1ESUA

S235a mutant of tem1 beta-lactamase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKAGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title TEM1 beta-lactamase structure solved by molecular replacement and refined structure of the S235A mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1esuA00
3IT9A 4QD4A 2H5SA 1BLHA 1H8YA 4XUZA 1LI9A 4IVKA 1WYBA 1K4FA 1YM1A 4QU3A 2I72A 3IWOA 1QMEA 3ZNTA 2BG1A 2H0TA 3W4QA 5FAOA 3N4IA 3OPLA 3WS2A 1YMXA 1CI8A 5TFQA 5CRFA 3IH8A 1JTDA 5CEBA 5CHJA 1SDEA 3AGDA 3DWZA 2R9WA 2WKIA 3MBZA 2WGIA 3NC8A 5FQKA 3HLEA 4R0QA 3TG9A 1NXYA 4KENB 4QB8A 3BFEA 1IYQA 1DY6A 4WYYA 5DF9A 4KZ3A 4N92A 5CEDA 2Y59A 1EWZA 3WS5A 1EROA 1M40A 1CK3A 3HLBA 1ALQA 2GDNA 3CZDA 1BTLA 1NZUA 3ZG8B 4LENA 4ZTKA 1O7EA 4MEZA 2X01A 3ZCZA 4DE0A 4HBUA 1BLPA 3IF6C 4GB7A 1FCNA 2WGWB 1KE0A 2QZ6A 1BZAA 3O88A 3S4XA 3UDIA 3G34A 4LV2A 3JYIA 1ONHA 2J7VA 4JF4A 3VOYA 3O86A 2RCXA 3EQVA 4KG2A 4OPRA 3HREA 3WS4A 3PBOA 4KZAA 1L0DA 1HD8A 1XGIA 1W5DA 4GDNA 4FSFA 1XPBA 2DCFA 5M19A 3OZHA 3UY6A 4OQHA 5EVIC 4S2NC 2DNSA 3BFCA 3BECA 3GV9A 1LLBA 2WGVA 1KE4A 1LI0A 4ZJ2A 1TDLA 1VM1A 3NI9A 4YFMA 4D2OA 5FSRA 2Y2JA 3Q7ZA 1SDNA 4U0TA 1MBLA 4BENA 3TOIA 3BFFA 3QNCA 4R4RA 4UAAA 1HZOA 1ERQA 3IF5A 3FV7A 4OLGA 4PM9A 1FR1A 4DKIA 3P98A 4GN2A 3ISGA 2WGWA 4FH4A 5FATA 4P85A 4X69A 2OSUA 2B5RA 3M2JA 4S2LA 5CTNA 1PWDA 4OKPA 1YT4A 1GHIA 3MKEA 5DTKA 3RJUA 2Y2LA 1QMFA 1YLJA 1NJ4A 4WEKA 3NY4A 1Q2PA 2HDRA 3IF6A 4LCMA 3DWKA 5A91A 4Y7PA 1MWTA 3QHYA 3I7JA 5FI6A 2IWDA 3AGFA 4GD8A 4WM9A 3WS0A 1ZKJA 5KMWA 1KVMA 2WAFA 3E2KA 3M2KA 2X02A 3B3XA 4X6TA 3N8RA 5EECA 4OQGA 5FI2A 2WAEA 1SHVA 2EX6A 1PZOA 3GQZA 3TSGA 1WYCA 3ZDJA 2HP9A 2ZC6B 3PTEA 1GA9A 5FAQA 2ZJ9A 4S2NA 5EE8A 2G2WA 1E3UD 5KSHA 5GLBA 2Y2IA 4BLMA 1K57C 4KQRA 3VSKA 4EV4A 4BJPA 3VP1A 3NCKA 2VGKA 3IH9A 5HAIA 3Q07A 4B4ZA 3HL9A 1KGFA 5CXWA 3V3RA 4FD8A 3SH8A 4FCFA 5DF8A 4DRTA 4KQQA 4R3BA 2EX9A 5E2GA 3WS1A 4X53A 1PI4A 4WBGA 4PMAA 4BD1A 2ZC4B 2OLVA 2WZXA 1TEMA 3BEBA 2Y55A 2XD1A 4GKUA 4QY5A 2XR0A 1RGYA 2HDSA 3CMZA 3DTMA 3LY3A 1N9BA 1ZC2A 1MWUA 1ES4A 3UPOA 1L0EA 2OV5A 1J9MA 2ZC7A 4E6XA 4X56A 2ZQAA 2EXBA 4S2IA 2ZQ8A 4Y0TA 2EFUA 3FYZA 4ZBEA 1YLPA 3CG5A 3VP3A 1H5XA 2PU4A 2XEPA 2XDMA 5HFOA 4OPQA 4N1XA 1C3BA 1NRFA 1K6SA 4N1HA 3V39A 5G18A 3O3VA 4BL3A 5HAPA 1VQQA 2JE5A 2XLNA 1KGGA 4U0XA 3V3SA 5JYPA 1SCWA 4JKTA 1JWVA 1PW8A 4WZ5A 4E3NA 5KZHA 5TGFA 1MWRA 3V50A 1L0GA 3UE0A 2ZM0A 3C4PA 2Y2PA 4OOLA 3G30A 5GLAA 5M1AA 5F82A 1I5QA 1NYYA 4E3IA 1K57A 1E3UA 4DXBA 4KZ7A 4UA6A 4E3MA 3N6IA 3S22A 4GNUA 1AXBA 4OVDA 4JBFA 2ZQ9A 2ZLYA 4OQ0A 3UN7A 5EOEA 2XFSA 3VSLA 1LL5A 1XKZA 2DRWA 3ZG7B 1CEGA 5FQMA 2Q9NA 2Y2KA 4K91A 4KZ4A 3OC2A 4N9KA 4EBNA 4RX2A 3UDFA 3S1YA 1PYYA 4B88A 3GSGA 1XX2A 5AQAA 4E6WA 1M6KA 3AGEA 4ID4A 4K0XA 4EBPA 1FCMA 3LY4A 1RP5A 4RYEA 2Y2MA 1NY0A 5HL1A 1WE4A 4MLLA 3W4OA 5DTTA 1XGJA 4DF6A 4EBLA 1H8ZA 1PZPA 2ZM2A 3HLFA 2ZQDA 4NK3A 4E3JA 2ZD8A 1PWGA 2ZQ7A 3FKVA 5CGSA 1L2SA 3PBTA 3ZVWA 3BLSA 4DE3A 5F1FA 1ERMA 1FSYA 1L0FA 5U47A 2ZC5B 3C5AA 3C7UA 3IXHA 3MZFA 4R23A 3MXRA 3N8LA 3N8SA 4C6YA 1YLTA 2UWXA 2XGNA 1KE3A 2WADA 4QJGA 3SS4A 3PBRA 2EFXA 4JXWA 1JWZA 3Q7VB 3V5MA 2P9VB 1W79A 2Y2OA 3OPRA 4UA9A 1YLWA 3ZG9B 3Q82A 2Y4AA 2J9PA 3A3DA 3DW0A 1IKGA 1HVBA 2WKHA 5KSCA 4ZAMA 3N7WA 3OCLA 4P87A 3UPNA 1YLYA 3WWXA 4DDYA 3IXBA 4KG5A 4QHCA 1TVFA 3E2LA 3PBSA 2XF3A 4JF5A 1BLCA 1CI9A 2XK1A 5E2EA 4PM6A 1YQSA 3BLMA 3UE1A 3C7VA 2R9XA 1K38A 4R4SA 5FQIA 4WZ5C 2PU2A 5CHUA 4E3LA 4L0LA 4X55A 4JF6A 3WRZA 3HVFA 1IYSA 1FQGA 3ZGAB 2J9OA 1HTZA 2HDQA 2ZC3B 3SS5A 4IBRA 3ITBA 1KGEA 2XQZA 4S2JA 3LCEA 4EWFA 3G31A 1E25A 2XD5A 3PAGA 4S2OA 5DVAA 5FA7A 2E8IA 3VFHA 4UHUA 1BUEA 2OLUA 1IEMA 3OPPA 5HARA 4X68A 1IKIA 5E2HA 3PAEA 3HLGA 2P9VA 1ONGA 3BM6A 4MBKA 5E43A 1JVJA 1RCJA 5FDHA 2HP6A 4WELA 1K25A 5GHYA 5CERA 3IQAA 2Q9MA 2V2FF 3Q1FA 3G35A 4ZJ1A 1JTGA 2PBYA 4OQIA 2WYXA 5EUAA 1DJBA 1GHPA 5DTSA 3GRJA 4R1GA 5I94A 1DJAA 3OPHA 4MBFA 4IVIA 3IHAA 2WZZA 3A3FA 1BLSA 1MWSA 1K55C 2WKEA 4RA7A 3LO7A 2JBFA 1IYPA 1KDWA 2HPBA 4S2PA 2EX2A 2Y2GA 3UE3A 2C6WB 4R3JA 3IHBA 3QNBA 4HEFA 1E4DA 4S2KA 2X71A 3NDEA 3ZNYA 1TDGA 4BL2A 1Y54A 1DJCA 4LCLA 5IHVA 4KZBA 1ESUA 4H8RA 1K54C 3P09A 4BD0A 5FASA 1U60A 2EXAA 1G68A 3HLDA 1ZG6A 1I2SA 1FSWA 3VP4A 3A3JA 3CJMA 3W8KA 3GMWA 1FOFA 3BRMA 3HUOA 5FQ9A 3ZFZA 5M18A 3HBRA 1NZOA 4NETA 4LV1A 4GD6A 2QPNA 1N4OA 5EVLA 3ZVTA 4DDSA 1GA0A 4C3QA 4PPRA 2C5WB 3LEZA 4UA7A 1K56D 5GLDA 4E3KA 1Q2QA 3FZCA 3MZDA 2Y2HA 3ITAA 3OCNA 2QMIA 5AQ7A 2CC1A 1YLZA 4WMCD 4P0MA 4XXRA 4IEDA 1NYMA 4OLDA 1ESIA 5FAPA 1W7FA 5F1GA 2Z2MB 4FH2A 4OOYA 4F94A 1MKIA 2FFFB 1JWPA 2FFYA 4C75A 3PBNA 3HUMA 4P6BA 3IXGA 1BULA 4CPKA 4PM5A 5F83A 1LHYA 4XUXA 2JCHA 4KG6A 4KQOA 4OPZA 4Q8IA 1K55A 3GTCA 4ZDXA 5BOHA 5L2FA 4RVAA 1BSGA 2P74A 4K0WA 4PM7A 3M6BA 1MY8A 3BFGA 3HLCA 1IELA 3MZEA 4HBTA 4OP8A 3RXWA 2V1ZA 4M3KA 4IBXA 5CTMA 3SH7A 3IF6B 4CJNA 5GL9A 1BT5A 1FR6A 2XH9A 3D4FA 5DF7A 1XA7A 4EUZA 1YMSA 1K54A 5EVID 4OP5A 2WUQA 5CECA 4WEJA 3VMAA 4GOGA 2A3UA 4KZ9A 4KZ5A 4BQMA 1ZG4A 4WZ4A 3C4OA 2A49A 3G2ZA 5A90A 2HP5A 4OONA 2EX8A 1RGZA 5FQJA 4OPYA 1W8YA 2G2UA 1MPLA 2J8YA 3HUNA 2Z2LB 3M6HA 3SOIA 4OOMA 1ES5A 3G2YA 4B4XA 3G32A 1IYOA 4Y0OA 5A92A 4N9LA 3UPPA 4HESA 4MBHA 3NIAA 1W8QA 3IWQA 4S2MA 4QY6A 5EVIB 1FCOA 1LL9A 3VP0A 1PIOA 4DE1A 5HAQA 3UO9A 3PBQA 3BFDA 4PM8A 1S6RA 2BLSA 5D3OA 1K56A 3ZG5A 3Q81A 3RXXA 3UNWA 3WRTA 1Z6FA 4JXGA 5FQQA 2Y2QA 5HX9A 5GHXA 3ZHHA 4WMCA 4JLFA 4Y0UA 4DXCA 4LV0A 1GHMA 1PI5A 4Z9QA 4OH0A 2VGJA 3MXSA 3O87A 3VFFA 3A3IA 4ZJ3A 1OMEA 1K4EA 2ZQCA 5EPHA 3G4PA 4GDBA 4JXVA 4EQIA 4O7DA 1ES2A 3A3EA 3NDGA 3FKWA 3W4PA 1MXOA 1ES3A 2H10A 2RL3A 2ZMAA 5AQBA 4RX3A 3Q7VA 5CHMA 3VOZA 1XXMA 5HW3A 5A93A 3VP2A 4DE2A 5JYOA 1CEFA 2Y2NA 4LV3A 1GCEA 3GR2A 2IWBA 3BYDA 3MFDA 1XP4A 2WK0A 4KZ8A 1K6RA 5EVIA 2ZM8A 3FWLA 3SH9A 4JPMA 3MKFA 3IWIA 5EOOA 4A5RA 2HDUA 5FI7A 4E3OA 1EI5A 2H0YA 3GVBA 5E2FA 2Y91A 3IXDA 1XA1A 5J8XA 5GLCA 4YINA 1PWCA 5AQ9A 5CGXA 3EQUA 4JXSA 1KVLA 3SS3A 2V20A 3ZG0A 1PW1A 3UDXA 3NBLA 5GHZA 5CGWA 1KDSA 2IWCA 1G6AA 2JC7A 3HLWA 4U3TA 1SKFA 4KZ6A 4GZBA 1S0WA 4MNRA 5TR7A 1I2WA 2XFTA 1O07A
chains in the Genus database with same CATH superfamily
3IT9A 1SZVA 1YM1A 4BBUA 3TJZC 2I72A 3N4IA 3NULA 3CPTA 3MR0A 5CHJA 1UGUA 4GHIA 3HLEA 1DY6A 3T1SA 2Y59A 1Y4OA 1M40A 3HLBA 3LR4A 2GDNA 1NZUA 3ZG8B 1BLPA 3IF6C 3DAVA 3B42A 3K3CA 3S4XA 5L10A 3IS2B 4BBTA 4JF4A 3LI8A 3NHQA 3O86A 3HREA 2WKRA 3KSIA 3PBOA 4KZAA 4KUOA 1L0DA 1XJ2A 2VV6A 2QJ7A 4OQHA 2DNSA 4GJ4A 3GV9A 4R3AA 1KE4A 3OBFA 2UV0E 5FSRA 2OOLA 3Q7ZA 4U0TA 1MBLA 4DJ2A 4R4RA 4X1MA 2ZL1B 4GN2A 4FH4A 4P85A 2W27A 2B5RA 3M2JA 5CTNA 4NXGA 3ULFA 1NJ4A 4WEKA 4EQ1A 1Q2PA 3IF6A 3BQ8A 3SZTA 4GD8A 4O8GA 3WS0A 4EERA 2X02A 3KO6A 5EECA 1WYCA 5HSQA 3ZDJA 2HP9A 3PTEA 1NRJA 1E3UD 3LIFA 2Y2IA 4I39A 2JKTM 3NCKA 2M7VA 3Q07A 4H6JB 5CXWA 3V3RA 4FD8A 4FCFA 5G4ZA 5DF8A 5E2GA 4X53A 1PI4A 2WZXA 2KLIA 1TEMA 1D1JA 2XD1A 2XR0A 3LEQA 3LY3A 1N9BA 1MWUA 4E6XA 2A2LA 3FYZA 1YLPA 1NWZA 3KSFA 2XEPA 3E98A 1NRFA 1K6SA 1VQQA 2JE5A 3CITA 1KGGA 1JWVA 2QJ5A 4YWZA 1JNUA 5GLAA 3T1QB 2G7UA 4E3IA 5MC7A 2XRNA 1AXBA 2ZLYA 5EOEA 4JGOA 1LL5A 2OWJA 2W3FA 4RX2A 3CWFA 3GSGA 1XX2A 1RP5A 4RYEA 2Y2MA 5HL1A 4DF6A 1N9LA 3LIDA 1PZPA 1LSVA 3EEAA 5CGSA 3NOUC 3C5AA 2GJ3A 1YLTA 2UWXA 2JN7A 4NKPA 2FH5A 4Q0JA 3E4QA 3OPRA 4UA9A 1T19A 2PYRA 3N7WA 3R7WB 3NOTC 3TW8A 3H82B 3NJAA 4KG5A 1TVFA 2NUTC 2ZMVA 1H8MA 1CI9A 4Y3IA 3UE1A 1K38A 5FQIA 4CLCA 4WZ5C 1G5UA 2PU2A 4E3LA 4JF6A 4KQDA 1IYSA 1FQGA 1XFNA 4IBRA 3ITBA 4S2JA 4EWFA 3G31A 3PAGA 5DVAA 1NLYA 4Q0IA 3KYZA 1DP9A 1ONGA 2VV7A 5FDHA 2HP6A 3OLOA 4PAUA 2V2FF 4ARZA 2XROA 1P9WA 3C38A 3GRJA 3JVUA 3OPHA 1K55C 4S2PA 2Y2GA 4HEFA 3GDIA 3NECA 1Y54A 3DTEA 2JKRI 1OTBA 4LCLA 4HJ3A 1G68A 3HLDA 3QP8A 4E04A 5AVFA 1OT6A 1FOFA 3ZFZA 3BW6A 2W1TB 1NZOA 2QPNA 1MZUA 1N4OA 1GA0A 2KX6A 3A0RA 4LRXC 3PR6A 1KOUA 2GNXA 3LEZA 4K08A 1K56D 5L8MA 5GLDA 4E3KA 2O9CA 1Q2QA 3EOIA 3DTKA 2CC1A 3S7PA 3LICA 2MJ6A 1ESIA 1W7FA 4F94A 4WF0A 2EWVA 1LT0A 2VX8A 3PXPA 1G6OA 2JCHA 3C8CA 3A0VA 4OPZA 4Q8IA 1K55A 4G3VA 2J80A 4GS9B 2P74A 4PM7A 3MQ0A 4OP8A 1MY8A 1Y28A 2ZOIA 5CTMA 2K2NA 1XA7A 1YMSA 1OJ5A 2R78A 4GOGA 4BQMA 3C4OA 5A90A 3CAXA 1RGZA 5CX7A 2J8YA 3KSHA 1TS6A 5C5KA 3SOIA 1ES5A 3L7HA 4Y0OA 3H7WB 5A92A 3P01A 4QY6A 1LL9A 1PIOA 5DFXA 5HAQA 1V9ZA 2NUPC 3BFDA 4KUKA 3ZG5A 3UNWA 5FQQA 2Y2QA 3EWKA 5GHXA 3MFXA 4II7A 4Y0UA 3IX3A 1PI5A 2Y79A 2VGJA 3LR3A 2PBDP 3RH8B 4EQIA 1K4EA 4JXVA 4O7DA 2VGLM 4XT2B 1ES2A 3FKWA 1F2KA 3OOVA 1S1YA 2A24A 2RL3A 5L07A 2HZ5A 1S1ZA 5AJGA 3Q7VA 2ZOHA 1S66L 5HW3A 4DE2A 1XP4A 2XA7S 2L4RA 5EVIA 5L09A 3SH9A 4ESPA 5EOOA 1EI5A 3GVBA 3IXDA 4EW7A 4YINA 2W3DA 1OT9A 2JKRM 2QHKA 3G6OA 3ZG0A 1GSWA 3LGOA 1G6AA 1S4RA 2YKFA 3HLWA 5DFYA 4KZ6A 3IHAA 1I2WA 1O07A 4XUZA 1K4FA 3W2ZA 3IWOA 3ZNTA 2H0TA 4JGPA 3OPLA 5CRFA 3AGDA 2R9WA 5FQKA 3TG9A 4MN5A 1IYQA 2J3WA 1LSXA 4KZ3A 4N92A 3WS5A 3UB9A 4MEZA 4GB7A 3V67A 2QZ6A 1BZAA 3O88A 3UDIA 3G34A 4LV2A 4FOFA 2RCXA 4QPRA 5F69A 3S7NA 1P0ZA 1N9OA 1W5DA 4GDNA 5LBRA 3OZHA 2INWA 3UY6A 1LLBA 2WGVA 1TDLA 2DMWA 4YFMA 4HJ4A 1SDNA 3FG8A 3QNCA 2PAVP 4EUVA 4PM9A 3ISGA 5FATA 3F1PB 3A0SA 1ACFA 1YT4A 3MKEA 3RJUA 2Q0OA 5A91A 5KIZA 1XJ3A 4Y7PA 3QHYA 5EM0A 3T1RA 1LL8A 2W0NA 1ZKJA 2V8FA 1FILA 4JGQA 1GSVA 5FI2A 3TSGA 4I3IA 4MMNA 2O0YA 1T18A 2ZJ9A 2OWHA 1K57C 4KQRA 3T4OA 4Y5FA 5A8BA 3VP1A 3HL9A 3TRCA 3SH8A 4DRTA 4DMZA 3WS1A 4PMAA 4IUHA 4BD1A 2ZC4B 2PR5A 1F5MA 2V8CA 1RGYA 3VOLA 3MS6A 1ZC2A 2OV5A 2ZC7A 2ZQAA 4PKYA 2WKPA 4Y0TA 4ZBEA 5HWTA 5HFOA 4OPQA 4LRYC 3O3VA 1VETA 5HAPA 3E4PA 5JYPA 5J4EA 5KZHA 1S4SA 2Y2PA 4YOFA 3G30A 4QWOA 5EM1A 1K57A 2PRFA 4KZ7A 4UA6A 3T4KA 2ZQ9A 3UN7A 3VSLA 1XKZA 4CLCD 3NOPC 1SKOB 4EBNA 2JKGA 4HP9A 3S1YA 4B88A 5AQAA 1M6KA 3AGEA 3D72A 1FCMA 3R4KA 1NY0A 3K3DA 5TBMA 4RQ9A 2ZM2A 3HLFA 4E3JA 2ZQ7A 3ZVWA 3BLSA 1FSYA 4M4XA 5U47A 2ZC5B 3C7UA 3MZFA 3N8LA 3N8SA 4NG2A 3SS4A 4R70A 2PDRA 1JWZA 2P9VB 2Y2OA 3FC7A 4UEYA 1YLWA 3SW1A 3U4LP 4ZAMA 2W3EA 4O01A 1BLCA 3IBJA 5E2EA 3C7VA 4HI4A 4MN6A 3HVFA 3ZGAB 3UE6A 2J9OA 2AVXA 1HTZA 4BBVA 2E8JA 2HDQA 2ZC3B 3PHYA 2W3HA 3E4OA 5FA7A 2E8IA 3VFHA 3KSGA 1IEMA 5HARA 1IKIA 3HLGA 3BM6A 1RCJA 4WELA 2Y8HA 3CPTB 1STZA 3G35A 4ZJ1A 1VEUA 2PBYA 4OQIA 2WYXA 3R7WA 1OJGA 3F1NA 5DTSA 5I94A 1J3WA 4MBFA 2WZZA 3UB8A 2WKEA 4HIAA 3LO7A 2JBFA 2EX2A 2C6WB 4R3JA 1E4DA 2X71A 3NDEA 1ESUA 2D02A 3P09A 1T1AA 4UQIS 4LPZA 1I2SA 4Y15A 1AWIA 1TS0A 3BRMA 3HUOA 1W63Q 5M18A 2GZAA 1N9NA 4G3WA 4NETA 5EVLA 3ZVTA 4PPRA 3MQOA 2C5WB 3T4TA 4UA7A 2FZ0A 1YKDA 4P0MA 4OLDA 4CLCC 5FAPA 4ZRRA 5F1GA 4OOYA 1MKIA 4FUWA 1D7EA 1JWPA 2FFYA 2FFFB 3PBNA 4P6BA 4C75A 3HCYA 4KG6A 3CUEC 1H3QA 5BOHA 5L2FA 3MSHA 4K0WA 1DP8A 3BFGA 3HLCA 1IELA 1YAXA 4HBTA 3UMEA 2VGLS 3IF6B 5GL9A 2XH9A 4EUZA 5EVID 5CECA 4KZ5A 4MCWA 2BASA 1GSXA 4F3LA 2HP5A 2EX8A 3B47A 1W8YA 1MPLA 4IJGA 4G3KA 3M6HA 4OOMA 1IYOA 4N9LA 3UPPA 4HESA 3NIAA 1W8QA 1P97A 5IU1A 4S2MA 4DE1A 3PBQA 1S6RA 2HV1A 3F1OA 1Z6FA 5HX9A 1YSQA 3LI9A 2B18A 1GHMA 3O87A 5HPFA 4P6ZM 3VFFA 3CUEA 1TD5A 2QWSA 5AQBA 1CJFA 3FPWA 5JYOA 3H7WA 1GCEA 4WLAA 2IWBA 3BYDA 4KZ8A 1K6RA 2ZM8A 3IWIA 2HDUA 3JVVA 1ODVA 1PWCA 3UMDA 3EQUA 2V20A 1PW1A 2QYBA 3T4LA 4U3TA 2KOIA 4XT2A 4S2LA 4QD4A 2H5SA 1H8YA 4IVKA 4QU3A 3IX8A 2BG1A 3W4QA 5FAOA 1YMXA 5TFQA 3VE4A 2GX5A 1SDEA 3DWZA 2WKIA 1TF1A 2WGIA 3LR0A 4R0QA 1NXYA 4KENB 4QB8A 3VE3A 3BFEA 4NXBA 1UWPX 1EWZA 1EROA 3CZDA 3MQQA 1BTLA 5FEGA 4LENA 3ZCZA 2VLGA 2BTFP 2WGWB 4HP4A 3JYIA 1ONHA 1F98A 5F6AA 4R38A 3VOYA 3C30A 4I3AA 4OPRA 2I9VA 1XGIA 1XPBA 5M19A 4Z1WA 5EVIC 1YPRA 1TS8A 3BFCA 3BECA 1DP6A 4ZJ2A 4D2OA 3TOIA 3ZYTA 3BFFA 4UAAA 4OLGA 2HGVA 5IS1A 4DKIA 3P98A 4JGRA 4X69A 2OSUA 1PWDA 1GHIA 5DTKA 2Y2LA 1YLJA 3O5YA 3NY4A 1MWTA 5FI6A 2IWDA 3AGFA 5F68A 5KMWA 4ETXA 2WAFA 3E2KA 3M2KA 2VJWA 3B3XA 3N8RA 3HJIA 2P08A 1SHVA 2V9AA 1PZOA 3B33A 2ZC6B 1PNEA 5FAQA 2V1BA 2L1MA 5EE8A 4B9OA 1HLUP 2G2WA 4HH2A 5GLBA 4BLMA 4Y17A 2VGKA 3IH9A 1KGFA 2VA0A 4KQQA 4R3BA 2EX9A 3LIBA 4I5SA 5AVEA 3BEBA 2Y55A 4QY5A 2HDSA 3CMZA 3DTMA 4O0PA 3UPOA 1L0EA 1P9RA 2PR6A 5EFWA 5EV0A 4X56A 2EFUA 4X25A 3VP3A 1H5XA 2PU4A 2ZBBA 3T1XA 2XDMA 4HNBA 1C3BA 3V39A 5G18A 4L9FA 4U0XA 3V3SA 1SCWA 1PW8A 1MWRA 3V50A 1L0GA 4I3JA 2ZM0A 3C4PA 5M1AA 5F82A 1I5QA 1NYYA 4DXBA 3KYEA 3N6IA 4GNUA 5J3WA 4OVDA 1PRQA 2XFSA 3ZG7B 2Q9NA 4KZ4A 3OC2A 4N9KA 2B02A 4DJ3A 3UDFA 1PYYA 1K0KA 3CI6A 4ID4A 4EBPA 3LY4A 1WE4A 3W4OA 1X0OA 3C2WA 3T4JA 4ME4A 1H8ZA 3GECA 4NK3A 3FKVA 2KDKA 3PBTA 4DE3A 5F1FA 1L0FA 2W1RA 3IXHA 3IS2A 3LUQA 2XGNA 1KE3A 2WADA 4QJGA 2ACGA 2EA9A 3Q7VB 3V5MA 1VB6A 3ZG9B 2J9PA 1SKOA 3DW0A 1IKGA 2WKHA 4P87A 3UPNA 1YLYA 4DDYA 4QHCA 3PBSA 4JF5A 2XK1A 3T12B 1ZHHB 3UB5P 3L9KA 2R9XA 1S67L 4R4SA 5CHUA 4L0LA 4X55A 3UB6A 3BY9A 2ZL1A 3SS5A 5HDSA 2XQZA 3LCEA 1E25A 4S2OA 1BUEA 2OLUA 2IA2A 3OPPA 4X68A 5E2HA 3RTYA 2Z6DA 3PAEA 2P9VA 2V1AA 5E43A 1K25A 5CERA 2Q9MA 3Q1FA 1JTGA 2JHEA 5DKLA 3DTIA 1GHPA 4R1GA 1T1CA 4R6LA 4IVIA 4RA7A 1IYPA 2HPBA 3IHBA 3QNBA 4S2KA 4BL2A 1DJCA 4GW9A 3PYPA 4KZBA 4H8RA 1K54C 2PT7A 3IX4A 1FIKA 5FASA 2EXAA 2PD8A 5DKKA 4PHTA 3GMWA 4H6JA 3HBRA 4PKYG 4GD6A 4DDSA 4LRZE 5K5BA 3FZCA 4I38A 2LB9A 2XA7M 3ITAA 2CMNA 2JKFA 5AQ7A 3HJKA 4FH2A 4ETZA 4PM5A 3HUMA 3BJNA 4CPKA 5F83A 4KQOA 4MDZA 4ZDXA 1BSGA 4P6ZS 3M6BA 3MZEA 2V1ZA 4M3KA 4IBXA 4CJNA 1BT5A 1FR6A 1OTIA 3D4FA 3T50A 1K54A 4WEJA 3VMAA 2A3UA 5FDSA 3G2ZA 3T4SA 4OPYA 3QP1A 4EXOA 2Z2LB 4B4XA 4WUJA 3G32A 4MBHA 4HQAA 3IWQA 3FPVA 3VP0A 4BWIA 1XJ4A 4PM8A 3S7QA 2PYPA 3Q81A 3WRTA 4WMCA 4JLFA 4HJ6A 4DXCA 2VZWA 4Z9QA 3G4PA 4GDBA 3NDGA 4IHQA 4HH3A 3W4PA 1MXOA 3KX0X 2ZMAA 4CQHA 5CHMA 3T4QA 3VOZA 3LIAA 3MJQA 5A93A 1CEFA 2Y2NA 2WK0A 3FWLA 4L9GA 4JPMA 3MKFA 4GHIB 3H82A 4A5RA 5FI7A 4E3OA 2H0YA 1VETB 2K7SA 5E2FA 5J8XA 4JXSA 1KVLA 2O9BA 5TJJA 3NBLA 5GHZA 5CGWA 1KDSA 5J7EA 2L0WA 4EESA 2JC7A 2W3GA 5HD5A 4GZBA 4LFUA 4MNRA 5TR7A 1H0MA 4MLLA 3MXQA 4HY8A 1UWNX 1BLHA 1LI9A 1WYBA 4GLQA 1QMEA 3WS2A 1CI8A 3EGDC 3IH8A 1JTDA 5CEBA 3MBZA 3NC8A 2Z6CA 5TBMB 4Y13A 4WYYA 5DF9A 5CEDA 1XJ6A 1CK3A 1ALQA 3P7NA 4ZTKA 1O7EA 2X01A 4DE0A 4HBUA 2HJEA 1FCNA 1KE0A 3QP6A 2J7VA 4WL9A 4B93A 3EQVA 4KG2A 3WS4A 4L9EA 3U2AA 1HD8A 2W1TA 4FSFA 2M7UA 2DCFA 2VEAA 3CHWP 1WA9A 4CLCE 5EVEA 4S2NC 1DRMA 5HPIA 3KYQA 1LI0A 1VM1A 3NI9A 1Z09A 2Y2JA 4BENA 1HZOA 1ERQA 3IF5A 3EEHA 3FV7A 1FR1A 2WGWA 3BWLA 4YNRA 5F5YA 4GS9A 4OKPA 1QMFA 2HDRA 4LCMA 3DWKA 1VEUB 3I7JA 1D06A 2PHYA 5HL6A 2ZMFA 3F1NB 4WM9A 5DJTA 1KVMA 1NLZA 4X6TA 4OQGA 2WAEA 2EX6A 1MC0A 3GQZA 3MMHA 5G4YA 4D60A 1GA9A 2H28A 4S2NA 5KSHA 4WN5A 4EV4A 3VSKA 2B95A 4BJPA 2VV8A 5HAIA 2K31A 4B4ZA 2O99A 2V0UA 2OAQ1 2VKSA 5I5LA 4WBGA 2OLVA 4GKUA 3LR5A 5HWVA 5HZHA 3TE8A 1ES4A 1J9MA 2EXBA 4S2IA 2ZQ8A 3CG5A 4NXEA 4N1XA 4N1HA 3E0YA 4BL3A 2XLNA 1VHMA 4JKTA 4WZ5A 4E3NA 5TGFA 3UE0A 4OOLA 1T1BA 1E3UA 2WKQA 4E3MA 3S22A 3MF0A 4F3LB 4JBFA 3H9WA 4OQ0A 4EEPA 3IBRA 2DRWA 1CEGA 2EWWA 5FQMA 3S7OA 4HOIA 2Y2KA 4K91A 4NXFA 2P04A 3UB7A 1OPXA 2LB5A 4IUKA 4E6WA 4K0XA 1BYWA 5DJUA 2O9AA 3F1OB 2HJ9C 5DTTA 1XGJA 4EBLA 3LFVA 4CLCB 1OTEA 2ZQDA 4AFIA 2ZD8A 1PWGA 4UQIM 1L2SA 1ERMA 4R23A 3MXRA 4C6YA 3PBRA 2EFXA 4JXWA 3LIEA 1W79A 3Q82A 2Y4AA 3A3DA 4ARZB 1HVBA 5KSCA 3OCLA 3WWXA 1ZTUA 3IXBA 3E2LA 2XF3A 1EW0A 4PM6A 1YQSA 3BLMA 1A0KA 4Q0HA 4Y2FA 3WRZA 3QP5A 1IOUA 2OAP1 3F1PA 4GCZA 1KGEA 1G28A 2VK3A 2XD5A 3VV4A 4UHUA 5FEFA 4MBKA 1JVJA 3D3OA 5GHYA 3IQAA 1OTDA 5HDCA 5EUAA 2YKHA 1DJBA 1IFQA 2J3TD 1DJAA 3JPUA 4LGWA 3A3FA 1BLSA 1MWSA 1KDWA 3UE3A 2V0WA 1YSPA 5FL3A 4DN0A 4MN7A 3ZNYA 1TDGA 5IHVA 3ICYA 3EGXC 4BD0A 1U60A 1ZG6A 1FSWA 3VP4A 3A3JA 3CJMA 3W8KA 5FQ9A 4LV1A 3DBAA 4C3QA 3D9YA 3MZDA 2Y2HA 3OCNA 4FTXA 2QMIA 1YLZA 4WMCD 3LYXA 4XXRA 4IEDA 1NYMA 2HF6A 3K2NA 2Z2MB 5HDDA 3IXGA 1BULA 1LHYA 4XUXA 4LLOB 1L3LA 3GTCA 4HHDA 4RVAA 3RXWA 2D01A 4NEED 3SH7A 5DF7A 4OP5A 2WUQA 1CQAA 4KZ9A 1ZG4A 4WZ4A 5HWWA 2A49A 2A24B 4X1LA 4OONA 5FQJA 1XFQA 2G2UA 3HUNA 4BMWA 3G2YA 1OTAA 1F9IA 5EVIB 1V9YA 1FCOA 1LSWA 1W63M 3UO9A 2BLSA 3ZQ5A 5D3OA 1K56A 3RXXA 4JXGA 5IT5A 3ZHHA 2QKPA 4EEUA 4LV0A 2M1CA 1PFLA 4OH0A 3MXSA 4EETB 3A3IA 3CLOA 4ZJ3A 1OMEA 2ZQCA 5EPHA 3A3EA 3BY8A 1ES3A 2H10A 4RX3A 1XXMA 2XSSA 3VP2A 2PD7A 4LV3A 3GR2A 3MFDA 5HD3A 3QP2A 3RFBA 4EU0A 2J3TC 2Y91A 1MKMA 1XA1A 5GLCA 2P7JA 5AQ9A 1TS7A 5CGXA 3SS3A 3BQAA 2JKTI 3UDXA 3QP4A 2IWCA 1SKFA 1S0WA 1CF0A 2XFTA
chains in the Genus database with same CATH topology
3IT9A 4QD4A 2H5SA 1BLHA 1H8YA 4XUZA 1LI9A 4IVKA 1WYBA 1K4FA 1YM1A 4QU3A 2I72A 3IWOA 1QMEA 3ZNTA 2BG1A 2H0TA 3W4QA 5FAOA 3N4IA 3OPLA 3WS2A 1YMXA 1CI8A 5TFQA 5CRFA 3IH8A 1JTDA 5CEBA 5CHJA 1SDEA 3AGDA 3DWZA 2R9WA 2WKIA 3MBZA 2WGIA 3NC8A 5FQKA 3HLEA 4R0QA 3TG9A 1NXYA 4KENB 4QB8A 3BFEA 1IYQA 1DY6A 4WYYA 5DF9A 4KZ3A 4N92A 5CEDA 2Y59A 1EWZA 3WS5A 1EROA 1M40A 1CK3A 3HLBA 1ALQA 2GDNA 3CZDA 1BTLA 1NZUA 3ZG8B 4LENA 4ZTKA 1O7EA 4MEZA 2X01A 3ZCZA 4DE0A 4HBUA 1BLPA 3IF6C 4GB7A 1FCNA 2WGWB 1KE0A 2QZ6A 1BZAA 3O88A 3S4XA 3UDIA 3G34A 4LV2A 3JYIA 1ONHA 2J7VA 4JF4A 3VOYA 3O86A 2RCXA 3EQVA 4KG2A 4OPRA 3HREA 3WS4A 3PBOA 4KZAA 1L0DA 1HD8A 1XGIA 1W5DA 4GDNA 4FSFA 1XPBA 2DCFA 5M19A 3OZHA 3UY6A 4OQHA 5EVIC 4S2NC 2DNSA 3BFCA 3BECA 3GV9A 1LLBA 2WGVA 1KE4A 1LI0A 4ZJ2A 1TDLA 1VM1A 3NI9A 4YFMA 4D2OA 5FSRA 2Y2JA 3Q7ZA 1SDNA 4U0TA 1MBLA 4BENA 3TOIA 3BFFA 3QNCA 4R4RA 4UAAA 1HZOA 1ERQA 3IF5A 3FV7A 4OLGA 4PM9A 1FR1A 4DKIA 3P98A 4GN2A 3ISGA 2WGWA 4FH4A 5FATA 4P85A 4X69A 2OSUA 2B5RA 3M2JA 4S2LA 5CTNA 1PWDA 4OKPA 1YT4A 1GHIA 3MKEA 5DTKA 3RJUA 2Y2LA 1QMFA 1YLJA 1NJ4A 4WEKA 3NY4A 1Q2PA 2HDRA 3IF6A 4LCMA 3DWKA 5A91A 4Y7PA 1MWTA 3QHYA 3I7JA 5FI6A 2IWDA 3AGFA 4GD8A 4WM9A 3WS0A 1ZKJA 5KMWA 1KVMA 2WAFA 3E2KA 3M2KA 2X02A 3B3XA 4X6TA 3N8RA 5EECA 4OQGA 5FI2A 2WAEA 1SHVA 2EX6A 1PZOA 3GQZA 3TSGA 1WYCA 3ZDJA 2HP9A 2ZC6B 3PTEA 1GA9A 5FAQA 2ZJ9A 4S2NA 5EE8A 2G2WA 1E3UD 5KSHA 5GLBA 2Y2IA 4BLMA 1K57C 4KQRA 3VSKA 4EV4A 4BJPA 3VP1A 3NCKA 2VGKA 3IH9A 5HAIA 3Q07A 4B4ZA 3HL9A 1KGFA 5CXWA 3V3RA 4FD8A 3SH8A 4FCFA 5DF8A 4DRTA 4KQQA 4R3BA 2EX9A 5E2GA 3WS1A 4X53A 1PI4A 4WBGA 4PMAA 4BD1A 2ZC4B 2OLVA 2WZXA 1TEMA 3BEBA 2Y55A 2XD1A 4GKUA 4QY5A 2XR0A 1RGYA 2HDSA 3CMZA 3DTMA 3LY3A 1N9BA 1ZC2A 1MWUA 1ES4A 3UPOA 1L0EA 2OV5A 1J9MA 2ZC7A 4E6XA 4X56A 2ZQAA 2EXBA 4S2IA 2ZQ8A 4Y0TA 2EFUA 3FYZA 4ZBEA 1YLPA 3CG5A 3VP3A 1H5XA 2PU4A 2XEPA 2XDMA 5HFOA 4OPQA 4N1XA 1C3BA 1NRFA 1K6SA 4N1HA 3V39A 5G18A 3O3VA 4BL3A 5HAPA 1VQQA 2JE5A 2XLNA 1KGGA 4U0XA 3V3SA 5JYPA 1SCWA 4JKTA 1JWVA 1PW8A 4WZ5A 4E3NA 5KZHA 5TGFA 1MWRA 3V50A 1L0GA 3UE0A 2ZM0A 3C4PA 2Y2PA 4OOLA 3G30A 5GLAA 5M1AA 5F82A 1I5QA 1NYYA 4E3IA 1K57A 1E3UA 4DXBA 4KZ7A 4UA6A 4E3MA 3N6IA 3S22A 4GNUA 1AXBA 4OVDA 4JBFA 2ZQ9A 2ZLYA 4OQ0A 3UN7A 5EOEA 2XFSA 3VSLA 1LL5A 1XKZA 2DRWA 3ZG7B 1CEGA 5FQMA 2Q9NA 2Y2KA 4K91A 4KZ4A 3OC2A 4N9KA 4EBNA 4RX2A 3UDFA 3S1YA 1PYYA 4B88A 3GSGA 1XX2A 5AQAA 4E6WA 1M6KA 3AGEA 4ID4A 4K0XA 4EBPA 1FCMA 3LY4A 1RP5A 4RYEA 2Y2MA 1NY0A 5HL1A 1WE4A 4MLLA 3W4OA 5DTTA 1XGJA 4DF6A 4EBLA 1H8ZA 1PZPA 2ZM2A 3HLFA 2ZQDA 4NK3A 4E3JA 2ZD8A 1PWGA 2ZQ7A 3FKVA 5CGSA 1L2SA 3PBTA 3ZVWA 3BLSA 4DE3A 5F1FA 1ERMA 1FSYA 1L0FA 5U47A 2ZC5B 3C5AA 3C7UA 3IXHA 3MZFA 4R23A 3MXRA 3N8LA 3N8SA 4C6YA 1YLTA 2UWXA 2XGNA 1KE3A 2WADA 4QJGA 3SS4A 3PBRA 2EFXA 4JXWA 1JWZA 3Q7VB 3V5MA 2P9VB 1W79A 2Y2OA 3OPRA 4UA9A 1YLWA 3ZG9B 3Q82A 2Y4AA 2J9PA 3A3DA 3DW0A 1IKGA 1HVBA 2WKHA 5KSCA 4ZAMA 3N7WA 3OCLA 4P87A 3UPNA 1YLYA 3WWXA 4DDYA 3IXBA 4KG5A 4QHCA 1TVFA 3E2LA 3PBSA 2XF3A 4JF5A 1BLCA 1CI9A 2XK1A 5E2EA 4PM6A 1YQSA 3BLMA 3UE1A 3C7VA 2R9XA 1K38A 4R4SA 5FQIA 4WZ5C 2PU2A 5CHUA 4E3LA 4L0LA 4X55A 4JF6A 3WRZA 3HVFA 1IYSA 1FQGA 3ZGAB 2J9OA 1HTZA 2HDQA 2ZC3B 3SS5A 4IBRA 3ITBA 1KGEA 2XQZA 4S2JA 3LCEA 4EWFA 3G31A 1E25A 2XD5A 3PAGA 4S2OA 5DVAA 5FA7A 2E8IA 3VFHA 4UHUA 1BUEA 2OLUA 1IEMA 3OPPA 5HARA 4X68A 1IKIA 5E2HA 3PAEA 3HLGA 2P9VA 1ONGA 3BM6A 4MBKA 5E43A 1JVJA 1RCJA 5FDHA 2HP6A 4WELA 1K25A 5GHYA 5CERA 3IQAA 2Q9MA 2V2FF 3Q1FA 3G35A 4ZJ1A 1JTGA 2PBYA 4OQIA 2WYXA 5EUAA 1DJBA 1GHPA 5DTSA 3GRJA 4R1GA 5I94A 1DJAA 3OPHA 4MBFA 4IVIA 3IHAA 2WZZA 3A3FA 1BLSA 1MWSA 1K55C 2WKEA 4RA7A 3LO7A 2JBFA 1IYPA 1KDWA 2HPBA 4S2PA 2EX2A 2Y2GA 3UE3A 2C6WB 4R3JA 3IHBA 3QNBA 4HEFA 1E4DA 4S2KA 2X71A 3NDEA 3ZNYA 1TDGA 4BL2A 1Y54A 1DJCA 4LCLA 5IHVA 4KZBA 1ESUA 4H8RA 1K54C 3P09A 4BD0A 5FASA 1U60A 2EXAA 1G68A 3HLDA 1ZG6A 1I2SA 1FSWA 3VP4A 3A3JA 3CJMA 3W8KA 3GMWA 1FOFA 3BRMA 3HUOA 5FQ9A 3ZFZA 5M18A 3HBRA 1NZOA 4NETA 4LV1A 4GD6A 2QPNA 1N4OA 5EVLA 3ZVTA 4DDSA 1GA0A 4C3QA 4PPRA 2C5WB 3LEZA 4UA7A 1K56D 5GLDA 4E3KA 1Q2QA 3FZCA 3MZDA 2Y2HA 3ITAA 3OCNA 2QMIA 5AQ7A 2CC1A 1YLZA 4WMCD 4P0MA 4XXRA 4IEDA 1NYMA 4OLDA 1ESIA 5FAPA 1W7FA 5F1GA 2Z2MB 4FH2A 4OOYA 4F94A 1MKIA 2FFFB 1JWPA 2FFYA 4C75A 3PBNA 3HUMA 4P6BA 3IXGA 1BULA 4CPKA 4PM5A 5F83A 1LHYA 4XUXA 2JCHA 4KG6A 4KQOA 4OPZA 4Q8IA 1K55A 3GTCA 4ZDXA 5BOHA 5L2FA 4RVAA 1BSGA 2P74A 4K0WA 4PM7A 3M6BA 1MY8A 3BFGA 3HLCA 1IELA 3MZEA 4HBTA 4OP8A 3RXWA 2V1ZA 4M3KA 4IBXA 5CTMA 3SH7A 3IF6B 4CJNA 5GL9A 1BT5A 1FR6A 2XH9A 3D4FA 5DF7A 1XA7A 4EUZA 1YMSA 1K54A 5EVID 4OP5A 2WUQA 5CECA 4WEJA 3VMAA 4GOGA 2A3UA 4KZ9A 4KZ5A 4BQMA 1ZG4A 4WZ4A 3C4OA 2A49A 3G2ZA 5A90A 2HP5A 4OONA 2EX8A 1RGZA 5FQJA 4OPYA 1W8YA 2G2UA 1MPLA 2J8YA 3HUNA 2Z2LB 3M6HA 3SOIA 4OOMA 1ES5A 3G2YA 4B4XA 3G32A 1IYOA 4Y0OA 5A92A 4N9LA 3UPPA 4HESA 4MBHA 3NIAA 1W8QA 3IWQA 4S2MA 4QY6A 5EVIB 1FCOA 1LL9A 3VP0A 1PIOA 4DE1A 5HAQA 3UO9A 3PBQA 3BFDA 4PM8A 1S6RA 2BLSA 5D3OA 1K56A 3ZG5A 3Q81A 3RXXA 3UNWA 3WRTA 1Z6FA 4JXGA 5FQQA 2Y2QA 5HX9A 5GHXA 3ZHHA 4WMCA 4JLFA 4Y0UA 4DXCA 4LV0A 1GHMA 1PI5A 4Z9QA 4OH0A 2VGJA 3MXSA 3O87A 3VFFA 3A3IA 4ZJ3A 1OMEA 1K4EA 2ZQCA 5EPHA 3G4PA 4GDBA 4JXVA 4EQIA 4O7DA 1ES2A 3A3EA 3NDGA 3FKWA 3W4PA 1MXOA 1ES3A 2H10A 2RL3A 2ZMAA 5AQBA 4RX3A 3Q7VA 5CHMA 3VOZA 1XXMA 5HW3A 5A93A 3VP2A 4DE2A 5JYOA 1CEFA 2Y2NA 4LV3A 1GCEA 3GR2A 2IWBA 3BYDA 3MFDA 1XP4A 2WK0A 4KZ8A 1K6RA 5EVIA 2ZM8A 3FWLA 3SH9A 4JPMA 3MKFA 3IWIA 5EOOA 4A5RA 2HDUA 5FI7A 4E3OA 1EI5A 2H0YA 3GVBA 5E2FA 2Y91A 3IXDA 1XA1A 5J8XA 5GLCA 4YINA 1PWCA 5AQ9A 5CGXA 3EQUA 4JXSA 1KVLA 3SS3A 2V20A 3ZG0A 1PW1A 3UDXA 3NBLA 5GHZA 5CGWA 1KDSA 2IWCA 1G6AA 2JC7A 3HLWA 4U3TA 1SKFA 4KZ6A 4GZBA 1S0WA 4MNRA 5TR7A 1I2WA 2XFTA 1O07A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IT9 A;  4QD4 A;  2H5S A;  1BLH A;  1H8Y A;  4XUZ A;  1LI9 A;  4IVK A;  1WYB A;  1K4F A;  1YM1 A;  4QU3 A;  2I72 A;  3IWO A;  1QME A;  3ZNT A;  2BG1 A;  2H0T A;  3W4Q A;  5FAO A;  3N4I A;  3OPL A;  3WS2 A;  1YMX A;  1CI8 A;  5TFQ A;  5CRF A;  3IH8 A;  1JTD A;  5CEB A;  5CHJ A;  1SDE A;  3AGD A;  3DWZ A;  2R9W A;  2WKI A;  3MBZ A;  2WGI A;  3NC8 A;  5FQK A;  3HLE A;  4R0Q A;  3TG9 A;  1NXY A;  4KEN B;  4QB8 A;  3BFE A;  1IYQ A;  1DY6 A;  4WYY A;  5DF9 A;  4KZ3 A;  4N92 A;  5CED A;  2Y59 A;  1EWZ A;  3WS5 A;  1ERO A;  1M40 A;  1CK3 A;  3HLB A;  1ALQ A;  2GDN A;  3CZD A;  1BTL A;  1NZU A;  3ZG8 B;  4LEN A;  4ZTK A;  1O7E A;  4MEZ A;  2X01 A;  3ZCZ A;  4DE0 A;  4HBU A;  1BLP A;  3IF6 C;  4GB7 A;  1FCN A;  2WGW B;  1KE0 A;  2QZ6 A;  1BZA A;  3O88 A;  3S4X A;  3UDI A;  3G34 A;  4LV2 A;  3JYI A;  1ONH A;  2J7V A;  4JF4 A;  3VOY A;  3O86 A;  2RCX A;  3EQV A;  4KG2 A;  4OPR A;  3HRE A;  3WS4 A;  3PBO A;  4KZA A;  1L0D A;  1HD8 A;  1XGI A;  1W5D A;  4GDN A;  4FSF A;  1XPB A;  2DCF A;  5M19 A;  3OZH A;  3UY6 A;  4OQH A;  5EVI C;  4S2N C;  2DNS A;  3BFC A;  3BEC A;  3GV9 A;  1LLB A;  2WGV A;  1KE4 A;  1LI0 A;  4ZJ2 A;  1TDL A;  1VM1 A;  3NI9 A;  4YFM A;  4D2O A;  5FSR A;  2Y2J A;  3Q7Z A;  1SDN A;  4U0T A;  1MBL A;  4BEN A;  3TOI A;  3BFF A;  3QNC A;  4R4R A;  4UAA A;  1HZO A;  1ERQ A;  3IF5 A;  3FV7 A;  4OLG A;  4PM9 A;  1FR1 A;  4DKI A;  3P98 A;  4GN2 A;  3ISG A;  2WGW A;  4FH4 A;  5FAT A;  4P85 A;  4X69 A;  2OSU A;  2B5R A;  3M2J A;  4S2L A;  5CTN A;  1PWD A;  4OKP A;  1YT4 A;  1GHI A;  3MKE A;  5DTK A;  3RJU A;  2Y2L A;  1QMF A;  1YLJ A;  1NJ4 A;  4WEK A;  3NY4 A;  1Q2P A;  2HDR A;  3IF6 A;  4LCM A;  3DWK A;  5A91 A;  4Y7P A;  1MWT A;  3QHY A;  3I7J A;  5FI6 A;  2IWD A;  3AGF A;  4GD8 A;  4WM9 A;  3WS0 A;  1ZKJ A;  5KMW A;  1KVM A;  2WAF A;  3E2K A;  3M2K A;  2X02 A;  3B3X A;  4X6T A;  3N8R A;  5EEC A;  4OQG A;  5FI2 A;  2WAE A;  1SHV A;  2EX6 A;  1PZO A;  3GQZ A;  3TSG A;  1WYC A;  3ZDJ A;  2HP9 A;  2ZC6 B;  3PTE A;  1GA9 A;  5FAQ A;  2ZJ9 A;  4S2N A;  5EE8 A;  2G2W A;  1E3U D;  5KSH A;  5GLB A;  2Y2I A;  4BLM A;  1K57 C;  4KQR A;  3VSK A;  4EV4 A;  4BJP A;  3VP1 A;  3NCK A;  2VGK A;  3IH9 A;  5HAI A;  3Q07 A;  4B4Z A;  3HL9 A;  1KGF A;  5CXW A;  3V3R A;  4FD8 A;  3SH8 A;  4FCF A;  5DF8 A;  4DRT A;  4KQQ A;  4R3B A;  2EX9 A;  5E2G A;  3WS1 A;  4X53 A;  1PI4 A;  4WBG A;  4PMA A;  4BD1 A;  2ZC4 B;  2OLV A;  2WZX A;  1TEM A;  3BEB A;  2Y55 A;  2XD1 A;  4GKU A;  4QY5 A;  2XR0 A;  1RGY A;  2HDS A;  3CMZ A;  3DTM A;  3LY3 A;  1N9B A;  1ZC2 A;  1MWU A;  1ES4 A;  3UPO A;  1L0E A;  2OV5 A;  1J9M A;  2ZC7 A;  4E6X A;  4X56 A;  2ZQA A;  2EXB A;  4S2I A;  2ZQ8 A;  4Y0T A;  2EFU A;  3FYZ A;  4ZBE A;  1YLP A;  3CG5 A;  3VP3 A;  1H5X A;  2PU4 A;  2XEP A;  2XDM A;  5HFO A;  4OPQ A;  4N1X A;  1C3B A;  1NRF A;  1K6S A;  4N1H A;  3V39 A;  5G18 A;  3O3V A;  4BL3 A;  5HAP A;  1VQQ A;  2JE5 A;  2XLN A;  1KGG A;  4U0X A;  3V3S A;  5JYP A;  1SCW A;  4JKT A;  1JWV A;  1PW8 A;  4WZ5 A;  4E3N A;  5KZH A;  5TGF A;  1MWR A;  3V50 A;  1L0G A;  3UE0 A;  2ZM0 A;  3C4P A;  2Y2P A;  4OOL A;  3G30 A;  5GLA A;  5M1A A;  5F82 A;  1I5Q A;  1NYY A;  4E3I A;  1K57 A;  1E3U A;  4DXB A;  4KZ7 A;  4UA6 A;  4E3M A;  3N6I A;  3S22 A;  4GNU A;  1AXB A;  4OVD A;  4JBF A;  2ZQ9 A;  2ZLY A;  4OQ0 A;  3UN7 A;  5EOE A;  2XFS A;  3VSL A;  1LL5 A;  1XKZ A;  2DRW A;  3ZG7 B;  1CEG A;  5FQM A;  2Q9N A;  2Y2K A;  4K91 A;  4KZ4 A;  3OC2 A;  4N9K A;  4EBN A;  4RX2 A;  3UDF A;  3S1Y A;  1PYY A;  4B88 A;  3GSG A;  1XX2 A;  5AQA A;  4E6W A;  1M6K A;  3AGE A;  4ID4 A;  4K0X A;  4EBP A;  1FCM A;  3LY4 A;  1RP5 A;  4RYE A;  2Y2M A;  1NY0 A;  5HL1 A;  1WE4 A;  4MLL A;  3W4O A;  5DTT A;  1XGJ A;  4DF6 A;  4EBL A;  1H8Z A;  1PZP A;  2ZM2 A;  3HLF A;  2ZQD A;  4NK3 A;  4E3J A;  2ZD8 A;  1PWG A;  2ZQ7 A;  3FKV A;  5CGS A;  1L2S A;  3PBT A;  3ZVW A;  3BLS A;  4DE3 A;  5F1F A;  1ERM A;  1FSY A;  1L0F A;  5U47 A;  2ZC5 B;  3C5A A;  3C7U A;  3IXH A;  3MZF A;  4R23 A;  3MXR A;  3N8L A;  3N8S A;  4C6Y A;  1YLT A;  2UWX A;  2XGN A;  1KE3 A;  2WAD A;  4QJG A;  3SS4 A;  3PBR A;  2EFX A;  4JXW A;  1JWZ A;  3Q7V B;  3V5M A;  2P9V B;  1W79 A;  2Y2O A;  3OPR A;  4UA9 A;  1YLW A;  3ZG9 B;  3Q82 A;  2Y4A A;  2J9P A;  3A3D A;  3DW0 A;  1IKG A;  1HVB A;  2WKH A;  5KSC A;  4ZAM A;  3N7W A;  3OCL A;  4P87 A;  3UPN A;  1YLY A;  3WWX A;  4DDY A;  3IXB A;  4KG5 A;  4QHC A;  1TVF A;  3E2L A;  3PBS A;  2XF3 A;  4JF5 A;  1BLC A;  1CI9 A;  2XK1 A;  5E2E A;  4PM6 A;  1YQS A;  3BLM A;  3UE1 A;  3C7V A;  2R9X A;  1K38 A;  4R4S A;  5FQI A;  4WZ5 C;  2PU2 A;  5CHU A;  4E3L A;  4L0L A;  4X55 A;  4JF6 A;  3WRZ A;  3HVF A;  1IYS A;  1FQG A;  3ZGA B;  2J9O A;  1HTZ A;  2HDQ A;  2ZC3 B;  3SS5 A;  4IBR A;  3ITB A;  1KGE A;  2XQZ A;  4S2J A;  3LCE A;  4EWF A;  3G31 A;  1E25 A;  2XD5 A;  3PAG A;  4S2O A;  5DVA A;  5FA7 A;  2E8I A;  3VFH A;  4UHU A;  1BUE A;  2OLU A;  1IEM A;  3OPP A;  5HAR A;  4X68 A;  1IKI A;  5E2H A;  3PAE A;  3HLG A;  2P9V A;  1ONG A;  3BM6 A;  4MBK A;  5E43 A;  1JVJ A;  1RCJ A;  5FDH A;  2HP6 A;  4WEL A;  1K25 A;  5GHY A;  5CER A;  3IQA A;  2Q9M A;  2V2F F;  3Q1F A;  3G35 A;  4ZJ1 A;  1JTG A;  2PBY A;  4OQI A;  2WYX A;  5EUA A;  1DJB A;  1GHP A;  5DTS A;  3GRJ A;  4R1G A;  5I94 A;  1DJA A;  3OPH A;  4MBF A;  4IVI A;  3IHA A;  2WZZ A;  3A3F A;  1BLS A;  1MWS A;  1K55 C;  2WKE A;  4RA7 A;  3LO7 A;  2JBF A;  1IYP A;  1KDW A;  2HPB A;  4S2P A;  2EX2 A;  2Y2G A;  3UE3 A;  2C6W B;  4R3J A;  3IHB A;  3QNB A;  4HEF A;  1E4D A;  4S2K A;  2X71 A;  3NDE A;  3ZNY A;  1TDG A;  4BL2 A;  1Y54 A;  1DJC A;  4LCL A;  5IHV A;  4KZB A;  1ESU A;  4H8R A;  1K54 C;  3P09 A;  4BD0 A;  5FAS A;  1U60 A;  2EXA A;  1G68 A;  3HLD A;  1ZG6 A;  1I2S A;  1FSW A;  3VP4 A;  3A3J A;  3CJM A;  3W8K A;  3GMW A;  1FOF A;  3BRM A;  3HUO A;  5FQ9 A;  3ZFZ A;  5M18 A;  3HBR A;  1NZO A;  4NET A;  4LV1 A;  4GD6 A;  2QPN A;  1N4O A;  5EVL A;  3ZVT A;  4DDS A;  1GA0 A;  4C3Q A;  4PPR A;  2C5W B;  3LEZ A;  4UA7 A;  1K56 D;  5GLD A;  4E3K A;  1Q2Q A;  3FZC A;  3MZD A;  2Y2H A;  3ITA A;  3OCN A;  2QMI A;  5AQ7 A;  2CC1 A;  1YLZ A;  4WMC D;  4P0M A;  4XXR A;  4IED A;  1NYM A;  4OLD A;  1ESI A;  5FAP A;  1W7F A;  5F1G A;  2Z2M B;  4FH2 A;  4OOY A;  4F94 A;  1MKI A;  2FFF B;  1JWP A;  2FFY A;  4C75 A;  3PBN A;  3HUM A;  4P6B A;  3IXG A;  1BUL A;  4CPK A;  4PM5 A;  5F83 A;  1LHY A;  4XUX A;  2JCH A;  4KG6 A;  4KQO A;  4OPZ A;  4Q8I A;  1K55 A;  3GTC A;  4ZDX A;  5BOH A;  5L2F A;  4RVA A;  1BSG A;  2P74 A;  4K0W A;  4PM7 A;  3M6B A;  1MY8 A;  3BFG A;  3HLC A;  1IEL A;  3MZE A;  4HBT A;  4OP8 A;  3RXW A;  2V1Z A;  4M3K A;  4IBX A;  5CTM A;  3SH7 A;  3IF6 B;  4CJN A;  5GL9 A;  1BT5 A;  1FR6 A;  2XH9 A;  3D4F A;  5DF7 A;  1XA7 A;  4EUZ A;  1YMS A;  1K54 A;  5EVI D;  4OP5 A;  2WUQ A;  5CEC A;  4WEJ A;  3VMA A;  4GOG A;  2A3U A;  4KZ9 A;  4KZ5 A;  4BQM A;  1ZG4 A;  4WZ4 A;  3C4O A;  2A49 A;  3G2Z A;  5A90 A;  2HP5 A;  4OON A;  2EX8 A;  1RGZ A;  5FQJ A;  4OPY A;  1W8Y A;  2G2U A;  1MPL A;  2J8Y A;  3HUN A;  2Z2L B;  3M6H A;  3SOI A;  4OOM A;  1ES5 A;  3G2Y A;  4B4X A;  3G32 A;  1IYO A;  4Y0O A;  5A92 A;  4N9L A;  3UPP A;  4HES A;  4MBH A;  3NIA A;  1W8Q A;  3IWQ A;  4S2M A;  4QY6 A;  5EVI B;  1FCO A;  1LL9 A;  3VP0 A;  1PIO A;  4DE1 A;  5HAQ A;  3UO9 A;  3PBQ A;  3BFD A;  4PM8 A;  1S6R A;  2BLS A;  5D3O A;  1K56 A;  3ZG5 A;  3Q81 A;  3RXX A;  3UNW A;  3WRT A;  1Z6F A;  4JXG A;  5FQQ A;  2Y2Q A;  5HX9 A;  5GHX A;  3ZHH A;  4WMC A;  4JLF A;  4Y0U A;  4DXC A;  4LV0 A;  1GHM A;  1PI5 A;  4Z9Q A;  4OH0 A;  2VGJ A;  3MXS A;  3O87 A;  3VFF A;  3A3I A;  4ZJ3 A;  1OME A;  1K4E A;  2ZQC A;  5EPH A;  3G4P A;  4GDB A;  4JXV A;  4EQI A;  4O7D A;  1ES2 A;  3A3E A;  3NDG A;  3FKW A;  3W4P A;  1MXO A;  1ES3 A;  2H10 A;  2RL3 A;  2ZMA A;  5AQB A;  4RX3 A;  3Q7V A;  5CHM A;  3VOZ A;  1XXM A;  5HW3 A;  5A93 A;  3VP2 A;  4DE2 A;  5JYO A;  1CEF A;  2Y2N A;  4LV3 A;  1GCE A;  3GR2 A;  2IWB A;  3BYD A;  3MFD A;  1XP4 A;  2WK0 A;  4KZ8 A;  1K6R A;  5EVI A;  2ZM8 A;  3FWL A;  3SH9 A;  4JPM A;  3MKF A;  3IWI A;  5EOO A;  4A5R A;  2HDU A;  5FI7 A;  4E3O A;  1EI5 A;  2H0Y A;  3GVB A;  5E2F A;  2Y91 A;  3IXD A;  1XA1 A;  5J8X A;  5GLC A;  4YIN A;  1PWC A;  5AQ9 A;  5CGX A;  3EQU A;  4JXS A;  1KVL A;  3SS3 A;  2V20 A;  3ZG0 A;  1PW1 A;  3UDX A;  3NBL A;  5GHZ A;  5CGW A;  1KDS A;  2IWC A;  1G6A A;  2JC7 A;  3HLW A;  4U3T A;  1SKF A;  4KZ6 A;  4GZB A;  1S0W A;  4MNR A;  5TR7 A;  1I2W A;  2XFT A;  1O07 A; 
#chains in the Genus database with same CATH topology
 3IT9 A;  1SZV A;  1YM1 A;  4BBU A;  3TJZ C;  2I72 A;  3N4I A;  3NUL A;  3CPT A;  3MR0 A;  5CHJ A;  1UGU A;  4GHI A;  3HLE A;  1DY6 A;  3T1S A;  2Y59 A;  1Y4O A;  1M40 A;  3HLB A;  3LR4 A;  2GDN A;  1NZU A;  3ZG8 B;  1BLP A;  3IF6 C;  3DAV A;  3B42 A;  3K3C A;  3S4X A;  5L10 A;  3IS2 B;  4BBT A;  4JF4 A;  3LI8 A;  3NHQ A;  3O86 A;  3HRE A;  2WKR A;  3KSI A;  3PBO A;  4KZA A;  4KUO A;  1L0D A;  1XJ2 A;  2VV6 A;  2QJ7 A;  4OQH A;  2DNS A;  4GJ4 A;  3GV9 A;  4R3A A;  1KE4 A;  3OBF A;  2UV0 E;  5FSR A;  2OOL A;  3Q7Z A;  4U0T A;  1MBL A;  4DJ2 A;  4R4R A;  4X1M A;  2ZL1 B;  4GN2 A;  4FH4 A;  4P85 A;  2W27 A;  2B5R A;  3M2J A;  5CTN A;  4NXG A;  3ULF A;  1NJ4 A;  4WEK A;  4EQ1 A;  1Q2P A;  3IF6 A;  3BQ8 A;  3SZT A;  4GD8 A;  4O8G A;  3WS0 A;  4EER A;  2X02 A;  3KO6 A;  5EEC A;  1WYC A;  5HSQ A;  3ZDJ A;  2HP9 A;  3PTE A;  1NRJ A;  1E3U D;  3LIF A;  2Y2I A;  4I39 A;  2JKT M;  3NCK A;  2M7V A;  3Q07 A;  4H6J B;  5CXW A;  3V3R A;  4FD8 A;  4FCF A;  5G4Z A;  5DF8 A;  5E2G A;  4X53 A;  1PI4 A;  2WZX A;  2KLI A;  1TEM A;  1D1J A;  2XD1 A;  2XR0 A;  3LEQ A;  3LY3 A;  1N9B A;  1MWU A;  4E6X A;  2A2L A;  3FYZ A;  1YLP A;  1NWZ A;  3KSF A;  2XEP A;  3E98 A;  1NRF A;  1K6S A;  1VQQ A;  2JE5 A;  3CIT A;  1KGG A;  1JWV A;  2QJ5 A;  4YWZ A;  1JNU A;  5GLA A;  3T1Q B;  2G7U A;  4E3I A;  5MC7 A;  2XRN A;  1AXB A;  2ZLY A;  5EOE A;  4JGO A;  1LL5 A;  2OWJ A;  2W3F A;  4RX2 A;  3CWF A;  3GSG A;  1XX2 A;  1RP5 A;  4RYE A;  2Y2M A;  5HL1 A;  4DF6 A;  1N9L A;  3LID A;  1PZP A;  1LSV A;  3EEA A;  5CGS A;  3NOU C;  3C5A A;  2GJ3 A;  1YLT A;  2UWX A;  2JN7 A;  4NKP A;  2FH5 A;  4Q0J A;  3E4Q A;  3OPR A;  4UA9 A;  1T19 A;  2PYR A;  3N7W A;  3R7W B;  3NOT C;  3TW8 A;  3H82 B;  3NJA A;  4KG5 A;  1TVF A;  2NUT C;  2ZMV A;  1H8M A;  1CI9 A;  4Y3I A;  3UE1 A;  1K38 A;  5FQI A;  4CLC A;  4WZ5 C;  1G5U A;  2PU2 A;  4E3L A;  4JF6 A;  4KQD A;  1IYS A;  1FQG A;  1XFN A;  4IBR A;  3ITB A;  4S2J A;  4EWF A;  3G31 A;  3PAG A;  5DVA A;  1NLY A;  4Q0I A;  3KYZ A;  1DP9 A;  1ONG A;  2VV7 A;  5FDH A;  2HP6 A;  3OLO A;  4PAU A;  2V2F F;  4ARZ A;  2XRO A;  1P9W A;  3C38 A;  3GRJ A;  3JVU A;  3OPH A;  1K55 C;  4S2P A;  2Y2G A;  4HEF A;  3GDI A;  3NEC A;  1Y54 A;  3DTE A;  2JKR I;  1OTB A;  4LCL A;  4HJ3 A;  1G68 A;  3HLD A;  3QP8 A;  4E04 A;  5AVF A;  1OT6 A;  1FOF A;  3ZFZ A;  3BW6 A;  2W1T B;  1NZO A;  2QPN A;  1MZU A;  1N4O A;  1GA0 A;  2KX6 A;  3A0R A;  4LRX C;  3PR6 A;  1KOU A;  2GNX A;  3LEZ A;  4K08 A;  1K56 D;  5L8M A;  5GLD A;  4E3K A;  2O9C A;  1Q2Q A;  3EOI A;  3DTK A;  2CC1 A;  3S7P A;  3LIC A;  2MJ6 A;  1ESI A;  1W7F A;  4F94 A;  4WF0 A;  2EWV A;  1LT0 A;  2VX8 A;  3PXP A;  1G6O A;  2JCH A;  3C8C A;  3A0V A;  4OPZ A;  4Q8I A;  1K55 A;  4G3V A;  2J80 A;  4GS9 B;  2P74 A;  4PM7 A;  3MQ0 A;  4OP8 A;  1MY8 A;  1Y28 A;  2ZOI A;  5CTM A;  2K2N A;  1XA7 A;  1YMS A;  1OJ5 A;  2R78 A;  4GOG A;  4BQM A;  3C4O A;  5A90 A;  3CAX A;  1RGZ A;  5CX7 A;  2J8Y A;  3KSH A;  1TS6 A;  5C5K A;  3SOI A;  1ES5 A;  3L7H A;  4Y0O A;  3H7W B;  5A92 A;  3P01 A;  4QY6 A;  1LL9 A;  1PIO A;  5DFX A;  5HAQ A;  1V9Z A;  2NUP C;  3BFD A;  4KUK A;  3ZG5 A;  3UNW A;  5FQQ A;  2Y2Q A;  3EWK A;  5GHX A;  3MFX A;  4II7 A;  4Y0U A;  3IX3 A;  1PI5 A;  2Y79 A;  2VGJ A;  3LR3 A;  2PBD P;  3RH8 B;  4EQI A;  1K4E A;  4JXV A;  4O7D A;  2VGL M;  4XT2 B;  1ES2 A;  3FKW A;  1F2K A;  3OOV A;  1S1Y A;  2A24 A;  2RL3 A;  5L07 A;  2HZ5 A;  1S1Z A;  5AJG A;  3Q7V A;  2ZOH A;  1S66 L;  5HW3 A;  4DE2 A;  1XP4 A;  2XA7 S;  2L4R A;  5EVI A;  5L09 A;  3SH9 A;  4ESP A;  5EOO A;  1EI5 A;  3GVB A;  3IXD A;  4EW7 A;  4YIN A;  2W3D A;  1OT9 A;  2JKR M;  2QHK A;  3G6O A;  3ZG0 A;  1GSW A;  3LGO A;  1G6A A;  1S4R A;  2YKF A;  3HLW A;  5DFY A;  4KZ6 A;  3IHA A;  1I2W A;  1O07 A;  4XUZ A;  1K4F A;  3W2Z A;  3IWO A;  3ZNT A;  2H0T A;  4JGP A;  3OPL A;  5CRF A;  3AGD A;  2R9W A;  5FQK A;  3TG9 A;  4MN5 A;  1IYQ A;  2J3W A;  1LSX A;  4KZ3 A;  4N92 A;  3WS5 A;  3UB9 A;  4MEZ A;  4GB7 A;  3V67 A;  2QZ6 A;  1BZA A;  3O88 A;  3UDI A;  3G34 A;  4LV2 A;  4FOF A;  2RCX A;  4QPR A;  5F69 A;  3S7N A;  1P0Z A;  1N9O A;  1W5D A;  4GDN A;  5LBR A;  3OZH A;  2INW A;  3UY6 A;  1LLB A;  2WGV A;  1TDL A;  2DMW A;  4YFM A;  4HJ4 A;  1SDN A;  3FG8 A;  3QNC A;  2PAV P;  4EUV A;  4PM9 A;  3ISG A;  5FAT A;  3F1P B;  3A0S A;  1ACF A;  1YT4 A;  3MKE A;  3RJU A;  2Q0O A;  5A91 A;  5KIZ A;  1XJ3 A;  4Y7P A;  3QHY A;  5EM0 A;  3T1R A;  1LL8 A;  2W0N A;  1ZKJ A;  2V8F A;  1FIL A;  4JGQ A;  1GSV A;  5FI2 A;  3TSG A;  4I3I A;  4MMN A;  2O0Y A;  1T18 A;  2ZJ9 A;  2OWH A;  1K57 C;  4KQR A;  3T4O A;  4Y5F A;  5A8B A;  3VP1 A;  3HL9 A;  3TRC A;  3SH8 A;  4DRT A;  4DMZ A;  3WS1 A;  4PMA A;  4IUH A;  4BD1 A;  2ZC4 B;  2PR5 A;  1F5M A;  2V8C A;  1RGY A;  3VOL A;  3MS6 A;  1ZC2 A;  2OV5 A;  2ZC7 A;  2ZQA A;  4PKY A;  2WKP A;  4Y0T A;  4ZBE A;  5HWT A;  5HFO A;  4OPQ A;  4LRY C;  3O3V A;  1VET A;  5HAP A;  3E4P A;  5JYP A;  5J4E A;  5KZH A;  1S4S A;  2Y2P A;  4YOF A;  3G30 A;  4QWO A;  5EM1 A;  1K57 A;  2PRF A;  4KZ7 A;  4UA6 A;  3T4K A;  2ZQ9 A;  3UN7 A;  3VSL A;  1XKZ A;  4CLC D;  3NOP C;  1SKO B;  4EBN A;  2JKG A;  4HP9 A;  3S1Y A;  4B88 A;  5AQA A;  1M6K A;  3AGE A;  3D72 A;  1FCM A;  3R4K A;  1NY0 A;  3K3D A;  5TBM A;  4RQ9 A;  2ZM2 A;  3HLF A;  4E3J A;  2ZQ7 A;  3ZVW A;  3BLS A;  1FSY A;  4M4X A;  5U47 A;  2ZC5 B;  3C7U A;  3MZF A;  3N8L A;  3N8S A;  4NG2 A;  3SS4 A;  4R70 A;  2PDR A;  1JWZ A;  2P9V B;  2Y2O A;  3FC7 A;  4UEY A;  1YLW A;  3SW1 A;  3U4L P;  4ZAM A;  2W3E A;  4O01 A;  1BLC A;  3IBJ A;  5E2E A;  3C7V A;  4HI4 A;  4MN6 A;  3HVF A;  3ZGA B;  3UE6 A;  2J9O A;  2AVX A;  1HTZ A;  4BBV A;  2E8J A;  2HDQ A;  2ZC3 B;  3PHY A;  2W3H A;  3E4O A;  5FA7 A;  2E8I A;  3VFH A;  3KSG A;  1IEM A;  5HAR A;  1IKI A;  3HLG A;  3BM6 A;  1RCJ A;  4WEL A;  2Y8H A;  3CPT B;  1STZ A;  3G35 A;  4ZJ1 A;  1VEU A;  2PBY A;  4OQI A;  2WYX A;  3R7W A;  1OJG A;  3F1N A;  5DTS A;  5I94 A;  1J3W A;  4MBF A;  2WZZ A;  3UB8 A;  2WKE A;  4HIA A;  3LO7 A;  2JBF A;  2EX2 A;  2C6W B;  4R3J A;  1E4D A;  2X71 A;  3NDE A;  1ESU A;  2D02 A;  3P09 A;  1T1A A;  4UQI S;  4LPZ A;  1I2S A;  4Y15 A;  1AWI A;  1TS0 A;  3BRM A;  3HUO A;  1W63 Q;  5M18 A;  2GZA A;  1N9N A;  4G3W A;  4NET A;  5EVL A;  3ZVT A;  4PPR A;  3MQO A;  2C5W B;  3T4T A;  4UA7 A;  2FZ0 A;  1YKD A;  4P0M A;  4OLD A;  4CLC C;  5FAP A;  4ZRR A;  5F1G A;  4OOY A;  1MKI A;  4FUW A;  1D7E A;  1JWP A;  2FFY A;  2FFF B;  3PBN A;  4P6B A;  4C75 A;  3HCY A;  4KG6 A;  3CUE C;  1H3Q A;  5BOH A;  5L2F A;  3MSH A;  4K0W A;  1DP8 A;  3BFG A;  3HLC A;  1IEL A;  1YAX A;  4HBT A;  3UME A;  2VGL S;  3IF6 B;  5GL9 A;  2XH9 A;  4EUZ A;  5EVI D;  5CEC A;  4KZ5 A;  4MCW A;  2BAS A;  1GSX A;  4F3L A;  2HP5 A;  2EX8 A;  3B47 A;  1W8Y A;  1MPL A;  4IJG A;  4G3K A;  3M6H A;  4OOM A;  1IYO A;  4N9L A;  3UPP A;  4HES A;  3NIA A;  1W8Q A;  1P97 A;  5IU1 A;  4S2M A;  4DE1 A;  3PBQ A;  1S6R A;  2HV1 A;  3F1O A;  1Z6F A;  5HX9 A;  1YSQ A;  3LI9 A;  2B18 A;  1GHM A;  3O87 A;  5HPF A;  4P6Z M;  3VFF A;  3CUE A;  1TD5 A;  2QWS A;  5AQB A;  1CJF A;  3FPW A;  5JYO A;  3H7W A;  1GCE A;  4WLA A;  2IWB A;  3BYD A;  4KZ8 A;  1K6R A;  2ZM8 A;  3IWI A;  2HDU A;  3JVV A;  1ODV A;  1PWC A;  3UMD A;  3EQU A;  2V20 A;  1PW1 A;  2QYB A;  3T4L A;  4U3T A;  2KOI A;  4XT2 A;  4S2L A;  4QD4 A;  2H5S A;  1H8Y A;  4IVK A;  4QU3 A;  3IX8 A;  2BG1 A;  3W4Q A;  5FAO A;  1YMX A;  5TFQ A;  3VE4 A;  2GX5 A;  1SDE A;  3DWZ A;  2WKI A;  1TF1 A;  2WGI A;  3LR0 A;  4R0Q A;  1NXY A;  4KEN B;  4QB8 A;  3VE3 A;  3BFE A;  4NXB A;  1UWP X;  1EWZ A;  1ERO A;  3CZD A;  3MQQ A;  1BTL A;  5FEG A;  4LEN A;  3ZCZ A;  2VLG A;  2BTF P;  2WGW B;  4HP4 A;  3JYI A;  1ONH A;  1F98 A;  5F6A A;  4R38 A;  3VOY A;  3C30 A;  4I3A A;  4OPR A;  2I9V A;  1XGI A;  1XPB A;  5M19 A;  4Z1W A;  5EVI C;  1YPR A;  1TS8 A;  3BFC A;  3BEC A;  1DP6 A;  4ZJ2 A;  4D2O A;  3TOI A;  3ZYT A;  3BFF A;  4UAA A;  4OLG A;  2HGV A;  5IS1 A;  4DKI A;  3P98 A;  4JGR A;  4X69 A;  2OSU A;  1PWD A;  1GHI A;  5DTK A;  2Y2L A;  1YLJ A;  3O5Y A;  3NY4 A;  1MWT A;  5FI6 A;  2IWD A;  3AGF A;  5F68 A;  5KMW A;  4ETX A;  2WAF A;  3E2K A;  3M2K A;  2VJW A;  3B3X A;  3N8R A;  3HJI A;  2P08 A;  1SHV A;  2V9A A;  1PZO A;  3B33 A;  2ZC6 B;  1PNE A;  5FAQ A;  2V1B A;  2L1M A;  5EE8 A;  4B9O A;  1HLU P;  2G2W A;  4HH2 A;  5GLB A;  4BLM A;  4Y17 A;  2VGK A;  3IH9 A;  1KGF A;  2VA0 A;  4KQQ A;  4R3B A;  2EX9 A;  3LIB A;  4I5S A;  5AVE A;  3BEB A;  2Y55 A;  4QY5 A;  2HDS A;  3CMZ A;  3DTM A;  4O0P A;  3UPO A;  1L0E A;  1P9R A;  2PR6 A;  5EFW A;  5EV0 A;  4X56 A;  2EFU A;  4X25 A;  3VP3 A;  1H5X A;  2PU4 A;  2ZBB A;  3T1X A;  2XDM A;  4HNB A;  1C3B A;  3V39 A;  5G18 A;  4L9F A;  4U0X A;  3V3S A;  1SCW A;  1PW8 A;  1MWR A;  3V50 A;  1L0G A;  4I3J A;  2ZM0 A;  3C4P A;  5M1A A;  5F82 A;  1I5Q A;  1NYY A;  4DXB A;  3KYE A;  3N6I A;  4GNU A;  5J3W A;  4OVD A;  1PRQ A;  2XFS A;  3ZG7 B;  2Q9N A;  4KZ4 A;  3OC2 A;  4N9K A;  2B02 A;  4DJ3 A;  3UDF A;  1PYY A;  1K0K A;  3CI6 A;  4ID4 A;  4EBP A;  3LY4 A;  1WE4 A;  3W4O A;  1X0O A;  3C2W A;  3T4J A;  4ME4 A;  1H8Z A;  3GEC A;  4NK3 A;  3FKV A;  2KDK A;  3PBT A;  4DE3 A;  5F1F A;  1L0F A;  2W1R A;  3IXH A;  3IS2 A;  3LUQ A;  2XGN A;  1KE3 A;  2WAD A;  4QJG A;  2ACG A;  2EA9 A;  3Q7V B;  3V5M A;  1VB6 A;  3ZG9 B;  2J9P A;  1SKO A;  3DW0 A;  1IKG A;  2WKH A;  4P87 A;  3UPN A;  1YLY A;  4DDY A;  4QHC A;  3PBS A;  4JF5 A;  2XK1 A;  3T12 B;  1ZHH B;  3UB5 P;  3L9K A;  2R9X A;  1S67 L;  4R4S A;  5CHU A;  4L0L A;  4X55 A;  3UB6 A;  3BY9 A;  2ZL1 A;  3SS5 A;  5HDS A;  2XQZ A;  3LCE A;  1E25 A;  4S2O A;  1BUE A;  2OLU A;  2IA2 A;  3OPP A;  4X68 A;  5E2H A;  3RTY A;  2Z6D A;  3PAE A;  2P9V A;  2V1A A;  5E43 A;  1K25 A;  5CER A;  2Q9M A;  3Q1F A;  1JTG A;  2JHE A;  5DKL A;  3DTI A;  1GHP A;  4R1G A;  1T1C A;  4R6L A;  4IVI A;  4RA7 A;  1IYP A;  2HPB A;  3IHB A;  3QNB A;  4S2K A;  4BL2 A;  1DJC A;  4GW9 A;  3PYP A;  4KZB A;  4H8R A;  1K54 C;  2PT7 A;  3IX4 A;  1FIK A;  5FAS A;  2EXA A;  2PD8 A;  5DKK A;  4PHT A;  3GMW A;  4H6J A;  3HBR A;  4PKY G;  4GD6 A;  4DDS A;  4LRZ E;  5K5B A;  3FZC A;  4I38 A;  2LB9 A;  2XA7 M;  3ITA A;  2CMN A;  2JKF A;  5AQ7 A;  3HJK A;  4FH2 A;  4ETZ A;  4PM5 A;  3HUM A;  3BJN A;  4CPK A;  5F83 A;  4KQO A;  4MDZ A;  4ZDX A;  1BSG A;  4P6Z S;  3M6B A;  3MZE A;  2V1Z A;  4M3K A;  4IBX A;  4CJN A;  1BT5 A;  1FR6 A;  1OTI A;  3D4F A;  3T50 A;  1K54 A;  4WEJ A;  3VMA A;  2A3U A;  5FDS A;  3G2Z A;  3T4S A;  4OPY A;  3QP1 A;  4EXO A;  2Z2L B;  4B4X A;  4WUJ A;  3G32 A;  4MBH A;  4HQA A;  3IWQ A;  3FPV A;  3VP0 A;  4BWI A;  1XJ4 A;  4PM8 A;  3S7Q A;  2PYP A;  3Q81 A;  3WRT A;  4WMC A;  4JLF A;  4HJ6 A;  4DXC A;  2VZW A;  4Z9Q A;  3G4P A;  4GDB A;  3NDG A;  4IHQ A;  4HH3 A;  3W4P A;  1MXO A;  3KX0 X;  2ZMA A;  4CQH A;  5CHM A;  3T4Q A;  3VOZ A;  3LIA A;  3MJQ A;  5A93 A;  1CEF A;  2Y2N A;  2WK0 A;  3FWL A;  4L9G A;  4JPM A;  3MKF A;  4GHI B;  3H82 A;  4A5R A;  5FI7 A;  4E3O A;  2H0Y A;  1VET B;  2K7S A;  5E2F A;  5J8X A;  4JXS A;  1KVL A;  2O9B A;  5TJJ A;  3NBL A;  5GHZ A;  5CGW A;  1KDS A;  5J7E A;  2L0W A;  4EES A;  2JC7 A;  2W3G A;  5HD5 A;  4GZB A;  4LFU A;  4MNR A;  5TR7 A;  1H0M A;  4MLL A;  3MXQ A;  4HY8 A;  1UWN X;  1BLH A;  1LI9 A;  1WYB A;  4GLQ A;  1QME A;  3WS2 A;  1CI8 A;  3EGD C;  3IH8 A;  1JTD A;  5CEB A;  3MBZ A;  3NC8 A;  2Z6C A;  5TBM B;  4Y13 A;  4WYY A;  5DF9 A;  5CED A;  1XJ6 A;  1CK3 A;  1ALQ A;  3P7N A;  4ZTK A;  1O7E A;  2X01 A;  4DE0 A;  4HBU A;  2HJE A;  1FCN A;  1KE0 A;  3QP6 A;  2J7V A;  4WL9 A;  4B93 A;  3EQV A;  4KG2 A;  3WS4 A;  4L9E A;  3U2A A;  1HD8 A;  2W1T A;  4FSF A;  2M7U A;  2DCF A;  2VEA A;  3CHW P;  1WA9 A;  4CLC E;  5EVE A;  4S2N C;  1DRM A;  5HPI A;  3KYQ A;  1LI0 A;  1VM1 A;  3NI9 A;  1Z09 A;  2Y2J A;  4BEN A;  1HZO A;  1ERQ A;  3IF5 A;  3EEH A;  3FV7 A;  1FR1 A;  2WGW A;  3BWL A;  4YNR A;  5F5Y A;  4GS9 A;  4OKP A;  1QMF A;  2HDR A;  4LCM A;  3DWK A;  1VEU B;  3I7J A;  1D06 A;  2PHY A;  5HL6 A;  2ZMF A;  3F1N B;  4WM9 A;  5DJT A;  1KVM A;  1NLZ A;  4X6T A;  4OQG A;  2WAE A;  2EX6 A;  1MC0 A;  3GQZ A;  3MMH A;  5G4Y A;  4D60 A;  1GA9 A;  2H28 A;  4S2N A;  5KSH A;  4WN5 A;  4EV4 A;  3VSK A;  2B95 A;  4BJP A;  2VV8 A;  5HAI A;  2K31 A;  4B4Z A;  2O99 A;  2V0U A;  2OAQ 1;  2VKS A;  5I5L A;  4WBG A;  2OLV A;  4GKU A;  3LR5 A;  5HWV A;  5HZH A;  3TE8 A;  1ES4 A;  1J9M A;  2EXB A;  4S2I A;  2ZQ8 A;  3CG5 A;  4NXE A;  4N1X A;  4N1H A;  3E0Y A;  4BL3 A;  2XLN A;  1VHM A;  4JKT A;  4WZ5 A;  4E3N A;  5TGF A;  3UE0 A;  4OOL A;  1T1B A;  1E3U A;  2WKQ A;  4E3M A;  3S22 A;  3MF0 A;  4F3L B;  4JBF A;  3H9W A;  4OQ0 A;  4EEP A;  3IBR A;  2DRW A;  1CEG A;  2EWW A;  5FQM A;  3S7O A;  4HOI A;  2Y2K A;  4K91 A;  4NXF A;  2P04 A;  3UB7 A;  1OPX A;  2LB5 A;  4IUK A;  4E6W A;  4K0X A;  1BYW A;  5DJU A;  2O9A A;  3F1O B;  2HJ9 C;  5DTT A;  1XGJ A;  4EBL A;  3LFV A;  4CLC B;  1OTE A;  2ZQD A;  4AFI A;  2ZD8 A;  1PWG A;  4UQI M;  1L2S A;  1ERM A;  4R23 A;  3MXR A;  4C6Y A;  3PBR A;  2EFX A;  4JXW A;  3LIE A;  1W79 A;  3Q82 A;  2Y4A A;  3A3D A;  4ARZ B;  1HVB A;  5KSC A;  3OCL A;  3WWX A;  1ZTU A;  3IXB A;  3E2L A;  2XF3 A;  1EW0 A;  4PM6 A;  1YQS A;  3BLM A;  1A0K A;  4Q0H A;  4Y2F A;  3WRZ A;  3QP5 A;  1IOU A;  2OAP 1;  3F1P A;  4GCZ A;  1KGE A;  1G28 A;  2VK3 A;  2XD5 A;  3VV4 A;  4UHU A;  5FEF A;  4MBK A;  1JVJ A;  3D3O A;  5GHY A;  3IQA A;  1OTD A;  5HDC A;  5EUA A;  2YKH A;  1DJB A;  1IFQ A;  2J3T D;  1DJA A;  3JPU A;  4LGW A;  3A3F A;  1BLS A;  1MWS A;  1KDW A;  3UE3 A;  2V0W A;  1YSP A;  5FL3 A;  4DN0 A;  4MN7 A;  3ZNY A;  1TDG A;  5IHV A;  3ICY A;  3EGX C;  4BD0 A;  1U60 A;  1ZG6 A;  1FSW A;  3VP4 A;  3A3J A;  3CJM A;  3W8K A;  5FQ9 A;  4LV1 A;  3DBA A;  4C3Q A;  3D9Y A;  3MZD A;  2Y2H A;  3OCN A;  4FTX A;  2QMI A;  1YLZ A;  4WMC D;  3LYX A;  4XXR A;  4IED A;  1NYM A;  2HF6 A;  3K2N A;  2Z2M B;  5HDD A;  3IXG A;  1BUL A;  1LHY A;  4XUX A;  4LLO B;  1L3L A;  3GTC A;  4HHD A;  4RVA A;  3RXW A;  2D01 A;  4NEE D;  3SH7 A;  5DF7 A;  4OP5 A;  2WUQ A;  1CQA A;  4KZ9 A;  1ZG4 A;  4WZ4 A;  5HWW A;  2A49 A;  2A24 B;  4X1L A;  4OON A;  5FQJ A;  1XFQ A;  2G2U A;  3HUN A;  4BMW A;  3G2Y A;  1OTA A;  1F9I A;  5EVI B;  1V9Y A;  1FCO A;  1LSW A;  1W63 M;  3UO9 A;  2BLS A;  3ZQ5 A;  5D3O A;  1K56 A;  3RXX A;  4JXG A;  5IT5 A;  3ZHH A;  2QKP A;  4EEU A;  4LV0 A;  2M1C A;  1PFL A;  4OH0 A;  3MXS A;  4EET B;  3A3I A;  3CLO A;  4ZJ3 A;  1OME A;  2ZQC A;  5EPH A;  3A3E A;  3BY8 A;  1ES3 A;  2H10 A;  4RX3 A;  1XXM A;  2XSS A;  3VP2 A;  2PD7 A;  4LV3 A;  3GR2 A;  3MFD A;  5HD3 A;  3QP2 A;  3RFB A;  4EU0 A;  2J3T C;  2Y91 A;  1MKM A;  1XA1 A;  5GLC A;  2P7J A;  5AQ9 A;  1TS7 A;  5CGX A;  3SS3 A;  3BQA A;  2JKT I;  3UDX A;  3QP4 A;  2IWC A;  1SKF A;  1S0W A;  1CF0 A;  2XFT A; 
#chains in the Genus database with same CATH homology
 3IT9 A;  4QD4 A;  2H5S A;  1BLH A;  1H8Y A;  4XUZ A;  1LI9 A;  4IVK A;  1WYB A;  1K4F A;  1YM1 A;  4QU3 A;  2I72 A;  3IWO A;  1QME A;  3ZNT A;  2BG1 A;  2H0T A;  3W4Q A;  5FAO A;  3N4I A;  3OPL A;  3WS2 A;  1YMX A;  1CI8 A;  5TFQ A;  5CRF A;  3IH8 A;  1JTD A;  5CEB A;  5CHJ A;  1SDE A;  3AGD A;  3DWZ A;  2R9W A;  2WKI A;  3MBZ A;  2WGI A;  3NC8 A;  5FQK A;  3HLE A;  4R0Q A;  3TG9 A;  1NXY A;  4KEN B;  4QB8 A;  3BFE A;  1IYQ A;  1DY6 A;  4WYY A;  5DF9 A;  4KZ3 A;  4N92 A;  5CED A;  2Y59 A;  1EWZ A;  3WS5 A;  1ERO A;  1M40 A;  1CK3 A;  3HLB A;  1ALQ A;  2GDN A;  3CZD A;  1BTL A;  1NZU A;  3ZG8 B;  4LEN A;  4ZTK A;  1O7E A;  4MEZ A;  2X01 A;  3ZCZ A;  4DE0 A;  4HBU A;  1BLP A;  3IF6 C;  4GB7 A;  1FCN A;  2WGW B;  1KE0 A;  2QZ6 A;  1BZA A;  3O88 A;  3S4X A;  3UDI A;  3G34 A;  4LV2 A;  3JYI A;  1ONH A;  2J7V A;  4JF4 A;  3VOY A;  3O86 A;  2RCX A;  3EQV A;  4KG2 A;  4OPR A;  3HRE A;  3WS4 A;  3PBO A;  4KZA A;  1L0D A;  1HD8 A;  1XGI A;  1W5D A;  4GDN A;  4FSF A;  1XPB A;  2DCF A;  5M19 A;  3OZH A;  3UY6 A;  4OQH A;  5EVI C;  4S2N C;  2DNS A;  3BFC A;  3BEC A;  3GV9 A;  1LLB A;  2WGV A;  1KE4 A;  1LI0 A;  4ZJ2 A;  1TDL A;  1VM1 A;  3NI9 A;  4YFM A;  4D2O A;  5FSR A;  2Y2J A;  3Q7Z A;  1SDN A;  4U0T A;  1MBL A;  4BEN A;  3TOI A;  3BFF A;  3QNC A;  4R4R A;  4UAA A;  1HZO A;  1ERQ A;  3IF5 A;  3FV7 A;  4OLG A;  4PM9 A;  1FR1 A;  4DKI A;  3P98 A;  4GN2 A;  3ISG A;  2WGW A;  4FH4 A;  5FAT A;  4P85 A;  4X69 A;  2OSU A;  2B5R A;  3M2J A;  4S2L A;  5CTN A;  1PWD A;  4OKP A;  1YT4 A;  1GHI A;  3MKE A;  5DTK A;  3RJU A;  2Y2L A;  1QMF A;  1YLJ A;  1NJ4 A;  4WEK A;  3NY4 A;  1Q2P A;  2HDR A;  3IF6 A;  4LCM A;  3DWK A;  5A91 A;  4Y7P A;  1MWT A;  3QHY A;  3I7J A;  5FI6 A;  2IWD A;  3AGF A;  4GD8 A;  4WM9 A;  3WS0 A;  1ZKJ A;  5KMW A;  1KVM A;  2WAF A;  3E2K A;  3M2K A;  2X02 A;  3B3X A;  4X6T A;  3N8R A;  5EEC A;  4OQG A;  5FI2 A;  2WAE A;  1SHV A;  2EX6 A;  1PZO A;  3GQZ A;  3TSG A;  1WYC A;  3ZDJ A;  2HP9 A;  2ZC6 B;  3PTE A;  1GA9 A;  5FAQ A;  2ZJ9 A;  4S2N A;  5EE8 A;  2G2W A;  1E3U D;  5KSH A;  5GLB A;  2Y2I A;  4BLM A;  1K57 C;  4KQR A;  3VSK A;  4EV4 A;  4BJP A;  3VP1 A;  3NCK A;  2VGK A;  3IH9 A;  5HAI A;  3Q07 A;  4B4Z A;  3HL9 A;  1KGF A;  5CXW A;  3V3R A;  4FD8 A;  3SH8 A;  4FCF A;  5DF8 A;  4DRT A;  4KQQ A;  4R3B A;  2EX9 A;  5E2G A;  3WS1 A;  4X53 A;  1PI4 A;  4WBG A;  4PMA A;  4BD1 A;  2ZC4 B;  2OLV A;  2WZX A;  1TEM A;  3BEB A;  2Y55 A;  2XD1 A;  4GKU A;  4QY5 A;  2XR0 A;  1RGY A;  2HDS A;  3CMZ A;  3DTM A;  3LY3 A;  1N9B A;  1ZC2 A;  1MWU A;  1ES4 A;  3UPO A;  1L0E A;  2OV5 A;  1J9M A;  2ZC7 A;  4E6X A;  4X56 A;  2ZQA A;  2EXB A;  4S2I A;  2ZQ8 A;  4Y0T A;  2EFU A;  3FYZ A;  4ZBE A;  1YLP A;  3CG5 A;  3VP3 A;  1H5X A;  2PU4 A;  2XEP A;  2XDM A;  5HFO A;  4OPQ A;  4N1X A;  1C3B A;  1NRF A;  1K6S A;  4N1H A;  3V39 A;  5G18 A;  3O3V A;  4BL3 A;  5HAP A;  1VQQ A;  2JE5 A;  2XLN A;  1KGG A;  4U0X A;  3V3S A;  5JYP A;  1SCW A;  4JKT A;  1JWV A;  1PW8 A;  4WZ5 A;  4E3N A;  5KZH A;  5TGF A;  1MWR A;  3V50 A;  1L0G A;  3UE0 A;  2ZM0 A;  3C4P A;  2Y2P A;  4OOL A;  3G30 A;  5GLA A;  5M1A A;  5F82 A;  1I5Q A;  1NYY A;  4E3I A;  1K57 A;  1E3U A;  4DXB A;  4KZ7 A;  4UA6 A;  4E3M A;  3N6I A;  3S22 A;  4GNU A;  1AXB A;  4OVD A;  4JBF A;  2ZQ9 A;  2ZLY A;  4OQ0 A;  3UN7 A;  5EOE A;  2XFS A;  3VSL A;  1LL5 A;  1XKZ A;  2DRW A;  3ZG7 B;  1CEG A;  5FQM A;  2Q9N A;  2Y2K A;  4K91 A;  4KZ4 A;  3OC2 A;  4N9K A;  4EBN A;  4RX2 A;  3UDF A;  3S1Y A;  1PYY A;  4B88 A;  3GSG A;  1XX2 A;  5AQA A;  4E6W A;  1M6K A;  3AGE A;  4ID4 A;  4K0X A;  4EBP A;  1FCM A;  3LY4 A;  1RP5 A;  4RYE A;  2Y2M A;  1NY0 A;  5HL1 A;  1WE4 A;  4MLL A;  3W4O A;  5DTT A;  1XGJ A;  4DF6 A;  4EBL A;  1H8Z A;  1PZP A;  2ZM2 A;  3HLF A;  2ZQD A;  4NK3 A;  4E3J A;  2ZD8 A;  1PWG A;  2ZQ7 A;  3FKV A;  5CGS A;  1L2S A;  3PBT A;  3ZVW A;  3BLS A;  4DE3 A;  5F1F A;  1ERM A;  1FSY A;  1L0F A;  5U47 A;  2ZC5 B;  3C5A A;  3C7U A;  3IXH A;  3MZF A;  4R23 A;  3MXR A;  3N8L A;  3N8S A;  4C6Y A;  1YLT A;  2UWX A;  2XGN A;  1KE3 A;  2WAD A;  4QJG A;  3SS4 A;  3PBR A;  2EFX A;  4JXW A;  1JWZ A;  3Q7V B;  3V5M A;  2P9V B;  1W79 A;  2Y2O A;  3OPR A;  4UA9 A;  1YLW A;  3ZG9 B;  3Q82 A;  2Y4A A;  2J9P A;  3A3D A;  3DW0 A;  1IKG A;  1HVB A;  2WKH A;  5KSC A;  4ZAM A;  3N7W A;  3OCL A;  4P87 A;  3UPN A;  1YLY A;  3WWX A;  4DDY A;  3IXB A;  4KG5 A;  4QHC A;  1TVF A;  3E2L A;  3PBS A;  2XF3 A;  4JF5 A;  1BLC A;  1CI9 A;  2XK1 A;  5E2E A;  4PM6 A;  1YQS A;  3BLM A;  3UE1 A;  3C7V A;  2R9X A;  1K38 A;  4R4S A;  5FQI A;  4WZ5 C;  2PU2 A;  5CHU A;  4E3L A;  4L0L A;  4X55 A;  4JF6 A;  3WRZ A;  3HVF A;  1IYS A;  1FQG A;  3ZGA B;  2J9O A;  1HTZ A;  2HDQ A;  2ZC3 B;  3SS5 A;  4IBR A;  3ITB A;  1KGE A;  2XQZ A;  4S2J A;  3LCE A;  4EWF A;  3G31 A;  1E25 A;  2XD5 A;  3PAG A;  4S2O A;  5DVA A;  5FA7 A;  2E8I A;  3VFH A;  4UHU A;  1BUE A;  2OLU A;  1IEM A;  3OPP A;  5HAR A;  4X68 A;  1IKI A;  5E2H A;  3PAE A;  3HLG A;  2P9V A;  1ONG A;  3BM6 A;  4MBK A;  5E43 A;  1JVJ A;  1RCJ A;  5FDH A;  2HP6 A;  4WEL A;  1K25 A;  5GHY A;  5CER A;  3IQA A;  2Q9M A;  2V2F F;  3Q1F A;  3G35 A;  4ZJ1 A;  1JTG A;  2PBY A;  4OQI A;  2WYX A;  5EUA A;  1DJB A;  1GHP A;  5DTS A;  3GRJ A;  4R1G A;  5I94 A;  1DJA A;  3OPH A;  4MBF A;  4IVI A;  3IHA A;  2WZZ A;  3A3F A;  1BLS A;  1MWS A;  1K55 C;  2WKE A;  4RA7 A;  3LO7 A;  2JBF A;  1IYP A;  1KDW A;  2HPB A;  4S2P A;  2EX2 A;  2Y2G A;  3UE3 A;  2C6W B;  4R3J A;  3IHB A;  3QNB A;  4HEF A;  1E4D A;  4S2K A;  2X71 A;  3NDE A;  3ZNY A;  1TDG A;  4BL2 A;  1Y54 A;  1DJC A;  4LCL A;  5IHV A;  4KZB A;  1ESU A;  4H8R A;  1K54 C;  3P09 A;  4BD0 A;  5FAS A;  1U60 A;  2EXA A;  1G68 A;  3HLD A;  1ZG6 A;  1I2S A;  1FSW A;  3VP4 A;  3A3J A;  3CJM A;  3W8K A;  3GMW A;  1FOF A;  3BRM A;  3HUO A;  5FQ9 A;  3ZFZ A;  5M18 A;  3HBR A;  1NZO A;  4NET A;  4LV1 A;  4GD6 A;  2QPN A;  1N4O A;  5EVL A;  3ZVT A;  4DDS A;  1GA0 A;  4C3Q A;  4PPR A;  2C5W B;  3LEZ A;  4UA7 A;  1K56 D;  5GLD A;  4E3K A;  1Q2Q A;  3FZC A;  3MZD A;  2Y2H A;  3ITA A;  3OCN A;  2QMI A;  5AQ7 A;  2CC1 A;  1YLZ A;  4WMC D;  4P0M A;  4XXR A;  4IED A;  1NYM A;  4OLD A;  1ESI A;  5FAP A;  1W7F A;  5F1G A;  2Z2M B;  4FH2 A;  4OOY A;  4F94 A;  1MKI A;  2FFF B;  1JWP A;  2FFY A;  4C75 A;  3PBN A;  3HUM A;  4P6B A;  3IXG A;  1BUL A;  4CPK A;  4PM5 A;  5F83 A;  1LHY A;  4XUX A;  2JCH A;  4KG6 A;  4KQO A;  4OPZ A;  4Q8I A;  1K55 A;  3GTC A;  4ZDX A;  5BOH A;  5L2F A;  4RVA A;  1BSG A;  2P74 A;  4K0W A;  4PM7 A;  3M6B A;  1MY8 A;  3BFG A;  3HLC A;  1IEL A;  3MZE A;  4HBT A;  4OP8 A;  3RXW A;  2V1Z A;  4M3K A;  4IBX A;  5CTM A;  3SH7 A;  3IF6 B;  4CJN A;  5GL9 A;  1BT5 A;  1FR6 A;  2XH9 A;  3D4F A;  5DF7 A;  1XA7 A;  4EUZ A;  1YMS A;  1K54 A;  5EVI D;  4OP5 A;  2WUQ A;  5CEC A;  4WEJ A;  3VMA A;  4GOG A;  2A3U A;  4KZ9 A;  4KZ5 A;  4BQM A;  1ZG4 A;  4WZ4 A;  3C4O A;  2A49 A;  3G2Z A;  5A90 A;  2HP5 A;  4OON A;  2EX8 A;  1RGZ A;  5FQJ A;  4OPY A;  1W8Y A;  2G2U A;  1MPL A;  2J8Y A;  3HUN A;  2Z2L B;  3M6H A;  3SOI A;  4OOM A;  1ES5 A;  3G2Y A;  4B4X A;  3G32 A;  1IYO A;  4Y0O A;  5A92 A;  4N9L A;  3UPP A;  4HES A;  4MBH A;  3NIA A;  1W8Q A;  3IWQ A;  4S2M A;  4QY6 A;  5EVI B;  1FCO A;  1LL9 A;  3VP0 A;  1PIO A;  4DE1 A;  5HAQ A;  3UO9 A;  3PBQ A;  3BFD A;  4PM8 A;  1S6R A;  2BLS A;  5D3O A;  1K56 A;  3ZG5 A;  3Q81 A;  3RXX A;  3UNW A;  3WRT A;  1Z6F A;  4JXG A;  5FQQ A;  2Y2Q A;  5HX9 A;  5GHX A;  3ZHH A;  4WMC A;  4JLF A;  4Y0U A;  4DXC A;  4LV0 A;  1GHM A;  1PI5 A;  4Z9Q A;  4OH0 A;  2VGJ A;  3MXS A;  3O87 A;  3VFF A;  3A3I A;  4ZJ3 A;  1OME A;  1K4E A;  2ZQC A;  5EPH A;  3G4P A;  4GDB A;  4JXV A;  4EQI A;  4O7D A;  1ES2 A;  3A3E A;  3NDG A;  3FKW A;  3W4P A;  1MXO A;  1ES3 A;  2H10 A;  2RL3 A;  2ZMA A;  5AQB A;  4RX3 A;  3Q7V A;  5CHM A;  3VOZ A;  1XXM A;  5HW3 A;  5A93 A;  3VP2 A;  4DE2 A;  5JYO A;  1CEF A;  2Y2N A;  4LV3 A;  1GCE A;  3GR2 A;  2IWB A;  3BYD A;  3MFD A;  1XP4 A;  2WK0 A;  4KZ8 A;  1K6R A;  5EVI A;  2ZM8 A;  3FWL A;  3SH9 A;  4JPM A;  3MKF A;  3IWI A;  5EOO A;  4A5R A;  2HDU A;  5FI7 A;  4E3O A;  1EI5 A;  2H0Y A;  3GVB A;  5E2F A;  2Y91 A;  3IXD A;  1XA1 A;  5J8X A;  5GLC A;  4YIN A;  1PWC A;  5AQ9 A;  5CGX A;  3EQU A;  4JXS A;  1KVL A;  3SS3 A;  2V20 A;  3ZG0 A;  1PW1 A;  3UDX A;  3NBL A;  5GHZ A;  5CGW A;  1KDS A;  2IWC A;  1G6A A;  2JC7 A;  3HLW A;  4U3T A;  1SKF A;  4KZ6 A;  4GZB A;  1S0W A;  4MNR A;  5TR7 A;  1I2W A;  2XFT A;  1O07 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...