLGA 1F2KA 3IWIA 4KENB 1BLCA 3PAEA 1K56A 1DJAA 1YMXA 2J7VA 2EX2A 3A3IA 4GDBA 2V1AA 4PAUA 4NXFA 3LY4A 3NECA 3GMWA 1OTDA 5E2EA 2XQZA 2OWJA 2ZL1B 2A3UA 5F5YA 4E6WA 3LUQA 1AWIA 5AQBA 4X6TA 3E4OA 4D60A 1F5MA 1DRMA 4EBLA
chains in the Genus database with same CATH topology
1JTDA 3C7VA 2OSUA 4OPRA 1NJ4A 1KE0A 3EQVA 1FOFA 4JF5A 3HREA 4GKUA 1DY6A 4OQIA 3SOIA 3HLDA 1MWSA 1IYPA 1IEMA 1XX2A 4DDSA 1GA0A 2H0TA 3BECA 1JWVA 1TEMA 3JYIA 4JF4A 1K4FA 3M2KA 5JYPA 5CECA 1JVJA 1I5QA 5CTMA 4S2NC 1L0FA 3UE0A 4LV1A 3G35A 1KDSA 4EBNA 3O88A 3G2ZA 4UA7A 4R4SA 2WYXA 2ZC6B 3HLWA 3BFGA 1GHMA 2ZQ7A 4JPMA 4D2OA 5M1AA 3S4XA 5G18A 5F1FA 1NZOA 3MKEA 4XUXA 3PTEA 4WEKA 3VP4A 3BFCA 1PWDA 4OLDA 5CHUA 2BLSA 2Z2MB 2IWDA 3OCNA 4WELA 5GLCA 3LY3A 2Y2NA 3BFFA 4C6YA 3V3RA 1L0GA 4ID4A 4FH4A 4FSFA 4B4XA 3P09A 5DF7A 1XXMA 5FATA 3Q7ZA 3GTCA 5EVIC 5J8XA 2WGIA 3UDIA 4OQHA 4PM9A 3NI9A 4GD6A 5CTNA 1MWUA 4IBRA 3N4IA 1Y54A 3MKFA 4OPZA 5M18A 1S6RA 4MBKA 1NXYA 3WS1A 3RJUA 2V1ZA 4E3JA 1YLZA 4LV0A 1YLPA 4OH0A 3VOZA 1FR6A 1W7FA 5CXWA 3GRJA 3D4FA 2Y2MA 4K91A 2HDUA 2XD1A 1EROA 4CPKA 1K57C 1CEGA 1RGZA 3ITAA 1FCMA 3VP2A 4RVAA 4HBUA 4BENA 1W8QA 3MZDA 3W8KA 4EWFA 4DE0A 4RYEA 4KZ3A 4GD8A 3UDXA 2A49A 5DTKA 3LO7A 5E2FA 1K55A 3UE3A 4OVDA 3BFDA 3HUOA 4KZ4A 1GA9A 2X02A 4S2PA 2P9VB 2WZZA 2IWBA 4LCMA 1ALQA 1RGYA 4X53A 5CEDA 3IXDA 3OC2A 4RX3A 3BRMA 4IVIA 3G31A 2OV5A 4WM9A 3OCLA 4MEZA 3HLFA 2C6WB 1NRFA 3PBQA 2HDQA 1FSYA 2Y2PA 4KZAA 2ZQCA 4E6XA 1E25A 4Q8IA 1SCWA 4WZ4A 4OP5A 3RXXA 4BJPA 4A5RA 3N7WA 4LV2A 2OLUA 4LV3A 5FQIA 3HLBA 2Y2HA 5F83A 4DE2A 3TG9A 2RCXA 4B88A 1E3UD 2WGWA 1XGIA 1XA1A 2XR0A 3IH8A 2X01A 3MZEA 3VP3A 5E2GA 3UE1A 1TVFA 1IYQA 4N9LA 4BL3A 5FI2A 5DVAA 3IH9A 3LEZA 3UPNA 3WS5A 1Q2QA 3FZCA 4KQRA 4GB7A 1K54A 2WZXA 2ZC3B 4U3TA 3ZNTA 1YQSA 5A93A 3EQUA 1FCNA 1H8ZA 1BZAA 1PW8A 2ZM8A 5GHZA 3N6IA 3ZG5A 3UDFA 4IVKA 3DWKA 2WGVA 1PW1A 4P0MA 5HARA 2Y2QA 4E3KA 1HZOA 1MBLA 3SS5A 3SH8A 2X71A 4QY5A 4B4ZA 1LHYA 4R3JA 3HBRA 4U0XA 4Z9QA 3WS0A 4QY6A 5FI7A 1E4DA 1PIOA 1TDLA 1XPBA 2WKHA 5FAOA 1K55C 1Q2PA 1YT4A 3AGDA 4JKTA 4PM8A 5EVLA 1VM1A 2WGWB 4RA7A 5EUAA 1ZG4A 3GR2A 1ZG6A 3IF6C 2DNSA 4YFMA 2EFUA 1FCOA 1SKFA 5F1GA 2ZMAA 3NBLA 1PYYA 4KZ6A 4JXGA 3BYDA 4DF6A 4NETA 5HAIA 3W4PA 3IQAA 2B5RA 2QMIA 3TSGA 3W4QA 4XXRA 3C4PA 1LL9A 4MNRA 3IHBA 4P87A 3FYZA 1YMSA 2ZC4B 1FR1A 1XP4A 1AXBA 1N4OA 5BOHA 4KZ8A 1IELA 2ZC5B 3LCEA 3UPOA 3OPLA 1CEFA 4S2LA 3IXHA 3FV7A 4R4RA 2PU4A 3OPHA 2P9VA 3O3VA 3NDGA 3SS3A 4DRTA 2EX9A 2ZQDA 2JBFA 1EI5A 5EE8A 5EPHA 3ZG0A 2WKIA 2XEPA 3QNBA 1NYYA 3OZHA 3TOIA 1LI0A 2Y2OA 2Y2JA 3IWOA 4OPQA 4QU3A 5E2HA 3BLSA 4GZBA 2XDMA 3Q7VA 4JXVA 1SHVA 1MWRA 4RX2A 3Q07A 4WBGA 5KSCA 5FQQA 3UY6A 1GHPA 5FQ9A 3O87A 1FQGA 3N8LA 5DF8A 4OOMA 2ZLYA 4QD4A 1KVLA 1M40A 4WEJA 4N92A 3Q81A 4H8RA 4L0LA 1K6SA 4QB8A 1NY0A 4HESA 5FSRA 1MPLA 4IEDA 2J9OA 5GL9A 3G4PA 5GLBA 5FQKA 1GCEA 4R0QA 4M3KA 5AQ9A 3M2JA 1IYOA 2QPNA 4JXWA 4Y7PA 2G2WA 3DW0A 1K56D 3C4OA 2FFYA 5TR7A 3WRTA 4KG5A 4KG2A 1WYCA 3IT9A 2H0YA 2Y59A 2ZM0A 4K0XA 4N1XA 1WE4A 3BEBA 3PBTA 5FI6A 2FFFB 2JCHA 5CGWA 1H8YA 1LL5A 2WK0A 2XFTA 5EVID 3GVBA 4P85A 2GDNA 3AGEA 2H10A 3A3FA 1BUEA 1FSWA 3I7JA 3MFDA 3QNCA 5U47A 4HBTA 2EX8A 2VGKA 3Q7VB 4PM5A 4OONA 4ZJ3A 3PAGA 1DJCA 3FKWA 3ZGAB 1RP5A 2Y91A 4WMCD 4X69A 1ES4A 4DDYA 1BLHA 5A90A 1PZPA 3NIAA 1S0WA 1H5XA 5GHXA 5EOOA 3GSGA 4ZJ2A 1OMEA 3A3JA 3HLGA 2Y2GA 4JLFA 3GQZA 4OP8A 2PBYA 3WRZA 1ERMA 4E3OA 5F82A 3BFEA 2G2UA 1TDGA 2Q9NA 5KSHA 1K38A 4S2MA 3MXRA 2DRWA 1KE4A 5EOEA 1BSGA 4S2NA 3Q1FA 3SS4A 3NY4A 2Z2LB 4GDNA 5I94A 5HAQA 4S2KA 5HX9A 4PPRA 3V39A 1YM1A 3PBOA 4BQMA 1NZUA 5DF9A 4PM7A 3ZG7B 3ZG8B 3NCKA 2R9WA 1K25A 3NDEA 1KVMA 1WYBA 3AGFA 4DE3A 4OOYA 4UA6A 1DJBA 3VSKA 1BULA 1HTZA 4S2OA 4GOGA 4MBHA 5KMWA 1ES3A 4E3LA 3IF5A 2WADA 3UO9A 4JXSA 1ZKJA 2ZD8A 4JBFA 3WS4A 5GLDA 3Q82A 4E3IA 4ZDXA 1ONHA 1LI9A 2WKEA 1BLPA 3E2KA 4S2IA 5EVIA 5TFQA 1XKZA 2HP9A 3VFHA 4FD8A 1YLWA 3A3EA 5E43A 3WWXA 2EXBA 3VMAA 1KGGA 2HPBA 2ZC7A 3ZNYA 1J9MA 4KZBA 3SH9A 3PBSA 2Y2IA 1PI4A 4FCFA 4F94A 5FAQA 2CC1A 4KZ7A 2Y55A 4UHUA 1CK3A 4WMCA 2EFXA 3UNWA 4OPYA 2ZQ8A 4DE1A 1E3UA 4IBXA 3MZFA 2E8IA 4MLLA 3S22A 1U60A 3VOYA 4X68A 3IHAA 3PBRA 2HP6A 3C7UA 1L0DA 3B3XA 3GV9A 3HUMA 1L2SA 3SH7A 3N8SA 4KG6A 1ESIA 4WYYA 2XGNA 3E2LA 2WAEA 4BL2A 4EQIA 5CGXA 4BD0A 2ZQAA 4DKIA 1K54C 1IKIA 1RCJA 2R9XA 2Y2LA 4O7DA 1BT5A 4N9KA 2RL3A 4BLMA 1PWGA 1LLBA 3G30A 4R23A 3VSLA 1PWCA 3ZCZA 1O07A 2J8YA 3ZFZA 4DXCA 3RXWA 1I2WA 5CHJA 4K0WA 1PI5A 1XGJA 3OPRA 5EVIB 1GHIA 3MBZA 1KGEA 3CZDA 5AQAA 4YINA 3DWZA 5GLAA 3VP0A 1N9BA 1MKIA 5A92A 3VP1A 2Y2KA 1L0EA 4KZ5A 3FWLA 1YLJA 5EECA 4BD1A 3PBNA 4Y0UA 5CHMA 3ZHHA 1EWZA 4WZ5A 1CI9A 4KZ9A 1W5DA 4OKPA 1YLTA 4Y0OA 3CMZA 4LCLA 1HVBA 4XUZA 4OQGA 5FAPA 4ZJ1A 3V5MA 3O86A 3HVFA 3NC8A 4PMAA 2WUQA 2XFSA 2BG1A 3BM6A 3V50A 3IWQA 2C5WB 2V2FF 2HDSA 3BLMA 5DTTA 5IHVA 1JWPA 4GN2A 5HL1A 3N8RA 1ERQA 4P6BA 4EV4A 1MWTA 1PZOA 1ZC2A 4MBFA 4ZAMA 4NK3A 5FASA 5M19A 4EBPA 3CG5A 3HLCA 1VQQA 3G32A 1YLYA 2EX6A 3P98A 4EUZA 2Y4AA 1W8YA 2OLVA 2ZM2A 3ITBA 4CJNA 3HLEA 1K4EA 3HUNA 1KDWA 5CEBA 1KE3A 2PU2A 4QHCA 3ZVTA 3ZG9B 2ZJ9A 4KQQA 4UA9A 2V20A 3W4OA 1JTGA 3UPPA 3QHYA 1CI8A 5GHYA 3ZDJA 2VGJA 4R3BA 1I2SA 3IF6A 5FA7A 3V3SA 3CJMA 3A3DA 5CERA 4Y0TA 1MXOA 2QZ6A 2XD5A 3S1YA 2HP5A 1ESUA 3G2YA 4JF6A 1SDNA 1O7EA 2JC7A 1ONGA 3C5AA 4HEFA 2XLNA 4R1GA 2XH9A 5CRFA 1BTLA 1K6RA 5HFOA 5HAPA 4LENA 1IYSA 1Z6FA 2I72A 3DTMA 5D3OA 3IXBA 4QJGA 2P74A 4C75A 4DXBA 1HD8A 1G6AA 4E3MA 1G68A 5HW3A 1JWZA 3MXSA 1IKGA 4PM6A 4ZTKA 1QMFA 3ISGA 4C3QA 2IWCA 4GNUA 4OOLA 1M6KA 3M6BA 4S2JA 2WAFA 3HL9A 1BLSA 2DCFA 4WZ5C 2H5SA 3ZVWA 1W79A 4OLGA 4X55A 4ZBEA 3WS2A 3IWIA 4KENB 5A91A 1BLCA 1QMEA 3PAEA 1K56A 1DJAA 1C3BA 1YMXA 2J7VA 2ZQ9A 5TGFA 3IXGA 2EX2A 5JYOA 4OQ0A 3A3IA 5FDHA 2XK1A 2UWXA 4GDBA 4X56A 5DTSA 3LY4A 3GMWA 5CGSA 3FKVA 2HDRA 5E2EA 2XF3A 2XQZA 3IF6B 5FQJA 3M6HA 3OPPA 4E3NA 3G34A 2A3UA 5FQMA 1MY8A 4E6WA 1NYMA 1XA7A 4FH2A 4KQOA 5L2FA 1SDEA 4N1HA 4X6TA 5AQBA 1ES5A 1KGFA 2EXAA 4UAAA 2Q9MA 3VFFA 2JE5A 5AQ7A 2J9PA 3UN7A 1K57A 4U0TA 4EBLA 1ES2A 5KZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTD A;  3C7V A;  2OSU A;  4OPR A;  1NJ4 A;  1KE0 A;  3EQV A;  1FOF A;  4JF5 A;  3HRE A;  4GKU A;  1DY6 A;  4OQI A;  3SOI A;  3HLD A;  1MWS A;  1IYP A;  1IEM A;  1XX2 A;  4DDS A;  1GA0 A;  2H0T A;  3BEC A;  1JWV A;  1TEM A;  3JYI A;  4JF4 A;  1K4F A;  3M2K A;  5JYP A;  5CEC A;  1JVJ A;  1I5Q A;  5CTM A;  4S2N C;  1L0F A;  3UE0 A;  4LV1 A;  3G35 A;  1KDS A;  4EBN A;  3O88 A;  3G2Z A;  4UA7 A;  4R4S A;  2WYX A;  2ZC6 B;  3HLW A;  3BFG A;  1GHM A;  2ZQ7 A;  4JPM A;  4D2O A;  5M1A A;  3S4X A;  5G18 A;  5F1F A;  1NZO A;  3MKE A;  4XUX A;  3PTE A;  4WEK A;  3VP4 A;  3BFC A;  1PWD A;  4OLD A;  5CHU A;  2BLS A;  2Z2M B;  2IWD A;  3OCN A;  4WEL A;  5GLC A;  3LY3 A;  2Y2N A;  3BFF A;  4C6Y A;  3V3R A;  1L0G A;  4ID4 A;  4FH4 A;  4FSF A;  4B4X A;  3P09 A;  5DF7 A;  1XXM A;  5FAT A;  3Q7Z A;  3GTC A;  5EVI C;  5J8X A;  2WGI A;  3UDI A;  4OQH A;  4PM9 A;  3NI9 A;  4GD6 A;  5CTN A;  1MWU A;  4IBR A;  3N4I A;  1Y54 A;  3MKF A;  4OPZ A;  5M18 A;  1S6R A;  4MBK A;  1NXY A;  3WS1 A;  3RJU A;  2V1Z A;  4E3J A;  1YLZ A;  4LV0 A;  1YLP A;  4OH0 A;  3VOZ A;  1FR6 A;  1W7F A;  5CXW A;  3GRJ A;  3D4F A;  2Y2M A;  4K91 A;  2HDU A;  2XD1 A;  1ERO A;  4CPK A;  1K57 C;  1CEG A;  1RGZ A;  3ITA A;  1FCM A;  3VP2 A;  4RVA A;  4HBU A;  4BEN A;  1W8Q A;  3MZD A;  3W8K A;  4EWF A;  4DE0 A;  4RYE A;  4KZ3 A;  4GD8 A;  3UDX A;  2A49 A;  5DTK A;  3LO7 A;  5E2F A;  1K55 A;  3UE3 A;  4OVD A;  3BFD A;  3HUO A;  4KZ4 A;  1GA9 A;  2X02 A;  4S2P A;  2P9V B;  2WZZ A;  2IWB A;  4LCM A;  1ALQ A;  1RGY A;  4X53 A;  5CED A;  3IXD A;  3OC2 A;  4RX3 A;  3BRM A;  4IVI A;  3G31 A;  2OV5 A;  4WM9 A;  3OCL A;  4MEZ A;  3HLF A;  2C6W B;  1NRF A;  3PBQ A;  2HDQ A;  1FSY A;  2Y2P A;  4KZA A;  2ZQC A;  4E6X A;  1E25 A;  4Q8I A;  1SCW A;  4WZ4 A;  4OP5 A;  3RXX A;  4BJP A;  4A5R A;  3N7W A;  4LV2 A;  2OLU A;  4LV3 A;  5FQI A;  3HLB A;  2Y2H A;  5F83 A;  4DE2 A;  3TG9 A;  2RCX A;  4B88 A;  1E3U D;  2WGW A;  1XGI A;  1XA1 A;  2XR0 A;  3IH8 A;  2X01 A;  3MZE A;  3VP3 A;  5E2G A;  3UE1 A;  1TVF A;  1IYQ A;  4N9L A;  4BL3 A;  5FI2 A;  5DVA A;  3IH9 A;  3LEZ A;  3UPN A;  3WS5 A;  1Q2Q A;  3FZC A;  4KQR A;  4GB7 A;  1K54 A;  2WZX A;  2ZC3 B;  4U3T A;  3ZNT A;  1YQS A;  5A93 A;  3EQU A;  1FCN A;  1H8Z A;  1BZA A;  1PW8 A;  2ZM8 A;  5GHZ A;  3N6I A;  3ZG5 A;  3UDF A;  4IVK A;  3DWK A;  2WGV A;  1PW1 A;  4P0M A;  5HAR A;  2Y2Q A;  4E3K A;  1HZO A;  1MBL A;  3SS5 A;  3SH8 A;  2X71 A;  4QY5 A;  4B4Z A;  1LHY A;  4R3J A;  3HBR A;  4U0X A;  4Z9Q A;  3WS0 A;  4QY6 A;  5FI7 A;  1E4D A;  1PIO A;  1TDL A;  1XPB A;  2WKH A;  5FAO A;  1K55 C;  1Q2P A;  1YT4 A;  3AGD A;  4JKT A;  4PM8 A;  5EVL A;  1VM1 A;  2WGW B;  4RA7 A;  5EUA A;  1ZG4 A;  3GR2 A;  1ZG6 A;  3IF6 C;  2DNS A;  4YFM A;  2EFU A;  1FCO A;  1SKF A;  5F1G A;  2ZMA A;  3NBL A;  1PYY A;  4KZ6 A;  4JXG A;  3BYD A;  4DF6 A;  4NET A;  5HAI A;  3W4P A;  3IQA A;  2B5R A;  2QMI A;  3TSG A;  3W4Q A;  4XXR A;  3C4P A;  1LL9 A;  4MNR A;  3IHB A;  4P87 A;  3FYZ A;  1YMS A;  2ZC4 B;  1FR1 A;  1XP4 A;  1AXB A;  1N4O A;  5BOH A;  4KZ8 A;  1IEL A;  2ZC5 B;  3LCE A;  3UPO A;  3OPL A;  1CEF A;  4S2L A;  3IXH A;  3FV7 A;  4R4R A;  2PU4 A;  3OPH A;  2P9V A;  3O3V A;  3NDG A;  3SS3 A;  4DRT A;  2EX9 A;  2ZQD A;  2JBF A;  1EI5 A;  5EE8 A;  5EPH A;  3ZG0 A;  2WKI A;  2XEP A;  3QNB A;  1NYY A;  3OZH A;  3TOI A;  1LI0 A;  2Y2O A;  2Y2J A;  3IWO A;  4OPQ A;  4QU3 A;  5E2H A;  3BLS A;  4GZB A;  2XDM A;  3Q7V A;  4JXV A;  1SHV A;  1MWR A;  4RX2 A;  3Q07 A;  4WBG A;  5KSC A;  5FQQ A;  3UY6 A;  1GHP A;  5FQ9 A;  3O87 A;  1FQG A;  3N8L A;  5DF8 A;  4OOM A;  2ZLY A;  4QD4 A;  1KVL A;  1M40 A;  4WEJ A;  4N92 A;  3Q81 A;  4H8R A;  4L0L A;  1K6S A;  4QB8 A;  1NY0 A;  4HES A;  5FSR A;  1MPL A;  4IED A;  2J9O A;  5GL9 A;  3G4P A;  5GLB A;  5FQK A;  1GCE A;  4R0Q A;  4M3K A;  5AQ9 A;  3M2J A;  1IYO A;  2QPN A;  4JXW A;  4Y7P A;  2G2W A;  3DW0 A;  1K56 D;  3C4O A;  2FFY A;  5TR7 A;  3WRT A;  4KG5 A;  4KG2 A;  1WYC A;  3IT9 A;  2H0Y A;  2Y59 A;  2ZM0 A;  4K0X A;  4N1X A;  1WE4 A;  3BEB A;  3PBT A;  5FI6 A;  2FFF B;  2JCH A;  5CGW A;  1H8Y A;  1LL5 A;  2WK0 A;  2XFT A;  5EVI D;  3GVB A;  4P85 A;  2GDN A;  3AGE A;  2H10 A;  3A3F A;  1BUE A;  1FSW A;  3I7J A;  3MFD A;  3QNC A;  5U47 A;  4HBT A;  2EX8 A;  2VGK A;  3Q7V B;  4PM5 A;  4OON A;  4ZJ3 A;  3PAG A;  1DJC A;  3FKW A;  3ZGA B;  1RP5 A;  2Y91 A;  4WMC D;  4X69 A;  1ES4 A;  4DDY A;  1BLH A;  5A90 A;  1PZP A;  3NIA A;  1S0W A;  1H5X A;  5GHX A;  5EOO A;  3GSG A;  4ZJ2 A;  1OME A;  3A3J A;  3HLG A;  2Y2G A;  4JLF A;  3GQZ A;  4OP8 A;  2PBY A;  3WRZ A;  1ERM A;  4E3O A;  5F82 A;  3BFE A;  2G2U A;  1TDG A;  2Q9N A;  5KSH A;  1K38 A;  4S2M A;  3MXR A;  2DRW A;  1KE4 A;  5EOE A;  1BSG A;  4S2N A;  3Q1F A;  3SS4 A;  3NY4 A;  2Z2L B;  4GDN A;  5I94 A;  5HAQ A;  4S2K A;  5HX9 A;  4PPR A;  3V39 A;  1YM1 A;  3PBO A;  4BQM A;  1NZU A;  5DF9 A;  4PM7 A;  3ZG7 B;  3ZG8 B;  3NCK A;  2R9W A;  1K25 A;  3NDE A;  1KVM A;  1WYB A;  3AGF A;  4DE3 A;  4OOY A;  4UA6 A;  1DJB A;  3VSK A;  1BUL A;  1HTZ A;  4S2O A;  4GOG A;  4MBH A;  5KMW A;  1ES3 A;  4E3L A;  3IF5 A;  2WAD A;  3UO9 A;  4JXS A;  1ZKJ A;  2ZD8 A;  4JBF A;  3WS4 A;  5GLD A;  3Q82 A;  4E3I A;  4ZDX A;  1ONH A;  1LI9 A;  2WKE A;  1BLP A;  3E2K A;  4S2I A;  5EVI A;  5TFQ A;  1XKZ A;  2HP9 A;  3VFH A;  4FD8 A;  1YLW A;  3A3E A;  5E43 A;  3WWX A;  2EXB A;  3VMA A;  1KGG A;  2HPB A;  2ZC7 A;  3ZNY A;  1J9M A;  4KZB A;  3SH9 A;  3PBS A;  2Y2I A;  1PI4 A;  4FCF A;  4F94 A;  5FAQ A;  2CC1 A;  4KZ7 A;  2Y55 A;  4UHU A;  1CK3 A;  4WMC A;  2EFX A;  3UNW A;  4OPY A;  2ZQ8 A;  4DE1 A;  1E3U A;  4IBX A;  3MZF A;  2E8I A;  4MLL A;  3S22 A;  1U60 A;  3VOY A;  4X68 A;  3IHA A;  3PBR A;  2HP6 A;  3C7U A;  1L0D A;  3B3X A;  3GV9 A;  3HUM A;  1L2S A;  3SH7 A;  3N8S A;  4KG6 A;  1ESI A;  4WYY A;  2XGN A;  3E2L A;  2WAE A;  4BL2 A;  4EQI A;  5CGX A;  4BD0 A;  2ZQA A;  4DKI A;  1K54 C;  1IKI A;  1RCJ A;  2R9X A;  2Y2L A;  4O7D A;  1BT5 A;  4N9K A;  2RL3 A;  4BLM A;  1PWG A;  1LLB A;  3G30 A;  4R23 A;  3VSL A;  1PWC A;  3ZCZ A;  1O07 A;  2J8Y A;  3ZFZ A;  4DXC A;  3RXW A;  1I2W A;  5CHJ A;  4K0W A;  1PI5 A;  1XGJ A;  3OPR A;  5EVI B;  1GHI A;  3MBZ A;  1KGE A;  3CZD A;  5AQA A;  4YIN A;  3DWZ A;  5GLA A;  3VP0 A;  1N9B A;  1MKI A;  5A92 A;  3VP1 A;  2Y2K A;  1L0E A;  4KZ5 A;  3FWL A;  1YLJ A;  5EEC A;  4BD1 A;  3PBN A;  4Y0U A;  5CHM A;  3ZHH A;  1EWZ A;  4WZ5 A;  1CI9 A;  4KZ9 A;  1W5D A;  4OKP A;  1YLT A;  4Y0O A;  3CMZ A;  4LCL A;  1HVB A;  4XUZ A;  4OQG A;  5FAP A;  4ZJ1 A;  3V5M A;  3O86 A;  3HVF A;  3NC8 A;  4PMA A;  2WUQ A;  2XFS A;  2BG1 A;  3BM6 A;  3V50 A;  3IWQ A;  2C5W B;  2V2F F;  2HDS A;  3BLM A;  5DTT A;  5IHV A;  1JWP A;  4GN2 A;  5HL1 A;  3N8R A;  1ERQ A;  4P6B A;  4EV4 A;  1MWT A;  1PZO A;  1ZC2 A;  4MBF A;  4ZAM A;  4NK3 A;  5FAS A;  5M19 A;  4EBP A;  3CG5 A;  3HLC A;  1VQQ A;  3G32 A;  1YLY A;  2EX6 A;  3P98 A;  4EUZ A;  2Y4A A;  1W8Y A;  2OLV A;  2ZM2 A;  3ITB A;  4CJN A;  3HLE A;  1K4E A;  3HUN A;  1KDW A;  5CEB A;  1KE3 A;  2PU2 A;  4QHC A;  3ZVT A;  3ZG9 B;  2ZJ9 A;  4KQQ A;  4UA9 A;  2V20 A;  3W4O A;  1JTG A;  3UPP A;  3QHY A;  1CI8 A;  5GHY A;  3ZDJ A;  2VGJ A;  4R3B A;  1I2S A;  3IF6 A;  5FA7 A;  3V3S A;  3CJM A;  3A3D A;  5CER A;  4Y0T A;  1MXO A;  2QZ6 A;  2XD5 A;  3S1Y A;  2HP5 A;  1ESU A;  3G2Y A;  4JF6 A;  1SDN A;  1O7E A;  2JC7 A;  1ONG A;  3C5A A;  4HEF A;  2XLN A;  4R1G A;  2XH9 A;  5CRF A;  1BTL A;  1K6R A;  5HFO A;  5HAP A;  4LEN A;  1IYS A;  1Z6F A;  2I72 A;  3DTM A;  5D3O A;  3IXB A;  4QJG A;  2P74 A;  4C75 A;  4DXB A;  1HD8 A;  1G6A A;  4E3M A;  1G68 A;  5HW3 A;  1JWZ A;  3MXS A;  1IKG A;  4PM6 A;  4ZTK A;  1QMF A;  3ISG A;  4C3Q A;  2IWC A;  4GNU A;  4OOL A;  1M6K A;  3M6B A;  4S2J A;  2WAF A;  3HL9 A;  1BLS A;  2DCF A;  4WZ5 C;  2H5S A;  3ZVW A;  1W79 A;  4OLG A;  4X55 A;  4ZBE A;  3WS2 A;  3IWI A;  4KEN B;  5A91 A;  1BLC A;  1QME A;  3PAE A;  1K56 A;  1DJA A;  1C3B A;  1YMX A;  2J7V A;  2ZQ9 A;  5TGF A;  3IXG A;  2EX2 A;  5JYO A;  4OQ0 A;  3A3I A;  5FDH A;  2XK1 A;  2UWX A;  4GDB A;  4X56 A;  5DTS A;  3LY4 A;  3GMW A;  5CGS A;  3FKV A;  2HDR A;  5E2E A;  2XF3 A;  2XQZ A;  3IF6 B;  5FQJ A;  3M6H A;  3OPP A;  4E3N A;  3G34 A;  2A3U A;  5FQM A;  1MY8 A;  4E6W A;  1NYM A;  1XA7 A;  4FH2 A;  4KQO A;  5L2F A;  1SDE A;  4N1H A;  4X6T A;  5AQB A;  1ES5 A;  1KGF A;  2EXA A;  4UAA A;  2Q9M A;  3VFF A;  2JE5 A;  5AQ7 A;  2J9P A;  3UN7 A;  1K57 A;  4U0T A;  4EBL A;  1ES2 A;  5KZH A; 
#chains in the Genus database with same CATH topology
 3F1O A;  4I5S A;  3MFX A;  4JF5 A;  3SOI A;  1IEM A;  4H6J A;  2H0T A;  4BMW A;  3JYI A;  1TEM A;  1K4F A;  3F1P A;  1XJ3 A;  1L0F A;  4LV1 A;  1NWZ A;  2PAV P;  2WYX A;  3HLW A;  2ZQ7 A;  5G18 A;  3VP4 A;  4WEK A;  3KSF A;  5CHU A;  2Z2M B;  2PR5 A;  1L0G A;  4ID4 A;  4FSF A;  3CWF A;  2A2L A;  3Q7Z A;  1OJ5 A;  2EWW A;  3UDI A;  2W1T A;  3F1O B;  3N4I A;  1Y54 A;  3IS2 A;  4MBK A;  2V1Z A;  4H6J B;  1YLP A;  3D4F A;  2Y2M A;  2HDU A;  4CPK A;  1K57 C;  1CEG A;  1RGZ A;  4O8G A;  4ETX A;  3EEH A;  1OT9 A;  4DE0 A;  2Z6D A;  4RYE A;  2A49 A;  5DTK A;  3LIA A;  3LO7 A;  3BFD A;  1X0O A;  1IOU A;  1T18 A;  2P9V B;  2WZZ A;  4HOI A;  2HJ9 C;  4IVI A;  4WM9 A;  3HLF A;  4E6X A;  4AFI A;  4Q8I A;  1SCW A;  4WZ4 A;  3CHW P;  3RXX A;  2G7U A;  2W1T B;  1S4S A;  1XJ6 A;  4LV3 A;  4DE2 A;  5FQI A;  1WA9 A;  5DKL A;  3FC7 A;  3IS2 B;  1XA1 A;  5E2G A;  3P7N A;  5FI2 A;  3KYZ A;  3LEZ A;  4KQR A;  1K54 A;  2ZM8 A;  3ZG5 A;  4QPR A;  1DP9 A;  3UDF A;  3LI9 A;  3NUL A;  2OWH A;  4HHD A;  2Y2Q A;  3NOP C;  4E3K A;  2X71 A;  4QY5 A;  4B4Z A;  1GSW A;  3LR0 A;  5G4Z A;  3WS0 A;  1Q2P A;  4O0P A;  4PM8 A;  5EUA A;  1LSX A;  1FCO A;  5F1G A;  1PYY A;  2W3G A;  4JXG A;  4NET A;  3W4P A;  2ACG A;  3IQA A;  2A24 A;  3OBF A;  4X25 A;  4EQ1 A;  3HJK A;  5BOH A;  2ZC5 B;  3UPO A;  4HY8 A;  3FV7 A;  2JKG A;  3OPH A;  2XSS A;  3NDG A;  5EPH A;  2PD8 A;  2JBF A;  2YKH A;  4QU3 A;  3RFB A;  4MN6 A;  2VLG A;  3Q07 A;  1F98 A;  1EW0 A;  5FQQ A;  1GHP A;  5FQ9 A;  2KLI A;  3KO6 A;  3N8L A;  5DF8 A;  4OOM A;  2ZLY A;  4QD4 A;  1M40 A;  1P0Z A;  4WEJ A;  1TS0 A;  3QP6 A;  3Q81 A;  3LI8 A;  1NY0 A;  1MPL A;  2J9O A;  3G4P A;  5FQK A;  4BBV A;  4GS9 A;  4R0Q A;  3C4O A;  4KG5 A;  3IT9 A;  4K0X A;  5FI6 A;  3CUE A;  5CGW A;  2HV1 A;  2WK0 A;  2XFT A;  5EVI D;  3GVB A;  1D1J A;  1IFQ A;  1BUE A;  1K0K A;  1DJC A;  3FKW A;  4GHI A;  1ES4 A;  2V8C A;  4FTX A;  1S0W A;  2JKT I;  5AVE A;  3A3J A;  1TF1 A;  3LID A;  1BYW A;  4EW7 A;  3NHQ A;  4Z1W A;  4E3O A;  3BFE A;  2G2U A;  4S2M A;  4GS9 B;  1KE4 A;  3V39 A;  5LBR A;  1S1Y A;  4E04 A;  1FIL A;  1CF0 A;  2R9W A;  1K25 A;  1WYB A;  1MKM A;  1DJB A;  3VSK A;  1BUL A;  1HTZ A;  1XFN A;  4E3L A;  4JXS A;  3UB6 A;  1OTA A;  4GHI B;  3WS4 A;  4LFU A;  2IA2 A;  2Z6C A;  4E3I A;  4ZDX A;  1ONH A;  3E2K A;  4S2I A;  4NKP A;  5EVI A;  2P7J A;  4LRZ E;  4FD8 A;  5TBM A;  5E43 A;  2V9A A;  3VMA A;  2ZC7 A;  1YSQ A;  1ZTU A;  2W0N A;  3PBS A;  2M7V A;  1PI4 A;  4F94 A;  3UB8 A;  1TS6 A;  4DE1 A;  4FOF A;  2E8I A;  3IHA A;  2HP6 A;  4BBT A;  3B3X A;  1L2S A;  3FPV A;  3E2L A;  3EWK A;  2W3H A;  4DKI A;  1K54 C;  2R9X A;  4N9K A;  5HDS A;  1PWG A;  1LLB A;  3G30 A;  3ZCZ A;  2J8Y A;  3RXW A;  1I2W A;  1PI5 A;  1J3W A;  4NG2 A;  5EVI B;  1GHI A;  3MBZ A;  1KGE A;  5TBM B;  3FG8 A;  1MKI A;  3VP1 A;  1YLJ A;  2GNX A;  4BD1 A;  5CHM A;  5CX7 A;  1W5D A;  3PXP A;  3CMZ A;  4LCL A;  1HVB A;  3TW8 A;  3LIB A;  1LSW A;  2WUQ A;  2C5W B;  5HL1 A;  3S7N A;  1MWT A;  3L7H A;  1PZO A;  4ZAM A;  3HLC A;  3G32 A;  4ESP A;  1YLY A;  4IUK A;  4JGO A;  2Y4A A;  3ITB A;  3A0S A;  5DJU A;  1KDW A;  3ZVT A;  2ZJ9 A;  5GHY A;  4IUH A;  2VGJ A;  1I2S A;  3CJM A;  5CER A;  2QZ6 A;  2XD5 A;  4LRX C;  3G2Y A;  1SDN A;  5A8B A;  2K31 A;  2XLN A;  1BTL A;  5HFO A;  3DTM A;  3T1R A;  1OTI A;  5J3W A;  4E3M A;  4XT2 A;  4ZTK A;  4GNU A;  4OOL A;  2H5S A;  3ZVW A;  4X55 A;  4ZBE A;  1CQA A;  3LIC A;  3C8C A;  2ZQ9 A;  3E4P A;  3IXG A;  3BY9 A;  2XK1 A;  2UWX A;  1T19 A;  2EA9 A;  3CUE C;  4LLO B;  2HDR A;  5FQJ A;  2D02 A;  3OPP A;  3ZQ5 A;  5FQM A;  4O01 A;  4KQO A;  3D3O A;  4PKY A;  4B93 A;  1ES5 A;  4HJ6 A;  1V9Y A;  2J9P A;  5F6A A;  1K57 A;  5KZH A;  4OPR A;  2OSU A;  1NJ4 A;  1FOF A;  4XT2 B;  4GKU A;  1DY6 A;  4OQI A;  2QKP A;  4L9E A;  5EM1 A;  3UME A;  5HWV A;  4G3V A;  4JF4 A;  3M2K A;  5CEC A;  1I5Q A;  5CTM A;  1P97 A;  3G35 A;  3TRC A;  1MC0 A;  1KDS A;  3O88 A;  3G2Z A;  4UA7 A;  4R4S A;  2ZC6 B;  1S66 L;  3MQO A;  5M1A A;  4G3K A;  2BTF P;  3S4X A;  3BY8 A;  5F1F A;  3MKE A;  3PTE A;  4R3A A;  4K08 A;  1CJF A;  2Y2N A;  3BFF A;  3V3R A;  4FH4 A;  3P09 A;  5FAT A;  3GTC A;  5EVI C;  5CTN A;  4PM9 A;  1MWU A;  3MKF A;  2VZW A;  5M18 A;  3MS6 A;  4OH0 A;  3GRJ A;  3LIE A;  1ERO A;  2JN7 A;  3VP2 A;  4HBU A;  1W8Q A;  3MZD A;  3W8K A;  3ZYT A;  3KX0 X;  4GD8 A;  3UDX A;  4LRY C;  3HUO A;  1GA9 A;  5CED A;  2YKF A;  2OV5 A;  2W3D A;  2C6W B;  1NRF A;  1DP8 A;  1FSY A;  3BW6 A;  2ZQC A;  3LYX A;  1N9N A;  4OP5 A;  4A5R A;  3N7W A;  3HLB A;  4HJ4 A;  1VHM A;  1XGI A;  3MZE A;  3VP3 A;  3UE1 A;  1IYQ A;  2PRF A;  3UPN A;  4GB7 A;  2WZX A;  3K2N A;  1YQS A;  5A93 A;  4MCW A;  1H8Z A;  5GHZ A;  5HDD A;  4EET B;  2WGV A;  4P0M A;  5HAR A;  2KOI A;  4I3A A;  3JVU A;  1LHY A;  1TD5 A;  2Q0O A;  3HBR A;  4U0X A;  1UGU A;  5FI7 A;  5HL6 A;  2WKH A;  1YT4 A;  2ZMV A;  3UB5 P;  4JKT A;  5EVL A;  2EFU A;  2V1B A;  3NBL A;  4NXE A;  2JKT M;  4EUV A;  4I3J A;  3C4P A;  1LL9 A;  3IHB A;  3H7W A;  2VKS A;  2GX5 A;  1XP4 A;  1AXB A;  1N4O A;  2JKF A;  4LPZ A;  2E8J A;  3VE4 A;  3OPL A;  1CEF A;  4S2L A;  2PU4 A;  2P9V A;  3O3V A;  2ZQD A;  3QNB A;  4EES A;  1NYY A;  2Y2J A;  1TS8 A;  3BLS A;  4Y13 A;  4WBG A;  5KSC A;  2M1C A;  3A0R A;  5FEG A;  4YNR A;  1VEU A;  4CLC D;  3DTE A;  4L0L A;  4QB8 A;  4HES A;  3LEQ A;  4IED A;  5GL9 A;  3H7W B;  1GCE A;  4Q0J A;  4M3K A;  4HIA A;  2QPN A;  4Y7P A;  4KG2 A;  2PR6 A;  2ZM0 A;  3BEB A;  2JCH A;  5HD5 A;  1LL5 A;  3T4T A;  2H10 A;  4ME4 A;  4GW9 A;  3MFD A;  1ODV A;  5U47 A;  4JGP A;  3RTY A;  1JNU A;  1T1C A;  4L9F A;  4Y2F A;  3T1Q B;  5L09 A;  1PZP A;  3NIA A;  5GHX A;  5EOO A;  3GSG A;  4ZJ2 A;  3ULF A;  3HLG A;  1VEU B;  4OP8 A;  3WRZ A;  1ERM A;  4UQI S;  1H8M A;  4X1L A;  3MQQ A;  2Q9N A;  3MXR A;  4II7 A;  5EOE A;  4S2N A;  3SS4 A;  4GDN A;  5I94 A;  2GZA A;  4UQI M;  5HAQ A;  4PPR A;  1YM1 A;  3PBO A;  4BQM A;  4Q0H A;  3ZG7 B;  2WKP A;  4R70 A;  3ZG8 B;  1MZU A;  1ZHH B;  3NCK A;  3H9W A;  4OOY A;  4MN5 A;  1ZKJ A;  1OJG A;  4GJ4 A;  1LI9 A;  5TFQ A;  3VFH A;  1YLW A;  3A3E A;  1OTB A;  1KGG A;  2P08 A;  4KZB A;  3SH9 A;  4Y5F A;  3MR0 A;  1LSV A;  5FAQ A;  3QP1 A;  2CC1 A;  5KIZ A;  4KZ7 A;  3UNW A;  4OPY A;  2PYP A;  4Y15 A;  5TJJ A;  4I39 A;  4CLC B;  4WN5 A;  1ESI A;  3E4Q A;  3KYQ A;  3JVV A;  2WAE A;  2AVX A;  2ZQA A;  1ACF A;  1BT5 A;  2HF6 A;  1V9Z A;  4R23 A;  2WKQ A;  1O07 A;  1YKD A;  3ZFZ A;  4DJ3 A;  1G5U A;  3IX8 A;  5CHJ A;  4K0W A;  3OPR A;  1SZV A;  2VV7 A;  4WF0 A;  1W63 M;  5GLA A;  1T1B A;  1PNE A;  4KZ5 A;  5G4Y A;  4HNB A;  2W27 A;  1PRQ A;  4OKP A;  3T50 A;  4Y0O A;  4OQG A;  5FAP A;  3V5M A;  4GLQ A;  3C30 A;  3VE3 A;  3PR6 A;  3R7W B;  2BG1 A;  3BM6 A;  3E98 A;  3CPT B;  1JWP A;  1NRJ A;  4P6B A;  4EV4 A;  2I9V A;  1ZC2 A;  3CLO A;  5FAS A;  5M19 A;  4EER A;  2O9A A;  1W8Y A;  2OLV A;  2ZM2 A;  4CJN A;  3HLE A;  1K4E A;  3HUN A;  4QHC A;  3ZG9 B;  2Y8H A;  2V20 A;  3UPP A;  2QWS A;  5FA7 A;  3IF6 A;  5FDS A;  2HP5 A;  1ESU A;  1O7E A;  1ONG A;  4HEF A;  4R1G A;  5CRF A;  3KSI A;  5HAP A;  1IYS A;  5D3O A;  4QJG A;  2P74 A;  1HD8 A;  1G6A A;  3MXS A;  4PM6 A;  3ISG A;  4KUO A;  2IWC A;  3HL9 A;  1BLS A;  1QME A;  1C3B A;  5TGF A;  3LIF A;  5JYO A;  5FDH A;  5FEF A;  2V0W A;  5DTS A;  3UMD A;  5CGS A;  3FKV A;  3D72 A;  2XF3 A;  3IF6 B;  2ZBB A;  3GEC A;  3M6H A;  4E3N A;  1XA7 A;  5L2F A;  2Q9M A;  2JE5 A;  5AQ7 A;  3UN7 A;  4HP4 A;  4U0T A;  3HUM A;  4G3W A;  1JTD A;  3EQV A;  3BWL A;  3HRE A;  5AJG A;  3HLD A;  1MWS A;  1NLZ A;  4HH2 A;  1XX2 A;  4DDS A;  2WKR A;  3BEC A;  1JWV A;  5JYP A;  4ARZ B;  1JVJ A;  4S2N C;  3UE0 A;  2VA0 A;  2JHE A;  4EBN A;  3BFG A;  3CIT A;  2XA7 S;  4XUX A;  1PWD A;  2BLS A;  3OCN A;  3LY3 A;  2XA7 M;  4B4X A;  5DF7 A;  1XXM A;  5J8X A;  4OQH A;  3NI9 A;  4GD6 A;  5HPF A;  5J4E A;  3EGX C;  5L07 A;  4OPZ A;  1S6R A;  1NXY A;  3RJU A;  4LV0 A;  4EXO A;  1FR6 A;  5CXW A;  2XD1 A;  3BJN A;  1D7E A;  1FCM A;  4BEN A;  4EWF A;  5AVF A;  5E2F A;  2B18 A;  2OAP 1;  3HJI A;  2IWB A;  4X53 A;  1ALQ A;  1RGY A;  3IXD A;  3OC2 A;  3BRM A;  3OCL A;  5MC7 A;  4MEZ A;  3PBQ A;  2HDQ A;  2Y2P A;  2OLU A;  1T1A A;  2CMN A;  2Y2H A;  5EFW A;  5F83 A;  3TG9 A;  4B88 A;  1E3U D;  2WGW A;  2XR0 A;  3IH8 A;  3SW1 A;  1TVF A;  4N9L A;  4BL3 A;  2K2N A;  3SZT A;  1Q2Q A;  4U3T A;  2ZC3 B;  3ZNT A;  2PD7 A;  1BZA A;  3N6I A;  4YOF A;  3OLO A;  4IVK A;  1S1Z A;  1Y4O A;  3DWK A;  3VOL A;  3F1N A;  5HZH A;  1MBL A;  2HJE A;  3SS5 A;  4Z9Q A;  2VGL S;  1E4D A;  1PIO A;  1TDL A;  1XPB A;  1K55 C;  1TS7 A;  2W3E A;  2VGL M;  2WGW B;  3GR2 A;  1ZG6 A;  3IF6 C;  1SKF A;  2PDR A;  3TSG A;  2B5R A;  2JKR I;  2L0W A;  3LR4 A;  2ZC4 B;  1FR1 A;  4KQD A;  2J3T D;  4KZ8 A;  3EOI A;  3F1N B;  3MJQ A;  2OOL A;  2LB9 A;  1EI5 A;  2WKI A;  2XEP A;  1UWN X;  3TOI A;  1H3Q A;  1LI0 A;  3JPU A;  3IWO A;  5E2H A;  4GZB A;  2XDM A;  3Q7V A;  4IJG A;  1SHV A;  1MWR A;  1YAX A;  2O0Y A;  2LB5 A;  4RX2 A;  4JXV A;  5EV0 A;  3UY6 A;  3O87 A;  2DMW A;  2MJ6 A;  4N92 A;  1K6S A;  5FSR A;  5GLB A;  2PYR A;  4L9G A;  3M2J A;  1IYO A;  4JXW A;  2G2W A;  5TR7 A;  1K56 D;  1LT0 A;  2H0Y A;  5L10 A;  1WE4 A;  1OPX A;  4P85 A;  3AGE A;  2KX6 A;  2L4R A;  2HGV A;  1FSW A;  3I7J A;  4HBT A;  1UWP X;  2VGK A;  3Q7V B;  4PM5 A;  3QP8 A;  4R6L A;  4MN7 A;  2Y91 A;  2L1M A;  4X69 A;  4Q0I A;  1BLH A;  1SKO A;  3DBA A;  3IX4 A;  1H5X A;  3B47 A;  3K3D A;  4GCZ A;  1OME A;  4JLF A;  2W1R A;  4EEP A;  4Y17 A;  5K5B A;  2PBY A;  1FIK A;  2B02 A;  4I3I A;  1TDG A;  1PFL A;  1K38 A;  2DRW A;  1Y28 A;  4S2K A;  4BBU A;  3ICY A;  3NJA A;  5DF9 A;  3MXQ A;  1N9O A;  5FL3 A;  3AGF A;  4DE3 A;  1H0M A;  4S2O A;  4GOG A;  3HCY A;  5KMW A;  1ES3 A;  3UO9 A;  2WAD A;  4NXG A;  2ZD8 A;  5GLD A;  2ZOH A;  2J3W A;  2WKE A;  1SKO B;  1XKZ A;  1L3L A;  2EXB A;  3ZNY A;  3QP4 A;  1J9M A;  4UEY A;  2Y2I A;  5EM0 A;  1HLU P;  4FCF A;  3EEA A;  3A0V A;  4UHU A;  4X1M A;  1CK3 A;  2KDK A;  2EWV A;  2ZQ8 A;  3MZF A;  3LR3 A;  4X68 A;  3PBR A;  1L0D A;  3GV9 A;  4ETZ A;  3SH7 A;  2O9B A;  1VET A;  2R78 A;  5CGX A;  4BD0 A;  3R4K A;  1RCJ A;  2Y79 A;  2INW A;  1D06 A;  1XGJ A;  3DTK A;  3IBR A;  3CZD A;  4YIN A;  3OOV A;  5IS1 A;  2Y2K A;  5EVE A;  3T1S A;  2V8F A;  3PBN A;  4HP9 A;  4KZ9 A;  1YLT A;  1NLY A;  3DAV A;  4ZJ1 A;  4DN0 A;  1VET B;  4MDZ A;  4PMA A;  3LR5 A;  2V2F F;  2HDS A;  5IHV A;  3F1P B;  3N8R A;  4Y3I A;  3C38 A;  1VQQ A;  2EX6 A;  3T4S A;  4EUZ A;  4UA9 A;  3W4O A;  1JTG A;  3QHY A;  1CI8 A;  3ZDJ A;  4R3B A;  5HPI A;  4Y0T A;  3E0Y A;  3H82 A;  3S1Y A;  2H28 A;  4JF6 A;  2ZOI A;  5IU1 A;  4BWI A;  2XH9 A;  4LEN A;  1Z6F A;  4C75 A;  4DXB A;  3EGD C;  4CLC A;  1G68 A;  4PHT A;  1QMF A;  4EEU A;  2K7S A;  1M6K A;  3M6B A;  4WZ5 C;  3IX3 A;  3T4Q A;  3WS2 A;  5F69 A;  5A91 A;  3MMH A;  4OQ0 A;  3G6O A;  4X56 A;  4NXB A;  3G34 A;  3S7Q A;  4CQH A;  2J3T C;  1MY8 A;  3H82 B;  1NYM A;  4FH2 A;  5DFX A;  4WLA A;  2PHY A;  1SDE A;  4N1H A;  2HZ5 A;  1KGF A;  2EXA A;  4UAA A;  5L8M A;  3VFF A;  2GJ3 A;  1VB6 A;  4RQ9 A;  3KYE A;  5F68 A;  1ES2 A;  3C7V A;  5HWW A;  1G6O A;  2VJW A;  1KE0 A;  3NOU C;  3R7W A;  1IYP A;  1GA0 A;  3CPT A;  4B9O A;  3C2W A;  3D9Y A;  3BQA A;  4HH3 A;  1GHM A;  4JPM A;  4D2O A;  1NZO A;  3BFC A;  4OLD A;  3PYP A;  2IWD A;  4WEL A;  5GLC A;  2FH5 A;  4C6Y A;  4NEE D;  2WGI A;  4IBR A;  4KUK A;  2VX8 A;  2J80 A;  3U2A A;  3WS1 A;  4E3J A;  1YLZ A;  5C5K A;  2P04 A;  5HD3 A;  3VOZ A;  1DP6 A;  1W7F A;  4K91 A;  4LGW A;  2A24 B;  3ITA A;  2VEA A;  4RVA A;  2JKR M;  1YSP A;  4KZ3 A;  1K55 A;  3T4O A;  3UE3 A;  1P9R A;  2BAS A;  4OVD A;  4KZ4 A;  2X02 A;  4S2P A;  4LCM A;  4RX3 A;  3G31 A;  2NUP C;  3U4L P;  4KZA A;  1E25 A;  4BJP A;  3UB9 A;  4LV2 A;  2D01 A;  2RCX A;  2X01 A;  1P9W A;  5DVA A;  3IH9 A;  3WS5 A;  3FZC A;  2XRN A;  4ARZ A;  2XRO A;  3EQU A;  1FCN A;  3QP2 A;  4IHQ A;  1PW8 A;  1PW1 A;  1HZO A;  3QP5 A;  3SH8 A;  1OTE A;  4R3J A;  4QY6 A;  1LL8 A;  3KSH A;  5FAO A;  3AGD A;  3MF0 A;  2NUT C;  1VM1 A;  4RA7 A;  1ZG4 A;  2PBD P;  2DNS A;  4YFM A;  2ZMA A;  4KZ6 A;  3BYD A;  4DF6 A;  3KSG A;  5HAI A;  2QMI A;  3W4Q A;  4XXR A;  4MNR A;  4CLC C;  4P87 A;  3FYZ A;  1YMS A;  5DFY A;  1IEL A;  4P6Z S;  3LCE A;  5IT5 A;  4DJ2 A;  3IXH A;  4R4R A;  3SS3 A;  4DRT A;  1F9I A;  2EX9 A;  4P6Z M;  5EE8 A;  3ZG0 A;  3OZH A;  2M7U A;  2Y2O A;  4OPQ A;  3CAX A;  1GSV A;  1FQG A;  1KVL A;  1A0K A;  1S4R A;  3T4K A;  4H8R A;  3T4J A;  2OAQ 1;  5AQ9 A;  3S7O A;  3DW0 A;  2FFY A;  3WRT A;  1WYC A;  2Y59 A;  4N1X A;  3UB7 A;  3PBT A;  2FFF B;  4ZRR A;  1XFQ A;  1H8Y A;  4JGR A;  1GSX A;  2GDN A;  3A3F A;  3QNC A;  4FUW A;  2EX8 A;  4OON A;  4ZJ3 A;  3PAG A;  3ZGA B;  1RP5 A;  4WMC D;  4DDY A;  1XJ2 A;  5A90 A;  2QHK A;  3BQ8 A;  2Y2G A;  5DJT A;  3GQZ A;  3P01 A;  3T1X A;  4HI4 A;  4WUJ A;  5F82 A;  5KSH A;  5I5L A;  3MSH A;  1BSG A;  1XJ4 A;  3Q1F A;  3L9K A;  3NY4 A;  2Z2L B;  5HX9 A;  1NZU A;  4PM7 A;  3V67 A;  3MQ0 A;  3GDI A;  3NDE A;  4M4X A;  1KVM A;  4UA6 A;  2PT7 A;  2VV6 A;  4MBH A;  3LGO A;  3IF5 A;  3TJZ C;  3TE8 A;  4JBF A;  3LFV A;  2VV8 A;  3B42 A;  3Q82 A;  1OT6 A;  1BLP A;  1S67 L;  2QJ5 A;  1STZ A;  3B33 A;  4DMZ A;  2QJ7 A;  2HP9 A;  3FPW A;  3WWX A;  2UV0 E;  2V0U A;  2HPB A;  2W3F A;  4WMC A;  2Y55 A;  2EFX A;  1E3U A;  4IBX A;  3VOY A;  4MLL A;  3S22 A;  4EU0 A;  1U60 A;  3C7U A;  3N8S A;  4KG6 A;  1Z09 A;  4WYY A;  3O5Y A;  2XGN A;  4BL2 A;  4EQI A;  1YPR A;  1IKI A;  2Y2L A;  4O7D A;  3CI6 A;  2O9C A;  4HJ3 A;  3VV4 A;  1G28 A;  2RL3 A;  4BLM A;  5HWT A;  3VSL A;  2QYB A;  1PWC A;  4DXC A;  4WL9 A;  5DKK A;  3K3C A;  4JGQ A;  5AQA A;  3DWZ A;  3VP0 A;  1N9B A;  2B95 A;  5A92 A;  1L0E A;  4R38 A;  3PHY A;  3FWL A;  5EEC A;  2O99 A;  4Y0U A;  3W2Z A;  3ZHH A;  1EWZ A;  4WZ5 A;  1CI9 A;  5HDC A;  4XUZ A;  4HQA A;  3O86 A;  3HVF A;  3DTI A;  3NC8 A;  2XFS A;  3V50 A;  3UE6 A;  3IWQ A;  4F3L A;  5DTT A;  3BLM A;  1KOU A;  4GN2 A;  3T4L A;  1ERQ A;  5HSQ A;  4YWZ A;  4MBF A;  4QWO A;  4NK3 A;  3IBJ A;  4EBP A;  4PKY G;  3CG5 A;  2VK3 A;  3P98 A;  5CEB A;  1KE3 A;  2PU2 A;  4CLC E;  4KQQ A;  1W63 Q;  3RH8 B;  3S7P A;  3V3S A;  2ZL1 A;  3A3D A;  4I38 A;  1MXO A;  2JC7 A;  3C5A A;  5J7E A;  1K6R A;  1N9L A;  2I72 A;  4MMN A;  3IXB A;  5HW3 A;  1JWZ A;  4F3L B;  1IKG A;  4C3Q A;  3T12 B;  3NOT C;  4S2J A;  2WAF A;  2DCF A;  2FZ0 A;  1W79 A;  2ZMF A;  4OLG A;  1F2K A;  3IWI A;  4KEN B;  1BLC A;  3PAE A;  1K56 A;  1DJA A;  1YMX A;  2J7V A;  2EX2 A;  3A3I A;  4GDB A;  2V1A A;  4PAU A;  4NXF A;  3LY4 A;  3NEC A;  3GMW A;  1OTD A;  5E2E A;  2XQZ A;  2OWJ A;  2ZL1 B;  2A3U A;  5F5Y A;  4E6W A;  3LUQ A;  1AWI A;  5AQB A;  4X6T A;  3E4O A;  4D60 A;  1F5M A;  1DRM A;  4EBL A; 
#chains in the Genus database with same CATH homology
 1JTD A;  3C7V A;  2OSU A;  4OPR A;  1NJ4 A;  1KE0 A;  3EQV A;  1FOF A;  4JF5 A;  3HRE A;  4GKU A;  1DY6 A;  4OQI A;  3SOI A;  3HLD A;  1MWS A;  1IYP A;  1IEM A;  1XX2 A;  4DDS A;  1GA0 A;  2H0T A;  3BEC A;  1JWV A;  1TEM A;  3JYI A;  4JF4 A;  1K4F A;  3M2K A;  5JYP A;  5CEC A;  1JVJ A;  1I5Q A;  5CTM A;  4S2N C;  1L0F A;  3UE0 A;  4LV1 A;  3G35 A;  1KDS A;  4EBN A;  3O88 A;  3G2Z A;  4UA7 A;  4R4S A;  2WYX A;  2ZC6 B;  3HLW A;  3BFG A;  1GHM A;  2ZQ7 A;  4JPM A;  4D2O A;  5M1A A;  3S4X A;  5G18 A;  5F1F A;  1NZO A;  3MKE A;  4XUX A;  3PTE A;  4WEK A;  3VP4 A;  3BFC A;  1PWD A;  4OLD A;  5CHU A;  2BLS A;  2Z2M B;  2IWD A;  3OCN A;  4WEL A;  5GLC A;  3LY3 A;  2Y2N A;  3BFF A;  4C6Y A;  3V3R A;  1L0G A;  4ID4 A;  4FH4 A;  4FSF A;  4B4X A;  3P09 A;  5DF7 A;  1XXM A;  5FAT A;  3Q7Z A;  3GTC A;  5EVI C;  5J8X A;  2WGI A;  3UDI A;  4OQH A;  4PM9 A;  3NI9 A;  4GD6 A;  5CTN A;  1MWU A;  4IBR A;  3N4I A;  1Y54 A;  3MKF A;  4OPZ A;  5M18 A;  1S6R A;  4MBK A;  1NXY A;  3WS1 A;  3RJU A;  2V1Z A;  4E3J A;  1YLZ A;  4LV0 A;  1YLP A;  4OH0 A;  3VOZ A;  1FR6 A;  1W7F A;  5CXW A;  3GRJ A;  3D4F A;  2Y2M A;  4K91 A;  2HDU A;  2XD1 A;  1ERO A;  4CPK A;  1K57 C;  1CEG A;  1RGZ A;  3ITA A;  1FCM A;  3VP2 A;  4RVA A;  4HBU A;  4BEN A;  1W8Q A;  3MZD A;  3W8K A;  4EWF A;  4DE0 A;  4RYE A;  4KZ3 A;  4GD8 A;  3UDX A;  2A49 A;  5DTK A;  3LO7 A;  5E2F A;  1K55 A;  3UE3 A;  4OVD A;  3BFD A;  3HUO A;  4KZ4 A;  1GA9 A;  2X02 A;  4S2P A;  2P9V B;  2WZZ A;  2IWB A;  4LCM A;  1ALQ A;  1RGY A;  4X53 A;  5CED A;  3IXD A;  3OC2 A;  4RX3 A;  3BRM A;  4IVI A;  3G31 A;  2OV5 A;  4WM9 A;  3OCL A;  4MEZ A;  3HLF A;  2C6W B;  1NRF A;  3PBQ A;  2HDQ A;  1FSY A;  2Y2P A;  4KZA A;  2ZQC A;  4E6X A;  1E25 A;  4Q8I A;  1SCW A;  4WZ4 A;  4OP5 A;  3RXX A;  4BJP A;  4A5R A;  3N7W A;  4LV2 A;  2OLU A;  4LV3 A;  5FQI A;  3HLB A;  2Y2H A;  5F83 A;  4DE2 A;  3TG9 A;  2RCX A;  4B88 A;  1E3U D;  2WGW A;  1XGI A;  1XA1 A;  2XR0 A;  3IH8 A;  2X01 A;  3MZE A;  3VP3 A;  5E2G A;  3UE1 A;  1TVF A;  1IYQ A;  4N9L A;  4BL3 A;  5FI2 A;  5DVA A;  3IH9 A;  3LEZ A;  3UPN A;  3WS5 A;  1Q2Q A;  3FZC A;  4KQR A;  4GB7 A;  1K54 A;  2WZX A;  2ZC3 B;  4U3T A;  3ZNT A;  1YQS A;  5A93 A;  3EQU A;  1FCN A;  1H8Z A;  1BZA A;  1PW8 A;  2ZM8 A;  5GHZ A;  3N6I A;  3ZG5 A;  3UDF A;  4IVK A;  3DWK A;  2WGV A;  1PW1 A;  4P0M A;  5HAR A;  2Y2Q A;  4E3K A;  1HZO A;  1MBL A;  3SS5 A;  3SH8 A;  2X71 A;  4QY5 A;  4B4Z A;  1LHY A;  4R3J A;  3HBR A;  4U0X A;  4Z9Q A;  3WS0 A;  4QY6 A;  5FI7 A;  1E4D A;  1PIO A;  1TDL A;  1XPB A;  2WKH A;  5FAO A;  1K55 C;  1Q2P A;  1YT4 A;  3AGD A;  4JKT A;  4PM8 A;  5EVL A;  1VM1 A;  2WGW B;  4RA7 A;  5EUA A;  1ZG4 A;  3GR2 A;  1ZG6 A;  3IF6 C;  2DNS A;  4YFM A;  2EFU A;  1FCO A;  1SKF A;  5F1G A;  2ZMA A;  3NBL A;  1PYY A;  4KZ6 A;  4JXG A;  3BYD A;  4DF6 A;  4NET A;  5HAI A;  3W4P A;  3IQA A;  2B5R A;  2QMI A;  3TSG A;  3W4Q A;  4XXR A;  3C4P A;  1LL9 A;  4MNR A;  3IHB A;  4P87 A;  3FYZ A;  1YMS A;  2ZC4 B;  1FR1 A;  1XP4 A;  1AXB A;  1N4O A;  5BOH A;  4KZ8 A;  1IEL A;  2ZC5 B;  3LCE A;  3UPO A;  3OPL A;  1CEF A;  4S2L A;  3IXH A;  3FV7 A;  4R4R A;  2PU4 A;  3OPH A;  2P9V A;  3O3V A;  3NDG A;  3SS3 A;  4DRT A;  2EX9 A;  2ZQD A;  2JBF A;  1EI5 A;  5EE8 A;  5EPH A;  3ZG0 A;  2WKI A;  2XEP A;  3QNB A;  1NYY A;  3OZH A;  3TOI A;  1LI0 A;  2Y2O A;  2Y2J A;  3IWO A;  4OPQ A;  4QU3 A;  5E2H A;  3BLS A;  4GZB A;  2XDM A;  3Q7V A;  4JXV A;  1SHV A;  1MWR A;  4RX2 A;  3Q07 A;  4WBG A;  5KSC A;  5FQQ A;  3UY6 A;  1GHP A;  5FQ9 A;  3O87 A;  1FQG A;  3N8L A;  5DF8 A;  4OOM A;  2ZLY A;  4QD4 A;  1KVL A;  1M40 A;  4WEJ A;  4N92 A;  3Q81 A;  4H8R A;  4L0L A;  1K6S A;  4QB8 A;  1NY0 A;  4HES A;  5FSR A;  1MPL A;  4IED A;  2J9O A;  5GL9 A;  3G4P A;  5GLB A;  5FQK A;  1GCE A;  4R0Q A;  4M3K A;  5AQ9 A;  3M2J A;  1IYO A;  2QPN A;  4JXW A;  4Y7P A;  2G2W A;  3DW0 A;  1K56 D;  3C4O A;  2FFY A;  5TR7 A;  3WRT A;  4KG5 A;  4KG2 A;  1WYC A;  3IT9 A;  2H0Y A;  2Y59 A;  2ZM0 A;  4K0X A;  4N1X A;  1WE4 A;  3BEB A;  3PBT A;  5FI6 A;  2FFF B;  2JCH A;  5CGW A;  1H8Y A;  1LL5 A;  2WK0 A;  2XFT A;  5EVI D;  3GVB A;  4P85 A;  2GDN A;  3AGE A;  2H10 A;  3A3F A;  1BUE A;  1FSW A;  3I7J A;  3MFD A;  3QNC A;  5U47 A;  4HBT A;  2EX8 A;  2VGK A;  3Q7V B;  4PM5 A;  4OON A;  4ZJ3 A;  3PAG A;  1DJC A;  3FKW A;  3ZGA B;  1RP5 A;  2Y91 A;  4WMC D;  4X69 A;  1ES4 A;  4DDY A;  1BLH A;  5A90 A;  1PZP A;  3NIA A;  1S0W A;  1H5X A;  5GHX A;  5EOO A;  3GSG A;  4ZJ2 A;  1OME A;  3A3J A;  3HLG A;  2Y2G A;  4JLF A;  3GQZ A;  4OP8 A;  2PBY A;  3WRZ A;  1ERM A;  4E3O A;  5F82 A;  3BFE A;  2G2U A;  1TDG A;  2Q9N A;  5KSH A;  1K38 A;  4S2M A;  3MXR A;  2DRW A;  1KE4 A;  5EOE A;  1BSG A;  4S2N A;  3Q1F A;  3SS4 A;  3NY4 A;  2Z2L B;  4GDN A;  5I94 A;  5HAQ A;  4S2K A;  5HX9 A;  4PPR A;  3V39 A;  1YM1 A;  3PBO A;  4BQM A;  1NZU A;  5DF9 A;  4PM7 A;  3ZG7 B;  3ZG8 B;  3NCK A;  2R9W A;  1K25 A;  3NDE A;  1KVM A;  1WYB A;  3AGF A;  4DE3 A;  4OOY A;  4UA6 A;  1DJB A;  3VSK A;  1BUL A;  1HTZ A;  4S2O A;  4GOG A;  4MBH A;  5KMW A;  1ES3 A;  4E3L A;  3IF5 A;  2WAD A;  3UO9 A;  4JXS A;  1ZKJ A;  2ZD8 A;  4JBF A;  3WS4 A;  5GLD A;  3Q82 A;  4E3I A;  4ZDX A;  1ONH A;  1LI9 A;  2WKE A;  1BLP A;  3E2K A;  4S2I A;  5EVI A;  5TFQ A;  1XKZ A;  2HP9 A;  3VFH A;  4FD8 A;  1YLW A;  3A3E A;  5E43 A;  3WWX A;  2EXB A;  3VMA A;  1KGG A;  2HPB A;  2ZC7 A;  3ZNY A;  1J9M A;  4KZB A;  3SH9 A;  3PBS A;  2Y2I A;  1PI4 A;  4FCF A;  4F94 A;  5FAQ A;  2CC1 A;  4KZ7 A;  2Y55 A;  4UHU A;  1CK3 A;  4WMC A;  2EFX A;  3UNW A;  4OPY A;  2ZQ8 A;  4DE1 A;  1E3U A;  4IBX A;  3MZF A;  2E8I A;  4MLL A;  3S22 A;  1U60 A;  3VOY A;  4X68 A;  3IHA A;  3PBR A;  2HP6 A;  3C7U A;  1L0D A;  3B3X A;  3GV9 A;  3HUM A;  1L2S A;  3SH7 A;  3N8S A;  4KG6 A;  1ESI A;  4WYY A;  2XGN A;  3E2L A;  2WAE A;  4BL2 A;  4EQI A;  5CGX A;  4BD0 A;  2ZQA A;  4DKI A;  1K54 C;  1IKI A;  1RCJ A;  2R9X A;  2Y2L A;  4O7D A;  1BT5 A;  4N9K A;  2RL3 A;  4BLM A;  1PWG A;  1LLB A;  3G30 A;  4R23 A;  3VSL A;  1PWC A;  3ZCZ A;  1O07 A;  2J8Y A;  3ZFZ A;  4DXC A;  3RXW A;  1I2W A;  5CHJ A;  4K0W A;  1PI5 A;  1XGJ A;  3OPR A;  5EVI B;  1GHI A;  3MBZ A;  1KGE A;  3CZD A;  5AQA A;  4YIN A;  3DWZ A;  5GLA A;  3VP0 A;  1N9B A;  1MKI A;  5A92 A;  3VP1 A;  2Y2K A;  1L0E A;  4KZ5 A;  3FWL A;  1YLJ A;  5EEC A;  4BD1 A;  3PBN A;  4Y0U A;  5CHM A;  3ZHH A;  1EWZ A;  4WZ5 A;  1CI9 A;  4KZ9 A;  1W5D A;  4OKP A;  1YLT A;  4Y0O A;  3CMZ A;  4LCL A;  1HVB A;  4XUZ A;  4OQG A;  5FAP A;  4ZJ1 A;  3V5M A;  3O86 A;  3HVF A;  3NC8 A;  4PMA A;  2WUQ A;  2XFS A;  2BG1 A;  3BM6 A;  3V50 A;  3IWQ A;  2C5W B;  2V2F F;  2HDS A;  3BLM A;  5DTT A;  5IHV A;  1JWP A;  4GN2 A;  5HL1 A;  3N8R A;  1ERQ A;  4P6B A;  4EV4 A;  1MWT A;  1PZO A;  1ZC2 A;  4MBF A;  4ZAM A;  4NK3 A;  5FAS A;  5M19 A;  4EBP A;  3CG5 A;  3HLC A;  1VQQ A;  3G32 A;  1YLY A;  2EX6 A;  3P98 A;  4EUZ A;  2Y4A A;  1W8Y A;  2OLV A;  2ZM2 A;  3ITB A;  4CJN A;  3HLE A;  1K4E A;  3HUN A;  1KDW A;  5CEB A;  1KE3 A;  2PU2 A;  4QHC A;  3ZVT A;  3ZG9 B;  2ZJ9 A;  4KQQ A;  4UA9 A;  2V20 A;  3W4O A;  1JTG A;  3UPP A;  3QHY A;  1CI8 A;  5GHY A;  3ZDJ A;  2VGJ A;  4R3B A;  1I2S A;  3IF6 A;  5FA7 A;  3V3S A;  3CJM A;  3A3D A;  5CER A;  4Y0T A;  1MXO A;  2QZ6 A;  2XD5 A;  3S1Y A;  2HP5 A;  1ESU A;  3G2Y A;  4JF6 A;  1SDN A;  1O7E A;  2JC7 A;  1ONG A;  3C5A A;  4HEF A;  2XLN A;  4R1G A;  2XH9 A;  5CRF A;  1BTL A;  1K6R A;  5HFO A;  5HAP A;  4LEN A;  1IYS A;  1Z6F A;  2I72 A;  3DTM A;  5D3O A;  3IXB A;  4QJG A;  2P74 A;  4C75 A;  4DXB A;  1HD8 A;  1G6A A;  4E3M A;  1G68 A;  5HW3 A;  1JWZ A;  3MXS A;  1IKG A;  4PM6 A;  4ZTK A;  1QMF A;  3ISG A;  4C3Q A;  2IWC A;  4GNU A;  4OOL A;  1M6K A;  3M6B A;  4S2J A;  2WAF A;  3HL9 A;  1BLS A;  2DCF A;  4WZ5 C;  2H5S A;  3ZVW A;  1W79 A;  4OLG A;  4X55 A;  4ZBE A;  3WS2 A;  3IWI A;  4KEN B;  5A91 A;  1BLC A;  1QME A;  3PAE A;  1K56 A;  1DJA A;  1C3B A;  1YMX A;  2J7V A;  2ZQ9 A;  5TGF A;  3IXG A;  2EX2 A;  5JYO A;  4OQ0 A;  3A3I A;  5FDH A;  2XK1 A;  2UWX A;  4GDB A;  4X56 A;  5DTS A;  3LY4 A;  3GMW A;  5CGS A;  3FKV A;  2HDR A;  5E2E A;  2XF3 A;  2XQZ A;  3IF6 B;  5FQJ A;  3M6H A;  3OPP A;  4E3N A;  3G34 A;  2A3U A;  5FQM A;  1MY8 A;  4E6W A;  1NYM A;  1XA7 A;  4FH2 A;  4KQO A;  5L2F A;  1SDE A;  4N1H A;  4X6T A;  5AQB A;  1ES5 A;  1KGF A;  2EXA A;  4UAA A;  2Q9M A;  3VFF A;  2JE5 A;  5AQ7 A;  2J9P A;  3UN7 A;  1K57 A;  4U0T A;  4EBL A;  1ES2 A;  5KZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...