1ESUA

S235a mutant of tem1 beta-lactamase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKAGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title TEM1 beta-lactamase structure solved by molecular replacement and refined structure of the S235A mutant.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 93
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1esuA00
2Y2KA 1L0GA 1I2SA 2Y2IA 2EFUA 3VP1A 2OLVA 3CG5A 3OPLA 4JF5A 3S1YA 1O7EA 4S2JA 3BFFA 3O88A 4DXCA 3G35A 1E3UA 1MBLA 1ZG6A 2IWDA 3IHBA 4R4RA 5FAOA 3MXSA 2XEPA 4LCLA 3OPPA 3FKVA 2V1ZA 5FSRA 1K4FA 5M1AA 2HDSA 2EX6A 4WEJA 1ES3A 4PPRA 1NY0A 3V39A 3GRJA 5E2GA 2ZM8A 2CC1A 3NI9A 4MBFA 4BLMA 3WS0A 4K0WA 4OLDA 2Y2HA 1IELA 4UA9A 4LENA 4E3IA 1K56A 4UA6A 3A3EA 1RGYA 2Y2OA 2OLUA 4KZ4A 1VM1A 3UE3A 1M40A 1BULA 4LV1A 3AGDA 2HP6A 3GMWA 5DTKA 4L0LA 1Z6FA 4ID4A 1IYPA 1CEFA 5DF9A 1E25A 1FCMA 4OPRA 4GDNA 3LY3A 3EQUA 1DJCA 1TVFA 3NDGA 1PWCA 2I72A 1FR1A 1KGFA 2WAFA 5TR7A 4PM6A 2VGJA 5EOOA 3UPOA 1IYSA 5EVIC 1FSWA 2EXBA 3LO7A 2WKEA 3N8SA 1K55A 5E2HA 4X56A 4FH2A 3IWQA 5DVAA 5EECA 4WZ5C 1YMSA 2JBFA 2ZD8A 1W5DA 3D4FA 3PBSA 4QY5A 2WZZA 3B3XA 4KENB 3NBLA 4MEZA 4E3OA 5F1FA 3MFDA 3IF6B 4FH4A 5FATA 1K25A 1N4OA 2XR0A 3N7WA 1XP4A 3BLSA 2WGVA 4DDYA 5HAIA 2DCFA 1DY6A 2PU2A 5D3OA 1QMEA 3ZG7B 1M6KA 4C3QA 4X68A 4HBUA 5I94A 2RL3A 2ZQ7A 4QY6A 3QNBA 1YMXA 3N8RA 4YINA 1E4DA 4JXWA 4OVDA 4GN2A 1K57A 2UWXA 3W8KA 3QNCA 5HAQA 5DTTA 1U60A 1HZOA 3BFEA 3WRZA 3VP4A 1PWDA 5HL1A 4UA7A 4C75A 1YM1A 1PZPA 1YLWA 2XLNA 4S2NC 3WS4A 3G32A 3SS4A 5FAPA 3BEBA 1YT4A 3TOIA 1YLJA 3Q1FA 1GHMA 3UN7A 1SCWA 3VSKA 2WADA 1EWZA 1JWZA 3V3RA 4WMCD 3BYDA 2BLSA 3PAGA 4DE3A 1NYMA 4KG5A 1XPBA 2OV5A 1IKGA 4QD4A 4WELA 4IVKA 3GR2A 4JXGA 2HDRA 3O3VA 1J9MA 4E6WA 2ZQAA 4K0XA 3VMAA 3DWZA 3C4PA 1JTGA 5E2EA 1L0FA 4JLFA 1RP5A 3MBZA 4DXBA 5HW3A 3CZDA 1MY8A 4HEFA 3A3IA 3ZG5A 3MZFA 2OSUA 3UPPA 3GSGA 3DW0A 4GD6A 3ITAA 1BT5A 3PBTA 5EUAA 4GOGA 4KZ9A 4OP5A 3IT9A 1Y54A 5FQJA 5FQIA 4DE2A 3M2KA 5KMWA 2Y2PA 2ZC3B 3HLCA 4E3JA 4OH0A 1KDWA 2ZC7A 5AQAA 4CPKA 4BL3A 3FV7A 1ESUA 5KSCA 3UNWA 1CK3A 4GB7A 1K4EA 3C7UA 5EPHA 1YLPA 3HUOA 5FDHA 1IEMA 2HP9A 1ALQA 1EI5A 4BQMA 4BENA 2ZC4B 2Y2QA 1GA0A 3WS2A 5EVID 3Q7VB 3NIAA 3FYZA 5EE8A 4LV3A 3ZDJA 5DF7A 3TSGA 3M2JA 1K57C 4M3KA 3I7JA 5BOHA 4MBHA 3P09A 1MWTA 1GHPA 5CGXA 4BD0A 1L0EA 4R3JA 2WUQA 4E3MA 5J8XA 2Y91A 2X71A 4PM7A 4UHUA 4JPMA 5DF8A 2WYXA 3ZVTA 4BD1A 4PM5A 3A3FA 4X55A 4KZ3A 2ZM0A 2IWBA 4E3LA 2WKIA 3WWXA 4KZ8A 3HREA 3PAEA 4XXRA 1C3BA 1PIOA 4PMAA 3WS5A 2PBYA 3PBRA 2ZQ9A 1KGGA 4GD8A 2J9OA 4OQIA 1IKIA 1SDEA 1KE0A 3GV9A 5GL9A 4KZ6A 2IWCA 4R3BA 5TGFA 2V20A 2Y4AA 4JF4A 1XA1A 5EVLA 3V5MA 1CI8A 2J9PA 1BLHA 4OQGA 2RCXA 1I2WA 4EWFA 2Y2LA 1PW8A 1PI5A 3VOYA 4PM8A 5TFQA 2B5RA 1XX2A 3BRMA 3IXGA 3Q07A 5A91A 2V2FF 2H0YA 4PM9A 1ES5A 1S6RA 3LY4A 3N8LA 4QU3A 4IBRA 1O07A 5FQKA 4IVIA 1PZOA 4RYEA 3G30A 2PU4A 4OKPA 5GHZA 4B4ZA 3HUMA 4R23A 4NETA 2XD1A 3GVBA 4OOMA 5F1GA 2H5SA 1OMEA 4N1HA 3W4QA 1ERQA 3OCLA 2WGWB 3GTCA 2ZC6B 3DWKA 4OOLA 5CXWA 3BFGA 1VQQA 3VSLA 2Y2GA 5A93A 3SH8A 4P0MA 5GLDA 2HDQA 2EX9A 3OC2A 4Y0TA 1MWRA 2ZQ8A 2G2WA 2WZXA 1KDSA 3NC8A 3IF6A 3PBOA 4HBTA 2ZQDA 4ZAMA 1TEMA 1ESIA 5CHMA 2EFXA 5HAPA 3VP3A 1WE4A 5HX9A 5FAQA 1KVLA 1MXOA 2HPBA 3BLMA 4QJGA 5KZHA 4YFMA 2Y2MA 2XH9A 4JXVA 3PBQA 3QHYA 1H5XA 2J7VA 1K54A 5CEDA 1LI9A 1G6AA 3UY6A 3LEZA 2P9VB 1K38A 1H8ZA 4MLLA 4R4SA 5EOEA 2EXAA 3ZCZA 4WMCA 5CGWA 2ZMAA 4OONA 2C6WB 3HVFA 2A3UA 4LV0A 3IWIA 1EROA 3ZG8B 1LL5A 1BTLA 2E8IA 3CMZA 3PBNA 2DNSA 1BLPA 1LHYA 3UE1A 4EBPA 4EV4A 4F94A 4RX3A 2Q9NA 3V50A 4A5RA 4ZDXA 2QMIA 1Q2PA 2QZ6A 1CI9A 3ZG9B 1IYQA 2FFFB 2Y2NA 1K55C 2ZQCA 5E43A 3NDEA 3TG9A 1YLZA 1GA9A 4JF6A 4WM9A 1KVMA 3G2ZA 4RX2A 1YLYA 2J8YA 2XFTA 3CJMA 3ZVWA 5CECA 4KG6A 4DDSA 1Q2QA 4HESA 1TDLA 4KQQA 4OLGA 2ZJ9A 2H0TA 5GHXA 4IEDA 3OPRA 3W4OA 3FZCA 4S2MA 1FOFA 5CERA 3PTEA 3O87A 2XK1A 2Z2LB 4DKIA 3IXHA 2GDNA 3MKFA 1PWGA 5AQ9A 3G4PA 3RJUA 3UDFA 5KSHA 4ZTKA 3S22A 4QHCA 5EVIA 3OZHA 5CHJA 2WKHA 1ERMA 1XGIA 3M6BA 3G34A 5F82A 4WZ5A 4WZ4A 1BSGA 2WK0A 4Y0OA 1GCEA 4KQRA 3Q7VA 1NYYA 1HVBA 1W8YA 2JC7A 4H8RA 3DTMA 5FI6A 1FQGA 1LI0A 3Q82A 5AQ7A 2JE5A 1JWPA 1PYYA 1DJBA 3MXRA 4ZJ2A 3UDIA 3C4OA 3MZDA 1JTDA 1W8QA 5A90A 4S2IA 4X69A 1W79A 4EBNA 3UO9A 3C5AA 5JYOA 3O86A 3IWOA 4P85A 1AXBA 1SHVA 1E3UD 1W7FA 2A49A 4OPYA 3SH9A 5M18A 1ZKJA 2DRWA 5FQMA 4EUZA 1NRFA 3MZEA 4KZBA 3IHAA 2Z2MB 4WYYA 5CGSA 4S2LA 1WYCA 3UPNA 4UAAA 3N4IA 4ZJ1A 1SDNA 2WAEA 1MPLA 4N92A 4O7DA 2XGNA 5E2FA 4MNRA 4S2NA 1ES2A 1NZOA 4U0TA 4N9LA 3SS5A 4R1GA 4DF6A 1MKIA 1K56D 3P98A 5GHYA 3EQVA 2HDUA 4RVAA 4Z9QA 1FSYA 3HLEA 1G68A 1NXYA 1BZAA 5JYPA 3WRTA 5A92A 3HLBA 3NY4A 3BECA 5FI2A 4E6XA 5M19A 1XA7A 2HP5A 2XQZA 3BM6A 3UE0A 4BJPA 4C6YA 4DRTA 3SH7A 5CEBA 1XGJA 3SS3A 4U0XA 4WBGA 5FI7A 2WGIA 4FSFA 4N9KA 4LV2A 4OPZA 2QPNA 4EQIA 1FR6A 2Q9MA 5U47A 1FCOA 5F83A 3MKEA 1RGZA 5HARA 4ZJ3A 3VP2A 3ZHHA 4B4XA 5CHUA 2FFYA 2ZC5B 5L2FA 2WGWA 1YQSA 4S2OA 3VFFA 3WS1A 3HLWA 3HL9A 4MBKA 4X6TA 1IYOA 1ONHA 3IH9A 2Y2JA 2H10A 3LCEA 3Q7ZA 4D2OA 2XDMA 4X53A 4XUZA 1TDGA 2XD5A 3C7VA 3M6HA 5IHVA 3SOIA 2XFSA 3V3SA 1KE4A 3Q81A 3VP0A 4KZAA 3UDXA 1HTZA 1ES4A 3AGFA 4KG2A 2Y55A 1K6SA 1I5QA 4XUXA 1KE3A 5GLBA 3HLFA 4ZBEA 3S4XA 4KZ7A 4N1XA 4K91A 1PI4A 3HBRA 5AQBA 1BLSA 5FQQA 4QB8A 4DE0A 1NJ4A 1BUEA 2VGKA 1CEGA 4FCFA 4BL2A 4GNUA 3IXBA 4JBFA 2P9VA 1LLBA 5FA7A 5G18A 1L2SA 4EBLA 1JWVA 1ONGA 3E2LA 4OPQA 2X02A 4OQ0A 4RA7A 3ISGA 2ZLYA 4P87A 3G31A 1YLTA 4S2PA 3IQAA 4Y0UA 4DE1A 2R9XA 4LCMA 4KQOA 4U3TA 3W4PA 4E3KA 4Y7PA 3VOZA 3IXDA 3BFCA 3IF5A 1H8YA 1DJAA 2Y59A 4OQHA 3IH8A 1FCNA 3ZNTA 1HD8A 2EX8A 4JXSA 2C5WB 4GDBA 1WYBA 1XXMA 3JYIA 3ZG0A 5GLAA 5CRFA 2BG1A 2X01A 4Q8IA 4NK3A 3VFHA 2EX2A 3FWLA 3ITBA 5HFOA 3A3DA 3N6IA 3NCKA 1S0WA 3HUNA 5CTMA 1SKFA 3HLGA 1RCJA 3OCNA 1L0DA 1MWUA 3RXWA 3GQZA 1PW1A 3RXXA 1LL9A 4KZ5A 3ZNYA 3G2YA 4OOYA 4E3NA 4OP8A 4GKUA 5CTNA 4WEKA 3ZGAB 3A3JA 5GLCA 1ZG4A 4CJNA 2JCHA 2P74A 2XF3A 2R9WA 3IF6C 4GZBA 1KGEA 3FKWA 2ZM2A 1NZUA 4S2KA 4FD8A 3OPHA 1GHIA 1K6RA 3HLDA 3BFDA 4P6BA 3AGEA 1BLCA 5DTSA 4JKTA 1N9BA 1QMFA 4IBXA 3ZFZA 1JVJA 1MWSA 1ZC2A 5EVIB 4R0QA 4B88A 3E2KA 1XKZA 2G2UA 5FASA 1K54C 5FQ9A
chains in the Genus database with same CATH superfamily
3F1NA 2Y2KA 2W1TB 2EFUA 2OLVA 3OPLA 4S2JA 3O88A 4DXCA 3G35A 1ZG6A 3T1XA 1BYWA 4R4RA 3MXSA 2PD7A 4LCLA 3OPPA 3FKVA 4JGPA 4WEJA 1VEUA 1ES3A 2V1AA 3V39A 5E2GA 4Y13A 1XJ2A 2Y2HA 4E3IA 4UA6A 4KUKA 3LGOA 3DAVA 1VM1A 3E4OA 5IS1A 5DTKA 4ID4A 1IYPA 1CEFA 2PR6A 1FCMA 1TVFA 1FR1A 3C2WA 3QP2A 5EOOA 3UPOA 5EVIC 1FSWA 2EXBA 1N9NA 2EWWA 2WKEA 4Z1WA 5E2HA 1OJ5A 1UGUA 4X56A 3IWQA 4WZ5C 1YMSA 5HD3A 1W5DA 3D4FA 3NBLA 3MFDA 4FH4A 5FATA 3LIFA 2M7VA 1XP4A 1FILA 2WGVA 4DDYA 1DY6A 3CPTB 1M6KA 4MDZA 1V9YA 4HBUA 2ZMVA 3QNBA 3MXQA 4YINA 4OVDA 5HAQA 3BQ8A 3BFEA 3VP4A 2XLNA 2V8FA 2H28A 2VLGA 1GHMA 2JKGA 1JWZA 4CLCB 4WMCD 3LIDA 1IKGA 4IVKA 3GR2A 4LPZA 2HDRA 4E6WA 3LICA 3ZYTA 2PYPA 3VMAA 5MC7A 3DWZA 3C4PA 5E2EA 1MY8A 4HEFA 3DTKA 5EUAA 2V9AA 3IT9A 4UQIM 5FQJA 4OH0A 1KDWA 1ESUA 3C7UA 3IBRA 4R6LA 4Y3IA 2HP9A 3PYPA 3LIAA 1GA0A 4HJ4A 5EVID 5EE8A 2HGVA 4LV3A 3ZDJA 3OLOA 1S4SA 4MBHA 4R38A 4MN5A 5CGXA 4E3MA 2X71A 3T1QB 2WYXA 5G4ZA 2IWBA 4E3LA 5J7EA 3PAEA 1MZUA 3PHYA 2QHKA 1C3BA 1IKIA 3D72A 4KZ6A 2Y4AA 4BMWA 5EVLA 3V5MA 1CI8A 2J9PA 1BLHA 2RCXA 1PI5A 2ZBBA 3VOYA 5CX7A 2V2FF 2PD8A 2Y79A 2BASA 3N8LA 4M4XA 1O07A 4IVIA 1P9WA 4RYEA 5GHZA 4R23A 2XD1A 3GVBA 4Y17A 1MC0A 3W4QA 1OMEA 1ERQA 3OCLA 3GTCA 2PT7A 2ZC6B 4RQ9A 1CQAA 2R78A 1MWRA 2G2WA 3KX0X 5G4YA 4HBTA 2ZQDA 3IX3A 2E8JA 5HAPA 3CPTA 1WE4A 5HX9A 5FAQA 4ETXA 3EWKA 4YFMA 2XH9A 3PBQA 3QHYA 1F2KA 3UY6A 1TS0A 3BWLA 1K38A 4MLLA 4Y2FA 5CGWA 2C6WB 4LV0A 4I3JA 3IWIA 1EROA 3ZG8B 2E8IA 2D02A 4F94A 4A5RA 1Q2PA 1IYQA 1LSWA 2FFFB 2Y2NA 1YLZA 5FDSA 1GA9A 2J8YA 2XFTA 4KG6A 4DDSA 2H0TA 5GHXA 3LFVA 3W4OA 1S1YA 4X1MA 5AQ9A 4NKPA 3T12B 5FEFA 5F82A 3M6BA 4Q0JA 2HZ5A 3MFXA 2FH5A 1HVBA 4H8RA 5FI6A 1VETA 2JE5A 3MXRA 2OAP1 1S1ZA 3HJIA 5A90A 3T4SA 1W79A 1NRJA 2DRWA 3IHAA 2Z2MB 1XFNA 2W0NA 4UAAA 3N4IA 1N9OA 1JNUA 1MPLA 4IJGA 4S2NA 3D3OA 1NZOA 4U0TA 5GHYA 2HDUA 4Z9QA 1Y4OA 3NJAA 2Z6DA 3NY4A 3BY9A 4E6XA 5M19A 4C6YA 2VV7A 3SS3A 2JKRI 2WGIA 4X25A 1Z09A 4N9KA 4LV2A 4OPZA 2QPNA 2W3DA 1LSVA 5CHUA 1NLZA 5F5YA 4G3KA 1YQSA 3OOVA 3WS1A 3HL9A 1IYOA 2Y2JA 3Q7ZA 2XD5A 3C7VA 5IHVA 4I38A 3SOIA 1XFQA 1ES4A 3D9YA 5GLBA 3S4XA 4N1XA 3S7OA 3HBRA 4DE0A 4FCFA 1CEGA 4BL2A 4GNUA 4JBFA 5G18A 1ONGA 2X02A 2ZLYA 4Y0UA 3IQAA 4KQOA 2K2NA 4E3KA 3IF5A 2O9AA 3MJQA 3MS6A 2Y59A 1HD8A 4JXSA 1IOUA 3LR5A 3FWLA 5HFOA 4HIAA 1S0WA 4QPRA 3PXPA 1PW1A 2WKRA 3LUQA 4ETZA 4OOYA 4OP8A 1OTEA 3A3JA 2QYBA 4EXOA 4GZBA 1NZUA 4S2KA 3AGEA 1BLCA 4JKTA 1QMFA 4IBXA 1MWSA 5FQ9A 3H7WB 2Y2IA 1DP6A 4JF5A 1O7EA 4EW7A 2XEPA 3GDIA 1K4FA 2HDSA 2EX6A 1P9RA 4PPRA 3NI9A 3S7NA 3WS0A 5AVFA 1IELA 1F98A 1RGYA 5L8MA 2OLUA 2DMWA 1BULA 3AGDA 2HP6A 3GMWA 2L1MA 1Z6FA 4OPRA 4GDNA 1DJCA 1PWCA 2I72A 2WAFA 1CJFA 3UE6A 3LR4A 4HY8A 3LO7A 3QP4A 1VHMA 5DVAA 1G28A 3B3XA 5F1FA 4E3OA 3IF6B 1K25A 2XR0A 5HAIA 5D3OA 4EERA 4C3QA 4HJ6A 5I94A 1YMXA 3N8RA 4IUHA 2PRFA 4R70A 3W8KA 3QNCA 1HLUP 2P7JA 4C75A 4P6ZM 4EUVA 2J3TC 4S2NC 3WS4A 3G32A 5FAPA 3SW1A 1YT4A 3Q1FA 3BYDA 2BLSA 4WELA 5AJGA 3O3VA 1JTGA 3VOLA 5HW3A 1RP5A 3MZFA 2NUTC 3CI6A 3GSGA 4GD6A 3ITAA 3MQQA 3PBTA 4OP5A 4DE2A 3M2KA 4DMZA 3T4QA 4CPKA 2Y8HA 4YOFA 3UNWA 4GB7A 1D1JA 3HUOA 1IEMA 1ALQA 3F1OA 3FYZA 3ICYA 2W3EA 3NIAA 1IFQA 2VV6A 1SZVA 4HQAA 5L09A 1K57C 5BOHA 1MWTA 1GHPA 4BD0A 4R3JA 4R3AA 4JPMA 2NUPC 1S4RA 2A24A 3ZVTA 4X55A 2WKIA 3WWXA 4XXRA 4OQIA 1SDEA 3ULFA 1KE0A 4I5SA 5TGFA 1XA1A 4OQGA 2D01A 5TFQA 2B5RA 2J3TD 3BRMA 3IXGA 3U4LP 2H0YA 5HPFA 1UWNX 4MCWA 4QU3A 4IBRA 3KSFA 4KQDA 1SKOA 2QKPA 5FEGA 4OKPA 2ZOHA 4B4ZA 1X0OA 3EGDC 3HUMA 3UB7A 4NETA 4K08A 5HWTA 4OOMA 5F1GA 1S66L 2ZL1A 2WGWB 3H82B 3DWKA 3BFGA 1VQQA 4WLAA 4P0MA 3SH8A 1S67L 3IBJA 3F1PB 5L07A 3LIBA 2WZXA 2B18A 3IF6A 1STZA 3PBOA 4ZAMA 1P97A 1TEMA 5HD5A 3MQ0A 4JXVA 1LI9A 1G6AA 2P9VB 1H8ZA 2EXAA 3UMDA 3L7HA 3MQOA 2ZMAA 4OONA 2A3UA 1DP8A 1LL5A 4EESA 3SZTA 3PBNA 2DNSA 1BLPA 1LHYA 1XJ4A 4EV4A 4ZDXA 4L9EA 2QMIA 1CI9A 4UQIS 3KSGA 5A8BA 2V0UA 2GX5A 3NDEA 3E4PA 3IX8A 4JF6A 2INWA 2M1CA 2W3HA 5L10A 4IEDA 3MSHA 3O5YA 4DN0A 3T1RA 3O87A 3UMEA 3VV4A 5TBMB 3IXHA 3MKFA 3UDFA 3S22A 2OAQ1 1OPXA 4GHIB 3T4KA 2LB5A 1ERMA 2WKHA 4O8GA 3G34A 2W1TA 2PBDP 4Y0OA 1XJ3A 5HWWA 3E4QA 4KQRA 1W8YA 3DTMA 1D7EA 3EGXC 2V8CA 3R7WB 1PYYA 4ZJ2A 3MZDA 3T4JA 4X69A 2KX6A 3C5AA 5JYOA 3IWOA 3QP1A 2KDKA 1OTDA 4KZBA 4WYYA 3UB9A 3UPNA 4LRYC 4ZJ1A 4F3LB 4H6JB 4O7DA 5E2FA 2JKRM 2Z6CA 4DF6A 3EQVA 4RVAA 1G68A 1TS8A 1TF1A 5JYPA 1T1BA 4GW9A 3HLBA 5FI2A 3BM6A 4DRTA 1XGJA 1P0ZA 4U0XA 5HPIA 2Q9MA 5U47A 2QWSA 3CLOA 2UV0E 5F83A 3ZHHA 4JGOA 2FFYA 5L2FA 2WGWA 4X1LA 5HDSA 4MBKA 4X6TA 1ONHA 2XROA 1G5UA 4X53A 4XUZA 2CMNA 1TDGA 3M6HA 2XA7M 4ME4A 1KE4A 1HTZA 3HJKA 4KG2A 1KE3A 3HLFA 4KZ7A 3BQAA 4K91A 5AQBA 5FQQA 1H8MA 4QB8A 1NJ4A 3IXBA 2P9VA 3C8CA 2VK3A 4EBLA 4OPQA 4RA7A 3ISGA 4CLCA 3G31A 1YLTA 4S2PA 4DE1A 4YNRA 4NXFA 4BBUA 3VOZA 3K3CA 3IXDA 2K31A 2C5WB 3U2AA 5IU1A 1XXMA 3JYIA 2YKFA 2X01A 4Q8IA 3VFHA 3CHWP 2VKSA 3A3DA 3NCKA 5CTMA 3RTYA 3HLGA 3OCNA 1YAXA 3B42A 1MWUA 1YSPA 3DTIA 4E3NA 3TJZC 3TW8A 3NOPC 4I3AA 4WEKA 3ZGAB 3C38A 4ZRRA 1ZG4A 2JCHA 2HJ9C 1N9LA 2R9WA 3IF6C 3FKWA 4NXGA 5DTSA 1K6RA 3HLDA 3BFDA 5F69A 5TBMA 4GHIA 5EVIB 4R0QA 3E2KA 2G2UA 5FASA 3GRJA 3CAXA 4NXEA 1L0GA 1I2SA 3CG5A 3S1YA 3BFFA 1E3UA 5FAOA 3IHBA 1VB6A 2V1ZA 5M1AA 1OTBA 1NY0A 2CC1A 4MBFA 1YPRA 5FL3A 4BLMA 4K0WA 4KUOA 4OLDA 2XSSA 3UB5P 4LENA 4LGWA 4ARZB 3DBAA 3A3EA 2Y2OA 4KZ4A 5EV0A 2VGLM 3UE3A 1M40A 2I9VA 4LFUA 5DF9A 2PAVP 3LY3A 1Y28A 1KGFA 4NXBA 3LR3A 3N8SA 1K55A 5EECA 3LI8A 2ZD8A 3PBSA 1LSXA 2WZZA 4KENB 4MEZA 1T1CA 1NLYA 2HJEA 1N4OA 3BLSA 2DCFA 1QMEA 2OWJA 4QY6A 4BWIA 1E4DA 4JXWA 1G6OA 1K57A 5DTTA 4EQ1A 1HZOA 3WRZA 4UA7A 1YLWA 2VX8A 3TOIA 1TD5A 1YLJA 3UN7A 1SCWA 4DJ2A 1EWZA 4FUWA 2LB9A 4WF0A 3PAGA 4DE3A 1V9ZA 3GECA 1XPBA 4BBVA 4GS9B 1L0FA 3MBZA 3CZDA 3V67A 3KYQA 3A3IA 3ZG5A 3UPPA 5IT5A 5HSQA 3DW0A 4GOGA 3EEAA 5FQIA 2K7SA 4HHDA 4IHQA 5HZHA 3HLCA 1F5MA 5AQAA 5KSCA 4BL3A 1CK3A 4Q0IA 5FDHA 1YLPA 2BTFP 2HF6A 3QP5A 4BQMA 2VV8A 4YWZA 5LBRA 3WS2A 3Q7VB 1PFLA 4AFIA 3P09A 5J3WA 1L0EA 3H9WA 3R4KA 4CLCC 4PM7A 5DF8A 3A0RA 4BD1A 4KZ3A 2ZM0A 4KZ8A 3HREA 2EWVA 2VJWA 2PBYA 3PBRA 4GD8A 2J9OA 3GV9A 5TJJA 2V20A 2JKFA 4JF4A 3S7QA 4ARZA 2KOIA 5A91A 2WKPA 1ES5A 1S6RA 3LY4A 3JPUA 5FQKA 1PZOA 3G30A 5I5LA 2EA9A 1ODVA 3TRCA 5CXWA 5GLDA 2HDQA 2EX9A 4Y0TA 2ZQ8A 1OTIA 4HP9A 4P6ZS 2EFXA 4CQHA 1KVLA 1MXOA 5KZHA 1A0KA 2Y2MA 2J7VA 5CEDA 1K54A 4JGQA 3LEZA 5EOEA 4GLQA 5DKLA 3HVFA 2Q0OA 3KYEA 1BTLA 4CLCD 3UE1A 4EBPA 3B33A 2Q9NA 4RX3A 4BBTA 4ESPA 1L3LA 3ZG9B 2JHEA 1K55C 2ZQCA 5E43A 3KO6A 3L9KA 4WM9A 3G2ZA 4RX2A 1YLYA 1XJ6A 3ZVWA 5CECA 1Q2QA 3MF0A 4HESA 2ZJ9A 3OPRA 2W3GA 2O9BA 1FOFA 5CERA 3PTEA 4DKIA 3G4PA 3RJUA 5KSHA 4ZTKA 5CHJA 3H7WA 4WZ4A 1BSGA 2WK0A 3IS2B 3EEHA 3Q7VA 2JC7A 4PHTA 3LIEA 4UEYA 1LI0A 1PRQA 4DJ3A 1JWPA 3UDIA 3C4OA 5EFWA 2O99A 1W8QA 4S2IA 3UO9A 1AXBA 1SHVA 3MR0A 1E3UD 1W7FA 1W63Q 3SH9A 5M18A 3S7PA 4EUZA 2O0YA 5CGSA 4S2LA 3IX4A 1WYCA 4N92A 4I3IA 2XGNA 4MNRA 2OWHA 1MKIA 1OTAA 3HLEA 4MN7A 1NXYA 2MJ6A 2PR5A 1BZAA 3LEQA 1PNEA 2HP5A 3SH7A 2JN7A 3KSIA 5FI7A 3RH8B 4FSFA 4EQIA 1FCOA 4NG2A 3MKEA 4ZJ3A 5HARA 4EEUA 5HDDA 2JKTI 2ZC5B 4S2OA 3TE8A 3HLWA 4E04A 3IH9A 3NOTC 2H10A 2XDMA 3QP8A 2QJ7A 4B9OA 3V3SA 3VP0A 3Q81A 4EEPA 2ZMFA 1I5QA 1NWZA 4XUXA 4ZBEA 4O01A 1BLSA 1BUEA 2VGKA 3CITA 5DFYA 1L2SA 3E2LA 4HOIA 4OQ0A 2B02A 3E98A 2R9XA 4U3TA 4XT2B 3BFCA 1H8YA 3IH8A 1FCNA 3ZNTA 3NULA 4GDBA 4II7A 4O0PA 3ZG0A 2P04A 3N6IA 1OJGA 3HUNA 1SKFA 1L0DA 3RXXA 1LL9A 4KZ5A 3G2YA 1FIKA 5CTNA 3BW6A 5GLCA 4CJNA 4HI4A 2ACGA 4JGRA 5DJUA 5DFXA 3OPHA 1TS7A 1GHIA 4P6BA 2GZAA 5F6AA 4CLCE 4EETB 3BJNA 1OT9A 1JVJA 3T50A 1XKZA 1K54C 2A2LA 3IS2A 1F9IA 5AVEA 3VP1A 3UB8A 3G6OA 3KYZA 3CUEC 3PR6A 3T1SA 1MBLA 2IWDA 1VETB 5FSRA 4WUJA 2ZM8A 4UA9A 1WA9A 1D06A 1K56A 3K2NA 4LV1A 4L0LA 1E25A 4HH3A 3EQUA 3NDGA 2P08A 5TR7A 4HP4A 2XRNA 4PM6A 2VGJA 1IYSA 3HCYA 5C5KA 3H82A 4FH2A 3BY8A 2W27A 1LL8A 2XA7S 2JBFA 3W2ZA 3F1PA 4QY5A 2PYRA 4Q0HA 5EM0A 3N7WA 2ZOIA 2PU2A 1T19A 3A0VA 3ZG7B 4X68A 1TS6A 2RL3A 2ZQ7A 4GN2A 2UWXA 3LYXA 3LR0A 3UB6A 1U60A 5HL1A 1PWDA 1YM1A 1PZPA 4WN5A 3SS4A 3BEBA 3VSKA 2WADA 3V3RA 1H0MA 4FTXA 1NYMA 1GSXA 4KG5A 2OV5A 4XT2A 4QD4A 4JXGA 1J9MA 2ZQAA 4K0XA 5HDCA 4Y15A 3E0YA 1YKDA 4JLFA 4DXBA 4GJ4A 2OSUA 1BT5A 4KZ9A 2WKQA 1Y54A 5KMWA 2Y2PA 4G3WA 2ZC3B 3OBFA 4E3JA 1J3WA 2ZC7A 3JVUA 3FV7A 5EM1A 1K4EA 5EPHA 4LRZE 3B47A 4B93A 1EI5A 4BENA 2ZC4B 2Y2QA 1T1AA 5DF7A 3R7WA 3TSGA 3M2JA 4M3KA 2V1BA 3I7JA 2IA2A 5J8XA 2WUQA 2Y91A 4UHUA 1GSWA 2W3FA 4PM5A 3A3FA 2VGLS 4HH2A 4L9GA 1PIOA 4PMAA 1MKMA 3WS5A 2ZQ9A 1KGGA 4F3LA 4EU0A 4H6JA 5GL9A 2IWCA 4R3BA 3QP6A 3T4LA 1I2WA 4EWFA 2Y2LA 1PW8A 4PM8A 1OT6A 2VA0A 1XX2A 3Q07A 3MMHA 5F68A 1CF0A 4PM9A 4PAUA 2PU4A 5J4EA 5KIZA 2H5SA 4N1HA 2QJ5A 4OOLA 2J3WA 3VSLA 2Y2GA 5A93A 3OC2A 3NC8A 1KDSA 4HJ3A 3EOIA 3NHQA 4WL9A 1ESIA 5CHMA 3VP3A 2HPBA 2KLIA 3BLMA 2O9CA 4QJGA 3FG8A 1K0KA 1T18A 4FOFA 1H5XA 4LRXC 4I39A 3RFBA 2OOLA 3ZCZA 1W63M 4R4SA 2W1RA 3ZQ5A 4D60A 4WMCA 4HNBA 2PHYA 3CMZA 1ACFA 3V50A 3FPWA 2QZ6A 2V0WA 1YSQA 1DRMA 3LI9A 2YKHA 1GSVA 2L0WA 3TG9A 2HV1A 3FPVA 1KVMA 1DP9A 3CJMA 3K3DA 1TDLA 1ZHHB 4KQQA 4OLGA 2VEAA 1EW0A 3FZCA 4S2MA 2XK1A 2Z2LB 2GDNA 1PWGA 1ZTUA 4QHCA 5EVIA 3OZHA 3T4OA 3DTEA 1XGIA 4WZ5A 4IUKA 3F1NB 3A0SA 3NECA 1GCEA 3P7NA 4MMNA 1NYYA 3F1OB 1FQGA 3Q82A 3P01A 5AQ7A 1DJBA 2B95A 1JTDA 2M7UA 1LT0A 2PDRA 4EBNA 1VEUB 3O86A 4P85A 2A24B 2A49A 4OPYA 1ZKJA 5FQMA 1NRFA 3MZEA 1AWIA 1SDNA 2WAEA 3VE3A 1ES2A 4NEED 3SS5A 4N9LA 4R1GA 1K56D 3P98A 1FSYA 2JKTM 3WRTA 5A92A 2GNXA 3BECA 2G7UA 1XA7A 2XQZA 3UE0A 1KOUA 4BJPA 5CEBA 3FC7A 2FZ0A 5K5BA 4WBGA 4MN6A 1FR6A 1SKOB 3VP2A 1RGZA 4B4XA 1H3QA 5EVEA 5DJTA 2ZL1B 3VFFA 4L9FA 5HWVA 4D2OA 3LCEA 3T4TA 2XFSA 4KZAA 3UDXA 3AGFA 4G3VA 2Y55A 1K6SA 3KSHA 2GJ3A 3CUEA 1PI4A 3CWFA 1LLBA 5FA7A 3VE4A 1JWVA 4P87A 2J80A 4LCMA 3W4PA 4Y7PA 1DJAA 4OQHA 2EX8A 1UWPX 3C30A 4GS9A 4PKYA 1WYBA 2VZWA 3JVVA 5CRFA 5GLAA 2BG1A 4NK3A 4PKYG 2EX2A 3ITBA 1RCJA 4LLOB 3RXWA 3GQZA 2AVXA 3ZNYA 4GKUA 5DKKA 2L4RA 4GCZA 2P74A 2XF3A 1KGEA 2ZM2A 4FD8A 4QWOA 4Y5FA 1N9BA 3NOUC 5HL6A 3ZFZA 1ZC2A 4B88A
chains in the Genus database with same CATH topology
2Y2KA 1L0GA 1I2SA 2Y2IA 2EFUA 3VP1A 2OLVA 3CG5A 3OPLA 4JF5A 3S1YA 1O7EA 4S2JA 3BFFA 3O88A 4DXCA 3G35A 1E3UA 1MBLA 1ZG6A 2IWDA 3IHBA 4R4RA 5FAOA 3MXSA 2XEPA 4LCLA 3OPPA 3FKVA 2V1ZA 5FSRA 1K4FA 5M1AA 2HDSA 2EX6A 4WEJA 1ES3A 4PPRA 1NY0A 3V39A 3GRJA 5E2GA 2ZM8A 2CC1A 3NI9A 4MBFA 4BLMA 3WS0A 4K0WA 4OLDA 2Y2HA 1IELA 4UA9A 4LENA 4E3IA 1K56A 4UA6A 3A3EA 1RGYA 2Y2OA 2OLUA 4KZ4A 1VM1A 3UE3A 1M40A 1BULA 4LV1A 3AGDA 2HP6A 3GMWA 5DTKA 4L0LA 1Z6FA 4ID4A 1IYPA 1CEFA 5DF9A 1E25A 1FCMA 4OPRA 4GDNA 3LY3A 3EQUA 1DJCA 1TVFA 3NDGA 1PWCA 2I72A 1FR1A 1KGFA 2WAFA 5TR7A 4PM6A 2VGJA 5EOOA 3UPOA 1IYSA 5EVIC 1FSWA 2EXBA 3LO7A 2WKEA 3N8SA 1K55A 5E2HA 4X56A 4FH2A 3IWQA 5DVAA 5EECA 4WZ5C 1YMSA 2JBFA 2ZD8A 1W5DA 3D4FA 3PBSA 4QY5A 2WZZA 3B3XA 4KENB 3NBLA 4MEZA 4E3OA 5F1FA 3MFDA 3IF6B 4FH4A 5FATA 1K25A 1N4OA 2XR0A 3N7WA 1XP4A 3BLSA 2WGVA 4DDYA 5HAIA 2DCFA 1DY6A 2PU2A 5D3OA 1QMEA 3ZG7B 1M6KA 4C3QA 4X68A 4HBUA 5I94A 2RL3A 2ZQ7A 4QY6A 3QNBA 1YMXA 3N8RA 4YINA 1E4DA 4JXWA 4OVDA 4GN2A 1K57A 2UWXA 3W8KA 3QNCA 5HAQA 5DTTA 1U60A 1HZOA 3BFEA 3WRZA 3VP4A 1PWDA 5HL1A 4UA7A 4C75A 1YM1A 1PZPA 1YLWA 2XLNA 4S2NC 3WS4A 3G32A 3SS4A 5FAPA 3BEBA 1YT4A 3TOIA 1YLJA 3Q1FA 1GHMA 3UN7A 1SCWA 3VSKA 2WADA 1EWZA 1JWZA 3V3RA 4WMCD 3BYDA 2BLSA 3PAGA 4DE3A 1NYMA 4KG5A 1XPBA 2OV5A 1IKGA 4QD4A 4WELA 4IVKA 3GR2A 4JXGA 2HDRA 3O3VA 1J9MA 4E6WA 2ZQAA 4K0XA 3VMAA 3DWZA 3C4PA 1JTGA 5E2EA 1L0FA 4JLFA 1RP5A 3MBZA 4DXBA 5HW3A 3CZDA 1MY8A 4HEFA 3A3IA 3ZG5A 3MZFA 2OSUA 3UPPA 3GSGA 3DW0A 4GD6A 3ITAA 1BT5A 3PBTA 5EUAA 4GOGA 4KZ9A 4OP5A 3IT9A 1Y54A 5FQJA 5FQIA 4DE2A 3M2KA 5KMWA 2Y2PA 2ZC3B 3HLCA 4E3JA 4OH0A 1KDWA 2ZC7A 5AQAA 4CPKA 4BL3A 3FV7A 1ESUA 5KSCA 3UNWA 1CK3A 4GB7A 1K4EA 3C7UA 5EPHA 1YLPA 3HUOA 5FDHA 1IEMA 2HP9A 1ALQA 1EI5A 4BQMA 4BENA 2ZC4B 2Y2QA 1GA0A 3WS2A 5EVID 3Q7VB 3NIAA 3FYZA 5EE8A 4LV3A 3ZDJA 5DF7A 3TSGA 3M2JA 1K57C 4M3KA 3I7JA 5BOHA 4MBHA 3P09A 1MWTA 1GHPA 5CGXA 4BD0A 1L0EA 4R3JA 2WUQA 4E3MA 5J8XA 2Y91A 2X71A 4PM7A 4UHUA 4JPMA 5DF8A 2WYXA 3ZVTA 4BD1A 4PM5A 3A3FA 4X55A 4KZ3A 2ZM0A 2IWBA 4E3LA 2WKIA 3WWXA 4KZ8A 3HREA 3PAEA 4XXRA 1C3BA 1PIOA 4PMAA 3WS5A 2PBYA 3PBRA 2ZQ9A 1KGGA 4GD8A 2J9OA 4OQIA 1IKIA 1SDEA 1KE0A 3GV9A 5GL9A 4KZ6A 2IWCA 4R3BA 5TGFA 2V20A 2Y4AA 4JF4A 1XA1A 5EVLA 3V5MA 1CI8A 2J9PA 1BLHA 4OQGA 2RCXA 1I2WA 4EWFA 2Y2LA 1PW8A 1PI5A 3VOYA 4PM8A 5TFQA 2B5RA 1XX2A 3BRMA 3IXGA 3Q07A 5A91A 2V2FF 2H0YA 4PM9A 1ES5A 1S6RA 3LY4A 3N8LA 4QU3A 4IBRA 1O07A 5FQKA 4IVIA 1PZOA 4RYEA 3G30A 2PU4A 4OKPA 5GHZA 4B4ZA 3HUMA 4R23A 4NETA 2XD1A 3GVBA 4OOMA 5F1GA 2H5SA 1OMEA 4N1HA 3W4QA 1ERQA 3OCLA 2WGWB 3GTCA 2ZC6B 3DWKA 4OOLA 5CXWA 3BFGA 1VQQA 3VSLA 2Y2GA 5A93A 3SH8A 4P0MA 5GLDA 2HDQA 2EX9A 3OC2A 4Y0TA 1MWRA 2ZQ8A 2G2WA 2WZXA 1KDSA 3NC8A 3IF6A 3PBOA 4HBTA 2ZQDA 4ZAMA 1TEMA 1ESIA 5CHMA 2EFXA 5HAPA 3VP3A 1WE4A 5HX9A 5FAQA 1KVLA 1MXOA 2HPBA 3BLMA 4QJGA 5KZHA 4YFMA 2Y2MA 2XH9A 4JXVA 3PBQA 3QHYA 1H5XA 2J7VA 1K54A 5CEDA 1LI9A 1G6AA 3UY6A 3LEZA 2P9VB 1K38A 1H8ZA 4MLLA 4R4SA 5EOEA 2EXAA 3ZCZA 4WMCA 5CGWA 2ZMAA 4OONA 2C6WB 3HVFA 2A3UA 4LV0A 3IWIA 1EROA 3ZG8B 1LL5A 1BTLA 2E8IA 3CMZA 3PBNA 2DNSA 1BLPA 1LHYA 3UE1A 4EBPA 4EV4A 4F94A 4RX3A 2Q9NA 3V50A 4A5RA 4ZDXA 2QMIA 1Q2PA 2QZ6A 1CI9A 3ZG9B 1IYQA 2FFFB 2Y2NA 1K55C 2ZQCA 5E43A 3NDEA 3TG9A 1YLZA 1GA9A 4JF6A 4WM9A 1KVMA 3G2ZA 4RX2A 1YLYA 2J8YA 2XFTA 3CJMA 3ZVWA 5CECA 4KG6A 4DDSA 1Q2QA 4HESA 1TDLA 4KQQA 4OLGA 2ZJ9A 2H0TA 5GHXA 4IEDA 3OPRA 3W4OA 3FZCA 4S2MA 1FOFA 5CERA 3PTEA 3O87A 2XK1A 2Z2LB 4DKIA 3IXHA 2GDNA 3MKFA 1PWGA 5AQ9A 3G4PA 3RJUA 3UDFA 5KSHA 4ZTKA 3S22A 4QHCA 5EVIA 3OZHA 5CHJA 2WKHA 1ERMA 1XGIA 3M6BA 3G34A 5F82A 4WZ5A 4WZ4A 1BSGA 2WK0A 4Y0OA 1GCEA 4KQRA 3Q7VA 1NYYA 1HVBA 1W8YA 2JC7A 4H8RA 3DTMA 5FI6A 1FQGA 1LI0A 3Q82A 5AQ7A 2JE5A 1JWPA 1PYYA 1DJBA 3MXRA 4ZJ2A 3UDIA 3C4OA 3MZDA 1JTDA 1W8QA 5A90A 4S2IA 4X69A 1W79A 4EBNA 3UO9A 3C5AA 5JYOA 3O86A 3IWOA 4P85A 1AXBA 1SHVA 1E3UD 1W7FA 2A49A 4OPYA 3SH9A 5M18A 1ZKJA 2DRWA 5FQMA 4EUZA 1NRFA 3MZEA 4KZBA 3IHAA 2Z2MB 4WYYA 5CGSA 4S2LA 1WYCA 3UPNA 4UAAA 3N4IA 4ZJ1A 1SDNA 2WAEA 1MPLA 4N92A 4O7DA 2XGNA 5E2FA 4MNRA 4S2NA 1ES2A 1NZOA 4U0TA 4N9LA 3SS5A 4R1GA 4DF6A 1MKIA 1K56D 3P98A 5GHYA 3EQVA 2HDUA 4RVAA 4Z9QA 1FSYA 3HLEA 1G68A 1NXYA 1BZAA 5JYPA 3WRTA 5A92A 3HLBA 3NY4A 3BECA 5FI2A 4E6XA 5M19A 1XA7A 2HP5A 2XQZA 3BM6A 3UE0A 4BJPA 4C6YA 4DRTA 3SH7A 5CEBA 1XGJA 3SS3A 4U0XA 4WBGA 5FI7A 2WGIA 4FSFA 4N9KA 4LV2A 4OPZA 2QPNA 4EQIA 1FR6A 2Q9MA 5U47A 1FCOA 5F83A 3MKEA 1RGZA 5HARA 4ZJ3A 3VP2A 3ZHHA 4B4XA 5CHUA 2FFYA 2ZC5B 5L2FA 2WGWA 1YQSA 4S2OA 3VFFA 3WS1A 3HLWA 3HL9A 4MBKA 4X6TA 1IYOA 1ONHA 3IH9A 2Y2JA 2H10A 3LCEA 3Q7ZA 4D2OA 2XDMA 4X53A 4XUZA 1TDGA 2XD5A 3C7VA 3M6HA 5IHVA 3SOIA 2XFSA 3V3SA 1KE4A 3Q81A 3VP0A 4KZAA 3UDXA 1HTZA 1ES4A 3AGFA 4KG2A 2Y55A 1K6SA 1I5QA 4XUXA 1KE3A 5GLBA 3HLFA 4ZBEA 3S4XA 4KZ7A 4N1XA 4K91A 1PI4A 3HBRA 5AQBA 1BLSA 5FQQA 4QB8A 4DE0A 1NJ4A 1BUEA 2VGKA 1CEGA 4FCFA 4BL2A 4GNUA 3IXBA 4JBFA 2P9VA 1LLBA 5FA7A 5G18A 1L2SA 4EBLA 1JWVA 1ONGA 3E2LA 4OPQA 2X02A 4OQ0A 4RA7A 3ISGA 2ZLYA 4P87A 3G31A 1YLTA 4S2PA 3IQAA 4Y0UA 4DE1A 2R9XA 4LCMA 4KQOA 4U3TA 3W4PA 4E3KA 4Y7PA 3VOZA 3IXDA 3BFCA 3IF5A 1H8YA 1DJAA 2Y59A 4OQHA 3IH8A 1FCNA 3ZNTA 1HD8A 2EX8A 4JXSA 2C5WB 4GDBA 1WYBA 1XXMA 3JYIA 3ZG0A 5GLAA 5CRFA 2BG1A 2X01A 4Q8IA 4NK3A 3VFHA 2EX2A 3FWLA 3ITBA 5HFOA 3A3DA 3N6IA 3NCKA 1S0WA 3HUNA 5CTMA 1SKFA 3HLGA 1RCJA 3OCNA 1L0DA 1MWUA 3RXWA 3GQZA 1PW1A 3RXXA 1LL9A 4KZ5A 3ZNYA 3G2YA 4OOYA 4E3NA 4OP8A 4GKUA 5CTNA 4WEKA 3ZGAB 3A3JA 5GLCA 1ZG4A 4CJNA 2JCHA 2P74A 2XF3A 2R9WA 3IF6C 4GZBA 1KGEA 3FKWA 2ZM2A 1NZUA 4S2KA 4FD8A 3OPHA 1GHIA 1K6RA 3HLDA 3BFDA 4P6BA 3AGEA 1BLCA 5DTSA 4JKTA 1N9BA 1QMFA 4IBXA 3ZFZA 1JVJA 1MWSA 1ZC2A 5EVIB 4R0QA 4B88A 3E2KA 1XKZA 2G2UA 5FASA 1K54C 5FQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2K A;  1L0G A;  1I2S A;  2Y2I A;  2EFU A;  3VP1 A;  2OLV A;  3CG5 A;  3OPL A;  4JF5 A;  3S1Y A;  1O7E A;  4S2J A;  3BFF A;  3O88 A;  4DXC A;  3G35 A;  1E3U A;  1MBL A;  1ZG6 A;  2IWD A;  3IHB A;  4R4R A;  5FAO A;  3MXS A;  2XEP A;  4LCL A;  3OPP A;  3FKV A;  2V1Z A;  5FSR A;  1K4F A;  5M1A A;  2HDS A;  2EX6 A;  4WEJ A;  1ES3 A;  4PPR A;  1NY0 A;  3V39 A;  3GRJ A;  5E2G A;  2ZM8 A;  2CC1 A;  3NI9 A;  4MBF A;  4BLM A;  3WS0 A;  4K0W A;  4OLD A;  2Y2H A;  1IEL A;  4UA9 A;  4LEN A;  4E3I A;  1K56 A;  4UA6 A;  3A3E A;  1RGY A;  2Y2O A;  2OLU A;  4KZ4 A;  1VM1 A;  3UE3 A;  1M40 A;  1BUL A;  4LV1 A;  3AGD A;  2HP6 A;  3GMW A;  5DTK A;  4L0L A;  1Z6F A;  4ID4 A;  1IYP A;  1CEF A;  5DF9 A;  1E25 A;  1FCM A;  4OPR A;  4GDN A;  3LY3 A;  3EQU A;  1DJC A;  1TVF A;  3NDG A;  1PWC A;  2I72 A;  1FR1 A;  1KGF A;  2WAF A;  5TR7 A;  4PM6 A;  2VGJ A;  5EOO A;  3UPO A;  1IYS A;  5EVI C;  1FSW A;  2EXB A;  3LO7 A;  2WKE A;  3N8S A;  1K55 A;  5E2H A;  4X56 A;  4FH2 A;  3IWQ A;  5DVA A;  5EEC A;  4WZ5 C;  1YMS A;  2JBF A;  2ZD8 A;  1W5D A;  3D4F A;  3PBS A;  4QY5 A;  2WZZ A;  3B3X A;  4KEN B;  3NBL A;  4MEZ A;  4E3O A;  5F1F A;  3MFD A;  3IF6 B;  4FH4 A;  5FAT A;  1K25 A;  1N4O A;  2XR0 A;  3N7W A;  1XP4 A;  3BLS A;  2WGV A;  4DDY A;  5HAI A;  2DCF A;  1DY6 A;  2PU2 A;  5D3O A;  1QME A;  3ZG7 B;  1M6K A;  4C3Q A;  4X68 A;  4HBU A;  5I94 A;  2RL3 A;  2ZQ7 A;  4QY6 A;  3QNB A;  1YMX A;  3N8R A;  4YIN A;  1E4D A;  4JXW A;  4OVD A;  4GN2 A;  1K57 A;  2UWX A;  3W8K A;  3QNC A;  5HAQ A;  5DTT A;  1U60 A;  1HZO A;  3BFE A;  3WRZ A;  3VP4 A;  1PWD A;  5HL1 A;  4UA7 A;  4C75 A;  1YM1 A;  1PZP A;  1YLW A;  2XLN A;  4S2N C;  3WS4 A;  3G32 A;  3SS4 A;  5FAP A;  3BEB A;  1YT4 A;  3TOI A;  1YLJ A;  3Q1F A;  1GHM A;  3UN7 A;  1SCW A;  3VSK A;  2WAD A;  1EWZ A;  1JWZ A;  3V3R A;  4WMC D;  3BYD A;  2BLS A;  3PAG A;  4DE3 A;  1NYM A;  4KG5 A;  1XPB A;  2OV5 A;  1IKG A;  4QD4 A;  4WEL A;  4IVK A;  3GR2 A;  4JXG A;  2HDR A;  3O3V A;  1J9M A;  4E6W A;  2ZQA A;  4K0X A;  3VMA A;  3DWZ A;  3C4P A;  1JTG A;  5E2E A;  1L0F A;  4JLF A;  1RP5 A;  3MBZ A;  4DXB A;  5HW3 A;  3CZD A;  1MY8 A;  4HEF A;  3A3I A;  3ZG5 A;  3MZF A;  2OSU A;  3UPP A;  3GSG A;  3DW0 A;  4GD6 A;  3ITA A;  1BT5 A;  3PBT A;  5EUA A;  4GOG A;  4KZ9 A;  4OP5 A;  3IT9 A;  1Y54 A;  5FQJ A;  5FQI A;  4DE2 A;  3M2K A;  5KMW A;  2Y2P A;  2ZC3 B;  3HLC A;  4E3J A;  4OH0 A;  1KDW A;  2ZC7 A;  5AQA A;  4CPK A;  4BL3 A;  3FV7 A;  1ESU A;  5KSC A;  3UNW A;  1CK3 A;  4GB7 A;  1K4E A;  3C7U A;  5EPH A;  1YLP A;  3HUO A;  5FDH A;  1IEM A;  2HP9 A;  1ALQ A;  1EI5 A;  4BQM A;  4BEN A;  2ZC4 B;  2Y2Q A;  1GA0 A;  3WS2 A;  5EVI D;  3Q7V B;  3NIA A;  3FYZ A;  5EE8 A;  4LV3 A;  3ZDJ A;  5DF7 A;  3TSG A;  3M2J A;  1K57 C;  4M3K A;  3I7J A;  5BOH A;  4MBH A;  3P09 A;  1MWT A;  1GHP A;  5CGX A;  4BD0 A;  1L0E A;  4R3J A;  2WUQ A;  4E3M A;  5J8X A;  2Y91 A;  2X71 A;  4PM7 A;  4UHU A;  4JPM A;  5DF8 A;  2WYX A;  3ZVT A;  4BD1 A;  4PM5 A;  3A3F A;  4X55 A;  4KZ3 A;  2ZM0 A;  2IWB A;  4E3L A;  2WKI A;  3WWX A;  4KZ8 A;  3HRE A;  3PAE A;  4XXR A;  1C3B A;  1PIO A;  4PMA A;  3WS5 A;  2PBY A;  3PBR A;  2ZQ9 A;  1KGG A;  4GD8 A;  2J9O A;  4OQI A;  1IKI A;  1SDE A;  1KE0 A;  3GV9 A;  5GL9 A;  4KZ6 A;  2IWC A;  4R3B A;  5TGF A;  2V20 A;  2Y4A A;  4JF4 A;  1XA1 A;  5EVL A;  3V5M A;  1CI8 A;  2J9P A;  1BLH A;  4OQG A;  2RCX A;  1I2W A;  4EWF A;  2Y2L A;  1PW8 A;  1PI5 A;  3VOY A;  4PM8 A;  5TFQ A;  2B5R A;  1XX2 A;  3BRM A;  3IXG A;  3Q07 A;  5A91 A;  2V2F F;  2H0Y A;  4PM9 A;  1ES5 A;  1S6R A;  3LY4 A;  3N8L A;  4QU3 A;  4IBR A;  1O07 A;  5FQK A;  4IVI A;  1PZO A;  4RYE A;  3G30 A;  2PU4 A;  4OKP A;  5GHZ A;  4B4Z A;  3HUM A;  4R23 A;  4NET A;  2XD1 A;  3GVB A;  4OOM A;  5F1G A;  2H5S A;  1OME A;  4N1H A;  3W4Q A;  1ERQ A;  3OCL A;  2WGW B;  3GTC A;  2ZC6 B;  3DWK A;  4OOL A;  5CXW A;  3BFG A;  1VQQ A;  3VSL A;  2Y2G A;  5A93 A;  3SH8 A;  4P0M A;  5GLD A;  2HDQ A;  2EX9 A;  3OC2 A;  4Y0T A;  1MWR A;  2ZQ8 A;  2G2W A;  2WZX A;  1KDS A;  3NC8 A;  3IF6 A;  3PBO A;  4HBT A;  2ZQD A;  4ZAM A;  1TEM A;  1ESI A;  5CHM A;  2EFX A;  5HAP A;  3VP3 A;  1WE4 A;  5HX9 A;  5FAQ A;  1KVL A;  1MXO A;  2HPB A;  3BLM A;  4QJG A;  5KZH A;  4YFM A;  2Y2M A;  2XH9 A;  4JXV A;  3PBQ A;  3QHY A;  1H5X A;  2J7V A;  1K54 A;  5CED A;  1LI9 A;  1G6A A;  3UY6 A;  3LEZ A;  2P9V B;  1K38 A;  1H8Z A;  4MLL A;  4R4S A;  5EOE A;  2EXA A;  3ZCZ A;  4WMC A;  5CGW A;  2ZMA A;  4OON A;  2C6W B;  3HVF A;  2A3U A;  4LV0 A;  3IWI A;  1ERO A;  3ZG8 B;  1LL5 A;  1BTL A;  2E8I A;  3CMZ A;  3PBN A;  2DNS A;  1BLP A;  1LHY A;  3UE1 A;  4EBP A;  4EV4 A;  4F94 A;  4RX3 A;  2Q9N A;  3V50 A;  4A5R A;  4ZDX A;  2QMI A;  1Q2P A;  2QZ6 A;  1CI9 A;  3ZG9 B;  1IYQ A;  2FFF B;  2Y2N A;  1K55 C;  2ZQC A;  5E43 A;  3NDE A;  3TG9 A;  1YLZ A;  1GA9 A;  4JF6 A;  4WM9 A;  1KVM A;  3G2Z A;  4RX2 A;  1YLY A;  2J8Y A;  2XFT A;  3CJM A;  3ZVW A;  5CEC A;  4KG6 A;  4DDS A;  1Q2Q A;  4HES A;  1TDL A;  4KQQ A;  4OLG A;  2ZJ9 A;  2H0T A;  5GHX A;  4IED A;  3OPR A;  3W4O A;  3FZC A;  4S2M A;  1FOF A;  5CER A;  3PTE A;  3O87 A;  2XK1 A;  2Z2L B;  4DKI A;  3IXH A;  2GDN A;  3MKF A;  1PWG A;  5AQ9 A;  3G4P A;  3RJU A;  3UDF A;  5KSH A;  4ZTK A;  3S22 A;  4QHC A;  5EVI A;  3OZH A;  5CHJ A;  2WKH A;  1ERM A;  1XGI A;  3M6B A;  3G34 A;  5F82 A;  4WZ5 A;  4WZ4 A;  1BSG A;  2WK0 A;  4Y0O A;  1GCE A;  4KQR A;  3Q7V A;  1NYY A;  1HVB A;  1W8Y A;  2JC7 A;  4H8R A;  3DTM A;  5FI6 A;  1FQG A;  1LI0 A;  3Q82 A;  5AQ7 A;  2JE5 A;  1JWP A;  1PYY A;  1DJB A;  3MXR A;  4ZJ2 A;  3UDI A;  3C4O A;  3MZD A;  1JTD A;  1W8Q A;  5A90 A;  4S2I A;  4X69 A;  1W79 A;  4EBN A;  3UO9 A;  3C5A A;  5JYO A;  3O86 A;  3IWO A;  4P85 A;  1AXB A;  1SHV A;  1E3U D;  1W7F A;  2A49 A;  4OPY A;  3SH9 A;  5M18 A;  1ZKJ A;  2DRW A;  5FQM A;  4EUZ A;  1NRF A;  3MZE A;  4KZB A;  3IHA A;  2Z2M B;  4WYY A;  5CGS A;  4S2L A;  1WYC A;  3UPN A;  4UAA A;  3N4I A;  4ZJ1 A;  1SDN A;  2WAE A;  1MPL A;  4N92 A;  4O7D A;  2XGN A;  5E2F A;  4MNR A;  4S2N A;  1ES2 A;  1NZO A;  4U0T A;  4N9L A;  3SS5 A;  4R1G A;  4DF6 A;  1MKI A;  1K56 D;  3P98 A;  5GHY A;  3EQV A;  2HDU A;  4RVA A;  4Z9Q A;  1FSY A;  3HLE A;  1G68 A;  1NXY A;  1BZA A;  5JYP A;  3WRT A;  5A92 A;  3HLB A;  3NY4 A;  3BEC A;  5FI2 A;  4E6X A;  5M19 A;  1XA7 A;  2HP5 A;  2XQZ A;  3BM6 A;  3UE0 A;  4BJP A;  4C6Y A;  4DRT A;  3SH7 A;  5CEB A;  1XGJ A;  3SS3 A;  4U0X A;  4WBG A;  5FI7 A;  2WGI A;  4FSF A;  4N9K A;  4LV2 A;  4OPZ A;  2QPN A;  4EQI A;  1FR6 A;  2Q9M A;  5U47 A;  1FCO A;  5F83 A;  3MKE A;  1RGZ A;  5HAR A;  4ZJ3 A;  3VP2 A;  3ZHH A;  4B4X A;  5CHU A;  2FFY A;  2ZC5 B;  5L2F A;  2WGW A;  1YQS A;  4S2O A;  3VFF A;  3WS1 A;  3HLW A;  3HL9 A;  4MBK A;  4X6T A;  1IYO A;  1ONH A;  3IH9 A;  2Y2J A;  2H10 A;  3LCE A;  3Q7Z A;  4D2O A;  2XDM A;  4X53 A;  4XUZ A;  1TDG A;  2XD5 A;  3C7V A;  3M6H A;  5IHV A;  3SOI A;  2XFS A;  3V3S A;  1KE4 A;  3Q81 A;  3VP0 A;  4KZA A;  3UDX A;  1HTZ A;  1ES4 A;  3AGF A;  4KG2 A;  2Y55 A;  1K6S A;  1I5Q A;  4XUX A;  1KE3 A;  5GLB A;  3HLF A;  4ZBE A;  3S4X A;  4KZ7 A;  4N1X A;  4K91 A;  1PI4 A;  3HBR A;  5AQB A;  1BLS A;  5FQQ A;  4QB8 A;  4DE0 A;  1NJ4 A;  1BUE A;  2VGK A;  1CEG A;  4FCF A;  4BL2 A;  4GNU A;  3IXB A;  4JBF A;  2P9V A;  1LLB A;  5FA7 A;  5G18 A;  1L2S A;  4EBL A;  1JWV A;  1ONG A;  3E2L A;  4OPQ A;  2X02 A;  4OQ0 A;  4RA7 A;  3ISG A;  2ZLY A;  4P87 A;  3G31 A;  1YLT A;  4S2P A;  3IQA A;  4Y0U A;  4DE1 A;  2R9X A;  4LCM A;  4KQO A;  4U3T A;  3W4P A;  4E3K A;  4Y7P A;  3VOZ A;  3IXD A;  3BFC A;  3IF5 A;  1H8Y A;  1DJA A;  2Y59 A;  4OQH A;  3IH8 A;  1FCN A;  3ZNT A;  1HD8 A;  2EX8 A;  4JXS A;  2C5W B;  4GDB A;  1WYB A;  1XXM A;  3JYI A;  3ZG0 A;  5GLA A;  5CRF A;  2BG1 A;  2X01 A;  4Q8I A;  4NK3 A;  3VFH A;  2EX2 A;  3FWL A;  3ITB A;  5HFO A;  3A3D A;  3N6I A;  3NCK A;  1S0W A;  3HUN A;  5CTM A;  1SKF A;  3HLG A;  1RCJ A;  3OCN A;  1L0D A;  1MWU A;  3RXW A;  3GQZ A;  1PW1 A;  3RXX A;  1LL9 A;  4KZ5 A;  3ZNY A;  3G2Y A;  4OOY A;  4E3N A;  4OP8 A;  4GKU A;  5CTN A;  4WEK A;  3ZGA B;  3A3J A;  5GLC A;  1ZG4 A;  4CJN A;  2JCH A;  2P74 A;  2XF3 A;  2R9W A;  3IF6 C;  4GZB A;  1KGE A;  3FKW A;  2ZM2 A;  1NZU A;  4S2K A;  4FD8 A;  3OPH A;  1GHI A;  1K6R A;  3HLD A;  3BFD A;  4P6B A;  3AGE A;  1BLC A;  5DTS A;  4JKT A;  1N9B A;  1QMF A;  4IBX A;  3ZFZ A;  1JVJ A;  1MWS A;  1ZC2 A;  5EVI B;  4R0Q A;  4B88 A;  3E2K A;  1XKZ A;  2G2U A;  5FAS A;  1K54 C;  5FQ9 A; 
#chains in the Genus database with same CATH topology
 3F1N A;  2Y2K A;  2W1T B;  2EFU A;  2OLV A;  3OPL A;  4S2J A;  3O88 A;  4DXC A;  3G35 A;  1ZG6 A;  3T1X A;  1BYW A;  4R4R A;  3MXS A;  2PD7 A;  4LCL A;  3OPP A;  3FKV A;  4JGP A;  4WEJ A;  1VEU A;  1ES3 A;  2V1A A;  3V39 A;  5E2G A;  4Y13 A;  1XJ2 A;  2Y2H A;  4E3I A;  4UA6 A;  4KUK A;  3LGO A;  3DAV A;  1VM1 A;  3E4O A;  5IS1 A;  5DTK A;  4ID4 A;  1IYP A;  1CEF A;  2PR6 A;  1FCM A;  1TVF A;  1FR1 A;  3C2W A;  3QP2 A;  5EOO A;  3UPO A;  5EVI C;  1FSW A;  2EXB A;  1N9N A;  2EWW A;  2WKE A;  4Z1W A;  5E2H A;  1OJ5 A;  1UGU A;  4X56 A;  3IWQ A;  4WZ5 C;  1YMS A;  5HD3 A;  1W5D A;  3D4F A;  3NBL A;  3MFD A;  4FH4 A;  5FAT A;  3LIF A;  2M7V A;  1XP4 A;  1FIL A;  2WGV A;  4DDY A;  1DY6 A;  3CPT B;  1M6K A;  4MDZ A;  1V9Y A;  4HBU A;  2ZMV A;  3QNB A;  3MXQ A;  4YIN A;  4OVD A;  5HAQ A;  3BQ8 A;  3BFE A;  3VP4 A;  2XLN A;  2V8F A;  2H28 A;  2VLG A;  1GHM A;  2JKG A;  1JWZ A;  4CLC B;  4WMC D;  3LID A;  1IKG A;  4IVK A;  3GR2 A;  4LPZ A;  2HDR A;  4E6W A;  3LIC A;  3ZYT A;  2PYP A;  3VMA A;  5MC7 A;  3DWZ A;  3C4P A;  5E2E A;  1MY8 A;  4HEF A;  3DTK A;  5EUA A;  2V9A A;  3IT9 A;  4UQI M;  5FQJ A;  4OH0 A;  1KDW A;  1ESU A;  3C7U A;  3IBR A;  4R6L A;  4Y3I A;  2HP9 A;  3PYP A;  3LIA A;  1GA0 A;  4HJ4 A;  5EVI D;  5EE8 A;  2HGV A;  4LV3 A;  3ZDJ A;  3OLO A;  1S4S A;  4MBH A;  4R38 A;  4MN5 A;  5CGX A;  4E3M A;  2X71 A;  3T1Q B;  2WYX A;  5G4Z A;  2IWB A;  4E3L A;  5J7E A;  3PAE A;  1MZU A;  3PHY A;  2QHK A;  1C3B A;  1IKI A;  3D72 A;  4KZ6 A;  2Y4A A;  4BMW A;  5EVL A;  3V5M A;  1CI8 A;  2J9P A;  1BLH A;  2RCX A;  1PI5 A;  2ZBB A;  3VOY A;  5CX7 A;  2V2F F;  2PD8 A;  2Y79 A;  2BAS A;  3N8L A;  4M4X A;  1O07 A;  4IVI A;  1P9W A;  4RYE A;  5GHZ A;  4R23 A;  2XD1 A;  3GVB A;  4Y17 A;  1MC0 A;  3W4Q A;  1OME A;  1ERQ A;  3OCL A;  3GTC A;  2PT7 A;  2ZC6 B;  4RQ9 A;  1CQA A;  2R78 A;  1MWR A;  2G2W A;  3KX0 X;  5G4Y A;  4HBT A;  2ZQD A;  3IX3 A;  2E8J A;  5HAP A;  3CPT A;  1WE4 A;  5HX9 A;  5FAQ A;  4ETX A;  3EWK A;  4YFM A;  2XH9 A;  3PBQ A;  3QHY A;  1F2K A;  3UY6 A;  1TS0 A;  3BWL A;  1K38 A;  4MLL A;  4Y2F A;  5CGW A;  2C6W B;  4LV0 A;  4I3J A;  3IWI A;  1ERO A;  3ZG8 B;  2E8I A;  2D02 A;  4F94 A;  4A5R A;  1Q2P A;  1IYQ A;  1LSW A;  2FFF B;  2Y2N A;  1YLZ A;  5FDS A;  1GA9 A;  2J8Y A;  2XFT A;  4KG6 A;  4DDS A;  2H0T A;  5GHX A;  3LFV A;  3W4O A;  1S1Y A;  4X1M A;  5AQ9 A;  4NKP A;  3T12 B;  5FEF A;  5F82 A;  3M6B A;  4Q0J A;  2HZ5 A;  3MFX A;  2FH5 A;  1HVB A;  4H8R A;  5FI6 A;  1VET A;  2JE5 A;  3MXR A;  2OAP 1;  1S1Z A;  3HJI A;  5A90 A;  3T4S A;  1W79 A;  1NRJ A;  2DRW A;  3IHA A;  2Z2M B;  1XFN A;  2W0N A;  4UAA A;  3N4I A;  1N9O A;  1JNU A;  1MPL A;  4IJG A;  4S2N A;  3D3O A;  1NZO A;  4U0T A;  5GHY A;  2HDU A;  4Z9Q A;  1Y4O A;  3NJA A;  2Z6D A;  3NY4 A;  3BY9 A;  4E6X A;  5M19 A;  4C6Y A;  2VV7 A;  3SS3 A;  2JKR I;  2WGI A;  4X25 A;  1Z09 A;  4N9K A;  4LV2 A;  4OPZ A;  2QPN A;  2W3D A;  1LSV A;  5CHU A;  1NLZ A;  5F5Y A;  4G3K A;  1YQS A;  3OOV A;  3WS1 A;  3HL9 A;  1IYO A;  2Y2J A;  3Q7Z A;  2XD5 A;  3C7V A;  5IHV A;  4I38 A;  3SOI A;  1XFQ A;  1ES4 A;  3D9Y A;  5GLB A;  3S4X A;  4N1X A;  3S7O A;  3HBR A;  4DE0 A;  4FCF A;  1CEG A;  4BL2 A;  4GNU A;  4JBF A;  5G18 A;  1ONG A;  2X02 A;  2ZLY A;  4Y0U A;  3IQA A;  4KQO A;  2K2N A;  4E3K A;  3IF5 A;  2O9A A;  3MJQ A;  3MS6 A;  2Y59 A;  1HD8 A;  4JXS A;  1IOU A;  3LR5 A;  3FWL A;  5HFO A;  4HIA A;  1S0W A;  4QPR A;  3PXP A;  1PW1 A;  2WKR A;  3LUQ A;  4ETZ A;  4OOY A;  4OP8 A;  1OTE A;  3A3J A;  2QYB A;  4EXO A;  4GZB A;  1NZU A;  4S2K A;  3AGE A;  1BLC A;  4JKT A;  1QMF A;  4IBX A;  1MWS A;  5FQ9 A;  3H7W B;  2Y2I A;  1DP6 A;  4JF5 A;  1O7E A;  4EW7 A;  2XEP A;  3GDI A;  1K4F A;  2HDS A;  2EX6 A;  1P9R A;  4PPR A;  3NI9 A;  3S7N A;  3WS0 A;  5AVF A;  1IEL A;  1F98 A;  1RGY A;  5L8M A;  2OLU A;  2DMW A;  1BUL A;  3AGD A;  2HP6 A;  3GMW A;  2L1M A;  1Z6F A;  4OPR A;  4GDN A;  1DJC A;  1PWC A;  2I72 A;  2WAF A;  1CJF A;  3UE6 A;  3LR4 A;  4HY8 A;  3LO7 A;  3QP4 A;  1VHM A;  5DVA A;  1G28 A;  3B3X A;  5F1F A;  4E3O A;  3IF6 B;  1K25 A;  2XR0 A;  5HAI A;  5D3O A;  4EER A;  4C3Q A;  4HJ6 A;  5I94 A;  1YMX A;  3N8R A;  4IUH A;  2PRF A;  4R70 A;  3W8K A;  3QNC A;  1HLU P;  2P7J A;  4C75 A;  4P6Z M;  4EUV A;  2J3T C;  4S2N C;  3WS4 A;  3G32 A;  5FAP A;  3SW1 A;  1YT4 A;  3Q1F A;  3BYD A;  2BLS A;  4WEL A;  5AJG A;  3O3V A;  1JTG A;  3VOL A;  5HW3 A;  1RP5 A;  3MZF A;  2NUT C;  3CI6 A;  3GSG A;  4GD6 A;  3ITA A;  3MQQ A;  3PBT A;  4OP5 A;  4DE2 A;  3M2K A;  4DMZ A;  3T4Q A;  4CPK A;  2Y8H A;  4YOF A;  3UNW A;  4GB7 A;  1D1J A;  3HUO A;  1IEM A;  1ALQ A;  3F1O A;  3FYZ A;  3ICY A;  2W3E A;  3NIA A;  1IFQ A;  2VV6 A;  1SZV A;  4HQA A;  5L09 A;  1K57 C;  5BOH A;  1MWT A;  1GHP A;  4BD0 A;  4R3J A;  4R3A A;  4JPM A;  2NUP C;  1S4R A;  2A24 A;  3ZVT A;  4X55 A;  2WKI A;  3WWX A;  4XXR A;  4OQI A;  1SDE A;  3ULF A;  1KE0 A;  4I5S A;  5TGF A;  1XA1 A;  4OQG A;  2D01 A;  5TFQ A;  2B5R A;  2J3T D;  3BRM A;  3IXG A;  3U4L P;  2H0Y A;  5HPF A;  1UWN X;  4MCW A;  4QU3 A;  4IBR A;  3KSF A;  4KQD A;  1SKO A;  2QKP A;  5FEG A;  4OKP A;  2ZOH A;  4B4Z A;  1X0O A;  3EGD C;  3HUM A;  3UB7 A;  4NET A;  4K08 A;  5HWT A;  4OOM A;  5F1G A;  1S66 L;  2ZL1 A;  2WGW B;  3H82 B;  3DWK A;  3BFG A;  1VQQ A;  4WLA A;  4P0M A;  3SH8 A;  1S67 L;  3IBJ A;  3F1P B;  5L07 A;  3LIB A;  2WZX A;  2B18 A;  3IF6 A;  1STZ A;  3PBO A;  4ZAM A;  1P97 A;  1TEM A;  5HD5 A;  3MQ0 A;  4JXV A;  1LI9 A;  1G6A A;  2P9V B;  1H8Z A;  2EXA A;  3UMD A;  3L7H A;  3MQO A;  2ZMA A;  4OON A;  2A3U A;  1DP8 A;  1LL5 A;  4EES A;  3SZT A;  3PBN A;  2DNS A;  1BLP A;  1LHY A;  1XJ4 A;  4EV4 A;  4ZDX A;  4L9E A;  2QMI A;  1CI9 A;  4UQI S;  3KSG A;  5A8B A;  2V0U A;  2GX5 A;  3NDE A;  3E4P A;  3IX8 A;  4JF6 A;  2INW A;  2M1C A;  2W3H A;  5L10 A;  4IED A;  3MSH A;  3O5Y A;  4DN0 A;  3T1R A;  3O87 A;  3UME A;  3VV4 A;  5TBM B;  3IXH A;  3MKF A;  3UDF A;  3S22 A;  2OAQ 1;  1OPX A;  4GHI B;  3T4K A;  2LB5 A;  1ERM A;  2WKH A;  4O8G A;  3G34 A;  2W1T A;  2PBD P;  4Y0O A;  1XJ3 A;  5HWW A;  3E4Q A;  4KQR A;  1W8Y A;  3DTM A;  1D7E A;  3EGX C;  2V8C A;  3R7W B;  1PYY A;  4ZJ2 A;  3MZD A;  3T4J A;  4X69 A;  2KX6 A;  3C5A A;  5JYO A;  3IWO A;  3QP1 A;  2KDK A;  1OTD A;  4KZB A;  4WYY A;  3UB9 A;  3UPN A;  4LRY C;  4ZJ1 A;  4F3L B;  4H6J B;  4O7D A;  5E2F A;  2JKR M;  2Z6C A;  4DF6 A;  3EQV A;  4RVA A;  1G68 A;  1TS8 A;  1TF1 A;  5JYP A;  1T1B A;  4GW9 A;  3HLB A;  5FI2 A;  3BM6 A;  4DRT A;  1XGJ A;  1P0Z A;  4U0X A;  5HPI A;  2Q9M A;  5U47 A;  2QWS A;  3CLO A;  2UV0 E;  5F83 A;  3ZHH A;  4JGO A;  2FFY A;  5L2F A;  2WGW A;  4X1L A;  5HDS A;  4MBK A;  4X6T A;  1ONH A;  2XRO A;  1G5U A;  4X53 A;  4XUZ A;  2CMN A;  1TDG A;  3M6H A;  2XA7 M;  4ME4 A;  1KE4 A;  1HTZ A;  3HJK A;  4KG2 A;  1KE3 A;  3HLF A;  4KZ7 A;  3BQA A;  4K91 A;  5AQB A;  5FQQ A;  1H8M A;  4QB8 A;  1NJ4 A;  3IXB A;  2P9V A;  3C8C A;  2VK3 A;  4EBL A;  4OPQ A;  4RA7 A;  3ISG A;  4CLC A;  3G31 A;  1YLT A;  4S2P A;  4DE1 A;  4YNR A;  4NXF A;  4BBU A;  3VOZ A;  3K3C A;  3IXD A;  2K31 A;  2C5W B;  3U2A A;  5IU1 A;  1XXM A;  3JYI A;  2YKF A;  2X01 A;  4Q8I A;  3VFH A;  3CHW P;  2VKS A;  3A3D A;  3NCK A;  5CTM A;  3RTY A;  3HLG A;  3OCN A;  1YAX A;  3B42 A;  1MWU A;  1YSP A;  3DTI A;  4E3N A;  3TJZ C;  3TW8 A;  3NOP C;  4I3A A;  4WEK A;  3ZGA B;  3C38 A;  4ZRR A;  1ZG4 A;  2JCH A;  2HJ9 C;  1N9L A;  2R9W A;  3IF6 C;  3FKW A;  4NXG A;  5DTS A;  1K6R A;  3HLD A;  3BFD A;  5F69 A;  5TBM A;  4GHI A;  5EVI B;  4R0Q A;  3E2K A;  2G2U A;  5FAS A;  3GRJ A;  3CAX A;  4NXE A;  1L0G A;  1I2S A;  3CG5 A;  3S1Y A;  3BFF A;  1E3U A;  5FAO A;  3IHB A;  1VB6 A;  2V1Z A;  5M1A A;  1OTB A;  1NY0 A;  2CC1 A;  4MBF A;  1YPR A;  5FL3 A;  4BLM A;  4K0W A;  4KUO A;  4OLD A;  2XSS A;  3UB5 P;  4LEN A;  4LGW A;  4ARZ B;  3DBA A;  3A3E A;  2Y2O A;  4KZ4 A;  5EV0 A;  2VGL M;  3UE3 A;  1M40 A;  2I9V A;  4LFU A;  5DF9 A;  2PAV P;  3LY3 A;  1Y28 A;  1KGF A;  4NXB A;  3LR3 A;  3N8S A;  1K55 A;  5EEC A;  3LI8 A;  2ZD8 A;  3PBS A;  1LSX A;  2WZZ A;  4KEN B;  4MEZ A;  1T1C A;  1NLY A;  2HJE A;  1N4O A;  3BLS A;  2DCF A;  1QME A;  2OWJ A;  4QY6 A;  4BWI A;  1E4D A;  4JXW A;  1G6O A;  1K57 A;  5DTT A;  4EQ1 A;  1HZO A;  3WRZ A;  4UA7 A;  1YLW A;  2VX8 A;  3TOI A;  1TD5 A;  1YLJ A;  3UN7 A;  1SCW A;  4DJ2 A;  1EWZ A;  4FUW A;  2LB9 A;  4WF0 A;  3PAG A;  4DE3 A;  1V9Z A;  3GEC A;  1XPB A;  4BBV A;  4GS9 B;  1L0F A;  3MBZ A;  3CZD A;  3V67 A;  3KYQ A;  3A3I A;  3ZG5 A;  3UPP A;  5IT5 A;  5HSQ A;  3DW0 A;  4GOG A;  3EEA A;  5FQI A;  2K7S A;  4HHD A;  4IHQ A;  5HZH A;  3HLC A;  1F5M A;  5AQA A;  5KSC A;  4BL3 A;  1CK3 A;  4Q0I A;  5FDH A;  1YLP A;  2BTF P;  2HF6 A;  3QP5 A;  4BQM A;  2VV8 A;  4YWZ A;  5LBR A;  3WS2 A;  3Q7V B;  1PFL A;  4AFI A;  3P09 A;  5J3W A;  1L0E A;  3H9W A;  3R4K A;  4CLC C;  4PM7 A;  5DF8 A;  3A0R A;  4BD1 A;  4KZ3 A;  2ZM0 A;  4KZ8 A;  3HRE A;  2EWV A;  2VJW A;  2PBY A;  3PBR A;  4GD8 A;  2J9O A;  3GV9 A;  5TJJ A;  2V20 A;  2JKF A;  4JF4 A;  3S7Q A;  4ARZ A;  2KOI A;  5A91 A;  2WKP A;  1ES5 A;  1S6R A;  3LY4 A;  3JPU A;  5FQK A;  1PZO A;  3G30 A;  5I5L A;  2EA9 A;  1ODV A;  3TRC A;  5CXW A;  5GLD A;  2HDQ A;  2EX9 A;  4Y0T A;  2ZQ8 A;  1OTI A;  4HP9 A;  4P6Z S;  2EFX A;  4CQH A;  1KVL A;  1MXO A;  5KZH A;  1A0K A;  2Y2M A;  2J7V A;  5CED A;  1K54 A;  4JGQ A;  3LEZ A;  5EOE A;  4GLQ A;  5DKL A;  3HVF A;  2Q0O A;  3KYE A;  1BTL A;  4CLC D;  3UE1 A;  4EBP A;  3B33 A;  2Q9N A;  4RX3 A;  4BBT A;  4ESP A;  1L3L A;  3ZG9 B;  2JHE A;  1K55 C;  2ZQC A;  5E43 A;  3KO6 A;  3L9K A;  4WM9 A;  3G2Z A;  4RX2 A;  1YLY A;  1XJ6 A;  3ZVW A;  5CEC A;  1Q2Q A;  3MF0 A;  4HES A;  2ZJ9 A;  3OPR A;  2W3G A;  2O9B A;  1FOF A;  5CER A;  3PTE A;  4DKI A;  3G4P A;  3RJU A;  5KSH A;  4ZTK A;  5CHJ A;  3H7W A;  4WZ4 A;  1BSG A;  2WK0 A;  3IS2 B;  3EEH A;  3Q7V A;  2JC7 A;  4PHT A;  3LIE A;  4UEY A;  1LI0 A;  1PRQ A;  4DJ3 A;  1JWP A;  3UDI A;  3C4O A;  5EFW A;  2O99 A;  1W8Q A;  4S2I A;  3UO9 A;  1AXB A;  1SHV A;  3MR0 A;  1E3U D;  1W7F A;  1W63 Q;  3SH9 A;  5M18 A;  3S7P A;  4EUZ A;  2O0Y A;  5CGS A;  4S2L A;  3IX4 A;  1WYC A;  4N92 A;  4I3I A;  2XGN A;  4MNR A;  2OWH A;  1MKI A;  1OTA A;  3HLE A;  4MN7 A;  1NXY A;  2MJ6 A;  2PR5 A;  1BZA A;  3LEQ A;  1PNE A;  2HP5 A;  3SH7 A;  2JN7 A;  3KSI A;  5FI7 A;  3RH8 B;  4FSF A;  4EQI A;  1FCO A;  4NG2 A;  3MKE A;  4ZJ3 A;  5HAR A;  4EEU A;  5HDD A;  2JKT I;  2ZC5 B;  4S2O A;  3TE8 A;  3HLW A;  4E04 A;  3IH9 A;  3NOT C;  2H10 A;  2XDM A;  3QP8 A;  2QJ7 A;  4B9O A;  3V3S A;  3VP0 A;  3Q81 A;  4EEP A;  2ZMF A;  1I5Q A;  1NWZ A;  4XUX A;  4ZBE A;  4O01 A;  1BLS A;  1BUE A;  2VGK A;  3CIT A;  5DFY A;  1L2S A;  3E2L A;  4HOI A;  4OQ0 A;  2B02 A;  3E98 A;  2R9X A;  4U3T A;  4XT2 B;  3BFC A;  1H8Y A;  3IH8 A;  1FCN A;  3ZNT A;  3NUL A;  4GDB A;  4II7 A;  4O0P A;  3ZG0 A;  2P04 A;  3N6I A;  1OJG A;  3HUN A;  1SKF A;  1L0D A;  3RXX A;  1LL9 A;  4KZ5 A;  3G2Y A;  1FIK A;  5CTN A;  3BW6 A;  5GLC A;  4CJN A;  4HI4 A;  2ACG A;  4JGR A;  5DJU A;  5DFX A;  3OPH A;  1TS7 A;  1GHI A;  4P6B A;  2GZA A;  5F6A A;  4CLC E;  4EET B;  3BJN A;  1OT9 A;  1JVJ A;  3T50 A;  1XKZ A;  1K54 C;  2A2L A;  3IS2 A;  1F9I A;  5AVE A;  3VP1 A;  3UB8 A;  3G6O A;  3KYZ A;  3CUE C;  3PR6 A;  3T1S A;  1MBL A;  2IWD A;  1VET B;  5FSR A;  4WUJ A;  2ZM8 A;  4UA9 A;  1WA9 A;  1D06 A;  1K56 A;  3K2N A;  4LV1 A;  4L0L A;  1E25 A;  4HH3 A;  3EQU A;  3NDG A;  2P08 A;  5TR7 A;  4HP4 A;  2XRN A;  4PM6 A;  2VGJ A;  1IYS A;  3HCY A;  5C5K A;  3H82 A;  4FH2 A;  3BY8 A;  2W27 A;  1LL8 A;  2XA7 S;  2JBF A;  3W2Z A;  3F1P A;  4QY5 A;  2PYR A;  4Q0H A;  5EM0 A;  3N7W A;  2ZOI A;  2PU2 A;  1T19 A;  3A0V A;  3ZG7 B;  4X68 A;  1TS6 A;  2RL3 A;  2ZQ7 A;  4GN2 A;  2UWX A;  3LYX A;  3LR0 A;  3UB6 A;  1U60 A;  5HL1 A;  1PWD A;  1YM1 A;  1PZP A;  4WN5 A;  3SS4 A;  3BEB A;  3VSK A;  2WAD A;  3V3R A;  1H0M A;  4FTX A;  1NYM A;  1GSX A;  4KG5 A;  2OV5 A;  4XT2 A;  4QD4 A;  4JXG A;  1J9M A;  2ZQA A;  4K0X A;  5HDC A;  4Y15 A;  3E0Y A;  1YKD A;  4JLF A;  4DXB A;  4GJ4 A;  2OSU A;  1BT5 A;  4KZ9 A;  2WKQ A;  1Y54 A;  5KMW A;  2Y2P A;  4G3W A;  2ZC3 B;  3OBF A;  4E3J A;  1J3W A;  2ZC7 A;  3JVU A;  3FV7 A;  5EM1 A;  1K4E A;  5EPH A;  4LRZ E;  3B47 A;  4B93 A;  1EI5 A;  4BEN A;  2ZC4 B;  2Y2Q A;  1T1A A;  5DF7 A;  3R7W A;  3TSG A;  3M2J A;  4M3K A;  2V1B A;  3I7J A;  2IA2 A;  5J8X A;  2WUQ A;  2Y91 A;  4UHU A;  1GSW A;  2W3F A;  4PM5 A;  3A3F A;  2VGL S;  4HH2 A;  4L9G A;  1PIO A;  4PMA A;  1MKM A;  3WS5 A;  2ZQ9 A;  1KGG A;  4F3L A;  4EU0 A;  4H6J A;  5GL9 A;  2IWC A;  4R3B A;  3QP6 A;  3T4L A;  1I2W A;  4EWF A;  2Y2L A;  1PW8 A;  4PM8 A;  1OT6 A;  2VA0 A;  1XX2 A;  3Q07 A;  3MMH A;  5F68 A;  1CF0 A;  4PM9 A;  4PAU A;  2PU4 A;  5J4E A;  5KIZ A;  2H5S A;  4N1H A;  2QJ5 A;  4OOL A;  2J3W A;  3VSL A;  2Y2G A;  5A93 A;  3OC2 A;  3NC8 A;  1KDS A;  4HJ3 A;  3EOI A;  3NHQ A;  4WL9 A;  1ESI A;  5CHM A;  3VP3 A;  2HPB A;  2KLI A;  3BLM A;  2O9C A;  4QJG A;  3FG8 A;  1K0K A;  1T18 A;  4FOF A;  1H5X A;  4LRX C;  4I39 A;  3RFB A;  2OOL A;  3ZCZ A;  1W63 M;  4R4S A;  2W1R A;  3ZQ5 A;  4D60 A;  4WMC A;  4HNB A;  2PHY A;  3CMZ A;  1ACF A;  3V50 A;  3FPW A;  2QZ6 A;  2V0W A;  1YSQ A;  1DRM A;  3LI9 A;  2YKH A;  1GSV A;  2L0W A;  3TG9 A;  2HV1 A;  3FPV A;  1KVM A;  1DP9 A;  3CJM A;  3K3D A;  1TDL A;  1ZHH B;  4KQQ A;  4OLG A;  2VEA A;  1EW0 A;  3FZC A;  4S2M A;  2XK1 A;  2Z2L B;  2GDN A;  1PWG A;  1ZTU A;  4QHC A;  5EVI A;  3OZH A;  3T4O A;  3DTE A;  1XGI A;  4WZ5 A;  4IUK A;  3F1N B;  3A0S A;  3NEC A;  1GCE A;  3P7N A;  4MMN A;  1NYY A;  3F1O B;  1FQG A;  3Q82 A;  3P01 A;  5AQ7 A;  1DJB A;  2B95 A;  1JTD A;  2M7U A;  1LT0 A;  2PDR A;  4EBN A;  1VEU B;  3O86 A;  4P85 A;  2A24 B;  2A49 A;  4OPY A;  1ZKJ A;  5FQM A;  1NRF A;  3MZE A;  1AWI A;  1SDN A;  2WAE A;  3VE3 A;  1ES2 A;  4NEE D;  3SS5 A;  4N9L A;  4R1G A;  1K56 D;  3P98 A;  1FSY A;  2JKT M;  3WRT A;  5A92 A;  2GNX A;  3BEC A;  2G7U A;  1XA7 A;  2XQZ A;  3UE0 A;  1KOU A;  4BJP A;  5CEB A;  3FC7 A;  2FZ0 A;  5K5B A;  4WBG A;  4MN6 A;  1FR6 A;  1SKO B;  3VP2 A;  1RGZ A;  4B4X A;  1H3Q A;  5EVE A;  5DJT A;  2ZL1 B;  3VFF A;  4L9F A;  5HWV A;  4D2O A;  3LCE A;  3T4T A;  2XFS A;  4KZA A;  3UDX A;  3AGF A;  4G3V A;  2Y55 A;  1K6S A;  3KSH A;  2GJ3 A;  3CUE A;  1PI4 A;  3CWF A;  1LLB A;  5FA7 A;  3VE4 A;  1JWV A;  4P87 A;  2J80 A;  4LCM A;  3W4P A;  4Y7P A;  1DJA A;  4OQH A;  2EX8 A;  1UWP X;  3C30 A;  4GS9 A;  4PKY A;  1WYB A;  2VZW A;  3JVV A;  5CRF A;  5GLA A;  2BG1 A;  4NK3 A;  4PKY G;  2EX2 A;  3ITB A;  1RCJ A;  4LLO B;  3RXW A;  3GQZ A;  2AVX A;  3ZNY A;  4GKU A;  5DKK A;  2L4R A;  4GCZ A;  2P74 A;  2XF3 A;  1KGE A;  2ZM2 A;  4FD8 A;  4QWO A;  4Y5F A;  1N9B A;  3NOU C;  5HL6 A;  3ZFZ A;  1ZC2 A;  4B88 A; 
#chains in the Genus database with same CATH homology
 2Y2K A;  1L0G A;  1I2S A;  2Y2I A;  2EFU A;  3VP1 A;  2OLV A;  3CG5 A;  3OPL A;  4JF5 A;  3S1Y A;  1O7E A;  4S2J A;  3BFF A;  3O88 A;  4DXC A;  3G35 A;  1E3U A;  1MBL A;  1ZG6 A;  2IWD A;  3IHB A;  4R4R A;  5FAO A;  3MXS A;  2XEP A;  4LCL A;  3OPP A;  3FKV A;  2V1Z A;  5FSR A;  1K4F A;  5M1A A;  2HDS A;  2EX6 A;  4WEJ A;  1ES3 A;  4PPR A;  1NY0 A;  3V39 A;  3GRJ A;  5E2G A;  2ZM8 A;  2CC1 A;  3NI9 A;  4MBF A;  4BLM A;  3WS0 A;  4K0W A;  4OLD A;  2Y2H A;  1IEL A;  4UA9 A;  4LEN A;  4E3I A;  1K56 A;  4UA6 A;  3A3E A;  1RGY A;  2Y2O A;  2OLU A;  4KZ4 A;  1VM1 A;  3UE3 A;  1M40 A;  1BUL A;  4LV1 A;  3AGD A;  2HP6 A;  3GMW A;  5DTK A;  4L0L A;  1Z6F A;  4ID4 A;  1IYP A;  1CEF A;  5DF9 A;  1E25 A;  1FCM A;  4OPR A;  4GDN A;  3LY3 A;  3EQU A;  1DJC A;  1TVF A;  3NDG A;  1PWC A;  2I72 A;  1FR1 A;  1KGF A;  2WAF A;  5TR7 A;  4PM6 A;  2VGJ A;  5EOO A;  3UPO A;  1IYS A;  5EVI C;  1FSW A;  2EXB A;  3LO7 A;  2WKE A;  3N8S A;  1K55 A;  5E2H A;  4X56 A;  4FH2 A;  3IWQ A;  5DVA A;  5EEC A;  4WZ5 C;  1YMS A;  2JBF A;  2ZD8 A;  1W5D A;  3D4F A;  3PBS A;  4QY5 A;  2WZZ A;  3B3X A;  4KEN B;  3NBL A;  4MEZ A;  4E3O A;  5F1F A;  3MFD A;  3IF6 B;  4FH4 A;  5FAT A;  1K25 A;  1N4O A;  2XR0 A;  3N7W A;  1XP4 A;  3BLS A;  2WGV A;  4DDY A;  5HAI A;  2DCF A;  1DY6 A;  2PU2 A;  5D3O A;  1QME A;  3ZG7 B;  1M6K A;  4C3Q A;  4X68 A;  4HBU A;  5I94 A;  2RL3 A;  2ZQ7 A;  4QY6 A;  3QNB A;  1YMX A;  3N8R A;  4YIN A;  1E4D A;  4JXW A;  4OVD A;  4GN2 A;  1K57 A;  2UWX A;  3W8K A;  3QNC A;  5HAQ A;  5DTT A;  1U60 A;  1HZO A;  3BFE A;  3WRZ A;  3VP4 A;  1PWD A;  5HL1 A;  4UA7 A;  4C75 A;  1YM1 A;  1PZP A;  1YLW A;  2XLN A;  4S2N C;  3WS4 A;  3G32 A;  3SS4 A;  5FAP A;  3BEB A;  1YT4 A;  3TOI A;  1YLJ A;  3Q1F A;  1GHM A;  3UN7 A;  1SCW A;  3VSK A;  2WAD A;  1EWZ A;  1JWZ A;  3V3R A;  4WMC D;  3BYD A;  2BLS A;  3PAG A;  4DE3 A;  1NYM A;  4KG5 A;  1XPB A;  2OV5 A;  1IKG A;  4QD4 A;  4WEL A;  4IVK A;  3GR2 A;  4JXG A;  2HDR A;  3O3V A;  1J9M A;  4E6W A;  2ZQA A;  4K0X A;  3VMA A;  3DWZ A;  3C4P A;  1JTG A;  5E2E A;  1L0F A;  4JLF A;  1RP5 A;  3MBZ A;  4DXB A;  5HW3 A;  3CZD A;  1MY8 A;  4HEF A;  3A3I A;  3ZG5 A;  3MZF A;  2OSU A;  3UPP A;  3GSG A;  3DW0 A;  4GD6 A;  3ITA A;  1BT5 A;  3PBT A;  5EUA A;  4GOG A;  4KZ9 A;  4OP5 A;  3IT9 A;  1Y54 A;  5FQJ A;  5FQI A;  4DE2 A;  3M2K A;  5KMW A;  2Y2P A;  2ZC3 B;  3HLC A;  4E3J A;  4OH0 A;  1KDW A;  2ZC7 A;  5AQA A;  4CPK A;  4BL3 A;  3FV7 A;  1ESU A;  5KSC A;  3UNW A;  1CK3 A;  4GB7 A;  1K4E A;  3C7U A;  5EPH A;  1YLP A;  3HUO A;  5FDH A;  1IEM A;  2HP9 A;  1ALQ A;  1EI5 A;  4BQM A;  4BEN A;  2ZC4 B;  2Y2Q A;  1GA0 A;  3WS2 A;  5EVI D;  3Q7V B;  3NIA A;  3FYZ A;  5EE8 A;  4LV3 A;  3ZDJ A;  5DF7 A;  3TSG A;  3M2J A;  1K57 C;  4M3K A;  3I7J A;  5BOH A;  4MBH A;  3P09 A;  1MWT A;  1GHP A;  5CGX A;  4BD0 A;  1L0E A;  4R3J A;  2WUQ A;  4E3M A;  5J8X A;  2Y91 A;  2X71 A;  4PM7 A;  4UHU A;  4JPM A;  5DF8 A;  2WYX A;  3ZVT A;  4BD1 A;  4PM5 A;  3A3F A;  4X55 A;  4KZ3 A;  2ZM0 A;  2IWB A;  4E3L A;  2WKI A;  3WWX A;  4KZ8 A;  3HRE A;  3PAE A;  4XXR A;  1C3B A;  1PIO A;  4PMA A;  3WS5 A;  2PBY A;  3PBR A;  2ZQ9 A;  1KGG A;  4GD8 A;  2J9O A;  4OQI A;  1IKI A;  1SDE A;  1KE0 A;  3GV9 A;  5GL9 A;  4KZ6 A;  2IWC A;  4R3B A;  5TGF A;  2V20 A;  2Y4A A;  4JF4 A;  1XA1 A;  5EVL A;  3V5M A;  1CI8 A;  2J9P A;  1BLH A;  4OQG A;  2RCX A;  1I2W A;  4EWF A;  2Y2L A;  1PW8 A;  1PI5 A;  3VOY A;  4PM8 A;  5TFQ A;  2B5R A;  1XX2 A;  3BRM A;  3IXG A;  3Q07 A;  5A91 A;  2V2F F;  2H0Y A;  4PM9 A;  1ES5 A;  1S6R A;  3LY4 A;  3N8L A;  4QU3 A;  4IBR A;  1O07 A;  5FQK A;  4IVI A;  1PZO A;  4RYE A;  3G30 A;  2PU4 A;  4OKP A;  5GHZ A;  4B4Z A;  3HUM A;  4R23 A;  4NET A;  2XD1 A;  3GVB A;  4OOM A;  5F1G A;  2H5S A;  1OME A;  4N1H A;  3W4Q A;  1ERQ A;  3OCL A;  2WGW B;  3GTC A;  2ZC6 B;  3DWK A;  4OOL A;  5CXW A;  3BFG A;  1VQQ A;  3VSL A;  2Y2G A;  5A93 A;  3SH8 A;  4P0M A;  5GLD A;  2HDQ A;  2EX9 A;  3OC2 A;  4Y0T A;  1MWR A;  2ZQ8 A;  2G2W A;  2WZX A;  1KDS A;  3NC8 A;  3IF6 A;  3PBO A;  4HBT A;  2ZQD A;  4ZAM A;  1TEM A;  1ESI A;  5CHM A;  2EFX A;  5HAP A;  3VP3 A;  1WE4 A;  5HX9 A;  5FAQ A;  1KVL A;  1MXO A;  2HPB A;  3BLM A;  4QJG A;  5KZH A;  4YFM A;  2Y2M A;  2XH9 A;  4JXV A;  3PBQ A;  3QHY A;  1H5X A;  2J7V A;  1K54 A;  5CED A;  1LI9 A;  1G6A A;  3UY6 A;  3LEZ A;  2P9V B;  1K38 A;  1H8Z A;  4MLL A;  4R4S A;  5EOE A;  2EXA A;  3ZCZ A;  4WMC A;  5CGW A;  2ZMA A;  4OON A;  2C6W B;  3HVF A;  2A3U A;  4LV0 A;  3IWI A;  1ERO A;  3ZG8 B;  1LL5 A;  1BTL A;  2E8I A;  3CMZ A;  3PBN A;  2DNS A;  1BLP A;  1LHY A;  3UE1 A;  4EBP A;  4EV4 A;  4F94 A;  4RX3 A;  2Q9N A;  3V50 A;  4A5R A;  4ZDX A;  2QMI A;  1Q2P A;  2QZ6 A;  1CI9 A;  3ZG9 B;  1IYQ A;  2FFF B;  2Y2N A;  1K55 C;  2ZQC A;  5E43 A;  3NDE A;  3TG9 A;  1YLZ A;  1GA9 A;  4JF6 A;  4WM9 A;  1KVM A;  3G2Z A;  4RX2 A;  1YLY A;  2J8Y A;  2XFT A;  3CJM A;  3ZVW A;  5CEC A;  4KG6 A;  4DDS A;  1Q2Q A;  4HES A;  1TDL A;  4KQQ A;  4OLG A;  2ZJ9 A;  2H0T A;  5GHX A;  4IED A;  3OPR A;  3W4O A;  3FZC A;  4S2M A;  1FOF A;  5CER A;  3PTE A;  3O87 A;  2XK1 A;  2Z2L B;  4DKI A;  3IXH A;  2GDN A;  3MKF A;  1PWG A;  5AQ9 A;  3G4P A;  3RJU A;  3UDF A;  5KSH A;  4ZTK A;  3S22 A;  4QHC A;  5EVI A;  3OZH A;  5CHJ A;  2WKH A;  1ERM A;  1XGI A;  3M6B A;  3G34 A;  5F82 A;  4WZ5 A;  4WZ4 A;  1BSG A;  2WK0 A;  4Y0O A;  1GCE A;  4KQR A;  3Q7V A;  1NYY A;  1HVB A;  1W8Y A;  2JC7 A;  4H8R A;  3DTM A;  5FI6 A;  1FQG A;  1LI0 A;  3Q82 A;  5AQ7 A;  2JE5 A;  1JWP A;  1PYY A;  1DJB A;  3MXR A;  4ZJ2 A;  3UDI A;  3C4O A;  3MZD A;  1JTD A;  1W8Q A;  5A90 A;  4S2I A;  4X69 A;  1W79 A;  4EBN A;  3UO9 A;  3C5A A;  5JYO A;  3O86 A;  3IWO A;  4P85 A;  1AXB A;  1SHV A;  1E3U D;  1W7F A;  2A49 A;  4OPY A;  3SH9 A;  5M18 A;  1ZKJ A;  2DRW A;  5FQM A;  4EUZ A;  1NRF A;  3MZE A;  4KZB A;  3IHA A;  2Z2M B;  4WYY A;  5CGS A;  4S2L A;  1WYC A;  3UPN A;  4UAA A;  3N4I A;  4ZJ1 A;  1SDN A;  2WAE A;  1MPL A;  4N92 A;  4O7D A;  2XGN A;  5E2F A;  4MNR A;  4S2N A;  1ES2 A;  1NZO A;  4U0T A;  4N9L A;  3SS5 A;  4R1G A;  4DF6 A;  1MKI A;  1K56 D;  3P98 A;  5GHY A;  3EQV A;  2HDU A;  4RVA A;  4Z9Q A;  1FSY A;  3HLE A;  1G68 A;  1NXY A;  1BZA A;  5JYP A;  3WRT A;  5A92 A;  3HLB A;  3NY4 A;  3BEC A;  5FI2 A;  4E6X A;  5M19 A;  1XA7 A;  2HP5 A;  2XQZ A;  3BM6 A;  3UE0 A;  4BJP A;  4C6Y A;  4DRT A;  3SH7 A;  5CEB A;  1XGJ A;  3SS3 A;  4U0X A;  4WBG A;  5FI7 A;  2WGI A;  4FSF A;  4N9K A;  4LV2 A;  4OPZ A;  2QPN A;  4EQI A;  1FR6 A;  2Q9M A;  5U47 A;  1FCO A;  5F83 A;  3MKE A;  1RGZ A;  5HAR A;  4ZJ3 A;  3VP2 A;  3ZHH A;  4B4X A;  5CHU A;  2FFY A;  2ZC5 B;  5L2F A;  2WGW A;  1YQS A;  4S2O A;  3VFF A;  3WS1 A;  3HLW A;  3HL9 A;  4MBK A;  4X6T A;  1IYO A;  1ONH A;  3IH9 A;  2Y2J A;  2H10 A;  3LCE A;  3Q7Z A;  4D2O A;  2XDM A;  4X53 A;  4XUZ A;  1TDG A;  2XD5 A;  3C7V A;  3M6H A;  5IHV A;  3SOI A;  2XFS A;  3V3S A;  1KE4 A;  3Q81 A;  3VP0 A;  4KZA A;  3UDX A;  1HTZ A;  1ES4 A;  3AGF A;  4KG2 A;  2Y55 A;  1K6S A;  1I5Q A;  4XUX A;  1KE3 A;  5GLB A;  3HLF A;  4ZBE A;  3S4X A;  4KZ7 A;  4N1X A;  4K91 A;  1PI4 A;  3HBR A;  5AQB A;  1BLS A;  5FQQ A;  4QB8 A;  4DE0 A;  1NJ4 A;  1BUE A;  2VGK A;  1CEG A;  4FCF A;  4BL2 A;  4GNU A;  3IXB A;  4JBF A;  2P9V A;  1LLB A;  5FA7 A;  5G18 A;  1L2S A;  4EBL A;  1JWV A;  1ONG A;  3E2L A;  4OPQ A;  2X02 A;  4OQ0 A;  4RA7 A;  3ISG A;  2ZLY A;  4P87 A;  3G31 A;  1YLT A;  4S2P A;  3IQA A;  4Y0U A;  4DE1 A;  2R9X A;  4LCM A;  4KQO A;  4U3T A;  3W4P A;  4E3K A;  4Y7P A;  3VOZ A;  3IXD A;  3BFC A;  3IF5 A;  1H8Y A;  1DJA A;  2Y59 A;  4OQH A;  3IH8 A;  1FCN A;  3ZNT A;  1HD8 A;  2EX8 A;  4JXS A;  2C5W B;  4GDB A;  1WYB A;  1XXM A;  3JYI A;  3ZG0 A;  5GLA A;  5CRF A;  2BG1 A;  2X01 A;  4Q8I A;  4NK3 A;  3VFH A;  2EX2 A;  3FWL A;  3ITB A;  5HFO A;  3A3D A;  3N6I A;  3NCK A;  1S0W A;  3HUN A;  5CTM A;  1SKF A;  3HLG A;  1RCJ A;  3OCN A;  1L0D A;  1MWU A;  3RXW A;  3GQZ A;  1PW1 A;  3RXX A;  1LL9 A;  4KZ5 A;  3ZNY A;  3G2Y A;  4OOY A;  4E3N A;  4OP8 A;  4GKU A;  5CTN A;  4WEK A;  3ZGA B;  3A3J A;  5GLC A;  1ZG4 A;  4CJN A;  2JCH A;  2P74 A;  2XF3 A;  2R9W A;  3IF6 C;  4GZB A;  1KGE A;  3FKW A;  2ZM2 A;  1NZU A;  4S2K A;  4FD8 A;  3OPH A;  1GHI A;  1K6R A;  3HLD A;  3BFD A;  4P6B A;  3AGE A;  1BLC A;  5DTS A;  4JKT A;  1N9B A;  1QMF A;  4IBX A;  3ZFZ A;  1JVJ A;  1MWS A;  1ZC2 A;  5EVI B;  4R0Q A;  4B88 A;  3E2K A;  1XKZ A;  2G2U A;  5FAS A;  1K54 C;  5FQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...