3G31A

Ctx-m-9 class a beta-lactamase complexed with compound 4 (gf1)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase CTX-M-9a
publication title Molecular docking and ligand specificity in fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 93
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3g31A00
3AGDA 1JTGA 2Y2MA 1ES4A 3P98A 1Q2PA 5EVIA 4Y0UA 3A3FA 4N9LA 4QJGA 3VP1A 4ZDXA 5IHVA 2ZQDA 3M6HA 5FAOA 1QMFA 5KSCA 1M6KA 1PWGA 2WKEA 5EPHA 4B4ZA 5M18A 1K6RA 3G2YA 4N1HA 5CXWA 1K57A 1FCMA 3SS3A 1LLBA 2R9WA 3MFDA 4LV1A 1KE4A 2P74A 4R0QA 4JXGA 3PBRA 1W8QA 3UO9A 1ES2A 4UAAA 2IWBA 3V5MA 4U0XA 2Y2LA 1XA7A 3IT9A 1XA1A 4YFMA 3MXSA 2HP9A 3S4XA 1J9MA 3CZDA 1RP5A 1IKIA 2ZMAA 3MXRA 2WGWB 4KZ7A 2CC1A 4ZJ3A 2J9OA 4EBNA 4R4SA 4EV4A 1M40A 3FZCA 4PM8A 4QY6A 1LI9A 1DJAA 2WADA 1IYSA 2RL3A 2Y55A 3HUMA 3RXXA 2Y91A 3W4PA 3LY3A 2EX6A 4LCMA 5CERA 4OPYA 1YQSA 1WYCA 4FSFA 4OQHA 1MWTA 2WZZA 2EX8A 4OPZA 1NY0A 5U47A 1K57C 3IWQA 1Y54A 1GHPA 4IVKA 3JYIA 5DF7A 4QU3A 4ZTKA 5GLBA 1I5QA 4QHCA 1ONGA 4KQOA 3V3RA 2VGJA 4KENB 1ZKJA 4RVAA 4R4RA 4RX3A 3BFEA 4GDNA 5GHZA 3N7WA 4GD6A 3V39A 1KVLA 2HPBA 4NETA 1Z6FA 4ZBEA 3UPPA 1ERMA 3D4FA 1BLCA 1RCJA 5CTNA 5DTKA 4JF6A 1YLTA 3OPPA 2XGNA 3G34A 4ZJ1A 1IYOA 4GOGA 2HDSA 3IHBA 1C3BA 3NI9A 3O88A 4ZAMA 5GHYA 5GHXA 2WGVA 1YMXA 2A49A 3HLFA 2P9VA 1TVFA 4OLGA 3GR2A 4GB7A 2Q9MA 4DDYA 3UDIA 5CECA 1WYBA 4F94A 4E3IA 4KQRA 1MXOA 4MBKA 1H8ZA 1QMEA 4LV0A 4FH2A 2WGIA 4OP8A 3N8RA 4OQGA 2WZXA 5CHJA 2HP6A 2QZ6A 4Y0OA 5HX9A 4MBHA 1K38A 3C4PA 2XDMA 4CJNA 1L0EA 4OVDA 5CGWA 2JC7A 4GN2A 1N4OA 5FAPA 4HEFA 3NDGA 2HP5A 4WMCA 5E2HA 1EWZA 1LL9A 4M3KA 5JYPA 1XP4A 2Y2PA 5FA7A 4KG6A 3P09A 5F1GA 3ZG5A 3HVFA 5FSRA 1ZC2A 5HAQA 4BL3A 3PBQA 1E25A 3VOYA 1FOFA 5FASA 5M19A 4S2NC 1K4FA 3NCKA 1FQGA 1W8YA 1FSYA 1W5DA 3HUOA 2PU4A 5FI7A 5F83A 4MNRA 4X6TA 5FQIA 5F1FA 4UA7A 5D3OA 4K0XA 3SS5A 3WRZA 4X55A 1ES5A 2Y2JA 4JXVA 1XGIA 3GRJA 3WS4A 3Q1FA 4N92A 5E2FA 4N1XA 1OMEA 3UNWA 4PM6A 5L2FA 3VSKA 2ZQ9A 2ZC6B 3M6BA 4QD4A 3NDEA 1U60A 4JF5A 3IF6B 5CEDA 3GSGA 2G2UA 1I2WA 3BLSA 4JLFA 2PU2A 4E6WA 1VQQA 4GNUA 4U3TA 2JE5A 2OLVA 4X53A 5DF8A 5EVID 4YINA 4DKIA 2Y2IA 4E3JA 2XF3A 4WM9A 4FD8A 1JWVA 4OP5A 2H0YA 4JPMA 2A3UA 1SKFA 2C5WB 2Z2LB 1TEMA 4BENA 4C6YA 4DXBA 1DY6A 1NJ4A 1PZOA 3I7JA 3CG5A 2G2WA 3GV9A 3GQZA 1PYYA 3PAGA 5F82A 2EXBA 3G32A 5DTSA 1LI0A 3C7UA 3UN7A 3ITAA 1SHVA 1HVBA 4S2KA 1YLZA 1K54C 1XGJA 2V1ZA 5HL1A 3Q81A 3BLMA 1PW8A 2XQZA 3MKEA 2V2FF 3UDXA 1MY8A 3Q7ZA 4R3JA 4KZAA 4E3OA 5AQBA 2BLSA 1BUEA 2IWCA 1VM1A 2WKIA 3AGEA 3E2KA 3IXDA 5FQKA 4EQIA 2OLUA 2QMIA 5GLDA 3N6IA 4JKTA 2Y2QA 5E43A 4C75A 3M2JA 2XD1A 5CGXA 1K56A 2ZM2A 1RGZA 5AQ7A 2ZQCA 3ZG9B 1BLSA 5CHMA 2XFSA 3IF6C 1L0DA 1ESUA 4OQIA 3W8KA 2WGWA 1H5XA 1IELA 4KZ8A 1SDEA 3SH9A 1KDWA 1ESIA 3IF5A 4FCFA 2XFTA 1S6RA 2WKHA 4WZ5C 1TDGA 1H8YA 2ZM8A 2JBFA 1CK3A 4OOLA 3VP4A 1GA9A 3LY4A 3FWLA 4ID4A 5CGSA 3SH7A 1E4DA 3PAEA 4S2NA 4A5RA 2OV5A 1SCWA 3N4IA 5A93A 5KSHA 4DXCA 2H10A 3M2KA 1TDLA 1ZG4A 5GL9A 1EROA 3BRMA 4OOYA 2FFFB 3RJUA 3C4OA 1FCOA 4OOMA 2ZC5B 3IXBA 1CEFA 1KGFA 5FDHA 3SS4A 3MZEA 3DWKA 3WS2A 3ZFZA 3BEBA 4OLDA 1FSWA 3GMWA 3UE1A 1ZG6A 3WS1A 2ZQAA 5I94A 3E2LA 1K4EA 4WEJA 4EUZA 3WWXA 2R9XA 2Y4AA 2E8IA 3BFGA 4GDBA 5A90A 5AQAA 4XUXA 5DF9A 4IBXA 3UPOA 2DRWA 3ZHHA 1MWUA 1E3UA 2XR0A 4MLLA 4WMCD 3G35A 3NY4A 4E6XA 3OC2A 3OPLA 1CEGA 5J8XA 5EECA 5FQ9A 1BLPA 4P87A 1PWCA 3DWZA 1HZOA 2X71A 2WAFA 3Q07A 3S1YA 3UE3A 3NIAA 3BFDA 3IWOA 4LCLA 2ZJ9A 4KZBA 4Y7PA 2B5RA 1MKIA 3BECA 2Q9NA 3VFHA 1MPLA 5HAIA 2UWXA 1BTLA 1ES3A 4OPQA 4JXSA 3LEZA 3IH9A 3GTCA 4QY5A 3LO7A 1YLYA 5M1AA 1IYPA 4E3NA 3OZHA 2ZD8A 4WBGA 3W4QA 1YM1A 3HUNA 1ALQA 2XD5A 1DJCA 3G30A 4KZ4A 1K54A 4P85A 2HDQA 4EBLA 1CI8A 2HDRA 2PBYA 4KZ9A 4PPRA 1S0WA 3ZG0A 2J8YA 1IKGA 2H0TA 1XXMA 3VMAA 4S2IA 1MBLA 2ZQ8A 2QPNA 3N8SA 3HBRA 4B4XA 3OCLA 1EI5A 3A3JA 4UA9A 1NZUA 2Y2OA 2Y59A 4RA7A 1GHMA 3G2ZA 1O7EA 2RCXA 4WEKA 4NK3A 3HLBA 1K55C 2EX9A 3QNCA 4KZ3A 2WAEA 4PMAA 3G4PA 3IF6A 3VP0A 3ZGAB 3ZVTA 4DF6A 3UPNA 1FR1A 3EQVA 4Y0TA 3W4OA 5EVIB 4DE1A 1CI9A 1K25A 1PI5A 2HDUA 4LV2A 3FKVA 5CTMA 1XKZA 4RX2A 5HAPA 5HW3A 3OCNA 4BD0A 4WZ5A 1JTDA 4P6BA 2XLNA 5CHUA 3ZVWA 4ZJ2A 5KZHA 3QNBA 3V3SA 3AGFA 3GVBA 3HLGA 1JWZA 3FKWA 4WYYA 3TSGA 4PM5A 1L0FA 3ISGA 5EVLA 3PBTA 3ZNTA 4OKPA 3B3XA 5EE8A 3SH8A 4H8RA 1JVJA 1K6SA 2X02A 3FYZA 1KE3A 4FH4A 4N9KA 1SDNA 1MWRA 3BM6A 1IYQA 2EX2A 3PTEA 1KE0A 2ZLYA 5GLCA 1LL5A 3UY6A 1L2SA 3HREA 1XX2A 2JCHA 2FFYA 3HLDA 1N9BA 4MEZA 4QB8A 4R23A 5E2EA 3LCEA 1K56D 1ONHA 3WRTA 2WYXA 5A92A 4JF4A 4XUZA 1PW1A 5HARA 1BLHA 3VFFA 3A3EA 3HLWA 3MZFA 4X68A 3HLCA 1HTZA 3O3VA 3MKFA 3G31A 4U0TA 4HESA 4B88A 4K91A 4KQQA 4JXWA 1KGGA 3VSLA 1BZAA 4DDSA 1RGYA 2WK0A 2ZC3B 4E3KA 1PZPA 4E3LA 4IVIA 1BSGA 3MBZA 5G18A 4GKUA 2GDNA 3DW0A 5E2GA 1L0GA 3ZG7B 3PBOA 4S2JA 2H5SA 3C5AA 5DTTA 5FQJA 2WUQA 2V20A 4PM9A 2IWDA 5EOOA 4BLMA 3FV7A 2ZM0A 4KZ5A 3ITBA 3MZDA 1O07A 5EVIC 4HBTA 5HFOA 4IEDA 1DJBA 4KG2A 5TGFA 2Y2HA 5DVAA 2OSUA 1PWDA 4S2PA 4R1GA 2DCFA 1YMSA 2Y2KA 4Q8IA 4UHUA 5FQMA 4DE3A 4O7DA 3PBNA 3V50A 4LV3A 1W79A 5EUAA 4C3QA 2J9PA 1NZOA 4KZ6A 1NYMA 2Z2MB 3BFFA 5FQQA 5A91A 2P9VB 1E3UD 5TFQA 4L0LA 4BL2A 1FR6A 2X01A 3N8LA 1Q2QA 5FAQA 5FI6A 4KG5A 1HD8A 1NRFA 4OQ0A 4P0MA 1FCNA 1PIOA 3WS5A 2ZC4B 5FI2A 3IWIA 4MBFA 3TG9A 5BOHA 5GLAA 1BULA 1KGEA 3UDFA 4BQMA 1YLPA 3BFCA 1PI4A 1K55A 1XPBA 1BT5A 1KVMA 3IQAA 3ZDJA 2Y2NA 2XH9A 3UE0A 5KMWA 2ZC7A 4Z9QA 2BG1A 3NBLA 4UA6A 2J7VA 2XK1A 1ERQA 3TOIA 3EQUA 3VOZA 2XEPA 3IHAA 4OH0A 2Y2GA 3PBSA 4EBPA 1JWPA 1MWSA 3IXHA 1IEMA 4WZ4A 1GCEA 1G6AA 4LENA 4CPKA 1YLWA 4OPRA 2C6WB 2DNSA 1GA0A 3C7VA 4PM7A 3ZNYA 4BD1A 4D2OA 3NC8A 2VGKA 1NYYA 3IH8A 3VP3A 4S2LA 5AQ9A 3VP2A 1WE4A 1KDSA 3ZG8B 3A3IA 5EOEA 4DE0A 1W7FA 4EWFA 1I2SA 3Q7VB 4S2MA 3QHYA 1G68A 3ZCZA 1AXBA 1LHYA 3O87A 3CJMA 4S2OA 4HBUA 4R3BA 4XXRA 2EFXA 5JYOA 3CMZA 3HL9A 4DE2A 3IXGA 2EFUA 4BJPA 5TR7A 3WS0A 4RYEA 4IBRA 3RXWA 2EXAA 3A3DA 2ZQ7A 3SOIA 1GHIA 4JBFA 1NXYA 1YLJA 3HLEA 5CRFA 3O86A 4K0WA 4OONA 2I72A 3Q7VA 4WELA 4X56A 4E3MA 4GD8A 4DRTA 3OPRA 3BYDA 3OPHA 4X69A 1YT4A 3S22A 5FATA 3DTMA 4GZBA 5CEBA 3Q82A
chains in the Genus database with same CATH superfamily
1ES4A 2Q0OA 5EVIA 3VP1A 1QMFA 5J7EA 1M6KA 5EPHA 3B33A 1K6RA 2R9WA 3BJNA 3LIBA 3QP2A 2P74A 2BASA 4R0QA 2V8CA 1FIKA 2IWBA 3V5MA 1OTAA 4YFMA 3MXSA 2CMNA 2HP9A 2P04A 1J9MA 3CZDA 3T4OA 4BWIA 1IKIA 1YKDA 4R4SA 3VOLA 3FZCA 4QY6A 3MQOA 2OWHA 2V8FA 3HUMA 3RXXA 5DFXA 3KX0X 2W3HA 4FSFA 1MWTA 2WZZA 2Z6CA 2EX8A 4OPZA 3VE4A 3IWQA 4IVKA 3FPVA 1S66L 3S7OA 2PAVP 1S1ZA 4QU3A 5DF7A 4ZTKA 5FEFA 4QHCA 4EXOA 3T4QA 1DP6A 2VGJA 5TBMA 4RVAA 4RX3A 4R4RA 3BFEA 1T19A 2HPBA 3UPPA 3D4FA 1BLCA 4JF6A 1YLTA 4ZJ1A 4NXGA 4X25A 4R38A 1C3BA 4BBVA 3ZQ5A 4OLGA 2W3FA 3LICA 4LV0A 1QMEA 5CHJA 1K38A 3C4PA 5CGWA 5FAPA 3JVUA 4KG6A 2XA7S 5FSRA 4HJ4A 5M19A 1FOFA 1S1YA 3HUOA 2PU4A 5FI7A 5FQIA 4X6TA 2NUTC 5D3OA 4K0XA 3WRZA 2O9BA 3H9WA 4MCWA 4MN6A 4N92A 4EERA 3UNWA 5L2FA 3M6BA 5L09A 3NDEA 4NEED 5CEDA 2G2UA 1I2WA 3BLSA 4JLFA 2L0WA 4Q0JA 2JKGA 3W2ZA 1ZTUA 2XF3A 4KQDA 4OP5A 1XFQA 1SKFA 2C5WB 1TEMA 1EW0A 4C6YA 4DXBA 1NJ4A 1W63M 3CG5A 3GQZA 5AVFA 3C7UA 1SHVA 5HL1A 3Q81A 2W1TB 3MKEA 2V2FF 3IBJA 3E0YA 1PNEA 5FQKA 1VM1A 4I3AA 4EQIA 5CGXA 2ZM2A 1RGZA 2VEAA 2J3WA 1BLSA 1V9ZA 3IF6C 1L0DA 1SDEA 4LRZE 2PD7A 1S6RA 4WZ5C 4OOLA 5G4ZA 3T12B 4ID4A 3FWLA 5CGSA 3EGDC 4S2NA 3HCYA 5KSHA 4DXCA 2H10A 4LGWA 5GL9A 1EROA 4OOYA 2FFFB 3E4OA 4WF0A 3NJAA 5FDHA 3BEBA 1X0OA 1T1CA 3T1SA 5AQAA 3C38A 3UPOA 1NWZA 3ZHHA 1MWUA 2XR0A 3NY4A 3OC2A 3CPTB 1Y28A 3CUEC 1BLPA 4LRXC 3DWZA 3T50A 3UE3A 3S1YA 3D3OA 3IWOA 2BTFP 4BBTA 1MKIA 4ETZA 4JXSA 3LEZA 4Y13A 3U2AA 1YLYA 4E3NA 2ZD8A 3W4QA 3HUNA 3G30A 4WL9A 1K54A 4EBLA 1CI8A 4PPRA 2W1RA 3LIEA 3ZG0A 4IJGA 4Y3IA 1LL8A 2ZQ8A 4B4XA 5A8BA 2XA7M 2XRNA 1GHMA 2GJ3A 4NK3A 4LLOB 2EX9A 1K0KA 2VJWA 2WAEA 3G4PA 3W4OA 1A0KA 4DE1A 3L9KA 1PI5A 2HDUA 5CTMA 4LV2A 3OCNA 4ESPA 3ZVWA 4ZJ2A 5KZHA 4WUJA 2VV6A 1JWZA 3FKWA 4PM5A 3ISGA 5EVLA 4OKPA 1JVJA 1K6SA 1KE3A 1N9NA 1SDNA 5GLCA 3RH8B 3UMDA 5FEGA 3UY6A 1XX2A 1N9BA 3LCEA 1K56D 4XUZA 1GSVA 5HD3A 5F5YA 4GS9B 3MZFA 3O3VA 4CQHA 4U0TA 1BZAA 3GECA 2ZC3B 4E3KA 4E3LA 4IVIA 3MBZA 2JKTM 3CI6A 3DW0A 4O8GA 3C30A 5FQJA 2V20A 2IWDA 1P9RA 2PBDP 4Y15A 4KZ5A 3MZDA 5HFOA 4HBTA 4KG2A 2Y2HA 4I39A 2OSUA 1PWDA 3UB8A 1YMSA 2Y2KA 3S7PA 4Q8IA 4DE3A 4O7DA 4GHIB 3MFXA 1WA9A 4LV3A 3BFFA 4G3WA 1N9OA 3KSIA 5TFQA 1FR6A 2X01A 3N8LA 2AVXA 5FAQA 5FI6A 4KG5A 1HD8A 4P0MA 1FCNA 2M7VA 3TG9A 1YLPA 2PD8A 1PI4A 1XPBA 1BT5A 3IQAA 2ZOIA 3ZDJA 3CPTA 1NLZA 4UQIM 2J7VA 3OLOA 3IHAA 1MWSA 3IXHA 4CLCE 3LR0A 4WZ4A 3F1NA 3IBRA 1NRJA 1S4RA 4OPRA 4D2OA 3E98A 1NYYA 3IH8A 4S2LA 3VP2A 5IS1A 4EWFA 4DE0A 1W7FA 4S2MA 2PT7A 2EFUA 2ZQ7A 3SOIA 5CRFA 3HLEA 4K0WA 2I72A 4X56A 4E3MA 4GD8A 3OPRA 3BYDA 4PHTA 4P6ZS 5FATA 4HOIA 2Y2MA 3A3FA 4N9LA 4ZDXA 5G4YA 5IHVA 2ZQDA 3A0RA 1PWGA 1K57A 4LV1A 2ZOHA 3V67A 3UO9A 3IX3A 3R4KA 1F5MA 1XA7A 3LGOA 1XA1A 4X1MA 1LT0A 1L3LA 1RP5A 3MXRA 4KZ7A 5HD5A 4GS9A 4PM8A 3EEAA 2INWA 1OTIA 1XJ6A 1OJGA 5L07A 1NY0A 5U47A 1K57C 1GHPA 3JYIA 4Z1WA 4Q0IA 3RFBA 4KENB 1ZKJA 3N7WA 4EEUA 3V39A 4NETA 4ZBEA 1ERMA 3JVVA 1RCJA 2EWVA 2XGNA 2EWWA 4GHIA 4ZAMA 5FL3A 5GHYA 1YMXA 2A49A 3GR2A 4GB7A 2Q9MA 3UDIA 1WYBA 2VV8A 4KQRA 3T4TA 1MXOA 4FH2A 4MBHA 4OVDA 1N4OA 4WMCA 5JYPA 1EWZA 4M3KA 1XP4A 2Y2PA 5FA7A 2A24A 4Y2FA 4F3LA 3PBQA 3BQAA 1FQGA 1W5DA 4UA7A 2Y2JA 4JXVA 5MC7A 4HH2A 4N1XA 1G28A 2MJ6A 1P9WA 3VSKA 2ZQ9A 2ZC6B 4QD4A 1U60A 3UB6A 3IF6B 1ODVA 3GSGA 1F2KA 4U3TA 2OLVA 5DF8A 4X53A 4YINA 1JWVA 2VX8A 2QHKA 2V0UA 1PZOA 2G2WA 3PAGA 2Y8HA 1LI0A 5IT5A 1YLZA 4R3AA 1PW8A 1MY8A 3EGXC 4KZAA 4P6ZM 4HIAA 1YAXA 1S4SA 3T1QB 3T4SA 3IXDA 4HQAA 5E43A 2Y2QA 2PR5A 4I3IA 5AQ7A 2ZQCA 3MF0A 4CLCA 1IELA 4II7A 1OTEA 1KDWA 3IF5A 1TDGA 2JBFA 3LY4A 1SCWA 5EFWA 3N4IA 1TDLA 3C4OA 4OOMA 3IXBA 3DWKA 3UE1A 1K4EA 3DTEA 3WWXA 3MS6A 5A90A 4O01A 5DF9A 4QWOA 1E3UA 4MLLA 3MR0A 1DP8A 4CLCC 3CLOA 3F1OA 2ZMFA 5FQ9A 3Q07A 3LIAA 4LCLA 2B5RA 3G6OA 2Q9NA 4OPQA 3CWFA 3LO7A 5M1AA 4NXFA 5HDDA 4P85A 2HDRA 2PBYA 1S0WA 2A2LA 1IKGA 3IS2A 3U4LP 3N8SA 3OCLA 1EI5A 5IU1A 1NZUA 3A0SA 2O99A 2Y59A 4RA7A 4LFUA 3G2ZA 2RCXA 4WEKA 1UWNX 1K55C 3GDIA 3B42A 1JNUA 4KZ3A 2QWSA 3IF6A 4PMAA 3UPNA 3EQVA 1T1AA 1CI9A 2ZL1B 4RX2A 5HAPA 4WZ5A 3OBFA 1JTDA 4EW7A 3QP6A 3QNBA 3HLGA 4BBUA 2FZ0A 3KYQA 3TSGA 1OPXA 3B3XA 1IYQA 2EX2A 1KE0A 2ZLYA 2V1AA 1HLUP 4MEZA 5A92A 1ONHA 2WYXA 3IX4A 2UV0E 2K2NA 5HARA 3MKFA 3G31A 4B88A 2I9VA 4K91A 4KQQA 1KGGA 2WK0A 3CUEA 5G18A 4GKUA 3FG8A 5L8MA 5EV0A 2O0YA 3FV7A 2ZM0A 3KSGA 3ITBA 1O07A 1S67L 5J4EA 2QJ5A 4Q0HA 5FQMA 3PBNA 2Z6DA 3V50A 4UQIS 5EUAA 1NZOA 2JKRI 1NYMA 5A91A 4L0LA 4BL2A 1TS0A 1STZA 2IA2A 3NOPC 1Q2QA 5DKLA 4LPZA 4EU0A 2EA9A 5FI2A 3IWIA 4MBFA 1BULA 1KGEA 4BQMA 2VK3A 4HP4A 5EM0A 1OJ5A 3F1NB 5DJTA 4WLAA 2XH9A 5KMWA 4L9FA 2HZ5A 4ETXA 4UA6A 2XK1A 3VOZA 3UB5P 4EBPA 1JWPA 3BY9A 1GCEA 1G6AA 3LIDA 5CX7A 2VGKA 3VP3A 3ZG8B 5EOEA 3MQ0A 3QHYA 1G68A 3DBAA 1LHYA 3O87A 3K2NA 4S2OA 4R3BA 2EFXA 5JYOA 2WKQA 2QYBA 3HL9A 4EUVA 5TR7A 3A3DA 2OAQ1 3C2WA 1GHIA 1ZHHB 4JBFA 3O86A 3Q7VA 4YNRA 3OPHA 4X69A 1XJ4A 3DTMA 1OTDA 1JTGA 3VV4A 3P98A 4KUOA 2ZL1A 3M6HA 1H0MA 5M18A 3G2YA 3SS3A 2WKRA 1LLBA 3JPUA 3PBRA 1W8QA 5HSQA 1ES2A 4Y5FA 2Y2LA 1H8MA 1CF0A 4NXBA 2D01A 3P7NA 1LSWA 2ZMAA 2WGWB 4EBNA 2CC1A 1M40A 1LI9A 1DJAA 2WADA 2RL3A 4HI4A 4O0PA 3E4QA 3W4PA 3LY3A 3P01A 4OQHA 1Y54A 2L1MA 5GLBA 1I5QA 1ONGA 3C8CA 3V3RA 2HF6A 5GHZA 4GD6A 1IOUA 4GOGA 4QPRA 2QKPA 2PYRA 4MN5A 3O88A 1MKMA 3LUQA 3HLFA 1DRMA 3K3DA 3BW6A 4DDYA 3LYXA 5CECA 2A24B 4IUHA 4E3IA 4F3LB 5HWTA 4MBKA 1H8ZA 4OQGA 4OP8A 3K3CA 2WZXA 4CJNA 2HP6A 2QZ6A 2LB9A 4Y0OA 2XDMA 4HEFA 3NDGA 2HP5A 5E2HA 4JGOA 5F1GA 3UE6A 4ARZB 1ZC2A 4BL3A 1LSXA 3LI9A 1E25A 3VOYA 5FASA 1CQAA 3NCKA 1SZVA 3MSHA 1W8YA 1FSYA 3T1XA 4MNRA 4MN7A 2KDKA 2W0NA 3S7QA 4X55A 3UB9A 3A0VA 3FPWA 1XGIA 4WN5A 3GRJA 3WS4A 3Q1FA 4PM6A 3LFVA 4HH3A 3HJIA 2ACGA 4DN0A 4E6WA 2L4RA 3KYZA 4GNUA 2JE5A 5EVID 4E3JA 1D06A 4FD8A 2A3UA 1N9LA 2H28A 1DY6A 3I7JA 5HWVA 1PYYA 2VLGA 5F82A 1G5UA 3G32A 2B02A 5DTSA 2M1CA 4I5SA 4S2KA 5J3WA 2W3EA 4R6LA 3BLMA 2XQZA 4R3JA 1CJFA 4E3OA 4HP9A 4CLCB 2B18A 2BLSA 1BUEA 1Y4OA 2IWCA 3E2KA 2OLUA 2QMIA 1PRQA 3N6IA 4JKTA 3M2JA 1K56A 4JGPA 3ZG9B 5HPFA 1ESUA 3W8KA 2WGWA 1H5XA 4KZ8A 4ME4A 3OOVA 4FCFA 2WKHA 2ZM8A 2V9AA 1GA9A 3SH7A 1E4DA 2O9AA 5A93A 3M2KA 1KOUA 3RJUA 1FCOA 3F1OB 2ZC5B 1KGFA 5I5LA 3VE3A 1VB6A 4OLDA 4L9GA 1ZG6A 3WS1A 5I94A 4WEJA 2R9XA 4EESA 3BFGA 3MMHA 4IBXA 3PXPA 4E6XA 3OPLA 1CEGA 3SZTA 5J8XA 4P87A 3CITA 1PWCA 1HZOA 2WAFA 4YOFA 3DTIA 4KZBA 4Y7PA 2QJ7A 2UWXA 4YWZA 3LR5A 3IS2B 3OZHA 1VETB 5HL6A 2W27A 4ARZA 1ALQA 2XD5A 1DJCA 4KZ4A 2HDQA 4KZ9A 3PHYA 1LSVA 5LBRA 4S2IA 2QPNA 3HBRA 2ZBBA 1SKOA 2Y2OA 2HJ9C 1O7EA 5DFYA 3T4KA 3F1PA 3QNCA 3UB7A 3ZVTA 1FR1A 3O5YA 1K25A 1MZUA 2VZWA 4BD0A 2PR6A 2XLNA 5CHUA 3V3SA 3AGFA 3GVBA 4WYYA 2R78A 3PBTA 3SH8A 3FYZA 4B93A 1MWRA 5F6AA 3PTEA 3DAVA 1LL5A 1L2SA 4R23A 2FFYA 4JF4A 4HHDA 2HGVA 4UEYA 3HLWA 4X68A 1HTZA 4HESA 4I38A 4JXWA 1F98A 3VSLA 4DDSA 1G6OA 1RGYA 2FH5A 3ICYA 1BSGA 3LR4A 4M4XA 3ZG7B 2KOIA 1J3WA 3B47A 5DTTA 4PM9A 5EOOA 4XT2B 5EVIC 2YKFA 1DJBA 3PYPA 4S2PA 4R1GA 4UHUA 3H82A 2J9PA 4EQ1A 2Z2MB 2P9VB 1VHMA 1TF1A 1VEUA 4OQ0A 1PIOA 2O9CA 3EWKA 3WS5A 5GLAA 3UDFA 3RTYA 3NULA 3BFCA 1IFQA 1K55A 1KVMA 2Y2NA 4JGQA 3T1RA 2ZC7A 4Z9QA 2BG1A 3NBLA 4FOFA 1ERQA 1AWIA 3PR6A 5DJUA 1IEMA 4LENA 4CPKA 2DNSA 4MMNA 4I3JA 5AJGA 4DJ2A 3C7VA 3D9YA 4HJ3A 3MQQA 3ZNYA 4IUKA 2JHEA 3IX8A 1VETA 5AQ9A 1KDSA 5HDCA 3Q7VB 2LB5A 2J80A 1T18A 4H6JA 4XXRA 4NXEA 3CMZA 1NLYA 3RXWA 2EXAA 5K5BA 1YLJA 4WELA 1YT4A 5FDSA 5CEBA 3Q82A 3AGDA 1Q2PA 1D7EA 4Y0UA 4QJGA 5FAOA 5KSCA 2KLIA 2WKEA 4B4ZA 4N1HA 5CXWA 1FCMA 3MFDA 1KE4A 4JXGA 3BQ8A 3TE8A 4UAAA 2VGLS 4U0XA 3IT9A 4DMZA 2JKRM 3S4XA 5EVEA 4ZJ3A 5HZHA 2J9OA 4EV4A 3FC7A 1IYSA 2PHYA 2Y55A 3T4LA 2Y91A 2EX6A 4B9OA 2GNXA 3QP8A 2HV1A 4LCMA 5CERA 4OPYA 1YQSA 1WYCA 3R7WB 4DJ3A 5KIZA 4JGRA 4KQOA 4XT2A 3ULFA 4GDNA 1T1BA 3QP5A 1KVLA 2PRFA 1Z6FA 5DTKA 5CTNA 3OPPA 4HNBA 3G34A 1IYOA 2HDSA 3IHBA 3NI9A 4E04A 2GX5A 5GHXA 2DMWA 2WGVA 2P9VA 1TVFA 2VKSA 1D1JA 1TD5A 1XJ2A 1W63Q 1UGUA 4F94A 1YSPA 1YPRA 2WGIA 5HX9A 3N8RA 4GJ4A 5L10A 1L0EA 2JC7A 4GN2A 1LL9A 2GZAA 2KX6A 4GW9A 3P09A 3ZG5A 3S7NA 5F69A 3HVFA 5HAQA 5AVEA 4S2NC 1K4FA 5DKKA 3E4PA 4EETB 5F83A 5F1FA 4GLQA 3SS5A 1ES5A 2V0WA 1OT9A 1H3QA 5E2FA 1OMEA 1DP9A 2PYPA 5HPIA 4JF5A 2JKFA 4KUKA 2PU2A 2E8JA 1VQQA 3MXQA 2JN7A 2OOLA 4DKIA 2Y2IA 4WM9A 5HDSA 2H0YA 4JPMA 2P7JA 4LRYC 2Z2LB 4BENA 3KSFA 3GV9A 4G3VA 5EM1A 1F9IA 2EXBA 3UN7A 3ITAA 1HVBA 1K54C 1XGJA 2V1ZA 4IHQA 2W3GA 3UDXA 3Q7ZA 5AQBA 2OWJA 3AGEA 2WKIA 1XFNA 5GLDA 2K7SA 2B95A 3KYEA 2XD1A 4C75A 2W1TA 5CHMA 2XFSA 2ZMVA 4OQIA 4PKYG 3SH9A 1ESIA 5HWWA 2XFTA 2VGLM 3H7WB 1H8YA 2W3DA 1CK3A 3VP4A 2J3TD 3LI8A 3NOUC 3PAEA 4A5RA 2OV5A 1ZG4A 4PAUA 3R7WA 4NKPA 3BRMA 3UMEA 3SS4A 1CEFA 3MZEA 2V1BA 3WS2A 3ZFZA 3BY8A 2NUPC 1FSWA 3GMWA 3D72A 2ZQAA 3E2LA 4EUZA 2Y4AA 2E8IA 4GDBA 2JKTI 4XUXA 2DRWA 3EOIA 4WMCD 3G35A 4L9EA 5EECA 4R70A 4ZRRA 1TS6A 2X71A 4HJ6A 3NIAA 3BFDA 2ZJ9A 2HJEA 3BECA 3VFHA 1MPLA 5HAIA 1BTLA 1ES3A 5C5KA 3IH9A 3GTCA 4QY5A 1IYPA 5TJJA 1SKOB 2K31A 3LEQA 4WBGA 1YM1A 4GCZA 3F1PB 2J8YA 2H0TA 3BWLA 1XXMA 3VMAA 2Y79A 1MBLA 2G7UA 4UA9A 3A3JA 3TJZC 1UWPX 2D02A 3HJKA 2OAP1 3HLBA 2M7UA 4HY8A 4DF6A 3VP0A 3CAXA 3ZGAB 4Y0TA 5EVIB 1PFLA 4G3KA 4MDZA 3FKVA 1XKZA 5HW3A 3NOTC 4P6BA 3NECA 1FILA 3NHQA 2XSSA 2VA0A 2VV7A 1L0FA 3KSHA 3ZNTA 5EE8A 4H8RA 4FH4A 2X02A 1GSXA 2YKHA 4N9KA 5F68A 3QP1A 3BM6A 4EEPA 4AFIA 4X1LA 3HREA 4QB8A 2JCHA 3HLDA 5E2EA 2PDRA 4NG2A 3WRTA 1PW1A 4FTXA 1BLHA 3VFFA 3A3EA 4CLCD 3HLCA 3LIFA 3KO6A 3LR3A 1PZPA 3SW1A 1Z09A 2GDNA 5E2GA 1L0GA 1GSWA 3PBOA 4RQ9A 3H82B 4S2JA 3T4JA 2H5SA 3C5AA 4BLMA 2WUQA 5TBMB 4FUWA 4IEDA 5TGFA 5DVAA 3H7WA 1VEUB 2DCFA 1MC0A 1W79A 1TS7A 4C3QA 1V9YA 4KZ6A 5FQQA 1E3UD 1NRFA 4PKYA 2ZC4B 4Y17A 5BOHA 3QP4A 1ACFA 3DTKA 1YSQA 2P08A 3CHWP 3UE0A 3TRCA 4D60A 3MJQA 1P0ZA 3TOIA 3EQUA 3L7HA 2XEPA 4OH0A 2Y2GA 3PBSA 1P97A 1OT6A 1YLWA 3TW8A 2C6WB 1GA0A 4PM7A 4H6JB 4BMWA 4BD1A 1TS8A 1XJ3A 3NC8A 2XROA 3ZYTA 2J3TC 4K08A 1WE4A 3A3IA 2WKPA 1I2SA 3ZCZA 1AXBA 3EEHA 3CJMA 1BYWA 4HBUA 4DE2A 3IXGA 4BJPA 3WS0A 4RYEA 4IBRA 1NXYA 4OONA 4DRTA 1OTBA 3S22A 4GZBA
chains in the Genus database with same CATH topology
3AGDA 1JTGA 2Y2MA 1ES4A 3P98A 1Q2PA 5EVIA 4Y0UA 3A3FA 4N9LA 4QJGA 3VP1A 4ZDXA 5IHVA 2ZQDA 3M6HA 5FAOA 1QMFA 5KSCA 1M6KA 1PWGA 2WKEA 5EPHA 4B4ZA 5M18A 1K6RA 3G2YA 4N1HA 5CXWA 1K57A 1FCMA 3SS3A 1LLBA 2R9WA 3MFDA 4LV1A 1KE4A 2P74A 4R0QA 4JXGA 3PBRA 1W8QA 3UO9A 1ES2A 4UAAA 2IWBA 3V5MA 4U0XA 2Y2LA 1XA7A 3IT9A 1XA1A 4YFMA 3MXSA 2HP9A 3S4XA 1J9MA 3CZDA 1RP5A 1IKIA 2ZMAA 3MXRA 2WGWB 4KZ7A 2CC1A 4ZJ3A 2J9OA 4EBNA 4R4SA 4EV4A 1M40A 3FZCA 4PM8A 4QY6A 1LI9A 1DJAA 2WADA 1IYSA 2RL3A 2Y55A 3HUMA 3RXXA 2Y91A 3W4PA 3LY3A 2EX6A 4LCMA 5CERA 4OPYA 1YQSA 1WYCA 4FSFA 4OQHA 1MWTA 2WZZA 2EX8A 4OPZA 1NY0A 5U47A 1K57C 3IWQA 1Y54A 1GHPA 4IVKA 3JYIA 5DF7A 4QU3A 4ZTKA 5GLBA 1I5QA 4QHCA 1ONGA 4KQOA 3V3RA 2VGJA 4KENB 1ZKJA 4RVAA 4R4RA 4RX3A 3BFEA 4GDNA 5GHZA 3N7WA 4GD6A 3V39A 1KVLA 2HPBA 4NETA 1Z6FA 4ZBEA 3UPPA 1ERMA 3D4FA 1BLCA 1RCJA 5CTNA 5DTKA 4JF6A 1YLTA 3OPPA 2XGNA 3G34A 4ZJ1A 1IYOA 4GOGA 2HDSA 3IHBA 1C3BA 3NI9A 3O88A 4ZAMA 5GHYA 5GHXA 2WGVA 1YMXA 2A49A 3HLFA 2P9VA 1TVFA 4OLGA 3GR2A 4GB7A 2Q9MA 4DDYA 3UDIA 5CECA 1WYBA 4F94A 4E3IA 4KQRA 1MXOA 4MBKA 1H8ZA 1QMEA 4LV0A 4FH2A 2WGIA 4OP8A 3N8RA 4OQGA 2WZXA 5CHJA 2HP6A 2QZ6A 4Y0OA 5HX9A 4MBHA 1K38A 3C4PA 2XDMA 4CJNA 1L0EA 4OVDA 5CGWA 2JC7A 4GN2A 1N4OA 5FAPA 4HEFA 3NDGA 2HP5A 4WMCA 5E2HA 1EWZA 1LL9A 4M3KA 5JYPA 1XP4A 2Y2PA 5FA7A 4KG6A 3P09A 5F1GA 3ZG5A 3HVFA 5FSRA 1ZC2A 5HAQA 4BL3A 3PBQA 1E25A 3VOYA 1FOFA 5FASA 5M19A 4S2NC 1K4FA 3NCKA 1FQGA 1W8YA 1FSYA 1W5DA 3HUOA 2PU4A 5FI7A 5F83A 4MNRA 4X6TA 5FQIA 5F1FA 4UA7A 5D3OA 4K0XA 3SS5A 3WRZA 4X55A 1ES5A 2Y2JA 4JXVA 1XGIA 3GRJA 3WS4A 3Q1FA 4N92A 5E2FA 4N1XA 1OMEA 3UNWA 4PM6A 5L2FA 3VSKA 2ZQ9A 2ZC6B 3M6BA 4QD4A 3NDEA 1U60A 4JF5A 3IF6B 5CEDA 3GSGA 2G2UA 1I2WA 3BLSA 4JLFA 2PU2A 4E6WA 1VQQA 4GNUA 4U3TA 2JE5A 2OLVA 4X53A 5DF8A 5EVID 4YINA 4DKIA 2Y2IA 4E3JA 2XF3A 4WM9A 4FD8A 1JWVA 4OP5A 2H0YA 4JPMA 2A3UA 1SKFA 2C5WB 2Z2LB 1TEMA 4BENA 4C6YA 4DXBA 1DY6A 1NJ4A 1PZOA 3I7JA 3CG5A 2G2WA 3GV9A 3GQZA 1PYYA 3PAGA 5F82A 2EXBA 3G32A 5DTSA 1LI0A 3C7UA 3UN7A 3ITAA 1SHVA 1HVBA 4S2KA 1YLZA 1K54C 1XGJA 2V1ZA 5HL1A 3Q81A 3BLMA 1PW8A 2XQZA 3MKEA 2V2FF 3UDXA 1MY8A 3Q7ZA 4R3JA 4KZAA 4E3OA 5AQBA 2BLSA 1BUEA 2IWCA 1VM1A 2WKIA 3AGEA 3E2KA 3IXDA 5FQKA 4EQIA 2OLUA 2QMIA 5GLDA 3N6IA 4JKTA 2Y2QA 5E43A 4C75A 3M2JA 2XD1A 5CGXA 1K56A 2ZM2A 1RGZA 5AQ7A 2ZQCA 3ZG9B 1BLSA 5CHMA 2XFSA 3IF6C 1L0DA 1ESUA 4OQIA 3W8KA 2WGWA 1H5XA 1IELA 4KZ8A 1SDEA 3SH9A 1KDWA 1ESIA 3IF5A 4FCFA 2XFTA 1S6RA 2WKHA 4WZ5C 1TDGA 1H8YA 2ZM8A 2JBFA 1CK3A 4OOLA 3VP4A 1GA9A 3LY4A 3FWLA 4ID4A 5CGSA 3SH7A 1E4DA 3PAEA 4S2NA 4A5RA 2OV5A 1SCWA 3N4IA 5A93A 5KSHA 4DXCA 2H10A 3M2KA 1TDLA 1ZG4A 5GL9A 1EROA 3BRMA 4OOYA 2FFFB 3RJUA 3C4OA 1FCOA 4OOMA 2ZC5B 3IXBA 1CEFA 1KGFA 5FDHA 3SS4A 3MZEA 3DWKA 3WS2A 3ZFZA 3BEBA 4OLDA 1FSWA 3GMWA 3UE1A 1ZG6A 3WS1A 2ZQAA 5I94A 3E2LA 1K4EA 4WEJA 4EUZA 3WWXA 2R9XA 2Y4AA 2E8IA 3BFGA 4GDBA 5A90A 5AQAA 4XUXA 5DF9A 4IBXA 3UPOA 2DRWA 3ZHHA 1MWUA 1E3UA 2XR0A 4MLLA 4WMCD 3G35A 3NY4A 4E6XA 3OC2A 3OPLA 1CEGA 5J8XA 5EECA 5FQ9A 1BLPA 4P87A 1PWCA 3DWZA 1HZOA 2X71A 2WAFA 3Q07A 3S1YA 3UE3A 3NIAA 3BFDA 3IWOA 4LCLA 2ZJ9A 4KZBA 4Y7PA 2B5RA 1MKIA 3BECA 2Q9NA 3VFHA 1MPLA 5HAIA 2UWXA 1BTLA 1ES3A 4OPQA 4JXSA 3LEZA 3IH9A 3GTCA 4QY5A 3LO7A 1YLYA 5M1AA 1IYPA 4E3NA 3OZHA 2ZD8A 4WBGA 3W4QA 1YM1A 3HUNA 1ALQA 2XD5A 1DJCA 3G30A 4KZ4A 1K54A 4P85A 2HDQA 4EBLA 1CI8A 2HDRA 2PBYA 4KZ9A 4PPRA 1S0WA 3ZG0A 2J8YA 1IKGA 2H0TA 1XXMA 3VMAA 4S2IA 1MBLA 2ZQ8A 2QPNA 3N8SA 3HBRA 4B4XA 3OCLA 1EI5A 3A3JA 4UA9A 1NZUA 2Y2OA 2Y59A 4RA7A 1GHMA 3G2ZA 1O7EA 2RCXA 4WEKA 4NK3A 3HLBA 1K55C 2EX9A 3QNCA 4KZ3A 2WAEA 4PMAA 3G4PA 3IF6A 3VP0A 3ZGAB 3ZVTA 4DF6A 3UPNA 1FR1A 3EQVA 4Y0TA 3W4OA 5EVIB 4DE1A 1CI9A 1K25A 1PI5A 2HDUA 4LV2A 3FKVA 5CTMA 1XKZA 4RX2A 5HAPA 5HW3A 3OCNA 4BD0A 4WZ5A 1JTDA 4P6BA 2XLNA 5CHUA 3ZVWA 4ZJ2A 5KZHA 3QNBA 3V3SA 3AGFA 3GVBA 3HLGA 1JWZA 3FKWA 4WYYA 3TSGA 4PM5A 1L0FA 3ISGA 5EVLA 3PBTA 3ZNTA 4OKPA 3B3XA 5EE8A 3SH8A 4H8RA 1JVJA 1K6SA 2X02A 3FYZA 1KE3A 4FH4A 4N9KA 1SDNA 1MWRA 3BM6A 1IYQA 2EX2A 3PTEA 1KE0A 2ZLYA 5GLCA 1LL5A 3UY6A 1L2SA 3HREA 1XX2A 2JCHA 2FFYA 3HLDA 1N9BA 4MEZA 4QB8A 4R23A 5E2EA 3LCEA 1K56D 1ONHA 3WRTA 2WYXA 5A92A 4JF4A 4XUZA 1PW1A 5HARA 1BLHA 3VFFA 3A3EA 3HLWA 3MZFA 4X68A 3HLCA 1HTZA 3O3VA 3MKFA 3G31A 4U0TA 4HESA 4B88A 4K91A 4KQQA 4JXWA 1KGGA 3VSLA 1BZAA 4DDSA 1RGYA 2WK0A 2ZC3B 4E3KA 1PZPA 4E3LA 4IVIA 1BSGA 3MBZA 5G18A 4GKUA 2GDNA 3DW0A 5E2GA 1L0GA 3ZG7B 3PBOA 4S2JA 2H5SA 3C5AA 5DTTA 5FQJA 2WUQA 2V20A 4PM9A 2IWDA 5EOOA 4BLMA 3FV7A 2ZM0A 4KZ5A 3ITBA 3MZDA 1O07A 5EVIC 4HBTA 5HFOA 4IEDA 1DJBA 4KG2A 5TGFA 2Y2HA 5DVAA 2OSUA 1PWDA 4S2PA 4R1GA 2DCFA 1YMSA 2Y2KA 4Q8IA 4UHUA 5FQMA 4DE3A 4O7DA 3PBNA 3V50A 4LV3A 1W79A 5EUAA 4C3QA 2J9PA 1NZOA 4KZ6A 1NYMA 2Z2MB 3BFFA 5FQQA 5A91A 2P9VB 1E3UD 5TFQA 4L0LA 4BL2A 1FR6A 2X01A 3N8LA 1Q2QA 5FAQA 5FI6A 4KG5A 1HD8A 1NRFA 4OQ0A 4P0MA 1FCNA 1PIOA 3WS5A 2ZC4B 5FI2A 3IWIA 4MBFA 3TG9A 5BOHA 5GLAA 1BULA 1KGEA 3UDFA 4BQMA 1YLPA 3BFCA 1PI4A 1K55A 1XPBA 1BT5A 1KVMA 3IQAA 3ZDJA 2Y2NA 2XH9A 3UE0A 5KMWA 2ZC7A 4Z9QA 2BG1A 3NBLA 4UA6A 2J7VA 2XK1A 1ERQA 3TOIA 3EQUA 3VOZA 2XEPA 3IHAA 4OH0A 2Y2GA 3PBSA 4EBPA 1JWPA 1MWSA 3IXHA 1IEMA 4WZ4A 1GCEA 1G6AA 4LENA 4CPKA 1YLWA 4OPRA 2C6WB 2DNSA 1GA0A 3C7VA 4PM7A 3ZNYA 4BD1A 4D2OA 3NC8A 2VGKA 1NYYA 3IH8A 3VP3A 4S2LA 5AQ9A 3VP2A 1WE4A 1KDSA 3ZG8B 3A3IA 5EOEA 4DE0A 1W7FA 4EWFA 1I2SA 3Q7VB 4S2MA 3QHYA 1G68A 3ZCZA 1AXBA 1LHYA 3O87A 3CJMA 4S2OA 4HBUA 4R3BA 4XXRA 2EFXA 5JYOA 3CMZA 3HL9A 4DE2A 3IXGA 2EFUA 4BJPA 5TR7A 3WS0A 4RYEA 4IBRA 3RXWA 2EXAA 3A3DA 2ZQ7A 3SOIA 1GHIA 4JBFA 1NXYA 1YLJA 3HLEA 5CRFA 3O86A 4K0WA 4OONA 2I72A 3Q7VA 4WELA 4X56A 4E3MA 4GD8A 4DRTA 3OPRA 3BYDA 3OPHA 4X69A 1YT4A 3S22A 5FATA 3DTMA 4GZBA 5CEBA 3Q82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AGD A;  1JTG A;  2Y2M A;  1ES4 A;  3P98 A;  1Q2P A;  5EVI A;  4Y0U A;  3A3F A;  4N9L A;  4QJG A;  3VP1 A;  4ZDX A;  5IHV A;  2ZQD A;  3M6H A;  5FAO A;  1QMF A;  5KSC A;  1M6K A;  1PWG A;  2WKE A;  5EPH A;  4B4Z A;  5M18 A;  1K6R A;  3G2Y A;  4N1H A;  5CXW A;  1K57 A;  1FCM A;  3SS3 A;  1LLB A;  2R9W A;  3MFD A;  4LV1 A;  1KE4 A;  2P74 A;  4R0Q A;  4JXG A;  3PBR A;  1W8Q A;  3UO9 A;  1ES2 A;  4UAA A;  2IWB A;  3V5M A;  4U0X A;  2Y2L A;  1XA7 A;  3IT9 A;  1XA1 A;  4YFM A;  3MXS A;  2HP9 A;  3S4X A;  1J9M A;  3CZD A;  1RP5 A;  1IKI A;  2ZMA A;  3MXR A;  2WGW B;  4KZ7 A;  2CC1 A;  4ZJ3 A;  2J9O A;  4EBN A;  4R4S A;  4EV4 A;  1M40 A;  3FZC A;  4PM8 A;  4QY6 A;  1LI9 A;  1DJA A;  2WAD A;  1IYS A;  2RL3 A;  2Y55 A;  3HUM A;  3RXX A;  2Y91 A;  3W4P A;  3LY3 A;  2EX6 A;  4LCM A;  5CER A;  4OPY A;  1YQS A;  1WYC A;  4FSF A;  4OQH A;  1MWT A;  2WZZ A;  2EX8 A;  4OPZ A;  1NY0 A;  5U47 A;  1K57 C;  3IWQ A;  1Y54 A;  1GHP A;  4IVK A;  3JYI A;  5DF7 A;  4QU3 A;  4ZTK A;  5GLB A;  1I5Q A;  4QHC A;  1ONG A;  4KQO A;  3V3R A;  2VGJ A;  4KEN B;  1ZKJ A;  4RVA A;  4R4R A;  4RX3 A;  3BFE A;  4GDN A;  5GHZ A;  3N7W A;  4GD6 A;  3V39 A;  1KVL A;  2HPB A;  4NET A;  1Z6F A;  4ZBE A;  3UPP A;  1ERM A;  3D4F A;  1BLC A;  1RCJ A;  5CTN A;  5DTK A;  4JF6 A;  1YLT A;  3OPP A;  2XGN A;  3G34 A;  4ZJ1 A;  1IYO A;  4GOG A;  2HDS A;  3IHB A;  1C3B A;  3NI9 A;  3O88 A;  4ZAM A;  5GHY A;  5GHX A;  2WGV A;  1YMX A;  2A49 A;  3HLF A;  2P9V A;  1TVF A;  4OLG A;  3GR2 A;  4GB7 A;  2Q9M A;  4DDY A;  3UDI A;  5CEC A;  1WYB A;  4F94 A;  4E3I A;  4KQR A;  1MXO A;  4MBK A;  1H8Z A;  1QME A;  4LV0 A;  4FH2 A;  2WGI A;  4OP8 A;  3N8R A;  4OQG A;  2WZX A;  5CHJ A;  2HP6 A;  2QZ6 A;  4Y0O A;  5HX9 A;  4MBH A;  1K38 A;  3C4P A;  2XDM A;  4CJN A;  1L0E A;  4OVD A;  5CGW A;  2JC7 A;  4GN2 A;  1N4O A;  5FAP A;  4HEF A;  3NDG A;  2HP5 A;  4WMC A;  5E2H A;  1EWZ A;  1LL9 A;  4M3K A;  5JYP A;  1XP4 A;  2Y2P A;  5FA7 A;  4KG6 A;  3P09 A;  5F1G A;  3ZG5 A;  3HVF A;  5FSR A;  1ZC2 A;  5HAQ A;  4BL3 A;  3PBQ A;  1E25 A;  3VOY A;  1FOF A;  5FAS A;  5M19 A;  4S2N C;  1K4F A;  3NCK A;  1FQG A;  1W8Y A;  1FSY A;  1W5D A;  3HUO A;  2PU4 A;  5FI7 A;  5F83 A;  4MNR A;  4X6T A;  5FQI A;  5F1F A;  4UA7 A;  5D3O A;  4K0X A;  3SS5 A;  3WRZ A;  4X55 A;  1ES5 A;  2Y2J A;  4JXV A;  1XGI A;  3GRJ A;  3WS4 A;  3Q1F A;  4N92 A;  5E2F A;  4N1X A;  1OME A;  3UNW A;  4PM6 A;  5L2F A;  3VSK A;  2ZQ9 A;  2ZC6 B;  3M6B A;  4QD4 A;  3NDE A;  1U60 A;  4JF5 A;  3IF6 B;  5CED A;  3GSG A;  2G2U A;  1I2W A;  3BLS A;  4JLF A;  2PU2 A;  4E6W A;  1VQQ A;  4GNU A;  4U3T A;  2JE5 A;  2OLV A;  4X53 A;  5DF8 A;  5EVI D;  4YIN A;  4DKI A;  2Y2I A;  4E3J A;  2XF3 A;  4WM9 A;  4FD8 A;  1JWV A;  4OP5 A;  2H0Y A;  4JPM A;  2A3U A;  1SKF A;  2C5W B;  2Z2L B;  1TEM A;  4BEN A;  4C6Y A;  4DXB A;  1DY6 A;  1NJ4 A;  1PZO A;  3I7J A;  3CG5 A;  2G2W A;  3GV9 A;  3GQZ A;  1PYY A;  3PAG A;  5F82 A;  2EXB A;  3G32 A;  5DTS A;  1LI0 A;  3C7U A;  3UN7 A;  3ITA A;  1SHV A;  1HVB A;  4S2K A;  1YLZ A;  1K54 C;  1XGJ A;  2V1Z A;  5HL1 A;  3Q81 A;  3BLM A;  1PW8 A;  2XQZ A;  3MKE A;  2V2F F;  3UDX A;  1MY8 A;  3Q7Z A;  4R3J A;  4KZA A;  4E3O A;  5AQB A;  2BLS A;  1BUE A;  2IWC A;  1VM1 A;  2WKI A;  3AGE A;  3E2K A;  3IXD A;  5FQK A;  4EQI A;  2OLU A;  2QMI A;  5GLD A;  3N6I A;  4JKT A;  2Y2Q A;  5E43 A;  4C75 A;  3M2J A;  2XD1 A;  5CGX A;  1K56 A;  2ZM2 A;  1RGZ A;  5AQ7 A;  2ZQC A;  3ZG9 B;  1BLS A;  5CHM A;  2XFS A;  3IF6 C;  1L0D A;  1ESU A;  4OQI A;  3W8K A;  2WGW A;  1H5X A;  1IEL A;  4KZ8 A;  1SDE A;  3SH9 A;  1KDW A;  1ESI A;  3IF5 A;  4FCF A;  2XFT A;  1S6R A;  2WKH A;  4WZ5 C;  1TDG A;  1H8Y A;  2ZM8 A;  2JBF A;  1CK3 A;  4OOL A;  3VP4 A;  1GA9 A;  3LY4 A;  3FWL A;  4ID4 A;  5CGS A;  3SH7 A;  1E4D A;  3PAE A;  4S2N A;  4A5R A;  2OV5 A;  1SCW A;  3N4I A;  5A93 A;  5KSH A;  4DXC A;  2H10 A;  3M2K A;  1TDL A;  1ZG4 A;  5GL9 A;  1ERO A;  3BRM A;  4OOY A;  2FFF B;  3RJU A;  3C4O A;  1FCO A;  4OOM A;  2ZC5 B;  3IXB A;  1CEF A;  1KGF A;  5FDH A;  3SS4 A;  3MZE A;  3DWK A;  3WS2 A;  3ZFZ A;  3BEB A;  4OLD A;  1FSW A;  3GMW A;  3UE1 A;  1ZG6 A;  3WS1 A;  2ZQA A;  5I94 A;  3E2L A;  1K4E A;  4WEJ A;  4EUZ A;  3WWX A;  2R9X A;  2Y4A A;  2E8I A;  3BFG A;  4GDB A;  5A90 A;  5AQA A;  4XUX A;  5DF9 A;  4IBX A;  3UPO A;  2DRW A;  3ZHH A;  1MWU A;  1E3U A;  2XR0 A;  4MLL A;  4WMC D;  3G35 A;  3NY4 A;  4E6X A;  3OC2 A;  3OPL A;  1CEG A;  5J8X A;  5EEC A;  5FQ9 A;  1BLP A;  4P87 A;  1PWC A;  3DWZ A;  1HZO A;  2X71 A;  2WAF A;  3Q07 A;  3S1Y A;  3UE3 A;  3NIA A;  3BFD A;  3IWO A;  4LCL A;  2ZJ9 A;  4KZB A;  4Y7P A;  2B5R A;  1MKI A;  3BEC A;  2Q9N A;  3VFH A;  1MPL A;  5HAI A;  2UWX A;  1BTL A;  1ES3 A;  4OPQ A;  4JXS A;  3LEZ A;  3IH9 A;  3GTC A;  4QY5 A;  3LO7 A;  1YLY A;  5M1A A;  1IYP A;  4E3N A;  3OZH A;  2ZD8 A;  4WBG A;  3W4Q A;  1YM1 A;  3HUN A;  1ALQ A;  2XD5 A;  1DJC A;  3G30 A;  4KZ4 A;  1K54 A;  4P85 A;  2HDQ A;  4EBL A;  1CI8 A;  2HDR A;  2PBY A;  4KZ9 A;  4PPR A;  1S0W A;  3ZG0 A;  2J8Y A;  1IKG A;  2H0T A;  1XXM A;  3VMA A;  4S2I A;  1MBL A;  2ZQ8 A;  2QPN A;  3N8S A;  3HBR A;  4B4X A;  3OCL A;  1EI5 A;  3A3J A;  4UA9 A;  1NZU A;  2Y2O A;  2Y59 A;  4RA7 A;  1GHM A;  3G2Z A;  1O7E A;  2RCX A;  4WEK A;  4NK3 A;  3HLB A;  1K55 C;  2EX9 A;  3QNC A;  4KZ3 A;  2WAE A;  4PMA A;  3G4P A;  3IF6 A;  3VP0 A;  3ZGA B;  3ZVT A;  4DF6 A;  3UPN A;  1FR1 A;  3EQV A;  4Y0T A;  3W4O A;  5EVI B;  4DE1 A;  1CI9 A;  1K25 A;  1PI5 A;  2HDU A;  4LV2 A;  3FKV A;  5CTM A;  1XKZ A;  4RX2 A;  5HAP A;  5HW3 A;  3OCN A;  4BD0 A;  4WZ5 A;  1JTD A;  4P6B A;  2XLN A;  5CHU A;  3ZVW A;  4ZJ2 A;  5KZH A;  3QNB A;  3V3S A;  3AGF A;  3GVB A;  3HLG A;  1JWZ A;  3FKW A;  4WYY A;  3TSG A;  4PM5 A;  1L0F A;  3ISG A;  5EVL A;  3PBT A;  3ZNT A;  4OKP A;  3B3X A;  5EE8 A;  3SH8 A;  4H8R A;  1JVJ A;  1K6S A;  2X02 A;  3FYZ A;  1KE3 A;  4FH4 A;  4N9K A;  1SDN A;  1MWR A;  3BM6 A;  1IYQ A;  2EX2 A;  3PTE A;  1KE0 A;  2ZLY A;  5GLC A;  1LL5 A;  3UY6 A;  1L2S A;  3HRE A;  1XX2 A;  2JCH A;  2FFY A;  3HLD A;  1N9B A;  4MEZ A;  4QB8 A;  4R23 A;  5E2E A;  3LCE A;  1K56 D;  1ONH A;  3WRT A;  2WYX A;  5A92 A;  4JF4 A;  4XUZ A;  1PW1 A;  5HAR A;  1BLH A;  3VFF A;  3A3E A;  3HLW A;  3MZF A;  4X68 A;  3HLC A;  1HTZ A;  3O3V A;  3MKF A;  3G31 A;  4U0T A;  4HES A;  4B88 A;  4K91 A;  4KQQ A;  4JXW A;  1KGG A;  3VSL A;  1BZA A;  4DDS A;  1RGY A;  2WK0 A;  2ZC3 B;  4E3K A;  1PZP A;  4E3L A;  4IVI A;  1BSG A;  3MBZ A;  5G18 A;  4GKU A;  2GDN A;  3DW0 A;  5E2G A;  1L0G A;  3ZG7 B;  3PBO A;  4S2J A;  2H5S A;  3C5A A;  5DTT A;  5FQJ A;  2WUQ A;  2V20 A;  4PM9 A;  2IWD A;  5EOO A;  4BLM A;  3FV7 A;  2ZM0 A;  4KZ5 A;  3ITB A;  3MZD A;  1O07 A;  5EVI C;  4HBT A;  5HFO A;  4IED A;  1DJB A;  4KG2 A;  5TGF A;  2Y2H A;  5DVA A;  2OSU A;  1PWD A;  4S2P A;  4R1G A;  2DCF A;  1YMS A;  2Y2K A;  4Q8I A;  4UHU A;  5FQM A;  4DE3 A;  4O7D A;  3PBN A;  3V50 A;  4LV3 A;  1W79 A;  5EUA A;  4C3Q A;  2J9P A;  1NZO A;  4KZ6 A;  1NYM A;  2Z2M B;  3BFF A;  5FQQ A;  5A91 A;  2P9V B;  1E3U D;  5TFQ A;  4L0L A;  4BL2 A;  1FR6 A;  2X01 A;  3N8L A;  1Q2Q A;  5FAQ A;  5FI6 A;  4KG5 A;  1HD8 A;  1NRF A;  4OQ0 A;  4P0M A;  1FCN A;  1PIO A;  3WS5 A;  2ZC4 B;  5FI2 A;  3IWI A;  4MBF A;  3TG9 A;  5BOH A;  5GLA A;  1BUL A;  1KGE A;  3UDF A;  4BQM A;  1YLP A;  3BFC A;  1PI4 A;  1K55 A;  1XPB A;  1BT5 A;  1KVM A;  3IQA A;  3ZDJ A;  2Y2N A;  2XH9 A;  3UE0 A;  5KMW A;  2ZC7 A;  4Z9Q A;  2BG1 A;  3NBL A;  4UA6 A;  2J7V A;  2XK1 A;  1ERQ A;  3TOI A;  3EQU A;  3VOZ A;  2XEP A;  3IHA A;  4OH0 A;  2Y2G A;  3PBS A;  4EBP A;  1JWP A;  1MWS A;  3IXH A;  1IEM A;  4WZ4 A;  1GCE A;  1G6A A;  4LEN A;  4CPK A;  1YLW A;  4OPR A;  2C6W B;  2DNS A;  1GA0 A;  3C7V A;  4PM7 A;  3ZNY A;  4BD1 A;  4D2O A;  3NC8 A;  2VGK A;  1NYY A;  3IH8 A;  3VP3 A;  4S2L A;  5AQ9 A;  3VP2 A;  1WE4 A;  1KDS A;  3ZG8 B;  3A3I A;  5EOE A;  4DE0 A;  1W7F A;  4EWF A;  1I2S A;  3Q7V B;  4S2M A;  3QHY A;  1G68 A;  3ZCZ A;  1AXB A;  1LHY A;  3O87 A;  3CJM A;  4S2O A;  4HBU A;  4R3B A;  4XXR A;  2EFX A;  5JYO A;  3CMZ A;  3HL9 A;  4DE2 A;  3IXG A;  2EFU A;  4BJP A;  5TR7 A;  3WS0 A;  4RYE A;  4IBR A;  3RXW A;  2EXA A;  3A3D A;  2ZQ7 A;  3SOI A;  1GHI A;  4JBF A;  1NXY A;  1YLJ A;  3HLE A;  5CRF A;  3O86 A;  4K0W A;  4OON A;  2I72 A;  3Q7V A;  4WEL A;  4X56 A;  4E3M A;  4GD8 A;  4DRT A;  3OPR A;  3BYD A;  3OPH A;  4X69 A;  1YT4 A;  3S22 A;  5FAT A;  3DTM A;  4GZB A;  5CEB A;  3Q82 A; 
#chains in the Genus database with same CATH topology
 1ES4 A;  2Q0O A;  5EVI A;  3VP1 A;  1QMF A;  5J7E A;  1M6K A;  5EPH A;  3B33 A;  1K6R A;  2R9W A;  3BJN A;  3LIB A;  3QP2 A;  2P74 A;  2BAS A;  4R0Q A;  2V8C A;  1FIK A;  2IWB A;  3V5M A;  1OTA A;  4YFM A;  3MXS A;  2CMN A;  2HP9 A;  2P04 A;  1J9M A;  3CZD A;  3T4O A;  4BWI A;  1IKI A;  1YKD A;  4R4S A;  3VOL A;  3FZC A;  4QY6 A;  3MQO A;  2OWH A;  2V8F A;  3HUM A;  3RXX A;  5DFX A;  3KX0 X;  2W3H A;  4FSF A;  1MWT A;  2WZZ A;  2Z6C A;  2EX8 A;  4OPZ A;  3VE4 A;  3IWQ A;  4IVK A;  3FPV A;  1S66 L;  3S7O A;  2PAV P;  1S1Z A;  4QU3 A;  5DF7 A;  4ZTK A;  5FEF A;  4QHC A;  4EXO A;  3T4Q A;  1DP6 A;  2VGJ A;  5TBM A;  4RVA A;  4RX3 A;  4R4R A;  3BFE A;  1T19 A;  2HPB A;  3UPP A;  3D4F A;  1BLC A;  4JF6 A;  1YLT A;  4ZJ1 A;  4NXG A;  4X25 A;  4R38 A;  1C3B A;  4BBV A;  3ZQ5 A;  4OLG A;  2W3F A;  3LIC A;  4LV0 A;  1QME A;  5CHJ A;  1K38 A;  3C4P A;  5CGW A;  5FAP A;  3JVU A;  4KG6 A;  2XA7 S;  5FSR A;  4HJ4 A;  5M19 A;  1FOF A;  1S1Y A;  3HUO A;  2PU4 A;  5FI7 A;  5FQI A;  4X6T A;  2NUT C;  5D3O A;  4K0X A;  3WRZ A;  2O9B A;  3H9W A;  4MCW A;  4MN6 A;  4N92 A;  4EER A;  3UNW A;  5L2F A;  3M6B A;  5L09 A;  3NDE A;  4NEE D;  5CED A;  2G2U A;  1I2W A;  3BLS A;  4JLF A;  2L0W A;  4Q0J A;  2JKG A;  3W2Z A;  1ZTU A;  2XF3 A;  4KQD A;  4OP5 A;  1XFQ A;  1SKF A;  2C5W B;  1TEM A;  1EW0 A;  4C6Y A;  4DXB A;  1NJ4 A;  1W63 M;  3CG5 A;  3GQZ A;  5AVF A;  3C7U A;  1SHV A;  5HL1 A;  3Q81 A;  2W1T B;  3MKE A;  2V2F F;  3IBJ A;  3E0Y A;  1PNE A;  5FQK A;  1VM1 A;  4I3A A;  4EQI A;  5CGX A;  2ZM2 A;  1RGZ A;  2VEA A;  2J3W A;  1BLS A;  1V9Z A;  3IF6 C;  1L0D A;  1SDE A;  4LRZ E;  2PD7 A;  1S6R A;  4WZ5 C;  4OOL A;  5G4Z A;  3T12 B;  4ID4 A;  3FWL A;  5CGS A;  3EGD C;  4S2N A;  3HCY A;  5KSH A;  4DXC A;  2H10 A;  4LGW A;  5GL9 A;  1ERO A;  4OOY A;  2FFF B;  3E4O A;  4WF0 A;  3NJA A;  5FDH A;  3BEB A;  1X0O A;  1T1C A;  3T1S A;  5AQA A;  3C38 A;  3UPO A;  1NWZ A;  3ZHH A;  1MWU A;  2XR0 A;  3NY4 A;  3OC2 A;  3CPT B;  1Y28 A;  3CUE C;  1BLP A;  4LRX C;  3DWZ A;  3T50 A;  3UE3 A;  3S1Y A;  3D3O A;  3IWO A;  2BTF P;  4BBT A;  1MKI A;  4ETZ A;  4JXS A;  3LEZ A;  4Y13 A;  3U2A A;  1YLY A;  4E3N A;  2ZD8 A;  3W4Q A;  3HUN A;  3G30 A;  4WL9 A;  1K54 A;  4EBL A;  1CI8 A;  4PPR A;  2W1R A;  3LIE A;  3ZG0 A;  4IJG A;  4Y3I A;  1LL8 A;  2ZQ8 A;  4B4X A;  5A8B A;  2XA7 M;  2XRN A;  1GHM A;  2GJ3 A;  4NK3 A;  4LLO B;  2EX9 A;  1K0K A;  2VJW A;  2WAE A;  3G4P A;  3W4O A;  1A0K A;  4DE1 A;  3L9K A;  1PI5 A;  2HDU A;  5CTM A;  4LV2 A;  3OCN A;  4ESP A;  3ZVW A;  4ZJ2 A;  5KZH A;  4WUJ A;  2VV6 A;  1JWZ A;  3FKW A;  4PM5 A;  3ISG A;  5EVL A;  4OKP A;  1JVJ A;  1K6S A;  1KE3 A;  1N9N A;  1SDN A;  5GLC A;  3RH8 B;  3UMD A;  5FEG A;  3UY6 A;  1XX2 A;  1N9B A;  3LCE A;  1K56 D;  4XUZ A;  1GSV A;  5HD3 A;  5F5Y A;  4GS9 B;  3MZF A;  3O3V A;  4CQH A;  4U0T A;  1BZA A;  3GEC A;  2ZC3 B;  4E3K A;  4E3L A;  4IVI A;  3MBZ A;  2JKT M;  3CI6 A;  3DW0 A;  4O8G A;  3C30 A;  5FQJ A;  2V20 A;  2IWD A;  1P9R A;  2PBD P;  4Y15 A;  4KZ5 A;  3MZD A;  5HFO A;  4HBT A;  4KG2 A;  2Y2H A;  4I39 A;  2OSU A;  1PWD A;  3UB8 A;  1YMS A;  2Y2K A;  3S7P A;  4Q8I A;  4DE3 A;  4O7D A;  4GHI B;  3MFX A;  1WA9 A;  4LV3 A;  3BFF A;  4G3W A;  1N9O A;  3KSI A;  5TFQ A;  1FR6 A;  2X01 A;  3N8L A;  2AVX A;  5FAQ A;  5FI6 A;  4KG5 A;  1HD8 A;  4P0M A;  1FCN A;  2M7V A;  3TG9 A;  1YLP A;  2PD8 A;  1PI4 A;  1XPB A;  1BT5 A;  3IQA A;  2ZOI A;  3ZDJ A;  3CPT A;  1NLZ A;  4UQI M;  2J7V A;  3OLO A;  3IHA A;  1MWS A;  3IXH A;  4CLC E;  3LR0 A;  4WZ4 A;  3F1N A;  3IBR A;  1NRJ A;  1S4R A;  4OPR A;  4D2O A;  3E98 A;  1NYY A;  3IH8 A;  4S2L A;  3VP2 A;  5IS1 A;  4EWF A;  4DE0 A;  1W7F A;  4S2M A;  2PT7 A;  2EFU A;  2ZQ7 A;  3SOI A;  5CRF A;  3HLE A;  4K0W A;  2I72 A;  4X56 A;  4E3M A;  4GD8 A;  3OPR A;  3BYD A;  4PHT A;  4P6Z S;  5FAT A;  4HOI A;  2Y2M A;  3A3F A;  4N9L A;  4ZDX A;  5G4Y A;  5IHV A;  2ZQD A;  3A0R A;  1PWG A;  1K57 A;  4LV1 A;  2ZOH A;  3V67 A;  3UO9 A;  3IX3 A;  3R4K A;  1F5M A;  1XA7 A;  3LGO A;  1XA1 A;  4X1M A;  1LT0 A;  1L3L A;  1RP5 A;  3MXR A;  4KZ7 A;  5HD5 A;  4GS9 A;  4PM8 A;  3EEA A;  2INW A;  1OTI A;  1XJ6 A;  1OJG A;  5L07 A;  1NY0 A;  5U47 A;  1K57 C;  1GHP A;  3JYI A;  4Z1W A;  4Q0I A;  3RFB A;  4KEN B;  1ZKJ A;  3N7W A;  4EEU A;  3V39 A;  4NET A;  4ZBE A;  1ERM A;  3JVV A;  1RCJ A;  2EWV A;  2XGN A;  2EWW A;  4GHI A;  4ZAM A;  5FL3 A;  5GHY A;  1YMX A;  2A49 A;  3GR2 A;  4GB7 A;  2Q9M A;  3UDI A;  1WYB A;  2VV8 A;  4KQR A;  3T4T A;  1MXO A;  4FH2 A;  4MBH A;  4OVD A;  1N4O A;  4WMC A;  5JYP A;  1EWZ A;  4M3K A;  1XP4 A;  2Y2P A;  5FA7 A;  2A24 A;  4Y2F A;  4F3L A;  3PBQ A;  3BQA A;  1FQG A;  1W5D A;  4UA7 A;  2Y2J A;  4JXV A;  5MC7 A;  4HH2 A;  4N1X A;  1G28 A;  2MJ6 A;  1P9W A;  3VSK A;  2ZQ9 A;  2ZC6 B;  4QD4 A;  1U60 A;  3UB6 A;  3IF6 B;  1ODV A;  3GSG A;  1F2K A;  4U3T A;  2OLV A;  5DF8 A;  4X53 A;  4YIN A;  1JWV A;  2VX8 A;  2QHK A;  2V0U A;  1PZO A;  2G2W A;  3PAG A;  2Y8H A;  1LI0 A;  5IT5 A;  1YLZ A;  4R3A A;  1PW8 A;  1MY8 A;  3EGX C;  4KZA A;  4P6Z M;  4HIA A;  1YAX A;  1S4S A;  3T1Q B;  3T4S A;  3IXD A;  4HQA A;  5E43 A;  2Y2Q A;  2PR5 A;  4I3I A;  5AQ7 A;  2ZQC A;  3MF0 A;  4CLC A;  1IEL A;  4II7 A;  1OTE A;  1KDW A;  3IF5 A;  1TDG A;  2JBF A;  3LY4 A;  1SCW A;  5EFW A;  3N4I A;  1TDL A;  3C4O A;  4OOM A;  3IXB A;  3DWK A;  3UE1 A;  1K4E A;  3DTE A;  3WWX A;  3MS6 A;  5A90 A;  4O01 A;  5DF9 A;  4QWO A;  1E3U A;  4MLL A;  3MR0 A;  1DP8 A;  4CLC C;  3CLO A;  3F1O A;  2ZMF A;  5FQ9 A;  3Q07 A;  3LIA A;  4LCL A;  2B5R A;  3G6O A;  2Q9N A;  4OPQ A;  3CWF A;  3LO7 A;  5M1A A;  4NXF A;  5HDD A;  4P85 A;  2HDR A;  2PBY A;  1S0W A;  2A2L A;  1IKG A;  3IS2 A;  3U4L P;  3N8S A;  3OCL A;  1EI5 A;  5IU1 A;  1NZU A;  3A0S A;  2O99 A;  2Y59 A;  4RA7 A;  4LFU A;  3G2Z A;  2RCX A;  4WEK A;  1UWN X;  1K55 C;  3GDI A;  3B42 A;  1JNU A;  4KZ3 A;  2QWS A;  3IF6 A;  4PMA A;  3UPN A;  3EQV A;  1T1A A;  1CI9 A;  2ZL1 B;  4RX2 A;  5HAP A;  4WZ5 A;  3OBF A;  1JTD A;  4EW7 A;  3QP6 A;  3QNB A;  3HLG A;  4BBU A;  2FZ0 A;  3KYQ A;  3TSG A;  1OPX A;  3B3X A;  1IYQ A;  2EX2 A;  1KE0 A;  2ZLY A;  2V1A A;  1HLU P;  4MEZ A;  5A92 A;  1ONH A;  2WYX A;  3IX4 A;  2UV0 E;  2K2N A;  5HAR A;  3MKF A;  3G31 A;  4B88 A;  2I9V A;  4K91 A;  4KQQ A;  1KGG A;  2WK0 A;  3CUE A;  5G18 A;  4GKU A;  3FG8 A;  5L8M A;  5EV0 A;  2O0Y A;  3FV7 A;  2ZM0 A;  3KSG A;  3ITB A;  1O07 A;  1S67 L;  5J4E A;  2QJ5 A;  4Q0H A;  5FQM A;  3PBN A;  2Z6D A;  3V50 A;  4UQI S;  5EUA A;  1NZO A;  2JKR I;  1NYM A;  5A91 A;  4L0L A;  4BL2 A;  1TS0 A;  1STZ A;  2IA2 A;  3NOP C;  1Q2Q A;  5DKL A;  4LPZ A;  4EU0 A;  2EA9 A;  5FI2 A;  3IWI A;  4MBF A;  1BUL A;  1KGE A;  4BQM A;  2VK3 A;  4HP4 A;  5EM0 A;  1OJ5 A;  3F1N B;  5DJT A;  4WLA A;  2XH9 A;  5KMW A;  4L9F A;  2HZ5 A;  4ETX A;  4UA6 A;  2XK1 A;  3VOZ A;  3UB5 P;  4EBP A;  1JWP A;  3BY9 A;  1GCE A;  1G6A A;  3LID A;  5CX7 A;  2VGK A;  3VP3 A;  3ZG8 B;  5EOE A;  3MQ0 A;  3QHY A;  1G68 A;  3DBA A;  1LHY A;  3O87 A;  3K2N A;  4S2O A;  4R3B A;  2EFX A;  5JYO A;  2WKQ A;  2QYB A;  3HL9 A;  4EUV A;  5TR7 A;  3A3D A;  2OAQ 1;  3C2W A;  1GHI A;  1ZHH B;  4JBF A;  3O86 A;  3Q7V A;  4YNR A;  3OPH A;  4X69 A;  1XJ4 A;  3DTM A;  1OTD A;  1JTG A;  3VV4 A;  3P98 A;  4KUO A;  2ZL1 A;  3M6H A;  1H0M A;  5M18 A;  3G2Y A;  3SS3 A;  2WKR A;  1LLB A;  3JPU A;  3PBR A;  1W8Q A;  5HSQ A;  1ES2 A;  4Y5F A;  2Y2L A;  1H8M A;  1CF0 A;  4NXB A;  2D01 A;  3P7N A;  1LSW A;  2ZMA A;  2WGW B;  4EBN A;  2CC1 A;  1M40 A;  1LI9 A;  1DJA A;  2WAD A;  2RL3 A;  4HI4 A;  4O0P A;  3E4Q A;  3W4P A;  3LY3 A;  3P01 A;  4OQH A;  1Y54 A;  2L1M A;  5GLB A;  1I5Q A;  1ONG A;  3C8C A;  3V3R A;  2HF6 A;  5GHZ A;  4GD6 A;  1IOU A;  4GOG A;  4QPR A;  2QKP A;  2PYR A;  4MN5 A;  3O88 A;  1MKM A;  3LUQ A;  3HLF A;  1DRM A;  3K3D A;  3BW6 A;  4DDY A;  3LYX A;  5CEC A;  2A24 B;  4IUH A;  4E3I A;  4F3L B;  5HWT A;  4MBK A;  1H8Z A;  4OQG A;  4OP8 A;  3K3C A;  2WZX A;  4CJN A;  2HP6 A;  2QZ6 A;  2LB9 A;  4Y0O A;  2XDM A;  4HEF A;  3NDG A;  2HP5 A;  5E2H A;  4JGO A;  5F1G A;  3UE6 A;  4ARZ B;  1ZC2 A;  4BL3 A;  1LSX A;  3LI9 A;  1E25 A;  3VOY A;  5FAS A;  1CQA A;  3NCK A;  1SZV A;  3MSH A;  1W8Y A;  1FSY A;  3T1X A;  4MNR A;  4MN7 A;  2KDK A;  2W0N A;  3S7Q A;  4X55 A;  3UB9 A;  3A0V A;  3FPW A;  1XGI A;  4WN5 A;  3GRJ A;  3WS4 A;  3Q1F A;  4PM6 A;  3LFV A;  4HH3 A;  3HJI A;  2ACG A;  4DN0 A;  4E6W A;  2L4R A;  3KYZ A;  4GNU A;  2JE5 A;  5EVI D;  4E3J A;  1D06 A;  4FD8 A;  2A3U A;  1N9L A;  2H28 A;  1DY6 A;  3I7J A;  5HWV A;  1PYY A;  2VLG A;  5F82 A;  1G5U A;  3G32 A;  2B02 A;  5DTS A;  2M1C A;  4I5S A;  4S2K A;  5J3W A;  2W3E A;  4R6L A;  3BLM A;  2XQZ A;  4R3J A;  1CJF A;  4E3O A;  4HP9 A;  4CLC B;  2B18 A;  2BLS A;  1BUE A;  1Y4O A;  2IWC A;  3E2K A;  2OLU A;  2QMI A;  1PRQ A;  3N6I A;  4JKT A;  3M2J A;  1K56 A;  4JGP A;  3ZG9 B;  5HPF A;  1ESU A;  3W8K A;  2WGW A;  1H5X A;  4KZ8 A;  4ME4 A;  3OOV A;  4FCF A;  2WKH A;  2ZM8 A;  2V9A A;  1GA9 A;  3SH7 A;  1E4D A;  2O9A A;  5A93 A;  3M2K A;  1KOU A;  3RJU A;  1FCO A;  3F1O B;  2ZC5 B;  1KGF A;  5I5L A;  3VE3 A;  1VB6 A;  4OLD A;  4L9G A;  1ZG6 A;  3WS1 A;  5I94 A;  4WEJ A;  2R9X A;  4EES A;  3BFG A;  3MMH A;  4IBX A;  3PXP A;  4E6X A;  3OPL A;  1CEG A;  3SZT A;  5J8X A;  4P87 A;  3CIT A;  1PWC A;  1HZO A;  2WAF A;  4YOF A;  3DTI A;  4KZB A;  4Y7P A;  2QJ7 A;  2UWX A;  4YWZ A;  3LR5 A;  3IS2 B;  3OZH A;  1VET B;  5HL6 A;  2W27 A;  4ARZ A;  1ALQ A;  2XD5 A;  1DJC A;  4KZ4 A;  2HDQ A;  4KZ9 A;  3PHY A;  1LSV A;  5LBR A;  4S2I A;  2QPN A;  3HBR A;  2ZBB A;  1SKO A;  2Y2O A;  2HJ9 C;  1O7E A;  5DFY A;  3T4K A;  3F1P A;  3QNC A;  3UB7 A;  3ZVT A;  1FR1 A;  3O5Y A;  1K25 A;  1MZU A;  2VZW A;  4BD0 A;  2PR6 A;  2XLN A;  5CHU A;  3V3S A;  3AGF A;  3GVB A;  4WYY A;  2R78 A;  3PBT A;  3SH8 A;  3FYZ A;  4B93 A;  1MWR A;  5F6A A;  3PTE A;  3DAV A;  1LL5 A;  1L2S A;  4R23 A;  2FFY A;  4JF4 A;  4HHD A;  2HGV A;  4UEY A;  3HLW A;  4X68 A;  1HTZ A;  4HES A;  4I38 A;  4JXW A;  1F98 A;  3VSL A;  4DDS A;  1G6O A;  1RGY A;  2FH5 A;  3ICY A;  1BSG A;  3LR4 A;  4M4X A;  3ZG7 B;  2KOI A;  1J3W A;  3B47 A;  5DTT A;  4PM9 A;  5EOO A;  4XT2 B;  5EVI C;  2YKF A;  1DJB A;  3PYP A;  4S2P A;  4R1G A;  4UHU A;  3H82 A;  2J9P A;  4EQ1 A;  2Z2M B;  2P9V B;  1VHM A;  1TF1 A;  1VEU A;  4OQ0 A;  1PIO A;  2O9C A;  3EWK A;  3WS5 A;  5GLA A;  3UDF A;  3RTY A;  3NUL A;  3BFC A;  1IFQ A;  1K55 A;  1KVM A;  2Y2N A;  4JGQ A;  3T1R A;  2ZC7 A;  4Z9Q A;  2BG1 A;  3NBL A;  4FOF A;  1ERQ A;  1AWI A;  3PR6 A;  5DJU A;  1IEM A;  4LEN A;  4CPK A;  2DNS A;  4MMN A;  4I3J A;  5AJG A;  4DJ2 A;  3C7V A;  3D9Y A;  4HJ3 A;  3MQQ A;  3ZNY A;  4IUK A;  2JHE A;  3IX8 A;  1VET A;  5AQ9 A;  1KDS A;  5HDC A;  3Q7V B;  2LB5 A;  2J80 A;  1T18 A;  4H6J A;  4XXR A;  4NXE A;  3CMZ A;  1NLY A;  3RXW A;  2EXA A;  5K5B A;  1YLJ A;  4WEL A;  1YT4 A;  5FDS A;  5CEB A;  3Q82 A;  3AGD A;  1Q2P A;  1D7E A;  4Y0U A;  4QJG A;  5FAO A;  5KSC A;  2KLI A;  2WKE A;  4B4Z A;  4N1H A;  5CXW A;  1FCM A;  3MFD A;  1KE4 A;  4JXG A;  3BQ8 A;  3TE8 A;  4UAA A;  2VGL S;  4U0X A;  3IT9 A;  4DMZ A;  2JKR M;  3S4X A;  5EVE A;  4ZJ3 A;  5HZH A;  2J9O A;  4EV4 A;  3FC7 A;  1IYS A;  2PHY A;  2Y55 A;  3T4L A;  2Y91 A;  2EX6 A;  4B9O A;  2GNX A;  3QP8 A;  2HV1 A;  4LCM A;  5CER A;  4OPY A;  1YQS A;  1WYC A;  3R7W B;  4DJ3 A;  5KIZ A;  4JGR A;  4KQO A;  4XT2 A;  3ULF A;  4GDN A;  1T1B A;  3QP5 A;  1KVL A;  2PRF A;  1Z6F A;  5DTK A;  5CTN A;  3OPP A;  4HNB A;  3G34 A;  1IYO A;  2HDS A;  3IHB A;  3NI9 A;  4E04 A;  2GX5 A;  5GHX A;  2DMW A;  2WGV A;  2P9V A;  1TVF A;  2VKS A;  1D1J A;  1TD5 A;  1XJ2 A;  1W63 Q;  1UGU A;  4F94 A;  1YSP A;  1YPR A;  2WGI A;  5HX9 A;  3N8R A;  4GJ4 A;  5L10 A;  1L0E A;  2JC7 A;  4GN2 A;  1LL9 A;  2GZA A;  2KX6 A;  4GW9 A;  3P09 A;  3ZG5 A;  3S7N A;  5F69 A;  3HVF A;  5HAQ A;  5AVE A;  4S2N C;  1K4F A;  5DKK A;  3E4P A;  4EET B;  5F83 A;  5F1F A;  4GLQ A;  3SS5 A;  1ES5 A;  2V0W A;  1OT9 A;  1H3Q A;  5E2F A;  1OME A;  1DP9 A;  2PYP A;  5HPI A;  4JF5 A;  2JKF A;  4KUK A;  2PU2 A;  2E8J A;  1VQQ A;  3MXQ A;  2JN7 A;  2OOL A;  4DKI A;  2Y2I A;  4WM9 A;  5HDS A;  2H0Y A;  4JPM A;  2P7J A;  4LRY C;  2Z2L B;  4BEN A;  3KSF A;  3GV9 A;  4G3V A;  5EM1 A;  1F9I A;  2EXB A;  3UN7 A;  3ITA A;  1HVB A;  1K54 C;  1XGJ A;  2V1Z A;  4IHQ A;  2W3G A;  3UDX A;  3Q7Z A;  5AQB A;  2OWJ A;  3AGE A;  2WKI A;  1XFN A;  5GLD A;  2K7S A;  2B95 A;  3KYE A;  2XD1 A;  4C75 A;  2W1T A;  5CHM A;  2XFS A;  2ZMV A;  4OQI A;  4PKY G;  3SH9 A;  1ESI A;  5HWW A;  2XFT A;  2VGL M;  3H7W B;  1H8Y A;  2W3D A;  1CK3 A;  3VP4 A;  2J3T D;  3LI8 A;  3NOU C;  3PAE A;  4A5R A;  2OV5 A;  1ZG4 A;  4PAU A;  3R7W A;  4NKP A;  3BRM A;  3UME A;  3SS4 A;  1CEF A;  3MZE A;  2V1B A;  3WS2 A;  3ZFZ A;  3BY8 A;  2NUP C;  1FSW A;  3GMW A;  3D72 A;  2ZQA A;  3E2L A;  4EUZ A;  2Y4A A;  2E8I A;  4GDB A;  2JKT I;  4XUX A;  2DRW A;  3EOI A;  4WMC D;  3G35 A;  4L9E A;  5EEC A;  4R70 A;  4ZRR A;  1TS6 A;  2X71 A;  4HJ6 A;  3NIA A;  3BFD A;  2ZJ9 A;  2HJE A;  3BEC A;  3VFH A;  1MPL A;  5HAI A;  1BTL A;  1ES3 A;  5C5K A;  3IH9 A;  3GTC A;  4QY5 A;  1IYP A;  5TJJ A;  1SKO B;  2K31 A;  3LEQ A;  4WBG A;  1YM1 A;  4GCZ A;  3F1P B;  2J8Y A;  2H0T A;  3BWL A;  1XXM A;  3VMA A;  2Y79 A;  1MBL A;  2G7U A;  4UA9 A;  3A3J A;  3TJZ C;  1UWP X;  2D02 A;  3HJK A;  2OAP 1;  3HLB A;  2M7U A;  4HY8 A;  4DF6 A;  3VP0 A;  3CAX A;  3ZGA B;  4Y0T A;  5EVI B;  1PFL A;  4G3K A;  4MDZ A;  3FKV A;  1XKZ A;  5HW3 A;  3NOT C;  4P6B A;  3NEC A;  1FIL A;  3NHQ A;  2XSS A;  2VA0 A;  2VV7 A;  1L0F A;  3KSH A;  3ZNT A;  5EE8 A;  4H8R A;  4FH4 A;  2X02 A;  1GSX A;  2YKH A;  4N9K A;  5F68 A;  3QP1 A;  3BM6 A;  4EEP A;  4AFI A;  4X1L A;  3HRE A;  4QB8 A;  2JCH A;  3HLD A;  5E2E A;  2PDR A;  4NG2 A;  3WRT A;  1PW1 A;  4FTX A;  1BLH A;  3VFF A;  3A3E A;  4CLC D;  3HLC A;  3LIF A;  3KO6 A;  3LR3 A;  1PZP A;  3SW1 A;  1Z09 A;  2GDN A;  5E2G A;  1L0G A;  1GSW A;  3PBO A;  4RQ9 A;  3H82 B;  4S2J A;  3T4J A;  2H5S A;  3C5A A;  4BLM A;  2WUQ A;  5TBM B;  4FUW A;  4IED A;  5TGF A;  5DVA A;  3H7W A;  1VEU B;  2DCF A;  1MC0 A;  1W79 A;  1TS7 A;  4C3Q A;  1V9Y A;  4KZ6 A;  5FQQ A;  1E3U D;  1NRF A;  4PKY A;  2ZC4 B;  4Y17 A;  5BOH A;  3QP4 A;  1ACF A;  3DTK A;  1YSQ A;  2P08 A;  3CHW P;  3UE0 A;  3TRC A;  4D60 A;  3MJQ A;  1P0Z A;  3TOI A;  3EQU A;  3L7H A;  2XEP A;  4OH0 A;  2Y2G A;  3PBS A;  1P97 A;  1OT6 A;  1YLW A;  3TW8 A;  2C6W B;  1GA0 A;  4PM7 A;  4H6J B;  4BMW A;  4BD1 A;  1TS8 A;  1XJ3 A;  3NC8 A;  2XRO A;  3ZYT A;  2J3T C;  4K08 A;  1WE4 A;  3A3I A;  2WKP A;  1I2S A;  3ZCZ A;  1AXB A;  3EEH A;  3CJM A;  1BYW A;  4HBU A;  4DE2 A;  3IXG A;  4BJP A;  3WS0 A;  4RYE A;  4IBR A;  1NXY A;  4OON A;  4DRT A;  1OTB A;  3S22 A;  4GZB A; 
#chains in the Genus database with same CATH homology
 3AGD A;  1JTG A;  2Y2M A;  1ES4 A;  3P98 A;  1Q2P A;  5EVI A;  4Y0U A;  3A3F A;  4N9L A;  4QJG A;  3VP1 A;  4ZDX A;  5IHV A;  2ZQD A;  3M6H A;  5FAO A;  1QMF A;  5KSC A;  1M6K A;  1PWG A;  2WKE A;  5EPH A;  4B4Z A;  5M18 A;  1K6R A;  3G2Y A;  4N1H A;  5CXW A;  1K57 A;  1FCM A;  3SS3 A;  1LLB A;  2R9W A;  3MFD A;  4LV1 A;  1KE4 A;  2P74 A;  4R0Q A;  4JXG A;  3PBR A;  1W8Q A;  3UO9 A;  1ES2 A;  4UAA A;  2IWB A;  3V5M A;  4U0X A;  2Y2L A;  1XA7 A;  3IT9 A;  1XA1 A;  4YFM A;  3MXS A;  2HP9 A;  3S4X A;  1J9M A;  3CZD A;  1RP5 A;  1IKI A;  2ZMA A;  3MXR A;  2WGW B;  4KZ7 A;  2CC1 A;  4ZJ3 A;  2J9O A;  4EBN A;  4R4S A;  4EV4 A;  1M40 A;  3FZC A;  4PM8 A;  4QY6 A;  1LI9 A;  1DJA A;  2WAD A;  1IYS A;  2RL3 A;  2Y55 A;  3HUM A;  3RXX A;  2Y91 A;  3W4P A;  3LY3 A;  2EX6 A;  4LCM A;  5CER A;  4OPY A;  1YQS A;  1WYC A;  4FSF A;  4OQH A;  1MWT A;  2WZZ A;  2EX8 A;  4OPZ A;  1NY0 A;  5U47 A;  1K57 C;  3IWQ A;  1Y54 A;  1GHP A;  4IVK A;  3JYI A;  5DF7 A;  4QU3 A;  4ZTK A;  5GLB A;  1I5Q A;  4QHC A;  1ONG A;  4KQO A;  3V3R A;  2VGJ A;  4KEN B;  1ZKJ A;  4RVA A;  4R4R A;  4RX3 A;  3BFE A;  4GDN A;  5GHZ A;  3N7W A;  4GD6 A;  3V39 A;  1KVL A;  2HPB A;  4NET A;  1Z6F A;  4ZBE A;  3UPP A;  1ERM A;  3D4F A;  1BLC A;  1RCJ A;  5CTN A;  5DTK A;  4JF6 A;  1YLT A;  3OPP A;  2XGN A;  3G34 A;  4ZJ1 A;  1IYO A;  4GOG A;  2HDS A;  3IHB A;  1C3B A;  3NI9 A;  3O88 A;  4ZAM A;  5GHY A;  5GHX A;  2WGV A;  1YMX A;  2A49 A;  3HLF A;  2P9V A;  1TVF A;  4OLG A;  3GR2 A;  4GB7 A;  2Q9M A;  4DDY A;  3UDI A;  5CEC A;  1WYB A;  4F94 A;  4E3I A;  4KQR A;  1MXO A;  4MBK A;  1H8Z A;  1QME A;  4LV0 A;  4FH2 A;  2WGI A;  4OP8 A;  3N8R A;  4OQG A;  2WZX A;  5CHJ A;  2HP6 A;  2QZ6 A;  4Y0O A;  5HX9 A;  4MBH A;  1K38 A;  3C4P A;  2XDM A;  4CJN A;  1L0E A;  4OVD A;  5CGW A;  2JC7 A;  4GN2 A;  1N4O A;  5FAP A;  4HEF A;  3NDG A;  2HP5 A;  4WMC A;  5E2H A;  1EWZ A;  1LL9 A;  4M3K A;  5JYP A;  1XP4 A;  2Y2P A;  5FA7 A;  4KG6 A;  3P09 A;  5F1G A;  3ZG5 A;  3HVF A;  5FSR A;  1ZC2 A;  5HAQ A;  4BL3 A;  3PBQ A;  1E25 A;  3VOY A;  1FOF A;  5FAS A;  5M19 A;  4S2N C;  1K4F A;  3NCK A;  1FQG A;  1W8Y A;  1FSY A;  1W5D A;  3HUO A;  2PU4 A;  5FI7 A;  5F83 A;  4MNR A;  4X6T A;  5FQI A;  5F1F A;  4UA7 A;  5D3O A;  4K0X A;  3SS5 A;  3WRZ A;  4X55 A;  1ES5 A;  2Y2J A;  4JXV A;  1XGI A;  3GRJ A;  3WS4 A;  3Q1F A;  4N92 A;  5E2F A;  4N1X A;  1OME A;  3UNW A;  4PM6 A;  5L2F A;  3VSK A;  2ZQ9 A;  2ZC6 B;  3M6B A;  4QD4 A;  3NDE A;  1U60 A;  4JF5 A;  3IF6 B;  5CED A;  3GSG A;  2G2U A;  1I2W A;  3BLS A;  4JLF A;  2PU2 A;  4E6W A;  1VQQ A;  4GNU A;  4U3T A;  2JE5 A;  2OLV A;  4X53 A;  5DF8 A;  5EVI D;  4YIN A;  4DKI A;  2Y2I A;  4E3J A;  2XF3 A;  4WM9 A;  4FD8 A;  1JWV A;  4OP5 A;  2H0Y A;  4JPM A;  2A3U A;  1SKF A;  2C5W B;  2Z2L B;  1TEM A;  4BEN A;  4C6Y A;  4DXB A;  1DY6 A;  1NJ4 A;  1PZO A;  3I7J A;  3CG5 A;  2G2W A;  3GV9 A;  3GQZ A;  1PYY A;  3PAG A;  5F82 A;  2EXB A;  3G32 A;  5DTS A;  1LI0 A;  3C7U A;  3UN7 A;  3ITA A;  1SHV A;  1HVB A;  4S2K A;  1YLZ A;  1K54 C;  1XGJ A;  2V1Z A;  5HL1 A;  3Q81 A;  3BLM A;  1PW8 A;  2XQZ A;  3MKE A;  2V2F F;  3UDX A;  1MY8 A;  3Q7Z A;  4R3J A;  4KZA A;  4E3O A;  5AQB A;  2BLS A;  1BUE A;  2IWC A;  1VM1 A;  2WKI A;  3AGE A;  3E2K A;  3IXD A;  5FQK A;  4EQI A;  2OLU A;  2QMI A;  5GLD A;  3N6I A;  4JKT A;  2Y2Q A;  5E43 A;  4C75 A;  3M2J A;  2XD1 A;  5CGX A;  1K56 A;  2ZM2 A;  1RGZ A;  5AQ7 A;  2ZQC A;  3ZG9 B;  1BLS A;  5CHM A;  2XFS A;  3IF6 C;  1L0D A;  1ESU A;  4OQI A;  3W8K A;  2WGW A;  1H5X A;  1IEL A;  4KZ8 A;  1SDE A;  3SH9 A;  1KDW A;  1ESI A;  3IF5 A;  4FCF A;  2XFT A;  1S6R A;  2WKH A;  4WZ5 C;  1TDG A;  1H8Y A;  2ZM8 A;  2JBF A;  1CK3 A;  4OOL A;  3VP4 A;  1GA9 A;  3LY4 A;  3FWL A;  4ID4 A;  5CGS A;  3SH7 A;  1E4D A;  3PAE A;  4S2N A;  4A5R A;  2OV5 A;  1SCW A;  3N4I A;  5A93 A;  5KSH A;  4DXC A;  2H10 A;  3M2K A;  1TDL A;  1ZG4 A;  5GL9 A;  1ERO A;  3BRM A;  4OOY A;  2FFF B;  3RJU A;  3C4O A;  1FCO A;  4OOM A;  2ZC5 B;  3IXB A;  1CEF A;  1KGF A;  5FDH A;  3SS4 A;  3MZE A;  3DWK A;  3WS2 A;  3ZFZ A;  3BEB A;  4OLD A;  1FSW A;  3GMW A;  3UE1 A;  1ZG6 A;  3WS1 A;  2ZQA A;  5I94 A;  3E2L A;  1K4E A;  4WEJ A;  4EUZ A;  3WWX A;  2R9X A;  2Y4A A;  2E8I A;  3BFG A;  4GDB A;  5A90 A;  5AQA A;  4XUX A;  5DF9 A;  4IBX A;  3UPO A;  2DRW A;  3ZHH A;  1MWU A;  1E3U A;  2XR0 A;  4MLL A;  4WMC D;  3G35 A;  3NY4 A;  4E6X A;  3OC2 A;  3OPL A;  1CEG A;  5J8X A;  5EEC A;  5FQ9 A;  1BLP A;  4P87 A;  1PWC A;  3DWZ A;  1HZO A;  2X71 A;  2WAF A;  3Q07 A;  3S1Y A;  3UE3 A;  3NIA A;  3BFD A;  3IWO A;  4LCL A;  2ZJ9 A;  4KZB A;  4Y7P A;  2B5R A;  1MKI A;  3BEC A;  2Q9N A;  3VFH A;  1MPL A;  5HAI A;  2UWX A;  1BTL A;  1ES3 A;  4OPQ A;  4JXS A;  3LEZ A;  3IH9 A;  3GTC A;  4QY5 A;  3LO7 A;  1YLY A;  5M1A A;  1IYP A;  4E3N A;  3OZH A;  2ZD8 A;  4WBG A;  3W4Q A;  1YM1 A;  3HUN A;  1ALQ A;  2XD5 A;  1DJC A;  3G30 A;  4KZ4 A;  1K54 A;  4P85 A;  2HDQ A;  4EBL A;  1CI8 A;  2HDR A;  2PBY A;  4KZ9 A;  4PPR A;  1S0W A;  3ZG0 A;  2J8Y A;  1IKG A;  2H0T A;  1XXM A;  3VMA A;  4S2I A;  1MBL A;  2ZQ8 A;  2QPN A;  3N8S A;  3HBR A;  4B4X A;  3OCL A;  1EI5 A;  3A3J A;  4UA9 A;  1NZU A;  2Y2O A;  2Y59 A;  4RA7 A;  1GHM A;  3G2Z A;  1O7E A;  2RCX A;  4WEK A;  4NK3 A;  3HLB A;  1K55 C;  2EX9 A;  3QNC A;  4KZ3 A;  2WAE A;  4PMA A;  3G4P A;  3IF6 A;  3VP0 A;  3ZGA B;  3ZVT A;  4DF6 A;  3UPN A;  1FR1 A;  3EQV A;  4Y0T A;  3W4O A;  5EVI B;  4DE1 A;  1CI9 A;  1K25 A;  1PI5 A;  2HDU A;  4LV2 A;  3FKV A;  5CTM A;  1XKZ A;  4RX2 A;  5HAP A;  5HW3 A;  3OCN A;  4BD0 A;  4WZ5 A;  1JTD A;  4P6B A;  2XLN A;  5CHU A;  3ZVW A;  4ZJ2 A;  5KZH A;  3QNB A;  3V3S A;  3AGF A;  3GVB A;  3HLG A;  1JWZ A;  3FKW A;  4WYY A;  3TSG A;  4PM5 A;  1L0F A;  3ISG A;  5EVL A;  3PBT A;  3ZNT A;  4OKP A;  3B3X A;  5EE8 A;  3SH8 A;  4H8R A;  1JVJ A;  1K6S A;  2X02 A;  3FYZ A;  1KE3 A;  4FH4 A;  4N9K A;  1SDN A;  1MWR A;  3BM6 A;  1IYQ A;  2EX2 A;  3PTE A;  1KE0 A;  2ZLY A;  5GLC A;  1LL5 A;  3UY6 A;  1L2S A;  3HRE A;  1XX2 A;  2JCH A;  2FFY A;  3HLD A;  1N9B A;  4MEZ A;  4QB8 A;  4R23 A;  5E2E A;  3LCE A;  1K56 D;  1ONH A;  3WRT A;  2WYX A;  5A92 A;  4JF4 A;  4XUZ A;  1PW1 A;  5HAR A;  1BLH A;  3VFF A;  3A3E A;  3HLW A;  3MZF A;  4X68 A;  3HLC A;  1HTZ A;  3O3V A;  3MKF A;  3G31 A;  4U0T A;  4HES A;  4B88 A;  4K91 A;  4KQQ A;  4JXW A;  1KGG A;  3VSL A;  1BZA A;  4DDS A;  1RGY A;  2WK0 A;  2ZC3 B;  4E3K A;  1PZP A;  4E3L A;  4IVI A;  1BSG A;  3MBZ A;  5G18 A;  4GKU A;  2GDN A;  3DW0 A;  5E2G A;  1L0G A;  3ZG7 B;  3PBO A;  4S2J A;  2H5S A;  3C5A A;  5DTT A;  5FQJ A;  2WUQ A;  2V20 A;  4PM9 A;  2IWD A;  5EOO A;  4BLM A;  3FV7 A;  2ZM0 A;  4KZ5 A;  3ITB A;  3MZD A;  1O07 A;  5EVI C;  4HBT A;  5HFO A;  4IED A;  1DJB A;  4KG2 A;  5TGF A;  2Y2H A;  5DVA A;  2OSU A;  1PWD A;  4S2P A;  4R1G A;  2DCF A;  1YMS A;  2Y2K A;  4Q8I A;  4UHU A;  5FQM A;  4DE3 A;  4O7D A;  3PBN A;  3V50 A;  4LV3 A;  1W79 A;  5EUA A;  4C3Q A;  2J9P A;  1NZO A;  4KZ6 A;  1NYM A;  2Z2M B;  3BFF A;  5FQQ A;  5A91 A;  2P9V B;  1E3U D;  5TFQ A;  4L0L A;  4BL2 A;  1FR6 A;  2X01 A;  3N8L A;  1Q2Q A;  5FAQ A;  5FI6 A;  4KG5 A;  1HD8 A;  1NRF A;  4OQ0 A;  4P0M A;  1FCN A;  1PIO A;  3WS5 A;  2ZC4 B;  5FI2 A;  3IWI A;  4MBF A;  3TG9 A;  5BOH A;  5GLA A;  1BUL A;  1KGE A;  3UDF A;  4BQM A;  1YLP A;  3BFC A;  1PI4 A;  1K55 A;  1XPB A;  1BT5 A;  1KVM A;  3IQA A;  3ZDJ A;  2Y2N A;  2XH9 A;  3UE0 A;  5KMW A;  2ZC7 A;  4Z9Q A;  2BG1 A;  3NBL A;  4UA6 A;  2J7V A;  2XK1 A;  1ERQ A;  3TOI A;  3EQU A;  3VOZ A;  2XEP A;  3IHA A;  4OH0 A;  2Y2G A;  3PBS A;  4EBP A;  1JWP A;  1MWS A;  3IXH A;  1IEM A;  4WZ4 A;  1GCE A;  1G6A A;  4LEN A;  4CPK A;  1YLW A;  4OPR A;  2C6W B;  2DNS A;  1GA0 A;  3C7V A;  4PM7 A;  3ZNY A;  4BD1 A;  4D2O A;  3NC8 A;  2VGK A;  1NYY A;  3IH8 A;  3VP3 A;  4S2L A;  5AQ9 A;  3VP2 A;  1WE4 A;  1KDS A;  3ZG8 B;  3A3I A;  5EOE A;  4DE0 A;  1W7F A;  4EWF A;  1I2S A;  3Q7V B;  4S2M A;  3QHY A;  1G68 A;  3ZCZ A;  1AXB A;  1LHY A;  3O87 A;  3CJM A;  4S2O A;  4HBU A;  4R3B A;  4XXR A;  2EFX A;  5JYO A;  3CMZ A;  3HL9 A;  4DE2 A;  3IXG A;  2EFU A;  4BJP A;  5TR7 A;  3WS0 A;  4RYE A;  4IBR A;  3RXW A;  2EXA A;  3A3D A;  2ZQ7 A;  3SOI A;  1GHI A;  4JBF A;  1NXY A;  1YLJ A;  3HLE A;  5CRF A;  3O86 A;  4K0W A;  4OON A;  2I72 A;  3Q7V A;  4WEL A;  4X56 A;  4E3M A;  4GD8 A;  4DRT A;  3OPR A;  3BYD A;  3OPH A;  4X69 A;  1YT4 A;  3S22 A;  5FAT A;  3DTM A;  4GZB A;  5CEB A;  3Q82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...