4DE2A

Ctx-m-9 class a beta-lactamase complexed with compound 12
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
260
structure length
260
Chain Sequence
AVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Structure-Based Design of Potent and Ligand-Efficient Inhibitors of CTX-M Class A Beta-Lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 90
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4de2A00
2PBYA 2Q9MA 1GA0A 4OQIA 5FAPA 1H8ZA 1W8YA 3G2ZA 3M6BA 4Y7PA 4D2OA 2EFXA 2XFTA 2A49A 3HLBA 3RJUA 3IT9A 5FA7A 4ZAMA 1CI9A 1K55A 1NZUA 2RL3A 2Z2MB 4BLMA 1E3UD 3FKVA 1BTLA 2Z2LB 1MWRA 1BZAA 1DJAA 4BQMA 3NCKA 1HTZA 2QMIA 3BEBA 3UE3A 1S6RA 3FKWA 5EVLA 1WYCA 3BLSA 2QZ6A 2ZQ9A 5GHYA 5KMWA 3DWZA 1BLHA 3GSGA 3SS3A 2PU4A 2Y59A 4KENB 4IBXA 4DF6A 1WE4A 1XX2A 2J9OA 1EROA 3Q82A 4KG6A 3ZVWA 2G2UA 5FATA 1K6RA 5AQ7A 4PPRA 3ZCZA 1ERMA 1E4DA 2WYXA 3O87A 1OMEA 1ALQA 5DF9A 4OH0A 4U3TA 2ZC7A 1FOFA 1ES2A 3WRZA 5DTTA 3LCEA 3AGDA 4FH4A 4OOLA 3B3XA 3ITAA 1DJBA 1W5DA 1K25A 3SH7A 4OP5A 3AGEA 2XR0A 4X69A 4S2IA 4PM5A 4B88A 3N4IA 1N4OA 4LCMA 3QHYA 3HLCA 1K56D 2WKHA 1FCNA 2XFSA 4LV1A 4S2LA 4ZJ3A 3UPOA 3NDEA 4HEFA 1GCEA 1KGGA 1K54A 3G31A 1K57A 3UE0A 4P87A 2HDQA 2H0TA 5A92A 3OC2A 3QNBA 1PW1A 5E2HA 2GDNA 4LV0A 2ZC3B 3EQVA 1JWVA 3M6HA 1L2SA 2FFFB 2WGWA 3HLGA 3IXHA 2EX6A 4X68A 3PTEA 4KQRA 5GHZA 3Q7VA 5F1GA 3C7VA 1KVLA 2EX9A 2WZZA 1LI0A 3ZHHA 3HBRA 2V2FF 3W4PA 1HD8A 2R9WA 5TR7A 4DE1A 2HDSA 3A3IA 3HLFA 1E3UA 3IF6B 4N9KA 1LL9A 4S2MA 5DTKA 2JCHA 2WZXA 4QHCA 1SKFA 5AQ9A 4XXRA 5EVIB 1JWPA 3RXWA 4FCFA 1PWGA 3ZNYA 4BL2A 4KZ4A 2H10A 5CTMA 1KGEA 4S2PA 2QPNA 1YLTA 2XD1A 4BD0A 1ESIA 2VGKA 3DTMA 3UDXA 3G35A 2ZC6B 4WZ4A 4IEDA 4CJNA 4Y0TA 3PBSA 3E2LA 1FQGA 1TDGA 3A3JA 5FAOA 4OPYA 5U47A 1IELA 1KVMA 5EPHA 1FSWA 4QU3A 5FAQA 5CEBA 4R23A 2RCXA 5TFQA 3ZNTA 3ZG0A 3SH8A 2ZM0A 3UE1A 3Q7ZA 2WAEA 2DCFA 2V20A 4QB8A 5CECA 2J8YA 4E3KA 3VP0A 4X6TA 5KSCA 3S4XA 3SH9A 4H8RA 1TEMA 5HFOA 2ZQDA 1KE3A 3OPPA 2Y2GA 4HBUA 4UA9A 4P85A 1PYYA 1K56A 5FQJA 4IBRA 1ZG6A 2Y2PA 1CK3A 3O86A 4KZ6A 4DE0A 5HAIA 1RGYA 3IQAA 3UDFA 4RX2A 2Y2MA 4OLDA 2Y55A 1DJCA 3PAEA 2VGJA 2J7VA 1XA1A 4GNUA 4MNRA 3D4FA 4S2JA 1YT4A 3CG5A 3IXGA 5FQMA 5EOOA 5CHUA 2X02A 3GV9A 3BFEA 3A3FA 1IYPA 1FR6A 2C5WB 3N7WA 1IYOA 5E2GA 1PWDA 4DXBA 1I2SA 1SDEA 4GB7A 4OONA 4DDYA 4PM9A 4GKUA 3ITBA 5JYPA 2ZM2A 4JXSA 5I94A 1FR1A 5GL9A 5J8XA 1E25A 4U0XA 2ZLYA 5A90A 4WEJA 3FWLA 3BFGA 3ZG9B 5A93A 2Y2NA 2FFYA 5GLBA 4JBFA 4RYEA 4GZBA 2J9PA 3N8SA 3ZFZA 4Q8IA 3LY4A 2ZQAA 5E43A 2JE5A 3IF6C 2XK1A 3PBRA 2Y2JA 1L0EA 4MBKA 4DXCA 5EVIC 1KE4A 4EQIA 5CTNA 1XGIA 4GD8A 1G68A 5KSHA 3MKEA 2E8IA 3LEZA 2H5SA 3N8LA 3VOZA 3SS4A 4KZBA 3I7JA 2XEPA 2G2WA 4E6XA 1SCWA 2X71A 4PM8A 2WK0A 4QY5A 5DF7A 5EUAA 3VP1A 1PI5A 4RX3A 4DDSA 2Q9NA 3VMAA 3WWXA 3E2KA 2BG1A 2WKIA 4N1XA 3CZDA 4WMCD 3UDIA 1NZOA 3C4PA 4E3JA 2XF3A 4P6BA 1ESUA 3MZEA 3BLMA 4XUZA 1GHPA 3MFDA 3NC8A 4E6WA 4ZDXA 4EBLA 1G6AA 1LLBA 2EXAA 2ZQ7A 3TSGA 1HZOA 1Z6FA 1WYBA 2IWCA 1L0DA 5FQ9A 1BUEA 3JYIA 4RVAA 2B5RA 2HP6A 4GOGA 5HW3A 4A5RA 1L0FA 2JBFA 4S2NC 3WS2A 3SOIA 3G32A 1YM1A 2WGWB 3MBZA 4IVKA 4ZTKA 2PU2A 4F94A 1CEGA 2ZMAA 1FSYA 4DE3A 1ZG4A 3C4OA 5A91A 3ZG8B 2CC1A 4KZAA 4QY6A 5CGSA 5GHXA 3HLEA 2ZJ9A 4PM7A 4FH2A 4JXWA 5L2FA 3ZGAB 4UHUA 4KZ7A 5CEDA 4EWFA 1TDLA 5FI7A 3IXDA 1ZKJA 5F83A 1SHVA 4K91A 4UA7A 1U60A 2V1ZA 2ZC4B 3PBNA 1AXBA 1H5XA 2ZD8A 4R3JA 1W79A 3C5AA 1YMSA 4KQOA 3VP2A 4OPRA 4P0MA 3WS5A 1YLJA 4B4XA 1XP4A 3SS5A 2HDUA 2P9VB 1W8QA 3LO7A 4JKTA 3HLDA 2IWDA 2DNSA 3Q1FA 3VOYA 2Y91A 2XLNA 3BECA 1N9BA 4N1HA 3ISGA 3VFFA 2Y2KA 4OQHA 3TOIA 4MBHA 5EE8A 4EBNA 2XQZA 1PZPA 2OV5A 1ZC2A 3G30A 3NIAA 5E2EA 3OPLA 3PAGA 4MEZA 4OOYA 1NXYA 2A3UA 4E3LA 2C6WB 2EX2A 5HAPA 4KQQA 3V3SA 4K0XA 4PM6A 4WMCA 4JPMA 3OPRA 1MWSA 3IHBA 3G2YA 2OSUA 3GR2A 5FQKA 4DKIA 4WM9A 5IHVA 1LI9A 4X53A 5FI2A 3W8KA 1K4EA 5M1AA 2EFUA 2Y2LA 2WUQA 4Y0UA 1IKIA 1K38A 4OP8A 1YLYA 3RXXA 1JTGA 2EX8A 1MWUA 3CJMA 2WADA 1K54C 3QNCA 4QD4A 4XUXA 4FD8A 4EV4A 4UAAA 5D3OA 5DTSA 2Y4AA 3A3DA 3VFHA 1BSGA 2ZQ8A 2Y2QA 3HUMA 4WBGA 4BENA 3V50A 1EWZA 4N92A 4OLGA 4GDNA 4JF4A 4WYYA 2Y2OA 1M40A 1VM1A 2OLUA 1IKGA 1O7EA 3OZHA 3PBQA 3V39A 4LENA 1BT5A 1CEFA 4NK3A 5KZHA 4X56A 5EECA 5HL1A 1NY0A 4FSFA 3NY4A 5HAQA 1M6KA 5CERA 2H0YA 2HDRA 1ONGA 1FCMA 3N8RA 3AGFA 3IH9A 1FCOA 5GLDA 4WELA 4EBPA 5E2FA 5G18A 4N9LA 1GA9A 1BLSA 1KDSA 3W4OA 1XKZA 1XPBA 3NDGA 2DRWA 3NI9A 1DY6A 4IVIA 4R3BA 2HPBA 5F1FA 3BFDA 4R0QA 4OOMA 4HBTA 2ZM8A 3BM6A 4ZJ2A 4E3MA 2XH9A 1IEMA 2IWBA 3G34A 3UPPA 1BULA 4GDBA 2EXBA 1PZOA 1NYYA 2HP5A 2XD5A 4C6YA 1XXMA 3IWIA 5FSRA 3IF5A 4OQGA 5GLCA 4KZ3A 1PI4A 5AQBA 1ES5A 3OCLA 3DW0A 1CI8A 1KE0A 2UWXA 1PW8A 3PBOA 1L0GA 3UN7A 3WS0A 1Y54A 1MWTA 3EQUA 4S2KA 3S1YA 3UO9A 5DVAA 5EVID 5F82A 3UY6A 3WRTA 4EUZA 4R4RA 4JF6A 1ERQA 5M18A 3GVBA 1YLWA 4KZ9A 4R4SA 4E3IA 1ONHA 3OCNA 1J9MA 1BLPA 5CXWA 4ZBEA 5FASA 3HREA 3M2JA 1H8YA 3LY3A 3G4PA 3NBLA 4WEKA 5GLAA 1YLZA 1IYSA 2XGNA 3MXRA 4E3NA 4WZ5C 3BRMA 3FV7A 1QMEA 4KZ5A 1RGZA 3Q7VB 5FQIA 2ZQCA 4O7DA 3GMWA 3IXBA 4Y0OA 4B4ZA 1C3BA 4OPQA 1NYMA 1YLPA 1ES4A 3IHAA 4ID4A 4DRTA 1K55C 4GN2A 1I2WA 1K4FA 1BLCA 1NJ4A 3VP4A 2HP9A 4OPZA 3MZDA 3HL9A 5FDHA 3A3EA 4S2OA 1XGJA 1TVFA 4CPKA 4KZ8A 3TG9A 4KG5A 5TGFA 4PMAA 4UA6A 1KDWA 1I5QA 1MPLA 3CMZA 4C3QA 3FYZA 3GTCA 4YFMA 3ZG7B 3PBTA 3O3VA 2WGVA 1ES3A 2P74A 4L0LA 1YMXA 3IH8A 4R1GA 3W4QA 1XA7A 3ZDJA 1JTDA 4X55A 5EOEA 1Q2QA 4KG2A 4U0TA 2WAFA 4Z9QA 1MBLA 3ZVTA 3VSLA 3UPNA 1RCJA 3HUNA 3GRJA 3MKFA 3C7UA 4JXVA 3WS4A 4C75A 1W7FA 5CGWA 1EI5A 1K6SA 3IF6A 3N6IA 5CHJA 5FI6A 4BJPA 2I72A 1JVJA 3VSKA 3GQZA 3HLWA 4JXGA 1S0WA 5CRFA 4NETA 5FQQA 5HX9A 3P09A 1PIOA 4LV3A 5EVIA 4HESA 4MBFA 2JC7A 3BFFA 2P9VA 4YINA 3OPHA 1O07A 5M19A 1K57C 4BD1A 3VP3A 3HUOA 4LV2A 1JWZA 2XDMA 1YQSA 4OQ0A 3P98A 3V3RA 2WGIA 3IWOA 3Q81A 4JLFA 2Y2IA 4RA7A 5BOHA 1VQQA 1KGFA 1SDNA 4GD6A 1QMFA 3V5MA 5JYOA 2ZC5B 4OKPA 3HVFA 4JF5A 1HVBA 5CGXA 4M3KA 5HARA 1IYQA 3M2KA 3FZCA 1Q2PA 1MXOA 3MXSA 4LCLA 1MY8A 3UNWA 2R9XA 3Q07A 3BYDA 4DE2A 3BFCA 2Y2HA 1NRFA 2X01A 1RP5A 4K0WA 4ZJ1A 5DF8A 5CHMA 4BL3A 1LHYA 4S2NA 3MZFA 3IWQA 5AQAA 3DWKA 4OVDA 1LL5A 4MLLA 1MKIA 3ZG5A 4WZ5A 2WKEA 3WS1A 3S22A 1PWCA 1GHMA 1GHIA 4QJGA 4E3OA 2BLSA 2OLVA 3O88A
chains in the Genus database with same CATH superfamily
4OQIA 3S7QA 4O01A 4Y7PA 2PAVP 3RJUA 1G6OA 2PBDP 2V8CA 1VB6A 2RL3A 2Z2MB 4Y3IA 4BLMA 1E3UD 2VV8A 1MWRA 1BZAA 3TJZC 2ZQ9A 3DWZA 1BLHA 3GSGA 1K0KA 4Y2FA 4KENB 2P04A 1S67L 1D7EA 3BY9A 2L1MA 1CJFA 3LR5A 2Z6CA 5AQ7A 4PPRA 2WYXA 1E4DA 5DF9A 2ZC7A 1FOFA 1ES2A 3WRZA 5DTTA 3AGDA 4FH4A 1DJBA 1YAXA 4FOFA 3AGEA 2XR0A 2AVXA 4EU0A 1K56D 4WUJA 3B33A 1GCEA 1K54A 5A8BA 2LB9A 3VE4A 2GDNA 3IS2B 3IX3A 1F5MA 1OJ5A 4UQIM 5GHZA 3FC7A 2XRNA 1KVLA 3ZHHA 2WZZA 1E3UA 2A24A 4S2MA 2W3EA 2WZXA 1SKFA 5HZHA 1JWPA 1PWGA 3E4PA 2XD1A 4BD0A 2VGKA 4L9GA 1OTDA 2UV0E 4WZ4A 3D9YA 3PBSA 3A3JA 5FAOA 3ZYTA 1KVMA 3L7HA 5EPHA 4HNBA 2W3DA 4LFUA 2ZL1B 5L10A 1P9WA 3QP8A 2VEAA 3MJQA 1CQAA 4QB8A 3T4SA 4JGQA 3VP0A 4K08A 3LR0A 1TEMA 1KE3A 3OPPA 2Y2GA 4UA9A 4P85A 1K56A 5FQJA 4IBRA 4R3AA 3UDFA 3TRCA 1YKDA 1DJCA 2Y55A 2J7VA 1XA1A 3CG5A 3IXGA 1OTIA 5EOOA 4ARZA 5CHUA 3CITA 1FR6A 5E2GA 2HZ5A 1SDEA 5FL3A 1F2KA 3ITBA 2OOLA 3H82B 4B9OA 4JXSA 5J8XA 2FH5A 5GLBA 2XA7M 2JKFA 2Y2JA 4DJ3A 4R38A 1KE4A 1OTBA 2E8IA 3N8LA 2M7VA 3SS4A 2G2WA 4E6XA 3LGOA 5DF7A 5EUAA 4QY5A 3VP1A 4DDSA 4Z1WA 3CZDA 5EM1A 4E3JA 4NG2A 4P6BA 1XJ3A 5KIZA 4EBLA 4PHTA 1HZOA 1Z6FA 2IWCA 3QP1A 1BUEA 4A5RA 1L0FA 1YM1A 3MBZA 4IVKA 2E8JA 4KZAA 4PM7A 4O8GA 3F1PB 2VKSA 4EWFA 3A0VA 3IXDA 1ZKJA 5F83A 4K91A 2V1ZA 2GNXA 1W79A 3WS5A 3DTIA 4LRYC 3T4LA 2PHYA 3HJKA 3LO7A 4Q0IA 3VOYA 2XLNA 4YWZA 4BMWA 3CUEA 3R4KA 2XQZA 4EBNA 2OV5A 3G30A 4OOYA 2VGLM 2EX2A 3G2YA 4HHDA 4X53A 1K4EA 5FDSA 1TS6A 2WUQA 1YLYA 4EEPA 4QD4A 2Y4AA 1W63M 5HWWA 1BSGA 3UMDA 5DKKA 2ZQ8A 3HUMA 3MQQA 4I3AA 4WYYA 2Y2OA 1M40A 2OLUA 3OZHA 1CEFA 4NK3A 4L9FA 5KZHA 5EECA 1NY0A 3NY4A 1ONGA 1SZVA 4HIAA 3E4QA 1PRQA 1BLSA 2PDRA 3W4OA 3NDGA 2DRWA 5F1FA 4R3BA 5HPIA 5DFXA 4OOMA 2ZM8A 3BM6A 4CLCA 3P7NA 1IFQA 5J4EA 1IEMA 3G34A 3UPPA 4HP4A 1XXMA 3IWIA 3A0SA 4HY8A 5AQBA 1ES5A 3DW0A 1CI8A 1S66L 3PBOA 3WS0A 2V0UA 3S1YA 3UO9A 3UY6A 5M18A 4R4SA 3IX4A 1J9MA 5CXWA 5FASA 2JKRM 1OT6A 4WEKA 1IYSA 4WZ5C 3BRMA 4KZ5A 3UB8A 3IXBA 4B4ZA 3KSHA 2A24B 1DP8A 4GN2A 1K4FA 3VP4A 1DRMA 4ETXA 4XT2A 1ODVA 3MZDA 1XGJA 1GSVA 4PMAA 4II7A 2OAP1 1MPLA 3CMZA 2WKPA 1D06A 4E04A 5LBRA 3PBTA 2WGVA 1ES3A 5DJUA 2J80A 3IH8A 4HH3A 4X55A 3UB9A 1LSXA 3GRJA 2NUTC 3C7UA 4JXVA 3FPWA 1W7FA 4QPRA 2V1BA 3N6IA 3EEHA 3QP2A 2I72A 3T4JA 5L09A 5HX9A 3P09A 4LV3A 2V8FA 3CWFA 3W2ZA 2QYBA 3KYEA 4YINA 3OPHA 5DFYA 4ARZB 4LV2A 1JWZA 3V3RA 2WGIA 4GW9A 3IWOA 5I5LA 3ULFA 1NLZA 3LYXA 1KGFA 1SDNA 4GD6A 3V5MA 3F1OA 3V67A 3VOLA 1HVBA 5HARA 3H9WA 3UB6A 1MY8A 4BBUA 3K3CA 3Q07A 4DE2A 3BFCA 2FZ0A 3IBRA 2HF6A 3IWQA 3ZG5A 3O88A 3T4KA 2Q9MA 3T4QA 5FAPA 3G2ZA 4G3KA 3VE3A 3MMHA 3IT9A 4YOFA 4ZAMA 1NZUA 3FKVA 4GHIB 2Y8HA 4BQMA 3MQ0A 3NCKA 2LB5A 2QMIA 3BEBA 3H82A 3UE3A 3FKWA 2HV1A 5GHYA 2Y59A 4PKYG 4IBXA 1WE4A 2J9OA 1EROA 3ZVWA 2V1AA 1ALQA 2J3WA 1W5DA 1K25A 3SH7A 4OP5A 1UGUA 4X69A 5FEGA 3BJNA 3N4IA 4LCMA 3HLCA 3UPOA 4IUHA 1KGGA 3G31A 3OOVA 2H0TA 3OC2A 5K5BA 3B47A 3M6HA 1L2SA 2FFFB 5F5YA 5HWTA 5J7EA 3KSGA 3F1NA 4I39A 3PTEA 4Y15A 3Q7VA 5F1GA 2EX9A 3HBRA 1HD8A 4DE1A 2HDSA 3A3IA 4N9KA 3T1QB 4I5SA 2QJ7A 1DP9A 3QP4A 2QPNA 2B95A 1ESIA 3UDXA 3G35A 4GS9B 4CJNA 1FQGA 1TDGA 3EOIA 1IELA 4QU3A 3GDIA 3R7WA 2RCXA 5TFQA 4PAUA 4MCWA 3SH8A 3UE1A 1S4SA 2BTFP 2DCFA 2V20A 2WAEA 5CECA 1UWPX 2J8YA 3IBJA 4X6TA 3B42A 3NHQA 1PYYA 1ZG6A 1RGYA 3IQAA 4CLCB 3T4OA 4OLDA 3PAEA 4GNUA 3D4FA 1MKMA 2X02A 1IYPA 2VA0A 3CUEC 4GKUA 2ZM2A 4U0XA 2ZLYA 5A90A 4GZBA 2OWHA 2ZQAA 2XK1A 1L0EA 3ICYA 3KO6A 4GD8A 5KSHA 3LEZA 2H5SA 2O0YA 1XFNA 4L9EA 1TF1A 1T19A 2XEPA 3LR3A 4PM8A 1PI5A 4N1XA 3FG8A 4WMCD 3UDIA 3DBAA 2R78A 3C4PA 4XT2B 1ESUA 3LFVA 3BLMA 1GHPA 4ZDXA 1G6AA 1LLBA 2EXAA 1FILA 2VK3A 3JYIA 4GOGA 5HW3A 3WS2A 2WGWB 4F3LA 4F94A 4Q0JA 2ZMAA 1FSYA 4DE3A 3H7WA 3TW8A 3ZG8B 4CLCC 5GHXA 3MQOA 3ZGAB 5AVFA 5CEDA 1TDLA 5FI7A 1MZUA 2ZC4B 3PBNA 4LLOB 1AXBA 4UQIS 3C5AA 4KQOA 4B4XA 1YLJA 4EXOA 2HDUA 2YKFA 2P7JA 5DJTA 4JKTA 3HLDA 2DNSA 3Q1FA 4MN5A 4DMZA 2Y91A 4N1HA 3VFFA 1NRJA 4OQHA 1VETA 4MBHA 3F1OB 1ZC2A 5E2EA 5HDCA 1VEUA 3OPLA 3PAGA 1V9YA 4QWOA 4KQQA 4K0XA 4WMCA 2XROA 4JPMA 3OPRA 5FQKA 5FI2A 4HI4A 2PYPA 4Y0UA 1IKIA 4OP8A 2WADA 3RFBA 1A0KA 4GCZA 3LI9A 4WBGA 3V50A 1F9IA 4HP9A 4N92A 1HLUP 1P97A 1IKGA 4LENA 1BT5A 3EEAA 4R70A 4NXEA 5HL1A 1N9NA 4FSFA 1M6KA 5CERA 2DMWA 4ESPA 2HDRA 2YKHA 3N8RA 1KOUA 5FEFA 3AGFA 3IH9A 4WELA 4EBPA 3EGXC 5G18A 4N9LA 2V9AA 4IVIA 1DY6A 3BFDA 2QWSA 2XA7S 4ZJ2A 5G4ZA 2XH9A 2VV7A 1H3QA 1PZOA 1NYYA 4C6YA 1G5UA 1ZTUA 4NXGA 4KZ3A 1PI4A 3OCLA 1AWIA 4KUOA 1L0GA 4GHIA 3UN7A 4S2KA 5DVAA 3WRTA 4R4RA 2JKGA 2VV6A 1BLPA 4ZBEA 4H6JA 1H8YA 3NBLA 3F1NB 1RGZA 3Q7VB 1VHMA 2WKQA 1C3BA 1NYMA 2NUPC 3EGDC 2MJ6A 3HL9A 4YNRA 5J3WA 3PXPA 4KZ8A 3S7PA 3TG9A 1OTEA 5TGFA 1L3LA 1KDWA 1I5QA 3LIEA 5IU1A 2O9BA 4CLCD 3R7WB 4YFMA 3ZG7B 4R1GA 3W4QA 1IOUA 3MSHA 2KLIA 4Z9QA 3ZVTA 1RCJA 3T50A 1GSWA 3CPTA 3LIDA 2VGLS 3VSKA 3GQZA 5L8MA 5FQQA 4NETA 1PIOA 4HESA 4MBFA 2JC7A 1T1BA 1D1JA 1O07A 5M19A 3VP3A 3LIBA 4GS9A 3E4OA 5DKLA 2ZMFA 3Q81A 4ZRRA 2QKPA 2QJ5A 4EETB 2QHKA 2ZC5B 2W3FA 4M3KA 1MXOA 3U2AA 3NOTC 3MXSA 3UNWA 2R9XA 2Y2HA 2PT7A 4ZJ1A 5CHMA 4BL3A 4WN5A 4ME4A 3MZFA 1LL5A 4MLLA 1MKIA 3WS1A 3S22A 1GHMA 4QJGA 2BLSA 3NI9A 3NOPC 2PBYA 1STZA 1H8ZA 2EFXA 2XFTA 2Z6DA 4CLCE 5FA7A 1CI9A 5F69A 4KQDA 1HTZA 1S6RA 1WYCA 3BLSA 2QZ6A 2J3TC 3SS3A 3GECA 4F3LB 2PU4A 2M1CA 3H7WB 3Q82A 4KG6A 2G2UA 5FATA 1K6RA 3ZCZA 3DAVA 3O87A 4OH0A 4ETZA 1S4RA 4G3WA 4OOLA 2PR5A 2GJ3A 2GX5A 4CQHA 2V0WA 4B88A 1N4OA 3QHYA 2WKHA 1FCNA 2XFSA 4LV1A 3LEQA 4S2LA 3NDEA 4HEFA 3RH8B 5EVEA 1K57A 2HJ9C 4P87A 2HDQA 5A92A 3QNBA 1PW1A 1OT9A 1VETB 2ZC3B 3EQVA 4LGWA 1JWVA 1VEUB 2WGWA 2EX6A 4X68A 2PD7A 2V2FF 3W4PA 2R9WA 1T1AA 5AJGA 3IF6B 3BQAA 2JCHA 2L4RA 5EVIB 3RXWA 4FCFA 4KZ4A 4P6ZM 5MC7A 1YLTA 3U4LP 4LRXC 4WLAA 5U47A 1FSWA 5FAQA 5CEBA 4R23A 5G4YA 2W3GA 3ZG0A 3S7NA 3JPUA 2PYRA 4PKYA 4E3KA 3UE6A 3T1SA 5KSCA 3S4XA 4H8RA 3G6OA 5HFOA 3DTEA 3NULA 4HBUA 4NXFA 5C5KA 2Y2PA 3O86A 2G7UA 5HAIA 2Y2MA 4S2JA 1YT4A 3KYZA 3MF0A 2OAQ1 3GV9A 2PD8A 2KOIA 3A3FA 3N7WA 1IYOA 1I2SA 4OONA 4DDYA 4BBVA 5I94A 5GL9A 3VV4A 1T1CA 3RTYA 3CLOA 4WEJA 3BFGA 5A93A 5EM0A 1EW0A 4JBFA 2J9PA 3UB7A 3ZFZA 3LY4A 5E43A 3IF6C 4MBKA 4H6JB 2WKRA 5EVIC 4EQIA 5CTNA 1TS8A 1XGIA 3C38A 4HJ3A 1G68A 3D3OA 3MKEA 1OTAA 3VOZA 1XFQA 3DTKA 4KZBA 3I7JA 2W27A 2X71A 2VLGA 4RX3A 2VX8A 2Q9NA 4BBTA 3VMAA 3WWXA 1SKOB 4IJGA 3NC8A 4E6WA 2J3TD 1S1YA 2ZQ7A 3TSGA 1WYBA 1L0DA 4RVAA 2B5RA 4M4XA 5EFWA 4S2NC 3SOIA 1YSQA 4ZTKA 4X25A 1CEGA 5A91A 3C4OA 1NWZA 3OLOA 2CC1A 4QY6A 3HLEA 4DJ2A 2Y79A 4MN7A 4FH2A 5L2FA 5TBMA 1X0OA 4UHUA 4GJ4A 1PFLA 3TE8A 1TS7A 1U60A 3BWLA 3CPTB 3QP6A 4R3JA 1YMSA 4P0MA 1XP4A 3SS5A 2VZWA 1W8QA 2KDKA 3D72A 3FPVA 3L9KA 1LT0A 1H0MA 3BECA 1N9BA 3ISGA 2Y2KA 1XJ2A 2PR6A 5HAPA 3V3SA 4PM6A 1MWSA 3IHBA 4DKIA 2OSUA 2W3HA 3GR2A 5IHVA 4UEYA 2B02A 3W8KA 3K3DA 2OWJA 4WF0A 3RXXA 1JTGA 1MWUA 3CJMA 1N9LA 3QNCA 3KX0X 4XUXA 1V9ZA 5HD5A 2I9VA 3A3DA 2KX6A 4BENA 1UWNX 4X1MA 3V39A 3PBQA 1O7EA 4X56A 1YSPA 2H28A 3SZTA 5HAQA 1FCOA 2W1RA 1KDSA 1XKZA 3P01A 1XPBA 4R0QA 3S7OA 2JN7A 2IWBA 4X1LA 2XD5A 1NLYA 1OPXA 3C8CA 3IF5A 2ZOHA 5AVEA 2UWXA 2P08A 1MWTA 3EQUA 5EVID 5F82A 4KZ9A 3EWKA 3OCNA 3HREA 3M2JA 4WL9A 3G4PA 5GLAA 2XSSA 1YLZA 2XGNA 3FV7A 5FQIA 4O7DA 3GMWA 4Y0OA 1YLPA 4ID4A 1BLCA 2HP9A 5HD3A 5FDHA 4S2OA 1TVFA 4CPKA 2O9AA 4UA6A 4LPZA 3GTCA 4GLQA 2D02A 5CX7A 5EV0A 2P74A 4L0LA 1YMXA 1XA7A 4JGOA 5EOEA 2WAFA 2GZAA 3UPNA 3MKFA 4C75A 1K6SA 3IF6A 4BJPA 1N9OA 1JVJA 3HLWA 1S0WA 4MMNA 5EVIA 3BFFA 2P9VA 1K57C 5F6AA 4BD1A 4Y17A 2XDMA 3P98A 4I3IA 2Y2IA 5BOHA 3UMEA 1VQQA 2HJEA 5JYOA 3JVVA 4OKPA 4KUKA 3HVFA 4JF5A 2INWA 3M2KA 3FZCA 1Q2PA 4JGRA 4AFIA 3ZQ5A 5HSQA 1NRFA 1RP5A 4K0WA 3LIFA 1LHYA 4S2NA 4IHQA 2Q0OA 2K31A 2WKEA 3T1XA 1PWCA 4HJ4A 5F68A 2OLVA 3NECA 1GA0A 1W8YA 5HDDA 3C30A 3M6BA 4D2OA 2A49A 3HLBA 3SW1A 1K55A 4EESA 2CMNA 3MXQA 3OBFA 1BTLA 2Z2LB 1DJAA 2M7UA 5HPFA 1H8MA 1MC0A 1XJ6A 5EVLA 5KMWA 4DF6A 1ACFA 1XX2A 4EUVA 5IT5A 1ERMA 1OMEA 5TBMB 4U3TA 1Z09A 3LCEA 3B3XA 3ITAA 4B93A 4S2IA 4PM5A 1SKOA 2L0WA 4ZJ3A 3QP5A 3UE0A 2JKTI 3JVUA 5E2HA 4LV0A 3CI6A 3HLGA 3IXHA 4KQRA 4EERA 1YPRA 5IS1A 3C7VA 3MFXA 4FTXA 2W0NA 1LI0A 2HGVA 4IUKA 4DN0A 5TR7A 3HLFA 5DTKA 1LL9A 2JKTM 4FUWA 4QHCA 4Q0HA 5AQ9A 4XXRA 2D01A 3ZNYA 2K7SA 4BL2A 2H10A 5CTMA 1W63Q 1KGEA 4S2PA 2W1TA 2ZBBA 3DTMA 2ZC6B 4IEDA 4Y0TA 4HQAA 3E2LA 4OPYA 4NKPA 3ZNTA 3PR6A 2ZM0A 3Q7ZA 4I38A 3T12B 4D60A 3SH9A 2ZQDA 1TD5A 1CK3A 3KYQA 4KZ6A 4DE0A 4RX2A 1Y28A 2VGJA 4MN6A 2PRFA 4HOIA 4MNRA 5FQMA 4EW7A 3LR4A 3BFEA 2C5WB 1J3WA 1PWDA 4DXBA 4GB7A 4PM9A 5JYPA 3CAXA 1FR1A 4BWIA 1E25A 3FWLA 4HH2A 3BQ8A 3ZG9B 2Y2NA 2FFYA 4RYEA 3N8SA 4Q8IA 1T18A 2JE5A 3A0RA 4HJ6A 2JHEA 3PBRA 3KSIA 4JGPA 4DXCA 1ZHHB 3CHWP 4I3JA 1SCWA 2JKRI 2WK0A 3E2KA 2BG1A 2WKIA 3BW6A 1NZOA 2XF3A 5TJJA 3NJAA 1XJ4A 3MZEA 4XUZA 3MFDA 5FQ9A 2ACGA 2HP6A 3MR0A 1P9RA 2VJWA 2JBFA 3G32A 2PU2A 2EWWA 1FIKA 1ZG4A 5CGSA 2ZJ9A 4JXWA 3BY8A 4KZ7A 3IX8A 1SHVA 4UA7A 3E0YA 4EQ1A 2ZOIA 1H5XA 1LSVA 2BASA 2ZD8A 3VP2A 4OPRA 4NXBA 2P9VB 3E98A 2IWDA 1GSXA 4P6ZS 5HDSA 2O99A 3TOIA 3IS2A 5EE8A 1PZPA 3NIAA 4MEZA 1NXYA 4G3VA 2A3UA 4E3LA 2C6WB 3LI8A 4WM9A 1LI9A 5M1AA 2EFUA 2K2NA 2Y2LA 1K38A 1LL8A 2EX8A 3PYPA 4EEUA 1K54C 4FD8A 4EV4A 4UAAA 5D3OA 5DTSA 3VFHA 4NEED 2EA9A 2Y2QA 1EWZA 4OLGA 4GDNA 4JF4A 2A2LA 2IA2A 1VM1A 3HCYA 2ZL1A 2H0YA 1FCMA 5GLDA 3KSFA 5E2FA 4Y13A 1GA9A 5HWVA 2HPBA 1OJGA 4HBTA 4E3MA 1BULA 4GDBA 2EXBA 2HP5A 5FSRA 1WA9A 4OQGA 4RQ9A 5GLCA 1LSWA 3PHYA 3K2NA 3LUQA 1KE0A 1PW8A 1Y54A 3O5YA 4EUZA 4JF6A 1ERQA 3GVBA 1YLWA 4E3IA 1G28A 1ONHA 5HL6A 3LY3A 2B18A 4E3NA 3MXRA 3C2WA 1QMEA 3MS6A 2O9CA 2ZQCA 3LIAA 4OPQA 1ES4A 3IHAA 4DRTA 1K55C 2ZMVA 1I2WA 1NJ4A 1DP6A 4OPZA 3T4TA 3A3EA 3NOUC 2W1TB 4KG5A 3HJIA 4C3QA 3FYZA 1JNUA 1BYWA 3O3VA 5L07A 1JTDA 1Q2QA 4KG2A 1PNEA 4U0TA 1MBLA 3VSLA 3F1PA 3HUNA 4LRZE 3T1RA 3WS4A 5CGWA 1EI5A 5CHJA 5FI6A 4JXGA 5CRFA 4Y5FA 4R6LA 3HUOA 1CF0A 1YQSA 4OQ0A 4JLFA 4RA7A 1P0ZA 4MDZA 1QMFA 5CGXA 1Y4OA 1IYQA 2EWVA 3UB5P 1TS0A 1S1ZA 4LCLA 3BYDA 1F98A 2X01A 3LICA 5DF8A 4O0PA 5AQAA 3DWKA 4OVDA 4WZ5A 1GHIA 4E3OA 3ZDJA
chains in the Genus database with same CATH topology
2PBYA 2Q9MA 1GA0A 4OQIA 5FAPA 1H8ZA 1W8YA 3G2ZA 3M6BA 4Y7PA 4D2OA 2EFXA 2XFTA 2A49A 3HLBA 3RJUA 3IT9A 5FA7A 4ZAMA 1CI9A 1K55A 1NZUA 2RL3A 2Z2MB 4BLMA 1E3UD 3FKVA 1BTLA 2Z2LB 1MWRA 1BZAA 1DJAA 4BQMA 3NCKA 1HTZA 2QMIA 3BEBA 3UE3A 1S6RA 3FKWA 5EVLA 1WYCA 3BLSA 2QZ6A 2ZQ9A 5GHYA 5KMWA 3DWZA 1BLHA 3GSGA 3SS3A 2PU4A 2Y59A 4KENB 4IBXA 4DF6A 1WE4A 1XX2A 2J9OA 1EROA 3Q82A 4KG6A 3ZVWA 2G2UA 5FATA 1K6RA 5AQ7A 4PPRA 3ZCZA 1ERMA 1E4DA 2WYXA 3O87A 1OMEA 1ALQA 5DF9A 4OH0A 4U3TA 2ZC7A 1FOFA 1ES2A 3WRZA 5DTTA 3LCEA 3AGDA 4FH4A 4OOLA 3B3XA 3ITAA 1DJBA 1W5DA 1K25A 3SH7A 4OP5A 3AGEA 2XR0A 4X69A 4S2IA 4PM5A 4B88A 3N4IA 1N4OA 4LCMA 3QHYA 3HLCA 1K56D 2WKHA 1FCNA 2XFSA 4LV1A 4S2LA 4ZJ3A 3UPOA 3NDEA 4HEFA 1GCEA 1KGGA 1K54A 3G31A 1K57A 3UE0A 4P87A 2HDQA 2H0TA 5A92A 3OC2A 3QNBA 1PW1A 5E2HA 2GDNA 4LV0A 2ZC3B 3EQVA 1JWVA 3M6HA 1L2SA 2FFFB 2WGWA 3HLGA 3IXHA 2EX6A 4X68A 3PTEA 4KQRA 5GHZA 3Q7VA 5F1GA 3C7VA 1KVLA 2EX9A 2WZZA 1LI0A 3ZHHA 3HBRA 2V2FF 3W4PA 1HD8A 2R9WA 5TR7A 4DE1A 2HDSA 3A3IA 3HLFA 1E3UA 3IF6B 4N9KA 1LL9A 4S2MA 5DTKA 2JCHA 2WZXA 4QHCA 1SKFA 5AQ9A 4XXRA 5EVIB 1JWPA 3RXWA 4FCFA 1PWGA 3ZNYA 4BL2A 4KZ4A 2H10A 5CTMA 1KGEA 4S2PA 2QPNA 1YLTA 2XD1A 4BD0A 1ESIA 2VGKA 3DTMA 3UDXA 3G35A 2ZC6B 4WZ4A 4IEDA 4CJNA 4Y0TA 3PBSA 3E2LA 1FQGA 1TDGA 3A3JA 5FAOA 4OPYA 5U47A 1IELA 1KVMA 5EPHA 1FSWA 4QU3A 5FAQA 5CEBA 4R23A 2RCXA 5TFQA 3ZNTA 3ZG0A 3SH8A 2ZM0A 3UE1A 3Q7ZA 2WAEA 2DCFA 2V20A 4QB8A 5CECA 2J8YA 4E3KA 3VP0A 4X6TA 5KSCA 3S4XA 3SH9A 4H8RA 1TEMA 5HFOA 2ZQDA 1KE3A 3OPPA 2Y2GA 4HBUA 4UA9A 4P85A 1PYYA 1K56A 5FQJA 4IBRA 1ZG6A 2Y2PA 1CK3A 3O86A 4KZ6A 4DE0A 5HAIA 1RGYA 3IQAA 3UDFA 4RX2A 2Y2MA 4OLDA 2Y55A 1DJCA 3PAEA 2VGJA 2J7VA 1XA1A 4GNUA 4MNRA 3D4FA 4S2JA 1YT4A 3CG5A 3IXGA 5FQMA 5EOOA 5CHUA 2X02A 3GV9A 3BFEA 3A3FA 1IYPA 1FR6A 2C5WB 3N7WA 1IYOA 5E2GA 1PWDA 4DXBA 1I2SA 1SDEA 4GB7A 4OONA 4DDYA 4PM9A 4GKUA 3ITBA 5JYPA 2ZM2A 4JXSA 5I94A 1FR1A 5GL9A 5J8XA 1E25A 4U0XA 2ZLYA 5A90A 4WEJA 3FWLA 3BFGA 3ZG9B 5A93A 2Y2NA 2FFYA 5GLBA 4JBFA 4RYEA 4GZBA 2J9PA 3N8SA 3ZFZA 4Q8IA 3LY4A 2ZQAA 5E43A 2JE5A 3IF6C 2XK1A 3PBRA 2Y2JA 1L0EA 4MBKA 4DXCA 5EVIC 1KE4A 4EQIA 5CTNA 1XGIA 4GD8A 1G68A 5KSHA 3MKEA 2E8IA 3LEZA 2H5SA 3N8LA 3VOZA 3SS4A 4KZBA 3I7JA 2XEPA 2G2WA 4E6XA 1SCWA 2X71A 4PM8A 2WK0A 4QY5A 5DF7A 5EUAA 3VP1A 1PI5A 4RX3A 4DDSA 2Q9NA 3VMAA 3WWXA 3E2KA 2BG1A 2WKIA 4N1XA 3CZDA 4WMCD 3UDIA 1NZOA 3C4PA 4E3JA 2XF3A 4P6BA 1ESUA 3MZEA 3BLMA 4XUZA 1GHPA 3MFDA 3NC8A 4E6WA 4ZDXA 4EBLA 1G6AA 1LLBA 2EXAA 2ZQ7A 3TSGA 1HZOA 1Z6FA 1WYBA 2IWCA 1L0DA 5FQ9A 1BUEA 3JYIA 4RVAA 2B5RA 2HP6A 4GOGA 5HW3A 4A5RA 1L0FA 2JBFA 4S2NC 3WS2A 3SOIA 3G32A 1YM1A 2WGWB 3MBZA 4IVKA 4ZTKA 2PU2A 4F94A 1CEGA 2ZMAA 1FSYA 4DE3A 1ZG4A 3C4OA 5A91A 3ZG8B 2CC1A 4KZAA 4QY6A 5CGSA 5GHXA 3HLEA 2ZJ9A 4PM7A 4FH2A 4JXWA 5L2FA 3ZGAB 4UHUA 4KZ7A 5CEDA 4EWFA 1TDLA 5FI7A 3IXDA 1ZKJA 5F83A 1SHVA 4K91A 4UA7A 1U60A 2V1ZA 2ZC4B 3PBNA 1AXBA 1H5XA 2ZD8A 4R3JA 1W79A 3C5AA 1YMSA 4KQOA 3VP2A 4OPRA 4P0MA 3WS5A 1YLJA 4B4XA 1XP4A 3SS5A 2HDUA 2P9VB 1W8QA 3LO7A 4JKTA 3HLDA 2IWDA 2DNSA 3Q1FA 3VOYA 2Y91A 2XLNA 3BECA 1N9BA 4N1HA 3ISGA 3VFFA 2Y2KA 4OQHA 3TOIA 4MBHA 5EE8A 4EBNA 2XQZA 1PZPA 2OV5A 1ZC2A 3G30A 3NIAA 5E2EA 3OPLA 3PAGA 4MEZA 4OOYA 1NXYA 2A3UA 4E3LA 2C6WB 2EX2A 5HAPA 4KQQA 3V3SA 4K0XA 4PM6A 4WMCA 4JPMA 3OPRA 1MWSA 3IHBA 3G2YA 2OSUA 3GR2A 5FQKA 4DKIA 4WM9A 5IHVA 1LI9A 4X53A 5FI2A 3W8KA 1K4EA 5M1AA 2EFUA 2Y2LA 2WUQA 4Y0UA 1IKIA 1K38A 4OP8A 1YLYA 3RXXA 1JTGA 2EX8A 1MWUA 3CJMA 2WADA 1K54C 3QNCA 4QD4A 4XUXA 4FD8A 4EV4A 4UAAA 5D3OA 5DTSA 2Y4AA 3A3DA 3VFHA 1BSGA 2ZQ8A 2Y2QA 3HUMA 4WBGA 4BENA 3V50A 1EWZA 4N92A 4OLGA 4GDNA 4JF4A 4WYYA 2Y2OA 1M40A 1VM1A 2OLUA 1IKGA 1O7EA 3OZHA 3PBQA 3V39A 4LENA 1BT5A 1CEFA 4NK3A 5KZHA 4X56A 5EECA 5HL1A 1NY0A 4FSFA 3NY4A 5HAQA 1M6KA 5CERA 2H0YA 2HDRA 1ONGA 1FCMA 3N8RA 3AGFA 3IH9A 1FCOA 5GLDA 4WELA 4EBPA 5E2FA 5G18A 4N9LA 1GA9A 1BLSA 1KDSA 3W4OA 1XKZA 1XPBA 3NDGA 2DRWA 3NI9A 1DY6A 4IVIA 4R3BA 2HPBA 5F1FA 3BFDA 4R0QA 4OOMA 4HBTA 2ZM8A 3BM6A 4ZJ2A 4E3MA 2XH9A 1IEMA 2IWBA 3G34A 3UPPA 1BULA 4GDBA 2EXBA 1PZOA 1NYYA 2HP5A 2XD5A 4C6YA 1XXMA 3IWIA 5FSRA 3IF5A 4OQGA 5GLCA 4KZ3A 1PI4A 5AQBA 1ES5A 3OCLA 3DW0A 1CI8A 1KE0A 2UWXA 1PW8A 3PBOA 1L0GA 3UN7A 3WS0A 1Y54A 1MWTA 3EQUA 4S2KA 3S1YA 3UO9A 5DVAA 5EVID 5F82A 3UY6A 3WRTA 4EUZA 4R4RA 4JF6A 1ERQA 5M18A 3GVBA 1YLWA 4KZ9A 4R4SA 4E3IA 1ONHA 3OCNA 1J9MA 1BLPA 5CXWA 4ZBEA 5FASA 3HREA 3M2JA 1H8YA 3LY3A 3G4PA 3NBLA 4WEKA 5GLAA 1YLZA 1IYSA 2XGNA 3MXRA 4E3NA 4WZ5C 3BRMA 3FV7A 1QMEA 4KZ5A 1RGZA 3Q7VB 5FQIA 2ZQCA 4O7DA 3GMWA 3IXBA 4Y0OA 4B4ZA 1C3BA 4OPQA 1NYMA 1YLPA 1ES4A 3IHAA 4ID4A 4DRTA 1K55C 4GN2A 1I2WA 1K4FA 1BLCA 1NJ4A 3VP4A 2HP9A 4OPZA 3MZDA 3HL9A 5FDHA 3A3EA 4S2OA 1XGJA 1TVFA 4CPKA 4KZ8A 3TG9A 4KG5A 5TGFA 4PMAA 4UA6A 1KDWA 1I5QA 1MPLA 3CMZA 4C3QA 3FYZA 3GTCA 4YFMA 3ZG7B 3PBTA 3O3VA 2WGVA 1ES3A 2P74A 4L0LA 1YMXA 3IH8A 4R1GA 3W4QA 1XA7A 3ZDJA 1JTDA 4X55A 5EOEA 1Q2QA 4KG2A 4U0TA 2WAFA 4Z9QA 1MBLA 3ZVTA 3VSLA 3UPNA 1RCJA 3HUNA 3GRJA 3MKFA 3C7UA 4JXVA 3WS4A 4C75A 1W7FA 5CGWA 1EI5A 1K6SA 3IF6A 3N6IA 5CHJA 5FI6A 4BJPA 2I72A 1JVJA 3VSKA 3GQZA 3HLWA 4JXGA 1S0WA 5CRFA 4NETA 5FQQA 5HX9A 3P09A 1PIOA 4LV3A 5EVIA 4HESA 4MBFA 2JC7A 3BFFA 2P9VA 4YINA 3OPHA 1O07A 5M19A 1K57C 4BD1A 3VP3A 3HUOA 4LV2A 1JWZA 2XDMA 1YQSA 4OQ0A 3P98A 3V3RA 2WGIA 3IWOA 3Q81A 4JLFA 2Y2IA 4RA7A 5BOHA 1VQQA 1KGFA 1SDNA 4GD6A 1QMFA 3V5MA 5JYOA 2ZC5B 4OKPA 3HVFA 4JF5A 1HVBA 5CGXA 4M3KA 5HARA 1IYQA 3M2KA 3FZCA 1Q2PA 1MXOA 3MXSA 4LCLA 1MY8A 3UNWA 2R9XA 3Q07A 3BYDA 4DE2A 3BFCA 2Y2HA 1NRFA 2X01A 1RP5A 4K0WA 4ZJ1A 5DF8A 5CHMA 4BL3A 1LHYA 4S2NA 3MZFA 3IWQA 5AQAA 3DWKA 4OVDA 1LL5A 4MLLA 1MKIA 3ZG5A 4WZ5A 2WKEA 3WS1A 3S22A 1PWCA 1GHMA 1GHIA 4QJGA 4E3OA 2BLSA 2OLVA 3O88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBY A;  2Q9M A;  1GA0 A;  4OQI A;  5FAP A;  1H8Z A;  1W8Y A;  3G2Z A;  3M6B A;  4Y7P A;  4D2O A;  2EFX A;  2XFT A;  2A49 A;  3HLB A;  3RJU A;  3IT9 A;  5FA7 A;  4ZAM A;  1CI9 A;  1K55 A;  1NZU A;  2RL3 A;  2Z2M B;  4BLM A;  1E3U D;  3FKV A;  1BTL A;  2Z2L B;  1MWR A;  1BZA A;  1DJA A;  4BQM A;  3NCK A;  1HTZ A;  2QMI A;  3BEB A;  3UE3 A;  1S6R A;  3FKW A;  5EVL A;  1WYC A;  3BLS A;  2QZ6 A;  2ZQ9 A;  5GHY A;  5KMW A;  3DWZ A;  1BLH A;  3GSG A;  3SS3 A;  2PU4 A;  2Y59 A;  4KEN B;  4IBX A;  4DF6 A;  1WE4 A;  1XX2 A;  2J9O A;  1ERO A;  3Q82 A;  4KG6 A;  3ZVW A;  2G2U A;  5FAT A;  1K6R A;  5AQ7 A;  4PPR A;  3ZCZ A;  1ERM A;  1E4D A;  2WYX A;  3O87 A;  1OME A;  1ALQ A;  5DF9 A;  4OH0 A;  4U3T A;  2ZC7 A;  1FOF A;  1ES2 A;  3WRZ A;  5DTT A;  3LCE A;  3AGD A;  4FH4 A;  4OOL A;  3B3X A;  3ITA A;  1DJB A;  1W5D A;  1K25 A;  3SH7 A;  4OP5 A;  3AGE A;  2XR0 A;  4X69 A;  4S2I A;  4PM5 A;  4B88 A;  3N4I A;  1N4O A;  4LCM A;  3QHY A;  3HLC A;  1K56 D;  2WKH A;  1FCN A;  2XFS A;  4LV1 A;  4S2L A;  4ZJ3 A;  3UPO A;  3NDE A;  4HEF A;  1GCE A;  1KGG A;  1K54 A;  3G31 A;  1K57 A;  3UE0 A;  4P87 A;  2HDQ A;  2H0T A;  5A92 A;  3OC2 A;  3QNB A;  1PW1 A;  5E2H A;  2GDN A;  4LV0 A;  2ZC3 B;  3EQV A;  1JWV A;  3M6H A;  1L2S A;  2FFF B;  2WGW A;  3HLG A;  3IXH A;  2EX6 A;  4X68 A;  3PTE A;  4KQR A;  5GHZ A;  3Q7V A;  5F1G A;  3C7V A;  1KVL A;  2EX9 A;  2WZZ A;  1LI0 A;  3ZHH A;  3HBR A;  2V2F F;  3W4P A;  1HD8 A;  2R9W A;  5TR7 A;  4DE1 A;  2HDS A;  3A3I A;  3HLF A;  1E3U A;  3IF6 B;  4N9K A;  1LL9 A;  4S2M A;  5DTK A;  2JCH A;  2WZX A;  4QHC A;  1SKF A;  5AQ9 A;  4XXR A;  5EVI B;  1JWP A;  3RXW A;  4FCF A;  1PWG A;  3ZNY A;  4BL2 A;  4KZ4 A;  2H10 A;  5CTM A;  1KGE A;  4S2P A;  2QPN A;  1YLT A;  2XD1 A;  4BD0 A;  1ESI A;  2VGK A;  3DTM A;  3UDX A;  3G35 A;  2ZC6 B;  4WZ4 A;  4IED A;  4CJN A;  4Y0T A;  3PBS A;  3E2L A;  1FQG A;  1TDG A;  3A3J A;  5FAO A;  4OPY A;  5U47 A;  1IEL A;  1KVM A;  5EPH A;  1FSW A;  4QU3 A;  5FAQ A;  5CEB A;  4R23 A;  2RCX A;  5TFQ A;  3ZNT A;  3ZG0 A;  3SH8 A;  2ZM0 A;  3UE1 A;  3Q7Z A;  2WAE A;  2DCF A;  2V20 A;  4QB8 A;  5CEC A;  2J8Y A;  4E3K A;  3VP0 A;  4X6T A;  5KSC A;  3S4X A;  3SH9 A;  4H8R A;  1TEM A;  5HFO A;  2ZQD A;  1KE3 A;  3OPP A;  2Y2G A;  4HBU A;  4UA9 A;  4P85 A;  1PYY A;  1K56 A;  5FQJ A;  4IBR A;  1ZG6 A;  2Y2P A;  1CK3 A;  3O86 A;  4KZ6 A;  4DE0 A;  5HAI A;  1RGY A;  3IQA A;  3UDF A;  4RX2 A;  2Y2M A;  4OLD A;  2Y55 A;  1DJC A;  3PAE A;  2VGJ A;  2J7V A;  1XA1 A;  4GNU A;  4MNR A;  3D4F A;  4S2J A;  1YT4 A;  3CG5 A;  3IXG A;  5FQM A;  5EOO A;  5CHU A;  2X02 A;  3GV9 A;  3BFE A;  3A3F A;  1IYP A;  1FR6 A;  2C5W B;  3N7W A;  1IYO A;  5E2G A;  1PWD A;  4DXB A;  1I2S A;  1SDE A;  4GB7 A;  4OON A;  4DDY A;  4PM9 A;  4GKU A;  3ITB A;  5JYP A;  2ZM2 A;  4JXS A;  5I94 A;  1FR1 A;  5GL9 A;  5J8X A;  1E25 A;  4U0X A;  2ZLY A;  5A90 A;  4WEJ A;  3FWL A;  3BFG A;  3ZG9 B;  5A93 A;  2Y2N A;  2FFY A;  5GLB A;  4JBF A;  4RYE A;  4GZB A;  2J9P A;  3N8S A;  3ZFZ A;  4Q8I A;  3LY4 A;  2ZQA A;  5E43 A;  2JE5 A;  3IF6 C;  2XK1 A;  3PBR A;  2Y2J A;  1L0E A;  4MBK A;  4DXC A;  5EVI C;  1KE4 A;  4EQI A;  5CTN A;  1XGI A;  4GD8 A;  1G68 A;  5KSH A;  3MKE A;  2E8I A;  3LEZ A;  2H5S A;  3N8L A;  3VOZ A;  3SS4 A;  4KZB A;  3I7J A;  2XEP A;  2G2W A;  4E6X A;  1SCW A;  2X71 A;  4PM8 A;  2WK0 A;  4QY5 A;  5DF7 A;  5EUA A;  3VP1 A;  1PI5 A;  4RX3 A;  4DDS A;  2Q9N A;  3VMA A;  3WWX A;  3E2K A;  2BG1 A;  2WKI A;  4N1X A;  3CZD A;  4WMC D;  3UDI A;  1NZO A;  3C4P A;  4E3J A;  2XF3 A;  4P6B A;  1ESU A;  3MZE A;  3BLM A;  4XUZ A;  1GHP A;  3MFD A;  3NC8 A;  4E6W A;  4ZDX A;  4EBL A;  1G6A A;  1LLB A;  2EXA A;  2ZQ7 A;  3TSG A;  1HZO A;  1Z6F A;  1WYB A;  2IWC A;  1L0D A;  5FQ9 A;  1BUE A;  3JYI A;  4RVA A;  2B5R A;  2HP6 A;  4GOG A;  5HW3 A;  4A5R A;  1L0F A;  2JBF A;  4S2N C;  3WS2 A;  3SOI A;  3G32 A;  1YM1 A;  2WGW B;  3MBZ A;  4IVK A;  4ZTK A;  2PU2 A;  4F94 A;  1CEG A;  2ZMA A;  1FSY A;  4DE3 A;  1ZG4 A;  3C4O A;  5A91 A;  3ZG8 B;  2CC1 A;  4KZA A;  4QY6 A;  5CGS A;  5GHX A;  3HLE A;  2ZJ9 A;  4PM7 A;  4FH2 A;  4JXW A;  5L2F A;  3ZGA B;  4UHU A;  4KZ7 A;  5CED A;  4EWF A;  1TDL A;  5FI7 A;  3IXD A;  1ZKJ A;  5F83 A;  1SHV A;  4K91 A;  4UA7 A;  1U60 A;  2V1Z A;  2ZC4 B;  3PBN A;  1AXB A;  1H5X A;  2ZD8 A;  4R3J A;  1W79 A;  3C5A A;  1YMS A;  4KQO A;  3VP2 A;  4OPR A;  4P0M A;  3WS5 A;  1YLJ A;  4B4X A;  1XP4 A;  3SS5 A;  2HDU A;  2P9V B;  1W8Q A;  3LO7 A;  4JKT A;  3HLD A;  2IWD A;  2DNS A;  3Q1F A;  3VOY A;  2Y91 A;  2XLN A;  3BEC A;  1N9B A;  4N1H A;  3ISG A;  3VFF A;  2Y2K A;  4OQH A;  3TOI A;  4MBH A;  5EE8 A;  4EBN A;  2XQZ A;  1PZP A;  2OV5 A;  1ZC2 A;  3G30 A;  3NIA A;  5E2E A;  3OPL A;  3PAG A;  4MEZ A;  4OOY A;  1NXY A;  2A3U A;  4E3L A;  2C6W B;  2EX2 A;  5HAP A;  4KQQ A;  3V3S A;  4K0X A;  4PM6 A;  4WMC A;  4JPM A;  3OPR A;  1MWS A;  3IHB A;  3G2Y A;  2OSU A;  3GR2 A;  5FQK A;  4DKI A;  4WM9 A;  5IHV A;  1LI9 A;  4X53 A;  5FI2 A;  3W8K A;  1K4E A;  5M1A A;  2EFU A;  2Y2L A;  2WUQ A;  4Y0U A;  1IKI A;  1K38 A;  4OP8 A;  1YLY A;  3RXX A;  1JTG A;  2EX8 A;  1MWU A;  3CJM A;  2WAD A;  1K54 C;  3QNC A;  4QD4 A;  4XUX A;  4FD8 A;  4EV4 A;  4UAA A;  5D3O A;  5DTS A;  2Y4A A;  3A3D A;  3VFH A;  1BSG A;  2ZQ8 A;  2Y2Q A;  3HUM A;  4WBG A;  4BEN A;  3V50 A;  1EWZ A;  4N92 A;  4OLG A;  4GDN A;  4JF4 A;  4WYY A;  2Y2O A;  1M40 A;  1VM1 A;  2OLU A;  1IKG A;  1O7E A;  3OZH A;  3PBQ A;  3V39 A;  4LEN A;  1BT5 A;  1CEF A;  4NK3 A;  5KZH A;  4X56 A;  5EEC A;  5HL1 A;  1NY0 A;  4FSF A;  3NY4 A;  5HAQ A;  1M6K A;  5CER A;  2H0Y A;  2HDR A;  1ONG A;  1FCM A;  3N8R A;  3AGF A;  3IH9 A;  1FCO A;  5GLD A;  4WEL A;  4EBP A;  5E2F A;  5G18 A;  4N9L A;  1GA9 A;  1BLS A;  1KDS A;  3W4O A;  1XKZ A;  1XPB A;  3NDG A;  2DRW A;  3NI9 A;  1DY6 A;  4IVI A;  4R3B A;  2HPB A;  5F1F A;  3BFD A;  4R0Q A;  4OOM A;  4HBT A;  2ZM8 A;  3BM6 A;  4ZJ2 A;  4E3M A;  2XH9 A;  1IEM A;  2IWB A;  3G34 A;  3UPP A;  1BUL A;  4GDB A;  2EXB A;  1PZO A;  1NYY A;  2HP5 A;  2XD5 A;  4C6Y A;  1XXM A;  3IWI A;  5FSR A;  3IF5 A;  4OQG A;  5GLC A;  4KZ3 A;  1PI4 A;  5AQB A;  1ES5 A;  3OCL A;  3DW0 A;  1CI8 A;  1KE0 A;  2UWX A;  1PW8 A;  3PBO A;  1L0G A;  3UN7 A;  3WS0 A;  1Y54 A;  1MWT A;  3EQU A;  4S2K A;  3S1Y A;  3UO9 A;  5DVA A;  5EVI D;  5F82 A;  3UY6 A;  3WRT A;  4EUZ A;  4R4R A;  4JF6 A;  1ERQ A;  5M18 A;  3GVB A;  1YLW A;  4KZ9 A;  4R4S A;  4E3I A;  1ONH A;  3OCN A;  1J9M A;  1BLP A;  5CXW A;  4ZBE A;  5FAS A;  3HRE A;  3M2J A;  1H8Y A;  3LY3 A;  3G4P A;  3NBL A;  4WEK A;  5GLA A;  1YLZ A;  1IYS A;  2XGN A;  3MXR A;  4E3N A;  4WZ5 C;  3BRM A;  3FV7 A;  1QME A;  4KZ5 A;  1RGZ A;  3Q7V B;  5FQI A;  2ZQC A;  4O7D A;  3GMW A;  3IXB A;  4Y0O A;  4B4Z A;  1C3B A;  4OPQ A;  1NYM A;  1YLP A;  1ES4 A;  3IHA A;  4ID4 A;  4DRT A;  1K55 C;  4GN2 A;  1I2W A;  1K4F A;  1BLC A;  1NJ4 A;  3VP4 A;  2HP9 A;  4OPZ A;  3MZD A;  3HL9 A;  5FDH A;  3A3E A;  4S2O A;  1XGJ A;  1TVF A;  4CPK A;  4KZ8 A;  3TG9 A;  4KG5 A;  5TGF A;  4PMA A;  4UA6 A;  1KDW A;  1I5Q A;  1MPL A;  3CMZ A;  4C3Q A;  3FYZ A;  3GTC A;  4YFM A;  3ZG7 B;  3PBT A;  3O3V A;  2WGV A;  1ES3 A;  2P74 A;  4L0L A;  1YMX A;  3IH8 A;  4R1G A;  3W4Q A;  1XA7 A;  3ZDJ A;  1JTD A;  4X55 A;  5EOE A;  1Q2Q A;  4KG2 A;  4U0T A;  2WAF A;  4Z9Q A;  1MBL A;  3ZVT A;  3VSL A;  3UPN A;  1RCJ A;  3HUN A;  3GRJ A;  3MKF A;  3C7U A;  4JXV A;  3WS4 A;  4C75 A;  1W7F A;  5CGW A;  1EI5 A;  1K6S A;  3IF6 A;  3N6I A;  5CHJ A;  5FI6 A;  4BJP A;  2I72 A;  1JVJ A;  3VSK A;  3GQZ A;  3HLW A;  4JXG A;  1S0W A;  5CRF A;  4NET A;  5FQQ A;  5HX9 A;  3P09 A;  1PIO A;  4LV3 A;  5EVI A;  4HES A;  4MBF A;  2JC7 A;  3BFF A;  2P9V A;  4YIN A;  3OPH A;  1O07 A;  5M19 A;  1K57 C;  4BD1 A;  3VP3 A;  3HUO A;  4LV2 A;  1JWZ A;  2XDM A;  1YQS A;  4OQ0 A;  3P98 A;  3V3R A;  2WGI A;  3IWO A;  3Q81 A;  4JLF A;  2Y2I A;  4RA7 A;  5BOH A;  1VQQ A;  1KGF A;  1SDN A;  4GD6 A;  1QMF A;  3V5M A;  5JYO A;  2ZC5 B;  4OKP A;  3HVF A;  4JF5 A;  1HVB A;  5CGX A;  4M3K A;  5HAR A;  1IYQ A;  3M2K A;  3FZC A;  1Q2P A;  1MXO A;  3MXS A;  4LCL A;  1MY8 A;  3UNW A;  2R9X A;  3Q07 A;  3BYD A;  4DE2 A;  3BFC A;  2Y2H A;  1NRF A;  2X01 A;  1RP5 A;  4K0W A;  4ZJ1 A;  5DF8 A;  5CHM A;  4BL3 A;  1LHY A;  4S2N A;  3MZF A;  3IWQ A;  5AQA A;  3DWK A;  4OVD A;  1LL5 A;  4MLL A;  1MKI A;  3ZG5 A;  4WZ5 A;  2WKE A;  3WS1 A;  3S22 A;  1PWC A;  1GHM A;  1GHI A;  4QJG A;  4E3O A;  2BLS A;  2OLV A;  3O88 A; 
#chains in the Genus database with same CATH topology
 4OQI A;  3S7Q A;  4O01 A;  4Y7P A;  2PAV P;  3RJU A;  1G6O A;  2PBD P;  2V8C A;  1VB6 A;  2RL3 A;  2Z2M B;  4Y3I A;  4BLM A;  1E3U D;  2VV8 A;  1MWR A;  1BZA A;  3TJZ C;  2ZQ9 A;  3DWZ A;  1BLH A;  3GSG A;  1K0K A;  4Y2F A;  4KEN B;  2P04 A;  1S67 L;  1D7E A;  3BY9 A;  2L1M A;  1CJF A;  3LR5 A;  2Z6C A;  5AQ7 A;  4PPR A;  2WYX A;  1E4D A;  5DF9 A;  2ZC7 A;  1FOF A;  1ES2 A;  3WRZ A;  5DTT A;  3AGD A;  4FH4 A;  1DJB A;  1YAX A;  4FOF A;  3AGE A;  2XR0 A;  2AVX A;  4EU0 A;  1K56 D;  4WUJ A;  3B33 A;  1GCE A;  1K54 A;  5A8B A;  2LB9 A;  3VE4 A;  2GDN A;  3IS2 B;  3IX3 A;  1F5M A;  1OJ5 A;  4UQI M;  5GHZ A;  3FC7 A;  2XRN A;  1KVL A;  3ZHH A;  2WZZ A;  1E3U A;  2A24 A;  4S2M A;  2W3E A;  2WZX A;  1SKF A;  5HZH A;  1JWP A;  1PWG A;  3E4P A;  2XD1 A;  4BD0 A;  2VGK A;  4L9G A;  1OTD A;  2UV0 E;  4WZ4 A;  3D9Y A;  3PBS A;  3A3J A;  5FAO A;  3ZYT A;  1KVM A;  3L7H A;  5EPH A;  4HNB A;  2W3D A;  4LFU A;  2ZL1 B;  5L10 A;  1P9W A;  3QP8 A;  2VEA A;  3MJQ A;  1CQA A;  4QB8 A;  3T4S A;  4JGQ A;  3VP0 A;  4K08 A;  3LR0 A;  1TEM A;  1KE3 A;  3OPP A;  2Y2G A;  4UA9 A;  4P85 A;  1K56 A;  5FQJ A;  4IBR A;  4R3A A;  3UDF A;  3TRC A;  1YKD A;  1DJC A;  2Y55 A;  2J7V A;  1XA1 A;  3CG5 A;  3IXG A;  1OTI A;  5EOO A;  4ARZ A;  5CHU A;  3CIT A;  1FR6 A;  5E2G A;  2HZ5 A;  1SDE A;  5FL3 A;  1F2K A;  3ITB A;  2OOL A;  3H82 B;  4B9O A;  4JXS A;  5J8X A;  2FH5 A;  5GLB A;  2XA7 M;  2JKF A;  2Y2J A;  4DJ3 A;  4R38 A;  1KE4 A;  1OTB A;  2E8I A;  3N8L A;  2M7V A;  3SS4 A;  2G2W A;  4E6X A;  3LGO A;  5DF7 A;  5EUA A;  4QY5 A;  3VP1 A;  4DDS A;  4Z1W A;  3CZD A;  5EM1 A;  4E3J A;  4NG2 A;  4P6B A;  1XJ3 A;  5KIZ A;  4EBL A;  4PHT A;  1HZO A;  1Z6F A;  2IWC A;  3QP1 A;  1BUE A;  4A5R A;  1L0F A;  1YM1 A;  3MBZ A;  4IVK A;  2E8J A;  4KZA A;  4PM7 A;  4O8G A;  3F1P B;  2VKS A;  4EWF A;  3A0V A;  3IXD A;  1ZKJ A;  5F83 A;  4K91 A;  2V1Z A;  2GNX A;  1W79 A;  3WS5 A;  3DTI A;  4LRY C;  3T4L A;  2PHY A;  3HJK A;  3LO7 A;  4Q0I A;  3VOY A;  2XLN A;  4YWZ A;  4BMW A;  3CUE A;  3R4K A;  2XQZ A;  4EBN A;  2OV5 A;  3G30 A;  4OOY A;  2VGL M;  2EX2 A;  3G2Y A;  4HHD A;  4X53 A;  1K4E A;  5FDS A;  1TS6 A;  2WUQ A;  1YLY A;  4EEP A;  4QD4 A;  2Y4A A;  1W63 M;  5HWW A;  1BSG A;  3UMD A;  5DKK A;  2ZQ8 A;  3HUM A;  3MQQ A;  4I3A A;  4WYY A;  2Y2O A;  1M40 A;  2OLU A;  3OZH A;  1CEF A;  4NK3 A;  4L9F A;  5KZH A;  5EEC A;  1NY0 A;  3NY4 A;  1ONG A;  1SZV A;  4HIA A;  3E4Q A;  1PRQ A;  1BLS A;  2PDR A;  3W4O A;  3NDG A;  2DRW A;  5F1F A;  4R3B A;  5HPI A;  5DFX A;  4OOM A;  2ZM8 A;  3BM6 A;  4CLC A;  3P7N A;  1IFQ A;  5J4E A;  1IEM A;  3G34 A;  3UPP A;  4HP4 A;  1XXM A;  3IWI A;  3A0S A;  4HY8 A;  5AQB A;  1ES5 A;  3DW0 A;  1CI8 A;  1S66 L;  3PBO A;  3WS0 A;  2V0U A;  3S1Y A;  3UO9 A;  3UY6 A;  5M18 A;  4R4S A;  3IX4 A;  1J9M A;  5CXW A;  5FAS A;  2JKR M;  1OT6 A;  4WEK A;  1IYS A;  4WZ5 C;  3BRM A;  4KZ5 A;  3UB8 A;  3IXB A;  4B4Z A;  3KSH A;  2A24 B;  1DP8 A;  4GN2 A;  1K4F A;  3VP4 A;  1DRM A;  4ETX A;  4XT2 A;  1ODV A;  3MZD A;  1XGJ A;  1GSV A;  4PMA A;  4II7 A;  2OAP 1;  1MPL A;  3CMZ A;  2WKP A;  1D06 A;  4E04 A;  5LBR A;  3PBT A;  2WGV A;  1ES3 A;  5DJU A;  2J80 A;  3IH8 A;  4HH3 A;  4X55 A;  3UB9 A;  1LSX A;  3GRJ A;  2NUT C;  3C7U A;  4JXV A;  3FPW A;  1W7F A;  4QPR A;  2V1B A;  3N6I A;  3EEH A;  3QP2 A;  2I72 A;  3T4J A;  5L09 A;  5HX9 A;  3P09 A;  4LV3 A;  2V8F A;  3CWF A;  3W2Z A;  2QYB A;  3KYE A;  4YIN A;  3OPH A;  5DFY A;  4ARZ B;  4LV2 A;  1JWZ A;  3V3R A;  2WGI A;  4GW9 A;  3IWO A;  5I5L A;  3ULF A;  1NLZ A;  3LYX A;  1KGF A;  1SDN A;  4GD6 A;  3V5M A;  3F1O A;  3V67 A;  3VOL A;  1HVB A;  5HAR A;  3H9W A;  3UB6 A;  1MY8 A;  4BBU A;  3K3C A;  3Q07 A;  4DE2 A;  3BFC A;  2FZ0 A;  3IBR A;  2HF6 A;  3IWQ A;  3ZG5 A;  3O88 A;  3T4K A;  2Q9M A;  3T4Q A;  5FAP A;  3G2Z A;  4G3K A;  3VE3 A;  3MMH A;  3IT9 A;  4YOF A;  4ZAM A;  1NZU A;  3FKV A;  4GHI B;  2Y8H A;  4BQM A;  3MQ0 A;  3NCK A;  2LB5 A;  2QMI A;  3BEB A;  3H82 A;  3UE3 A;  3FKW A;  2HV1 A;  5GHY A;  2Y59 A;  4PKY G;  4IBX A;  1WE4 A;  2J9O A;  1ERO A;  3ZVW A;  2V1A A;  1ALQ A;  2J3W A;  1W5D A;  1K25 A;  3SH7 A;  4OP5 A;  1UGU A;  4X69 A;  5FEG A;  3BJN A;  3N4I A;  4LCM A;  3HLC A;  3UPO A;  4IUH A;  1KGG A;  3G31 A;  3OOV A;  2H0T A;  3OC2 A;  5K5B A;  3B47 A;  3M6H A;  1L2S A;  2FFF B;  5F5Y A;  5HWT A;  5J7E A;  3KSG A;  3F1N A;  4I39 A;  3PTE A;  4Y15 A;  3Q7V A;  5F1G A;  2EX9 A;  3HBR A;  1HD8 A;  4DE1 A;  2HDS A;  3A3I A;  4N9K A;  3T1Q B;  4I5S A;  2QJ7 A;  1DP9 A;  3QP4 A;  2QPN A;  2B95 A;  1ESI A;  3UDX A;  3G35 A;  4GS9 B;  4CJN A;  1FQG A;  1TDG A;  3EOI A;  1IEL A;  4QU3 A;  3GDI A;  3R7W A;  2RCX A;  5TFQ A;  4PAU A;  4MCW A;  3SH8 A;  3UE1 A;  1S4S A;  2BTF P;  2DCF A;  2V20 A;  2WAE A;  5CEC A;  1UWP X;  2J8Y A;  3IBJ A;  4X6T A;  3B42 A;  3NHQ A;  1PYY A;  1ZG6 A;  1RGY A;  3IQA A;  4CLC B;  3T4O A;  4OLD A;  3PAE A;  4GNU A;  3D4F A;  1MKM A;  2X02 A;  1IYP A;  2VA0 A;  3CUE C;  4GKU A;  2ZM2 A;  4U0X A;  2ZLY A;  5A90 A;  4GZB A;  2OWH A;  2ZQA A;  2XK1 A;  1L0E A;  3ICY A;  3KO6 A;  4GD8 A;  5KSH A;  3LEZ A;  2H5S A;  2O0Y A;  1XFN A;  4L9E A;  1TF1 A;  1T19 A;  2XEP A;  3LR3 A;  4PM8 A;  1PI5 A;  4N1X A;  3FG8 A;  4WMC D;  3UDI A;  3DBA A;  2R78 A;  3C4P A;  4XT2 B;  1ESU A;  3LFV A;  3BLM A;  1GHP A;  4ZDX A;  1G6A A;  1LLB A;  2EXA A;  1FIL A;  2VK3 A;  3JYI A;  4GOG A;  5HW3 A;  3WS2 A;  2WGW B;  4F3L A;  4F94 A;  4Q0J A;  2ZMA A;  1FSY A;  4DE3 A;  3H7W A;  3TW8 A;  3ZG8 B;  4CLC C;  5GHX A;  3MQO A;  3ZGA B;  5AVF A;  5CED A;  1TDL A;  5FI7 A;  1MZU A;  2ZC4 B;  3PBN A;  4LLO B;  1AXB A;  4UQI S;  3C5A A;  4KQO A;  4B4X A;  1YLJ A;  4EXO A;  2HDU A;  2YKF A;  2P7J A;  5DJT A;  4JKT A;  3HLD A;  2DNS A;  3Q1F A;  4MN5 A;  4DMZ A;  2Y91 A;  4N1H A;  3VFF A;  1NRJ A;  4OQH A;  1VET A;  4MBH A;  3F1O B;  1ZC2 A;  5E2E A;  5HDC A;  1VEU A;  3OPL A;  3PAG A;  1V9Y A;  4QWO A;  4KQQ A;  4K0X A;  4WMC A;  2XRO A;  4JPM A;  3OPR A;  5FQK A;  5FI2 A;  4HI4 A;  2PYP A;  4Y0U A;  1IKI A;  4OP8 A;  2WAD A;  3RFB A;  1A0K A;  4GCZ A;  3LI9 A;  4WBG A;  3V50 A;  1F9I A;  4HP9 A;  4N92 A;  1HLU P;  1P97 A;  1IKG A;  4LEN A;  1BT5 A;  3EEA A;  4R70 A;  4NXE A;  5HL1 A;  1N9N A;  4FSF A;  1M6K A;  5CER A;  2DMW A;  4ESP A;  2HDR A;  2YKH A;  3N8R A;  1KOU A;  5FEF A;  3AGF A;  3IH9 A;  4WEL A;  4EBP A;  3EGX C;  5G18 A;  4N9L A;  2V9A A;  4IVI A;  1DY6 A;  3BFD A;  2QWS A;  2XA7 S;  4ZJ2 A;  5G4Z A;  2XH9 A;  2VV7 A;  1H3Q A;  1PZO A;  1NYY A;  4C6Y A;  1G5U A;  1ZTU A;  4NXG A;  4KZ3 A;  1PI4 A;  3OCL A;  1AWI A;  4KUO A;  1L0G A;  4GHI A;  3UN7 A;  4S2K A;  5DVA A;  3WRT A;  4R4R A;  2JKG A;  2VV6 A;  1BLP A;  4ZBE A;  4H6J A;  1H8Y A;  3NBL A;  3F1N B;  1RGZ A;  3Q7V B;  1VHM A;  2WKQ A;  1C3B A;  1NYM A;  2NUP C;  3EGD C;  2MJ6 A;  3HL9 A;  4YNR A;  5J3W A;  3PXP A;  4KZ8 A;  3S7P A;  3TG9 A;  1OTE A;  5TGF A;  1L3L A;  1KDW A;  1I5Q A;  3LIE A;  5IU1 A;  2O9B A;  4CLC D;  3R7W B;  4YFM A;  3ZG7 B;  4R1G A;  3W4Q A;  1IOU A;  3MSH A;  2KLI A;  4Z9Q A;  3ZVT A;  1RCJ A;  3T50 A;  1GSW A;  3CPT A;  3LID A;  2VGL S;  3VSK A;  3GQZ A;  5L8M A;  5FQQ A;  4NET A;  1PIO A;  4HES A;  4MBF A;  2JC7 A;  1T1B A;  1D1J A;  1O07 A;  5M19 A;  3VP3 A;  3LIB A;  4GS9 A;  3E4O A;  5DKL A;  2ZMF A;  3Q81 A;  4ZRR A;  2QKP A;  2QJ5 A;  4EET B;  2QHK A;  2ZC5 B;  2W3F A;  4M3K A;  1MXO A;  3U2A A;  3NOT C;  3MXS A;  3UNW A;  2R9X A;  2Y2H A;  2PT7 A;  4ZJ1 A;  5CHM A;  4BL3 A;  4WN5 A;  4ME4 A;  3MZF A;  1LL5 A;  4MLL A;  1MKI A;  3WS1 A;  3S22 A;  1GHM A;  4QJG A;  2BLS A;  3NI9 A;  3NOP C;  2PBY A;  1STZ A;  1H8Z A;  2EFX A;  2XFT A;  2Z6D A;  4CLC E;  5FA7 A;  1CI9 A;  5F69 A;  4KQD A;  1HTZ A;  1S6R A;  1WYC A;  3BLS A;  2QZ6 A;  2J3T C;  3SS3 A;  3GEC A;  4F3L B;  2PU4 A;  2M1C A;  3H7W B;  3Q82 A;  4KG6 A;  2G2U A;  5FAT A;  1K6R A;  3ZCZ A;  3DAV A;  3O87 A;  4OH0 A;  4ETZ A;  1S4R A;  4G3W A;  4OOL A;  2PR5 A;  2GJ3 A;  2GX5 A;  4CQH A;  2V0W A;  4B88 A;  1N4O A;  3QHY A;  2WKH A;  1FCN A;  2XFS A;  4LV1 A;  3LEQ A;  4S2L A;  3NDE A;  4HEF A;  3RH8 B;  5EVE A;  1K57 A;  2HJ9 C;  4P87 A;  2HDQ A;  5A92 A;  3QNB A;  1PW1 A;  1OT9 A;  1VET B;  2ZC3 B;  3EQV A;  4LGW A;  1JWV A;  1VEU B;  2WGW A;  2EX6 A;  4X68 A;  2PD7 A;  2V2F F;  3W4P A;  2R9W A;  1T1A A;  5AJG A;  3IF6 B;  3BQA A;  2JCH A;  2L4R A;  5EVI B;  3RXW A;  4FCF A;  4KZ4 A;  4P6Z M;  5MC7 A;  1YLT A;  3U4L P;  4LRX C;  4WLA A;  5U47 A;  1FSW A;  5FAQ A;  5CEB A;  4R23 A;  5G4Y A;  2W3G A;  3ZG0 A;  3S7N A;  3JPU A;  2PYR A;  4PKY A;  4E3K A;  3UE6 A;  3T1S A;  5KSC A;  3S4X A;  4H8R A;  3G6O A;  5HFO A;  3DTE A;  3NUL A;  4HBU A;  4NXF A;  5C5K A;  2Y2P A;  3O86 A;  2G7U A;  5HAI A;  2Y2M A;  4S2J A;  1YT4 A;  3KYZ A;  3MF0 A;  2OAQ 1;  3GV9 A;  2PD8 A;  2KOI A;  3A3F A;  3N7W A;  1IYO A;  1I2S A;  4OON A;  4DDY A;  4BBV A;  5I94 A;  5GL9 A;  3VV4 A;  1T1C A;  3RTY A;  3CLO A;  4WEJ A;  3BFG A;  5A93 A;  5EM0 A;  1EW0 A;  4JBF A;  2J9P A;  3UB7 A;  3ZFZ A;  3LY4 A;  5E43 A;  3IF6 C;  4MBK A;  4H6J B;  2WKR A;  5EVI C;  4EQI A;  5CTN A;  1TS8 A;  1XGI A;  3C38 A;  4HJ3 A;  1G68 A;  3D3O A;  3MKE A;  1OTA A;  3VOZ A;  1XFQ A;  3DTK A;  4KZB A;  3I7J A;  2W27 A;  2X71 A;  2VLG A;  4RX3 A;  2VX8 A;  2Q9N A;  4BBT A;  3VMA A;  3WWX A;  1SKO B;  4IJG A;  3NC8 A;  4E6W A;  2J3T D;  1S1Y A;  2ZQ7 A;  3TSG A;  1WYB A;  1L0D A;  4RVA A;  2B5R A;  4M4X A;  5EFW A;  4S2N C;  3SOI A;  1YSQ A;  4ZTK A;  4X25 A;  1CEG A;  5A91 A;  3C4O A;  1NWZ A;  3OLO A;  2CC1 A;  4QY6 A;  3HLE A;  4DJ2 A;  2Y79 A;  4MN7 A;  4FH2 A;  5L2F A;  5TBM A;  1X0O A;  4UHU A;  4GJ4 A;  1PFL A;  3TE8 A;  1TS7 A;  1U60 A;  3BWL A;  3CPT B;  3QP6 A;  4R3J A;  1YMS A;  4P0M A;  1XP4 A;  3SS5 A;  2VZW A;  1W8Q A;  2KDK A;  3D72 A;  3FPV A;  3L9K A;  1LT0 A;  1H0M A;  3BEC A;  1N9B A;  3ISG A;  2Y2K A;  1XJ2 A;  2PR6 A;  5HAP A;  3V3S A;  4PM6 A;  1MWS A;  3IHB A;  4DKI A;  2OSU A;  2W3H A;  3GR2 A;  5IHV A;  4UEY A;  2B02 A;  3W8K A;  3K3D A;  2OWJ A;  4WF0 A;  3RXX A;  1JTG A;  1MWU A;  3CJM A;  1N9L A;  3QNC A;  3KX0 X;  4XUX A;  1V9Z A;  5HD5 A;  2I9V A;  3A3D A;  2KX6 A;  4BEN A;  1UWN X;  4X1M A;  3V39 A;  3PBQ A;  1O7E A;  4X56 A;  1YSP A;  2H28 A;  3SZT A;  5HAQ A;  1FCO A;  2W1R A;  1KDS A;  1XKZ A;  3P01 A;  1XPB A;  4R0Q A;  3S7O A;  2JN7 A;  2IWB A;  4X1L A;  2XD5 A;  1NLY A;  1OPX A;  3C8C A;  3IF5 A;  2ZOH A;  5AVE A;  2UWX A;  2P08 A;  1MWT A;  3EQU A;  5EVI D;  5F82 A;  4KZ9 A;  3EWK A;  3OCN A;  3HRE A;  3M2J A;  4WL9 A;  3G4P A;  5GLA A;  2XSS A;  1YLZ A;  2XGN A;  3FV7 A;  5FQI A;  4O7D A;  3GMW A;  4Y0O A;  1YLP A;  4ID4 A;  1BLC A;  2HP9 A;  5HD3 A;  5FDH A;  4S2O A;  1TVF A;  4CPK A;  2O9A A;  4UA6 A;  4LPZ A;  3GTC A;  4GLQ A;  2D02 A;  5CX7 A;  5EV0 A;  2P74 A;  4L0L A;  1YMX A;  1XA7 A;  4JGO A;  5EOE A;  2WAF A;  2GZA A;  3UPN A;  3MKF A;  4C75 A;  1K6S A;  3IF6 A;  4BJP A;  1N9O A;  1JVJ A;  3HLW A;  1S0W A;  4MMN A;  5EVI A;  3BFF A;  2P9V A;  1K57 C;  5F6A A;  4BD1 A;  4Y17 A;  2XDM A;  3P98 A;  4I3I A;  2Y2I A;  5BOH A;  3UME A;  1VQQ A;  2HJE A;  5JYO A;  3JVV A;  4OKP A;  4KUK A;  3HVF A;  4JF5 A;  2INW A;  3M2K A;  3FZC A;  1Q2P A;  4JGR A;  4AFI A;  3ZQ5 A;  5HSQ A;  1NRF A;  1RP5 A;  4K0W A;  3LIF A;  1LHY A;  4S2N A;  4IHQ A;  2Q0O A;  2K31 A;  2WKE A;  3T1X A;  1PWC A;  4HJ4 A;  5F68 A;  2OLV A;  3NEC A;  1GA0 A;  1W8Y A;  5HDD A;  3C30 A;  3M6B A;  4D2O A;  2A49 A;  3HLB A;  3SW1 A;  1K55 A;  4EES A;  2CMN A;  3MXQ A;  3OBF A;  1BTL A;  2Z2L B;  1DJA A;  2M7U A;  5HPF A;  1H8M A;  1MC0 A;  1XJ6 A;  5EVL A;  5KMW A;  4DF6 A;  1ACF A;  1XX2 A;  4EUV A;  5IT5 A;  1ERM A;  1OME A;  5TBM B;  4U3T A;  1Z09 A;  3LCE A;  3B3X A;  3ITA A;  4B93 A;  4S2I A;  4PM5 A;  1SKO A;  2L0W A;  4ZJ3 A;  3QP5 A;  3UE0 A;  2JKT I;  3JVU A;  5E2H A;  4LV0 A;  3CI6 A;  3HLG A;  3IXH A;  4KQR A;  4EER A;  1YPR A;  5IS1 A;  3C7V A;  3MFX A;  4FTX A;  2W0N A;  1LI0 A;  2HGV A;  4IUK A;  4DN0 A;  5TR7 A;  3HLF A;  5DTK A;  1LL9 A;  2JKT M;  4FUW A;  4QHC A;  4Q0H A;  5AQ9 A;  4XXR A;  2D01 A;  3ZNY A;  2K7S A;  4BL2 A;  2H10 A;  5CTM A;  1W63 Q;  1KGE A;  4S2P A;  2W1T A;  2ZBB A;  3DTM A;  2ZC6 B;  4IED A;  4Y0T A;  4HQA A;  3E2L A;  4OPY A;  4NKP A;  3ZNT A;  3PR6 A;  2ZM0 A;  3Q7Z A;  4I38 A;  3T12 B;  4D60 A;  3SH9 A;  2ZQD A;  1TD5 A;  1CK3 A;  3KYQ A;  4KZ6 A;  4DE0 A;  4RX2 A;  1Y28 A;  2VGJ A;  4MN6 A;  2PRF A;  4HOI A;  4MNR A;  5FQM A;  4EW7 A;  3LR4 A;  3BFE A;  2C5W B;  1J3W A;  1PWD A;  4DXB A;  4GB7 A;  4PM9 A;  5JYP A;  3CAX A;  1FR1 A;  4BWI A;  1E25 A;  3FWL A;  4HH2 A;  3BQ8 A;  3ZG9 B;  2Y2N A;  2FFY A;  4RYE A;  3N8S A;  4Q8I A;  1T18 A;  2JE5 A;  3A0R A;  4HJ6 A;  2JHE A;  3PBR A;  3KSI A;  4JGP A;  4DXC A;  1ZHH B;  3CHW P;  4I3J A;  1SCW A;  2JKR I;  2WK0 A;  3E2K A;  2BG1 A;  2WKI A;  3BW6 A;  1NZO A;  2XF3 A;  5TJJ A;  3NJA A;  1XJ4 A;  3MZE A;  4XUZ A;  3MFD A;  5FQ9 A;  2ACG A;  2HP6 A;  3MR0 A;  1P9R A;  2VJW A;  2JBF A;  3G32 A;  2PU2 A;  2EWW A;  1FIK A;  1ZG4 A;  5CGS A;  2ZJ9 A;  4JXW A;  3BY8 A;  4KZ7 A;  3IX8 A;  1SHV A;  4UA7 A;  3E0Y A;  4EQ1 A;  2ZOI A;  1H5X A;  1LSV A;  2BAS A;  2ZD8 A;  3VP2 A;  4OPR A;  4NXB A;  2P9V B;  3E98 A;  2IWD A;  1GSX A;  4P6Z S;  5HDS A;  2O99 A;  3TOI A;  3IS2 A;  5EE8 A;  1PZP A;  3NIA A;  4MEZ A;  1NXY A;  4G3V A;  2A3U A;  4E3L A;  2C6W B;  3LI8 A;  4WM9 A;  1LI9 A;  5M1A A;  2EFU A;  2K2N A;  2Y2L A;  1K38 A;  1LL8 A;  2EX8 A;  3PYP A;  4EEU A;  1K54 C;  4FD8 A;  4EV4 A;  4UAA A;  5D3O A;  5DTS A;  3VFH A;  4NEE D;  2EA9 A;  2Y2Q A;  1EWZ A;  4OLG A;  4GDN A;  4JF4 A;  2A2L A;  2IA2 A;  1VM1 A;  3HCY A;  2ZL1 A;  2H0Y A;  1FCM A;  5GLD A;  3KSF A;  5E2F A;  4Y13 A;  1GA9 A;  5HWV A;  2HPB A;  1OJG A;  4HBT A;  4E3M A;  1BUL A;  4GDB A;  2EXB A;  2HP5 A;  5FSR A;  1WA9 A;  4OQG A;  4RQ9 A;  5GLC A;  1LSW A;  3PHY A;  3K2N A;  3LUQ A;  1KE0 A;  1PW8 A;  1Y54 A;  3O5Y A;  4EUZ A;  4JF6 A;  1ERQ A;  3GVB A;  1YLW A;  4E3I A;  1G28 A;  1ONH A;  5HL6 A;  3LY3 A;  2B18 A;  4E3N A;  3MXR A;  3C2W A;  1QME A;  3MS6 A;  2O9C A;  2ZQC A;  3LIA A;  4OPQ A;  1ES4 A;  3IHA A;  4DRT A;  1K55 C;  2ZMV A;  1I2W A;  1NJ4 A;  1DP6 A;  4OPZ A;  3T4T A;  3A3E A;  3NOU C;  2W1T B;  4KG5 A;  3HJI A;  4C3Q A;  3FYZ A;  1JNU A;  1BYW A;  3O3V A;  5L07 A;  1JTD A;  1Q2Q A;  4KG2 A;  1PNE A;  4U0T A;  1MBL A;  3VSL A;  3F1P A;  3HUN A;  4LRZ E;  3T1R A;  3WS4 A;  5CGW A;  1EI5 A;  5CHJ A;  5FI6 A;  4JXG A;  5CRF A;  4Y5F A;  4R6L A;  3HUO A;  1CF0 A;  1YQS A;  4OQ0 A;  4JLF A;  4RA7 A;  1P0Z A;  4MDZ A;  1QMF A;  5CGX A;  1Y4O A;  1IYQ A;  2EWV A;  3UB5 P;  1TS0 A;  1S1Z A;  4LCL A;  3BYD A;  1F98 A;  2X01 A;  3LIC A;  5DF8 A;  4O0P A;  5AQA A;  3DWK A;  4OVD A;  4WZ5 A;  1GHI A;  4E3O A;  3ZDJ A; 
#chains in the Genus database with same CATH homology
 2PBY A;  2Q9M A;  1GA0 A;  4OQI A;  5FAP A;  1H8Z A;  1W8Y A;  3G2Z A;  3M6B A;  4Y7P A;  4D2O A;  2EFX A;  2XFT A;  2A49 A;  3HLB A;  3RJU A;  3IT9 A;  5FA7 A;  4ZAM A;  1CI9 A;  1K55 A;  1NZU A;  2RL3 A;  2Z2M B;  4BLM A;  1E3U D;  3FKV A;  1BTL A;  2Z2L B;  1MWR A;  1BZA A;  1DJA A;  4BQM A;  3NCK A;  1HTZ A;  2QMI A;  3BEB A;  3UE3 A;  1S6R A;  3FKW A;  5EVL A;  1WYC A;  3BLS A;  2QZ6 A;  2ZQ9 A;  5GHY A;  5KMW A;  3DWZ A;  1BLH A;  3GSG A;  3SS3 A;  2PU4 A;  2Y59 A;  4KEN B;  4IBX A;  4DF6 A;  1WE4 A;  1XX2 A;  2J9O A;  1ERO A;  3Q82 A;  4KG6 A;  3ZVW A;  2G2U A;  5FAT A;  1K6R A;  5AQ7 A;  4PPR A;  3ZCZ A;  1ERM A;  1E4D A;  2WYX A;  3O87 A;  1OME A;  1ALQ A;  5DF9 A;  4OH0 A;  4U3T A;  2ZC7 A;  1FOF A;  1ES2 A;  3WRZ A;  5DTT A;  3LCE A;  3AGD A;  4FH4 A;  4OOL A;  3B3X A;  3ITA A;  1DJB A;  1W5D A;  1K25 A;  3SH7 A;  4OP5 A;  3AGE A;  2XR0 A;  4X69 A;  4S2I A;  4PM5 A;  4B88 A;  3N4I A;  1N4O A;  4LCM A;  3QHY A;  3HLC A;  1K56 D;  2WKH A;  1FCN A;  2XFS A;  4LV1 A;  4S2L A;  4ZJ3 A;  3UPO A;  3NDE A;  4HEF A;  1GCE A;  1KGG A;  1K54 A;  3G31 A;  1K57 A;  3UE0 A;  4P87 A;  2HDQ A;  2H0T A;  5A92 A;  3OC2 A;  3QNB A;  1PW1 A;  5E2H A;  2GDN A;  4LV0 A;  2ZC3 B;  3EQV A;  1JWV A;  3M6H A;  1L2S A;  2FFF B;  2WGW A;  3HLG A;  3IXH A;  2EX6 A;  4X68 A;  3PTE A;  4KQR A;  5GHZ A;  3Q7V A;  5F1G A;  3C7V A;  1KVL A;  2EX9 A;  2WZZ A;  1LI0 A;  3ZHH A;  3HBR A;  2V2F F;  3W4P A;  1HD8 A;  2R9W A;  5TR7 A;  4DE1 A;  2HDS A;  3A3I A;  3HLF A;  1E3U A;  3IF6 B;  4N9K A;  1LL9 A;  4S2M A;  5DTK A;  2JCH A;  2WZX A;  4QHC A;  1SKF A;  5AQ9 A;  4XXR A;  5EVI B;  1JWP A;  3RXW A;  4FCF A;  1PWG A;  3ZNY A;  4BL2 A;  4KZ4 A;  2H10 A;  5CTM A;  1KGE A;  4S2P A;  2QPN A;  1YLT A;  2XD1 A;  4BD0 A;  1ESI A;  2VGK A;  3DTM A;  3UDX A;  3G35 A;  2ZC6 B;  4WZ4 A;  4IED A;  4CJN A;  4Y0T A;  3PBS A;  3E2L A;  1FQG A;  1TDG A;  3A3J A;  5FAO A;  4OPY A;  5U47 A;  1IEL A;  1KVM A;  5EPH A;  1FSW A;  4QU3 A;  5FAQ A;  5CEB A;  4R23 A;  2RCX A;  5TFQ A;  3ZNT A;  3ZG0 A;  3SH8 A;  2ZM0 A;  3UE1 A;  3Q7Z A;  2WAE A;  2DCF A;  2V20 A;  4QB8 A;  5CEC A;  2J8Y A;  4E3K A;  3VP0 A;  4X6T A;  5KSC A;  3S4X A;  3SH9 A;  4H8R A;  1TEM A;  5HFO A;  2ZQD A;  1KE3 A;  3OPP A;  2Y2G A;  4HBU A;  4UA9 A;  4P85 A;  1PYY A;  1K56 A;  5FQJ A;  4IBR A;  1ZG6 A;  2Y2P A;  1CK3 A;  3O86 A;  4KZ6 A;  4DE0 A;  5HAI A;  1RGY A;  3IQA A;  3UDF A;  4RX2 A;  2Y2M A;  4OLD A;  2Y55 A;  1DJC A;  3PAE A;  2VGJ A;  2J7V A;  1XA1 A;  4GNU A;  4MNR A;  3D4F A;  4S2J A;  1YT4 A;  3CG5 A;  3IXG A;  5FQM A;  5EOO A;  5CHU A;  2X02 A;  3GV9 A;  3BFE A;  3A3F A;  1IYP A;  1FR6 A;  2C5W B;  3N7W A;  1IYO A;  5E2G A;  1PWD A;  4DXB A;  1I2S A;  1SDE A;  4GB7 A;  4OON A;  4DDY A;  4PM9 A;  4GKU A;  3ITB A;  5JYP A;  2ZM2 A;  4JXS A;  5I94 A;  1FR1 A;  5GL9 A;  5J8X A;  1E25 A;  4U0X A;  2ZLY A;  5A90 A;  4WEJ A;  3FWL A;  3BFG A;  3ZG9 B;  5A93 A;  2Y2N A;  2FFY A;  5GLB A;  4JBF A;  4RYE A;  4GZB A;  2J9P A;  3N8S A;  3ZFZ A;  4Q8I A;  3LY4 A;  2ZQA A;  5E43 A;  2JE5 A;  3IF6 C;  2XK1 A;  3PBR A;  2Y2J A;  1L0E A;  4MBK A;  4DXC A;  5EVI C;  1KE4 A;  4EQI A;  5CTN A;  1XGI A;  4GD8 A;  1G68 A;  5KSH A;  3MKE A;  2E8I A;  3LEZ A;  2H5S A;  3N8L A;  3VOZ A;  3SS4 A;  4KZB A;  3I7J A;  2XEP A;  2G2W A;  4E6X A;  1SCW A;  2X71 A;  4PM8 A;  2WK0 A;  4QY5 A;  5DF7 A;  5EUA A;  3VP1 A;  1PI5 A;  4RX3 A;  4DDS A;  2Q9N A;  3VMA A;  3WWX A;  3E2K A;  2BG1 A;  2WKI A;  4N1X A;  3CZD A;  4WMC D;  3UDI A;  1NZO A;  3C4P A;  4E3J A;  2XF3 A;  4P6B A;  1ESU A;  3MZE A;  3BLM A;  4XUZ A;  1GHP A;  3MFD A;  3NC8 A;  4E6W A;  4ZDX A;  4EBL A;  1G6A A;  1LLB A;  2EXA A;  2ZQ7 A;  3TSG A;  1HZO A;  1Z6F A;  1WYB A;  2IWC A;  1L0D A;  5FQ9 A;  1BUE A;  3JYI A;  4RVA A;  2B5R A;  2HP6 A;  4GOG A;  5HW3 A;  4A5R A;  1L0F A;  2JBF A;  4S2N C;  3WS2 A;  3SOI A;  3G32 A;  1YM1 A;  2WGW B;  3MBZ A;  4IVK A;  4ZTK A;  2PU2 A;  4F94 A;  1CEG A;  2ZMA A;  1FSY A;  4DE3 A;  1ZG4 A;  3C4O A;  5A91 A;  3ZG8 B;  2CC1 A;  4KZA A;  4QY6 A;  5CGS A;  5GHX A;  3HLE A;  2ZJ9 A;  4PM7 A;  4FH2 A;  4JXW A;  5L2F A;  3ZGA B;  4UHU A;  4KZ7 A;  5CED A;  4EWF A;  1TDL A;  5FI7 A;  3IXD A;  1ZKJ A;  5F83 A;  1SHV A;  4K91 A;  4UA7 A;  1U60 A;  2V1Z A;  2ZC4 B;  3PBN A;  1AXB A;  1H5X A;  2ZD8 A;  4R3J A;  1W79 A;  3C5A A;  1YMS A;  4KQO A;  3VP2 A;  4OPR A;  4P0M A;  3WS5 A;  1YLJ A;  4B4X A;  1XP4 A;  3SS5 A;  2HDU A;  2P9V B;  1W8Q A;  3LO7 A;  4JKT A;  3HLD A;  2IWD A;  2DNS A;  3Q1F A;  3VOY A;  2Y91 A;  2XLN A;  3BEC A;  1N9B A;  4N1H A;  3ISG A;  3VFF A;  2Y2K A;  4OQH A;  3TOI A;  4MBH A;  5EE8 A;  4EBN A;  2XQZ A;  1PZP A;  2OV5 A;  1ZC2 A;  3G30 A;  3NIA A;  5E2E A;  3OPL A;  3PAG A;  4MEZ A;  4OOY A;  1NXY A;  2A3U A;  4E3L A;  2C6W B;  2EX2 A;  5HAP A;  4KQQ A;  3V3S A;  4K0X A;  4PM6 A;  4WMC A;  4JPM A;  3OPR A;  1MWS A;  3IHB A;  3G2Y A;  2OSU A;  3GR2 A;  5FQK A;  4DKI A;  4WM9 A;  5IHV A;  1LI9 A;  4X53 A;  5FI2 A;  3W8K A;  1K4E A;  5M1A A;  2EFU A;  2Y2L A;  2WUQ A;  4Y0U A;  1IKI A;  1K38 A;  4OP8 A;  1YLY A;  3RXX A;  1JTG A;  2EX8 A;  1MWU A;  3CJM A;  2WAD A;  1K54 C;  3QNC A;  4QD4 A;  4XUX A;  4FD8 A;  4EV4 A;  4UAA A;  5D3O A;  5DTS A;  2Y4A A;  3A3D A;  3VFH A;  1BSG A;  2ZQ8 A;  2Y2Q A;  3HUM A;  4WBG A;  4BEN A;  3V50 A;  1EWZ A;  4N92 A;  4OLG A;  4GDN A;  4JF4 A;  4WYY A;  2Y2O A;  1M40 A;  1VM1 A;  2OLU A;  1IKG A;  1O7E A;  3OZH A;  3PBQ A;  3V39 A;  4LEN A;  1BT5 A;  1CEF A;  4NK3 A;  5KZH A;  4X56 A;  5EEC A;  5HL1 A;  1NY0 A;  4FSF A;  3NY4 A;  5HAQ A;  1M6K A;  5CER A;  2H0Y A;  2HDR A;  1ONG A;  1FCM A;  3N8R A;  3AGF A;  3IH9 A;  1FCO A;  5GLD A;  4WEL A;  4EBP A;  5E2F A;  5G18 A;  4N9L A;  1GA9 A;  1BLS A;  1KDS A;  3W4O A;  1XKZ A;  1XPB A;  3NDG A;  2DRW A;  3NI9 A;  1DY6 A;  4IVI A;  4R3B A;  2HPB A;  5F1F A;  3BFD A;  4R0Q A;  4OOM A;  4HBT A;  2ZM8 A;  3BM6 A;  4ZJ2 A;  4E3M A;  2XH9 A;  1IEM A;  2IWB A;  3G34 A;  3UPP A;  1BUL A;  4GDB A;  2EXB A;  1PZO A;  1NYY A;  2HP5 A;  2XD5 A;  4C6Y A;  1XXM A;  3IWI A;  5FSR A;  3IF5 A;  4OQG A;  5GLC A;  4KZ3 A;  1PI4 A;  5AQB A;  1ES5 A;  3OCL A;  3DW0 A;  1CI8 A;  1KE0 A;  2UWX A;  1PW8 A;  3PBO A;  1L0G A;  3UN7 A;  3WS0 A;  1Y54 A;  1MWT A;  3EQU A;  4S2K A;  3S1Y A;  3UO9 A;  5DVA A;  5EVI D;  5F82 A;  3UY6 A;  3WRT A;  4EUZ A;  4R4R A;  4JF6 A;  1ERQ A;  5M18 A;  3GVB A;  1YLW A;  4KZ9 A;  4R4S A;  4E3I A;  1ONH A;  3OCN A;  1J9M A;  1BLP A;  5CXW A;  4ZBE A;  5FAS A;  3HRE A;  3M2J A;  1H8Y A;  3LY3 A;  3G4P A;  3NBL A;  4WEK A;  5GLA A;  1YLZ A;  1IYS A;  2XGN A;  3MXR A;  4E3N A;  4WZ5 C;  3BRM A;  3FV7 A;  1QME A;  4KZ5 A;  1RGZ A;  3Q7V B;  5FQI A;  2ZQC A;  4O7D A;  3GMW A;  3IXB A;  4Y0O A;  4B4Z A;  1C3B A;  4OPQ A;  1NYM A;  1YLP A;  1ES4 A;  3IHA A;  4ID4 A;  4DRT A;  1K55 C;  4GN2 A;  1I2W A;  1K4F A;  1BLC A;  1NJ4 A;  3VP4 A;  2HP9 A;  4OPZ A;  3MZD A;  3HL9 A;  5FDH A;  3A3E A;  4S2O A;  1XGJ A;  1TVF A;  4CPK A;  4KZ8 A;  3TG9 A;  4KG5 A;  5TGF A;  4PMA A;  4UA6 A;  1KDW A;  1I5Q A;  1MPL A;  3CMZ A;  4C3Q A;  3FYZ A;  3GTC A;  4YFM A;  3ZG7 B;  3PBT A;  3O3V A;  2WGV A;  1ES3 A;  2P74 A;  4L0L A;  1YMX A;  3IH8 A;  4R1G A;  3W4Q A;  1XA7 A;  3ZDJ A;  1JTD A;  4X55 A;  5EOE A;  1Q2Q A;  4KG2 A;  4U0T A;  2WAF A;  4Z9Q A;  1MBL A;  3ZVT A;  3VSL A;  3UPN A;  1RCJ A;  3HUN A;  3GRJ A;  3MKF A;  3C7U A;  4JXV A;  3WS4 A;  4C75 A;  1W7F A;  5CGW A;  1EI5 A;  1K6S A;  3IF6 A;  3N6I A;  5CHJ A;  5FI6 A;  4BJP A;  2I72 A;  1JVJ A;  3VSK A;  3GQZ A;  3HLW A;  4JXG A;  1S0W A;  5CRF A;  4NET A;  5FQQ A;  5HX9 A;  3P09 A;  1PIO A;  4LV3 A;  5EVI A;  4HES A;  4MBF A;  2JC7 A;  3BFF A;  2P9V A;  4YIN A;  3OPH A;  1O07 A;  5M19 A;  1K57 C;  4BD1 A;  3VP3 A;  3HUO A;  4LV2 A;  1JWZ A;  2XDM A;  1YQS A;  4OQ0 A;  3P98 A;  3V3R A;  2WGI A;  3IWO A;  3Q81 A;  4JLF A;  2Y2I A;  4RA7 A;  5BOH A;  1VQQ A;  1KGF A;  1SDN A;  4GD6 A;  1QMF A;  3V5M A;  5JYO A;  2ZC5 B;  4OKP A;  3HVF A;  4JF5 A;  1HVB A;  5CGX A;  4M3K A;  5HAR A;  1IYQ A;  3M2K A;  3FZC A;  1Q2P A;  1MXO A;  3MXS A;  4LCL A;  1MY8 A;  3UNW A;  2R9X A;  3Q07 A;  3BYD A;  4DE2 A;  3BFC A;  2Y2H A;  1NRF A;  2X01 A;  1RP5 A;  4K0W A;  4ZJ1 A;  5DF8 A;  5CHM A;  4BL3 A;  1LHY A;  4S2N A;  3MZF A;  3IWQ A;  5AQA A;  3DWK A;  4OVD A;  1LL5 A;  4MLL A;  1MKI A;  3ZG5 A;  4WZ5 A;  2WKE A;  3WS1 A;  3S22 A;  1PWC A;  1GHM A;  1GHI A;  4QJG A;  4E3O A;  2BLS A;  2OLV A;  3O88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...