1ESUA

S235a mutant of tem1 beta-lactamase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKAGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title TEM1 beta-lactamase structure solved by molecular replacement and refined structure of the S235A mutant.
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1esuA00
4KG5A 4E3KA 4S2OA 3IHBA 4B4XA 3VSKA 4XXRA 5L2FA 5AQBA 1MWTA 2ZM2A 2JCHA 4OPRA 4GKUA 3VP4A 1FCMA 2GDNA 5F1GA 1YLTA 1K54A 2EFXA 3BFGA 3UO9A 2UWXA 1Z6FA 4KZ3A 3O87A 1L0GA 3PBOA 2OLUA 4MLLA 4R3JA 1RGZA 4S2NA 4UAAA 3RXXA 1DJCA 4Y7PA 3ZG7B 1MBLA 3ZVTA 5HL1A 4X56A 3HL9A 3TSGA 3MZDA 3GMWA 1CI9A 1EI5A 2Y2QA 4R4SA 1K6SA 3O3VA 1JTDA 3BEBA 3SH9A 4IVKA 5CHUA 3BLSA 2P9VB 2XFTA 4RA7A 1Q2PA 1SCWA 3FKWA 3WS0A 1JWVA 2ZQ7A 4K0WA 4FCFA 2WADA 4XUZA 2BG1A 5CGWA 1ES4A 4WBGA 2JE5A 3IHAA 2XR0A 4DE3A 3NC8A 3W4OA 2HDRA 5EECA 2WAEA 1KE3A 2ZC7A 1KGGA 2Z2LB 1IYQA 4QY5A 4N9KA 4X6TA 3DWZA 1CI8A 4ZBEA 3IF6B 1MKIA 1NYYA 1LLBA 2EX2A 4E3MA 4ZJ3A 4E3LA 5I94A 3NY4A 4OP8A 5FQMA 5E2FA 4FD8A 2E8IA 4DXBA 2J9OA 1WE4A 1GHMA 3V39A 3PAGA 1E4DA 1ZC2A 1BLCA 4Z9QA 5FASA 1PW1A 3Q82A 3UDXA 4DKIA 4H8RA 4QHCA 5GHZA 1K56D 4EUZA 4WMCD 4WZ5A 5FSRA 1PWDA 3IF6C 4MBKA 4EBLA 3WS2A 1K4FA 4UA9A 2Y2NA 3VMAA 2J9PA 2WGVA 4JXSA 2ZJ9A 3O88A 4MBFA 3RJUA 1XA1A 4WELA 1ESUA 1J9MA 1BLHA 3G2YA 3FKVA 4ZAMA 4OP5A 5F83A 4DRTA 4BQMA 4OKPA 4IBRA 5FAQA 5CGXA 4FH2A 4OPZA 5HAIA 3VSLA 3Q7VB 3SH8A 5HAQA 5KSHA 1ESIA 3A3FA 1W7FA 4IVIA 4Y0UA 5F82A 3BM6A 4OQGA 4OLGA 2HDQA 3VP0A 3LY4A 3ITBA 3N8LA 2Y2KA 1O07A 2ZC5B 4PMAA 5E2HA 5A91A 2ZQ9A 3C7UA 2JC7A 3OCNA 5EVLA 1O7EA 4EV4A 1Y54A 4JF5A 3UE3A 4KZ8A 3BECA 3LCEA 5FQ9A 3S4XA 3C5AA 2Y2MA 2DRWA 4OONA 4KZBA 5FA7A 1GCEA 1H8YA 4N92A 4OPQA 2WKHA 2WUQA 2G2WA 4OOMA 1OMEA 2EFUA 4MBHA 3HLWA 5FQQA 4RX3A 4OH0A 3G2ZA 3C7VA 4LCLA 3CJMA 1XXMA 4X53A 4EWFA 4S2LA 3P09A 4JPMA 5A92A 5CEDA 3ZNYA 4S2MA 1ONHA 5BOHA 1G68A 1MY8A 1XGIA 4GOGA 4PPRA 2X01A 3BFCA 1W8QA 1IYPA 2ZM0A 3MBZA 3A3DA 1IEMA 5GL9A 3ZHHA 2B5RA 2G2UA 2H0TA 1BLSA 5A93A 2IWCA 4JXGA 3QNBA 5EPHA 5DF7A 2Y2LA 5EVIB 3BLMA 5TFQA 4U0TA 4X55A 1TDGA 1QMEA 3BRMA 4WMCA 3DWKA 1NRFA 3ZFZA 4WM9A 3A3EA 1LI9A 4UA7A 5CTNA 2WGWB 1DJAA 1YMSA 3BFEA 3FYZA 5DTKA 4EQIA 5JYOA 2ZC6B 1W79A 2XD1A 1PI4A 4LV0A 1K55C 3NDEA 4QB8A 5FQJA 2FFFB 4P0MA 4M3KA 4E3NA 3LY3A 3ZG8B 4ID4A 3EQVA 4OPYA 3UPNA 2XK1A 5EVIC 2ZQDA 3GQZA 2QZ6A 3M6BA 3UE0A 1I2SA 4GNUA 3V50A 3IXHA 2A3UA 4GN2A 5CTMA 1H5XA 1E3UD 1L2SA 5EOEA 1IYSA 5GLDA 2R9XA 5TGFA 3ZVWA 1JWPA 1PZPA 4ZJ2A 4E6XA 3SS3A 4NETA 3HLDA 4WYYA 2XGNA 2J7VA 2I72A 3MKEA 4S2JA 5GLCA 1KGEA 5FI2A 1ES5A 2HDSA 2IWBA 3S1YA 3FZCA 4K91A 3CG5A 3ZG0A 4IEDA 3Q1FA 3GRJA 3ISGA 2V20A 5GLBA 1ES3A 2ZQAA 3C4PA 4BD0A 5HARA 3ZG5A 1N4OA 4N1HA 2Y2JA 2PU2A 3E2KA 4JF4A 3VOZA 2ZC4B 2PU4A 1LL5A 1ZG4A 1BUEA 3NDGA 3PAEA 4WEKA 2P74A 3MXRA 2Y2GA 2OSUA 1MWUA 3HUMA 4LENA 1GHPA 2OV5A 4O7DA 3WS4A 4DE2A 5E43A 1ZKJA 1BZAA 1SKFA 1L0FA 4YINA 3OPRA 4OVDA 2XQZA 3P98A 4LCMA 4JXVA 4R23A 2WGIA 2QPNA 4DF6A 2VGKA 5CRFA 5CHJA 4JLFA 4E3IA 3DTMA 3IXDA 4B88A 1L0DA 3WS5A 4JKTA 1DY6A 1NYMA 1MWRA 4L0LA 3HVFA 3G4PA 1YLPA 3OPPA 3ZCZA 5HFOA 3ZGAB 3M2JA 1K6RA 1CK3A 1LL9A 3BYDA 4S2IA 2IWDA 4PM5A 2HP6A 2QMIA 1YM1A 4IBXA 4KZAA 3W4QA 4PM8A 1MPLA 4HESA 4OQIA 4DDYA 1Q2QA 1K57A 3QHYA 1PYYA 2XF3A 4Q8IA 4DE1A 2EX6A 2Y2IA 3I7JA 1XPBA 4C6YA 4EBPA 3VFHA 4HEFA 3W8KA 2Q9MA 2Y2OA 2V1ZA 3IQAA 5A90A 4S2PA 5AQ7A 3UDFA 1ZG6A 1IYOA 1FOFA 4PM6A 5TR7A 3V5MA 1ES2A 1NJ4A 1RGYA 3MZEA 5HAPA 3G30A 3GSGA 1K54C 3BFDA 4UHUA 5KMWA 3PBQA 3HUOA 3OC2A 3N4IA 3SOIA 5CXWA 3UPOA 2Q9NA 1BTLA 3V3SA 4S2NC 2A49A 3OPLA 1ERMA 1KVLA 5M18A 1PIOA 3IH9A 4KG6A 1S6RA 3N6IA 4P6BA 3N8SA 4BL2A 4B4ZA 4C3QA 2WYXA 4OOYA 4KG2A 5AQ9A 1XX2A 3B3XA 1YLJA 5GHYA 2ZQCA 4GD8A 3ZG9B 3GR2A 3IWIA 4LV2A 4OOLA 4BENA 4U3TA 3D4FA 4YFMA 3MXSA 1PZOA 2R9WA 3IF5A 3AGFA 5F1FA 1QMFA 3IXBA 1IKIA 5G18A 2RCXA 2C6WB 3Q81A 3E2LA 2P9VA 2BLSA 3WRZA 3VP1A 4FSFA 3DW0A 4CPKA 3MFDA 4K0XA 5DVAA 3NIAA 4R1GA 3UN7A 1K25A 3WWXA 3SH7A 4C75A 4P87A 1PWGA 3PTEA 1S0WA 1XKZA 2WKEA 1K56A 1MXOA 2X02A 1CEFA 5E2GA 1JTGA 2V2FF 3IWQA 4KENB 1KVMA 3LEZA 1TDLA 5EUAA 1I5QA 3UNWA 4WZ5C 1I2WA 1YLYA 4KZ5A 1N9BA 1M6KA 1JVJA 2H0YA 3IF6A 4D2OA 1XA7A 2EXBA 2H10A 2XLNA 4BD1A 4F94A 1HD8A 3SS4A 4LV3A 1PWCA 1TEMA 4GDNA 3G32A 5D3OA 1KE4A 4E3OA 5FAOA 3S22A 1G6AA 2Y55A 3IH8A 2HDUA 1TVFA 5EVID 4S2KA 3TOIA 2Y2PA 3C4OA 3HLBA 3W4PA 3M2KA 5HW3A 1SDEA 3FWLA 5FI6A 1BSGA 1GA0A 1CEGA 4NK3A 1VQQA 3OZHA 4GZBA 3VP3A 4ZDXA 4RX2A 2X71A 4KZ9A 1FCOA 1M40A 4QD4A 1AXBA 2XDMA 2XFSA 4A5RA 5HX9A 4QY6A 4ZTKA 3VFFA 3AGDA 4HBUA 3NI9A 1FR6A 5CERA 4GDBA 2EX9A 1EROA 3EQUA 1KE0A 3Q7VA 3HUNA 5GHXA 5CHMA 5E2EA 3M6HA 4KZ6A 2EX8A 5DF9A 2J8YA 3HLCA 5JYPA 5CEBA 1W5DA 1ERQA 3IT9A 2RL3A 4BL3A 3WS1A 4N9LA 3HLGA 5CGSA 1WYBA 2DCFA 1JWZA 1RP5A 4Y0OA 2WK0A 1L0EA 4Y0TA 3A3IA 3OPHA 4WZ4A 3CZDA 3LO7A 1HVBA 3PBRA 4X68A 1VM1A 2ZM8A 1IELA 2VGJA 4KQOA 1NZUA 3GVBA 5CECA 3PBSA 3VOYA 4OQHA 4LV1A 3HLFA 5EOOA 3NCKA 3NBLA 4KZ4A 1YLZA 1FSWA 1YMXA 1YQSA 1HTZA 1FCNA 1BLPA 3MZFA 1BULA 5U47A 2HP5A 5FI7A 4UA6A 1MWSA 3UY6A 3O86A 3ZDJA 1YLWA 4DE0A 4QJGA 4R4RA 2Y2HA 4MEZA 3A3JA 4DDSA 4JF6A 4WEJA 4N1XA 4PM7A 2ZQ8A 1H8ZA 1K55A 1XGJA 1K38A 1E3UA 5FQKA 4KZ7A 3UE1A 4BLMA 4R3BA 3RXWA 2XH9A 2PBYA 5EVIA 1RCJA 5KZHA 4U0XA 2C5WB 4MNRA 4E3JA 3AGEA 5M19A 3GTCA 4JXWA 4HBTA 1C3BA 2WAFA 2WGWA 1ONGA 4ZJ1A 3HBRA 1K4EA 1FSYA 3G35A 3G34A 1SDNA 1U60A 4RYEA 2JBFA 3HREA 5DTTA 3FV7A 2HP9A 3N8RA 2HPBA 2WZXA 4XUXA 1HZOA 2H5SA 3TG9A 2Y4AA 1NXYA 2FFYA 2ZC3B 5FATA 5GLAA 2ZD8A 3JYIA 2XD5A 1NY0A 2ZLYA 3QNCA 2WZZA 5EE8A 3N7WA 1GA9A 4JBFA 4OQ0A 1E25A 3MKFA 5AQAA 1PW8A 3CMZA 3Q07A 4E6WA 3IXGA 4R0QA 4RVAA 3VP2A 3G31A 4DXCA 2Y91A 2Z2MB 3OCLA 3UPPA 1BT5A 1LHYA 1KDSA 2Y59A 2DNSA 4GB7A 1W8YA 1LI0A 3PBNA 1ALQA 4P85A 5DF8A 2WKIA 5KSCA 1FQGA 5FDHA 3ZNTA 1IKGA 2CC1A 1KGFA 4EBNA 3IWOA 5IHVA 5M1AA 1GHIA 4QU3A 1DJBA 2ZMAA 4OLDA 4GD6A 2EXAA 1KDWA 4BJPA 5DTSA 3WRTA 1FR1A 3ITAA 2XEPA 1SHVA 5FAPA 3V3RA 1YT4A 1WYCA 1NZOA 1K57C 3HLEA 3PBTA 4CJNA 5FQIA 5J8XA 4PM9A 3Q7ZA 1PI5A 3SS5A 3BFFA 4KQQA 3UDIA 2OLVA 4FH4A 1XP4A 4KQRA 1EWZA 3GV9A 4X69A
chains in the Genus database with same CATH superfamily
1K0KA 3VSKA 4XXRA 2JKFA 1MWTA 1FCMA 5HDCA 5F1GA 1Z6FA 5FEGA 1L0GA 3H82B 3PBOA 1RGZA 4S2NA 1ZHHB 2JKRM 5A8BA 3O3VA 3BEBA 4ARZA 3JVUA 3QP6A 4NXFA 4RA7A 2NUPC 1S67L 3E4QA 3LI9A 4YWZA 2BG1A 1ES4A 2PR5A 3BWLA 2JKRI 2XR0A 3GECA 2Z6DA 3W4OA 1XJ4A 5EECA 2ZC7A 1KGGA 4QY5A 4JGOA 4EQ1A 4KUOA 4ZJ3A 4E3LA 1NLYA 1UGUA 3NY4A 3TJZC 4OP8A 2A24A 4Z9QA 1OT6A 1PW1A 1T1AA 2PYRA 4QHCA 4WMCD 5TBMA 5FSRA 5F68A 3IF6C 3WS2A 1VETB 2Y2NA 2J9PA 3RJUA 1T1BA 4LRZE 1XA1A 4WELA 1ESUA 3T50A 4BQMA 5IU1A 3UB7A 3CPTA 5HAIA 2IA2A 3SH8A 5KSHA 1ESIA 3MMHA 4NG2A 5F82A 3BM6A 3D9YA 2HDQA 3N8LA 5A91A 1F5MA 4KZ8A 5EV0A 3S4XA 1F9IA 2Y2MA 2CMNA 4OONA 5FA7A 1GCEA 4LGWA 5G4YA 1OMEA 5HZHA 5DJUA 3C7VA 3CJMA 4X53A 3LIFA 4S2LA 3F1OA 1DP8A 2X01A 3ZHHA 2BTFP 2H0TA 5DJTA 2IWCA 4JXGA 4U0TA 3BRMA 3DWKA 5DFXA 3A3EA 2YKHA 3MQOA 3BQ8A 4EQIA 3BFEA 3FYZA 5DTKA 3P7NA 4BBUA 1V9YA 1CQAA 4IUHA 5FQJA 4P0MA 4E3NA 2XK1A 5EVIC 4JGQA 2QZ6A 2Z6CA 3M6BA 3UE0A 3V50A 5GLDA 3LIAA 1E3UD 2R9XA 5TGFA 1PZPA 4ZJ2A 2XGNA 2I72A 1KGEA 5FI2A 1ES5A 2HDSA 3CG5A 2UV0E 2V20A 2PD8A 4BD0A 3C4PA 4N1HA 4M4XA 2Y2JA 4JF4A 1LL5A 3NDGA 4G3VA 4WEKA 2P74A 2Y2GA 3SW1A 1BZAA 4OVDA 2XQZA 4HY8A 4LCMA 4JXVA 2WGIA 2NUTC 4JGRA 5CHJA 3DTMA 1L0DA 3QP2A 4DJ3A 4CLCB 3HVFA 2W0NA 1OJ5A 1YLPA 1D06A 5HFOA 3ZGAB 1K6RA 3GDIA 3BYDA 3C30A 2IWDA 4PM5A 1IFQA 2HP6A 1CJFA 2QMIA 4IBXA 4KZAA 4OQIA 1FILA 4MDZA 1X0OA 1WA9A 4Q8IA 1G6OA 4DE1A 2Y2IA 5I5LA 4C6YA 3VFHA 4HEFA 3MS6A 2V1ZA 2XA7S 3UDFA 3PYPA 4PM6A 1NJ4A 5HAPA 3T4OA 3GSGA 4UHUA 3PBQA 5CXWA 2Q9NA 4MMNA 4S2NC 4NXBA 2YKFA 4NXEA 3NULA 3E0YA 3D72A 1S6RA 3N6IA 1H3QA 4O0PA 4C3QA 4FUWA 5AQ9A 3H82A 3B3XA 4LLOB 3CWFA 4LV2A 5DFYA 4O01A 2R9WA 1LSXA 3IXBA 1AWIA 1IKIA 5G18A 2C6WB 3Q81A 1STZA 1UWPX 2GJ3A 4HJ3A 4EETB 1T1CA 3DTKA 1S66L 3T1RA 1PWGA 1MXOA 3H9WA 2X02A 2LB9A 4L9EA 2V2FF 1OTBA 1KVMA 3RTYA 3NECA 2K2NA 3UNWA 1YLYA 2ZOIA 3LIBA 2H0YA 1XA7A 2EXBA 4X25A 4F94A 4LV3A 1PWCA 4LPZA 5FL3A 2G7UA 3IH8A 5EVID 2B02A 4S2KA 3TOIA 2KOIA 3W4PA 3M2KA 1A0KA 3UB8A 2JKTM 1VETA 4RX2A 3ZYTA 1AXBA 3VV4A 4MCWA 1IOUA 4GDBA 2EX9A 1EROA 2JKTI 3EQUA 1KE0A 3HUNA 5GHXA 4BMWA 3M6HA 4KZ6A 2EX8A 5DF9A 4DN0A 3HLCA 1W5DA 4BL3A 5L10A 3TE8A 3T4JA 1WYBA 1P9WA 1L0EA 3A3IA 3OPHA 2M7VA 1VM1A 2ZM8A 1IELA 1NZUA 3GVBA 2KX6A 4Y13A 3HJKA 4KZ4A 4LFUA 1YMXA 1BULA 4CLCE 4ETXA 3F1NB 4GHIB 2Y2HA 4MEZA 4UQIS 4JF6A 1H8ZA 2P7JA 3ULFA 1E3UA 5FQKA 4KZ7A 3O5YA 1RCJA 2QYBA 3BW6A 4MNRA 1G28A 3CHWP 3CI6A 1K4EA 3G34A 3KSIA 4RYEA 4HIAA 2JBFA 2L1MA 3FPVA 2FH5A 2JN7A 3N8RA 2HPBA 2WZXA 4XUXA 3NHQA 1S1ZA 2H5SA 2ZC3B 5GLAA 3JYIA 3QNCA 3A0SA 3MKFA 1PW8A 4P6ZS 3IXGA 3MFXA 3VP2A 2Z2MB 3UPPA 1LHYA 2DNSA 2W3FA 5EVEA 1W8YA 1LI0A 3PBNA 1ALQA 5KSCA 5AVFA 2CC1A 2HV1A 3WRTA 1FR1A 1NRJA 1SHVA 1WYCA 3HLEA 5HD5A 4F3LB 4CLCA 3SS5A 3UDIA 3UB6A 4X1LA 1XJ6A 4WN5A 1XP4A 3BY8A 4X69A 4KG5A 4S2OA 5L2FA 2AVXA 2V8FA 2I9VA 2W3DA 2ZM2A 3VP4A 4OPRA 1YLTA 1K54A 3BFGA 1Z09A 4R3JA 3L7HA 3RXXA 2PD7A 4Y7PA 1MBLA 4AFIA 4X56A 1TS7A 1Y28A 1CI9A 4EESA 1K6SA 3SH9A 3IBJA 3BLSA 3QP4A 4I5SA 2ZQ7A 4K0WA 4FCFA 2J3TD 3IHAA 5HWTA 5FDSA 3W2ZA 1KE3A 4Y15A 2PR6A 4B93A 4E3MA 1ODVA 5FQMA 5E2FA 4FD8A 2J9OA 4Y5FA 1ZC2A 4DKIA 5GHZA 1K56D 3K3DA 1YSPA 1LSVA 2O99A 3LYXA 2WGVA 4JXSA 2ZJ9A 4YOFA 1OJGA 1BLHA 3G2YA 1YAXA 4OKPA 3HJIA 1VEUB 4IBRA 4FH2A 4OPZA 3VSLA 3Q7VB 5EM0A 1W7FA 4OQGA 3VP0A 3LY4A 2LB5A 3L9KA 3UE3A 5FQ9A 2DRWA 2INWA 4KZBA 1H8YA 4N92A 2WUQA 2EFUA 5FQQA 4RX3A 4LCLA 3P09A 4JPMA 5A92A 5CEDA 1GSXA 4HOIA 1ONHA 4S2MA 1JNUA 1G68A 4PPRA 3BFCA 2ZM0A 3MBZA 2WKQA 2B5RA 5A93A 2PBDP 4R3AA 1QMEA 1NRFA 3C2WA 3A0VA 3R4KA 4MN7A 1W79A 4QB8A 2HGVA 4OPYA 3F1NA 5CTMA 4GHIA 1H5XA 1L2SA 3LI8A 1IYSA 1JWPA 5HD3A 3HLDA 2J7VA 5L09A 4XT2B 3S1YA 4PKYA 4K91A 4EW7A 5DKKA 3ISGA 5GLBA 1YKDA 3MF0A 2ZQAA 3ZG5A 2PU2A 3E2KA 3PAEA 1ZG4A 4G3WA 1LT0A 2OV5A 2VKSA 1L0FA 4R23A 2QPNA 2VGKA 2FZ0A 5L8MA 3QP8A 4HP9A 4B88A 3WS5A 4JKTA 4L0LA 3OPPA 2W27A 1H0MA 1CK3A 4QPRA 5HDDA 1YM1A 1MPLA 4HESA 2EWWA 1K57A 3QHYA 1PYYA 2XF3A 3I7JA 2OAP1 3H7WB 3LIDA 4Q0HA 2Y2OA 1ZG6A 2V8CA 1FOFA 5F6AA 5CX7A 2OWHA 2ZL1B 1K54C 3V3SA 3B42A 1KVLA 5IS1A 5M18A 4ZRRA 4KG2A 2PHYA 1XX2A 5GHYA 3ZG9B 3GR2A 3IWIA 1OT9A 4BENA 3G6OA 4U3TA 3D4FA 4BWIA 4K08A 1QMFA 1PNEA 2ZMFA 2RCXA 3F1PA 3E2LA 1N9NA 2BLSA 4FSFA 3DW0A 2DMWA 5DVAA 1VB6A 3A0RA 4R1GA 2QHKA 1K25A 1HLUP 4P87A 1K56A 1LL8A 4DJ2A 5E2GA 1JTGA 1OPXA 3IWQA 2ACGA 1TDLA 1I5QA 1MC0A 1N9BA 4D2OA 1P97A 2V1AA 3G32A 1G5UA 5FAOA 1G6AA 2Y55A 1TVFA 2V9AA 2GX5A 3HLBA 1SDEA 3FWLA 3E98A 4NK3A 1VQQA 4GZBA 3VP3A 2X71A 4KZ9A 1M40A 2O9BA 2XDMA 2XFSA 3NJAA 3AGDA 2QKPA 4HBUA 1VEUA 2VA0A 5FEFA 3Q7VA 3FG8A 5E2EA 2OOLA 2BASA 5JYPA 3VE3A 3UE6A 3UB5P 3WS1A 5CGSA 2DCFA 4Y0OA 1HVBA 1DP9A 4X68A 4KQOA 2VZWA 5CECA 3VOYA 4NEED 3HLFA 3NCKA 2MJ6A 3NBLA 1FSWA 2Y8HA 3MQQA 1HTZA 1F98A 2HP5A 5HPFA 4HNBA 3O86A 2VV8A 4DE0A 4QJGA 4R4RA 4CLCD 4N1XA 2VGLS 4HH2A 1K55A 1XGJA 1VHMA 1K38A 1D1JA 2JHEA 4E3JA 3S7OA 3TRCA 3GTCA 4JXWA 4ZJ1A 3HBRA 3IS2B 3T4LA 4I38A 3VE4A 5FATA 2ZD8A 2XD5A 5EE8A 2ZLYA 2WZZA 5AQAA 1E25A 4XT2A 3MSHA 3Q07A 4R0QA 3G31A 3BQAA 5L07A 4BBVA 1FQGA 5FDHA 1KGFA 4B9OA 4EBNA 5IHVA 1GHIA 4QU3A 3ITAA 1K57C 4CJNA 5J8XA 4PM9A 3B33A 3Q7ZA 2OAQ1 1PI5A 2OLVA 3DAVA 3FC7A 4FH4A 1NLZA 4KQRA 4UEYA 1EWZA 3GV9A 4E3KA 3LFVA 3NOPC 4B4XA 4HJ4A 4IUKA 5AQBA 2KLIA 4GKUA 3VOLA 2UWXA 4KZ3A 4MLLA 3T1XA 4UAAA 1DJCA 3ZG7B 3ZVTA 5HL1A 3TSGA 1MZUA 1EI5A 4I3AA 3EGDC 3OBFA 4IVKA 2ZL1A 2P9VB 3UB9A 3LEQA 2J3TC 1SCWA 3WS0A 2WADA 3KSHA 5CGWA 3MJQA 2JE5A 2HDRA 1OTEA 2WAEA 2B18A 2Z2LB 4X6TA 3S7PA 4GCZA 3DWZA 1CI8A 4LRYC 1MKIA 3K3CA 1NYYA 3IBRA 4Y2FA 4DXBA 1WE4A 4D60A 1E4DA 1BLCA 5LBRA 3UDXA 4H8RA 4HJ6A 1PWDA 4MBKA 1T18A 1K4FA 4UA9A 3VMAA 4MBFA 1CF0A 3IX4A 4PHTA 3FKVA 4ZAMA 5F83A 4DRTA 3PXPA 5FAQA 5CGXA 4GJ4A 3A3FA 4IVIA 4Y0UA 3EEHA 1O07A 2ZC5B 1TF1A 2XA7M 5E2HA 3R7WB 2ZQ9A 2JC7A 3OCNA 3T1SA 1Y54A 2VK3A 1PRQA 4EXOA 4WL9A 3BJNA 2G2WA 4MBHA 3G2ZA 4EWFA 2A24B 4HP4A 3ZNYA 3QP1A 1DRMA 3DTEA 1XGIA 4GOGA 1W8QA 1GSWA 1BLSA 5TFQA 5EPHA 5DF7A 3BLMA 4KUKA 4ESPA 4X55A 3DTIA 3ZFZA 4WM9A 2O9AA 1LI9A 4UA7A 5CTNA 4LV0A 4MN6A 1K55C 2FFFB 5AJGA 4M3KA 2XROA 4ID4A 3EQVA 3UPNA 2ZQDA 2W3EA 4GNUA 3IXHA 2A3UA 4GN2A 5EOEA 3LR5A 4E6XA 1T19A 3SS3A 3MR0A 3MKEA 4S2JA 5GLCA 1TS0A 3B47A 4Z1WA 5EM1A 1N9LA 3U4LP 1ES3A 2XSSA 1N4OA 3IS2A 2GZAA 2ZC4B 1BUEA 4DMZA 3MXRA 1GHPA 4DE2A 2P04A 4O7DA 3WS4A 3F1OB 3UMDA 3EEAA 3T4TA 5MC7A 4HH3A 2W1TB 4DF6A 5CRFA 5IT5A 4E3IA 1DY6A 3G4PA 1DP6A 5J4EA 3MXQA 5J3WA 2OWJA 1LL9A 4PAUA 3W4QA 4PM8A 1Q2QA 4R6LA 1GSVA 3V67A 2EX6A 4HHDA 4EBPA 2QJ7A 3W8KA 5A90A 3LGOA 5AQ7A 1IYOA 3V5MA 1ES2A 4I39A 3G30A 4G3KA 5KMWA 1XFQA 3OC2A 3UPOA 2A49A 2D01A 4UQIM 4GS9B 4KG6A 2WKPA 4BL2A 3CUEA 4B4ZA 1YLJA 1SKOB 4GD8A 4OOLA 3CLOA 4YFMA 3IF5A 3LIEA 2KDKA 2P9VA 3VP1A 2E8JA 4CPKA 3KSGA 3S7QA 2JKGA 2R78A 3KYEA 3SH7A 3PTEA 3EWKA 1XKZA 2WKEA 3LR3A 1CEFA 4X1MA 4P6ZM 4KENB 3LEZA 5EUAA 3P01A 4QWOA 2VLGA 4BD1A 1HD8A 4LRXC 3SS4A 1TEMA 4GDNA 5D3OA 1KE4A 4R70A 4E3OA 3S22A 2Y2PA 3C4OA 5HW3A 3OZHA 2HF6A 1ZTUA 2O0YA 4QD4A 1FCOA 4A5RA 5HX9A 4HI4A 2K7SA 3NI9A 1FR6A 2V0WA 1S1YA 5EFWA 2EWVA 5CEBA 2J3WA 2RL3A 4Y17A 3KYQA 4N9LA 2PT7A 3HLGA 3R7WA 1RP5A 2WK0A 4Y0TA 4WZ4A 5AVEA 3PBSA 4OQHA 5EOOA 1YLZA 1YQSA 1FCNA 1BLPA 3MZFA 3T1QB 4UA6A 4CLCC 2VV6A 1MWSA 4E04A 1YLWA 3KYZA 2ZQ8A 1TS6A 2PAVP 3D3OA 4BLMA 4F3LA 3RXWA 1EW0A 2ZMVA 5KZHA 1YPRA 4Y3IA 4HBTA 1C3BA 2WAFA 3E4OA 2A2LA 1FSYA 4HQAA 1SDNA 3OLOA 2XRNA 3HREA 5DTTA 3FV7A 2HP9A 1HZOA 2Y4AA 1NXYA 2FFYA 2Y79A 3N7WA 5HWVA 1GA9A 4OQ0A 3NOUC 4L9GA 4DXCA 2VEAA 3OCLA 4FTXA 4I3IA 3KO6A 3LICA 4YNRA 1MKMA 3KX0X 2WKIA 3ZNTA 1IKGA 5HPIA 2ZMAA 4OLDA 2EXAA 5DTSA 3PHYA 1XJ3A 2W1TA 4IJGA 1SZVA 3PBTA 5FQIA 3EGXC 3BY9A 1ACFA 3IHBA 2JCHA 2GDNA 2EFXA 3UO9A 3O87A 2OLUA 3HL9A 3MZDA 3GMWA 3RH8B 4PKYG 2Y2QA 4R4SA 1JTDA 2ZBBA 1D7EA 5CHUA 3CUEC 2XFTA 5HL6A 1Q2PA 3FKWA 1JWVA 1H8MA 5G4ZA 4XUZA 4EUVA 4WBGA 1LSWA 4GS9A 3LUQA 4DE3A 3NC8A 3ICYA 4WUJA 5J7EA 1IYQA 4N9KA 1SKOA 4ZBEA 3IF6B 1YSQA 1LLBA 2EX2A 5I94A 2E8IA 3V39A 1GHMA 3PAGA 5FASA 3TW8A 3Q82A 4EUZA 4WZ5A 4EBLA 3U2AA 4EEUA 3O88A 2EA9A 3RFBA 1J9MA 4OP5A 5C5KA 5HAQA 5HDSA 4KQDA 4OLGA 3ITBA 3DBAA 2Y2KA 4PMAA 4H6JB 1UWNX 3C7UA 5EVLA 1O7EA 4EV4A 4JF5A 3BECA 3LCEA 3E4PA 3C5AA 1PFLA 4FOFA 4OPQA 1KOUA 2WKHA 2P08A 4WF0A 4OOMA 3HLWA 4OH0A 1L3LA 1Y4OA 1XXMA 2PYPA 3T4QA 1V9ZA 5BOHA 1TD5A 4II7A 4ME4A 1MY8A 5GL9A 1IYPA 3A3DA 1IEMA 3S7NA 2L0WA 2G2UA 3QNBA 2Y2LA 5EVIB 3LR4A 3JVVA 1TDGA 4WMCA 5K5BA 2WGWB 1DJAA 1YMSA 5JYOA 2ZC6B 2XD1A 1PI4A 3IX3A 3NDEA 5HSQA 2B95A 3LY3A 3ZG8B 3H7WA 3GQZA 1I2SA 1N9OA 4Q0IA 3ZVWA 1S4SA 4NETA 4WYYA 2QJ5A 2Q0OA 2IWBA 3FZCA 3ZG0A 4IEDA 3Q1FA 3GRJA 5HARA 2VX8A 3VOZA 2PU4A 2OSUA 1MWUA 3HUMA 4LENA 4RQ9A 5E43A 1ZKJA 1SKFA 2M1CA 4YINA 3OPRA 2O9CA 3P98A 3KSFA 3CITA 1BYWA 4JLFA 3IXDA 1NYMA 2W1RA 1MWRA 1OTAA 4EEPA 3QP5A 3OOVA 5HWWA 3ZQ5A 3ZCZA 2M7UA 3M2JA 4S2IA 4DDYA 4GLQA 3EOIA 1XPBA 3FPWA 2Q9MA 3IQAA 4S2PA 5TR7A 4JGPA 1RGYA 3MQ0A 3MZEA 4ARZB 3BFDA 3HUOA 3N4IA 4GW9A 3SOIA 1BTLA 3OPLA 1ERMA 1FIKA 1PIOA 3IH9A 1OTDA 2VGLM 4P6BA 1XJ2A 3N8SA 2WYXA 4O8GA 4OOYA 2V1BA 2ZQCA 3MXSA 1PZOA 3C8CA 3AGFA 5F1FA 2H28A 3WRZA 3MFDA 4K0XA 5TBMB 4L9FA 3NIAA 1P9RA 3UN7A 3WWXA 4C75A 1S0WA 4Q0JA 3PR6A 4WZ5C 1I2WA 4KZ5A 1M6KA 1JVJA 3CPTB 3HCYA 3IF6A 2GNXA 2H10A 2XLNA 5DKLA 3JPUA 2HDUA 5F69A 4CQHA 4R38A 5FI6A 2ZOHA 1BSGA 1GA0A 2V0UA 1CEGA 1XFNA 3T4KA 2W3HA 4BBTA 1OTIA 4ZDXA 1P0ZA 4QY6A 4ZTKA 3VFFA 5CERA 4ETZA 3SZTA 5CHMA 3F1PB 2J8YA 1ERQA 3IX8A 3IT9A 4NXGA 4I3JA 4H6JA 1JWZA 1J3WA 3CZDA 3LO7A 2PDRA 3T12B 3LR0A 3PBRA 2VGJA 4LV1A 1W63Q 3CAXA 2PRFA 5U47A 5FI7A 3UMEA 5F5YA 3UY6A 3ZDJA 2HJEA 1F2KA 3A3JA 4DDSA 4WEJA 4PM7A 2VJWA 1W63M 3UE1A 4R3BA 2XH9A 2PBYA 5EVIA 3T4SA 4U0XA 2C5WB 3AGEA 5M19A 1NWZA 2WGWA 1ONGA 2J80A 3G35A 1U60A 3NOTC 5KIZA 2QWSA 2WKRA 2HJ9C 5TJJA 3TG9A 2D02A 1NY0A 4JBFA 3CMZA 4E6WA 4RVAA 3K2NA 2Y91A 1BT5A 1KDSA 2Y59A 4GB7A 4IHQA 4WLAA 1S4RA 2L4RA 4P85A 5DF8A 4EU0A 3IWOA 4MN5A 5M1AA 1DJBA 4GD6A 1KDWA 4BJPA 4EERA 1TS8A 3C38A 2XEPA 5FAPA 3V3RA 1YT4A 1NZOA 4NKPA 2W3GA 3BFFA 4KQQA 2HZ5A 2K31A 2VV7A
chains in the Genus database with same CATH topology
4KG5A 4E3KA 4S2OA 3IHBA 4B4XA 3VSKA 4XXRA 5L2FA 5AQBA 1MWTA 2ZM2A 2JCHA 4OPRA 4GKUA 3VP4A 1FCMA 2GDNA 5F1GA 1YLTA 1K54A 2EFXA 3BFGA 3UO9A 2UWXA 1Z6FA 4KZ3A 3O87A 1L0GA 3PBOA 2OLUA 4MLLA 4R3JA 1RGZA 4S2NA 4UAAA 3RXXA 1DJCA 4Y7PA 3ZG7B 1MBLA 3ZVTA 5HL1A 4X56A 3HL9A 3TSGA 3MZDA 3GMWA 1CI9A 1EI5A 2Y2QA 4R4SA 1K6SA 3O3VA 1JTDA 3BEBA 3SH9A 4IVKA 5CHUA 3BLSA 2P9VB 2XFTA 4RA7A 1Q2PA 1SCWA 3FKWA 3WS0A 1JWVA 2ZQ7A 4K0WA 4FCFA 2WADA 4XUZA 2BG1A 5CGWA 1ES4A 4WBGA 2JE5A 3IHAA 2XR0A 4DE3A 3NC8A 3W4OA 2HDRA 5EECA 2WAEA 1KE3A 2ZC7A 1KGGA 2Z2LB 1IYQA 4QY5A 4N9KA 4X6TA 3DWZA 1CI8A 4ZBEA 3IF6B 1MKIA 1NYYA 1LLBA 2EX2A 4E3MA 4ZJ3A 4E3LA 5I94A 3NY4A 4OP8A 5FQMA 5E2FA 4FD8A 2E8IA 4DXBA 2J9OA 1WE4A 1GHMA 3V39A 3PAGA 1E4DA 1ZC2A 1BLCA 4Z9QA 5FASA 1PW1A 3Q82A 3UDXA 4DKIA 4H8RA 4QHCA 5GHZA 1K56D 4EUZA 4WMCD 4WZ5A 5FSRA 1PWDA 3IF6C 4MBKA 4EBLA 3WS2A 1K4FA 4UA9A 2Y2NA 3VMAA 2J9PA 2WGVA 4JXSA 2ZJ9A 3O88A 4MBFA 3RJUA 1XA1A 4WELA 1ESUA 1J9MA 1BLHA 3G2YA 3FKVA 4ZAMA 4OP5A 5F83A 4DRTA 4BQMA 4OKPA 4IBRA 5FAQA 5CGXA 4FH2A 4OPZA 5HAIA 3VSLA 3Q7VB 3SH8A 5HAQA 5KSHA 1ESIA 3A3FA 1W7FA 4IVIA 4Y0UA 5F82A 3BM6A 4OQGA 4OLGA 2HDQA 3VP0A 3LY4A 3ITBA 3N8LA 2Y2KA 1O07A 2ZC5B 4PMAA 5E2HA 5A91A 2ZQ9A 3C7UA 2JC7A 3OCNA 5EVLA 1O7EA 4EV4A 1Y54A 4JF5A 3UE3A 4KZ8A 3BECA 3LCEA 5FQ9A 3S4XA 3C5AA 2Y2MA 2DRWA 4OONA 4KZBA 5FA7A 1GCEA 1H8YA 4N92A 4OPQA 2WKHA 2WUQA 2G2WA 4OOMA 1OMEA 2EFUA 4MBHA 3HLWA 5FQQA 4RX3A 4OH0A 3G2ZA 3C7VA 4LCLA 3CJMA 1XXMA 4X53A 4EWFA 4S2LA 3P09A 4JPMA 5A92A 5CEDA 3ZNYA 4S2MA 1ONHA 5BOHA 1G68A 1MY8A 1XGIA 4GOGA 4PPRA 2X01A 3BFCA 1W8QA 1IYPA 2ZM0A 3MBZA 3A3DA 1IEMA 5GL9A 3ZHHA 2B5RA 2G2UA 2H0TA 1BLSA 5A93A 2IWCA 4JXGA 3QNBA 5EPHA 5DF7A 2Y2LA 5EVIB 3BLMA 5TFQA 4U0TA 4X55A 1TDGA 1QMEA 3BRMA 4WMCA 3DWKA 1NRFA 3ZFZA 4WM9A 3A3EA 1LI9A 4UA7A 5CTNA 2WGWB 1DJAA 1YMSA 3BFEA 3FYZA 5DTKA 4EQIA 5JYOA 2ZC6B 1W79A 2XD1A 1PI4A 4LV0A 1K55C 3NDEA 4QB8A 5FQJA 2FFFB 4P0MA 4M3KA 4E3NA 3LY3A 3ZG8B 4ID4A 3EQVA 4OPYA 3UPNA 2XK1A 5EVIC 2ZQDA 3GQZA 2QZ6A 3M6BA 3UE0A 1I2SA 4GNUA 3V50A 3IXHA 2A3UA 4GN2A 5CTMA 1H5XA 1E3UD 1L2SA 5EOEA 1IYSA 5GLDA 2R9XA 5TGFA 3ZVWA 1JWPA 1PZPA 4ZJ2A 4E6XA 3SS3A 4NETA 3HLDA 4WYYA 2XGNA 2J7VA 2I72A 3MKEA 4S2JA 5GLCA 1KGEA 5FI2A 1ES5A 2HDSA 2IWBA 3S1YA 3FZCA 4K91A 3CG5A 3ZG0A 4IEDA 3Q1FA 3GRJA 3ISGA 2V20A 5GLBA 1ES3A 2ZQAA 3C4PA 4BD0A 5HARA 3ZG5A 1N4OA 4N1HA 2Y2JA 2PU2A 3E2KA 4JF4A 3VOZA 2ZC4B 2PU4A 1LL5A 1ZG4A 1BUEA 3NDGA 3PAEA 4WEKA 2P74A 3MXRA 2Y2GA 2OSUA 1MWUA 3HUMA 4LENA 1GHPA 2OV5A 4O7DA 3WS4A 4DE2A 5E43A 1ZKJA 1BZAA 1SKFA 1L0FA 4YINA 3OPRA 4OVDA 2XQZA 3P98A 4LCMA 4JXVA 4R23A 2WGIA 2QPNA 4DF6A 2VGKA 5CRFA 5CHJA 4JLFA 4E3IA 3DTMA 3IXDA 4B88A 1L0DA 3WS5A 4JKTA 1DY6A 1NYMA 1MWRA 4L0LA 3HVFA 3G4PA 1YLPA 3OPPA 3ZCZA 5HFOA 3ZGAB 3M2JA 1K6RA 1CK3A 1LL9A 3BYDA 4S2IA 2IWDA 4PM5A 2HP6A 2QMIA 1YM1A 4IBXA 4KZAA 3W4QA 4PM8A 1MPLA 4HESA 4OQIA 4DDYA 1Q2QA 1K57A 3QHYA 1PYYA 2XF3A 4Q8IA 4DE1A 2EX6A 2Y2IA 3I7JA 1XPBA 4C6YA 4EBPA 3VFHA 4HEFA 3W8KA 2Q9MA 2Y2OA 2V1ZA 3IQAA 5A90A 4S2PA 5AQ7A 3UDFA 1ZG6A 1IYOA 1FOFA 4PM6A 5TR7A 3V5MA 1ES2A 1NJ4A 1RGYA 3MZEA 5HAPA 3G30A 3GSGA 1K54C 3BFDA 4UHUA 5KMWA 3PBQA 3HUOA 3OC2A 3N4IA 3SOIA 5CXWA 3UPOA 2Q9NA 1BTLA 3V3SA 4S2NC 2A49A 3OPLA 1ERMA 1KVLA 5M18A 1PIOA 3IH9A 4KG6A 1S6RA 3N6IA 4P6BA 3N8SA 4BL2A 4B4ZA 4C3QA 2WYXA 4OOYA 4KG2A 5AQ9A 1XX2A 3B3XA 1YLJA 5GHYA 2ZQCA 4GD8A 3ZG9B 3GR2A 3IWIA 4LV2A 4OOLA 4BENA 4U3TA 3D4FA 4YFMA 3MXSA 1PZOA 2R9WA 3IF5A 3AGFA 5F1FA 1QMFA 3IXBA 1IKIA 5G18A 2RCXA 2C6WB 3Q81A 3E2LA 2P9VA 2BLSA 3WRZA 3VP1A 4FSFA 3DW0A 4CPKA 3MFDA 4K0XA 5DVAA 3NIAA 4R1GA 3UN7A 1K25A 3WWXA 3SH7A 4C75A 4P87A 1PWGA 3PTEA 1S0WA 1XKZA 2WKEA 1K56A 1MXOA 2X02A 1CEFA 5E2GA 1JTGA 2V2FF 3IWQA 4KENB 1KVMA 3LEZA 1TDLA 5EUAA 1I5QA 3UNWA 4WZ5C 1I2WA 1YLYA 4KZ5A 1N9BA 1M6KA 1JVJA 2H0YA 3IF6A 4D2OA 1XA7A 2EXBA 2H10A 2XLNA 4BD1A 4F94A 1HD8A 3SS4A 4LV3A 1PWCA 1TEMA 4GDNA 3G32A 5D3OA 1KE4A 4E3OA 5FAOA 3S22A 1G6AA 2Y55A 3IH8A 2HDUA 1TVFA 5EVID 4S2KA 3TOIA 2Y2PA 3C4OA 3HLBA 3W4PA 3M2KA 5HW3A 1SDEA 3FWLA 5FI6A 1BSGA 1GA0A 1CEGA 4NK3A 1VQQA 3OZHA 4GZBA 3VP3A 4ZDXA 4RX2A 2X71A 4KZ9A 1FCOA 1M40A 4QD4A 1AXBA 2XDMA 2XFSA 4A5RA 5HX9A 4QY6A 4ZTKA 3VFFA 3AGDA 4HBUA 3NI9A 1FR6A 5CERA 4GDBA 2EX9A 1EROA 3EQUA 1KE0A 3Q7VA 3HUNA 5GHXA 5CHMA 5E2EA 3M6HA 4KZ6A 2EX8A 5DF9A 2J8YA 3HLCA 5JYPA 5CEBA 1W5DA 1ERQA 3IT9A 2RL3A 4BL3A 3WS1A 4N9LA 3HLGA 5CGSA 1WYBA 2DCFA 1JWZA 1RP5A 4Y0OA 2WK0A 1L0EA 4Y0TA 3A3IA 3OPHA 4WZ4A 3CZDA 3LO7A 1HVBA 3PBRA 4X68A 1VM1A 2ZM8A 1IELA 2VGJA 4KQOA 1NZUA 3GVBA 5CECA 3PBSA 3VOYA 4OQHA 4LV1A 3HLFA 5EOOA 3NCKA 3NBLA 4KZ4A 1YLZA 1FSWA 1YMXA 1YQSA 1HTZA 1FCNA 1BLPA 3MZFA 1BULA 5U47A 2HP5A 5FI7A 4UA6A 1MWSA 3UY6A 3O86A 3ZDJA 1YLWA 4DE0A 4QJGA 4R4RA 2Y2HA 4MEZA 3A3JA 4DDSA 4JF6A 4WEJA 4N1XA 4PM7A 2ZQ8A 1H8ZA 1K55A 1XGJA 1K38A 1E3UA 5FQKA 4KZ7A 3UE1A 4BLMA 4R3BA 3RXWA 2XH9A 2PBYA 5EVIA 1RCJA 5KZHA 4U0XA 2C5WB 4MNRA 4E3JA 3AGEA 5M19A 3GTCA 4JXWA 4HBTA 1C3BA 2WAFA 2WGWA 1ONGA 4ZJ1A 3HBRA 1K4EA 1FSYA 3G35A 3G34A 1SDNA 1U60A 4RYEA 2JBFA 3HREA 5DTTA 3FV7A 2HP9A 3N8RA 2HPBA 2WZXA 4XUXA 1HZOA 2H5SA 3TG9A 2Y4AA 1NXYA 2FFYA 2ZC3B 5FATA 5GLAA 2ZD8A 3JYIA 2XD5A 1NY0A 2ZLYA 3QNCA 2WZZA 5EE8A 3N7WA 1GA9A 4JBFA 4OQ0A 1E25A 3MKFA 5AQAA 1PW8A 3CMZA 3Q07A 4E6WA 3IXGA 4R0QA 4RVAA 3VP2A 3G31A 4DXCA 2Y91A 2Z2MB 3OCLA 3UPPA 1BT5A 1LHYA 1KDSA 2Y59A 2DNSA 4GB7A 1W8YA 1LI0A 3PBNA 1ALQA 4P85A 5DF8A 2WKIA 5KSCA 1FQGA 5FDHA 3ZNTA 1IKGA 2CC1A 1KGFA 4EBNA 3IWOA 5IHVA 5M1AA 1GHIA 4QU3A 1DJBA 2ZMAA 4OLDA 4GD6A 2EXAA 1KDWA 4BJPA 5DTSA 3WRTA 1FR1A 3ITAA 2XEPA 1SHVA 5FAPA 3V3RA 1YT4A 1WYCA 1NZOA 1K57C 3HLEA 3PBTA 4CJNA 5FQIA 5J8XA 4PM9A 3Q7ZA 1PI5A 3SS5A 3BFFA 4KQQA 3UDIA 2OLVA 4FH4A 1XP4A 4KQRA 1EWZA 3GV9A 4X69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KG5 A;  4E3K A;  4S2O A;  3IHB A;  4B4X A;  3VSK A;  4XXR A;  5L2F A;  5AQB A;  1MWT A;  2ZM2 A;  2JCH A;  4OPR A;  4GKU A;  3VP4 A;  1FCM A;  2GDN A;  5F1G A;  1YLT A;  1K54 A;  2EFX A;  3BFG A;  3UO9 A;  2UWX A;  1Z6F A;  4KZ3 A;  3O87 A;  1L0G A;  3PBO A;  2OLU A;  4MLL A;  4R3J A;  1RGZ A;  4S2N A;  4UAA A;  3RXX A;  1DJC A;  4Y7P A;  3ZG7 B;  1MBL A;  3ZVT A;  5HL1 A;  4X56 A;  3HL9 A;  3TSG A;  3MZD A;  3GMW A;  1CI9 A;  1EI5 A;  2Y2Q A;  4R4S A;  1K6S A;  3O3V A;  1JTD A;  3BEB A;  3SH9 A;  4IVK A;  5CHU A;  3BLS A;  2P9V B;  2XFT A;  4RA7 A;  1Q2P A;  1SCW A;  3FKW A;  3WS0 A;  1JWV A;  2ZQ7 A;  4K0W A;  4FCF A;  2WAD A;  4XUZ A;  2BG1 A;  5CGW A;  1ES4 A;  4WBG A;  2JE5 A;  3IHA A;  2XR0 A;  4DE3 A;  3NC8 A;  3W4O A;  2HDR A;  5EEC A;  2WAE A;  1KE3 A;  2ZC7 A;  1KGG A;  2Z2L B;  1IYQ A;  4QY5 A;  4N9K A;  4X6T A;  3DWZ A;  1CI8 A;  4ZBE A;  3IF6 B;  1MKI A;  1NYY A;  1LLB A;  2EX2 A;  4E3M A;  4ZJ3 A;  4E3L A;  5I94 A;  3NY4 A;  4OP8 A;  5FQM A;  5E2F A;  4FD8 A;  2E8I A;  4DXB A;  2J9O A;  1WE4 A;  1GHM A;  3V39 A;  3PAG A;  1E4D A;  1ZC2 A;  1BLC A;  4Z9Q A;  5FAS A;  1PW1 A;  3Q82 A;  3UDX A;  4DKI A;  4H8R A;  4QHC A;  5GHZ A;  1K56 D;  4EUZ A;  4WMC D;  4WZ5 A;  5FSR A;  1PWD A;  3IF6 C;  4MBK A;  4EBL A;  3WS2 A;  1K4F A;  4UA9 A;  2Y2N A;  3VMA A;  2J9P A;  2WGV A;  4JXS A;  2ZJ9 A;  3O88 A;  4MBF A;  3RJU A;  1XA1 A;  4WEL A;  1ESU A;  1J9M A;  1BLH A;  3G2Y A;  3FKV A;  4ZAM A;  4OP5 A;  5F83 A;  4DRT A;  4BQM A;  4OKP A;  4IBR A;  5FAQ A;  5CGX A;  4FH2 A;  4OPZ A;  5HAI A;  3VSL A;  3Q7V B;  3SH8 A;  5HAQ A;  5KSH A;  1ESI A;  3A3F A;  1W7F A;  4IVI A;  4Y0U A;  5F82 A;  3BM6 A;  4OQG A;  4OLG A;  2HDQ A;  3VP0 A;  3LY4 A;  3ITB A;  3N8L A;  2Y2K A;  1O07 A;  2ZC5 B;  4PMA A;  5E2H A;  5A91 A;  2ZQ9 A;  3C7U A;  2JC7 A;  3OCN A;  5EVL A;  1O7E A;  4EV4 A;  1Y54 A;  4JF5 A;  3UE3 A;  4KZ8 A;  3BEC A;  3LCE A;  5FQ9 A;  3S4X A;  3C5A A;  2Y2M A;  2DRW A;  4OON A;  4KZB A;  5FA7 A;  1GCE A;  1H8Y A;  4N92 A;  4OPQ A;  2WKH A;  2WUQ A;  2G2W A;  4OOM A;  1OME A;  2EFU A;  4MBH A;  3HLW A;  5FQQ A;  4RX3 A;  4OH0 A;  3G2Z A;  3C7V A;  4LCL A;  3CJM A;  1XXM A;  4X53 A;  4EWF A;  4S2L A;  3P09 A;  4JPM A;  5A92 A;  5CED A;  3ZNY A;  4S2M A;  1ONH A;  5BOH A;  1G68 A;  1MY8 A;  1XGI A;  4GOG A;  4PPR A;  2X01 A;  3BFC A;  1W8Q A;  1IYP A;  2ZM0 A;  3MBZ A;  3A3D A;  1IEM A;  5GL9 A;  3ZHH A;  2B5R A;  2G2U A;  2H0T A;  1BLS A;  5A93 A;  2IWC A;  4JXG A;  3QNB A;  5EPH A;  5DF7 A;  2Y2L A;  5EVI B;  3BLM A;  5TFQ A;  4U0T A;  4X55 A;  1TDG A;  1QME A;  3BRM A;  4WMC A;  3DWK A;  1NRF A;  3ZFZ A;  4WM9 A;  3A3E A;  1LI9 A;  4UA7 A;  5CTN A;  2WGW B;  1DJA A;  1YMS A;  3BFE A;  3FYZ A;  5DTK A;  4EQI A;  5JYO A;  2ZC6 B;  1W79 A;  2XD1 A;  1PI4 A;  4LV0 A;  1K55 C;  3NDE A;  4QB8 A;  5FQJ A;  2FFF B;  4P0M A;  4M3K A;  4E3N A;  3LY3 A;  3ZG8 B;  4ID4 A;  3EQV A;  4OPY A;  3UPN A;  2XK1 A;  5EVI C;  2ZQD A;  3GQZ A;  2QZ6 A;  3M6B A;  3UE0 A;  1I2S A;  4GNU A;  3V50 A;  3IXH A;  2A3U A;  4GN2 A;  5CTM A;  1H5X A;  1E3U D;  1L2S A;  5EOE A;  1IYS A;  5GLD A;  2R9X A;  5TGF A;  3ZVW A;  1JWP A;  1PZP A;  4ZJ2 A;  4E6X A;  3SS3 A;  4NET A;  3HLD A;  4WYY A;  2XGN A;  2J7V A;  2I72 A;  3MKE A;  4S2J A;  5GLC A;  1KGE A;  5FI2 A;  1ES5 A;  2HDS A;  2IWB A;  3S1Y A;  3FZC A;  4K91 A;  3CG5 A;  3ZG0 A;  4IED A;  3Q1F A;  3GRJ A;  3ISG A;  2V20 A;  5GLB A;  1ES3 A;  2ZQA A;  3C4P A;  4BD0 A;  5HAR A;  3ZG5 A;  1N4O A;  4N1H A;  2Y2J A;  2PU2 A;  3E2K A;  4JF4 A;  3VOZ A;  2ZC4 B;  2PU4 A;  1LL5 A;  1ZG4 A;  1BUE A;  3NDG A;  3PAE A;  4WEK A;  2P74 A;  3MXR A;  2Y2G A;  2OSU A;  1MWU A;  3HUM A;  4LEN A;  1GHP A;  2OV5 A;  4O7D A;  3WS4 A;  4DE2 A;  5E43 A;  1ZKJ A;  1BZA A;  1SKF A;  1L0F A;  4YIN A;  3OPR A;  4OVD A;  2XQZ A;  3P98 A;  4LCM A;  4JXV A;  4R23 A;  2WGI A;  2QPN A;  4DF6 A;  2VGK A;  5CRF A;  5CHJ A;  4JLF A;  4E3I A;  3DTM A;  3IXD A;  4B88 A;  1L0D A;  3WS5 A;  4JKT A;  1DY6 A;  1NYM A;  1MWR A;  4L0L A;  3HVF A;  3G4P A;  1YLP A;  3OPP A;  3ZCZ A;  5HFO A;  3ZGA B;  3M2J A;  1K6R A;  1CK3 A;  1LL9 A;  3BYD A;  4S2I A;  2IWD A;  4PM5 A;  2HP6 A;  2QMI A;  1YM1 A;  4IBX A;  4KZA A;  3W4Q A;  4PM8 A;  1MPL A;  4HES A;  4OQI A;  4DDY A;  1Q2Q A;  1K57 A;  3QHY A;  1PYY A;  2XF3 A;  4Q8I A;  4DE1 A;  2EX6 A;  2Y2I A;  3I7J A;  1XPB A;  4C6Y A;  4EBP A;  3VFH A;  4HEF A;  3W8K A;  2Q9M A;  2Y2O A;  2V1Z A;  3IQA A;  5A90 A;  4S2P A;  5AQ7 A;  3UDF A;  1ZG6 A;  1IYO A;  1FOF A;  4PM6 A;  5TR7 A;  3V5M A;  1ES2 A;  1NJ4 A;  1RGY A;  3MZE A;  5HAP A;  3G30 A;  3GSG A;  1K54 C;  3BFD A;  4UHU A;  5KMW A;  3PBQ A;  3HUO A;  3OC2 A;  3N4I A;  3SOI A;  5CXW A;  3UPO A;  2Q9N A;  1BTL A;  3V3S A;  4S2N C;  2A49 A;  3OPL A;  1ERM A;  1KVL A;  5M18 A;  1PIO A;  3IH9 A;  4KG6 A;  1S6R A;  3N6I A;  4P6B A;  3N8S A;  4BL2 A;  4B4Z A;  4C3Q A;  2WYX A;  4OOY A;  4KG2 A;  5AQ9 A;  1XX2 A;  3B3X A;  1YLJ A;  5GHY A;  2ZQC A;  4GD8 A;  3ZG9 B;  3GR2 A;  3IWI A;  4LV2 A;  4OOL A;  4BEN A;  4U3T A;  3D4F A;  4YFM A;  3MXS A;  1PZO A;  2R9W A;  3IF5 A;  3AGF A;  5F1F A;  1QMF A;  3IXB A;  1IKI A;  5G18 A;  2RCX A;  2C6W B;  3Q81 A;  3E2L A;  2P9V A;  2BLS A;  3WRZ A;  3VP1 A;  4FSF A;  3DW0 A;  4CPK A;  3MFD A;  4K0X A;  5DVA A;  3NIA A;  4R1G A;  3UN7 A;  1K25 A;  3WWX A;  3SH7 A;  4C75 A;  4P87 A;  1PWG A;  3PTE A;  1S0W A;  1XKZ A;  2WKE A;  1K56 A;  1MXO A;  2X02 A;  1CEF A;  5E2G A;  1JTG A;  2V2F F;  3IWQ A;  4KEN B;  1KVM A;  3LEZ A;  1TDL A;  5EUA A;  1I5Q A;  3UNW A;  4WZ5 C;  1I2W A;  1YLY A;  4KZ5 A;  1N9B A;  1M6K A;  1JVJ A;  2H0Y A;  3IF6 A;  4D2O A;  1XA7 A;  2EXB A;  2H10 A;  2XLN A;  4BD1 A;  4F94 A;  1HD8 A;  3SS4 A;  4LV3 A;  1PWC A;  1TEM A;  4GDN A;  3G32 A;  5D3O A;  1KE4 A;  4E3O A;  5FAO A;  3S22 A;  1G6A A;  2Y55 A;  3IH8 A;  2HDU A;  1TVF A;  5EVI D;  4S2K A;  3TOI A;  2Y2P A;  3C4O A;  3HLB A;  3W4P A;  3M2K A;  5HW3 A;  1SDE A;  3FWL A;  5FI6 A;  1BSG A;  1GA0 A;  1CEG A;  4NK3 A;  1VQQ A;  3OZH A;  4GZB A;  3VP3 A;  4ZDX A;  4RX2 A;  2X71 A;  4KZ9 A;  1FCO A;  1M40 A;  4QD4 A;  1AXB A;  2XDM A;  2XFS A;  4A5R A;  5HX9 A;  4QY6 A;  4ZTK A;  3VFF A;  3AGD A;  4HBU A;  3NI9 A;  1FR6 A;  5CER A;  4GDB A;  2EX9 A;  1ERO A;  3EQU A;  1KE0 A;  3Q7V A;  3HUN A;  5GHX A;  5CHM A;  5E2E A;  3M6H A;  4KZ6 A;  2EX8 A;  5DF9 A;  2J8Y A;  3HLC A;  5JYP A;  5CEB A;  1W5D A;  1ERQ A;  3IT9 A;  2RL3 A;  4BL3 A;  3WS1 A;  4N9L A;  3HLG A;  5CGS A;  1WYB A;  2DCF A;  1JWZ A;  1RP5 A;  4Y0O A;  2WK0 A;  1L0E A;  4Y0T A;  3A3I A;  3OPH A;  4WZ4 A;  3CZD A;  3LO7 A;  1HVB A;  3PBR A;  4X68 A;  1VM1 A;  2ZM8 A;  1IEL A;  2VGJ A;  4KQO A;  1NZU A;  3GVB A;  5CEC A;  3PBS A;  3VOY A;  4OQH A;  4LV1 A;  3HLF A;  5EOO A;  3NCK A;  3NBL A;  4KZ4 A;  1YLZ A;  1FSW A;  1YMX A;  1YQS A;  1HTZ A;  1FCN A;  1BLP A;  3MZF A;  1BUL A;  5U47 A;  2HP5 A;  5FI7 A;  4UA6 A;  1MWS A;  3UY6 A;  3O86 A;  3ZDJ A;  1YLW A;  4DE0 A;  4QJG A;  4R4R A;  2Y2H A;  4MEZ A;  3A3J A;  4DDS A;  4JF6 A;  4WEJ A;  4N1X A;  4PM7 A;  2ZQ8 A;  1H8Z A;  1K55 A;  1XGJ A;  1K38 A;  1E3U A;  5FQK A;  4KZ7 A;  3UE1 A;  4BLM A;  4R3B A;  3RXW A;  2XH9 A;  2PBY A;  5EVI A;  1RCJ A;  5KZH A;  4U0X A;  2C5W B;  4MNR A;  4E3J A;  3AGE A;  5M19 A;  3GTC A;  4JXW A;  4HBT A;  1C3B A;  2WAF A;  2WGW A;  1ONG A;  4ZJ1 A;  3HBR A;  1K4E A;  1FSY A;  3G35 A;  3G34 A;  1SDN A;  1U60 A;  4RYE A;  2JBF A;  3HRE A;  5DTT A;  3FV7 A;  2HP9 A;  3N8R A;  2HPB A;  2WZX A;  4XUX A;  1HZO A;  2H5S A;  3TG9 A;  2Y4A A;  1NXY A;  2FFY A;  2ZC3 B;  5FAT A;  5GLA A;  2ZD8 A;  3JYI A;  2XD5 A;  1NY0 A;  2ZLY A;  3QNC A;  2WZZ A;  5EE8 A;  3N7W A;  1GA9 A;  4JBF A;  4OQ0 A;  1E25 A;  3MKF A;  5AQA A;  1PW8 A;  3CMZ A;  3Q07 A;  4E6W A;  3IXG A;  4R0Q A;  4RVA A;  3VP2 A;  3G31 A;  4DXC A;  2Y91 A;  2Z2M B;  3OCL A;  3UPP A;  1BT5 A;  1LHY A;  1KDS A;  2Y59 A;  2DNS A;  4GB7 A;  1W8Y A;  1LI0 A;  3PBN A;  1ALQ A;  4P85 A;  5DF8 A;  2WKI A;  5KSC A;  1FQG A;  5FDH A;  3ZNT A;  1IKG A;  2CC1 A;  1KGF A;  4EBN A;  3IWO A;  5IHV A;  5M1A A;  1GHI A;  4QU3 A;  1DJB A;  2ZMA A;  4OLD A;  4GD6 A;  2EXA A;  1KDW A;  4BJP A;  5DTS A;  3WRT A;  1FR1 A;  3ITA A;  2XEP A;  1SHV A;  5FAP A;  3V3R A;  1YT4 A;  1WYC A;  1NZO A;  1K57 C;  3HLE A;  3PBT A;  4CJN A;  5FQI A;  5J8X A;  4PM9 A;  3Q7Z A;  1PI5 A;  3SS5 A;  3BFF A;  4KQQ A;  3UDI A;  2OLV A;  4FH4 A;  1XP4 A;  4KQR A;  1EWZ A;  3GV9 A;  4X69 A; 
#chains in the Genus database with same CATH topology
 1K0K A;  3VSK A;  4XXR A;  2JKF A;  1MWT A;  1FCM A;  5HDC A;  5F1G A;  1Z6F A;  5FEG A;  1L0G A;  3H82 B;  3PBO A;  1RGZ A;  4S2N A;  1ZHH B;  2JKR M;  5A8B A;  3O3V A;  3BEB A;  4ARZ A;  3JVU A;  3QP6 A;  4NXF A;  4RA7 A;  2NUP C;  1S67 L;  3E4Q A;  3LI9 A;  4YWZ A;  2BG1 A;  1ES4 A;  2PR5 A;  3BWL A;  2JKR I;  2XR0 A;  3GEC A;  2Z6D A;  3W4O A;  1XJ4 A;  5EEC A;  2ZC7 A;  1KGG A;  4QY5 A;  4JGO A;  4EQ1 A;  4KUO A;  4ZJ3 A;  4E3L A;  1NLY A;  1UGU A;  3NY4 A;  3TJZ C;  4OP8 A;  2A24 A;  4Z9Q A;  1OT6 A;  1PW1 A;  1T1A A;  2PYR A;  4QHC A;  4WMC D;  5TBM A;  5FSR A;  5F68 A;  3IF6 C;  3WS2 A;  1VET B;  2Y2N A;  2J9P A;  3RJU A;  1T1B A;  4LRZ E;  1XA1 A;  4WEL A;  1ESU A;  3T50 A;  4BQM A;  5IU1 A;  3UB7 A;  3CPT A;  5HAI A;  2IA2 A;  3SH8 A;  5KSH A;  1ESI A;  3MMH A;  4NG2 A;  5F82 A;  3BM6 A;  3D9Y A;  2HDQ A;  3N8L A;  5A91 A;  1F5M A;  4KZ8 A;  5EV0 A;  3S4X A;  1F9I A;  2Y2M A;  2CMN A;  4OON A;  5FA7 A;  1GCE A;  4LGW A;  5G4Y A;  1OME A;  5HZH A;  5DJU A;  3C7V A;  3CJM A;  4X53 A;  3LIF A;  4S2L A;  3F1O A;  1DP8 A;  2X01 A;  3ZHH A;  2BTF P;  2H0T A;  5DJT A;  2IWC A;  4JXG A;  4U0T A;  3BRM A;  3DWK A;  5DFX A;  3A3E A;  2YKH A;  3MQO A;  3BQ8 A;  4EQI A;  3BFE A;  3FYZ A;  5DTK A;  3P7N A;  4BBU A;  1V9Y A;  1CQA A;  4IUH A;  5FQJ A;  4P0M A;  4E3N A;  2XK1 A;  5EVI C;  4JGQ A;  2QZ6 A;  2Z6C A;  3M6B A;  3UE0 A;  3V50 A;  5GLD A;  3LIA A;  1E3U D;  2R9X A;  5TGF A;  1PZP A;  4ZJ2 A;  2XGN A;  2I72 A;  1KGE A;  5FI2 A;  1ES5 A;  2HDS A;  3CG5 A;  2UV0 E;  2V20 A;  2PD8 A;  4BD0 A;  3C4P A;  4N1H A;  4M4X A;  2Y2J A;  4JF4 A;  1LL5 A;  3NDG A;  4G3V A;  4WEK A;  2P74 A;  2Y2G A;  3SW1 A;  1BZA A;  4OVD A;  2XQZ A;  4HY8 A;  4LCM A;  4JXV A;  2WGI A;  2NUT C;  4JGR A;  5CHJ A;  3DTM A;  1L0D A;  3QP2 A;  4DJ3 A;  4CLC B;  3HVF A;  2W0N A;  1OJ5 A;  1YLP A;  1D06 A;  5HFO A;  3ZGA B;  1K6R A;  3GDI A;  3BYD A;  3C30 A;  2IWD A;  4PM5 A;  1IFQ A;  2HP6 A;  1CJF A;  2QMI A;  4IBX A;  4KZA A;  4OQI A;  1FIL A;  4MDZ A;  1X0O A;  1WA9 A;  4Q8I A;  1G6O A;  4DE1 A;  2Y2I A;  5I5L A;  4C6Y A;  3VFH A;  4HEF A;  3MS6 A;  2V1Z A;  2XA7 S;  3UDF A;  3PYP A;  4PM6 A;  1NJ4 A;  5HAP A;  3T4O A;  3GSG A;  4UHU A;  3PBQ A;  5CXW A;  2Q9N A;  4MMN A;  4S2N C;  4NXB A;  2YKF A;  4NXE A;  3NUL A;  3E0Y A;  3D72 A;  1S6R A;  3N6I A;  1H3Q A;  4O0P A;  4C3Q A;  4FUW A;  5AQ9 A;  3H82 A;  3B3X A;  4LLO B;  3CWF A;  4LV2 A;  5DFY A;  4O01 A;  2R9W A;  1LSX A;  3IXB A;  1AWI A;  1IKI A;  5G18 A;  2C6W B;  3Q81 A;  1STZ A;  1UWP X;  2GJ3 A;  4HJ3 A;  4EET B;  1T1C A;  3DTK A;  1S66 L;  3T1R A;  1PWG A;  1MXO A;  3H9W A;  2X02 A;  2LB9 A;  4L9E A;  2V2F F;  1OTB A;  1KVM A;  3RTY A;  3NEC A;  2K2N A;  3UNW A;  1YLY A;  2ZOI A;  3LIB A;  2H0Y A;  1XA7 A;  2EXB A;  4X25 A;  4F94 A;  4LV3 A;  1PWC A;  4LPZ A;  5FL3 A;  2G7U A;  3IH8 A;  5EVI D;  2B02 A;  4S2K A;  3TOI A;  2KOI A;  3W4P A;  3M2K A;  1A0K A;  3UB8 A;  2JKT M;  1VET A;  4RX2 A;  3ZYT A;  1AXB A;  3VV4 A;  4MCW A;  1IOU A;  4GDB A;  2EX9 A;  1ERO A;  2JKT I;  3EQU A;  1KE0 A;  3HUN A;  5GHX A;  4BMW A;  3M6H A;  4KZ6 A;  2EX8 A;  5DF9 A;  4DN0 A;  3HLC A;  1W5D A;  4BL3 A;  5L10 A;  3TE8 A;  3T4J A;  1WYB A;  1P9W A;  1L0E A;  3A3I A;  3OPH A;  2M7V A;  1VM1 A;  2ZM8 A;  1IEL A;  1NZU A;  3GVB A;  2KX6 A;  4Y13 A;  3HJK A;  4KZ4 A;  4LFU A;  1YMX A;  1BUL A;  4CLC E;  4ETX A;  3F1N B;  4GHI B;  2Y2H A;  4MEZ A;  4UQI S;  4JF6 A;  1H8Z A;  2P7J A;  3ULF A;  1E3U A;  5FQK A;  4KZ7 A;  3O5Y A;  1RCJ A;  2QYB A;  3BW6 A;  4MNR A;  1G28 A;  3CHW P;  3CI6 A;  1K4E A;  3G34 A;  3KSI A;  4RYE A;  4HIA A;  2JBF A;  2L1M A;  3FPV A;  2FH5 A;  2JN7 A;  3N8R A;  2HPB A;  2WZX A;  4XUX A;  3NHQ A;  1S1Z A;  2H5S A;  2ZC3 B;  5GLA A;  3JYI A;  3QNC A;  3A0S A;  3MKF A;  1PW8 A;  4P6Z S;  3IXG A;  3MFX A;  3VP2 A;  2Z2M B;  3UPP A;  1LHY A;  2DNS A;  2W3F A;  5EVE A;  1W8Y A;  1LI0 A;  3PBN A;  1ALQ A;  5KSC A;  5AVF A;  2CC1 A;  2HV1 A;  3WRT A;  1FR1 A;  1NRJ A;  1SHV A;  1WYC A;  3HLE A;  5HD5 A;  4F3L B;  4CLC A;  3SS5 A;  3UDI A;  3UB6 A;  4X1L A;  1XJ6 A;  4WN5 A;  1XP4 A;  3BY8 A;  4X69 A;  4KG5 A;  4S2O A;  5L2F A;  2AVX A;  2V8F A;  2I9V A;  2W3D A;  2ZM2 A;  3VP4 A;  4OPR A;  1YLT A;  1K54 A;  3BFG A;  1Z09 A;  4R3J A;  3L7H A;  3RXX A;  2PD7 A;  4Y7P A;  1MBL A;  4AFI A;  4X56 A;  1TS7 A;  1Y28 A;  1CI9 A;  4EES A;  1K6S A;  3SH9 A;  3IBJ A;  3BLS A;  3QP4 A;  4I5S A;  2ZQ7 A;  4K0W A;  4FCF A;  2J3T D;  3IHA A;  5HWT A;  5FDS A;  3W2Z A;  1KE3 A;  4Y15 A;  2PR6 A;  4B93 A;  4E3M A;  1ODV A;  5FQM A;  5E2F A;  4FD8 A;  2J9O A;  4Y5F A;  1ZC2 A;  4DKI A;  5GHZ A;  1K56 D;  3K3D A;  1YSP A;  1LSV A;  2O99 A;  3LYX A;  2WGV A;  4JXS A;  2ZJ9 A;  4YOF A;  1OJG A;  1BLH A;  3G2Y A;  1YAX A;  4OKP A;  3HJI A;  1VEU B;  4IBR A;  4FH2 A;  4OPZ A;  3VSL A;  3Q7V B;  5EM0 A;  1W7F A;  4OQG A;  3VP0 A;  3LY4 A;  2LB5 A;  3L9K A;  3UE3 A;  5FQ9 A;  2DRW A;  2INW A;  4KZB A;  1H8Y A;  4N92 A;  2WUQ A;  2EFU A;  5FQQ A;  4RX3 A;  4LCL A;  3P09 A;  4JPM A;  5A92 A;  5CED A;  1GSX A;  4HOI A;  1ONH A;  4S2M A;  1JNU A;  1G68 A;  4PPR A;  3BFC A;  2ZM0 A;  3MBZ A;  2WKQ A;  2B5R A;  5A93 A;  2PBD P;  4R3A A;  1QME A;  1NRF A;  3C2W A;  3A0V A;  3R4K A;  4MN7 A;  1W79 A;  4QB8 A;  2HGV A;  4OPY A;  3F1N A;  5CTM A;  4GHI A;  1H5X A;  1L2S A;  3LI8 A;  1IYS A;  1JWP A;  5HD3 A;  3HLD A;  2J7V A;  5L09 A;  4XT2 B;  3S1Y A;  4PKY A;  4K91 A;  4EW7 A;  5DKK A;  3ISG A;  5GLB A;  1YKD A;  3MF0 A;  2ZQA A;  3ZG5 A;  2PU2 A;  3E2K A;  3PAE A;  1ZG4 A;  4G3W A;  1LT0 A;  2OV5 A;  2VKS A;  1L0F A;  4R23 A;  2QPN A;  2VGK A;  2FZ0 A;  5L8M A;  3QP8 A;  4HP9 A;  4B88 A;  3WS5 A;  4JKT A;  4L0L A;  3OPP A;  2W27 A;  1H0M A;  1CK3 A;  4QPR A;  5HDD A;  1YM1 A;  1MPL A;  4HES A;  2EWW A;  1K57 A;  3QHY A;  1PYY A;  2XF3 A;  3I7J A;  2OAP 1;  3H7W B;  3LID A;  4Q0H A;  2Y2O A;  1ZG6 A;  2V8C A;  1FOF A;  5F6A A;  5CX7 A;  2OWH A;  2ZL1 B;  1K54 C;  3V3S A;  3B42 A;  1KVL A;  5IS1 A;  5M18 A;  4ZRR A;  4KG2 A;  2PHY A;  1XX2 A;  5GHY A;  3ZG9 B;  3GR2 A;  3IWI A;  1OT9 A;  4BEN A;  3G6O A;  4U3T A;  3D4F A;  4BWI A;  4K08 A;  1QMF A;  1PNE A;  2ZMF A;  2RCX A;  3F1P A;  3E2L A;  1N9N A;  2BLS A;  4FSF A;  3DW0 A;  2DMW A;  5DVA A;  1VB6 A;  3A0R A;  4R1G A;  2QHK A;  1K25 A;  1HLU P;  4P87 A;  1K56 A;  1LL8 A;  4DJ2 A;  5E2G A;  1JTG A;  1OPX A;  3IWQ A;  2ACG A;  1TDL A;  1I5Q A;  1MC0 A;  1N9B A;  4D2O A;  1P97 A;  2V1A A;  3G32 A;  1G5U A;  5FAO A;  1G6A A;  2Y55 A;  1TVF A;  2V9A A;  2GX5 A;  3HLB A;  1SDE A;  3FWL A;  3E98 A;  4NK3 A;  1VQQ A;  4GZB A;  3VP3 A;  2X71 A;  4KZ9 A;  1M40 A;  2O9B A;  2XDM A;  2XFS A;  3NJA A;  3AGD A;  2QKP A;  4HBU A;  1VEU A;  2VA0 A;  5FEF A;  3Q7V A;  3FG8 A;  5E2E A;  2OOL A;  2BAS A;  5JYP A;  3VE3 A;  3UE6 A;  3UB5 P;  3WS1 A;  5CGS A;  2DCF A;  4Y0O A;  1HVB A;  1DP9 A;  4X68 A;  4KQO A;  2VZW A;  5CEC A;  3VOY A;  4NEE D;  3HLF A;  3NCK A;  2MJ6 A;  3NBL A;  1FSW A;  2Y8H A;  3MQQ A;  1HTZ A;  1F98 A;  2HP5 A;  5HPF A;  4HNB A;  3O86 A;  2VV8 A;  4DE0 A;  4QJG A;  4R4R A;  4CLC D;  4N1X A;  2VGL S;  4HH2 A;  1K55 A;  1XGJ A;  1VHM A;  1K38 A;  1D1J A;  2JHE A;  4E3J A;  3S7O A;  3TRC A;  3GTC A;  4JXW A;  4ZJ1 A;  3HBR A;  3IS2 B;  3T4L A;  4I38 A;  3VE4 A;  5FAT A;  2ZD8 A;  2XD5 A;  5EE8 A;  2ZLY A;  2WZZ A;  5AQA A;  1E25 A;  4XT2 A;  3MSH A;  3Q07 A;  4R0Q A;  3G31 A;  3BQA A;  5L07 A;  4BBV A;  1FQG A;  5FDH A;  1KGF A;  4B9O A;  4EBN A;  5IHV A;  1GHI A;  4QU3 A;  3ITA A;  1K57 C;  4CJN A;  5J8X A;  4PM9 A;  3B33 A;  3Q7Z A;  2OAQ 1;  1PI5 A;  2OLV A;  3DAV A;  3FC7 A;  4FH4 A;  1NLZ A;  4KQR A;  4UEY A;  1EWZ A;  3GV9 A;  4E3K A;  3LFV A;  3NOP C;  4B4X A;  4HJ4 A;  4IUK A;  5AQB A;  2KLI A;  4GKU A;  3VOL A;  2UWX A;  4KZ3 A;  4MLL A;  3T1X A;  4UAA A;  1DJC A;  3ZG7 B;  3ZVT A;  5HL1 A;  3TSG A;  1MZU A;  1EI5 A;  4I3A A;  3EGD C;  3OBF A;  4IVK A;  2ZL1 A;  2P9V B;  3UB9 A;  3LEQ A;  2J3T C;  1SCW A;  3WS0 A;  2WAD A;  3KSH A;  5CGW A;  3MJQ A;  2JE5 A;  2HDR A;  1OTE A;  2WAE A;  2B18 A;  2Z2L B;  4X6T A;  3S7P A;  4GCZ A;  3DWZ A;  1CI8 A;  4LRY C;  1MKI A;  3K3C A;  1NYY A;  3IBR A;  4Y2F A;  4DXB A;  1WE4 A;  4D60 A;  1E4D A;  1BLC A;  5LBR A;  3UDX A;  4H8R A;  4HJ6 A;  1PWD A;  4MBK A;  1T18 A;  1K4F A;  4UA9 A;  3VMA A;  4MBF A;  1CF0 A;  3IX4 A;  4PHT A;  3FKV A;  4ZAM A;  5F83 A;  4DRT A;  3PXP A;  5FAQ A;  5CGX A;  4GJ4 A;  3A3F A;  4IVI A;  4Y0U A;  3EEH A;  1O07 A;  2ZC5 B;  1TF1 A;  2XA7 M;  5E2H A;  3R7W B;  2ZQ9 A;  2JC7 A;  3OCN A;  3T1S A;  1Y54 A;  2VK3 A;  1PRQ A;  4EXO A;  4WL9 A;  3BJN A;  2G2W A;  4MBH A;  3G2Z A;  4EWF A;  2A24 B;  4HP4 A;  3ZNY A;  3QP1 A;  1DRM A;  3DTE A;  1XGI A;  4GOG A;  1W8Q A;  1GSW A;  1BLS A;  5TFQ A;  5EPH A;  5DF7 A;  3BLM A;  4KUK A;  4ESP A;  4X55 A;  3DTI A;  3ZFZ A;  4WM9 A;  2O9A A;  1LI9 A;  4UA7 A;  5CTN A;  4LV0 A;  4MN6 A;  1K55 C;  2FFF B;  5AJG A;  4M3K A;  2XRO A;  4ID4 A;  3EQV A;  3UPN A;  2ZQD A;  2W3E A;  4GNU A;  3IXH A;  2A3U A;  4GN2 A;  5EOE A;  3LR5 A;  4E6X A;  1T19 A;  3SS3 A;  3MR0 A;  3MKE A;  4S2J A;  5GLC A;  1TS0 A;  3B47 A;  4Z1W A;  5EM1 A;  1N9L A;  3U4L P;  1ES3 A;  2XSS A;  1N4O A;  3IS2 A;  2GZA A;  2ZC4 B;  1BUE A;  4DMZ A;  3MXR A;  1GHP A;  4DE2 A;  2P04 A;  4O7D A;  3WS4 A;  3F1O B;  3UMD A;  3EEA A;  3T4T A;  5MC7 A;  4HH3 A;  2W1T B;  4DF6 A;  5CRF A;  5IT5 A;  4E3I A;  1DY6 A;  3G4P A;  1DP6 A;  5J4E A;  3MXQ A;  5J3W A;  2OWJ A;  1LL9 A;  4PAU A;  3W4Q A;  4PM8 A;  1Q2Q A;  4R6L A;  1GSV A;  3V67 A;  2EX6 A;  4HHD A;  4EBP A;  2QJ7 A;  3W8K A;  5A90 A;  3LGO A;  5AQ7 A;  1IYO A;  3V5M A;  1ES2 A;  4I39 A;  3G30 A;  4G3K A;  5KMW A;  1XFQ A;  3OC2 A;  3UPO A;  2A49 A;  2D01 A;  4UQI M;  4GS9 B;  4KG6 A;  2WKP A;  4BL2 A;  3CUE A;  4B4Z A;  1YLJ A;  1SKO B;  4GD8 A;  4OOL A;  3CLO A;  4YFM A;  3IF5 A;  3LIE A;  2KDK A;  2P9V A;  3VP1 A;  2E8J A;  4CPK A;  3KSG A;  3S7Q A;  2JKG A;  2R78 A;  3KYE A;  3SH7 A;  3PTE A;  3EWK A;  1XKZ A;  2WKE A;  3LR3 A;  1CEF A;  4X1M A;  4P6Z M;  4KEN B;  3LEZ A;  5EUA A;  3P01 A;  4QWO A;  2VLG A;  4BD1 A;  1HD8 A;  4LRX C;  3SS4 A;  1TEM A;  4GDN A;  5D3O A;  1KE4 A;  4R70 A;  4E3O A;  3S22 A;  2Y2P A;  3C4O A;  5HW3 A;  3OZH A;  2HF6 A;  1ZTU A;  2O0Y A;  4QD4 A;  1FCO A;  4A5R A;  5HX9 A;  4HI4 A;  2K7S A;  3NI9 A;  1FR6 A;  2V0W A;  1S1Y A;  5EFW A;  2EWV A;  5CEB A;  2J3W A;  2RL3 A;  4Y17 A;  3KYQ A;  4N9L A;  2PT7 A;  3HLG A;  3R7W A;  1RP5 A;  2WK0 A;  4Y0T A;  4WZ4 A;  5AVE A;  3PBS A;  4OQH A;  5EOO A;  1YLZ A;  1YQS A;  1FCN A;  1BLP A;  3MZF A;  3T1Q B;  4UA6 A;  4CLC C;  2VV6 A;  1MWS A;  4E04 A;  1YLW A;  3KYZ A;  2ZQ8 A;  1TS6 A;  2PAV P;  3D3O A;  4BLM A;  4F3L A;  3RXW A;  1EW0 A;  2ZMV A;  5KZH A;  1YPR A;  4Y3I A;  4HBT A;  1C3B A;  2WAF A;  3E4O A;  2A2L A;  1FSY A;  4HQA A;  1SDN A;  3OLO A;  2XRN A;  3HRE A;  5DTT A;  3FV7 A;  2HP9 A;  1HZO A;  2Y4A A;  1NXY A;  2FFY A;  2Y79 A;  3N7W A;  5HWV A;  1GA9 A;  4OQ0 A;  3NOU C;  4L9G A;  4DXC A;  2VEA A;  3OCL A;  4FTX A;  4I3I A;  3KO6 A;  3LIC A;  4YNR A;  1MKM A;  3KX0 X;  2WKI A;  3ZNT A;  1IKG A;  5HPI A;  2ZMA A;  4OLD A;  2EXA A;  5DTS A;  3PHY A;  1XJ3 A;  2W1T A;  4IJG A;  1SZV A;  3PBT A;  5FQI A;  3EGX C;  3BY9 A;  1ACF A;  3IHB A;  2JCH A;  2GDN A;  2EFX A;  3UO9 A;  3O87 A;  2OLU A;  3HL9 A;  3MZD A;  3GMW A;  3RH8 B;  4PKY G;  2Y2Q A;  4R4S A;  1JTD A;  2ZBB A;  1D7E A;  5CHU A;  3CUE C;  2XFT A;  5HL6 A;  1Q2P A;  3FKW A;  1JWV A;  1H8M A;  5G4Z A;  4XUZ A;  4EUV A;  4WBG A;  1LSW A;  4GS9 A;  3LUQ A;  4DE3 A;  3NC8 A;  3ICY A;  4WUJ A;  5J7E A;  1IYQ A;  4N9K A;  1SKO A;  4ZBE A;  3IF6 B;  1YSQ A;  1LLB A;  2EX2 A;  5I94 A;  2E8I A;  3V39 A;  1GHM A;  3PAG A;  5FAS A;  3TW8 A;  3Q82 A;  4EUZ A;  4WZ5 A;  4EBL A;  3U2A A;  4EEU A;  3O88 A;  2EA9 A;  3RFB A;  1J9M A;  4OP5 A;  5C5K A;  5HAQ A;  5HDS A;  4KQD A;  4OLG A;  3ITB A;  3DBA A;  2Y2K A;  4PMA A;  4H6J B;  1UWN X;  3C7U A;  5EVL A;  1O7E A;  4EV4 A;  4JF5 A;  3BEC A;  3LCE A;  3E4P A;  3C5A A;  1PFL A;  4FOF A;  4OPQ A;  1KOU A;  2WKH A;  2P08 A;  4WF0 A;  4OOM A;  3HLW A;  4OH0 A;  1L3L A;  1Y4O A;  1XXM A;  2PYP A;  3T4Q A;  1V9Z A;  5BOH A;  1TD5 A;  4II7 A;  4ME4 A;  1MY8 A;  5GL9 A;  1IYP A;  3A3D A;  1IEM A;  3S7N A;  2L0W A;  2G2U A;  3QNB A;  2Y2L A;  5EVI B;  3LR4 A;  3JVV A;  1TDG A;  4WMC A;  5K5B A;  2WGW B;  1DJA A;  1YMS A;  5JYO A;  2ZC6 B;  2XD1 A;  1PI4 A;  3IX3 A;  3NDE A;  5HSQ A;  2B95 A;  3LY3 A;  3ZG8 B;  3H7W A;  3GQZ A;  1I2S A;  1N9O A;  4Q0I A;  3ZVW A;  1S4S A;  4NET A;  4WYY A;  2QJ5 A;  2Q0O A;  2IWB A;  3FZC A;  3ZG0 A;  4IED A;  3Q1F A;  3GRJ A;  5HAR A;  2VX8 A;  3VOZ A;  2PU4 A;  2OSU A;  1MWU A;  3HUM A;  4LEN A;  4RQ9 A;  5E43 A;  1ZKJ A;  1SKF A;  2M1C A;  4YIN A;  3OPR A;  2O9C A;  3P98 A;  3KSF A;  3CIT A;  1BYW A;  4JLF A;  3IXD A;  1NYM A;  2W1R A;  1MWR A;  1OTA A;  4EEP A;  3QP5 A;  3OOV A;  5HWW A;  3ZQ5 A;  3ZCZ A;  2M7U A;  3M2J A;  4S2I A;  4DDY A;  4GLQ A;  3EOI A;  1XPB A;  3FPW A;  2Q9M A;  3IQA A;  4S2P A;  5TR7 A;  4JGP A;  1RGY A;  3MQ0 A;  3MZE A;  4ARZ B;  3BFD A;  3HUO A;  3N4I A;  4GW9 A;  3SOI A;  1BTL A;  3OPL A;  1ERM A;  1FIK A;  1PIO A;  3IH9 A;  1OTD A;  2VGL M;  4P6B A;  1XJ2 A;  3N8S A;  2WYX A;  4O8G A;  4OOY A;  2V1B A;  2ZQC A;  3MXS A;  1PZO A;  3C8C A;  3AGF A;  5F1F A;  2H28 A;  3WRZ A;  3MFD A;  4K0X A;  5TBM B;  4L9F A;  3NIA A;  1P9R A;  3UN7 A;  3WWX A;  4C75 A;  1S0W A;  4Q0J A;  3PR6 A;  4WZ5 C;  1I2W A;  4KZ5 A;  1M6K A;  1JVJ A;  3CPT B;  3HCY A;  3IF6 A;  2GNX A;  2H10 A;  2XLN A;  5DKL A;  3JPU A;  2HDU A;  5F69 A;  4CQH A;  4R38 A;  5FI6 A;  2ZOH A;  1BSG A;  1GA0 A;  2V0U A;  1CEG A;  1XFN A;  3T4K A;  2W3H A;  4BBT A;  1OTI A;  4ZDX A;  1P0Z A;  4QY6 A;  4ZTK A;  3VFF A;  5CER A;  4ETZ A;  3SZT A;  5CHM A;  3F1P B;  2J8Y A;  1ERQ A;  3IX8 A;  3IT9 A;  4NXG A;  4I3J A;  4H6J A;  1JWZ A;  1J3W A;  3CZD A;  3LO7 A;  2PDR A;  3T12 B;  3LR0 A;  3PBR A;  2VGJ A;  4LV1 A;  1W63 Q;  3CAX A;  2PRF A;  5U47 A;  5FI7 A;  3UME A;  5F5Y A;  3UY6 A;  3ZDJ A;  2HJE A;  1F2K A;  3A3J A;  4DDS A;  4WEJ A;  4PM7 A;  2VJW A;  1W63 M;  3UE1 A;  4R3B A;  2XH9 A;  2PBY A;  5EVI A;  3T4S A;  4U0X A;  2C5W B;  3AGE A;  5M19 A;  1NWZ A;  2WGW A;  1ONG A;  2J80 A;  3G35 A;  1U60 A;  3NOT C;  5KIZ A;  2QWS A;  2WKR A;  2HJ9 C;  5TJJ A;  3TG9 A;  2D02 A;  1NY0 A;  4JBF A;  3CMZ A;  4E6W A;  4RVA A;  3K2N A;  2Y91 A;  1BT5 A;  1KDS A;  2Y59 A;  4GB7 A;  4IHQ A;  4WLA A;  1S4R A;  2L4R A;  4P85 A;  5DF8 A;  4EU0 A;  3IWO A;  4MN5 A;  5M1A A;  1DJB A;  4GD6 A;  1KDW A;  4BJP A;  4EER A;  1TS8 A;  3C38 A;  2XEP A;  5FAP A;  3V3R A;  1YT4 A;  1NZO A;  4NKP A;  2W3G A;  3BFF A;  4KQQ A;  2HZ5 A;  2K31 A;  2VV7 A; 
#chains in the Genus database with same CATH homology
 4KG5 A;  4E3K A;  4S2O A;  3IHB A;  4B4X A;  3VSK A;  4XXR A;  5L2F A;  5AQB A;  1MWT A;  2ZM2 A;  2JCH A;  4OPR A;  4GKU A;  3VP4 A;  1FCM A;  2GDN A;  5F1G A;  1YLT A;  1K54 A;  2EFX A;  3BFG A;  3UO9 A;  2UWX A;  1Z6F A;  4KZ3 A;  3O87 A;  1L0G A;  3PBO A;  2OLU A;  4MLL A;  4R3J A;  1RGZ A;  4S2N A;  4UAA A;  3RXX A;  1DJC A;  4Y7P A;  3ZG7 B;  1MBL A;  3ZVT A;  5HL1 A;  4X56 A;  3HL9 A;  3TSG A;  3MZD A;  3GMW A;  1CI9 A;  1EI5 A;  2Y2Q A;  4R4S A;  1K6S A;  3O3V A;  1JTD A;  3BEB A;  3SH9 A;  4IVK A;  5CHU A;  3BLS A;  2P9V B;  2XFT A;  4RA7 A;  1Q2P A;  1SCW A;  3FKW A;  3WS0 A;  1JWV A;  2ZQ7 A;  4K0W A;  4FCF A;  2WAD A;  4XUZ A;  2BG1 A;  5CGW A;  1ES4 A;  4WBG A;  2JE5 A;  3IHA A;  2XR0 A;  4DE3 A;  3NC8 A;  3W4O A;  2HDR A;  5EEC A;  2WAE A;  1KE3 A;  2ZC7 A;  1KGG A;  2Z2L B;  1IYQ A;  4QY5 A;  4N9K A;  4X6T A;  3DWZ A;  1CI8 A;  4ZBE A;  3IF6 B;  1MKI A;  1NYY A;  1LLB A;  2EX2 A;  4E3M A;  4ZJ3 A;  4E3L A;  5I94 A;  3NY4 A;  4OP8 A;  5FQM A;  5E2F A;  4FD8 A;  2E8I A;  4DXB A;  2J9O A;  1WE4 A;  1GHM A;  3V39 A;  3PAG A;  1E4D A;  1ZC2 A;  1BLC A;  4Z9Q A;  5FAS A;  1PW1 A;  3Q82 A;  3UDX A;  4DKI A;  4H8R A;  4QHC A;  5GHZ A;  1K56 D;  4EUZ A;  4WMC D;  4WZ5 A;  5FSR A;  1PWD A;  3IF6 C;  4MBK A;  4EBL A;  3WS2 A;  1K4F A;  4UA9 A;  2Y2N A;  3VMA A;  2J9P A;  2WGV A;  4JXS A;  2ZJ9 A;  3O88 A;  4MBF A;  3RJU A;  1XA1 A;  4WEL A;  1ESU A;  1J9M A;  1BLH A;  3G2Y A;  3FKV A;  4ZAM A;  4OP5 A;  5F83 A;  4DRT A;  4BQM A;  4OKP A;  4IBR A;  5FAQ A;  5CGX A;  4FH2 A;  4OPZ A;  5HAI A;  3VSL A;  3Q7V B;  3SH8 A;  5HAQ A;  5KSH A;  1ESI A;  3A3F A;  1W7F A;  4IVI A;  4Y0U A;  5F82 A;  3BM6 A;  4OQG A;  4OLG A;  2HDQ A;  3VP0 A;  3LY4 A;  3ITB A;  3N8L A;  2Y2K A;  1O07 A;  2ZC5 B;  4PMA A;  5E2H A;  5A91 A;  2ZQ9 A;  3C7U A;  2JC7 A;  3OCN A;  5EVL A;  1O7E A;  4EV4 A;  1Y54 A;  4JF5 A;  3UE3 A;  4KZ8 A;  3BEC A;  3LCE A;  5FQ9 A;  3S4X A;  3C5A A;  2Y2M A;  2DRW A;  4OON A;  4KZB A;  5FA7 A;  1GCE A;  1H8Y A;  4N92 A;  4OPQ A;  2WKH A;  2WUQ A;  2G2W A;  4OOM A;  1OME A;  2EFU A;  4MBH A;  3HLW A;  5FQQ A;  4RX3 A;  4OH0 A;  3G2Z A;  3C7V A;  4LCL A;  3CJM A;  1XXM A;  4X53 A;  4EWF A;  4S2L A;  3P09 A;  4JPM A;  5A92 A;  5CED A;  3ZNY A;  4S2M A;  1ONH A;  5BOH A;  1G68 A;  1MY8 A;  1XGI A;  4GOG A;  4PPR A;  2X01 A;  3BFC A;  1W8Q A;  1IYP A;  2ZM0 A;  3MBZ A;  3A3D A;  1IEM A;  5GL9 A;  3ZHH A;  2B5R A;  2G2U A;  2H0T A;  1BLS A;  5A93 A;  2IWC A;  4JXG A;  3QNB A;  5EPH A;  5DF7 A;  2Y2L A;  5EVI B;  3BLM A;  5TFQ A;  4U0T A;  4X55 A;  1TDG A;  1QME A;  3BRM A;  4WMC A;  3DWK A;  1NRF A;  3ZFZ A;  4WM9 A;  3A3E A;  1LI9 A;  4UA7 A;  5CTN A;  2WGW B;  1DJA A;  1YMS A;  3BFE A;  3FYZ A;  5DTK A;  4EQI A;  5JYO A;  2ZC6 B;  1W79 A;  2XD1 A;  1PI4 A;  4LV0 A;  1K55 C;  3NDE A;  4QB8 A;  5FQJ A;  2FFF B;  4P0M A;  4M3K A;  4E3N A;  3LY3 A;  3ZG8 B;  4ID4 A;  3EQV A;  4OPY A;  3UPN A;  2XK1 A;  5EVI C;  2ZQD A;  3GQZ A;  2QZ6 A;  3M6B A;  3UE0 A;  1I2S A;  4GNU A;  3V50 A;  3IXH A;  2A3U A;  4GN2 A;  5CTM A;  1H5X A;  1E3U D;  1L2S A;  5EOE A;  1IYS A;  5GLD A;  2R9X A;  5TGF A;  3ZVW A;  1JWP A;  1PZP A;  4ZJ2 A;  4E6X A;  3SS3 A;  4NET A;  3HLD A;  4WYY A;  2XGN A;  2J7V A;  2I72 A;  3MKE A;  4S2J A;  5GLC A;  1KGE A;  5FI2 A;  1ES5 A;  2HDS A;  2IWB A;  3S1Y A;  3FZC A;  4K91 A;  3CG5 A;  3ZG0 A;  4IED A;  3Q1F A;  3GRJ A;  3ISG A;  2V20 A;  5GLB A;  1ES3 A;  2ZQA A;  3C4P A;  4BD0 A;  5HAR A;  3ZG5 A;  1N4O A;  4N1H A;  2Y2J A;  2PU2 A;  3E2K A;  4JF4 A;  3VOZ A;  2ZC4 B;  2PU4 A;  1LL5 A;  1ZG4 A;  1BUE A;  3NDG A;  3PAE A;  4WEK A;  2P74 A;  3MXR A;  2Y2G A;  2OSU A;  1MWU A;  3HUM A;  4LEN A;  1GHP A;  2OV5 A;  4O7D A;  3WS4 A;  4DE2 A;  5E43 A;  1ZKJ A;  1BZA A;  1SKF A;  1L0F A;  4YIN A;  3OPR A;  4OVD A;  2XQZ A;  3P98 A;  4LCM A;  4JXV A;  4R23 A;  2WGI A;  2QPN A;  4DF6 A;  2VGK A;  5CRF A;  5CHJ A;  4JLF A;  4E3I A;  3DTM A;  3IXD A;  4B88 A;  1L0D A;  3WS5 A;  4JKT A;  1DY6 A;  1NYM A;  1MWR A;  4L0L A;  3HVF A;  3G4P A;  1YLP A;  3OPP A;  3ZCZ A;  5HFO A;  3ZGA B;  3M2J A;  1K6R A;  1CK3 A;  1LL9 A;  3BYD A;  4S2I A;  2IWD A;  4PM5 A;  2HP6 A;  2QMI A;  1YM1 A;  4IBX A;  4KZA A;  3W4Q A;  4PM8 A;  1MPL A;  4HES A;  4OQI A;  4DDY A;  1Q2Q A;  1K57 A;  3QHY A;  1PYY A;  2XF3 A;  4Q8I A;  4DE1 A;  2EX6 A;  2Y2I A;  3I7J A;  1XPB A;  4C6Y A;  4EBP A;  3VFH A;  4HEF A;  3W8K A;  2Q9M A;  2Y2O A;  2V1Z A;  3IQA A;  5A90 A;  4S2P A;  5AQ7 A;  3UDF A;  1ZG6 A;  1IYO A;  1FOF A;  4PM6 A;  5TR7 A;  3V5M A;  1ES2 A;  1NJ4 A;  1RGY A;  3MZE A;  5HAP A;  3G30 A;  3GSG A;  1K54 C;  3BFD A;  4UHU A;  5KMW A;  3PBQ A;  3HUO A;  3OC2 A;  3N4I A;  3SOI A;  5CXW A;  3UPO A;  2Q9N A;  1BTL A;  3V3S A;  4S2N C;  2A49 A;  3OPL A;  1ERM A;  1KVL A;  5M18 A;  1PIO A;  3IH9 A;  4KG6 A;  1S6R A;  3N6I A;  4P6B A;  3N8S A;  4BL2 A;  4B4Z A;  4C3Q A;  2WYX A;  4OOY A;  4KG2 A;  5AQ9 A;  1XX2 A;  3B3X A;  1YLJ A;  5GHY A;  2ZQC A;  4GD8 A;  3ZG9 B;  3GR2 A;  3IWI A;  4LV2 A;  4OOL A;  4BEN A;  4U3T A;  3D4F A;  4YFM A;  3MXS A;  1PZO A;  2R9W A;  3IF5 A;  3AGF A;  5F1F A;  1QMF A;  3IXB A;  1IKI A;  5G18 A;  2RCX A;  2C6W B;  3Q81 A;  3E2L A;  2P9V A;  2BLS A;  3WRZ A;  3VP1 A;  4FSF A;  3DW0 A;  4CPK A;  3MFD A;  4K0X A;  5DVA A;  3NIA A;  4R1G A;  3UN7 A;  1K25 A;  3WWX A;  3SH7 A;  4C75 A;  4P87 A;  1PWG A;  3PTE A;  1S0W A;  1XKZ A;  2WKE A;  1K56 A;  1MXO A;  2X02 A;  1CEF A;  5E2G A;  1JTG A;  2V2F F;  3IWQ A;  4KEN B;  1KVM A;  3LEZ A;  1TDL A;  5EUA A;  1I5Q A;  3UNW A;  4WZ5 C;  1I2W A;  1YLY A;  4KZ5 A;  1N9B A;  1M6K A;  1JVJ A;  2H0Y A;  3IF6 A;  4D2O A;  1XA7 A;  2EXB A;  2H10 A;  2XLN A;  4BD1 A;  4F94 A;  1HD8 A;  3SS4 A;  4LV3 A;  1PWC A;  1TEM A;  4GDN A;  3G32 A;  5D3O A;  1KE4 A;  4E3O A;  5FAO A;  3S22 A;  1G6A A;  2Y55 A;  3IH8 A;  2HDU A;  1TVF A;  5EVI D;  4S2K A;  3TOI A;  2Y2P A;  3C4O A;  3HLB A;  3W4P A;  3M2K A;  5HW3 A;  1SDE A;  3FWL A;  5FI6 A;  1BSG A;  1GA0 A;  1CEG A;  4NK3 A;  1VQQ A;  3OZH A;  4GZB A;  3VP3 A;  4ZDX A;  4RX2 A;  2X71 A;  4KZ9 A;  1FCO A;  1M40 A;  4QD4 A;  1AXB A;  2XDM A;  2XFS A;  4A5R A;  5HX9 A;  4QY6 A;  4ZTK A;  3VFF A;  3AGD A;  4HBU A;  3NI9 A;  1FR6 A;  5CER A;  4GDB A;  2EX9 A;  1ERO A;  3EQU A;  1KE0 A;  3Q7V A;  3HUN A;  5GHX A;  5CHM A;  5E2E A;  3M6H A;  4KZ6 A;  2EX8 A;  5DF9 A;  2J8Y A;  3HLC A;  5JYP A;  5CEB A;  1W5D A;  1ERQ A;  3IT9 A;  2RL3 A;  4BL3 A;  3WS1 A;  4N9L A;  3HLG A;  5CGS A;  1WYB A;  2DCF A;  1JWZ A;  1RP5 A;  4Y0O A;  2WK0 A;  1L0E A;  4Y0T A;  3A3I A;  3OPH A;  4WZ4 A;  3CZD A;  3LO7 A;  1HVB A;  3PBR A;  4X68 A;  1VM1 A;  2ZM8 A;  1IEL A;  2VGJ A;  4KQO A;  1NZU A;  3GVB A;  5CEC A;  3PBS A;  3VOY A;  4OQH A;  4LV1 A;  3HLF A;  5EOO A;  3NCK A;  3NBL A;  4KZ4 A;  1YLZ A;  1FSW A;  1YMX A;  1YQS A;  1HTZ A;  1FCN A;  1BLP A;  3MZF A;  1BUL A;  5U47 A;  2HP5 A;  5FI7 A;  4UA6 A;  1MWS A;  3UY6 A;  3O86 A;  3ZDJ A;  1YLW A;  4DE0 A;  4QJG A;  4R4R A;  2Y2H A;  4MEZ A;  3A3J A;  4DDS A;  4JF6 A;  4WEJ A;  4N1X A;  4PM7 A;  2ZQ8 A;  1H8Z A;  1K55 A;  1XGJ A;  1K38 A;  1E3U A;  5FQK A;  4KZ7 A;  3UE1 A;  4BLM A;  4R3B A;  3RXW A;  2XH9 A;  2PBY A;  5EVI A;  1RCJ A;  5KZH A;  4U0X A;  2C5W B;  4MNR A;  4E3J A;  3AGE A;  5M19 A;  3GTC A;  4JXW A;  4HBT A;  1C3B A;  2WAF A;  2WGW A;  1ONG A;  4ZJ1 A;  3HBR A;  1K4E A;  1FSY A;  3G35 A;  3G34 A;  1SDN A;  1U60 A;  4RYE A;  2JBF A;  3HRE A;  5DTT A;  3FV7 A;  2HP9 A;  3N8R A;  2HPB A;  2WZX A;  4XUX A;  1HZO A;  2H5S A;  3TG9 A;  2Y4A A;  1NXY A;  2FFY A;  2ZC3 B;  5FAT A;  5GLA A;  2ZD8 A;  3JYI A;  2XD5 A;  1NY0 A;  2ZLY A;  3QNC A;  2WZZ A;  5EE8 A;  3N7W A;  1GA9 A;  4JBF A;  4OQ0 A;  1E25 A;  3MKF A;  5AQA A;  1PW8 A;  3CMZ A;  3Q07 A;  4E6W A;  3IXG A;  4R0Q A;  4RVA A;  3VP2 A;  3G31 A;  4DXC A;  2Y91 A;  2Z2M B;  3OCL A;  3UPP A;  1BT5 A;  1LHY A;  1KDS A;  2Y59 A;  2DNS A;  4GB7 A;  1W8Y A;  1LI0 A;  3PBN A;  1ALQ A;  4P85 A;  5DF8 A;  2WKI A;  5KSC A;  1FQG A;  5FDH A;  3ZNT A;  1IKG A;  2CC1 A;  1KGF A;  4EBN A;  3IWO A;  5IHV A;  5M1A A;  1GHI A;  4QU3 A;  1DJB A;  2ZMA A;  4OLD A;  4GD6 A;  2EXA A;  1KDW A;  4BJP A;  5DTS A;  3WRT A;  1FR1 A;  3ITA A;  2XEP A;  1SHV A;  5FAP A;  3V3R A;  1YT4 A;  1WYC A;  1NZO A;  1K57 C;  3HLE A;  3PBT A;  4CJN A;  5FQI A;  5J8X A;  4PM9 A;  3Q7Z A;  1PI5 A;  3SS5 A;  3BFF A;  4KQQ A;  3UDI A;  2OLV A;  4FH4 A;  1XP4 A;  4KQR A;  1EWZ A;  3GV9 A;  4X69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...