1ESUA

S235a mutant of tem1 beta-lactamase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKAGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title TEM1 beta-lactamase structure solved by molecular replacement and refined structure of the S235A mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1esuA00
1YM1A 1ES3A 3FZCA 3MXRA 3N8SA 3IWIA 3NBLA 4JKTA 1XA1A 1IYOA 1IYSA 4S2JA 2P74A 5J8XA 1YLTA 5M18A 1GHPA 3VP1A 1H5XA 3NIAA 5EUAA 5FQMA 2HP9A 3ITAA 1EWZA 4WEKA 1DJCA 3IF6B 2H5SA 3UN7A 3RXXA 1K56A 1ES2A 5EVIB 2BG1A 1LI0A 4MBKA 5AQBA 3TOIA 4DE0A 1KGGA 1KGEA 4UAAA 5EPHA 3MXSA 1PW1A 4X68A 2Y2KA 4LV0A 3QNCA 2Y2HA 3DTMA 1IKGA 3HLCA 3UDFA 1FCOA 3OPPA 5M19A 2Z2MB 1Q2QA 1SDEA 2DRWA 4CPKA 1JVJA 1ONGA 5FI7A 3BLSA 5EOEA 3IH9A 1K4FA 1L0EA 2ZM0A 4KG6A 2Y59A 4E3OA 4HESA 2IWDA 4X56A 4GN2A 2Y2PA 4B4XA 1WYBA 4EBLA 4JPMA 2WUQA 3O87A 3Q1FA 4OKPA 5CEDA 2OSUA 4WMCA 5CGXA 2G2WA 3V50A 3ZHHA 2EFXA 2A49A 3WS1A 4C3QA 2OLVA 5FAOA 2WGWB 2XR0A 3PAGA 2WADA 4R4SA 4C6YA 3GRJA 4X55A 5A90A 4IBRA 4A5RA 3M6BA 4CJNA 3Q07A 3W8KA 2ZQDA 3ZG0A 2XD5A 2HP6A 4GKUA 2WKHA 2QPNA 4OONA 1CI9A 4FH2A 4OOLA 3BLMA 2RCXA 4S2KA 4EBNA 2XFTA 5CHMA 4B4ZA 4DXBA 4E3KA 1HZOA 1MKIA 2ZC3B 1JWVA 2QZ6A 4DE3A 2JBFA 5CECA 2J8YA 4MBFA 5FDHA 4K0WA 1H8ZA 1K38A 4BL3A 3A3JA 2QMIA 3EQVA 1LI9A 1ALQA 2Q9NA 1BZAA 1VM1A 3HL9A 1PWCA 3B3XA 4PPRA 3JYIA 4YFMA 3W4OA 2I72A 2RL3A 1ERQA 2DCFA 1YLYA 1CEGA 3TG9A 3ITBA 3IXBA 1K54A 2EXAA 5F83A 5HAIA 2WZXA 1ES5A 4F94A 3UO9A 2Y2QA 4KZBA 3VP2A 3HREA 3SS5A 1MWRA 1SDNA 4EV4A 2ZQ8A 3VFHA 4E6XA 4Z9QA 3O3VA 3W4PA 2E8IA 4QY6A 2XFSA 1FOFA 3QHYA 5U47A 3FWLA 3N8LA 3RJUA 3CZDA 3DWKA 1BLHA 4OPQA 2OV5A 3AGFA 3MKFA 1PZPA 1Z6FA 4IVIA 3NDEA 2X71A 1BTLA 1K57A 3MZEA 4OP8A 1CEFA 2GDNA 4C75A 4GD6A 4P85A 3SS3A 4M3KA 1WYCA 3IH8A 5GLCA 4KZ3A 5DF8A 4WELA 4N1XA 1MBLA 3CMZA 1K54C 2B5RA 5CXWA 4OLGA 1JWZA 1W7FA 5EE8A 1EI5A 2HDQA 1I2SA 4JXGA 3OPRA 4RVAA 5GHZA 3VSLA 4HBTA 1ES4A 4DE2A 4S2MA 1HVBA 3Q7ZA 4QY5A 3IF6C 3OPHA 1Q2PA 1FSWA 4UA9A 1HD8A 4WYYA 3GSGA 1FCMA 3AGDA 1YLZA 2Y2LA 3IXDA 1ZC2A 3V3RA 4HEFA 4KQQA 4IBXA 1IEMA 3PBRA 5FA7A 3OPLA 4E3MA 1KE0A 2JCHA 2WKEA 4GDNA 4N1HA 3UNWA 3ZG5A 3V3SA 4BLMA 1MPLA 1L0GA 4DF6A 1RCJA 3HLGA 1IELA 1WE4A 4N92A 2X02A 5FI6A 1O7EA 1XP4A 3MZDA 3V5MA 4OQIA 5KSCA 3PTEA 5JYOA 5HARA 3MKEA 3O88A 5E2EA 3D4FA 3E2LA 1ZKJA 4KZ5A 3ZG7B 4FH4A 4H8RA 4UA6A 3FV7A 1ZG4A 2JC7A 4PM8A 4X53A 3SS4A 4DE1A 5HAPA 4O7DA 1FSYA 4WZ5A 3V39A 1ZG6A 3N6IA 1TDLA 1H8YA 3P98A 2Y55A 3A3IA 3PBNA 4LENA 5F1FA 2HPBA 4KQRA 4WM9A 4OQGA 3LO7A 3EQUA 5EECA 5FQJA 5A92A 3WS0A 5FI2A 5DTKA 2X01A 2J7VA 3SOIA 4MNRA 2H0YA 3NCKA 4KENB 3ZGAB 2HP5A 3IT9A 3S22A 3OCNA 4JLFA 3GV9A 2WZZA 3CG5A 4N9LA 5F82A 3G2ZA 1O07A 1YLWA 4LCMA 1NZUA 1K25A 2Z2LB 1LHYA 2ZC6B 5FSRA 1K55A 1SCWA 1GA0A 2R9WA 1S6RA 1XXMA 4LV3A 2ZM2A 3BFGA 4ZJ1A 3ZNTA 3C7VA 2EX9A 2VGKA 3WRTA 3IQAA 5HX9A 4QHCA 1YMSA 2PBYA 3MBZA 1BT5A 4WZ5C 5GLDA 4OPYA 4OQ0A 3DW0A 3NI9A 4OPZA 3VOYA 2ZMAA 3ZG9B 1PI5A 4RYEA 4BD1A 2Q9MA 5CHJA 2H0TA 2WAEA 5JYPA 3LCEA 4UA7A 3ZDJA 2V20A 2A3UA 2Y2IA 5D3OA 5FQIA 3ZVTA 3UDIA 1NYMA 4PM7A 5IHVA 4ZAMA 3MFDA 5DF9A 4WZ4A 1DY6A 1L0DA 4S2OA 5FAQA 2IWCA 3GMWA 1C3BA 1KVLA 5AQ9A 5GHYA 1E25A 2H10A 5A91A 4JXWA 1PYYA 3UPOA 2ZC4B 3ISGA 4FD8A 4R3JA 3S1YA 4S2IA 1K55C 4E6WA 4R4RA 1XGJA 4QJGA 4GZBA 2ZQAA 1W5DA 3LEZA 4NK3A 4OQHA 5CTNA 3WS2A 2P9VA 1GHMA 3C5AA 1L2SA 1BLSA 3WS4A 1KVMA 1NZOA 1PZOA 2HDSA 1W79A 3NDGA 3PAEA 1K6SA 4GB7A 2PU2A 5FASA 1LLBA 2ZD8A 4KG2A 4DRTA 2C5WB 1JTGA 1BUEA 3S4XA 4B88A 3HLDA 1W8QA 3IXGA 5GLAA 4E3LA 5FQQA 3BECA 2BLSA 3A3DA 4JXSA 1NYYA 2VGJA 2XD1A 2V1ZA 4S2PA 2XK1A 4E3JA 4U3TA 3ZNYA 1FR6A 1FQGA 1MWUA 1K4EA 1NXYA 2Y2OA 4GOGA 4P0MA 3HBRA 5FQKA 3UE3A 4DKIA 4U0XA 1MY8A 2ZLYA 3UDXA 1LL9A 4ZTKA 3M6HA 2EX2A 4KZ7A 5HFOA 5EOOA 1RGYA 1YLPA 3LY3A 1NRFA 4KZ9A 1TDGA 4KZAA 4PM6A 3G31A 4JBFA 4JF5A 3N4IA 4OPRA 4QB8A 4OOMA 3WS5A 3DWZA 1J9MA 4K0XA 5TFQA 1JWPA 3BRMA 3VOZA 4Q8IA 3I7JA 1E4DA 4Y0UA 1L0FA 3IWQA 4EQIA 1DJAA 5I94A 1GA9A 3BFDA 1K57C 2XF3A 1CK3A 4OLDA 4R1GA 4D2OA 3PBQA 3SH7A 5TGFA 2P9VB 5EVID 3C7UA 1XA7A 4MEZA 3IHBA 1PWDA 3IXHA 3AGEA 3A3EA 2R9XA 4GD8A 1QMFA 2Y2GA 2JE5A 5DVAA 1AXBA 3NC8A 5TR7A 4EUZA 2PU4A 5BOHA 2EX6A 1E3UD 1M6KA 4WEJA 1BULA 4S2NA 4EBPA 4WBGA 3ZCZA 1YLJA 4KG5A 2WAFA 2XDMA 3WWXA 4XXRA 3HLBA 4OH0A 1DJBA 3Q7VA 5CHUA 4BENA 3G4PA 4ID4A 4ZDXA 1N9BA 5FATA 5CERA 2FFFB 3BEBA 4QD4A 4X69A 4ZBEA 5GHXA 5GL9A 1OMEA 2HDRA 3CJMA 4PM9A 4UHUA 5HL1A 5KMWA 1TEMA 2DNSA 3VP0A 2FFYA 5CEBA 5G18A 1NY0A 3BFCA 5M1AA 3ZG8B 2WK0A 4Y7PA 1PW8A 3IF5A 3BFFA 4OP5A 2ZQCA 4BJPA 1RP5A 1KDWA 4OVDA 4RA7A 1JTDA 3E2KA 3VP3A 2Y2JA 2XGNA 3ZVWA 2WGVA 4XUXA 3Q81A 3UY6A 3VFFA 1TVFA 4S2NC 4FSFA 5CGWA 1SKFA 2EXBA 1K56D 3W4QA 2EFUA 3Q82A 1M40A 3IWOA 1Y54A 1G68A 4NETA 3LY4A 5FAPA 4Y0OA 5FQ9A 1GCEA 3UPNA 1QMEA 2Y2NA 1SHVA 1W8YA 2ZQ7A 1YT4A 2ZQ9A 1KE3A 3UPPA 2G2UA 1IYQA 4XUZA 3BM6A 1MWSA 3IHAA 5AQAA 1XKZA 4U0TA 4DDSA 1IYPA 1BLPA 3MZFA 4OOYA 1YQSA 1VQQA 3C4PA 5DTTA 1KGFA 3BYDA 5DF7A 3OCLA 1KDSA 3Q7VB 4WMCD 3NY4A 5DTSA 5E43A 1U60A 1XPBA 4DDYA 4JF4A 4GNUA 1XGIA 3N7WA 1ESUA 3SH8A 3HLWA 1FCNA 4GDBA 4JF6A 3PBTA 4PM5A 3P09A 2ZM8A 1XX2A 4LV2A 3OZHA 1PIOA 4HBUA 4IEDA 3G30A 3FKWA 4FCFA 2WYXA 1RGZA 3PBSA 4KZ8A 4S2LA 4R0QA 5E2GA 2EX8A 3RXWA 3ZFZA 3TSGA 4LCLA 3C4OA 2C6WB 3G34A 2CC1A 4K91A 3VMAA 1BLCA 1GHIA 4EWFA 4ZJ3A 4N9KA 1HTZA 4P6BA 1BSGA 1IKIA 1LL5A 2J9OA 1I5QA 1ESIA 3O86A 5KZHA 2ZC7A 1G6AA 4YINA 4MBHA 1N4OA 4BD0A 3G35A 4RX3A 5KSHA 2XLNA 5A93A 1CI8A 4L0LA 3HVFA 4QU3A 2XEPA 3VP4A 5E2HA 4P87A 3G2YA 3QNBA 3N8RA 5CGSA 3IF6A 2IWBA 4R23A 5HAQA 5EVIA 3GVBA 3HLEA 4BL2A 4Y0TA 3UE1A 3FKVA 4JXVA 3HUMA 3OC2A 3GQZA 2Y91A 3WRZA 4LV1A 1PI4A 5E2FA 2HDUA 5L2FA 1YMXA 5GLBA 1PWGA 2V2FF 5AQ7A 3HUOA 1E3UA 1MXOA 4PMAA 1KE4A 3SH9A 3M2KA 4KQOA 4MLLA 2ZJ9A 4X6TA 4KZ6A 1I2WA 1MWTA 2UWXA 4R3BA 4DXCA 3GTCA 3UE0A 3PBOA 2Y4AA 2WKIA 5EVLA 1S0WA 5CTMA 2WGIA 5F1GA 5CRFA 5HW3A 1EROA 2XH9A 3BFEA 3FYZA 3GR2A 2OLUA 2WGWA 3HUNA 1NJ4A 1K6RA 2Y2MA 4RX2A 3HLFA 3M2JA 2ZC5B 4ZJ2A 3A3FA 1ERMA 1FR1A 1ONHA 3VSKA 4E3IA 4E3NA 3G32A 4IVKA 5EVIC 4KZ4A 2XQZA 2J9PA 4BQMA
chains in the Genus database with same CATH superfamily
4DJ2A 1ES3A 3LICA 4G3KA 3NBLA 4WF0A 4S2JA 4G3VA 5M18A 2INWA 1GHPA 2HP9A 1ES2A 4MBKA 1KGGA 3LIBA 1KGEA 1J3WA 1XJ3A 2Y2KA 4WUJA 3QNCA 2Y79A 5HDDA 5M19A 1Q2QA 1SDEA 1ONGA 5FI7A 5EOEA 3IH9A 4X56A 3F1NB 2Y2PA 3G6OA 3O87A 3Q1FA 5CEDA 3VE4A 5CGXA 2FZ0A 2G2WA 2EWWA 2QJ5A 4XT2B 4X55A 1XJ6A 1OTEA 2XD5A 2HP6A 3K3CA 3T4KA 3B33A 1CI9A 4NG2A 2VX8A 1HZOA 4E04A 2QZ6A 5CECA 5FDHA 4GLQA 4BL3A 3A3JA 3EQVA 5EV0A 3HL9A 3B3XA 1ERQA 3EEAA 4O0PA 3ITBA 3IXBA 2EXAA 5F83A 4L9GA 2OWHA 3UO9A 3MSHA 2ZQ8A 4Z9QA 1WA9A 1FOFA 3N8LA 4OPQA 4EXOA 4IVIA 3NDEA 1XJ2A 1IFQA 3IH8A 2JKTM 3IBRA 4KZ3A 5DF8A 4PKYA 4N1XA 2HDQA 4JXGA 5EVEA 1XJ4A 4EUVA 3LEQA 2QHKA 2VEAA 4S2MA 3OPHA 2W1RA 4WYYA 2VA0A 1YLZA 2Y2LA 4GS9B 4YWZA 5G4YA 4KQQA 1IEMA 3PBRA 2W3GA 1T19A 1ZTUA 1W63Q 2JCHA 3ZG5A 3V3SA 3CWFA 3PXPA 2J80A 1O7EA 3L9KA 3V67A 5HARA 3MKEA 5FL3A 2L1MA 1DP8A 4NXFA 1ZG4A 1IOUA 2WKRA 2K7SA 5HAPA 4WZ5A 4PKYG 3A3IA 3UB5P 4KQRA 4WM9A 1Z09A 2KDKA 5FI2A 2J7VA 4MNRA 2H0YA 4KENB 3IT9A 3S22A 4JLFA 4N9LA 5F82A 1OTAA 1YLWA 5J7EA 3BFGA 4ZJ1A 4EW7A 2EX9A 3LR4A 1NWZA 1LL8A 3WRTA 5HX9A 3MBZA 1BT5A 4OQ0A 3R7WA 3K2NA 4EETB 3ZG9B 1PI5A 5HPIA 2Q9MA 3IX4A 2H0TA 2WAEA 3LCEA 4LLOB 2V20A 2A3UA 3ZDJA 2Y2IA 1UWNX 5FQIA 4GJ4A 4G3WA 1NYMA 4PM7A 5IHVA 3DTEA 4WZ4A 5FAQA 1KVLA 5GHYA 2ZBBA 2JKRM 3UPOA 4HJ4A 4R3JA 2MJ6A 4S2IA 3KSFA 4OQHA 3LEZA 5CTNA 3PHYA 4LRZE 1BLSA 3WS4A 1KVMA 2E8JA 1SKOB 1W79A 3NDGA 3PAEA 4ARZA 1LLBA 3QP1A 4JGOA 4H6JB 4I3AA 3S4XA 3KX0X 3IXGA 1W8QA 4IHQA 4MCWA 5FQQA 3BECA 2BLSA 4WLAA 3CLOA 4ZRRA 4KUOA 2V1ZA 4E3JA 4YNRA 1FR6A 4P0MA 1K4EA 2Y2OA 3LIFA 2ZL1A 3A0VA 3B42A 2XA7S 4KZ7A 5EOOA 2VK3A 3LY3A 2W3EA 1TDGA 4KZAA 2QYBA 4QB8A 2ZMVA 4GHIB 4OOMA 4B93A 1J9MA 4JGPA 1JWPA 4MN5A 3BRMA 4Q8IA 3ZYTA 1E4DA 3T4TA 4UQIS 1VEUA 4R38A 5A8BA 2LB9A 2UV0E 3SH7A 2GJ3A 5EVID 1PWDA 4HNBA 4GD8A 5LBRA 3UE6A 1QMFA 3SW1A 1AXBA 5TR7A 4EUZA 3K3DA 1E3UD 2PYPA 4M4XA 1BULA 1YSQA 4WBGA 3ZCZA 5HL6A 2WAFA 4WL9A 3WWXA 3NJAA 3T4QA 1TF1A 4X1MA 2VGLS 3BEBA 4QD4A 4X69A 4ZBEA 4CLCA 5GHXA 3CJMA 4UHUA 2FFYA 3ZG8B 3LIAA 1PW8A 3IF5A 4OP5A 3P7NA 1A0KA 3VP3A 2XGNA 2WGVA 4XUXA 3UY6A 2O9CA 4S2NC 1GSXA 3W4QA 1G6OA 2EFUA 3Q82A 3IWOA 3H7WB 5FAPA 4B9OA 1AWIA 4HH2A 2W27A 4Y5FA 1SHVA 2ZQ7A 4XUZA 1IYPA 1BLPA 3MZFA 4OOYA 5AJGA 2PR6A 3QP4A 1KGFA 1KDSA 3Q7VB 4P6ZM 1CQAA 3A0RA 1XGIA 5HSQA 4NKPA 4Y15A 3HLWA 3T1SA 3CPTB 3D9YA 3S7PA 4PM5A 2ZM8A 1T1CA 1XX2A 4R0QA 3TSGA 5L09A 3VMAA 2OWJA 1N9LA 2VV6A 2PD8A 3C2WA 4P6BA 2J9OA 4JGQA 2D02A 3T1RA 2ZC7A 4BD0A 1N4OA 3MS6A 3G35A 4RX3A 2XLNA 4P87A 3IF6A 3UB9A 5HAQA 4O01A 4GW9A 1S1YA 4Z1WA 2Y91A 3H82B 3GDIA 1F98A 4LGWA 1MXOA 1ZHHB 4KQOA 4MLLA 4X6TA 2HF6A 4KZ6A 1I2WA 3PBOA 5CTMA 4HQAA 2WKQA 2WGIA 5HD3A 1EROA 4MDZA 3GR2A 3CUEC 4RX2A 2Y2MA 3HLFA 2HV1A 4FUWA 1ERMA 3VSKA 4E3IA 2XQZA 5KSHA 4BQMA 3FZCA 2HZ5A 3IWIA 1XA1A 5J8XA 1YLTA 4EESA 5FEFA 1H5XA 3NIAA 3BY8A 3C8CA 3UN7A 3D3OA 1LI0A 3TOIA 2I9VA 4UAAA 3MXSA 1PW1A 2EA9A 4NXGA 4I5SA 3UDFA 5J3WA 2Z2MB 3QP5A 1F5MA 3BLSA 3LR0A 1L0EA 4KG6A 4HESA 2IWDA 4CLCE 2W3DA 4EBLA 2OSUA 4WMCA 3ZQ5A 2PAVP 3ZHHA 2EFXA 2A49A 3R4KA 3WS1A 2OLVA 2XR0A 4F3LA 2WADA 3GRJA 5A90A 4A5RA 5MC7A 3W8KA 4PAUA 3NHQA 3TJZC 2GNXA 3BLMA 2RCXA 4S2KA 2XFTA 5CHMA 4E3KA 1TS7A 4K08A 4R70A 1JWVA 4DE3A 2J8YA 1PFLA 1LI9A 1VM1A 1PWCA 1OT9A 3E4PA 3MF0A 4PPRA 3W4OA 4HP9A 1ES5A 3CHWP 3L7HA 2J3TC 4IJGA 1MWRA 4EV4A 5DFYA 3MQQA 5U47A 3FWLA 2OV5A 1Z6FA 2ZOHA 4OP8A 2GDNA 3SS3A 1WYCA 5GLCA 4ETZA 3O5YA 3CMZA 3R7WB 1K54C 2A24A 1EI5A 2M7UA 3OPRA 2V8FA 3LIDA 4Y3IA 5TBMA 4Y13A 3IF6C 1Q2PA 4R6LA 3OPLA 4N1HA 4BLMA 1RCJA 3HLGA 1XP4A 4OQIA 1K0KA 3PTEA 4GCZA 4KZ5A 3FV7A 4X53A 3SS4A 3CAXA 1H8YA 3P98A 3KO6A 3PBNA 4LENA 5F1FA 2HPBA 3ULFA 5EECA 3WS0A 2QJ7A 5DTKA 4JGRA 2HP5A 3VE3A 1PNEA 2PT7A 4LCMA 1VEUB 1LHYA 4CLCD 5DKKA 4DN0A 3IQAA 3NI9A 1VETA 2L4RA 4MMNA 4I3IA 4BD1A 5JYPA 5HZHA 5J4EA 1X0OA 3ZVTA 3UDIA 1DY6A 2CMNA 2FH5A 1C3BA 2P7JA 1E25A 2VV7A 5A91A 2ZC4B 3S1YA 3IX3A 1K55C 4E6WA 3IS2A 2ZQAA 2P9VA 5C5KA 2HDSA 3QP2A 2J3TD 4GB7A 2PU2A 4KG2A 4DRTA 2C5WB 3HLDA 5GLAA 4E3LA 5HWWA 3CITA 2VGJA 2XD1A 4S2PA 4IUHA 4U3TA 1FQGA 4GOGA 4DKIA 3UE3A 4U0XA 1P0ZA 3M6HA 1OTBA 5HFOA 5L07A 3LUQA 5EM1A 5TFQA 1VB6A 3I7JA 1DJAA 2B95A 2Z6CA 3T4LA 2XF3A 4DJ3A 5TGFA 4LRYC 3RFBA 2L0WA 3C7UA 1XA7A 5KIZA 2M1CA 3BWLA 3IXHA 3AGEA 3NECA 3BJNA 4ESPA 4S2NA 2G7UA 1YLJA 4KG5A 3T4SA 5CX7A 2XDMA 4XXRA 3HLBA 4OH0A 2HJEA 1F2KA 4NXEA 1V9YA 2FFFB 2VLGA 5GL9A 2HDRA 2Q0OA 4PM9A 5KMWA 5G4ZA 1TEMA 2DNSA 3QP6A 4O8GA 3BFFA 2ZQCA 4OVDA 2R78A 4HI4A 4Q0JA 3VFFA 2JKGA 4FSFA 3SZTA 2EXBA 3F1OB 5EM0A 4NETA 3LY4A 3TE8A 4Y0OA 1QMEA 2Y2NA 3PYPA 1W8YA 3A0SA 1EW0A 1IYQA 3W2ZA 4DDSA 2IA2A 3P01A 2LB5A 1YQSA 3KYZA 5L8MA 5DTTA 3F1PB 5DF7A 4WMCD 3NY4A 5DTSA 1P9RA 1ESUA 1H0MA 3LYXA 3PBTA 4BMWA 3P09A 2VZWA 3OZHA 1PIOA 5E2GA 4FCFA 1RGZA 3LI9A 4LFUA 4LRXC 2CC1A 1BLCA 1LSWA 4EWFA 4ZJ3A 1LL5A 1G6AA 4YINA 4MBHA 4L0LA 3EGDC 2NUPC 3CUEA 3HVFA 2W1TB 2XEPA 5E2HA 3UMEA 3G2YA 3QNBA 5CGSA 2IWBA 2D01A 3EOIA 2PBDP 2V0WA 3HLEA 1T18A 3FKVA 4JXVA 1P9WA 3WRZA 2HDUA 5L2FA 5GLBA 1FILA 1PWGA 2V2FF 3HUOA 3SH9A 3M2KA 5F69A 1MWTA 4R3BA 3F1NA 2Y4AA 2XROA 1S0WA 4Y17A 5F1GA 3BFEA 4XT2A 3FYZA 2OAP1 1SZVA 3GECA 2Z6DA 1S1ZA 3A3FA 3G32A 3T12B 1YM1A 1TS6A 2P08A 1IYOA 1IYSA 2P74A 5FDSA 3ITAA 1EWZA 4WEKA 1DJCA 4ME4A 4WN5A 1K56A 5EVIB 5AQBA 4DE0A 5EPHA 4LV0A 2Y2HA 3DTMA 1IKGA 2DMWA 3H9WA 3HLCA 3KSHA 3OPPA 2K2NA 2OAQ1 2HGVA 2DRWA 3FPWA 4CPKA 4HHDA 1TS0A 2ZM0A 3S7NA 2PHYA 2V1BA 3HJIA 1WYBA 3KSIA 3T50A 3V50A 2WGWB 2J3WA 4C6YA 4R4SA 4IBRA 1T1BA 3Q07A 3VOLA 3EGXC 3ZG0A 1GSWA 2QPNA 4HIAA 4OOLA 4EBNA 4B4ZA 4DXBA 3UB7A 1MKIA 3C30A 1FIKA 2P04A 4MBFA 1K38A 2QMIA 4FOFA 3U2AA 3JYIA 4YFMA 2AVXA 3TW8A 2RL3A 1YLYA 1CEGA 3TG9A 1K54A 4GS9A 5K5BA 5HAIA 2WZXA 4F94A 2ZOIA 3SS5A 4MN7A 1SDNA 3VFHA 3W4PA 4QY6A 2XFSA 1MKMA 3RJUA 3S7OA 3CZDA 1BLHA 3AGFA 3VV4A 1PZPA 2H28A 2X71A 1BTLA 1K57A 3MZEA 1CEFA 4C75A 4P85A 4WELA 2VV8A 3OOVA 1HLUP 3MQ0A 4OLGA 1JWZA 5EE8A 1I2SA 3FC7A 4RVAA 3VSLA 1ES4A 3DTKA 4QY5A 1FSWA 1HD8A 1FCMA 3FPVA 3IXDA 1ZC2A 3E4QA 4E3MA 5FA7A 1KE0A 4GDNA 3T4JA 4I3JA 1L0GA 5EFWA 1WE4A 4N92A 5FI6A 2X02A 5KSCA 3O88A 3MJQA 5E2EA 3D4FA 2YKFA 1ZKJA 4H8RA 2JC7A 3T4OA 1FSYA 1ZG6A 3N6IA 2Y55A 2QKPA 1CF0A 4OQGA 3JPUA 3LO7A 3EQUA 3SOIA 2X01A 3KYQA 2B18A 4EU0A 3ZGAB 4PHTA 1SKOA 3GV9A 2WZZA 2Z2LB 1K25A 2ZC6B 4H6JA 1K55A 1GA0A 2JN7A 2R9WA 5F5YA 2ZM2A 3C7VA 4QHCA 1YMSA 5GLDA 4HP4A 4OPZA 2K31A 2ZMAA 4RYEA 3KYEA 3DBAA 5D3OA 4GHIA 2V1AA 1ACFA 5DF9A 1S66L 3BY9A 1Y4OA 4S2OA 2IWCA 2GZAA 3ISGA 4FD8A 1JNUA 4R4RA 1XGJA 4Q0HA 1L3LA 3C5AA 1L2SA 1G28A 1K6SA 1OJ5A 1JTGA 3LGOA 3OLOA 3A3DA 4JXSA 4HH3A 1MWUA 5FQKA 1YSPA 3JVVA 3UDXA 1LL9A 4ZTKA 2EX2A 1RGYA 1YLPA 2OOLA 5AVEA 4JBFA 3N4IA 5DJTA 4FTXA 3WS5A 4K0XA 3VOZA 4EQIA 2O9AA 5I94A 1K57C 4OLDA 1CK3A 4D2OA 3PBQA 4MEZA 3H7WA 5IU1A 4QWOA 4ARZB 2Y2GA 5DVAA 2XA7M 2PU4A 1M6KA 4WEJA 1DP9A 4II7A 1DJBA 3Q7VA 3DAVA 5CHUA 4BENA 3G4PA 2ZL1B 3MFXA 4UQIM 1YPRA 1LSVA 3CPTA 5HWTA 3LIEA 1NY0A 3UMDA 4BJPA 1RP5A 1KDWA 1JTDA 3BQAA 3E2KA 3BQ8A 4P6ZS 2Y2JA 3ZVWA 2QWSA 1S4SA 1SKFA 3KSGA 2HJ9C 1K56D 3E4OA 4NXBA 3LFVA 1G68A 2VGLM 5FQ9A 1GCEA 4UEYA 2ZQ9A 2G2UA 3BM6A 5AQAA 1XKZA 2XSSA 1VQQA 1D06A 4EEUA 3C4PA 3BYDA 3H82A 4IUKA 4JF4A 4GNUA 4CLCB 3N7WA 3SH8A 4GDBA 4HY8A 4LV2A 1NLYA 5I5LA 3G30A 2WYXA 4KZ8A 3ZFZA 3C4OA 2C6WB 1LT0A 4K91A 1DP6A 4N9KA 1HTZA 1BSGA 1I5QA 5KZHA 4D60A 5A93A 3VP4A 3C38A 4R23A 4BL2A 4Y0TA 1T1AA 3OC2A 4LV1A 2Y8HA 1PI4A 5HPFA 4X1LA 4PMAA 1KE4A 1KOUA 2UWXA 3GTCA 5EVLA 4Y2FA 5CRFA 5HW3A 4DMZA 1N9OA 3JVUA 2OLUA 3HUNA 4HOIA 1K6RA 3LR3A 4ZJ2A 1ONHA 4E3NA 3QP8A 4IVKA 5EVIC 4KZ4A 5FATA 3IBJA 2J9PA 3MXRA 3N8SA 4JKTA 1NLZA 4KQDA 3BW6A 4QPRA 2W3FA 3VP1A 5FQMA 5EUAA 3NOUC 3IF6B 5IS1A 2H5SA 3RXXA 1LSXA 2BG1A 5FEGA 4BWIA 5TJJA 4X68A 2KOIA 3MQOA 1FCOA 1JVJA 1K4FA 4E3OA 2Y59A 3MMHA 4GN2A 2ACGA 4B4XA 4JPMA 2WUQA 4OKPA 1S67L 3E98A 4EEPA 4C3QA 5FAOA 4KUKA 3PAGA 3M6BA 4CJNA 3NULA 4EERA 2ZQDA 2V9AA 2B02A 1H8MA 4GKUA 2WKHA 4OONA 4YOFA 4FH2A 1DRMA 5DJUA 2ZC3B 2JBFA 4K0WA 1H8ZA 1S4RA 1ALQA 2Q9NA 1BZAA 5F6AA 4LPZA 5HWVA 2I72A 4HJ3A 1NRJA 2DCFA 2O9BA 4EQ1A 3T1QB 3IX8A 2Y2QA 1UGUA 2O99A 4KZBA 3VP2A 3HREA 4E6XA 3O3VA 1YAXA 2E8IA 4F3LB 3QHYA 4RQ9A 3DWKA 1N9NA 3MKFA 2VKSA 3TRCA 1UWPX 4GD6A 4M3KA 5HDSA 1MBLA 2B5RA 5CXWA 1W7FA 5GHZA 4HBTA 4DE2A 2PDRA 3MXQA 1HVBA 3Q7ZA 3MR0A 4UA9A 3GSGA 3AGDA 2A2LA 3V3RA 4HEFA 4IBXA 4BBTA 2WKEA 3S7QA 3UNWA 1MPLA 2PYRA 4DF6A 1IELA 2ZMFA 3V5MA 3MZDA 2V0UA 1TS8A 3FG8A 5JYOA 3E2LA 3ZG7B 4FH4A 5IT5A 4UA6A 4PM8A 4DE1A 1OTIA 4O7DA 3V39A 1TDLA 2A24B 5HD5A 4BBUA 2BASA 5FQJA 5A92A 3T1XA 3NCKA 5TBMB 3HCYA 1XFQA 3OCNA 1MZUA 3CG5A 3G2ZA 1O07A 1NZUA 5FSRA 1SCWA 4CQHA 2PD7A 1S6RA 1XXMA 4LV3A 3CI6A 3ZNTA 2VGKA 1MC0A 4HJ6A 4X25A 3U4LP 2PBYA 1W63M 4WZ5C 3EEHA 4OPYA 3DW0A 3VOYA 5CHJA 4ETXA 3UB6A 2JKTI 4UA7A 3NOTC 2BTFP 2JHEA 3LI8A 4ZAMA 3MFDA 2GX5A 1YKDA 2O0YA 1L0DA 3GMWA 5AQ9A 2H10A 4JXWA 1PYYA 4I38A 4AFIA 1ODVA 4QJGA 4GZBA 1W5DA 3WS2A 4NK3A 4BBVA 1GHMA 1Y28A 3B47A 1NZOA 1PZOA 2M7VA 5FASA 2ZD8A 4B88A 1BUEA 2XRNA 1NYYA 1D1JA 2XK1A 3ZNYA 1NXYA 3HBRA 1V9ZA 1MY8A 2ZLYA 4L9FA 1VETB 3DTIA 3NOPC 4KZ9A 1NRFA 4PM6A 1TD5A 3G31A 4JF5A 4OPRA 4MN6A 3DWZA 2VJWA 1OT6A 2EWVA 4Y0UA 1STZA 1L0FA 3IWQA 1GA9A 3BFDA 3IS2B 3F1OA 4R1GA 1G5UA 2P9VB 3IHBA 1H3QA 3A3EA 2R9XA 1OJGA 3ICYA 2JE5A 2WKPA 3NC8A 5BOHA 1P97A 2EX6A 2NUTC 3UB8A 4EBPA 3HJKA 3F1PA 3E0YA 4ZDXA 4ID4A 1N9BA 5CERA 3RTYA 1OMEA 5HL1A 1BYWA 3VP0A 5CEBA 5G18A 3D72A 5M1AA 3BFCA 2WK0A 2JKRI 4Y7PA 4RA7A 3OBFA 3Q81A 1TVFA 5CGWA 1PRQA 1VHMA 1XFNA 5L10A 1M40A 1Y54A 5DKLA 3UPNA 2W1TA 4CLCC 1YT4A 3UPPA 1KE3A 1MWSA 3IHAA 3PR6A 4U0TA 5HDCA 2KLIA 3OCLA 5E43A 1U60A 1XPBA 4DDYA 4Q0IA 3RH8B 1FCNA 2V8CA 4JF6A 4HBUA 4IEDA 3FKWA 4S2LA 3PBSA 1OTDA 2EX8A 3RXWA 4LCLA 2JKFA 3G34A 1GHIA 1GSVA 5DFXA 5F68A 2PR5A 1IKIA 1OPXA 3LR5A 1ESIA 4L9EA 3O86A 1CI8A 4QU3A 3N8RA 5EVIA 3GVBA 3UE1A 3HUMA 3GQZA 1CJFA 3EWKA 5E2FA 1F9IA 1YMXA 5AQ7A 2W3HA 1E3UA 2YKHA 2ZJ9A 5AVFA 4DXCA 3UE0A 2WKIA 2PRFA 2XH9A 4R3AA 2WGWA 1NJ4A 4I39A 4NEED 3M2JA 2ZC5B 1D7EA 1FR1A 2W0NA 2KX6A
chains in the Genus database with same CATH topology
1YM1A 1ES3A 3FZCA 3MXRA 3N8SA 3IWIA 3NBLA 4JKTA 1XA1A 1IYOA 1IYSA 4S2JA 2P74A 5J8XA 1YLTA 5M18A 1GHPA 3VP1A 1H5XA 3NIAA 5EUAA 5FQMA 2HP9A 3ITAA 1EWZA 4WEKA 1DJCA 3IF6B 2H5SA 3UN7A 3RXXA 1K56A 1ES2A 5EVIB 2BG1A 1LI0A 4MBKA 5AQBA 3TOIA 4DE0A 1KGGA 1KGEA 4UAAA 5EPHA 3MXSA 1PW1A 4X68A 2Y2KA 4LV0A 3QNCA 2Y2HA 3DTMA 1IKGA 3HLCA 3UDFA 1FCOA 3OPPA 5M19A 2Z2MB 1Q2QA 1SDEA 2DRWA 4CPKA 1JVJA 1ONGA 5FI7A 3BLSA 5EOEA 3IH9A 1K4FA 1L0EA 2ZM0A 4KG6A 2Y59A 4E3OA 4HESA 2IWDA 4X56A 4GN2A 2Y2PA 4B4XA 1WYBA 4EBLA 4JPMA 2WUQA 3O87A 3Q1FA 4OKPA 5CEDA 2OSUA 4WMCA 5CGXA 2G2WA 3V50A 3ZHHA 2EFXA 2A49A 3WS1A 4C3QA 2OLVA 5FAOA 2WGWB 2XR0A 3PAGA 2WADA 4R4SA 4C6YA 3GRJA 4X55A 5A90A 4IBRA 4A5RA 3M6BA 4CJNA 3Q07A 3W8KA 2ZQDA 3ZG0A 2XD5A 2HP6A 4GKUA 2WKHA 2QPNA 4OONA 1CI9A 4FH2A 4OOLA 3BLMA 2RCXA 4S2KA 4EBNA 2XFTA 5CHMA 4B4ZA 4DXBA 4E3KA 1HZOA 1MKIA 2ZC3B 1JWVA 2QZ6A 4DE3A 2JBFA 5CECA 2J8YA 4MBFA 5FDHA 4K0WA 1H8ZA 1K38A 4BL3A 3A3JA 2QMIA 3EQVA 1LI9A 1ALQA 2Q9NA 1BZAA 1VM1A 3HL9A 1PWCA 3B3XA 4PPRA 3JYIA 4YFMA 3W4OA 2I72A 2RL3A 1ERQA 2DCFA 1YLYA 1CEGA 3TG9A 3ITBA 3IXBA 1K54A 2EXAA 5F83A 5HAIA 2WZXA 1ES5A 4F94A 3UO9A 2Y2QA 4KZBA 3VP2A 3HREA 3SS5A 1MWRA 1SDNA 4EV4A 2ZQ8A 3VFHA 4E6XA 4Z9QA 3O3VA 3W4PA 2E8IA 4QY6A 2XFSA 1FOFA 3QHYA 5U47A 3FWLA 3N8LA 3RJUA 3CZDA 3DWKA 1BLHA 4OPQA 2OV5A 3AGFA 3MKFA 1PZPA 1Z6FA 4IVIA 3NDEA 2X71A 1BTLA 1K57A 3MZEA 4OP8A 1CEFA 2GDNA 4C75A 4GD6A 4P85A 3SS3A 4M3KA 1WYCA 3IH8A 5GLCA 4KZ3A 5DF8A 4WELA 4N1XA 1MBLA 3CMZA 1K54C 2B5RA 5CXWA 4OLGA 1JWZA 1W7FA 5EE8A 1EI5A 2HDQA 1I2SA 4JXGA 3OPRA 4RVAA 5GHZA 3VSLA 4HBTA 1ES4A 4DE2A 4S2MA 1HVBA 3Q7ZA 4QY5A 3IF6C 3OPHA 1Q2PA 1FSWA 4UA9A 1HD8A 4WYYA 3GSGA 1FCMA 3AGDA 1YLZA 2Y2LA 3IXDA 1ZC2A 3V3RA 4HEFA 4KQQA 4IBXA 1IEMA 3PBRA 5FA7A 3OPLA 4E3MA 1KE0A 2JCHA 2WKEA 4GDNA 4N1HA 3UNWA 3ZG5A 3V3SA 4BLMA 1MPLA 1L0GA 4DF6A 1RCJA 3HLGA 1IELA 1WE4A 4N92A 2X02A 5FI6A 1O7EA 1XP4A 3MZDA 3V5MA 4OQIA 5KSCA 3PTEA 5JYOA 5HARA 3MKEA 3O88A 5E2EA 3D4FA 3E2LA 1ZKJA 4KZ5A 3ZG7B 4FH4A 4H8RA 4UA6A 3FV7A 1ZG4A 2JC7A 4PM8A 4X53A 3SS4A 4DE1A 5HAPA 4O7DA 1FSYA 4WZ5A 3V39A 1ZG6A 3N6IA 1TDLA 1H8YA 3P98A 2Y55A 3A3IA 3PBNA 4LENA 5F1FA 2HPBA 4KQRA 4WM9A 4OQGA 3LO7A 3EQUA 5EECA 5FQJA 5A92A 3WS0A 5FI2A 5DTKA 2X01A 2J7VA 3SOIA 4MNRA 2H0YA 3NCKA 4KENB 3ZGAB 2HP5A 3IT9A 3S22A 3OCNA 4JLFA 3GV9A 2WZZA 3CG5A 4N9LA 5F82A 3G2ZA 1O07A 1YLWA 4LCMA 1NZUA 1K25A 2Z2LB 1LHYA 2ZC6B 5FSRA 1K55A 1SCWA 1GA0A 2R9WA 1S6RA 1XXMA 4LV3A 2ZM2A 3BFGA 4ZJ1A 3ZNTA 3C7VA 2EX9A 2VGKA 3WRTA 3IQAA 5HX9A 4QHCA 1YMSA 2PBYA 3MBZA 1BT5A 4WZ5C 5GLDA 4OPYA 4OQ0A 3DW0A 3NI9A 4OPZA 3VOYA 2ZMAA 3ZG9B 1PI5A 4RYEA 4BD1A 2Q9MA 5CHJA 2H0TA 2WAEA 5JYPA 3LCEA 4UA7A 3ZDJA 2V20A 2A3UA 2Y2IA 5D3OA 5FQIA 3ZVTA 3UDIA 1NYMA 4PM7A 5IHVA 4ZAMA 3MFDA 5DF9A 4WZ4A 1DY6A 1L0DA 4S2OA 5FAQA 2IWCA 3GMWA 1C3BA 1KVLA 5AQ9A 5GHYA 1E25A 2H10A 5A91A 4JXWA 1PYYA 3UPOA 2ZC4B 3ISGA 4FD8A 4R3JA 3S1YA 4S2IA 1K55C 4E6WA 4R4RA 1XGJA 4QJGA 4GZBA 2ZQAA 1W5DA 3LEZA 4NK3A 4OQHA 5CTNA 3WS2A 2P9VA 1GHMA 3C5AA 1L2SA 1BLSA 3WS4A 1KVMA 1NZOA 1PZOA 2HDSA 1W79A 3NDGA 3PAEA 1K6SA 4GB7A 2PU2A 5FASA 1LLBA 2ZD8A 4KG2A 4DRTA 2C5WB 1JTGA 1BUEA 3S4XA 4B88A 3HLDA 1W8QA 3IXGA 5GLAA 4E3LA 5FQQA 3BECA 2BLSA 3A3DA 4JXSA 1NYYA 2VGJA 2XD1A 2V1ZA 4S2PA 2XK1A 4E3JA 4U3TA 3ZNYA 1FR6A 1FQGA 1MWUA 1K4EA 1NXYA 2Y2OA 4GOGA 4P0MA 3HBRA 5FQKA 3UE3A 4DKIA 4U0XA 1MY8A 2ZLYA 3UDXA 1LL9A 4ZTKA 3M6HA 2EX2A 4KZ7A 5HFOA 5EOOA 1RGYA 1YLPA 3LY3A 1NRFA 4KZ9A 1TDGA 4KZAA 4PM6A 3G31A 4JBFA 4JF5A 3N4IA 4OPRA 4QB8A 4OOMA 3WS5A 3DWZA 1J9MA 4K0XA 5TFQA 1JWPA 3BRMA 3VOZA 4Q8IA 3I7JA 1E4DA 4Y0UA 1L0FA 3IWQA 4EQIA 1DJAA 5I94A 1GA9A 3BFDA 1K57C 2XF3A 1CK3A 4OLDA 4R1GA 4D2OA 3PBQA 3SH7A 5TGFA 2P9VB 5EVID 3C7UA 1XA7A 4MEZA 3IHBA 1PWDA 3IXHA 3AGEA 3A3EA 2R9XA 4GD8A 1QMFA 2Y2GA 2JE5A 5DVAA 1AXBA 3NC8A 5TR7A 4EUZA 2PU4A 5BOHA 2EX6A 1E3UD 1M6KA 4WEJA 1BULA 4S2NA 4EBPA 4WBGA 3ZCZA 1YLJA 4KG5A 2WAFA 2XDMA 3WWXA 4XXRA 3HLBA 4OH0A 1DJBA 3Q7VA 5CHUA 4BENA 3G4PA 4ID4A 4ZDXA 1N9BA 5FATA 5CERA 2FFFB 3BEBA 4QD4A 4X69A 4ZBEA 5GHXA 5GL9A 1OMEA 2HDRA 3CJMA 4PM9A 4UHUA 5HL1A 5KMWA 1TEMA 2DNSA 3VP0A 2FFYA 5CEBA 5G18A 1NY0A 3BFCA 5M1AA 3ZG8B 2WK0A 4Y7PA 1PW8A 3IF5A 3BFFA 4OP5A 2ZQCA 4BJPA 1RP5A 1KDWA 4OVDA 4RA7A 1JTDA 3E2KA 3VP3A 2Y2JA 2XGNA 3ZVWA 2WGVA 4XUXA 3Q81A 3UY6A 3VFFA 1TVFA 4S2NC 4FSFA 5CGWA 1SKFA 2EXBA 1K56D 3W4QA 2EFUA 3Q82A 1M40A 3IWOA 1Y54A 1G68A 4NETA 3LY4A 5FAPA 4Y0OA 5FQ9A 1GCEA 3UPNA 1QMEA 2Y2NA 1SHVA 1W8YA 2ZQ7A 1YT4A 2ZQ9A 1KE3A 3UPPA 2G2UA 1IYQA 4XUZA 3BM6A 1MWSA 3IHAA 5AQAA 1XKZA 4U0TA 4DDSA 1IYPA 1BLPA 3MZFA 4OOYA 1YQSA 1VQQA 3C4PA 5DTTA 1KGFA 3BYDA 5DF7A 3OCLA 1KDSA 3Q7VB 4WMCD 3NY4A 5DTSA 5E43A 1U60A 1XPBA 4DDYA 4JF4A 4GNUA 1XGIA 3N7WA 1ESUA 3SH8A 3HLWA 1FCNA 4GDBA 4JF6A 3PBTA 4PM5A 3P09A 2ZM8A 1XX2A 4LV2A 3OZHA 1PIOA 4HBUA 4IEDA 3G30A 3FKWA 4FCFA 2WYXA 1RGZA 3PBSA 4KZ8A 4S2LA 4R0QA 5E2GA 2EX8A 3RXWA 3ZFZA 3TSGA 4LCLA 3C4OA 2C6WB 3G34A 2CC1A 4K91A 3VMAA 1BLCA 1GHIA 4EWFA 4ZJ3A 4N9KA 1HTZA 4P6BA 1BSGA 1IKIA 1LL5A 2J9OA 1I5QA 1ESIA 3O86A 5KZHA 2ZC7A 1G6AA 4YINA 4MBHA 1N4OA 4BD0A 3G35A 4RX3A 5KSHA 2XLNA 5A93A 1CI8A 4L0LA 3HVFA 4QU3A 2XEPA 3VP4A 5E2HA 4P87A 3G2YA 3QNBA 3N8RA 5CGSA 3IF6A 2IWBA 4R23A 5HAQA 5EVIA 3GVBA 3HLEA 4BL2A 4Y0TA 3UE1A 3FKVA 4JXVA 3HUMA 3OC2A 3GQZA 2Y91A 3WRZA 4LV1A 1PI4A 5E2FA 2HDUA 5L2FA 1YMXA 5GLBA 1PWGA 2V2FF 5AQ7A 3HUOA 1E3UA 1MXOA 4PMAA 1KE4A 3SH9A 3M2KA 4KQOA 4MLLA 2ZJ9A 4X6TA 4KZ6A 1I2WA 1MWTA 2UWXA 4R3BA 4DXCA 3GTCA 3UE0A 3PBOA 2Y4AA 2WKIA 5EVLA 1S0WA 5CTMA 2WGIA 5F1GA 5CRFA 5HW3A 1EROA 2XH9A 3BFEA 3FYZA 3GR2A 2OLUA 2WGWA 3HUNA 1NJ4A 1K6RA 2Y2MA 4RX2A 3HLFA 3M2JA 2ZC5B 4ZJ2A 3A3FA 1ERMA 1FR1A 1ONHA 3VSKA 4E3IA 4E3NA 3G32A 4IVKA 5EVIC 4KZ4A 2XQZA 2J9PA 4BQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YM1 A;  1ES3 A;  3FZC A;  3MXR A;  3N8S A;  3IWI A;  3NBL A;  4JKT A;  1XA1 A;  1IYO A;  1IYS A;  4S2J A;  2P74 A;  5J8X A;  1YLT A;  5M18 A;  1GHP A;  3VP1 A;  1H5X A;  3NIA A;  5EUA A;  5FQM A;  2HP9 A;  3ITA A;  1EWZ A;  4WEK A;  1DJC A;  3IF6 B;  2H5S A;  3UN7 A;  3RXX A;  1K56 A;  1ES2 A;  5EVI B;  2BG1 A;  1LI0 A;  4MBK A;  5AQB A;  3TOI A;  4DE0 A;  1KGG A;  1KGE A;  4UAA A;  5EPH A;  3MXS A;  1PW1 A;  4X68 A;  2Y2K A;  4LV0 A;  3QNC A;  2Y2H A;  3DTM A;  1IKG A;  3HLC A;  3UDF A;  1FCO A;  3OPP A;  5M19 A;  2Z2M B;  1Q2Q A;  1SDE A;  2DRW A;  4CPK A;  1JVJ A;  1ONG A;  5FI7 A;  3BLS A;  5EOE A;  3IH9 A;  1K4F A;  1L0E A;  2ZM0 A;  4KG6 A;  2Y59 A;  4E3O A;  4HES A;  2IWD A;  4X56 A;  4GN2 A;  2Y2P A;  4B4X A;  1WYB A;  4EBL A;  4JPM A;  2WUQ A;  3O87 A;  3Q1F A;  4OKP A;  5CED A;  2OSU A;  4WMC A;  5CGX A;  2G2W A;  3V50 A;  3ZHH A;  2EFX A;  2A49 A;  3WS1 A;  4C3Q A;  2OLV A;  5FAO A;  2WGW B;  2XR0 A;  3PAG A;  2WAD A;  4R4S A;  4C6Y A;  3GRJ A;  4X55 A;  5A90 A;  4IBR A;  4A5R A;  3M6B A;  4CJN A;  3Q07 A;  3W8K A;  2ZQD A;  3ZG0 A;  2XD5 A;  2HP6 A;  4GKU A;  2WKH A;  2QPN A;  4OON A;  1CI9 A;  4FH2 A;  4OOL A;  3BLM A;  2RCX A;  4S2K A;  4EBN A;  2XFT A;  5CHM A;  4B4Z A;  4DXB A;  4E3K A;  1HZO A;  1MKI A;  2ZC3 B;  1JWV A;  2QZ6 A;  4DE3 A;  2JBF A;  5CEC A;  2J8Y A;  4MBF A;  5FDH A;  4K0W A;  1H8Z A;  1K38 A;  4BL3 A;  3A3J A;  2QMI A;  3EQV A;  1LI9 A;  1ALQ A;  2Q9N A;  1BZA A;  1VM1 A;  3HL9 A;  1PWC A;  3B3X A;  4PPR A;  3JYI A;  4YFM A;  3W4O A;  2I72 A;  2RL3 A;  1ERQ A;  2DCF A;  1YLY A;  1CEG A;  3TG9 A;  3ITB A;  3IXB A;  1K54 A;  2EXA A;  5F83 A;  5HAI A;  2WZX A;  1ES5 A;  4F94 A;  3UO9 A;  2Y2Q A;  4KZB A;  3VP2 A;  3HRE A;  3SS5 A;  1MWR A;  1SDN A;  4EV4 A;  2ZQ8 A;  3VFH A;  4E6X A;  4Z9Q A;  3O3V A;  3W4P A;  2E8I A;  4QY6 A;  2XFS A;  1FOF A;  3QHY A;  5U47 A;  3FWL A;  3N8L A;  3RJU A;  3CZD A;  3DWK A;  1BLH A;  4OPQ A;  2OV5 A;  3AGF A;  3MKF A;  1PZP A;  1Z6F A;  4IVI A;  3NDE A;  2X71 A;  1BTL A;  1K57 A;  3MZE A;  4OP8 A;  1CEF A;  2GDN A;  4C75 A;  4GD6 A;  4P85 A;  3SS3 A;  4M3K A;  1WYC A;  3IH8 A;  5GLC A;  4KZ3 A;  5DF8 A;  4WEL A;  4N1X A;  1MBL A;  3CMZ A;  1K54 C;  2B5R A;  5CXW A;  4OLG A;  1JWZ A;  1W7F A;  5EE8 A;  1EI5 A;  2HDQ A;  1I2S A;  4JXG A;  3OPR A;  4RVA A;  5GHZ A;  3VSL A;  4HBT A;  1ES4 A;  4DE2 A;  4S2M A;  1HVB A;  3Q7Z A;  4QY5 A;  3IF6 C;  3OPH A;  1Q2P A;  1FSW A;  4UA9 A;  1HD8 A;  4WYY A;  3GSG A;  1FCM A;  3AGD A;  1YLZ A;  2Y2L A;  3IXD A;  1ZC2 A;  3V3R A;  4HEF A;  4KQQ A;  4IBX A;  1IEM A;  3PBR A;  5FA7 A;  3OPL A;  4E3M A;  1KE0 A;  2JCH A;  2WKE A;  4GDN A;  4N1H A;  3UNW A;  3ZG5 A;  3V3S A;  4BLM A;  1MPL A;  1L0G A;  4DF6 A;  1RCJ A;  3HLG A;  1IEL A;  1WE4 A;  4N92 A;  2X02 A;  5FI6 A;  1O7E A;  1XP4 A;  3MZD A;  3V5M A;  4OQI A;  5KSC A;  3PTE A;  5JYO A;  5HAR A;  3MKE A;  3O88 A;  5E2E A;  3D4F A;  3E2L A;  1ZKJ A;  4KZ5 A;  3ZG7 B;  4FH4 A;  4H8R A;  4UA6 A;  3FV7 A;  1ZG4 A;  2JC7 A;  4PM8 A;  4X53 A;  3SS4 A;  4DE1 A;  5HAP A;  4O7D A;  1FSY A;  4WZ5 A;  3V39 A;  1ZG6 A;  3N6I A;  1TDL A;  1H8Y A;  3P98 A;  2Y55 A;  3A3I A;  3PBN A;  4LEN A;  5F1F A;  2HPB A;  4KQR A;  4WM9 A;  4OQG A;  3LO7 A;  3EQU A;  5EEC A;  5FQJ A;  5A92 A;  3WS0 A;  5FI2 A;  5DTK A;  2X01 A;  2J7V A;  3SOI A;  4MNR A;  2H0Y A;  3NCK A;  4KEN B;  3ZGA B;  2HP5 A;  3IT9 A;  3S22 A;  3OCN A;  4JLF A;  3GV9 A;  2WZZ A;  3CG5 A;  4N9L A;  5F82 A;  3G2Z A;  1O07 A;  1YLW A;  4LCM A;  1NZU A;  1K25 A;  2Z2L B;  1LHY A;  2ZC6 B;  5FSR A;  1K55 A;  1SCW A;  1GA0 A;  2R9W A;  1S6R A;  1XXM A;  4LV3 A;  2ZM2 A;  3BFG A;  4ZJ1 A;  3ZNT A;  3C7V A;  2EX9 A;  2VGK A;  3WRT A;  3IQA A;  5HX9 A;  4QHC A;  1YMS A;  2PBY A;  3MBZ A;  1BT5 A;  4WZ5 C;  5GLD A;  4OPY A;  4OQ0 A;  3DW0 A;  3NI9 A;  4OPZ A;  3VOY A;  2ZMA A;  3ZG9 B;  1PI5 A;  4RYE A;  4BD1 A;  2Q9M A;  5CHJ A;  2H0T A;  2WAE A;  5JYP A;  3LCE A;  4UA7 A;  3ZDJ A;  2V20 A;  2A3U A;  2Y2I A;  5D3O A;  5FQI A;  3ZVT A;  3UDI A;  1NYM A;  4PM7 A;  5IHV A;  4ZAM A;  3MFD A;  5DF9 A;  4WZ4 A;  1DY6 A;  1L0D A;  4S2O A;  5FAQ A;  2IWC A;  3GMW A;  1C3B A;  1KVL A;  5AQ9 A;  5GHY A;  1E25 A;  2H10 A;  5A91 A;  4JXW A;  1PYY A;  3UPO A;  2ZC4 B;  3ISG A;  4FD8 A;  4R3J A;  3S1Y A;  4S2I A;  1K55 C;  4E6W A;  4R4R A;  1XGJ A;  4QJG A;  4GZB A;  2ZQA A;  1W5D A;  3LEZ A;  4NK3 A;  4OQH A;  5CTN A;  3WS2 A;  2P9V A;  1GHM A;  3C5A A;  1L2S A;  1BLS A;  3WS4 A;  1KVM A;  1NZO A;  1PZO A;  2HDS A;  1W79 A;  3NDG A;  3PAE A;  1K6S A;  4GB7 A;  2PU2 A;  5FAS A;  1LLB A;  2ZD8 A;  4KG2 A;  4DRT A;  2C5W B;  1JTG A;  1BUE A;  3S4X A;  4B88 A;  3HLD A;  1W8Q A;  3IXG A;  5GLA A;  4E3L A;  5FQQ A;  3BEC A;  2BLS A;  3A3D A;  4JXS A;  1NYY A;  2VGJ A;  2XD1 A;  2V1Z A;  4S2P A;  2XK1 A;  4E3J A;  4U3T A;  3ZNY A;  1FR6 A;  1FQG A;  1MWU A;  1K4E A;  1NXY A;  2Y2O A;  4GOG A;  4P0M A;  3HBR A;  5FQK A;  3UE3 A;  4DKI A;  4U0X A;  1MY8 A;  2ZLY A;  3UDX A;  1LL9 A;  4ZTK A;  3M6H A;  2EX2 A;  4KZ7 A;  5HFO A;  5EOO A;  1RGY A;  1YLP A;  3LY3 A;  1NRF A;  4KZ9 A;  1TDG A;  4KZA A;  4PM6 A;  3G31 A;  4JBF A;  4JF5 A;  3N4I A;  4OPR A;  4QB8 A;  4OOM A;  3WS5 A;  3DWZ A;  1J9M A;  4K0X A;  5TFQ A;  1JWP A;  3BRM A;  3VOZ A;  4Q8I A;  3I7J A;  1E4D A;  4Y0U A;  1L0F A;  3IWQ A;  4EQI A;  1DJA A;  5I94 A;  1GA9 A;  3BFD A;  1K57 C;  2XF3 A;  1CK3 A;  4OLD A;  4R1G A;  4D2O A;  3PBQ A;  3SH7 A;  5TGF A;  2P9V B;  5EVI D;  3C7U A;  1XA7 A;  4MEZ A;  3IHB A;  1PWD A;  3IXH A;  3AGE A;  3A3E A;  2R9X A;  4GD8 A;  1QMF A;  2Y2G A;  2JE5 A;  5DVA A;  1AXB A;  3NC8 A;  5TR7 A;  4EUZ A;  2PU4 A;  5BOH A;  2EX6 A;  1E3U D;  1M6K A;  4WEJ A;  1BUL A;  4S2N A;  4EBP A;  4WBG A;  3ZCZ A;  1YLJ A;  4KG5 A;  2WAF A;  2XDM A;  3WWX A;  4XXR A;  3HLB A;  4OH0 A;  1DJB A;  3Q7V A;  5CHU A;  4BEN A;  3G4P A;  4ID4 A;  4ZDX A;  1N9B A;  5FAT A;  5CER A;  2FFF B;  3BEB A;  4QD4 A;  4X69 A;  4ZBE A;  5GHX A;  5GL9 A;  1OME A;  2HDR A;  3CJM A;  4PM9 A;  4UHU A;  5HL1 A;  5KMW A;  1TEM A;  2DNS A;  3VP0 A;  2FFY A;  5CEB A;  5G18 A;  1NY0 A;  3BFC A;  5M1A A;  3ZG8 B;  2WK0 A;  4Y7P A;  1PW8 A;  3IF5 A;  3BFF A;  4OP5 A;  2ZQC A;  4BJP A;  1RP5 A;  1KDW A;  4OVD A;  4RA7 A;  1JTD A;  3E2K A;  3VP3 A;  2Y2J A;  2XGN A;  3ZVW A;  2WGV A;  4XUX A;  3Q81 A;  3UY6 A;  3VFF A;  1TVF A;  4S2N C;  4FSF A;  5CGW A;  1SKF A;  2EXB A;  1K56 D;  3W4Q A;  2EFU A;  3Q82 A;  1M40 A;  3IWO A;  1Y54 A;  1G68 A;  4NET A;  3LY4 A;  5FAP A;  4Y0O A;  5FQ9 A;  1GCE A;  3UPN A;  1QME A;  2Y2N A;  1SHV A;  1W8Y A;  2ZQ7 A;  1YT4 A;  2ZQ9 A;  1KE3 A;  3UPP A;  2G2U A;  1IYQ A;  4XUZ A;  3BM6 A;  1MWS A;  3IHA A;  5AQA A;  1XKZ A;  4U0T A;  4DDS A;  1IYP A;  1BLP A;  3MZF A;  4OOY A;  1YQS A;  1VQQ A;  3C4P A;  5DTT A;  1KGF A;  3BYD A;  5DF7 A;  3OCL A;  1KDS A;  3Q7V B;  4WMC D;  3NY4 A;  5DTS A;  5E43 A;  1U60 A;  1XPB A;  4DDY A;  4JF4 A;  4GNU A;  1XGI A;  3N7W A;  1ESU A;  3SH8 A;  3HLW A;  1FCN A;  4GDB A;  4JF6 A;  3PBT A;  4PM5 A;  3P09 A;  2ZM8 A;  1XX2 A;  4LV2 A;  3OZH A;  1PIO A;  4HBU A;  4IED A;  3G30 A;  3FKW A;  4FCF A;  2WYX A;  1RGZ A;  3PBS A;  4KZ8 A;  4S2L A;  4R0Q A;  5E2G A;  2EX8 A;  3RXW A;  3ZFZ A;  3TSG A;  4LCL A;  3C4O A;  2C6W B;  3G34 A;  2CC1 A;  4K91 A;  3VMA A;  1BLC A;  1GHI A;  4EWF A;  4ZJ3 A;  4N9K A;  1HTZ A;  4P6B A;  1BSG A;  1IKI A;  1LL5 A;  2J9O A;  1I5Q A;  1ESI A;  3O86 A;  5KZH A;  2ZC7 A;  1G6A A;  4YIN A;  4MBH A;  1N4O A;  4BD0 A;  3G35 A;  4RX3 A;  5KSH A;  2XLN A;  5A93 A;  1CI8 A;  4L0L A;  3HVF A;  4QU3 A;  2XEP A;  3VP4 A;  5E2H A;  4P87 A;  3G2Y A;  3QNB A;  3N8R A;  5CGS A;  3IF6 A;  2IWB A;  4R23 A;  5HAQ A;  5EVI A;  3GVB A;  3HLE A;  4BL2 A;  4Y0T A;  3UE1 A;  3FKV A;  4JXV A;  3HUM A;  3OC2 A;  3GQZ A;  2Y91 A;  3WRZ A;  4LV1 A;  1PI4 A;  5E2F A;  2HDU A;  5L2F A;  1YMX A;  5GLB A;  1PWG A;  2V2F F;  5AQ7 A;  3HUO A;  1E3U A;  1MXO A;  4PMA A;  1KE4 A;  3SH9 A;  3M2K A;  4KQO A;  4MLL A;  2ZJ9 A;  4X6T A;  4KZ6 A;  1I2W A;  1MWT A;  2UWX A;  4R3B A;  4DXC A;  3GTC A;  3UE0 A;  3PBO A;  2Y4A A;  2WKI A;  5EVL A;  1S0W A;  5CTM A;  2WGI A;  5F1G A;  5CRF A;  5HW3 A;  1ERO A;  2XH9 A;  3BFE A;  3FYZ A;  3GR2 A;  2OLU A;  2WGW A;  3HUN A;  1NJ4 A;  1K6R A;  2Y2M A;  4RX2 A;  3HLF A;  3M2J A;  2ZC5 B;  4ZJ2 A;  3A3F A;  1ERM A;  1FR1 A;  1ONH A;  3VSK A;  4E3I A;  4E3N A;  3G32 A;  4IVK A;  5EVI C;  4KZ4 A;  2XQZ A;  2J9P A;  4BQM A; 
#chains in the Genus database with same CATH topology
 4DJ2 A;  1ES3 A;  3LIC A;  4G3K A;  3NBL A;  4WF0 A;  4S2J A;  4G3V A;  5M18 A;  2INW A;  1GHP A;  2HP9 A;  1ES2 A;  4MBK A;  1KGG A;  3LIB A;  1KGE A;  1J3W A;  1XJ3 A;  2Y2K A;  4WUJ A;  3QNC A;  2Y79 A;  5HDD A;  5M19 A;  1Q2Q A;  1SDE A;  1ONG A;  5FI7 A;  5EOE A;  3IH9 A;  4X56 A;  3F1N B;  2Y2P A;  3G6O A;  3O87 A;  3Q1F A;  5CED A;  3VE4 A;  5CGX A;  2FZ0 A;  2G2W A;  2EWW A;  2QJ5 A;  4XT2 B;  4X55 A;  1XJ6 A;  1OTE A;  2XD5 A;  2HP6 A;  3K3C A;  3T4K A;  3B33 A;  1CI9 A;  4NG2 A;  2VX8 A;  1HZO A;  4E04 A;  2QZ6 A;  5CEC A;  5FDH A;  4GLQ A;  4BL3 A;  3A3J A;  3EQV A;  5EV0 A;  3HL9 A;  3B3X A;  1ERQ A;  3EEA A;  4O0P A;  3ITB A;  3IXB A;  2EXA A;  5F83 A;  4L9G A;  2OWH A;  3UO9 A;  3MSH A;  2ZQ8 A;  4Z9Q A;  1WA9 A;  1FOF A;  3N8L A;  4OPQ A;  4EXO A;  4IVI A;  3NDE A;  1XJ2 A;  1IFQ A;  3IH8 A;  2JKT M;  3IBR A;  4KZ3 A;  5DF8 A;  4PKY A;  4N1X A;  2HDQ A;  4JXG A;  5EVE A;  1XJ4 A;  4EUV A;  3LEQ A;  2QHK A;  2VEA A;  4S2M A;  3OPH A;  2W1R A;  4WYY A;  2VA0 A;  1YLZ A;  2Y2L A;  4GS9 B;  4YWZ A;  5G4Y A;  4KQQ A;  1IEM A;  3PBR A;  2W3G A;  1T19 A;  1ZTU A;  1W63 Q;  2JCH A;  3ZG5 A;  3V3S A;  3CWF A;  3PXP A;  2J80 A;  1O7E A;  3L9K A;  3V67 A;  5HAR A;  3MKE A;  5FL3 A;  2L1M A;  1DP8 A;  4NXF A;  1ZG4 A;  1IOU A;  2WKR A;  2K7S A;  5HAP A;  4WZ5 A;  4PKY G;  3A3I A;  3UB5 P;  4KQR A;  4WM9 A;  1Z09 A;  2KDK A;  5FI2 A;  2J7V A;  4MNR A;  2H0Y A;  4KEN B;  3IT9 A;  3S22 A;  4JLF A;  4N9L A;  5F82 A;  1OTA A;  1YLW A;  5J7E A;  3BFG A;  4ZJ1 A;  4EW7 A;  2EX9 A;  3LR4 A;  1NWZ A;  1LL8 A;  3WRT A;  5HX9 A;  3MBZ A;  1BT5 A;  4OQ0 A;  3R7W A;  3K2N A;  4EET B;  3ZG9 B;  1PI5 A;  5HPI A;  2Q9M A;  3IX4 A;  2H0T A;  2WAE A;  3LCE A;  4LLO B;  2V20 A;  2A3U A;  3ZDJ A;  2Y2I A;  1UWN X;  5FQI A;  4GJ4 A;  4G3W A;  1NYM A;  4PM7 A;  5IHV A;  3DTE A;  4WZ4 A;  5FAQ A;  1KVL A;  5GHY A;  2ZBB A;  2JKR M;  3UPO A;  4HJ4 A;  4R3J A;  2MJ6 A;  4S2I A;  3KSF A;  4OQH A;  3LEZ A;  5CTN A;  3PHY A;  4LRZ E;  1BLS A;  3WS4 A;  1KVM A;  2E8J A;  1SKO B;  1W79 A;  3NDG A;  3PAE A;  4ARZ A;  1LLB A;  3QP1 A;  4JGO A;  4H6J B;  4I3A A;  3S4X A;  3KX0 X;  3IXG A;  1W8Q A;  4IHQ A;  4MCW A;  5FQQ A;  3BEC A;  2BLS A;  4WLA A;  3CLO A;  4ZRR A;  4KUO A;  2V1Z A;  4E3J A;  4YNR A;  1FR6 A;  4P0M A;  1K4E A;  2Y2O A;  3LIF A;  2ZL1 A;  3A0V A;  3B42 A;  2XA7 S;  4KZ7 A;  5EOO A;  2VK3 A;  3LY3 A;  2W3E A;  1TDG A;  4KZA A;  2QYB A;  4QB8 A;  2ZMV A;  4GHI B;  4OOM A;  4B93 A;  1J9M A;  4JGP A;  1JWP A;  4MN5 A;  3BRM A;  4Q8I A;  3ZYT A;  1E4D A;  3T4T A;  4UQI S;  1VEU A;  4R38 A;  5A8B A;  2LB9 A;  2UV0 E;  3SH7 A;  2GJ3 A;  5EVI D;  1PWD A;  4HNB A;  4GD8 A;  5LBR A;  3UE6 A;  1QMF A;  3SW1 A;  1AXB A;  5TR7 A;  4EUZ A;  3K3D A;  1E3U D;  2PYP A;  4M4X A;  1BUL A;  1YSQ A;  4WBG A;  3ZCZ A;  5HL6 A;  2WAF A;  4WL9 A;  3WWX A;  3NJA A;  3T4Q A;  1TF1 A;  4X1M A;  2VGL S;  3BEB A;  4QD4 A;  4X69 A;  4ZBE A;  4CLC A;  5GHX A;  3CJM A;  4UHU A;  2FFY A;  3ZG8 B;  3LIA A;  1PW8 A;  3IF5 A;  4OP5 A;  3P7N A;  1A0K A;  3VP3 A;  2XGN A;  2WGV A;  4XUX A;  3UY6 A;  2O9C A;  4S2N C;  1GSX A;  3W4Q A;  1G6O A;  2EFU A;  3Q82 A;  3IWO A;  3H7W B;  5FAP A;  4B9O A;  1AWI A;  4HH2 A;  2W27 A;  4Y5F A;  1SHV A;  2ZQ7 A;  4XUZ A;  1IYP A;  1BLP A;  3MZF A;  4OOY A;  5AJG A;  2PR6 A;  3QP4 A;  1KGF A;  1KDS A;  3Q7V B;  4P6Z M;  1CQA A;  3A0R A;  1XGI A;  5HSQ A;  4NKP A;  4Y15 A;  3HLW A;  3T1S A;  3CPT B;  3D9Y A;  3S7P A;  4PM5 A;  2ZM8 A;  1T1C A;  1XX2 A;  4R0Q A;  3TSG A;  5L09 A;  3VMA A;  2OWJ A;  1N9L A;  2VV6 A;  2PD8 A;  3C2W A;  4P6B A;  2J9O A;  4JGQ A;  2D02 A;  3T1R A;  2ZC7 A;  4BD0 A;  1N4O A;  3MS6 A;  3G35 A;  4RX3 A;  2XLN A;  4P87 A;  3IF6 A;  3UB9 A;  5HAQ A;  4O01 A;  4GW9 A;  1S1Y A;  4Z1W A;  2Y91 A;  3H82 B;  3GDI A;  1F98 A;  4LGW A;  1MXO A;  1ZHH B;  4KQO A;  4MLL A;  4X6T A;  2HF6 A;  4KZ6 A;  1I2W A;  3PBO A;  5CTM A;  4HQA A;  2WKQ A;  2WGI A;  5HD3 A;  1ERO A;  4MDZ A;  3GR2 A;  3CUE C;  4RX2 A;  2Y2M A;  3HLF A;  2HV1 A;  4FUW A;  1ERM A;  3VSK A;  4E3I A;  2XQZ A;  5KSH A;  4BQM A;  3FZC A;  2HZ5 A;  3IWI A;  1XA1 A;  5J8X A;  1YLT A;  4EES A;  5FEF A;  1H5X A;  3NIA A;  3BY8 A;  3C8C A;  3UN7 A;  3D3O A;  1LI0 A;  3TOI A;  2I9V A;  4UAA A;  3MXS A;  1PW1 A;  2EA9 A;  4NXG A;  4I5S A;  3UDF A;  5J3W A;  2Z2M B;  3QP5 A;  1F5M A;  3BLS A;  3LR0 A;  1L0E A;  4KG6 A;  4HES A;  2IWD A;  4CLC E;  2W3D A;  4EBL A;  2OSU A;  4WMC A;  3ZQ5 A;  2PAV P;  3ZHH A;  2EFX A;  2A49 A;  3R4K A;  3WS1 A;  2OLV A;  2XR0 A;  4F3L A;  2WAD A;  3GRJ A;  5A90 A;  4A5R A;  5MC7 A;  3W8K A;  4PAU A;  3NHQ A;  3TJZ C;  2GNX A;  3BLM A;  2RCX A;  4S2K A;  2XFT A;  5CHM A;  4E3K A;  1TS7 A;  4K08 A;  4R70 A;  1JWV A;  4DE3 A;  2J8Y A;  1PFL A;  1LI9 A;  1VM1 A;  1PWC A;  1OT9 A;  3E4P A;  3MF0 A;  4PPR A;  3W4O A;  4HP9 A;  1ES5 A;  3CHW P;  3L7H A;  2J3T C;  4IJG A;  1MWR A;  4EV4 A;  5DFY A;  3MQQ A;  5U47 A;  3FWL A;  2OV5 A;  1Z6F A;  2ZOH A;  4OP8 A;  2GDN A;  3SS3 A;  1WYC A;  5GLC A;  4ETZ A;  3O5Y A;  3CMZ A;  3R7W B;  1K54 C;  2A24 A;  1EI5 A;  2M7U A;  3OPR A;  2V8F A;  3LID A;  4Y3I A;  5TBM A;  4Y13 A;  3IF6 C;  1Q2P A;  4R6L A;  3OPL A;  4N1H A;  4BLM A;  1RCJ A;  3HLG A;  1XP4 A;  4OQI A;  1K0K A;  3PTE A;  4GCZ A;  4KZ5 A;  3FV7 A;  4X53 A;  3SS4 A;  3CAX A;  1H8Y A;  3P98 A;  3KO6 A;  3PBN A;  4LEN A;  5F1F A;  2HPB A;  3ULF A;  5EEC A;  3WS0 A;  2QJ7 A;  5DTK A;  4JGR A;  2HP5 A;  3VE3 A;  1PNE A;  2PT7 A;  4LCM A;  1VEU B;  1LHY A;  4CLC D;  5DKK A;  4DN0 A;  3IQA A;  3NI9 A;  1VET A;  2L4R A;  4MMN A;  4I3I A;  4BD1 A;  5JYP A;  5HZH A;  5J4E A;  1X0O A;  3ZVT A;  3UDI A;  1DY6 A;  2CMN A;  2FH5 A;  1C3B A;  2P7J A;  1E25 A;  2VV7 A;  5A91 A;  2ZC4 B;  3S1Y A;  3IX3 A;  1K55 C;  4E6W A;  3IS2 A;  2ZQA A;  2P9V A;  5C5K A;  2HDS A;  3QP2 A;  2J3T D;  4GB7 A;  2PU2 A;  4KG2 A;  4DRT A;  2C5W B;  3HLD A;  5GLA A;  4E3L A;  5HWW A;  3CIT A;  2VGJ A;  2XD1 A;  4S2P A;  4IUH A;  4U3T A;  1FQG A;  4GOG A;  4DKI A;  3UE3 A;  4U0X A;  1P0Z A;  3M6H A;  1OTB A;  5HFO A;  5L07 A;  3LUQ A;  5EM1 A;  5TFQ A;  1VB6 A;  3I7J A;  1DJA A;  2B95 A;  2Z6C A;  3T4L A;  2XF3 A;  4DJ3 A;  5TGF A;  4LRY C;  3RFB A;  2L0W A;  3C7U A;  1XA7 A;  5KIZ A;  2M1C A;  3BWL A;  3IXH A;  3AGE A;  3NEC A;  3BJN A;  4ESP A;  4S2N A;  2G7U A;  1YLJ A;  4KG5 A;  3T4S A;  5CX7 A;  2XDM A;  4XXR A;  3HLB A;  4OH0 A;  2HJE A;  1F2K A;  4NXE A;  1V9Y A;  2FFF B;  2VLG A;  5GL9 A;  2HDR A;  2Q0O A;  4PM9 A;  5KMW A;  5G4Z A;  1TEM A;  2DNS A;  3QP6 A;  4O8G A;  3BFF A;  2ZQC A;  4OVD A;  2R78 A;  4HI4 A;  4Q0J A;  3VFF A;  2JKG A;  4FSF A;  3SZT A;  2EXB A;  3F1O B;  5EM0 A;  4NET A;  3LY4 A;  3TE8 A;  4Y0O A;  1QME A;  2Y2N A;  3PYP A;  1W8Y A;  3A0S A;  1EW0 A;  1IYQ A;  3W2Z A;  4DDS A;  2IA2 A;  3P01 A;  2LB5 A;  1YQS A;  3KYZ A;  5L8M A;  5DTT A;  3F1P B;  5DF7 A;  4WMC D;  3NY4 A;  5DTS A;  1P9R A;  1ESU A;  1H0M A;  3LYX A;  3PBT A;  4BMW A;  3P09 A;  2VZW A;  3OZH A;  1PIO A;  5E2G A;  4FCF A;  1RGZ A;  3LI9 A;  4LFU A;  4LRX C;  2CC1 A;  1BLC A;  1LSW A;  4EWF A;  4ZJ3 A;  1LL5 A;  1G6A A;  4YIN A;  4MBH A;  4L0L A;  3EGD C;  2NUP C;  3CUE A;  3HVF A;  2W1T B;  2XEP A;  5E2H A;  3UME A;  3G2Y A;  3QNB A;  5CGS A;  2IWB A;  2D01 A;  3EOI A;  2PBD P;  2V0W A;  3HLE A;  1T18 A;  3FKV A;  4JXV A;  1P9W A;  3WRZ A;  2HDU A;  5L2F A;  5GLB A;  1FIL A;  1PWG A;  2V2F F;  3HUO A;  3SH9 A;  3M2K A;  5F69 A;  1MWT A;  4R3B A;  3F1N A;  2Y4A A;  2XRO A;  1S0W A;  4Y17 A;  5F1G A;  3BFE A;  4XT2 A;  3FYZ A;  2OAP 1;  1SZV A;  3GEC A;  2Z6D A;  1S1Z A;  3A3F A;  3G32 A;  3T12 B;  1YM1 A;  1TS6 A;  2P08 A;  1IYO A;  1IYS A;  2P74 A;  5FDS A;  3ITA A;  1EWZ A;  4WEK A;  1DJC A;  4ME4 A;  4WN5 A;  1K56 A;  5EVI B;  5AQB A;  4DE0 A;  5EPH A;  4LV0 A;  2Y2H A;  3DTM A;  1IKG A;  2DMW A;  3H9W A;  3HLC A;  3KSH A;  3OPP A;  2K2N A;  2OAQ 1;  2HGV A;  2DRW A;  3FPW A;  4CPK A;  4HHD A;  1TS0 A;  2ZM0 A;  3S7N A;  2PHY A;  2V1B A;  3HJI A;  1WYB A;  3KSI A;  3T50 A;  3V50 A;  2WGW B;  2J3W A;  4C6Y A;  4R4S A;  4IBR A;  1T1B A;  3Q07 A;  3VOL A;  3EGX C;  3ZG0 A;  1GSW A;  2QPN A;  4HIA A;  4OOL A;  4EBN A;  4B4Z A;  4DXB A;  3UB7 A;  1MKI A;  3C30 A;  1FIK A;  2P04 A;  4MBF A;  1K38 A;  2QMI A;  4FOF A;  3U2A A;  3JYI A;  4YFM A;  2AVX A;  3TW8 A;  2RL3 A;  1YLY A;  1CEG A;  3TG9 A;  1K54 A;  4GS9 A;  5K5B A;  5HAI A;  2WZX A;  4F94 A;  2ZOI A;  3SS5 A;  4MN7 A;  1SDN A;  3VFH A;  3W4P A;  4QY6 A;  2XFS A;  1MKM A;  3RJU A;  3S7O A;  3CZD A;  1BLH A;  3AGF A;  3VV4 A;  1PZP A;  2H28 A;  2X71 A;  1BTL A;  1K57 A;  3MZE A;  1CEF A;  4C75 A;  4P85 A;  4WEL A;  2VV8 A;  3OOV A;  1HLU P;  3MQ0 A;  4OLG A;  1JWZ A;  5EE8 A;  1I2S A;  3FC7 A;  4RVA A;  3VSL A;  1ES4 A;  3DTK A;  4QY5 A;  1FSW A;  1HD8 A;  1FCM A;  3FPV A;  3IXD A;  1ZC2 A;  3E4Q A;  4E3M A;  5FA7 A;  1KE0 A;  4GDN A;  3T4J A;  4I3J A;  1L0G A;  5EFW A;  1WE4 A;  4N92 A;  5FI6 A;  2X02 A;  5KSC A;  3O88 A;  3MJQ A;  5E2E A;  3D4F A;  2YKF A;  1ZKJ A;  4H8R A;  2JC7 A;  3T4O A;  1FSY A;  1ZG6 A;  3N6I A;  2Y55 A;  2QKP A;  1CF0 A;  4OQG A;  3JPU A;  3LO7 A;  3EQU A;  3SOI A;  2X01 A;  3KYQ A;  2B18 A;  4EU0 A;  3ZGA B;  4PHT A;  1SKO A;  3GV9 A;  2WZZ A;  2Z2L B;  1K25 A;  2ZC6 B;  4H6J A;  1K55 A;  1GA0 A;  2JN7 A;  2R9W A;  5F5Y A;  2ZM2 A;  3C7V A;  4QHC A;  1YMS A;  5GLD A;  4HP4 A;  4OPZ A;  2K31 A;  2ZMA A;  4RYE A;  3KYE A;  3DBA A;  5D3O A;  4GHI A;  2V1A A;  1ACF A;  5DF9 A;  1S66 L;  3BY9 A;  1Y4O A;  4S2O A;  2IWC A;  2GZA A;  3ISG A;  4FD8 A;  1JNU A;  4R4R A;  1XGJ A;  4Q0H A;  1L3L A;  3C5A A;  1L2S A;  1G28 A;  1K6S A;  1OJ5 A;  1JTG A;  3LGO A;  3OLO A;  3A3D A;  4JXS A;  4HH3 A;  1MWU A;  5FQK A;  1YSP A;  3JVV A;  3UDX A;  1LL9 A;  4ZTK A;  2EX2 A;  1RGY A;  1YLP A;  2OOL A;  5AVE A;  4JBF A;  3N4I A;  5DJT A;  4FTX A;  3WS5 A;  4K0X A;  3VOZ A;  4EQI A;  2O9A A;  5I94 A;  1K57 C;  4OLD A;  1CK3 A;  4D2O A;  3PBQ A;  4MEZ A;  3H7W A;  5IU1 A;  4QWO A;  4ARZ B;  2Y2G A;  5DVA A;  2XA7 M;  2PU4 A;  1M6K A;  4WEJ A;  1DP9 A;  4II7 A;  1DJB A;  3Q7V A;  3DAV A;  5CHU A;  4BEN A;  3G4P A;  2ZL1 B;  3MFX A;  4UQI M;  1YPR A;  1LSV A;  3CPT A;  5HWT A;  3LIE A;  1NY0 A;  3UMD A;  4BJP A;  1RP5 A;  1KDW A;  1JTD A;  3BQA A;  3E2K A;  3BQ8 A;  4P6Z S;  2Y2J A;  3ZVW A;  2QWS A;  1S4S A;  1SKF A;  3KSG A;  2HJ9 C;  1K56 D;  3E4O A;  4NXB A;  3LFV A;  1G68 A;  2VGL M;  5FQ9 A;  1GCE A;  4UEY A;  2ZQ9 A;  2G2U A;  3BM6 A;  5AQA A;  1XKZ A;  2XSS A;  1VQQ A;  1D06 A;  4EEU A;  3C4P A;  3BYD A;  3H82 A;  4IUK A;  4JF4 A;  4GNU A;  4CLC B;  3N7W A;  3SH8 A;  4GDB A;  4HY8 A;  4LV2 A;  1NLY A;  5I5L A;  3G30 A;  2WYX A;  4KZ8 A;  3ZFZ A;  3C4O A;  2C6W B;  1LT0 A;  4K91 A;  1DP6 A;  4N9K A;  1HTZ A;  1BSG A;  1I5Q A;  5KZH A;  4D60 A;  5A93 A;  3VP4 A;  3C38 A;  4R23 A;  4BL2 A;  4Y0T A;  1T1A A;  3OC2 A;  4LV1 A;  2Y8H A;  1PI4 A;  5HPF A;  4X1L A;  4PMA A;  1KE4 A;  1KOU A;  2UWX A;  3GTC A;  5EVL A;  4Y2F A;  5CRF A;  5HW3 A;  4DMZ A;  1N9O A;  3JVU A;  2OLU A;  3HUN A;  4HOI A;  1K6R A;  3LR3 A;  4ZJ2 A;  1ONH A;  4E3N A;  3QP8 A;  4IVK A;  5EVI C;  4KZ4 A;  5FAT A;  3IBJ A;  2J9P A;  3MXR A;  3N8S A;  4JKT A;  1NLZ A;  4KQD A;  3BW6 A;  4QPR A;  2W3F A;  3VP1 A;  5FQM A;  5EUA A;  3NOU C;  3IF6 B;  5IS1 A;  2H5S A;  3RXX A;  1LSX A;  2BG1 A;  5FEG A;  4BWI A;  5TJJ A;  4X68 A;  2KOI A;  3MQO A;  1FCO A;  1JVJ A;  1K4F A;  4E3O A;  2Y59 A;  3MMH A;  4GN2 A;  2ACG A;  4B4X A;  4JPM A;  2WUQ A;  4OKP A;  1S67 L;  3E98 A;  4EEP A;  4C3Q A;  5FAO A;  4KUK A;  3PAG A;  3M6B A;  4CJN A;  3NUL A;  4EER A;  2ZQD A;  2V9A A;  2B02 A;  1H8M A;  4GKU A;  2WKH A;  4OON A;  4YOF A;  4FH2 A;  1DRM A;  5DJU A;  2ZC3 B;  2JBF A;  4K0W A;  1H8Z A;  1S4R A;  1ALQ A;  2Q9N A;  1BZA A;  5F6A A;  4LPZ A;  5HWV A;  2I72 A;  4HJ3 A;  1NRJ A;  2DCF A;  2O9B A;  4EQ1 A;  3T1Q B;  3IX8 A;  2Y2Q A;  1UGU A;  2O99 A;  4KZB A;  3VP2 A;  3HRE A;  4E6X A;  3O3V A;  1YAX A;  2E8I A;  4F3L B;  3QHY A;  4RQ9 A;  3DWK A;  1N9N A;  3MKF A;  2VKS A;  3TRC A;  1UWP X;  4GD6 A;  4M3K A;  5HDS A;  1MBL A;  2B5R A;  5CXW A;  1W7F A;  5GHZ A;  4HBT A;  4DE2 A;  2PDR A;  3MXQ A;  1HVB A;  3Q7Z A;  3MR0 A;  4UA9 A;  3GSG A;  3AGD A;  2A2L A;  3V3R A;  4HEF A;  4IBX A;  4BBT A;  2WKE A;  3S7Q A;  3UNW A;  1MPL A;  2PYR A;  4DF6 A;  1IEL A;  2ZMF A;  3V5M A;  3MZD A;  2V0U A;  1TS8 A;  3FG8 A;  5JYO A;  3E2L A;  3ZG7 B;  4FH4 A;  5IT5 A;  4UA6 A;  4PM8 A;  4DE1 A;  1OTI A;  4O7D A;  3V39 A;  1TDL A;  2A24 B;  5HD5 A;  4BBU A;  2BAS A;  5FQJ A;  5A92 A;  3T1X A;  3NCK A;  5TBM B;  3HCY A;  1XFQ A;  3OCN A;  1MZU A;  3CG5 A;  3G2Z A;  1O07 A;  1NZU A;  5FSR A;  1SCW A;  4CQH A;  2PD7 A;  1S6R A;  1XXM A;  4LV3 A;  3CI6 A;  3ZNT A;  2VGK A;  1MC0 A;  4HJ6 A;  4X25 A;  3U4L P;  2PBY A;  1W63 M;  4WZ5 C;  3EEH A;  4OPY A;  3DW0 A;  3VOY A;  5CHJ A;  4ETX A;  3UB6 A;  2JKT I;  4UA7 A;  3NOT C;  2BTF P;  2JHE A;  3LI8 A;  4ZAM A;  3MFD A;  2GX5 A;  1YKD A;  2O0Y A;  1L0D A;  3GMW A;  5AQ9 A;  2H10 A;  4JXW A;  1PYY A;  4I38 A;  4AFI A;  1ODV A;  4QJG A;  4GZB A;  1W5D A;  3WS2 A;  4NK3 A;  4BBV A;  1GHM A;  1Y28 A;  3B47 A;  1NZO A;  1PZO A;  2M7V A;  5FAS A;  2ZD8 A;  4B88 A;  1BUE A;  2XRN A;  1NYY A;  1D1J A;  2XK1 A;  3ZNY A;  1NXY A;  3HBR A;  1V9Z A;  1MY8 A;  2ZLY A;  4L9F A;  1VET B;  3DTI A;  3NOP C;  4KZ9 A;  1NRF A;  4PM6 A;  1TD5 A;  3G31 A;  4JF5 A;  4OPR A;  4MN6 A;  3DWZ A;  2VJW A;  1OT6 A;  2EWV A;  4Y0U A;  1STZ A;  1L0F A;  3IWQ A;  1GA9 A;  3BFD A;  3IS2 B;  3F1O A;  4R1G A;  1G5U A;  2P9V B;  3IHB A;  1H3Q A;  3A3E A;  2R9X A;  1OJG A;  3ICY A;  2JE5 A;  2WKP A;  3NC8 A;  5BOH A;  1P97 A;  2EX6 A;  2NUT C;  3UB8 A;  4EBP A;  3HJK A;  3F1P A;  3E0Y A;  4ZDX A;  4ID4 A;  1N9B A;  5CER A;  3RTY A;  1OME A;  5HL1 A;  1BYW A;  3VP0 A;  5CEB A;  5G18 A;  3D72 A;  5M1A A;  3BFC A;  2WK0 A;  2JKR I;  4Y7P A;  4RA7 A;  3OBF A;  3Q81 A;  1TVF A;  5CGW A;  1PRQ A;  1VHM A;  1XFN A;  5L10 A;  1M40 A;  1Y54 A;  5DKL A;  3UPN A;  2W1T A;  4CLC C;  1YT4 A;  3UPP A;  1KE3 A;  1MWS A;  3IHA A;  3PR6 A;  4U0T A;  5HDC A;  2KLI A;  3OCL A;  5E43 A;  1U60 A;  1XPB A;  4DDY A;  4Q0I A;  3RH8 B;  1FCN A;  2V8C A;  4JF6 A;  4HBU A;  4IED A;  3FKW A;  4S2L A;  3PBS A;  1OTD A;  2EX8 A;  3RXW A;  4LCL A;  2JKF A;  3G34 A;  1GHI A;  1GSV A;  5DFX A;  5F68 A;  2PR5 A;  1IKI A;  1OPX A;  3LR5 A;  1ESI A;  4L9E A;  3O86 A;  1CI8 A;  4QU3 A;  3N8R A;  5EVI A;  3GVB A;  3UE1 A;  3HUM A;  3GQZ A;  1CJF A;  3EWK A;  5E2F A;  1F9I A;  1YMX A;  5AQ7 A;  2W3H A;  1E3U A;  2YKH A;  2ZJ9 A;  5AVF A;  4DXC A;  3UE0 A;  2WKI A;  2PRF A;  2XH9 A;  4R3A A;  2WGW A;  1NJ4 A;  4I39 A;  4NEE D;  3M2J A;  2ZC5 B;  1D7E A;  1FR1 A;  2W0N A;  2KX6 A; 
#chains in the Genus database with same CATH homology
 1YM1 A;  1ES3 A;  3FZC A;  3MXR A;  3N8S A;  3IWI A;  3NBL A;  4JKT A;  1XA1 A;  1IYO A;  1IYS A;  4S2J A;  2P74 A;  5J8X A;  1YLT A;  5M18 A;  1GHP A;  3VP1 A;  1H5X A;  3NIA A;  5EUA A;  5FQM A;  2HP9 A;  3ITA A;  1EWZ A;  4WEK A;  1DJC A;  3IF6 B;  2H5S A;  3UN7 A;  3RXX A;  1K56 A;  1ES2 A;  5EVI B;  2BG1 A;  1LI0 A;  4MBK A;  5AQB A;  3TOI A;  4DE0 A;  1KGG A;  1KGE A;  4UAA A;  5EPH A;  3MXS A;  1PW1 A;  4X68 A;  2Y2K A;  4LV0 A;  3QNC A;  2Y2H A;  3DTM A;  1IKG A;  3HLC A;  3UDF A;  1FCO A;  3OPP A;  5M19 A;  2Z2M B;  1Q2Q A;  1SDE A;  2DRW A;  4CPK A;  1JVJ A;  1ONG A;  5FI7 A;  3BLS A;  5EOE A;  3IH9 A;  1K4F A;  1L0E A;  2ZM0 A;  4KG6 A;  2Y59 A;  4E3O A;  4HES A;  2IWD A;  4X56 A;  4GN2 A;  2Y2P A;  4B4X A;  1WYB A;  4EBL A;  4JPM A;  2WUQ A;  3O87 A;  3Q1F A;  4OKP A;  5CED A;  2OSU A;  4WMC A;  5CGX A;  2G2W A;  3V50 A;  3ZHH A;  2EFX A;  2A49 A;  3WS1 A;  4C3Q A;  2OLV A;  5FAO A;  2WGW B;  2XR0 A;  3PAG A;  2WAD A;  4R4S A;  4C6Y A;  3GRJ A;  4X55 A;  5A90 A;  4IBR A;  4A5R A;  3M6B A;  4CJN A;  3Q07 A;  3W8K A;  2ZQD A;  3ZG0 A;  2XD5 A;  2HP6 A;  4GKU A;  2WKH A;  2QPN A;  4OON A;  1CI9 A;  4FH2 A;  4OOL A;  3BLM A;  2RCX A;  4S2K A;  4EBN A;  2XFT A;  5CHM A;  4B4Z A;  4DXB A;  4E3K A;  1HZO A;  1MKI A;  2ZC3 B;  1JWV A;  2QZ6 A;  4DE3 A;  2JBF A;  5CEC A;  2J8Y A;  4MBF A;  5FDH A;  4K0W A;  1H8Z A;  1K38 A;  4BL3 A;  3A3J A;  2QMI A;  3EQV A;  1LI9 A;  1ALQ A;  2Q9N A;  1BZA A;  1VM1 A;  3HL9 A;  1PWC A;  3B3X A;  4PPR A;  3JYI A;  4YFM A;  3W4O A;  2I72 A;  2RL3 A;  1ERQ A;  2DCF A;  1YLY A;  1CEG A;  3TG9 A;  3ITB A;  3IXB A;  1K54 A;  2EXA A;  5F83 A;  5HAI A;  2WZX A;  1ES5 A;  4F94 A;  3UO9 A;  2Y2Q A;  4KZB A;  3VP2 A;  3HRE A;  3SS5 A;  1MWR A;  1SDN A;  4EV4 A;  2ZQ8 A;  3VFH A;  4E6X A;  4Z9Q A;  3O3V A;  3W4P A;  2E8I A;  4QY6 A;  2XFS A;  1FOF A;  3QHY A;  5U47 A;  3FWL A;  3N8L A;  3RJU A;  3CZD A;  3DWK A;  1BLH A;  4OPQ A;  2OV5 A;  3AGF A;  3MKF A;  1PZP A;  1Z6F A;  4IVI A;  3NDE A;  2X71 A;  1BTL A;  1K57 A;  3MZE A;  4OP8 A;  1CEF A;  2GDN A;  4C75 A;  4GD6 A;  4P85 A;  3SS3 A;  4M3K A;  1WYC A;  3IH8 A;  5GLC A;  4KZ3 A;  5DF8 A;  4WEL A;  4N1X A;  1MBL A;  3CMZ A;  1K54 C;  2B5R A;  5CXW A;  4OLG A;  1JWZ A;  1W7F A;  5EE8 A;  1EI5 A;  2HDQ A;  1I2S A;  4JXG A;  3OPR A;  4RVA A;  5GHZ A;  3VSL A;  4HBT A;  1ES4 A;  4DE2 A;  4S2M A;  1HVB A;  3Q7Z A;  4QY5 A;  3IF6 C;  3OPH A;  1Q2P A;  1FSW A;  4UA9 A;  1HD8 A;  4WYY A;  3GSG A;  1FCM A;  3AGD A;  1YLZ A;  2Y2L A;  3IXD A;  1ZC2 A;  3V3R A;  4HEF A;  4KQQ A;  4IBX A;  1IEM A;  3PBR A;  5FA7 A;  3OPL A;  4E3M A;  1KE0 A;  2JCH A;  2WKE A;  4GDN A;  4N1H A;  3UNW A;  3ZG5 A;  3V3S A;  4BLM A;  1MPL A;  1L0G A;  4DF6 A;  1RCJ A;  3HLG A;  1IEL A;  1WE4 A;  4N92 A;  2X02 A;  5FI6 A;  1O7E A;  1XP4 A;  3MZD A;  3V5M A;  4OQI A;  5KSC A;  3PTE A;  5JYO A;  5HAR A;  3MKE A;  3O88 A;  5E2E A;  3D4F A;  3E2L A;  1ZKJ A;  4KZ5 A;  3ZG7 B;  4FH4 A;  4H8R A;  4UA6 A;  3FV7 A;  1ZG4 A;  2JC7 A;  4PM8 A;  4X53 A;  3SS4 A;  4DE1 A;  5HAP A;  4O7D A;  1FSY A;  4WZ5 A;  3V39 A;  1ZG6 A;  3N6I A;  1TDL A;  1H8Y A;  3P98 A;  2Y55 A;  3A3I A;  3PBN A;  4LEN A;  5F1F A;  2HPB A;  4KQR A;  4WM9 A;  4OQG A;  3LO7 A;  3EQU A;  5EEC A;  5FQJ A;  5A92 A;  3WS0 A;  5FI2 A;  5DTK A;  2X01 A;  2J7V A;  3SOI A;  4MNR A;  2H0Y A;  3NCK A;  4KEN B;  3ZGA B;  2HP5 A;  3IT9 A;  3S22 A;  3OCN A;  4JLF A;  3GV9 A;  2WZZ A;  3CG5 A;  4N9L A;  5F82 A;  3G2Z A;  1O07 A;  1YLW A;  4LCM A;  1NZU A;  1K25 A;  2Z2L B;  1LHY A;  2ZC6 B;  5FSR A;  1K55 A;  1SCW A;  1GA0 A;  2R9W A;  1S6R A;  1XXM A;  4LV3 A;  2ZM2 A;  3BFG A;  4ZJ1 A;  3ZNT A;  3C7V A;  2EX9 A;  2VGK A;  3WRT A;  3IQA A;  5HX9 A;  4QHC A;  1YMS A;  2PBY A;  3MBZ A;  1BT5 A;  4WZ5 C;  5GLD A;  4OPY A;  4OQ0 A;  3DW0 A;  3NI9 A;  4OPZ A;  3VOY A;  2ZMA A;  3ZG9 B;  1PI5 A;  4RYE A;  4BD1 A;  2Q9M A;  5CHJ A;  2H0T A;  2WAE A;  5JYP A;  3LCE A;  4UA7 A;  3ZDJ A;  2V20 A;  2A3U A;  2Y2I A;  5D3O A;  5FQI A;  3ZVT A;  3UDI A;  1NYM A;  4PM7 A;  5IHV A;  4ZAM A;  3MFD A;  5DF9 A;  4WZ4 A;  1DY6 A;  1L0D A;  4S2O A;  5FAQ A;  2IWC A;  3GMW A;  1C3B A;  1KVL A;  5AQ9 A;  5GHY A;  1E25 A;  2H10 A;  5A91 A;  4JXW A;  1PYY A;  3UPO A;  2ZC4 B;  3ISG A;  4FD8 A;  4R3J A;  3S1Y A;  4S2I A;  1K55 C;  4E6W A;  4R4R A;  1XGJ A;  4QJG A;  4GZB A;  2ZQA A;  1W5D A;  3LEZ A;  4NK3 A;  4OQH A;  5CTN A;  3WS2 A;  2P9V A;  1GHM A;  3C5A A;  1L2S A;  1BLS A;  3WS4 A;  1KVM A;  1NZO A;  1PZO A;  2HDS A;  1W79 A;  3NDG A;  3PAE A;  1K6S A;  4GB7 A;  2PU2 A;  5FAS A;  1LLB A;  2ZD8 A;  4KG2 A;  4DRT A;  2C5W B;  1JTG A;  1BUE A;  3S4X A;  4B88 A;  3HLD A;  1W8Q A;  3IXG A;  5GLA A;  4E3L A;  5FQQ A;  3BEC A;  2BLS A;  3A3D A;  4JXS A;  1NYY A;  2VGJ A;  2XD1 A;  2V1Z A;  4S2P A;  2XK1 A;  4E3J A;  4U3T A;  3ZNY A;  1FR6 A;  1FQG A;  1MWU A;  1K4E A;  1NXY A;  2Y2O A;  4GOG A;  4P0M A;  3HBR A;  5FQK A;  3UE3 A;  4DKI A;  4U0X A;  1MY8 A;  2ZLY A;  3UDX A;  1LL9 A;  4ZTK A;  3M6H A;  2EX2 A;  4KZ7 A;  5HFO A;  5EOO A;  1RGY A;  1YLP A;  3LY3 A;  1NRF A;  4KZ9 A;  1TDG A;  4KZA A;  4PM6 A;  3G31 A;  4JBF A;  4JF5 A;  3N4I A;  4OPR A;  4QB8 A;  4OOM A;  3WS5 A;  3DWZ A;  1J9M A;  4K0X A;  5TFQ A;  1JWP A;  3BRM A;  3VOZ A;  4Q8I A;  3I7J A;  1E4D A;  4Y0U A;  1L0F A;  3IWQ A;  4EQI A;  1DJA A;  5I94 A;  1GA9 A;  3BFD A;  1K57 C;  2XF3 A;  1CK3 A;  4OLD A;  4R1G A;  4D2O A;  3PBQ A;  3SH7 A;  5TGF A;  2P9V B;  5EVI D;  3C7U A;  1XA7 A;  4MEZ A;  3IHB A;  1PWD A;  3IXH A;  3AGE A;  3A3E A;  2R9X A;  4GD8 A;  1QMF A;  2Y2G A;  2JE5 A;  5DVA A;  1AXB A;  3NC8 A;  5TR7 A;  4EUZ A;  2PU4 A;  5BOH A;  2EX6 A;  1E3U D;  1M6K A;  4WEJ A;  1BUL A;  4S2N A;  4EBP A;  4WBG A;  3ZCZ A;  1YLJ A;  4KG5 A;  2WAF A;  2XDM A;  3WWX A;  4XXR A;  3HLB A;  4OH0 A;  1DJB A;  3Q7V A;  5CHU A;  4BEN A;  3G4P A;  4ID4 A;  4ZDX A;  1N9B A;  5FAT A;  5CER A;  2FFF B;  3BEB A;  4QD4 A;  4X69 A;  4ZBE A;  5GHX A;  5GL9 A;  1OME A;  2HDR A;  3CJM A;  4PM9 A;  4UHU A;  5HL1 A;  5KMW A;  1TEM A;  2DNS A;  3VP0 A;  2FFY A;  5CEB A;  5G18 A;  1NY0 A;  3BFC A;  5M1A A;  3ZG8 B;  2WK0 A;  4Y7P A;  1PW8 A;  3IF5 A;  3BFF A;  4OP5 A;  2ZQC A;  4BJP A;  1RP5 A;  1KDW A;  4OVD A;  4RA7 A;  1JTD A;  3E2K A;  3VP3 A;  2Y2J A;  2XGN A;  3ZVW A;  2WGV A;  4XUX A;  3Q81 A;  3UY6 A;  3VFF A;  1TVF A;  4S2N C;  4FSF A;  5CGW A;  1SKF A;  2EXB A;  1K56 D;  3W4Q A;  2EFU A;  3Q82 A;  1M40 A;  3IWO A;  1Y54 A;  1G68 A;  4NET A;  3LY4 A;  5FAP A;  4Y0O A;  5FQ9 A;  1GCE A;  3UPN A;  1QME A;  2Y2N A;  1SHV A;  1W8Y A;  2ZQ7 A;  1YT4 A;  2ZQ9 A;  1KE3 A;  3UPP A;  2G2U A;  1IYQ A;  4XUZ A;  3BM6 A;  1MWS A;  3IHA A;  5AQA A;  1XKZ A;  4U0T A;  4DDS A;  1IYP A;  1BLP A;  3MZF A;  4OOY A;  1YQS A;  1VQQ A;  3C4P A;  5DTT A;  1KGF A;  3BYD A;  5DF7 A;  3OCL A;  1KDS A;  3Q7V B;  4WMC D;  3NY4 A;  5DTS A;  5E43 A;  1U60 A;  1XPB A;  4DDY A;  4JF4 A;  4GNU A;  1XGI A;  3N7W A;  1ESU A;  3SH8 A;  3HLW A;  1FCN A;  4GDB A;  4JF6 A;  3PBT A;  4PM5 A;  3P09 A;  2ZM8 A;  1XX2 A;  4LV2 A;  3OZH A;  1PIO A;  4HBU A;  4IED A;  3G30 A;  3FKW A;  4FCF A;  2WYX A;  1RGZ A;  3PBS A;  4KZ8 A;  4S2L A;  4R0Q A;  5E2G A;  2EX8 A;  3RXW A;  3ZFZ A;  3TSG A;  4LCL A;  3C4O A;  2C6W B;  3G34 A;  2CC1 A;  4K91 A;  3VMA A;  1BLC A;  1GHI A;  4EWF A;  4ZJ3 A;  4N9K A;  1HTZ A;  4P6B A;  1BSG A;  1IKI A;  1LL5 A;  2J9O A;  1I5Q A;  1ESI A;  3O86 A;  5KZH A;  2ZC7 A;  1G6A A;  4YIN A;  4MBH A;  1N4O A;  4BD0 A;  3G35 A;  4RX3 A;  5KSH A;  2XLN A;  5A93 A;  1CI8 A;  4L0L A;  3HVF A;  4QU3 A;  2XEP A;  3VP4 A;  5E2H A;  4P87 A;  3G2Y A;  3QNB A;  3N8R A;  5CGS A;  3IF6 A;  2IWB A;  4R23 A;  5HAQ A;  5EVI A;  3GVB A;  3HLE A;  4BL2 A;  4Y0T A;  3UE1 A;  3FKV A;  4JXV A;  3HUM A;  3OC2 A;  3GQZ A;  2Y91 A;  3WRZ A;  4LV1 A;  1PI4 A;  5E2F A;  2HDU A;  5L2F A;  1YMX A;  5GLB A;  1PWG A;  2V2F F;  5AQ7 A;  3HUO A;  1E3U A;  1MXO A;  4PMA A;  1KE4 A;  3SH9 A;  3M2K A;  4KQO A;  4MLL A;  2ZJ9 A;  4X6T A;  4KZ6 A;  1I2W A;  1MWT A;  2UWX A;  4R3B A;  4DXC A;  3GTC A;  3UE0 A;  3PBO A;  2Y4A A;  2WKI A;  5EVL A;  1S0W A;  5CTM A;  2WGI A;  5F1G A;  5CRF A;  5HW3 A;  1ERO A;  2XH9 A;  3BFE A;  3FYZ A;  3GR2 A;  2OLU A;  2WGW A;  3HUN A;  1NJ4 A;  1K6R A;  2Y2M A;  4RX2 A;  3HLF A;  3M2J A;  2ZC5 B;  4ZJ2 A;  3A3F A;  1ERM A;  1FR1 A;  1ONH A;  3VSK A;  4E3I A;  4E3N A;  3G32 A;  4IVK A;  5EVI C;  4KZ4 A;  2XQZ A;  2J9P A;  4BQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...