4DE2A

Ctx-m-9 class a beta-lactamase complexed with compound 12
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
260
structure length
260
Chain Sequence
AVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
publication title Structure-Based Design of Potent and Ligand-Efficient Inhibitors of CTX-M Class A Beta-Lactamase
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4de2A00
4EBNA 2G2UA 3GMWA 4MBKA 4E3NA 1K55A 1XP4A 2V1ZA 1I5QA 4N9LA 4EWFA 2WGIA 4Q8IA 4RYEA 5DVAA 1KVMA 4FH4A 3FYZA 3NC8A 3HUMA 1SDNA 2Y2IA 4PM6A 2EX9A 2I72A 2R9WA 3BRMA 4MBFA 3ZNYA 3UDIA 2EX6A 4GDBA 3E2LA 5HX9A 4BENA 2ZQDA 4KG5A 2HPBA 1PW8A 1K38A 1K6RA 5CEBA 5I94A 1XKZA 2E8IA 2XGNA 1RGYA 4WZ4A 4S2NC 1ONHA 3GVBA 2EFXA 2ZQAA 4JXGA 2QPNA 1G6AA 5D3OA 5DF7A 5CXWA 5CHJA 4LCLA 4JBFA 2OSUA 3N6IA 2Y2KA 5L2FA 5A92A 2Y55A 3LCEA 4KG6A 5EVIC 3MXRA 4HBTA 1K56A 1E3UA 3ZG7B 3NCKA 3VP0A 3AGDA 4S2JA 2IWDA 4X69A 3OPPA 4OQIA 5F82A 1KGFA 2EX2A 1JWPA 5JYOA 3HLGA 5HAQA 2WKHA 5F1GA 2H10A 5E2GA 3A3IA 4S2NA 4RA7A 3EQUA 5FSRA 4S2OA 1PI5A 3SOIA 4C75A 3G2ZA 4PM9A 4A5RA 1XPBA 5EVIA 1IYSA 3G34A 1ALQA 3G30A 1Y54A 5FI2A 2Y2JA 1LL9A 1MY8A 1TVFA 4OONA 2IWCA 3MKEA 3UNWA 3EQVA 2HDUA 3IWIA 3HLCA 3IH9A 2Z2LB 2Y2PA 3PTEA 4GN2A 3BEBA 3ZVWA 1C3BA 5DTTA 4QY5A 1XGJA 3UO9A 3BLMA 3MZDA 2ZQ8A 3VP4A 5HL1A 5CECA 3ITBA 5GLDA 1W7FA 1PIOA 5M18A 4HBUA 4XUZA 3O87A 3CG5A 3HUNA 3WS0A 2ZQ9A 5A91A 4OVDA 1KVLA 3B3XA 3MXSA 2ZC5B 2ZQ7A 4OOYA 5CERA 5CHUA 2H0TA 1XGIA 3CZDA 2Q9MA 3GRJA 3NDGA 3SS5A 1NYYA 1JTDA 4DE1A 1IKGA 4P0MA 3DWZA 3SS3A 2ZJ9A 5EUAA 4JF6A 3A3DA 3S1YA 1FR1A 5EECA 3O86A 3C4PA 2H5SA 2Y91A 2V20A 3HLFA 2X71A 5CTMA 1RP5A 4BD1A 4E3MA 3W8KA 1K4FA 4OPYA 4OH0A 4KENB 1DJAA 4MEZA 3A3EA 4UA9A 5FATA 3HLWA 1IYPA 3PBQA 1ES4A 5U47A 3ZHHA 1Q2PA 1K57C 2XFTA 2WAFA 1I2SA 3FV7A 5KMWA 2GDNA 5A90A 5GHZA 4X56A 1E3UD 3WS4A 4M3KA 4K91A 4B88A 4UHUA 3SH7A 2XR0A 1YMSA 1K6SA 3OPLA 1JWVA 2ZM0A 1H8YA 2WGWB 2R9XA 4WEJA 1ERMA 1BTLA 3BFEA 3NY4A 4S2MA 3IQAA 4UA6A 5EPHA 1MWTA 3DTMA 4MNRA 5G18A 3GR2A 4Z9QA 1KGGA 3ZGAB 1PI4A 1FQGA 1MXOA 3G2YA 3Q82A 4OLDA 5EVID 2EXAA 4N92A 3FWLA 2Y2OA 3AGFA 5FASA 3BFCA 2J7VA 2X02A 4LENA 3VOYA 3OCLA 2Y2QA 3E2KA 1BLHA 1GA0A 2HDRA 3IXHA 3N8LA 5DF9A 5TGFA 4DXBA 4OPZA 4QD4A 1ES3A 4PM5A 1PZOA 3OPRA 4JKTA 1MWSA 1TEMA 1L2SA 2WKEA 1XA1A 2C6WB 4UAAA 4KG2A 3IXDA 3V50A 3LY4A 4DE2A 1EI5A 4FD8A 4R4SA 4HEFA 4LV3A 3VP2A 5A93A 3BECA 1PWGA 2JC7A 3HUOA 2ZM2A 3IWOA 5GLBA 4XUXA 4PPRA 4ZJ3A 4E6XA 4FSFA 5FQIA 4E3JA 2XLNA 2DNSA 1Z6FA 2PBYA 1PZPA 4JF5A 1TDGA 3VFFA 1YT4A 3A3FA 3LEZA 3WRZA 5HW3A 2DCFA 2OLVA 5FDHA 3OPHA 4Y0UA 2WZXA 4WMCD 1EWZA 1CEGA 4DDYA 4IVIA 1E4DA 1S0WA 2PU2A 1VQQA 1L0DA 2ZC4B 3NIAA 4JXSA 5FQ9A 3OC2A 5HARA 2ZC3B 4WEKA 3OCNA 5HAPA 1LL5A 3RXWA 3BFFA 3N8SA 3ZCZA 2OV5A 2Y2MA 2C5WB 4OQHA 3IF5A 4OKPA 2JE5A 2VGKA 4OQGA 3V5MA 2RCXA 2HP9A 4DF6A 4BL2A 3OZHA 3O3VA 4LV1A 3O88A 5EVIB 4KQQA 3ZG9B 5F83A 3GV9A 5HFOA 5CGWA 1O7EA 1KDSA 1IYOA 5FAOA 4Y0TA 1L0EA 3LY3A 4Y7PA 4P85A 1Q2QA 1SDEA 3ZVTA 3PBSA 1LHYA 3W4OA 1AXBA 2G2WA 3FZCA 4NK3A 4KZ5A 5E2HA 5FQQA 5FQJA 4BD0A 3W4PA 4PMAA 1YLWA 2XD1A 4OLGA 3P98A 3Q7ZA 5AQAA 2ZQCA 4QU3A 4WBGA 1JWZA 2HDSA 3UN7A 1XXMA 5JYPA 3G32A 1BZAA 4CPKA 4U0XA 3IF6C 3UE1A 5CGXA 3VSKA 4S2LA 4LV0A 1NY0A 3C7VA 1BLCA 4WM9A 3Q81A 2XF3A 5TR7A 4KQRA 1CI8A 4EV4A 1ZG6A 1IYQA 1HVBA 3P09A 2FFYA 5HAIA 2CC1A 4DE3A 1MPLA 1BLPA 3HL9A 3ZG8B 3HLDA 5KSCA 1FCOA 1PWCA 5FI6A 1YLPA 3HREA 1YLZA 5M19A 1MKIA 4B4ZA 3C5AA 3G31A 3N7WA 3UPNA 3IF6A 1YLJA 3Q7VA 4ZJ2A 4OPRA 4WZ5C 4OP5A 3IXBA 3C7UA 1N4OA 4GD6A 3I7JA 5AQ9A 3SH9A 4R1GA 4YINA 2J9OA 3CMZA 1MWRA 1GHIA 3Q1FA 4D2OA 4JXVA 3NDEA 4WYYA 2OLUA 3TG9A 3HLEA 3WS2A 4DE0A 4E3KA 1FSYA 3V3SA 4C6YA 3ZG0A 3TOIA 3VFHA 2BG1A 1K56D 3UDXA 4BL3A 1CK3A 2EXBA 4HESA 1N9BA 1LI0A 4DDSA 3UPOA 4F94A 1PYYA 4GNUA 4KZ7A 2Y4AA 1LLBA 4WZ5A 4NETA 1RCJA 1SHVA 2Q9NA 3M2JA 1VM1A 3WWXA 2RL3A 3IHAA 4R0QA 2A3UA 5M1AA 5FA7A 5IHVA 4YFMA 1SKFA 1LI9A 4GDNA 1KDWA 1YLYA 1BSGA 1KE3A 2XD5A 4KZBA 5BOHA 2WZZA 3GQZA 3ZDJA 1I2WA 1ZG4A 2Y59A 2J9PA 3BYDA 1CEFA 4WELA 2WK0A 3DW0A 2EFUA 3ITAA 5DTSA 3V3RA 1E25A 3G4PA 1WYCA 1FCNA 2JBFA 4IBRA 1S6RA 1ERQA 1GA9A 5CRFA 1SCWA 4BQMA 5GLCA 3ZG5A 3HBRA 1GCEA 4R4RA 4EUZA 1KGEA 5E2EA 2QMIA 1J9MA 3QNCA 3LO7A 3IXGA 3N4IA 4KQOA 1W8YA 4GZBA 1GHPA 5GHYA 1DJCA 3AGEA 1FCMA 4KZ9A 1ZKJA 4X53A 1KE0A 4L0LA 2BLSA 3ISGA 1NRFA 2ZC7A 5CHMA 4H8RA 3VSLA 2XH9A 5DTKA 1ONGA 5EOOA 4ZAMA 4R3BA 4QHCA 1NZOA 2Y2NA 4ID4A 3IWQA 5AQ7A 2WUQA 5KZHA 4DRTA 1ZC2A 3HLBA 4MLLA 3A3JA 3FKVA 3WS1A 4B4XA 1FR6A 1BLSA 4JLFA 3C4OA 2Z2MB 2XQZA 4X6TA 1H5XA 1KE4A 5GL9A 2JCHA 2HP6A 4N1XA 2FFFB 4BLMA 3NBLA 5J8XA 2P9VB 4GKUA 1H8ZA 1JVJA 1W5DA 3QNBA 5EE8A 3TSGA 3PBTA 4UA7A 1FOFA 3MBZA 2H0YA 1G68A 4FCFA 4KZ4A 1NXYA 3WRTA 1NYMA 2V2FF 2P9VA 2ZM8A 2X01A 3UE3A 1GHMA 3FKWA 4QJGA 5GLAA 5KSHA 2WYXA 1O07A 2ZC6B 1YLTA 4GD8A 4E6WA 2Y2GA 3VOZA 4RX2A 2HDQA 5DF8A 2QZ6A 4KZ6A 4X68A 1M40A 2P74A 2ZLYA 3MZEA 4S2KA 4S2IA 1ES2A 1CI9A 1ES5A 4S2PA 5FAQA 4KZAA 1HD8A 2A49A 4IEDA 1PWDA 4K0XA 4N1HA 3UY6A 3SH8A 3ZNTA 1DJBA 5FQMA 4KZ8A 2HP5A 3BM6A 4KZ3A 3MFDA 3IF6B 3DWKA 3Q7VB 5F1FA 4K0WA 3S22A 1K4EA 2WKIA 3BLSA 2J8YA 1ESUA 1WE4A 1HTZA 1DY6A 3SS4A 3NI9A 1RGZA 4EBPA 4OOLA 1FSWA 1NJ4A 1QMFA 3M2KA 1K25A 3UE0A 3UPPA 4LV2A 5TFQA 3PBNA 3PBOA 4IVKA 3D4FA 5CTNA 3ZFZA 2PU4A 2ZD8A 2VGJA 1L0FA 2XDMA 1OMEA 1BULA 4QB8A 4E3LA 5CGSA 5CEDA 1IEMA 3M6BA 1W79A 4JXWA 5EOEA 3N8RA 4PM7A 1EROA 5E43A 1K54C 3BFDA 1YM1A 3JYIA 3VMAA 2DRWA 1ESIA 3G35A 1NZUA 4LCMA 4N9KA 3WS5A 4EQIA 5GHXA 4OQ0A 4ZJ1A 1L0GA 5FAPA 3MKFA 1XX2A 2ZMAA 3IT9A 2B5RA 4C3QA 3Q07A 4ZTKA 4OPQA 2XK1A 5FI7A 2IWBA 2EX8A 1IKIA 4WMCA 1IELA 3IHBA 1YMXA 1MBLA 4U0TA 2UWXA 1PW1A 3MZFA 4OOMA 3QHYA 1M6KA 1K54A 5FQKA 4DKIA 3HVFA 1YQSA 3IH8A 2WAEA 4GOGA 4RX3A 5EVLA 4Y0OA 4P6BA 3RXXA 4JPMA 3VP3A 2Y2LA 5AQBA 1XA7A 3VP1A 2XFSA 3M6HA 4DXCA 4U3TA 5E2FA 4JF4A 3GSGA 4X55A 1HZOA 3RJUA 4QY6A 4OP8A 1BT5A 4ZBEA 3CJMA 4FH2A 1QMEA 3UDFA 4PM8A 1K55C 4P87A 3PAGA 1U60A 3W4QA 3V39A 3PBRA 4O7DA 4R3JA 2WGVA 4R23A 2WGWA 4RVAA 3PAEA 1K57A 4GB7A 4E3OA 3GTCA 1BUEA 4MBHA 2WADA 4E3IA 4ZDXA 4EBLA 1JTGA 4BJPA 1WYBA 4XXRA 1W8QA 1MWUA 2Y2HA 2XEPA 4IBXA 1TDLA 3S4XA 4CJNA 3BFGA
chains in the Genus database with same CATH superfamily
3L9KA 3LI8A 4LRXC 3GMWA 1K55A 1XP4A 1KVMA 4FH4A 3FYZA 3NC8A 1SKOA 3HUMA 1SDNA 2I72A 2R9WA 5FDSA 2O9BA 3MXQA 3LIDA 5HX9A 5IS1A 4BENA 3NOTC 1PW8A 1TS0A 5G4YA 4WZ4A 1AWIA 1N9OA 2QPNA 4PKYG 2JKRM 3PR6A 2M7UA 3ZG7B 1E3UA 3VOLA 2VLGA 4E04A 1S66L 3VP0A 4X69A 4YOFA 2OWJA 5HAQA 2EWWA 2OWHA 4RA7A 4PAUA 3EQUA 5FSRA 3SOIA 4WN5A 2L4RA 3OLOA 2D01A 2KLIA 2P04A 3G34A 1OTBA 3UNWA 3O5YA 3MKEA 2XA7S 4ETZA 3PTEA 1C3BA 5DTTA 3UO9A 5AVFA 3ITBA 5GLDA 1V9YA 4Q0IA 2KX6A 1DP8A 1LL8A 2ZQ9A 3NJAA 5A91A 2V0WA 1TS6A 2H0TA 3NDGA 4DE1A 3JVUA 4HQAA 3SS3A 3A3DA 2V20A 4OH0A 4MEZA 3HLWA 1Q2PA 1I2SA 4HJ4A 3MS6A 3EWKA 3DTEA 4Y17A 3OPLA 4HJ3A 5DJUA 3CWFA 2WGWB 2R9XA 2XRNA 3IQAA 1OT9A 1LSVA 2W0NA 3PYPA 3T1SA 3OBFA 2A24B 3EEAA 4Z9QA 1KGGA 3Q82A 5EVID 1ACFA 1YKDA 2EXAA 1BYWA 1H3QA 3FWLA 5FASA 4R6LA 2HDRA 3KX0X 5DKLA 2V0UA 4QD4A 1PZOA 1TEMA 2PDRA 1L2SA 5I5LA 3IXDA 3IS2B 4R4SA 4HEFA 3BECA 4BWIA 3RFBA 4ZJ3A 1PZPA 3BW6A 3VFFA 3LEZA 3S7PA 4Y0UA 4WMCD 4DDYA 4JGPA 3GDIA 1CJFA 1VQQA 3MMHA 1OJ5A 3BFFA 2QJ7A 2D02A 4L9FA 1XJ2A 1ZHHB 4IUHA 4ME4A 2HP9A 4DF6A 5HL6A 4KQQA 1O7EA 1IYOA 5FAOA 5DKKA 4Y0TA 3IX4A 1Q2QA 3W4OA 1AXBA 5FQQA 3FZCA 5FQJA 3W4PA 4PMAA 2XD1A 1XJ3A 4OLGA 3S7QA 3Q7ZA 2CMNA 4QU3A 4UQIS 4LGWA 3NULA 4CPKA 5EFWA 5TR7A 4KQRA 1IYQA 1HVBA 3E4QA 5DFYA 3ZG8B 5KSCA 5M19A 3G31A 4LRYC 3UPNA 4ZJ2A 2O99A 3ULFA 5AQ9A 4R1GA 3T1XA 2VGLS 3MQOA 1GHIA 3B33A 4JXVA 2OLUA 1YSPA 4E3KA 4C6YA 3ZG0A 3UDXA 1CK3A 4DDSA 2L1MA 3HCYA 5F68A 4GNUA 2Y4AA 4DJ3A 2Q9NA 1VM1A 4DN0A 3WWXA 3W2ZA 5F6AA 5FA7A 2PT7A 4GDNA 1KDWA 2WZZA 3ICYA 3K3DA 2Y59A 4GHIB 4CLCE 3G4PA 1ERQA 5CRFA 4FOFA 4Q0JA 4R4RA 1OTAA 1J9MA 3IXGA 2OAP1 1GHPA 4EERA 1VB6A 1DJCA 4KZ9A 1ZKJA 1KE0A 2JKTI 3VSLA 1UGUA 1ONGA 4F3LA 4ZAMA 1PFLA 4R3BA 3H82B 5AQ7A 5J7EA 2MJ6A 2DMWA 1OTDA 1ZC2A 3A3JA 4B4XA 1BLSA 2YKHA 1T1AA 4I5SA 3TSGA 1FOFA 4QWOA 3FPWA 4CLCD 1MC0A 2ZM8A 2IA2A 3FKWA 2JKTM 1NLYA 1O07A 2Y2GA 4WF0A 5DF8A 3CITA 4S2IA 3MZEA 3LUQA 3SH8A 2L0WA 3MFDA 3IF6B 3DWKA 3Q7VB 5F1FA 2VA0A 3BLSA 1HTZA 1DY6A 4Y3IA 2V9AA 1FSWA 1K25A 4HI4A 3UE0A 2K2NA 4LV2A 4Z1WA 5CTNA 1OJGA 5CGSA 4JXWA 5EOEA 3N8RA 2QHKA 1P0ZA 4MN6A 3BFDA 1YM1A 3JYIA 1S67L 3G35A 1NZUA 4LCMA 3MKFA 2ZMAA 3NOUC 4ZTKA 1Y4OA 3T12B 4H6JB 5FI7A 4WMCA 3IHBA 1MBLA 2V8CA 3CUEA 3HVFA 4H6JA 4GOGA 4Y0OA 4P6BA 4JPMA 1GSWA 1N9LA 2Y79A 2Y2LA 4DXCA 4HHDA 4HH2A 3T4LA 2W1RA 4QY6A 2JKGA 1QMEA 3PAGA 3W4QA 4R23A 4RVAA 4GB7A 2PR6A 4E3IA 4BJPA 4XXRA 1W8QA 2Y2HA 1TDLA 4CJNA 2WKRA 2G2UA 1F5MA 2A2LA 2V1ZA 2B02A 1PNEA 4EWFA 4RYEA 2HJ9C 2EX9A 2HZ5A 3BRMA 4MBFA 3UDIA 3FPVA 3LR3A 5I94A 2XGNA 1ONHA 3GVBA 3UB9A 2KOIA 2EFXA 2ZQAA 4JXGA 2V1BA 5CXWA 4JBFA 2JN7A 2GNXA 2Y55A 5EVIC 4R38A 3HJIA 3NCKA 3AGDA 4S2JA 4OQIA 5F82A 1KGFA 2WKHA 4S2OA 4EUVA 3G2ZA 1XPBA 1FIKA 3G30A 1ALQA 2Y2JA 1MY8A 3NOPC 2IWCA 2QKPA 3EQVA 3IWIA 2Z2LB 2Y2PA 3LR5A 4GN2A 3BEBA 3ZVWA 1TS8A 1XGJA 3JPUA 4I3AA 1PIOA 4XUZA 2HGVA 3CG5A 1YPRA 2ZQ7A 3D9YA 1L3LA 3F1OA 1LSXA 5CHUA 1XGIA 3CZDA 2Q9MA 5C5KA 1NYYA 4I3JA 3BY9A 3FC7A 3DWZA 3O86A 3C4PA 2Y91A 3HLFA 3KSFA 5CTMA 1RP5A 1CF0A 3T4OA 1IYPA 1ES4A 5L09A 5FEFA 3KYEA 3DTKA 5KMWA 3WS4A 4M3KA 3CPTB 3P7NA 4UHUA 4B88A 1YMSA 1H8YA 1ERMA 5EPHA 3DTMA 5FL3A 3LICA 3CPTA 3GR2A 1MKMA 3MF0A 3TW8A 3BFCA 4JGRA 4LENA 2VV6A 3OCLA 2Y2QA 3K2NA 1GA0A 3IXHA 3N8LA 5DF9A 4DXBA 4OPZA 1SKOB 1ES3A 4PM5A 2C6WB 5HDCA 3JVVA 4KG2A 3V50A 3LY4A 3GECA 4DE2A 4LV3A 5A93A 2LB5A 5GLBA 1PWGA 2JC7A 3HUOA 3IWOA 4PPRA 3EGXC 2VX8A 5IT5A 4FSFA 3KSHA 2XLNA 4JF5A 1TDGA 3A3FA 3WRZA 2DCFA 5FDHA 4G3WA 4X1LA 1EWZA 4BBUA 1E4DA 3ZYTA 4EEPA 2PU2A 4JXSA 3NIAA 5HARA 4WEKA 3ZCZA 2Y2MA 4X25A 2C5WB 4OQHA 4EQ1A 4OQGA 3V5MA 2PRFA 3ZG9B 5F83A 3GV9A 5CGWA 1KDSA 4BBVA 3LY3A 2GJ3A 1SDEA 3PBSA 4BD0A 4JGOA 1YLWA 5F69A 1JWZA 2HDSA 1XXMA 1BZAA 2W3DA 3UE1A 5CGXA 4S2LA 4LV0A 2K31A 1BLCA 4WM9A 3Q81A 4UEYA 4YWZA 3T4TA 1CI8A 4EV4A 3SW1A 4GLQA 3P09A 5HAIA 2W3EA 4MN7A 3QP5A 1BLPA 2J80A 4Y15A 3HLDA 1PWCA 1UWNX 5FI6A 3HREA 2P08A 4GW9A 4GD6A 3SH9A 3R7WB 3Q1FA 2ACGA 3NDEA 3TG9A 5HSQA 4CLCC 3V3SA 2Q0OA 3R7WA 2YKFA 4BL3A 2VZWA 2EXBA 4F94A 1LLBA 4NETA 1SHVA 3M2JA 2RL3A 2H28A 5IHVA 5HD3A 2FH5A 1GSXA 1KE3A 1YLYA 3MQQA 4IHQA 4KZBA 4R3AA 2WK0A 2EFUA 4WUJA 5DTSA 5AVEA 3H9WA 1E25A 1FCNA 4IBRA 1OPXA 2OOLA 4LPZA 2O0YA 1GCEA 4EUZA 3LO7A 3ZQ5A 1W8YA 1W63M 4GZBA 4X53A 1OTIA 4L9EA 5LBRA 4H8RA 5EVEA 4HP9A 5EOOA 2Y2NA 3IWQA 3LR0A 2J3TD 4KQDA 3CAXA 3HLBA 3FKVA 1KOUA 3WS1A 4NXEA 3U2AA 3C4OA 2XQZA 1NRJA 1WA9A 4BLMA 3NBLA 5J8XA 2P9VB 1JVJA 4UA7A 4X1MA 1VETB 3MBZA 2PR5A 1NXYA 1NYMA 2P9VA 2X01A 3UE3A 3SZTA 3CI6A 5IU1A 1VETA 2WYXA 1G28A 4K08A 1M40A 2P74A 1P9WA 2PBDP 1ES2A 4S2PA 1ES5A 3T4SA 4KZAA 1PWDA 3UY6A 3ZNTA 1DJBA 5FQMA 5HPIA 4KZ8A 3QP8A 3S22A 1ESUA 1RGZA 4EBPA 1TF1A 2VEAA 3M2KA 1TS7A 3PBNA 3PBOA 4IVKA 3D4FA 1L0FA 1OMEA 1BULA 4E3LA 3M6BA 1EROA 5E43A 2PHYA 4HH3A 5L07A 1K54C 2LB9A 3VMAA 2DRWA 1ESIA 4P6ZS 1OTEA 4EQIA 4OQ0A 4ZJ1A 1L0GA 4ESPA 1XX2A 3S7OA 2B5RA 2B95A 3Q07A 4B9OA 4RQ9A 3QP2A 1F2KA 2IWBA 1IKIA 2ZOIA 5EV0A 2UWXA 5DJTA 3VE3A 1VEUA 5EVLA 2OAQ1 3VP3A 1XA7A 3F1PA 1A0KA 4U3TA 4DJ2A 5HWVA 2Z6CA 3GSGA 4X55A 3RJUA 5A8BA 4OP8A 4PM8A 3IX8A 5F5YA 2WGVA 1K57A 4PHTA 3BJNA 3GTCA 4F3LB 1JTGA 1WYBA 1MWUA 2XEPA 2O9AA 3EGDC 3S4XA 5K5BA 4E3NA 3F1NB 2WGIA 4Q8IA 1J3WA 2WKQA 2V1AA 4PM6A 1VHMA 1P9RA 2EX6A 3F1NA 4GDBA 2PAVP 3H7WB 1LSWA 4KG5A 2HPBA 1K38A 4AFIA 5CEBA 3UB7A 1XKZA 4S2NC 3UMDA 4CQHA 3H7WA 4LCLA 2PYPA 2Y2KA 5A92A 3LCEA 4KG6A 3MXRA 4HBTA 2PYRA 5HDDA 3OPPA 5FEGA 5JYOA 5F1GA 2H10A 3A3IA 1PI5A 1ODVA 4PM9A 5EVIA 4G3VA 2J3WA 4IJGA 2Y8HA 5FI2A 1LL9A 4OONA 1D7EA 1TVFA 2HDUA 4ARZA 1G5UA 3VP4A 5HL1A 3MZDA 2ZQ8A 5M18A 3KSGA 4HBUA 3O87A 4QPRA 1IOUA 1KVLA 3MXSA 5CERA 3SS5A 1JNUA 4HY8A 1FR1A 2W27A 4BD1A 2X71A 4E3MA 1K4FA 4OPYA 5J3WA 1DJAA 3A3EA 3LIBA 3PBQA 2XA7M 3ZHHA 5U47A 1K57C 2AVXA 3FV7A 2HF6A 5A90A 1E3UD 3T50A 1JWVA 2ZM0A 4EW7A 3NY4A 1BTLA 3BFEA 4S2MA 4UA6A 1MWTA 3MSHA 4MNRA 5G18A 1XFNA 3D72A 3U4LP 1FQGA 4OLDA 3EEHA 4HP4A 4N92A 2Y2OA 4EEUA 2X02A 3VOYA 3C30A 4EESA 1BLHA 5TGFA 3OPRA 4JKTA 1MWSA 2WKEA 4UAAA 2QYBA 3B47A 1EI5A 3VV4A 1DP9A 4NKPA 3MQ0A 4XUXA 4E6XA 5FQIA 4E3JA 5KIZA 4NG2A 2DNSA 1Z6FA 1ZTUA 5HW3A 2VJWA 3VE4A 2OLVA 3OOVA 1S4SA 1CEGA 4NEED 4IVIA 1S0WA 3RTYA 2ZC4B 5FQ9A 5HAPA 3OC2A 2ZC3B 1LL5A 3RXWA 2OV5A 3IF5A 4BBTA 4BL2A 3OZHA 3O3VA 3TE8A 4P85A 3ZVTA 1LHYA 4KZ5A 1T1BA 3P98A 4WBGA 3LIAA 1UWPX 4O01A 5TBMA 5JYPA 3C8CA 3IF6C 3PXPA 2Z6DA 1NY0A 3D3OA 3C7VA 3F1OB 2XF3A 4HNBA 1K0KA 1ZG6A 2J3TC 2FFYA 2JKFA 3NECA 3HL9A 2W1TA 1FCOA 1YLPA 1YLZA 2BTFP 1F9IA 3N7WA 1W63Q 1YLJA 4WZ5C 4OP5A 3IXBA 3C7UA 3I7JA 3S7NA 4FTXA 2J9OA 3QP4A 4D2OA 4WYYA 3HLEA 3WS2A 3TOIA 3VFHA 1K56D 1XFQA 4HESA 1N9BA 3B42A 1LI0A 4KZ7A 2R78A 1EW0A 3MR0A 1RCJA 2VK3A 3IHAA 4R0QA 4YFMA 1SKFA 1LI9A 1STZA 4KUOA 4CLCA 2ZL1B 5BOHA 2XD5A 1ZG4A 2J9PA 3BYDA 3ITAA 4LLOB 2P7JA 2VGLM 2ZL1A 1WYCA 2JBFA 1S6RA 1SCWA 3HBRA 3C2WA 4KQOA 5GHYA 2VV8A 1S1YA 4B93A 2BLSA 3ISGA 2ZC7A 3L7HA 1MZUA 5DTKA 4QHCA 2WUQA 5KZHA 3DBAA 4DRTA 2ZMFA 3LR4A 3BWLA 1X0OA 4JLFA 4HJ6A 2Z2MB 4NXBA 2FZ0A 1KE4A 2JCHA 5EM0A 4GKUA 1H8ZA 1W5DA 3QNBA 5EE8A 1LT0A 2H0YA 4FCFA 3WRTA 1GHMA 3BY8A 4QJGA 3R4KA 4NXFA 1YLTA 4E6WA 4RX2A 2HDQA 3TRCA 4KZ6A 4X68A 4GCZA 3UB6A 2ZLYA 1CI9A 2M1CA 1HD8A 2A49A 1DP6A 4N1HA 2V8FA 4KZ3A 3A0RA 4LRZE 2WKIA 1WE4A 4L9GA 3SS4A 4OOLA 3UB5P 4D60A 1NJ4A 1QMFA 3UPPA 3LIEA 5TFQA 3T4QA 2PU4A 2XDMA 5CEDA 1IEMA 1W79A 2ZOHA 4N9KA 3WS5A 4WL9A 5FAPA 3A0VA 3T4JA 3CLOA 4OPQA 2XK1A 4FUWA 4PKYA 2EX8A 4Y13A 1IELA 3A0SA 1YMXA 3LFVA 4OOMA 1M6KA 1K54A 5FQKA 1YQSA 3IH8A 2WAEA 4RX3A 4I38A 2VV7A 3RXXA 5AQBA 5E2FA 4JF4A 4YNRA 1HZOA 1BT5A 3KSIA 3CJMA 1T18A 4FH2A 3T1QB 1K55C 2WKPA 3V39A 3LI9A 4O7DA 4R3JA 2WGWA 4E3OA 1BUEA 2WADA 1G6OA 3KO6A 3BFGA 2A24A 4EBNA 3BQAA 1NLZA 3IX3A 1XJ6A 4MBKA 1I5QA 2E8JA 4N9LA 3LGOA 5DVAA 2Y2IA 3CHWP 3ZNYA 3E2LA 1H0MA 2ZQDA 1K6RA 3IS2A 2INWA 4I3IA 1D06A 1CQAA 2E8IA 1RGYA 1IFQA 1OT6A 1G6AA 5D3OA 5DF7A 5CHJA 2OSUA 3N6IA 5L2FA 2KDKA 2I9VA 1K56A 5HWWA 4EU0A 2IWDA 5L10A 2EX2A 1HLUP 1JWPA 3HLGA 4DMZA 5E2GA 3K3CA 4JGQA 4S2NA 4C75A 2XSSA 5HZHA 4A5RA 1IYSA 3UMEA 1Y54A 5DFXA 3HLCA 3IH9A 5L8MA 4QY5A 3BLMA 5CECA 1W7FA 3HUNA 3WS0A 4OVDA 3B3XA 3NHQA 2ZC5B 4OOYA 3GRJA 4XT2B 1JTDA 1IKGA 4P0MA 2ZJ9A 5EUAA 4JF6A 3S1YA 5EECA 2H5SA 2O9CA 2VKSA 1VEUB 3W8KA 1H8MA 4KENB 4XT2A 4UA9A 5FATA 3F1PB 4ETXA 2WAFA 2XFTA 2GDNA 4KUKA 5GHZA 4X56A 4K91A 5HWTA 3SH7A 2XR0A 4MN5A 4R70A 1K6SA 4WEJA 3FG8A 2HV1A 2HJEA 4Y5FA 3ZGAB 1PI4A 5CX7A 1MXOA 3G2YA 3AGFA 2J7VA 3E0YA 3E2KA 4GJ4A 3T1RA 1XA1A 3IBJA 4GHIA 4FD8A 3VP2A 1FILA 2ZM2A 2BASA 2PBYA 1PRQA 3QP1A 1YT4A 3OPHA 2WZXA 2B18A 2W3HA 2PD8A 1L0DA 1YSQA 3OCNA 3N8SA 3H82A 5HDSA 4OKPA 2JE5A 2VGKA 2RCXA 4LV1A 1GSVA 3O88A 5EVIB 4HOIA 4IUKA 5HFOA 4LFUA 1L0EA 4Y7PA 4ARZB 4MCWA 2G2WA 4NK3A 5E2HA 1TD5A 2XROA 1XJ4A 5AQAA 2W3FA 2ZQCA 4II7A 4O8GA 3UN7A 3G32A 4U0XA 4I39A 5TJJA 3RH8B 2EWVA 3LEQA 3VSKA 3MJQA 1F98A 2PD7A 1T1CA 5G4ZA 2CC1A 4DE3A 1MPLA 3P01A 3TJZC 3QP6A 1MKIA 4B4ZA 3C5AA 4ZRRA 2NUTC 1T19A 4Y2FA 3IF6A 3Q7VA 4OPRA 1N4OA 2G7UA 3BQ8A 4YINA 3CMZA 1MWRA 4DE0A 1FSYA 2BG1A 1V9ZA 3UPOA 1S1ZA 1PYYA 4WZ5A 1NWZA 4BMWA 5M1AA 2A3UA 3LYXA 1BSGA 5HD5A 3GQZA 1DRMA 3ZDJA 3LIFA 1I2WA 5AJGA 2M7VA 1CEFA 4WELA 4WLAA 3DW0A 1Z09A 3V3RA 3E4PA 3KYZA 3T4KA 1GA9A 4BQMA 5GLCA 3ZG5A 3MFXA 4G3KA 3EOIA 1KGEA 5E2EA 2QMIA 3QNCA 3N4IA 3UE6A 1P97A 3AGEA 1FCMA 4L0LA 1NRFA 1SZVA 5CHMA 2XH9A 1NZOA 4ID4A 4EXOA 2JHEA 4MLLA 3UB8A 1FR6A 4O0PA 1YAXA 4X6TA 1H5XA 5GL9A 4N1XA 2HP6A 5J4EA 2FFFB 4M4XA 1Y28A 3PBTA 3C38A 1G68A 5TBMB 4KZ4A 3PHYA 2V2FF 2ZMVA 4Q0HA 3HJKA 5GLAA 5KSHA 2ZC6B 4GD8A 3VOZA 2QZ6A 3DAVA 4S2KA 1D1JA 5FAQA 2W1TB 4K0XA 4IEDA 5EM1A 2HP5A 3BM6A 2K7SA 4K0WA 1K4EA 2J8YA 1S4RA 3NI9A 2EA9A 4GS9B 2W3GA 3V67A 3ZFZA 2ZD8A 2VGJA 2GX5A 1N9NA 3KYQA 5MC7A 4QB8A 4GS9A 4UQIM 4PM7A 3CUEC 4HIAA 5GHXA 4CLCB 3IT9A 4C3QA 3E4OA 4EETB 4MDZA 4U0TA 4NXGA 2QWSA 3MZFA 1PW1A 3QHYA 4DKIA 5HPFA 3G6OA 3VP1A 2XFSA 3M6HA 3IBRA 2ZBBA 3DTIA 4ZBEA 4MMNA 3UDFA 4P87A 2NUPC 1U60A 4P6ZM 3E98A 3PBRA 3PAEA 2QJ5A 4MBHA 4ZDXA 2JKRI 4EBLA 2UV0E 4IBXA 2GZAA
chains in the Genus database with same CATH topology
4EBNA 2G2UA 3GMWA 4MBKA 4E3NA 1K55A 1XP4A 2V1ZA 1I5QA 4N9LA 4EWFA 2WGIA 4Q8IA 4RYEA 5DVAA 1KVMA 4FH4A 3FYZA 3NC8A 3HUMA 1SDNA 2Y2IA 4PM6A 2EX9A 2I72A 2R9WA 3BRMA 4MBFA 3ZNYA 3UDIA 2EX6A 4GDBA 3E2LA 5HX9A 4BENA 2ZQDA 4KG5A 2HPBA 1PW8A 1K38A 1K6RA 5CEBA 5I94A 1XKZA 2E8IA 2XGNA 1RGYA 4WZ4A 4S2NC 1ONHA 3GVBA 2EFXA 2ZQAA 4JXGA 2QPNA 1G6AA 5D3OA 5DF7A 5CXWA 5CHJA 4LCLA 4JBFA 2OSUA 3N6IA 2Y2KA 5L2FA 5A92A 2Y55A 3LCEA 4KG6A 5EVIC 3MXRA 4HBTA 1K56A 1E3UA 3ZG7B 3NCKA 3VP0A 3AGDA 4S2JA 2IWDA 4X69A 3OPPA 4OQIA 5F82A 1KGFA 2EX2A 1JWPA 5JYOA 3HLGA 5HAQA 2WKHA 5F1GA 2H10A 5E2GA 3A3IA 4S2NA 4RA7A 3EQUA 5FSRA 4S2OA 1PI5A 3SOIA 4C75A 3G2ZA 4PM9A 4A5RA 1XPBA 5EVIA 1IYSA 3G34A 1ALQA 3G30A 1Y54A 5FI2A 2Y2JA 1LL9A 1MY8A 1TVFA 4OONA 2IWCA 3MKEA 3UNWA 3EQVA 2HDUA 3IWIA 3HLCA 3IH9A 2Z2LB 2Y2PA 3PTEA 4GN2A 3BEBA 3ZVWA 1C3BA 5DTTA 4QY5A 1XGJA 3UO9A 3BLMA 3MZDA 2ZQ8A 3VP4A 5HL1A 5CECA 3ITBA 5GLDA 1W7FA 1PIOA 5M18A 4HBUA 4XUZA 3O87A 3CG5A 3HUNA 3WS0A 2ZQ9A 5A91A 4OVDA 1KVLA 3B3XA 3MXSA 2ZC5B 2ZQ7A 4OOYA 5CERA 5CHUA 2H0TA 1XGIA 3CZDA 2Q9MA 3GRJA 3NDGA 3SS5A 1NYYA 1JTDA 4DE1A 1IKGA 4P0MA 3DWZA 3SS3A 2ZJ9A 5EUAA 4JF6A 3A3DA 3S1YA 1FR1A 5EECA 3O86A 3C4PA 2H5SA 2Y91A 2V20A 3HLFA 2X71A 5CTMA 1RP5A 4BD1A 4E3MA 3W8KA 1K4FA 4OPYA 4OH0A 4KENB 1DJAA 4MEZA 3A3EA 4UA9A 5FATA 3HLWA 1IYPA 3PBQA 1ES4A 5U47A 3ZHHA 1Q2PA 1K57C 2XFTA 2WAFA 1I2SA 3FV7A 5KMWA 2GDNA 5A90A 5GHZA 4X56A 1E3UD 3WS4A 4M3KA 4K91A 4B88A 4UHUA 3SH7A 2XR0A 1YMSA 1K6SA 3OPLA 1JWVA 2ZM0A 1H8YA 2WGWB 2R9XA 4WEJA 1ERMA 1BTLA 3BFEA 3NY4A 4S2MA 3IQAA 4UA6A 5EPHA 1MWTA 3DTMA 4MNRA 5G18A 3GR2A 4Z9QA 1KGGA 3ZGAB 1PI4A 1FQGA 1MXOA 3G2YA 3Q82A 4OLDA 5EVID 2EXAA 4N92A 3FWLA 2Y2OA 3AGFA 5FASA 3BFCA 2J7VA 2X02A 4LENA 3VOYA 3OCLA 2Y2QA 3E2KA 1BLHA 1GA0A 2HDRA 3IXHA 3N8LA 5DF9A 5TGFA 4DXBA 4OPZA 4QD4A 1ES3A 4PM5A 1PZOA 3OPRA 4JKTA 1MWSA 1TEMA 1L2SA 2WKEA 1XA1A 2C6WB 4UAAA 4KG2A 3IXDA 3V50A 3LY4A 4DE2A 1EI5A 4FD8A 4R4SA 4HEFA 4LV3A 3VP2A 5A93A 3BECA 1PWGA 2JC7A 3HUOA 2ZM2A 3IWOA 5GLBA 4XUXA 4PPRA 4ZJ3A 4E6XA 4FSFA 5FQIA 4E3JA 2XLNA 2DNSA 1Z6FA 2PBYA 1PZPA 4JF5A 1TDGA 3VFFA 1YT4A 3A3FA 3LEZA 3WRZA 5HW3A 2DCFA 2OLVA 5FDHA 3OPHA 4Y0UA 2WZXA 4WMCD 1EWZA 1CEGA 4DDYA 4IVIA 1E4DA 1S0WA 2PU2A 1VQQA 1L0DA 2ZC4B 3NIAA 4JXSA 5FQ9A 3OC2A 5HARA 2ZC3B 4WEKA 3OCNA 5HAPA 1LL5A 3RXWA 3BFFA 3N8SA 3ZCZA 2OV5A 2Y2MA 2C5WB 4OQHA 3IF5A 4OKPA 2JE5A 2VGKA 4OQGA 3V5MA 2RCXA 2HP9A 4DF6A 4BL2A 3OZHA 3O3VA 4LV1A 3O88A 5EVIB 4KQQA 3ZG9B 5F83A 3GV9A 5HFOA 5CGWA 1O7EA 1KDSA 1IYOA 5FAOA 4Y0TA 1L0EA 3LY3A 4Y7PA 4P85A 1Q2QA 1SDEA 3ZVTA 3PBSA 1LHYA 3W4OA 1AXBA 2G2WA 3FZCA 4NK3A 4KZ5A 5E2HA 5FQQA 5FQJA 4BD0A 3W4PA 4PMAA 1YLWA 2XD1A 4OLGA 3P98A 3Q7ZA 5AQAA 2ZQCA 4QU3A 4WBGA 1JWZA 2HDSA 3UN7A 1XXMA 5JYPA 3G32A 1BZAA 4CPKA 4U0XA 3IF6C 3UE1A 5CGXA 3VSKA 4S2LA 4LV0A 1NY0A 3C7VA 1BLCA 4WM9A 3Q81A 2XF3A 5TR7A 4KQRA 1CI8A 4EV4A 1ZG6A 1IYQA 1HVBA 3P09A 2FFYA 5HAIA 2CC1A 4DE3A 1MPLA 1BLPA 3HL9A 3ZG8B 3HLDA 5KSCA 1FCOA 1PWCA 5FI6A 1YLPA 3HREA 1YLZA 5M19A 1MKIA 4B4ZA 3C5AA 3G31A 3N7WA 3UPNA 3IF6A 1YLJA 3Q7VA 4ZJ2A 4OPRA 4WZ5C 4OP5A 3IXBA 3C7UA 1N4OA 4GD6A 3I7JA 5AQ9A 3SH9A 4R1GA 4YINA 2J9OA 3CMZA 1MWRA 1GHIA 3Q1FA 4D2OA 4JXVA 3NDEA 4WYYA 2OLUA 3TG9A 3HLEA 3WS2A 4DE0A 4E3KA 1FSYA 3V3SA 4C6YA 3ZG0A 3TOIA 3VFHA 2BG1A 1K56D 3UDXA 4BL3A 1CK3A 2EXBA 4HESA 1N9BA 1LI0A 4DDSA 3UPOA 4F94A 1PYYA 4GNUA 4KZ7A 2Y4AA 1LLBA 4WZ5A 4NETA 1RCJA 1SHVA 2Q9NA 3M2JA 1VM1A 3WWXA 2RL3A 3IHAA 4R0QA 2A3UA 5M1AA 5FA7A 5IHVA 4YFMA 1SKFA 1LI9A 4GDNA 1KDWA 1YLYA 1BSGA 1KE3A 2XD5A 4KZBA 5BOHA 2WZZA 3GQZA 3ZDJA 1I2WA 1ZG4A 2Y59A 2J9PA 3BYDA 1CEFA 4WELA 2WK0A 3DW0A 2EFUA 3ITAA 5DTSA 3V3RA 1E25A 3G4PA 1WYCA 1FCNA 2JBFA 4IBRA 1S6RA 1ERQA 1GA9A 5CRFA 1SCWA 4BQMA 5GLCA 3ZG5A 3HBRA 1GCEA 4R4RA 4EUZA 1KGEA 5E2EA 2QMIA 1J9MA 3QNCA 3LO7A 3IXGA 3N4IA 4KQOA 1W8YA 4GZBA 1GHPA 5GHYA 1DJCA 3AGEA 1FCMA 4KZ9A 1ZKJA 4X53A 1KE0A 4L0LA 2BLSA 3ISGA 1NRFA 2ZC7A 5CHMA 4H8RA 3VSLA 2XH9A 5DTKA 1ONGA 5EOOA 4ZAMA 4R3BA 4QHCA 1NZOA 2Y2NA 4ID4A 3IWQA 5AQ7A 2WUQA 5KZHA 4DRTA 1ZC2A 3HLBA 4MLLA 3A3JA 3FKVA 3WS1A 4B4XA 1FR6A 1BLSA 4JLFA 3C4OA 2Z2MB 2XQZA 4X6TA 1H5XA 1KE4A 5GL9A 2JCHA 2HP6A 4N1XA 2FFFB 4BLMA 3NBLA 5J8XA 2P9VB 4GKUA 1H8ZA 1JVJA 1W5DA 3QNBA 5EE8A 3TSGA 3PBTA 4UA7A 1FOFA 3MBZA 2H0YA 1G68A 4FCFA 4KZ4A 1NXYA 3WRTA 1NYMA 2V2FF 2P9VA 2ZM8A 2X01A 3UE3A 1GHMA 3FKWA 4QJGA 5GLAA 5KSHA 2WYXA 1O07A 2ZC6B 1YLTA 4GD8A 4E6WA 2Y2GA 3VOZA 4RX2A 2HDQA 5DF8A 2QZ6A 4KZ6A 4X68A 1M40A 2P74A 2ZLYA 3MZEA 4S2KA 4S2IA 1ES2A 1CI9A 1ES5A 4S2PA 5FAQA 4KZAA 1HD8A 2A49A 4IEDA 1PWDA 4K0XA 4N1HA 3UY6A 3SH8A 3ZNTA 1DJBA 5FQMA 4KZ8A 2HP5A 3BM6A 4KZ3A 3MFDA 3IF6B 3DWKA 3Q7VB 5F1FA 4K0WA 3S22A 1K4EA 2WKIA 3BLSA 2J8YA 1ESUA 1WE4A 1HTZA 1DY6A 3SS4A 3NI9A 1RGZA 4EBPA 4OOLA 1FSWA 1NJ4A 1QMFA 3M2KA 1K25A 3UE0A 3UPPA 4LV2A 5TFQA 3PBNA 3PBOA 4IVKA 3D4FA 5CTNA 3ZFZA 2PU4A 2ZD8A 2VGJA 1L0FA 2XDMA 1OMEA 1BULA 4QB8A 4E3LA 5CGSA 5CEDA 1IEMA 3M6BA 1W79A 4JXWA 5EOEA 3N8RA 4PM7A 1EROA 5E43A 1K54C 3BFDA 1YM1A 3JYIA 3VMAA 2DRWA 1ESIA 3G35A 1NZUA 4LCMA 4N9KA 3WS5A 4EQIA 5GHXA 4OQ0A 4ZJ1A 1L0GA 5FAPA 3MKFA 1XX2A 2ZMAA 3IT9A 2B5RA 4C3QA 3Q07A 4ZTKA 4OPQA 2XK1A 5FI7A 2IWBA 2EX8A 1IKIA 4WMCA 1IELA 3IHBA 1YMXA 1MBLA 4U0TA 2UWXA 1PW1A 3MZFA 4OOMA 3QHYA 1M6KA 1K54A 5FQKA 4DKIA 3HVFA 1YQSA 3IH8A 2WAEA 4GOGA 4RX3A 5EVLA 4Y0OA 4P6BA 3RXXA 4JPMA 3VP3A 2Y2LA 5AQBA 1XA7A 3VP1A 2XFSA 3M6HA 4DXCA 4U3TA 5E2FA 4JF4A 3GSGA 4X55A 1HZOA 3RJUA 4QY6A 4OP8A 1BT5A 4ZBEA 3CJMA 4FH2A 1QMEA 3UDFA 4PM8A 1K55C 4P87A 3PAGA 1U60A 3W4QA 3V39A 3PBRA 4O7DA 4R3JA 2WGVA 4R23A 2WGWA 4RVAA 3PAEA 1K57A 4GB7A 4E3OA 3GTCA 1BUEA 4MBHA 2WADA 4E3IA 4ZDXA 4EBLA 1JTGA 4BJPA 1WYBA 4XXRA 1W8QA 1MWUA 2Y2HA 2XEPA 4IBXA 1TDLA 3S4XA 4CJNA 3BFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EBN A;  2G2U A;  3GMW A;  4MBK A;  4E3N A;  1K55 A;  1XP4 A;  2V1Z A;  1I5Q A;  4N9L A;  4EWF A;  2WGI A;  4Q8I A;  4RYE A;  5DVA A;  1KVM A;  4FH4 A;  3FYZ A;  3NC8 A;  3HUM A;  1SDN A;  2Y2I A;  4PM6 A;  2EX9 A;  2I72 A;  2R9W A;  3BRM A;  4MBF A;  3ZNY A;  3UDI A;  2EX6 A;  4GDB A;  3E2L A;  5HX9 A;  4BEN A;  2ZQD A;  4KG5 A;  2HPB A;  1PW8 A;  1K38 A;  1K6R A;  5CEB A;  5I94 A;  1XKZ A;  2E8I A;  2XGN A;  1RGY A;  4WZ4 A;  4S2N C;  1ONH A;  3GVB A;  2EFX A;  2ZQA A;  4JXG A;  2QPN A;  1G6A A;  5D3O A;  5DF7 A;  5CXW A;  5CHJ A;  4LCL A;  4JBF A;  2OSU A;  3N6I A;  2Y2K A;  5L2F A;  5A92 A;  2Y55 A;  3LCE A;  4KG6 A;  5EVI C;  3MXR A;  4HBT A;  1K56 A;  1E3U A;  3ZG7 B;  3NCK A;  3VP0 A;  3AGD A;  4S2J A;  2IWD A;  4X69 A;  3OPP A;  4OQI A;  5F82 A;  1KGF A;  2EX2 A;  1JWP A;  5JYO A;  3HLG A;  5HAQ A;  2WKH A;  5F1G A;  2H10 A;  5E2G A;  3A3I A;  4S2N A;  4RA7 A;  3EQU A;  5FSR A;  4S2O A;  1PI5 A;  3SOI A;  4C75 A;  3G2Z A;  4PM9 A;  4A5R A;  1XPB A;  5EVI A;  1IYS A;  3G34 A;  1ALQ A;  3G30 A;  1Y54 A;  5FI2 A;  2Y2J A;  1LL9 A;  1MY8 A;  1TVF A;  4OON A;  2IWC A;  3MKE A;  3UNW A;  3EQV A;  2HDU A;  3IWI A;  3HLC A;  3IH9 A;  2Z2L B;  2Y2P A;  3PTE A;  4GN2 A;  3BEB A;  3ZVW A;  1C3B A;  5DTT A;  4QY5 A;  1XGJ A;  3UO9 A;  3BLM A;  3MZD A;  2ZQ8 A;  3VP4 A;  5HL1 A;  5CEC A;  3ITB A;  5GLD A;  1W7F A;  1PIO A;  5M18 A;  4HBU A;  4XUZ A;  3O87 A;  3CG5 A;  3HUN A;  3WS0 A;  2ZQ9 A;  5A91 A;  4OVD A;  1KVL A;  3B3X A;  3MXS A;  2ZC5 B;  2ZQ7 A;  4OOY A;  5CER A;  5CHU A;  2H0T A;  1XGI A;  3CZD A;  2Q9M A;  3GRJ A;  3NDG A;  3SS5 A;  1NYY A;  1JTD A;  4DE1 A;  1IKG A;  4P0M A;  3DWZ A;  3SS3 A;  2ZJ9 A;  5EUA A;  4JF6 A;  3A3D A;  3S1Y A;  1FR1 A;  5EEC A;  3O86 A;  3C4P A;  2H5S A;  2Y91 A;  2V20 A;  3HLF A;  2X71 A;  5CTM A;  1RP5 A;  4BD1 A;  4E3M A;  3W8K A;  1K4F A;  4OPY A;  4OH0 A;  4KEN B;  1DJA A;  4MEZ A;  3A3E A;  4UA9 A;  5FAT A;  3HLW A;  1IYP A;  3PBQ A;  1ES4 A;  5U47 A;  3ZHH A;  1Q2P A;  1K57 C;  2XFT A;  2WAF A;  1I2S A;  3FV7 A;  5KMW A;  2GDN A;  5A90 A;  5GHZ A;  4X56 A;  1E3U D;  3WS4 A;  4M3K A;  4K91 A;  4B88 A;  4UHU A;  3SH7 A;  2XR0 A;  1YMS A;  1K6S A;  3OPL A;  1JWV A;  2ZM0 A;  1H8Y A;  2WGW B;  2R9X A;  4WEJ A;  1ERM A;  1BTL A;  3BFE A;  3NY4 A;  4S2M A;  3IQA A;  4UA6 A;  5EPH A;  1MWT A;  3DTM A;  4MNR A;  5G18 A;  3GR2 A;  4Z9Q A;  1KGG A;  3ZGA B;  1PI4 A;  1FQG A;  1MXO A;  3G2Y A;  3Q82 A;  4OLD A;  5EVI D;  2EXA A;  4N92 A;  3FWL A;  2Y2O A;  3AGF A;  5FAS A;  3BFC A;  2J7V A;  2X02 A;  4LEN A;  3VOY A;  3OCL A;  2Y2Q A;  3E2K A;  1BLH A;  1GA0 A;  2HDR A;  3IXH A;  3N8L A;  5DF9 A;  5TGF A;  4DXB A;  4OPZ A;  4QD4 A;  1ES3 A;  4PM5 A;  1PZO A;  3OPR A;  4JKT A;  1MWS A;  1TEM A;  1L2S A;  2WKE A;  1XA1 A;  2C6W B;  4UAA A;  4KG2 A;  3IXD A;  3V50 A;  3LY4 A;  4DE2 A;  1EI5 A;  4FD8 A;  4R4S A;  4HEF A;  4LV3 A;  3VP2 A;  5A93 A;  3BEC A;  1PWG A;  2JC7 A;  3HUO A;  2ZM2 A;  3IWO A;  5GLB A;  4XUX A;  4PPR A;  4ZJ3 A;  4E6X A;  4FSF A;  5FQI A;  4E3J A;  2XLN A;  2DNS A;  1Z6F A;  2PBY A;  1PZP A;  4JF5 A;  1TDG A;  3VFF A;  1YT4 A;  3A3F A;  3LEZ A;  3WRZ A;  5HW3 A;  2DCF A;  2OLV A;  5FDH A;  3OPH A;  4Y0U A;  2WZX A;  4WMC D;  1EWZ A;  1CEG A;  4DDY A;  4IVI A;  1E4D A;  1S0W A;  2PU2 A;  1VQQ A;  1L0D A;  2ZC4 B;  3NIA A;  4JXS A;  5FQ9 A;  3OC2 A;  5HAR A;  2ZC3 B;  4WEK A;  3OCN A;  5HAP A;  1LL5 A;  3RXW A;  3BFF A;  3N8S A;  3ZCZ A;  2OV5 A;  2Y2M A;  2C5W B;  4OQH A;  3IF5 A;  4OKP A;  2JE5 A;  2VGK A;  4OQG A;  3V5M A;  2RCX A;  2HP9 A;  4DF6 A;  4BL2 A;  3OZH A;  3O3V A;  4LV1 A;  3O88 A;  5EVI B;  4KQQ A;  3ZG9 B;  5F83 A;  3GV9 A;  5HFO A;  5CGW A;  1O7E A;  1KDS A;  1IYO A;  5FAO A;  4Y0T A;  1L0E A;  3LY3 A;  4Y7P A;  4P85 A;  1Q2Q A;  1SDE A;  3ZVT A;  3PBS A;  1LHY A;  3W4O A;  1AXB A;  2G2W A;  3FZC A;  4NK3 A;  4KZ5 A;  5E2H A;  5FQQ A;  5FQJ A;  4BD0 A;  3W4P A;  4PMA A;  1YLW A;  2XD1 A;  4OLG A;  3P98 A;  3Q7Z A;  5AQA A;  2ZQC A;  4QU3 A;  4WBG A;  1JWZ A;  2HDS A;  3UN7 A;  1XXM A;  5JYP A;  3G32 A;  1BZA A;  4CPK A;  4U0X A;  3IF6 C;  3UE1 A;  5CGX A;  3VSK A;  4S2L A;  4LV0 A;  1NY0 A;  3C7V A;  1BLC A;  4WM9 A;  3Q81 A;  2XF3 A;  5TR7 A;  4KQR A;  1CI8 A;  4EV4 A;  1ZG6 A;  1IYQ A;  1HVB A;  3P09 A;  2FFY A;  5HAI A;  2CC1 A;  4DE3 A;  1MPL A;  1BLP A;  3HL9 A;  3ZG8 B;  3HLD A;  5KSC A;  1FCO A;  1PWC A;  5FI6 A;  1YLP A;  3HRE A;  1YLZ A;  5M19 A;  1MKI A;  4B4Z A;  3C5A A;  3G31 A;  3N7W A;  3UPN A;  3IF6 A;  1YLJ A;  3Q7V A;  4ZJ2 A;  4OPR A;  4WZ5 C;  4OP5 A;  3IXB A;  3C7U A;  1N4O A;  4GD6 A;  3I7J A;  5AQ9 A;  3SH9 A;  4R1G A;  4YIN A;  2J9O A;  3CMZ A;  1MWR A;  1GHI A;  3Q1F A;  4D2O A;  4JXV A;  3NDE A;  4WYY A;  2OLU A;  3TG9 A;  3HLE A;  3WS2 A;  4DE0 A;  4E3K A;  1FSY A;  3V3S A;  4C6Y A;  3ZG0 A;  3TOI A;  3VFH A;  2BG1 A;  1K56 D;  3UDX A;  4BL3 A;  1CK3 A;  2EXB A;  4HES A;  1N9B A;  1LI0 A;  4DDS A;  3UPO A;  4F94 A;  1PYY A;  4GNU A;  4KZ7 A;  2Y4A A;  1LLB A;  4WZ5 A;  4NET A;  1RCJ A;  1SHV A;  2Q9N A;  3M2J A;  1VM1 A;  3WWX A;  2RL3 A;  3IHA A;  4R0Q A;  2A3U A;  5M1A A;  5FA7 A;  5IHV A;  4YFM A;  1SKF A;  1LI9 A;  4GDN A;  1KDW A;  1YLY A;  1BSG A;  1KE3 A;  2XD5 A;  4KZB A;  5BOH A;  2WZZ A;  3GQZ A;  3ZDJ A;  1I2W A;  1ZG4 A;  2Y59 A;  2J9P A;  3BYD A;  1CEF A;  4WEL A;  2WK0 A;  3DW0 A;  2EFU A;  3ITA A;  5DTS A;  3V3R A;  1E25 A;  3G4P A;  1WYC A;  1FCN A;  2JBF A;  4IBR A;  1S6R A;  1ERQ A;  1GA9 A;  5CRF A;  1SCW A;  4BQM A;  5GLC A;  3ZG5 A;  3HBR A;  1GCE A;  4R4R A;  4EUZ A;  1KGE A;  5E2E A;  2QMI A;  1J9M A;  3QNC A;  3LO7 A;  3IXG A;  3N4I A;  4KQO A;  1W8Y A;  4GZB A;  1GHP A;  5GHY A;  1DJC A;  3AGE A;  1FCM A;  4KZ9 A;  1ZKJ A;  4X53 A;  1KE0 A;  4L0L A;  2BLS A;  3ISG A;  1NRF A;  2ZC7 A;  5CHM A;  4H8R A;  3VSL A;  2XH9 A;  5DTK A;  1ONG A;  5EOO A;  4ZAM A;  4R3B A;  4QHC A;  1NZO A;  2Y2N A;  4ID4 A;  3IWQ A;  5AQ7 A;  2WUQ A;  5KZH A;  4DRT A;  1ZC2 A;  3HLB A;  4MLL A;  3A3J A;  3FKV A;  3WS1 A;  4B4X A;  1FR6 A;  1BLS A;  4JLF A;  3C4O A;  2Z2M B;  2XQZ A;  4X6T A;  1H5X A;  1KE4 A;  5GL9 A;  2JCH A;  2HP6 A;  4N1X A;  2FFF B;  4BLM A;  3NBL A;  5J8X A;  2P9V B;  4GKU A;  1H8Z A;  1JVJ A;  1W5D A;  3QNB A;  5EE8 A;  3TSG A;  3PBT A;  4UA7 A;  1FOF A;  3MBZ A;  2H0Y A;  1G68 A;  4FCF A;  4KZ4 A;  1NXY A;  3WRT A;  1NYM A;  2V2F F;  2P9V A;  2ZM8 A;  2X01 A;  3UE3 A;  1GHM A;  3FKW A;  4QJG A;  5GLA A;  5KSH A;  2WYX A;  1O07 A;  2ZC6 B;  1YLT A;  4GD8 A;  4E6W A;  2Y2G A;  3VOZ A;  4RX2 A;  2HDQ A;  5DF8 A;  2QZ6 A;  4KZ6 A;  4X68 A;  1M40 A;  2P74 A;  2ZLY A;  3MZE A;  4S2K A;  4S2I A;  1ES2 A;  1CI9 A;  1ES5 A;  4S2P A;  5FAQ A;  4KZA A;  1HD8 A;  2A49 A;  4IED A;  1PWD A;  4K0X A;  4N1H A;  3UY6 A;  3SH8 A;  3ZNT A;  1DJB A;  5FQM A;  4KZ8 A;  2HP5 A;  3BM6 A;  4KZ3 A;  3MFD A;  3IF6 B;  3DWK A;  3Q7V B;  5F1F A;  4K0W A;  3S22 A;  1K4E A;  2WKI A;  3BLS A;  2J8Y A;  1ESU A;  1WE4 A;  1HTZ A;  1DY6 A;  3SS4 A;  3NI9 A;  1RGZ A;  4EBP A;  4OOL A;  1FSW A;  1NJ4 A;  1QMF A;  3M2K A;  1K25 A;  3UE0 A;  3UPP A;  4LV2 A;  5TFQ A;  3PBN A;  3PBO A;  4IVK A;  3D4F A;  5CTN A;  3ZFZ A;  2PU4 A;  2ZD8 A;  2VGJ A;  1L0F A;  2XDM A;  1OME A;  1BUL A;  4QB8 A;  4E3L A;  5CGS A;  5CED A;  1IEM A;  3M6B A;  1W79 A;  4JXW A;  5EOE A;  3N8R A;  4PM7 A;  1ERO A;  5E43 A;  1K54 C;  3BFD A;  1YM1 A;  3JYI A;  3VMA A;  2DRW A;  1ESI A;  3G35 A;  1NZU A;  4LCM A;  4N9K A;  3WS5 A;  4EQI A;  5GHX A;  4OQ0 A;  4ZJ1 A;  1L0G A;  5FAP A;  3MKF A;  1XX2 A;  2ZMA A;  3IT9 A;  2B5R A;  4C3Q A;  3Q07 A;  4ZTK A;  4OPQ A;  2XK1 A;  5FI7 A;  2IWB A;  2EX8 A;  1IKI A;  4WMC A;  1IEL A;  3IHB A;  1YMX A;  1MBL A;  4U0T A;  2UWX A;  1PW1 A;  3MZF A;  4OOM A;  3QHY A;  1M6K A;  1K54 A;  5FQK A;  4DKI A;  3HVF A;  1YQS A;  3IH8 A;  2WAE A;  4GOG A;  4RX3 A;  5EVL A;  4Y0O A;  4P6B A;  3RXX A;  4JPM A;  3VP3 A;  2Y2L A;  5AQB A;  1XA7 A;  3VP1 A;  2XFS A;  3M6H A;  4DXC A;  4U3T A;  5E2F A;  4JF4 A;  3GSG A;  4X55 A;  1HZO A;  3RJU A;  4QY6 A;  4OP8 A;  1BT5 A;  4ZBE A;  3CJM A;  4FH2 A;  1QME A;  3UDF A;  4PM8 A;  1K55 C;  4P87 A;  3PAG A;  1U60 A;  3W4Q A;  3V39 A;  3PBR A;  4O7D A;  4R3J A;  2WGV A;  4R23 A;  2WGW A;  4RVA A;  3PAE A;  1K57 A;  4GB7 A;  4E3O A;  3GTC A;  1BUE A;  4MBH A;  2WAD A;  4E3I A;  4ZDX A;  4EBL A;  1JTG A;  4BJP A;  1WYB A;  4XXR A;  1W8Q A;  1MWU A;  2Y2H A;  2XEP A;  4IBX A;  1TDL A;  3S4X A;  4CJN A;  3BFG A; 
#chains in the Genus database with same CATH topology
 3L9K A;  3LI8 A;  4LRX C;  3GMW A;  1K55 A;  1XP4 A;  1KVM A;  4FH4 A;  3FYZ A;  3NC8 A;  1SKO A;  3HUM A;  1SDN A;  2I72 A;  2R9W A;  5FDS A;  2O9B A;  3MXQ A;  3LID A;  5HX9 A;  5IS1 A;  4BEN A;  3NOT C;  1PW8 A;  1TS0 A;  5G4Y A;  4WZ4 A;  1AWI A;  1N9O A;  2QPN A;  4PKY G;  2JKR M;  3PR6 A;  2M7U A;  3ZG7 B;  1E3U A;  3VOL A;  2VLG A;  4E04 A;  1S66 L;  3VP0 A;  4X69 A;  4YOF A;  2OWJ A;  5HAQ A;  2EWW A;  2OWH A;  4RA7 A;  4PAU A;  3EQU A;  5FSR A;  3SOI A;  4WN5 A;  2L4R A;  3OLO A;  2D01 A;  2KLI A;  2P04 A;  3G34 A;  1OTB A;  3UNW A;  3O5Y A;  3MKE A;  2XA7 S;  4ETZ A;  3PTE A;  1C3B A;  5DTT A;  3UO9 A;  5AVF A;  3ITB A;  5GLD A;  1V9Y A;  4Q0I A;  2KX6 A;  1DP8 A;  1LL8 A;  2ZQ9 A;  3NJA A;  5A91 A;  2V0W A;  1TS6 A;  2H0T A;  3NDG A;  4DE1 A;  3JVU A;  4HQA A;  3SS3 A;  3A3D A;  2V20 A;  4OH0 A;  4MEZ A;  3HLW A;  1Q2P A;  1I2S A;  4HJ4 A;  3MS6 A;  3EWK A;  3DTE A;  4Y17 A;  3OPL A;  4HJ3 A;  5DJU A;  3CWF A;  2WGW B;  2R9X A;  2XRN A;  3IQA A;  1OT9 A;  1LSV A;  2W0N A;  3PYP A;  3T1S A;  3OBF A;  2A24 B;  3EEA A;  4Z9Q A;  1KGG A;  3Q82 A;  5EVI D;  1ACF A;  1YKD A;  2EXA A;  1BYW A;  1H3Q A;  3FWL A;  5FAS A;  4R6L A;  2HDR A;  3KX0 X;  5DKL A;  2V0U A;  4QD4 A;  1PZO A;  1TEM A;  2PDR A;  1L2S A;  5I5L A;  3IXD A;  3IS2 B;  4R4S A;  4HEF A;  3BEC A;  4BWI A;  3RFB A;  4ZJ3 A;  1PZP A;  3BW6 A;  3VFF A;  3LEZ A;  3S7P A;  4Y0U A;  4WMC D;  4DDY A;  4JGP A;  3GDI A;  1CJF A;  1VQQ A;  3MMH A;  1OJ5 A;  3BFF A;  2QJ7 A;  2D02 A;  4L9F A;  1XJ2 A;  1ZHH B;  4IUH A;  4ME4 A;  2HP9 A;  4DF6 A;  5HL6 A;  4KQQ A;  1O7E A;  1IYO A;  5FAO A;  5DKK A;  4Y0T A;  3IX4 A;  1Q2Q A;  3W4O A;  1AXB A;  5FQQ A;  3FZC A;  5FQJ A;  3W4P A;  4PMA A;  2XD1 A;  1XJ3 A;  4OLG A;  3S7Q A;  3Q7Z A;  2CMN A;  4QU3 A;  4UQI S;  4LGW A;  3NUL A;  4CPK A;  5EFW A;  5TR7 A;  4KQR A;  1IYQ A;  1HVB A;  3E4Q A;  5DFY A;  3ZG8 B;  5KSC A;  5M19 A;  3G31 A;  4LRY C;  3UPN A;  4ZJ2 A;  2O99 A;  3ULF A;  5AQ9 A;  4R1G A;  3T1X A;  2VGL S;  3MQO A;  1GHI A;  3B33 A;  4JXV A;  2OLU A;  1YSP A;  4E3K A;  4C6Y A;  3ZG0 A;  3UDX A;  1CK3 A;  4DDS A;  2L1M A;  3HCY A;  5F68 A;  4GNU A;  2Y4A A;  4DJ3 A;  2Q9N A;  1VM1 A;  4DN0 A;  3WWX A;  3W2Z A;  5F6A A;  5FA7 A;  2PT7 A;  4GDN A;  1KDW A;  2WZZ A;  3ICY A;  3K3D A;  2Y59 A;  4GHI B;  4CLC E;  3G4P A;  1ERQ A;  5CRF A;  4FOF A;  4Q0J A;  4R4R A;  1OTA A;  1J9M A;  3IXG A;  2OAP 1;  1GHP A;  4EER A;  1VB6 A;  1DJC A;  4KZ9 A;  1ZKJ A;  1KE0 A;  2JKT I;  3VSL A;  1UGU A;  1ONG A;  4F3L A;  4ZAM A;  1PFL A;  4R3B A;  3H82 B;  5AQ7 A;  5J7E A;  2MJ6 A;  2DMW A;  1OTD A;  1ZC2 A;  3A3J A;  4B4X A;  1BLS A;  2YKH A;  1T1A A;  4I5S A;  3TSG A;  1FOF A;  4QWO A;  3FPW A;  4CLC D;  1MC0 A;  2ZM8 A;  2IA2 A;  3FKW A;  2JKT M;  1NLY A;  1O07 A;  2Y2G A;  4WF0 A;  5DF8 A;  3CIT A;  4S2I A;  3MZE A;  3LUQ A;  3SH8 A;  2L0W A;  3MFD A;  3IF6 B;  3DWK A;  3Q7V B;  5F1F A;  2VA0 A;  3BLS A;  1HTZ A;  1DY6 A;  4Y3I A;  2V9A A;  1FSW A;  1K25 A;  4HI4 A;  3UE0 A;  2K2N A;  4LV2 A;  4Z1W A;  5CTN A;  1OJG A;  5CGS A;  4JXW A;  5EOE A;  3N8R A;  2QHK A;  1P0Z A;  4MN6 A;  3BFD A;  1YM1 A;  3JYI A;  1S67 L;  3G35 A;  1NZU A;  4LCM A;  3MKF A;  2ZMA A;  3NOU C;  4ZTK A;  1Y4O A;  3T12 B;  4H6J B;  5FI7 A;  4WMC A;  3IHB A;  1MBL A;  2V8C A;  3CUE A;  3HVF A;  4H6J A;  4GOG A;  4Y0O A;  4P6B A;  4JPM A;  1GSW A;  1N9L A;  2Y79 A;  2Y2L A;  4DXC A;  4HHD A;  4HH2 A;  3T4L A;  2W1R A;  4QY6 A;  2JKG A;  1QME A;  3PAG A;  3W4Q A;  4R23 A;  4RVA A;  4GB7 A;  2PR6 A;  4E3I A;  4BJP A;  4XXR A;  1W8Q A;  2Y2H A;  1TDL A;  4CJN A;  2WKR A;  2G2U A;  1F5M A;  2A2L A;  2V1Z A;  2B02 A;  1PNE A;  4EWF A;  4RYE A;  2HJ9 C;  2EX9 A;  2HZ5 A;  3BRM A;  4MBF A;  3UDI A;  3FPV A;  3LR3 A;  5I94 A;  2XGN A;  1ONH A;  3GVB A;  3UB9 A;  2KOI A;  2EFX A;  2ZQA A;  4JXG A;  2V1B A;  5CXW A;  4JBF A;  2JN7 A;  2GNX A;  2Y55 A;  5EVI C;  4R38 A;  3HJI A;  3NCK A;  3AGD A;  4S2J A;  4OQI A;  5F82 A;  1KGF A;  2WKH A;  4S2O A;  4EUV A;  3G2Z A;  1XPB A;  1FIK A;  3G30 A;  1ALQ A;  2Y2J A;  1MY8 A;  3NOP C;  2IWC A;  2QKP A;  3EQV A;  3IWI A;  2Z2L B;  2Y2P A;  3LR5 A;  4GN2 A;  3BEB A;  3ZVW A;  1TS8 A;  1XGJ A;  3JPU A;  4I3A A;  1PIO A;  4XUZ A;  2HGV A;  3CG5 A;  1YPR A;  2ZQ7 A;  3D9Y A;  1L3L A;  3F1O A;  1LSX A;  5CHU A;  1XGI A;  3CZD A;  2Q9M A;  5C5K A;  1NYY A;  4I3J A;  3BY9 A;  3FC7 A;  3DWZ A;  3O86 A;  3C4P A;  2Y91 A;  3HLF A;  3KSF A;  5CTM A;  1RP5 A;  1CF0 A;  3T4O A;  1IYP A;  1ES4 A;  5L09 A;  5FEF A;  3KYE A;  3DTK A;  5KMW A;  3WS4 A;  4M3K A;  3CPT B;  3P7N A;  4UHU A;  4B88 A;  1YMS A;  1H8Y A;  1ERM A;  5EPH A;  3DTM A;  5FL3 A;  3LIC A;  3CPT A;  3GR2 A;  1MKM A;  3MF0 A;  3TW8 A;  3BFC A;  4JGR A;  4LEN A;  2VV6 A;  3OCL A;  2Y2Q A;  3K2N A;  1GA0 A;  3IXH A;  3N8L A;  5DF9 A;  4DXB A;  4OPZ A;  1SKO B;  1ES3 A;  4PM5 A;  2C6W B;  5HDC A;  3JVV A;  4KG2 A;  3V50 A;  3LY4 A;  3GEC A;  4DE2 A;  4LV3 A;  5A93 A;  2LB5 A;  5GLB A;  1PWG A;  2JC7 A;  3HUO A;  3IWO A;  4PPR A;  3EGX C;  2VX8 A;  5IT5 A;  4FSF A;  3KSH A;  2XLN A;  4JF5 A;  1TDG A;  3A3F A;  3WRZ A;  2DCF A;  5FDH A;  4G3W A;  4X1L A;  1EWZ A;  4BBU A;  1E4D A;  3ZYT A;  4EEP A;  2PU2 A;  4JXS A;  3NIA A;  5HAR A;  4WEK A;  3ZCZ A;  2Y2M A;  4X25 A;  2C5W B;  4OQH A;  4EQ1 A;  4OQG A;  3V5M A;  2PRF A;  3ZG9 B;  5F83 A;  3GV9 A;  5CGW A;  1KDS A;  4BBV A;  3LY3 A;  2GJ3 A;  1SDE A;  3PBS A;  4BD0 A;  4JGO A;  1YLW A;  5F69 A;  1JWZ A;  2HDS A;  1XXM A;  1BZA A;  2W3D A;  3UE1 A;  5CGX A;  4S2L A;  4LV0 A;  2K31 A;  1BLC A;  4WM9 A;  3Q81 A;  4UEY A;  4YWZ A;  3T4T A;  1CI8 A;  4EV4 A;  3SW1 A;  4GLQ A;  3P09 A;  5HAI A;  2W3E A;  4MN7 A;  3QP5 A;  1BLP A;  2J80 A;  4Y15 A;  3HLD A;  1PWC A;  1UWN X;  5FI6 A;  3HRE A;  2P08 A;  4GW9 A;  4GD6 A;  3SH9 A;  3R7W B;  3Q1F A;  2ACG A;  3NDE A;  3TG9 A;  5HSQ A;  4CLC C;  3V3S A;  2Q0O A;  3R7W A;  2YKF A;  4BL3 A;  2VZW A;  2EXB A;  4F94 A;  1LLB A;  4NET A;  1SHV A;  3M2J A;  2RL3 A;  2H28 A;  5IHV A;  5HD3 A;  2FH5 A;  1GSX A;  1KE3 A;  1YLY A;  3MQQ A;  4IHQ A;  4KZB A;  4R3A A;  2WK0 A;  2EFU A;  4WUJ A;  5DTS A;  5AVE A;  3H9W A;  1E25 A;  1FCN A;  4IBR A;  1OPX A;  2OOL A;  4LPZ A;  2O0Y A;  1GCE A;  4EUZ A;  3LO7 A;  3ZQ5 A;  1W8Y A;  1W63 M;  4GZB A;  4X53 A;  1OTI A;  4L9E A;  5LBR A;  4H8R A;  5EVE A;  4HP9 A;  5EOO A;  2Y2N A;  3IWQ A;  3LR0 A;  2J3T D;  4KQD A;  3CAX A;  3HLB A;  3FKV A;  1KOU A;  3WS1 A;  4NXE A;  3U2A A;  3C4O A;  2XQZ A;  1NRJ A;  1WA9 A;  4BLM A;  3NBL A;  5J8X A;  2P9V B;  1JVJ A;  4UA7 A;  4X1M A;  1VET B;  3MBZ A;  2PR5 A;  1NXY A;  1NYM A;  2P9V A;  2X01 A;  3UE3 A;  3SZT A;  3CI6 A;  5IU1 A;  1VET A;  2WYX A;  1G28 A;  4K08 A;  1M40 A;  2P74 A;  1P9W A;  2PBD P;  1ES2 A;  4S2P A;  1ES5 A;  3T4S A;  4KZA A;  1PWD A;  3UY6 A;  3ZNT A;  1DJB A;  5FQM A;  5HPI A;  4KZ8 A;  3QP8 A;  3S22 A;  1ESU A;  1RGZ A;  4EBP A;  1TF1 A;  2VEA A;  3M2K A;  1TS7 A;  3PBN A;  3PBO A;  4IVK A;  3D4F A;  1L0F A;  1OME A;  1BUL A;  4E3L A;  3M6B A;  1ERO A;  5E43 A;  2PHY A;  4HH3 A;  5L07 A;  1K54 C;  2LB9 A;  3VMA A;  2DRW A;  1ESI A;  4P6Z S;  1OTE A;  4EQI A;  4OQ0 A;  4ZJ1 A;  1L0G A;  4ESP A;  1XX2 A;  3S7O A;  2B5R A;  2B95 A;  3Q07 A;  4B9O A;  4RQ9 A;  3QP2 A;  1F2K A;  2IWB A;  1IKI A;  2ZOI A;  5EV0 A;  2UWX A;  5DJT A;  3VE3 A;  1VEU A;  5EVL A;  2OAQ 1;  3VP3 A;  1XA7 A;  3F1P A;  1A0K A;  4U3T A;  4DJ2 A;  5HWV A;  2Z6C A;  3GSG A;  4X55 A;  3RJU A;  5A8B A;  4OP8 A;  4PM8 A;  3IX8 A;  5F5Y A;  2WGV A;  1K57 A;  4PHT A;  3BJN A;  3GTC A;  4F3L B;  1JTG A;  1WYB A;  1MWU A;  2XEP A;  2O9A A;  3EGD C;  3S4X A;  5K5B A;  4E3N A;  3F1N B;  2WGI A;  4Q8I A;  1J3W A;  2WKQ A;  2V1A A;  4PM6 A;  1VHM A;  1P9R A;  2EX6 A;  3F1N A;  4GDB A;  2PAV P;  3H7W B;  1LSW A;  4KG5 A;  2HPB A;  1K38 A;  4AFI A;  5CEB A;  3UB7 A;  1XKZ A;  4S2N C;  3UMD A;  4CQH A;  3H7W A;  4LCL A;  2PYP A;  2Y2K A;  5A92 A;  3LCE A;  4KG6 A;  3MXR A;  4HBT A;  2PYR A;  5HDD A;  3OPP A;  5FEG A;  5JYO A;  5F1G A;  2H10 A;  3A3I A;  1PI5 A;  1ODV A;  4PM9 A;  5EVI A;  4G3V A;  2J3W A;  4IJG A;  2Y8H A;  5FI2 A;  1LL9 A;  4OON A;  1D7E A;  1TVF A;  2HDU A;  4ARZ A;  1G5U A;  3VP4 A;  5HL1 A;  3MZD A;  2ZQ8 A;  5M18 A;  3KSG A;  4HBU A;  3O87 A;  4QPR A;  1IOU A;  1KVL A;  3MXS A;  5CER A;  3SS5 A;  1JNU A;  4HY8 A;  1FR1 A;  2W27 A;  4BD1 A;  2X71 A;  4E3M A;  1K4F A;  4OPY A;  5J3W A;  1DJA A;  3A3E A;  3LIB A;  3PBQ A;  2XA7 M;  3ZHH A;  5U47 A;  1K57 C;  2AVX A;  3FV7 A;  2HF6 A;  5A90 A;  1E3U D;  3T50 A;  1JWV A;  2ZM0 A;  4EW7 A;  3NY4 A;  1BTL A;  3BFE A;  4S2M A;  4UA6 A;  1MWT A;  3MSH A;  4MNR A;  5G18 A;  1XFN A;  3D72 A;  3U4L P;  1FQG A;  4OLD A;  3EEH A;  4HP4 A;  4N92 A;  2Y2O A;  4EEU A;  2X02 A;  3VOY A;  3C30 A;  4EES A;  1BLH A;  5TGF A;  3OPR A;  4JKT A;  1MWS A;  2WKE A;  4UAA A;  2QYB A;  3B47 A;  1EI5 A;  3VV4 A;  1DP9 A;  4NKP A;  3MQ0 A;  4XUX A;  4E6X A;  5FQI A;  4E3J A;  5KIZ A;  4NG2 A;  2DNS A;  1Z6F A;  1ZTU A;  5HW3 A;  2VJW A;  3VE4 A;  2OLV A;  3OOV A;  1S4S A;  1CEG A;  4NEE D;  4IVI A;  1S0W A;  3RTY A;  2ZC4 B;  5FQ9 A;  5HAP A;  3OC2 A;  2ZC3 B;  1LL5 A;  3RXW A;  2OV5 A;  3IF5 A;  4BBT A;  4BL2 A;  3OZH A;  3O3V A;  3TE8 A;  4P85 A;  3ZVT A;  1LHY A;  4KZ5 A;  1T1B A;  3P98 A;  4WBG A;  3LIA A;  1UWP X;  4O01 A;  5TBM A;  5JYP A;  3C8C A;  3IF6 C;  3PXP A;  2Z6D A;  1NY0 A;  3D3O A;  3C7V A;  3F1O B;  2XF3 A;  4HNB A;  1K0K A;  1ZG6 A;  2J3T C;  2FFY A;  2JKF A;  3NEC A;  3HL9 A;  2W1T A;  1FCO A;  1YLP A;  1YLZ A;  2BTF P;  1F9I A;  3N7W A;  1W63 Q;  1YLJ A;  4WZ5 C;  4OP5 A;  3IXB A;  3C7U A;  3I7J A;  3S7N A;  4FTX A;  2J9O A;  3QP4 A;  4D2O A;  4WYY A;  3HLE A;  3WS2 A;  3TOI A;  3VFH A;  1K56 D;  1XFQ A;  4HES A;  1N9B A;  3B42 A;  1LI0 A;  4KZ7 A;  2R78 A;  1EW0 A;  3MR0 A;  1RCJ A;  2VK3 A;  3IHA A;  4R0Q A;  4YFM A;  1SKF A;  1LI9 A;  1STZ A;  4KUO A;  4CLC A;  2ZL1 B;  5BOH A;  2XD5 A;  1ZG4 A;  2J9P A;  3BYD A;  3ITA A;  4LLO B;  2P7J A;  2VGL M;  2ZL1 A;  1WYC A;  2JBF A;  1S6R A;  1SCW A;  3HBR A;  3C2W A;  4KQO A;  5GHY A;  2VV8 A;  1S1Y A;  4B93 A;  2BLS A;  3ISG A;  2ZC7 A;  3L7H A;  1MZU A;  5DTK A;  4QHC A;  2WUQ A;  5KZH A;  3DBA A;  4DRT A;  2ZMF A;  3LR4 A;  3BWL A;  1X0O A;  4JLF A;  4HJ6 A;  2Z2M B;  4NXB A;  2FZ0 A;  1KE4 A;  2JCH A;  5EM0 A;  4GKU A;  1H8Z A;  1W5D A;  3QNB A;  5EE8 A;  1LT0 A;  2H0Y A;  4FCF A;  3WRT A;  1GHM A;  3BY8 A;  4QJG A;  3R4K A;  4NXF A;  1YLT A;  4E6W A;  4RX2 A;  2HDQ A;  3TRC A;  4KZ6 A;  4X68 A;  4GCZ A;  3UB6 A;  2ZLY A;  1CI9 A;  2M1C A;  1HD8 A;  2A49 A;  1DP6 A;  4N1H A;  2V8F A;  4KZ3 A;  3A0R A;  4LRZ E;  2WKI A;  1WE4 A;  4L9G A;  3SS4 A;  4OOL A;  3UB5 P;  4D60 A;  1NJ4 A;  1QMF A;  3UPP A;  3LIE A;  5TFQ A;  3T4Q A;  2PU4 A;  2XDM A;  5CED A;  1IEM A;  1W79 A;  2ZOH A;  4N9K A;  3WS5 A;  4WL9 A;  5FAP A;  3A0V A;  3T4J A;  3CLO A;  4OPQ A;  2XK1 A;  4FUW A;  4PKY A;  2EX8 A;  4Y13 A;  1IEL A;  3A0S A;  1YMX A;  3LFV A;  4OOM A;  1M6K A;  1K54 A;  5FQK A;  1YQS A;  3IH8 A;  2WAE A;  4RX3 A;  4I38 A;  2VV7 A;  3RXX A;  5AQB A;  5E2F A;  4JF4 A;  4YNR A;  1HZO A;  1BT5 A;  3KSI A;  3CJM A;  1T18 A;  4FH2 A;  3T1Q B;  1K55 C;  2WKP A;  3V39 A;  3LI9 A;  4O7D A;  4R3J A;  2WGW A;  4E3O A;  1BUE A;  2WAD A;  1G6O A;  3KO6 A;  3BFG A;  2A24 A;  4EBN A;  3BQA A;  1NLZ A;  3IX3 A;  1XJ6 A;  4MBK A;  1I5Q A;  2E8J A;  4N9L A;  3LGO A;  5DVA A;  2Y2I A;  3CHW P;  3ZNY A;  3E2L A;  1H0M A;  2ZQD A;  1K6R A;  3IS2 A;  2INW A;  4I3I A;  1D06 A;  1CQA A;  2E8I A;  1RGY A;  1IFQ A;  1OT6 A;  1G6A A;  5D3O A;  5DF7 A;  5CHJ A;  2OSU A;  3N6I A;  5L2F A;  2KDK A;  2I9V A;  1K56 A;  5HWW A;  4EU0 A;  2IWD A;  5L10 A;  2EX2 A;  1HLU P;  1JWP A;  3HLG A;  4DMZ A;  5E2G A;  3K3C A;  4JGQ A;  4S2N A;  4C75 A;  2XSS A;  5HZH A;  4A5R A;  1IYS A;  3UME A;  1Y54 A;  5DFX A;  3HLC A;  3IH9 A;  5L8M A;  4QY5 A;  3BLM A;  5CEC A;  1W7F A;  3HUN A;  3WS0 A;  4OVD A;  3B3X A;  3NHQ A;  2ZC5 B;  4OOY A;  3GRJ A;  4XT2 B;  1JTD A;  1IKG A;  4P0M A;  2ZJ9 A;  5EUA A;  4JF6 A;  3S1Y A;  5EEC A;  2H5S A;  2O9C A;  2VKS A;  1VEU B;  3W8K A;  1H8M A;  4KEN B;  4XT2 A;  4UA9 A;  5FAT A;  3F1P B;  4ETX A;  2WAF A;  2XFT A;  2GDN A;  4KUK A;  5GHZ A;  4X56 A;  4K91 A;  5HWT A;  3SH7 A;  2XR0 A;  4MN5 A;  4R70 A;  1K6S A;  4WEJ A;  3FG8 A;  2HV1 A;  2HJE A;  4Y5F A;  3ZGA B;  1PI4 A;  5CX7 A;  1MXO A;  3G2Y A;  3AGF A;  2J7V A;  3E0Y A;  3E2K A;  4GJ4 A;  3T1R A;  1XA1 A;  3IBJ A;  4GHI A;  4FD8 A;  3VP2 A;  1FIL A;  2ZM2 A;  2BAS A;  2PBY A;  1PRQ A;  3QP1 A;  1YT4 A;  3OPH A;  2WZX A;  2B18 A;  2W3H A;  2PD8 A;  1L0D A;  1YSQ A;  3OCN A;  3N8S A;  3H82 A;  5HDS A;  4OKP A;  2JE5 A;  2VGK A;  2RCX A;  4LV1 A;  1GSV A;  3O88 A;  5EVI B;  4HOI A;  4IUK A;  5HFO A;  4LFU A;  1L0E A;  4Y7P A;  4ARZ B;  4MCW A;  2G2W A;  4NK3 A;  5E2H A;  1TD5 A;  2XRO A;  1XJ4 A;  5AQA A;  2W3F A;  2ZQC A;  4II7 A;  4O8G A;  3UN7 A;  3G32 A;  4U0X A;  4I39 A;  5TJJ A;  3RH8 B;  2EWV A;  3LEQ A;  3VSK A;  3MJQ A;  1F98 A;  2PD7 A;  1T1C A;  5G4Z A;  2CC1 A;  4DE3 A;  1MPL A;  3P01 A;  3TJZ C;  3QP6 A;  1MKI A;  4B4Z A;  3C5A A;  4ZRR A;  2NUT C;  1T19 A;  4Y2F A;  3IF6 A;  3Q7V A;  4OPR A;  1N4O A;  2G7U A;  3BQ8 A;  4YIN A;  3CMZ A;  1MWR A;  4DE0 A;  1FSY A;  2BG1 A;  1V9Z A;  3UPO A;  1S1Z A;  1PYY A;  4WZ5 A;  1NWZ A;  4BMW A;  5M1A A;  2A3U A;  3LYX A;  1BSG A;  5HD5 A;  3GQZ A;  1DRM A;  3ZDJ A;  3LIF A;  1I2W A;  5AJG A;  2M7V A;  1CEF A;  4WEL A;  4WLA A;  3DW0 A;  1Z09 A;  3V3R A;  3E4P A;  3KYZ A;  3T4K A;  1GA9 A;  4BQM A;  5GLC A;  3ZG5 A;  3MFX A;  4G3K A;  3EOI A;  1KGE A;  5E2E A;  2QMI A;  3QNC A;  3N4I A;  3UE6 A;  1P97 A;  3AGE A;  1FCM A;  4L0L A;  1NRF A;  1SZV A;  5CHM A;  2XH9 A;  1NZO A;  4ID4 A;  4EXO A;  2JHE A;  4MLL A;  3UB8 A;  1FR6 A;  4O0P A;  1YAX A;  4X6T A;  1H5X A;  5GL9 A;  4N1X A;  2HP6 A;  5J4E A;  2FFF B;  4M4X A;  1Y28 A;  3PBT A;  3C38 A;  1G68 A;  5TBM B;  4KZ4 A;  3PHY A;  2V2F F;  2ZMV A;  4Q0H A;  3HJK A;  5GLA A;  5KSH A;  2ZC6 B;  4GD8 A;  3VOZ A;  2QZ6 A;  3DAV A;  4S2K A;  1D1J A;  5FAQ A;  2W1T B;  4K0X A;  4IED A;  5EM1 A;  2HP5 A;  3BM6 A;  2K7S A;  4K0W A;  1K4E A;  2J8Y A;  1S4R A;  3NI9 A;  2EA9 A;  4GS9 B;  2W3G A;  3V67 A;  3ZFZ A;  2ZD8 A;  2VGJ A;  2GX5 A;  1N9N A;  3KYQ A;  5MC7 A;  4QB8 A;  4GS9 A;  4UQI M;  4PM7 A;  3CUE C;  4HIA A;  5GHX A;  4CLC B;  3IT9 A;  4C3Q A;  3E4O A;  4EET B;  4MDZ A;  4U0T A;  4NXG A;  2QWS A;  3MZF A;  1PW1 A;  3QHY A;  4DKI A;  5HPF A;  3G6O A;  3VP1 A;  2XFS A;  3M6H A;  3IBR A;  2ZBB A;  3DTI A;  4ZBE A;  4MMN A;  3UDF A;  4P87 A;  2NUP C;  1U60 A;  4P6Z M;  3E98 A;  3PBR A;  3PAE A;  2QJ5 A;  4MBH A;  4ZDX A;  2JKR I;  4EBL A;  2UV0 E;  4IBX A;  2GZA A; 
#chains in the Genus database with same CATH homology
 4EBN A;  2G2U A;  3GMW A;  4MBK A;  4E3N A;  1K55 A;  1XP4 A;  2V1Z A;  1I5Q A;  4N9L A;  4EWF A;  2WGI A;  4Q8I A;  4RYE A;  5DVA A;  1KVM A;  4FH4 A;  3FYZ A;  3NC8 A;  3HUM A;  1SDN A;  2Y2I A;  4PM6 A;  2EX9 A;  2I72 A;  2R9W A;  3BRM A;  4MBF A;  3ZNY A;  3UDI A;  2EX6 A;  4GDB A;  3E2L A;  5HX9 A;  4BEN A;  2ZQD A;  4KG5 A;  2HPB A;  1PW8 A;  1K38 A;  1K6R A;  5CEB A;  5I94 A;  1XKZ A;  2E8I A;  2XGN A;  1RGY A;  4WZ4 A;  4S2N C;  1ONH A;  3GVB A;  2EFX A;  2ZQA A;  4JXG A;  2QPN A;  1G6A A;  5D3O A;  5DF7 A;  5CXW A;  5CHJ A;  4LCL A;  4JBF A;  2OSU A;  3N6I A;  2Y2K A;  5L2F A;  5A92 A;  2Y55 A;  3LCE A;  4KG6 A;  5EVI C;  3MXR A;  4HBT A;  1K56 A;  1E3U A;  3ZG7 B;  3NCK A;  3VP0 A;  3AGD A;  4S2J A;  2IWD A;  4X69 A;  3OPP A;  4OQI A;  5F82 A;  1KGF A;  2EX2 A;  1JWP A;  5JYO A;  3HLG A;  5HAQ A;  2WKH A;  5F1G A;  2H10 A;  5E2G A;  3A3I A;  4S2N A;  4RA7 A;  3EQU A;  5FSR A;  4S2O A;  1PI5 A;  3SOI A;  4C75 A;  3G2Z A;  4PM9 A;  4A5R A;  1XPB A;  5EVI A;  1IYS A;  3G34 A;  1ALQ A;  3G30 A;  1Y54 A;  5FI2 A;  2Y2J A;  1LL9 A;  1MY8 A;  1TVF A;  4OON A;  2IWC A;  3MKE A;  3UNW A;  3EQV A;  2HDU A;  3IWI A;  3HLC A;  3IH9 A;  2Z2L B;  2Y2P A;  3PTE A;  4GN2 A;  3BEB A;  3ZVW A;  1C3B A;  5DTT A;  4QY5 A;  1XGJ A;  3UO9 A;  3BLM A;  3MZD A;  2ZQ8 A;  3VP4 A;  5HL1 A;  5CEC A;  3ITB A;  5GLD A;  1W7F A;  1PIO A;  5M18 A;  4HBU A;  4XUZ A;  3O87 A;  3CG5 A;  3HUN A;  3WS0 A;  2ZQ9 A;  5A91 A;  4OVD A;  1KVL A;  3B3X A;  3MXS A;  2ZC5 B;  2ZQ7 A;  4OOY A;  5CER A;  5CHU A;  2H0T A;  1XGI A;  3CZD A;  2Q9M A;  3GRJ A;  3NDG A;  3SS5 A;  1NYY A;  1JTD A;  4DE1 A;  1IKG A;  4P0M A;  3DWZ A;  3SS3 A;  2ZJ9 A;  5EUA A;  4JF6 A;  3A3D A;  3S1Y A;  1FR1 A;  5EEC A;  3O86 A;  3C4P A;  2H5S A;  2Y91 A;  2V20 A;  3HLF A;  2X71 A;  5CTM A;  1RP5 A;  4BD1 A;  4E3M A;  3W8K A;  1K4F A;  4OPY A;  4OH0 A;  4KEN B;  1DJA A;  4MEZ A;  3A3E A;  4UA9 A;  5FAT A;  3HLW A;  1IYP A;  3PBQ A;  1ES4 A;  5U47 A;  3ZHH A;  1Q2P A;  1K57 C;  2XFT A;  2WAF A;  1I2S A;  3FV7 A;  5KMW A;  2GDN A;  5A90 A;  5GHZ A;  4X56 A;  1E3U D;  3WS4 A;  4M3K A;  4K91 A;  4B88 A;  4UHU A;  3SH7 A;  2XR0 A;  1YMS A;  1K6S A;  3OPL A;  1JWV A;  2ZM0 A;  1H8Y A;  2WGW B;  2R9X A;  4WEJ A;  1ERM A;  1BTL A;  3BFE A;  3NY4 A;  4S2M A;  3IQA A;  4UA6 A;  5EPH A;  1MWT A;  3DTM A;  4MNR A;  5G18 A;  3GR2 A;  4Z9Q A;  1KGG A;  3ZGA B;  1PI4 A;  1FQG A;  1MXO A;  3G2Y A;  3Q82 A;  4OLD A;  5EVI D;  2EXA A;  4N92 A;  3FWL A;  2Y2O A;  3AGF A;  5FAS A;  3BFC A;  2J7V A;  2X02 A;  4LEN A;  3VOY A;  3OCL A;  2Y2Q A;  3E2K A;  1BLH A;  1GA0 A;  2HDR A;  3IXH A;  3N8L A;  5DF9 A;  5TGF A;  4DXB A;  4OPZ A;  4QD4 A;  1ES3 A;  4PM5 A;  1PZO A;  3OPR A;  4JKT A;  1MWS A;  1TEM A;  1L2S A;  2WKE A;  1XA1 A;  2C6W B;  4UAA A;  4KG2 A;  3IXD A;  3V50 A;  3LY4 A;  4DE2 A;  1EI5 A;  4FD8 A;  4R4S A;  4HEF A;  4LV3 A;  3VP2 A;  5A93 A;  3BEC A;  1PWG A;  2JC7 A;  3HUO A;  2ZM2 A;  3IWO A;  5GLB A;  4XUX A;  4PPR A;  4ZJ3 A;  4E6X A;  4FSF A;  5FQI A;  4E3J A;  2XLN A;  2DNS A;  1Z6F A;  2PBY A;  1PZP A;  4JF5 A;  1TDG A;  3VFF A;  1YT4 A;  3A3F A;  3LEZ A;  3WRZ A;  5HW3 A;  2DCF A;  2OLV A;  5FDH A;  3OPH A;  4Y0U A;  2WZX A;  4WMC D;  1EWZ A;  1CEG A;  4DDY A;  4IVI A;  1E4D A;  1S0W A;  2PU2 A;  1VQQ A;  1L0D A;  2ZC4 B;  3NIA A;  4JXS A;  5FQ9 A;  3OC2 A;  5HAR A;  2ZC3 B;  4WEK A;  3OCN A;  5HAP A;  1LL5 A;  3RXW A;  3BFF A;  3N8S A;  3ZCZ A;  2OV5 A;  2Y2M A;  2C5W B;  4OQH A;  3IF5 A;  4OKP A;  2JE5 A;  2VGK A;  4OQG A;  3V5M A;  2RCX A;  2HP9 A;  4DF6 A;  4BL2 A;  3OZH A;  3O3V A;  4LV1 A;  3O88 A;  5EVI B;  4KQQ A;  3ZG9 B;  5F83 A;  3GV9 A;  5HFO A;  5CGW A;  1O7E A;  1KDS A;  1IYO A;  5FAO A;  4Y0T A;  1L0E A;  3LY3 A;  4Y7P A;  4P85 A;  1Q2Q A;  1SDE A;  3ZVT A;  3PBS A;  1LHY A;  3W4O A;  1AXB A;  2G2W A;  3FZC A;  4NK3 A;  4KZ5 A;  5E2H A;  5FQQ A;  5FQJ A;  4BD0 A;  3W4P A;  4PMA A;  1YLW A;  2XD1 A;  4OLG A;  3P98 A;  3Q7Z A;  5AQA A;  2ZQC A;  4QU3 A;  4WBG A;  1JWZ A;  2HDS A;  3UN7 A;  1XXM A;  5JYP A;  3G32 A;  1BZA A;  4CPK A;  4U0X A;  3IF6 C;  3UE1 A;  5CGX A;  3VSK A;  4S2L A;  4LV0 A;  1NY0 A;  3C7V A;  1BLC A;  4WM9 A;  3Q81 A;  2XF3 A;  5TR7 A;  4KQR A;  1CI8 A;  4EV4 A;  1ZG6 A;  1IYQ A;  1HVB A;  3P09 A;  2FFY A;  5HAI A;  2CC1 A;  4DE3 A;  1MPL A;  1BLP A;  3HL9 A;  3ZG8 B;  3HLD A;  5KSC A;  1FCO A;  1PWC A;  5FI6 A;  1YLP A;  3HRE A;  1YLZ A;  5M19 A;  1MKI A;  4B4Z A;  3C5A A;  3G31 A;  3N7W A;  3UPN A;  3IF6 A;  1YLJ A;  3Q7V A;  4ZJ2 A;  4OPR A;  4WZ5 C;  4OP5 A;  3IXB A;  3C7U A;  1N4O A;  4GD6 A;  3I7J A;  5AQ9 A;  3SH9 A;  4R1G A;  4YIN A;  2J9O A;  3CMZ A;  1MWR A;  1GHI A;  3Q1F A;  4D2O A;  4JXV A;  3NDE A;  4WYY A;  2OLU A;  3TG9 A;  3HLE A;  3WS2 A;  4DE0 A;  4E3K A;  1FSY A;  3V3S A;  4C6Y A;  3ZG0 A;  3TOI A;  3VFH A;  2BG1 A;  1K56 D;  3UDX A;  4BL3 A;  1CK3 A;  2EXB A;  4HES A;  1N9B A;  1LI0 A;  4DDS A;  3UPO A;  4F94 A;  1PYY A;  4GNU A;  4KZ7 A;  2Y4A A;  1LLB A;  4WZ5 A;  4NET A;  1RCJ A;  1SHV A;  2Q9N A;  3M2J A;  1VM1 A;  3WWX A;  2RL3 A;  3IHA A;  4R0Q A;  2A3U A;  5M1A A;  5FA7 A;  5IHV A;  4YFM A;  1SKF A;  1LI9 A;  4GDN A;  1KDW A;  1YLY A;  1BSG A;  1KE3 A;  2XD5 A;  4KZB A;  5BOH A;  2WZZ A;  3GQZ A;  3ZDJ A;  1I2W A;  1ZG4 A;  2Y59 A;  2J9P A;  3BYD A;  1CEF A;  4WEL A;  2WK0 A;  3DW0 A;  2EFU A;  3ITA A;  5DTS A;  3V3R A;  1E25 A;  3G4P A;  1WYC A;  1FCN A;  2JBF A;  4IBR A;  1S6R A;  1ERQ A;  1GA9 A;  5CRF A;  1SCW A;  4BQM A;  5GLC A;  3ZG5 A;  3HBR A;  1GCE A;  4R4R A;  4EUZ A;  1KGE A;  5E2E A;  2QMI A;  1J9M A;  3QNC A;  3LO7 A;  3IXG A;  3N4I A;  4KQO A;  1W8Y A;  4GZB A;  1GHP A;  5GHY A;  1DJC A;  3AGE A;  1FCM A;  4KZ9 A;  1ZKJ A;  4X53 A;  1KE0 A;  4L0L A;  2BLS A;  3ISG A;  1NRF A;  2ZC7 A;  5CHM A;  4H8R A;  3VSL A;  2XH9 A;  5DTK A;  1ONG A;  5EOO A;  4ZAM A;  4R3B A;  4QHC A;  1NZO A;  2Y2N A;  4ID4 A;  3IWQ A;  5AQ7 A;  2WUQ A;  5KZH A;  4DRT A;  1ZC2 A;  3HLB A;  4MLL A;  3A3J A;  3FKV A;  3WS1 A;  4B4X A;  1FR6 A;  1BLS A;  4JLF A;  3C4O A;  2Z2M B;  2XQZ A;  4X6T A;  1H5X A;  1KE4 A;  5GL9 A;  2JCH A;  2HP6 A;  4N1X A;  2FFF B;  4BLM A;  3NBL A;  5J8X A;  2P9V B;  4GKU A;  1H8Z A;  1JVJ A;  1W5D A;  3QNB A;  5EE8 A;  3TSG A;  3PBT A;  4UA7 A;  1FOF A;  3MBZ A;  2H0Y A;  1G68 A;  4FCF A;  4KZ4 A;  1NXY A;  3WRT A;  1NYM A;  2V2F F;  2P9V A;  2ZM8 A;  2X01 A;  3UE3 A;  1GHM A;  3FKW A;  4QJG A;  5GLA A;  5KSH A;  2WYX A;  1O07 A;  2ZC6 B;  1YLT A;  4GD8 A;  4E6W A;  2Y2G A;  3VOZ A;  4RX2 A;  2HDQ A;  5DF8 A;  2QZ6 A;  4KZ6 A;  4X68 A;  1M40 A;  2P74 A;  2ZLY A;  3MZE A;  4S2K A;  4S2I A;  1ES2 A;  1CI9 A;  1ES5 A;  4S2P A;  5FAQ A;  4KZA A;  1HD8 A;  2A49 A;  4IED A;  1PWD A;  4K0X A;  4N1H A;  3UY6 A;  3SH8 A;  3ZNT A;  1DJB A;  5FQM A;  4KZ8 A;  2HP5 A;  3BM6 A;  4KZ3 A;  3MFD A;  3IF6 B;  3DWK A;  3Q7V B;  5F1F A;  4K0W A;  3S22 A;  1K4E A;  2WKI A;  3BLS A;  2J8Y A;  1ESU A;  1WE4 A;  1HTZ A;  1DY6 A;  3SS4 A;  3NI9 A;  1RGZ A;  4EBP A;  4OOL A;  1FSW A;  1NJ4 A;  1QMF A;  3M2K A;  1K25 A;  3UE0 A;  3UPP A;  4LV2 A;  5TFQ A;  3PBN A;  3PBO A;  4IVK A;  3D4F A;  5CTN A;  3ZFZ A;  2PU4 A;  2ZD8 A;  2VGJ A;  1L0F A;  2XDM A;  1OME A;  1BUL A;  4QB8 A;  4E3L A;  5CGS A;  5CED A;  1IEM A;  3M6B A;  1W79 A;  4JXW A;  5EOE A;  3N8R A;  4PM7 A;  1ERO A;  5E43 A;  1K54 C;  3BFD A;  1YM1 A;  3JYI A;  3VMA A;  2DRW A;  1ESI A;  3G35 A;  1NZU A;  4LCM A;  4N9K A;  3WS5 A;  4EQI A;  5GHX A;  4OQ0 A;  4ZJ1 A;  1L0G A;  5FAP A;  3MKF A;  1XX2 A;  2ZMA A;  3IT9 A;  2B5R A;  4C3Q A;  3Q07 A;  4ZTK A;  4OPQ A;  2XK1 A;  5FI7 A;  2IWB A;  2EX8 A;  1IKI A;  4WMC A;  1IEL A;  3IHB A;  1YMX A;  1MBL A;  4U0T A;  2UWX A;  1PW1 A;  3MZF A;  4OOM A;  3QHY A;  1M6K A;  1K54 A;  5FQK A;  4DKI A;  3HVF A;  1YQS A;  3IH8 A;  2WAE A;  4GOG A;  4RX3 A;  5EVL A;  4Y0O A;  4P6B A;  3RXX A;  4JPM A;  3VP3 A;  2Y2L A;  5AQB A;  1XA7 A;  3VP1 A;  2XFS A;  3M6H A;  4DXC A;  4U3T A;  5E2F A;  4JF4 A;  3GSG A;  4X55 A;  1HZO A;  3RJU A;  4QY6 A;  4OP8 A;  1BT5 A;  4ZBE A;  3CJM A;  4FH2 A;  1QME A;  3UDF A;  4PM8 A;  1K55 C;  4P87 A;  3PAG A;  1U60 A;  3W4Q A;  3V39 A;  3PBR A;  4O7D A;  4R3J A;  2WGV A;  4R23 A;  2WGW A;  4RVA A;  3PAE A;  1K57 A;  4GB7 A;  4E3O A;  3GTC A;  1BUE A;  4MBH A;  2WAD A;  4E3I A;  4ZDX A;  4EBL A;  1JTG A;  4BJP A;  1WYB A;  4XXR A;  1W8Q A;  1MWU A;  2Y2H A;  2XEP A;  4IBX A;  1TDL A;  3S4X A;  4CJN A;  3BFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...