2XA7S

Ap2 clathrin adaptor core in active complex with cargo peptides
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADAPTOR-RELATED PROTEIN COMPLEX 2, ALPHA 2 SUBUNIT
publication title A Large Scale Conformational Change Couples Membrane Recruitment to Cargo Binding in the Ap2 Clathrin Adaptor Complex
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 37
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2xa7S00
2XA7M 2XA7S 1W63M 2JKRM 2FH5A 4P6ZM 2VGLM 4P6ZS 2VGLS 2JKRI 4UQIM 4UQIS 1W63Q 4NEED 5MC7A 2JKTM 1NRJA 2HF6A 3TJZC 2JKTI
chains in the Genus database with same CATH superfamily
2XSSA 3A3JA 2JE5A 1F98A 2BASA 3PBTA 3A0RA 5FQJA 1S67L 1K6SA 2EX9A 3FV7A 2XR0A 5DKKA 5M18A 5AQAA 2J3WA 2W3GA 3UB6A 1I5QA 4NEED 4BL2A 3C4OA 2WKRA 1MC0A 2O9CA 3BRMA 3G2YA 4WF0A 3IBRA 1VQQA 4GHIA 4KG6A 4LCMA 1S4RA 3LYXA 3NOTC 2VX8A 4R1GA 4L9FA 1WA9A 3BFDA 3OLOA 4CLCD 2Y2MA 5EPHA 2CMNA 3EQVA 4NXEA 1XX2A 2ZC4B 1KOUA 3V3SA 1T1BA 4O0PA 5HPIA 4EQ1A 5DTTA 3TW8A 3LIDA 2ZQAA 2UWXA 1L0EA 3HLWA 3L7HA 3LIEA 3KSHA 2V0WA 3PHYA 4UQIM 2C5WB 1BTLA 3T4QA 4EQIA 4DJ3A 5IT5A 4R38A 1OTBA 5FEGA 1K54C 2A49A 3C7UA 4JF5A 4OONA 2X71A 4PAUA 1OT9A 2LB5A 3PTEA 4KUOA 2XD5A 2FFYA 4LFUA 4QB8A 4QWOA 1L3LA 1GHIA 4R3JA 5AQBA 4RA7A 1NRFA 3Q82A 1TDGA 4ZBEA 1SDNA 1DP8A 3MZDA 1YT4A 4E3KA 4GHIB 5AQ9A 3F1OA 3ZVWA 4HESA 3T1RA 4BBUA 4F3LA 5AJGA 3ZG0A 3BEBA 5GHYA 3ZDJA 3MJQA 1TS0A 3I7JA 4BWIA 3AGFA 3ZHHA 2VEAA 2WZZA 2XRNA 4AFIA 2M1CA 1K56D 3MZEA 5F6AA 5AVEA 4RX3A 3TG9A 1K57C 2P74A 1CJFA 3GVBA 2K31A 2QJ5A 5TBMA 1CF0A 3LY4A 3IWIA 5CHJA 3E2LA 1H8YA 1IEMA 3MFXA 4JPMA 4LGWA 1KE4A 2JKFA 2R78A 2ZC6B 3A3EA 4UQIS 5IU1A 4DE0A 2ZJ9A 3SZTA 1OJGA 4S2OA 2ZC5B 1ERMA 5F69A 2NUPC 3BQ8A 1MWSA 2RCXA 3ZNYA 2XA7M 4KENB 1S1ZA 3P01A 4OQHA 3MR0A 3IX4A 3S4XA 1NWZA 1ES2A 3F1OB 5F5YA 3ZGAB 4F3LB 4IBXA 1NRJA 2ZC3B 2R9WA 4GN2A 4WZ5A 1LSXA 4MN7A 4BMWA 4L9GA 4QU3A 2V9AA 1TEMA 4IUKA 4KG2A 3DWKA 1OTAA 1E3UD 1RGZA 3S7OA 1XA7A 4WM9A 3ISGA 4PMAA 2OSUA 1JTDA 3CWFA 2WAEA 4LV2A 5E2FA 2ZOHA 1LL5A 4HEFA 1I2WA 5TBMB 3T4KA 3W4PA 4R23A 5EVIC 3FZCA 4I3JA 3QP1A 1S4SA 2QHKA 4S2JA 4YINA 3E4PA 3LO7A 4HIAA 4R4RA 3OPPA 4JGRA 2OV5A 1RGYA 4EEPA 2Y2IA 3HCYA 4GKUA 1W5DA 3VSKA 4LRXC 2OAP1 1YLJA 1A0KA 5EUAA 4N9KA 5FQIA 1W63M 3MQ0A 3FYZA 3LICA 3KSFA 1DJCA 5TR7A 4G3VA 3BYDA 4S2LA 3F1NA 1ES4A 5A91A 1J3WA 1SKOA 5GLAA 4HNBA 2ZC7A 1FCNA 2VZWA 2H5SA 1PWCA 3C7VA 4KQOA 5HL6A 3VMAA 1ONGA 3W8KA 5J4EA 2XA7S 3BFCA 3PBSA 3W4OA 4N92A 5CXWA 4IHQA 5L10A 4MBKA 2KX6A 1MXOA 3M6BA 4EXOA 2I72A 3VP2A 2WGWA 1W8YA 2JKTM 3MS6A 1Q2PA 4ARZA 4OQGA 1T1CA 4HY8A 2PU2A 1PW1A 2EX6A 3LR3A 3ULFA 3CITA 2ZQ9A 3IF6C 3TSGA 1TS7A 4P6ZM 4Y3IA 5HAQA 2Z6DA 3C8CA 3LI9A 2Y2KA 3GR2A 3E0YA 3T1QB 3JVUA 4KZ9A 3SS3A 4XT2A 5LBRA 4L9EA 1G6OA 4OPYA 4E3LA 4UEYA 4R4SA 2B18A 4OP5A 4KQRA 1GA9A 3LR5A 3E98A 3MXRA 4DKIA 4EUVA 5HPFA 3CUEA 3MSHA 2WZXA 4XUXA 4N1HA 1H8MA 1ES5A 3EEAA 3F1NB 1SKOB 1PI4A 3IT9A 4HQAA 5JYOA 1N9BA 2V20A 1ZG6A 3ZG5A 4Y5FA 2MJ6A 4BD0A 4EBPA 3IH9A 5CRFA 3Q07A 1IYPA 3Q81A 5FQ9A 2H0YA 2WGWB 5I94A 1L0GA 3V67A 4ARZB 1CI9A 3N6IA 4HHDA 5AQ7A 1H8ZA 2ZLYA 3NBLA 4K0WA 1T18A 4JXWA 1ERQA 1V9YA 1FR6A 1W7FA 1O07A 4GLQA 3BW6A 3PXPA 2FZ0A 3ICYA 1JVJA 4PM6A 3D9YA 4XT2B 2KOIA 2J8YA 1YPRA 4JXVA 2V8FA 3VV4A 2IWBA 1TDLA 3UMEA 3NDEA 1ESUA 5F83A 5HD3A 1GA0A 1LI0A 2B02A 3B42A 3VP0A 4MCWA 2JC7A 4DE1A 2A24B 1F9IA 3IH8A 3UE6A 4QPRA 4S2NC 4G3WA 1K0KA 1STZA 3N8SA 4LENA 4JBFA 3CJMA 4B9OA 1T19A 1P9WA 2P9VA 5A93A 5GL9A 2X02A 1PWGA 2Y2QA 1NXYA 3MBZA 3QP5A 3RXXA 1YLZA 3S7QA 4HI4A 3QHYA 4X69A 1F2KA 3M2KA 1PFLA 3KSGA 4MBFA 2VGLS 2A3UA 4KQQA 4GW9A 3UN7A 3GSGA 5HWVA 5CTNA 3P09A 1K25A 1NZOA 1FSWA 2YKFA 1HTZA 1GSVA 2PBYA 3M2JA 3T4LA 3H7WA 3HVFA 4EU0A 3FPVA 4QY6A 1ALQA 3HJIA 2VV7A 3SS4A 1LT0A 3SH7A 4Q8IA 1V9ZA 2XH9A 2A2LA 3AGEA 2VKSA 3EQUA 4KZAA 3HBRA 1PW8A 3GECA 5EM0A 5IS1A 3G4PA 1XJ2A 4X68A 4EERA 4HJ4A 3MFDA 2K7SA 1KVLA 1E3UA 1M40A 5L07A 5GHZA 3IX8A 2P9VB 1ZG4A 2L0WA 3CAXA 4DE3A 4X25A 3OC2A 1BLSA 4H6JA 1K55C 3HLFA 3ZG8B 2W1TB 1O7EA 3QNBA 4GJ4A 4CJNA 5HW3A 3WS4A 1U60A 1ZKJA 4EBNA 2KDKA 3MKEA 2VA0A 2QMIA 3LIFA 2ZMAA 2J9OA 1SCWA 3NULA 3OPHA 2Y59A 3H7WB 3IXBA 4WEJA 3LR0A 4FOFA 1KGGA 1W63Q 1XXMA 1F5MA 1XFQA 3LFVA 5TJJA 4RX2A 1HVBA 4MN5A 2XF3A 4P6BA 2QPNA 2HDUA 2J3TC 3VP4A 4DXCA 1OTIA 4PM9A 4JXSA 4BQMA 2CC1A 3VFHA 4HP4A 4Z1WA 2EXBA 2QJ7A 3IWQA 1PYYA 4MMNA 2WADA 4ESPA 3S22A 3WWXA 5G4YA 4HJ3A 4LV1A 4U0TA 3IHAA 1WYBA 4PM7A 2O9AA 4OOYA 5E43A 5EV0A 3FKVA 4BL3A 1K54A 1IELA 3W4QA 2VLGA 4H6JB 3Q1FA 2G7UA 5FQMA 2AVXA 5AVFA 4KZ7A 4EV4A 3BFFA 2PD8A 4IVKA 4X1LA 2JHEA 1N9OA 1M6KA 4B4ZA 3TJZC 2PR5A 4IBRA 3HLDA 4WLAA 1NLYA 2VJWA 4HBUA 4WEKA 3ZG7B 2XLNA 5HARA 2WKHA 2GJ3A 4LV0A 1KVMA 2RL3A 3NIAA 3FWLA 3IXGA 3OCNA 4I5SA 4O01A 2OAQ1 4DE2A 5HFOA 5DTKA 3H82A 5U47A 1XP4A 2HF6A 5FQQA 3T12B 5KZHA 5FASA 3NECA 4S2PA 4Y17A 2QWSA 3CG5A 4NETA 4QHCA 3K3CA 1ACFA 5EVEA 4BBVA 1K57A 2WAFA 4Y7PA 1GHPA 1J9MA 3B33A 2WKIA 3NC8A 4ETZA 4OPRA 3G31A 4DN0A 2G2WA 1ZC2A 2HDQA 3BLMA 1XJ6A 1VM1A 4XXRA 1BUEA 3GMWA 2V8CA 4X1MA 2WKPA 4PM8A 4NK3A 3FG8A 1ESIA 3HLEA 1YSPA 2W3DA 2ZQDA 4B88A 1K4EA 3OPRA 5E2HA 4X56A 1TD5A 1LSWA 1MBLA 4FD8A 3PAGA 3A0VA 3BY8A 1SHVA 2INWA 3HJKA 4Y13A 4ME4A 3A3IA 5E2GA 1S6RA 2H10A 5FQKA 4NG2A 3HREA 2W0NA 3C30A 3OOVA 5KSCA 5DJUA 2ZL1B 4WBGA 5FSRA 2YKHA 3H82B 1PI5A 2ZM8A 1WE4A 4GOGA 3P98A 3GQZA 4ZDXA 1LI9A 5F1GA 1ZHHB 3LEZA 5DFXA 1L0DA 3UDFA 3BFGA 1IYQA 3RXWA 1FCMA 2PT7A 5FEFA 4G3KA 4O7DA 2PYRA 2JKTI 4X6TA 5GLDA 5EVIA 2UV0E 4OKPA 4Q0IA 5HAPA 5EM1A 2PU4A 2XFTA 5G4ZA 3UB7A 1MPLA 3N7WA 1PIOA 2WGVA 5DF7A 2HDRA 2XD1A 4WN5A 1Z09A 4S2IA 3MXQA 3ZG9B 3LGOA 4X53A 5HDCA 4S2MA 2V2FF 2IWDA 4IUHA 1YQSA 3F1PB 1GCEA 4PPRA 3HUOA 1NLZA 5CECA 1MKIA 1H3QA 1RP5A 2EA9A 2M7VA 2BG1A 5CTMA 5KSHA 2ACGA 4MBHA 3ZYTA 5L09A 1Y4OA 2HPBA 3E4QA 5FATA 2Y55A 1C3BA 2EXAA 2ZBBA 1DJAA 2Y2NA 3SOIA 3UB8A 3IX3A 5C5KA 1ES3A 4ZJ2A 4OQ0A 3GRJA 1MZUA 3FC7A 3IF6A 3MQQA 2K2NA 4LPZA 3BWLA 5EVIB 2PDRA 2VGKA 3Q7ZA 3O87A 3PBQA 4E3JA 1ZTUA 5FA7A 5F68A 2JKGA 5GHXA 2PBDP 4JXGA 3MMHA 5HWTA 1DRMA 3CHWP 1MY8A 3BLSA 4DRTA 4IEDA 2XGNA 3UO9A 2X01A 2HZ5A 4C6YA 1OJ5A 2A24A 3V39A 3C38A 1P9RA 4DJ2A 1Y28A 4KZ4A 2OLVA 3W2ZA 1LLBA 4P0MA 2GZAA 2HP6A 5J3WA 1I2SA 5E2EA 2R9XA 2ZOIA 3L9KA 3GDIA 1JTGA 1FCOA 1FQGA 5A92A 5EECA 1N4OA 3VOZA 4E6XA 4HP9A 5FDHA 4CLCC 4EESA 3UE0A 3NHQA 2P04A 3UB5P 2HJ9C 1BLHA 5FL3A 4GS9A 1XA1A 5D3OA 3QP8A 1IOUA 3N8RA 4OQIA 4LLOB 5TGFA 3UPPA 1IYSA 3SH8A 1JNUA 1YLYA 2DNSA 1OT6A 3IF6B 3NJAA 1CK3A 4DF6A 2I9VA 3QP6A 3KX0X 2HP5A 2Y2LA 1QMFA 1K38A 4EBLA 5HZHA 5GLBA 1CQAA 1W8QA 1PNEA 5CERA 3O5YA 2W27A 4P6ZS 4LRYC 2Y2GA 3D3OA 3N4IA 1IFQA 1H5XA 2Y2OA 3ZFZA 5EOOA 4LV3A 2Y2HA 1HD8A 3MF0A 3Q7VA 3T4OA 1JWPA 5L2FA 4GZBA 4S2NA 1VEUA 4OP8A 5HWWA 1YLTA 2W3FA 3HUMA 3DTIA 4GD8A 5DKLA 1G68A 2HGVA 2JBFA 2BTFP 1VETA 2Y4AA 1UGUA 1HZOA 3S1YA 5EVLA 4WMCA 4XUZA 1KE0A 3IXHA 4UA9A 4R6LA 4D2OA 2J9PA 1N9LA 2W1TA 3ZCZA 2QYBA 4GS9B 5EVID 4QJGA 2PD7A 4CPKA 4K0XA 3T4SA 2JKRM 5A8BA 1QMEA 1KGEA 1BZAA 4MNRA 3TRCA 3EEHA 5CGWA 4HJ6A 1EI5A 2H28A 2DRWA 1S66L 4ZJ3A 4CLCE 3QP4A 3UPOA 2D02A 4WELA 2KLIA 2O99A 4GB7A 1BT5A 1HLUP 2ZM0A 1XGJA 3T1XA 5CGSA 1AWIA 3R7WA 1D7EA 4DDSA 4QY5A 2GDNA 1MKMA 3RJUA 4OLGA 4KZ8A 3OPLA 2ZQ8A 5HSQA 4EUZA 3Q7VB 4FSFA 2IA2A 3IS2B 1VEUB 3WS0A 1GSXA 2WK0A 4K91A 1KDSA 3T1SA 3V5MA 1VETB 3HUNA 3FKWA 2V1AA 1OPXA 2HDSA 3VP3A 1K55A 2QKPA 5DFYA 4R3BA 5DVAA 4DMZA 3LEQA 4C75A 3G32A 4OOLA 4M3KA 1S1YA 4EW7A 3UE3A 3CI6A 4KUKA 3VE4A 2E8JA 4E04A 3NI9A 5A90A 3PYPA 1DJBA 4UA7A 2PHYA 5DF8A 4PKYG 4JLFA 2VK3A 1YLWA 3T4TA 4NXFA 2V1ZA 2G2UA 2M7UA 1L0FA 1LSVA 4P87A 1TF1A 2B95A 3RTYA 3R7WB 4BLMA 2OOLA 3MQOA 4KG5A 5G18A 1IKIA 3NCKA 3PBNA 4I38A 3IXDA 2Q9MA 4FH2A 4NKPA 4GDBA 2H0TA 3A3DA 5HAIA 2PAVP 3VE3A 3ZNTA 2ZMVA 3HLCA 1D06A 1UWPX 3UNWA 4JF4A 2W3EA 1LL9A 2XQZA 3WRTA 3E4OA 4FCFA 2PYPA 1VB6A 3DWZA 4FTXA 1XGIA 4RYEA 3KYZA 1MWRA 1Z6FA 5J8XA 3AGDA 2O0YA 4P85A 3TE8A 5CEBA 5DTSA 4BD1A 5FAQA 1LHYA 2XFSA 3O3VA 1YKDA 2JN7A 4LCLA 2ZL1A 4BBTA 2DCFA 1PRQA 3CLOA 2XK1A 3GTCA 1PZPA 4HBTA 4OPQA 4R70A 3DBAA 1UWNX 3S7NA 5EFWA 3ITBA 4KZBA 3A0SA 4E3MA 1G5UA 4E3OA 3EOIA 4WMCD 4OOMA 2Q0OA 1CI8A 2V0UA 3ZQ5A 3BQAA 5CHUA 4UAAA 1Y54A 2OWJA 3IHBA 5HL1A 4Z9QA 5HD5A 3UY6A 3WS1A 3CMZA 2PRFA 1DP6A 5FI7A 2OWHA 3WS2A 2HV1A 1XFNA 3DAVA 2L4RA 4HH2A 4B93A 4B4XA 3KYQA 3D4FA 4FH4A 5FAOA 4UA6A 3UDXA 1JWVA 5FI6A 3RFBA 1NY0A 4ID4A 4IVIA 4ZTKA 3VSLA 3SS5A 3G35A 3RH8B 5HDSA 1X0OA 1NYMA 4Q0HA 3F1PA 2LB9A 3WS5A 4YNRA 1NZUA 3LI8A 3DTMA 1BULA 1Q2QA 3VFFA 3OCLA 4I3IA 1BYWA 5JYPA 3BECA 5KIZA 5FAPA 1D1JA 2WYXA 2O9BA 4X55A 3LY3A 4D60A 4JKTA 4Q0JA 1G6AA 4GCZA 4U0XA 1E4DA 1EWZA 2L1MA 5EOEA 4WZ5C 2ZD8A 4RVAA 3MKFA 4OVDA 1NJ4A 2B5RA 1NYYA 3G6OA 2J80A 3LR4A 2D01A 1TS8A 5HDDA 3IQAA 2BLSA 3KSIA 4OPZA 4UHUA 2GX5A 2J7VA 5BOHA 3G34A 4PKYA 4MLLA 2WKQA 4K08A 1ONHA 1G28A 4ZRRA 1W79A 1OTDA 1ODVA 1LL8A 4GDNA 2XEPA 1JWZA 2Y91A 4DDYA 2EWVA 1FIKA 1SZVA 5MC7A 3MZFA 4L0LA 4JGQA 3SW1A 2Y8HA 1FR1A 2J3TD 1OMEA 1CEFA 4CQHA 1YAXA 3G2ZA 4KZ5A 4MEZA 4Y0TA 4M4XA 2Y79A 3M6HA 4E3NA 3NOPC 3SH9A 3C4PA 4YFMA 3QP2A 1KE3A 3HLBA 4N9LA 2Z2MB 2Y2JA 1BLCA 4WYYA 4I3AA 1YLPA 1YSQA 1H0MA 2W3HA 4MN6A 1FOFA 3FPWA 3PBOA 2XDMA 1IYOA 2Z2LB 1VHMA 1YMXA 3ZVTA 1TVFA 3V50A 5EE8A 3NDGA 3LCEA 2ZM2A 4YWZA 4NXGA 3WRZA 4C3QA 1FILA 2GNXA 5F82A 3HLGA 1TS6A 5IHVA 4Y0UA 3K2NA 3DTKA 4E3IA 3A3FA 5CEDA 3DTEA 3LUQA 4FUWA 4EWFA 1P0ZA 3C5AA 3TOIA 3PR6A 2DMWA 3GV9A 1GHMA 4ZJ1A 1K4FA 5TFQA 1GSWA 3E2KA 1FSYA 1KDWA 4RQ9A 1EROA 1YMSA 2OLUA 3C2WA 1KGFA 4Y0OA 4ETXA 2ZMFA 5HX9A 4CLCA 4NXBA 3UMDA 2QZ6A 3CUEC 3VOYA 1CEGA 1XPBA 4A5RA 2EX2A 2Y2PA 2WKEA 1K6RA 3IBJA 5DJTA 1OTEA 3T4JA 2VGLM 2EFUA 4PHTA 5CX7A 2NUTC 3O86A 4HH3A 2JKRI 2PR6A 3OBFA 3JYIA 3OZHA 3DW0A 2W1RA 3BY9A 1SDEA 2ZQCA 4KZ6A 3P7NA 1PWDA 3B47A 1L2SA 4S2KA 3LIAA 3IWOA 2E8IA 2FH5A 2VV8A 1YM1A 3UDIA 3CPTA 4H8RA 4Y15A 4HOIA 1WYCA 3QNCA 3EGXC 1RCJA 1XJ3A 3MXSA 3UE1A 3UPNA 4LRZE 5M1AA 3VOLA 4R0QA 5DF9A 4Y2FA 1T1AA 3IS2A 3ITAA 2Q9NA 4BENA 3R4KA 4JGOA 3NOUC 4GNUA 4N1XA 4EEUA 3VP1A 1XJ4A 4KZ3A 3K3DA 4CLCB 4IJGA 4O8GA 2EX8A 4EETB 4PM5A 2WGIA 5FDSA 3PAEA 4MDZA 3S7PA 3T50A 1MWUA 5M19A 1K56A 3B3XA 2V1BA 3H9WA 3LIBA 2P7JA 2HJEA 3EGDC 3JVVA 1SKFA 4OH0A 5I5LA 3BM6A 3O88A 1P97A 5CHMA 4E6WA 3G30A 4I39A 2JCHA 4WUJA 5K5BA 4WL9A 3BJNA 5KMWA 4F94A 4U3TA 1N9NA 2EFXA 3BFEA 2VGJA 1BLPA 3CPTB 4II7A 1AXBA 2EWWA 2VV6A 5FI2A 3UB9A 2IWCA 2Z6CA 5CGXA 1S0WA 5F1FA 5L8MA 3CZDA 1DY6A 2P08A 3U2AA 4BJPA 3NY4A 5J7EA 1XKZA 4ZAMA 3N8LA 4QD4A 5GLCA 2C6WB 1BSGA 4DXBA 2HP9A 3PBRA 3IF5A 3V3RA 2FFFB 3KO6A 1DP9A 3JPUA 4OLDA 3HL9A 1MWTA 4R3AA 4YOFA 2XROA 1E25A 2ZQ7A 1PZOA 3KYEA 3U4LP 4KQDA 4GD6A 1EW0A 4WZ4A 3D72A 4JGPA 3EWKA 4JF6A 2WUQA 1IKGA
chains in the Genus database with same CATH topology
2OWJA 2XSSA 5KSHA 3ZYTA 5HD5A 1F98A 2BASA 3PBTA 3A0RA 3VV4A 1S67L 3E4QA 3UMEA 5DKKA 1DP6A 2J3WA 5HD3A 2W3GA 2OWHA 3UB6A 2B02A 3B42A 4NEED 4MCWA 2HV1A 1XFNA 2A24B 2ZBBA 1F9IA 2L4RA 2WKRA 3UB8A 1MC0A 2O9CA 4HH2A 4QPRA 3UE6A 4B93A 3KYQA 4WF0A 5C5KA 3IBRA 4G3WA 4GHIA 3RFBA 1S4RA 1MZUA 3LYXA 1STZA 3FC7A 3MQQA 2K2NA 3NOTC 4LPZA 2VX8A 3BWLA 4L9FA 3RH8B 2PDRA 5HDSA 1WA9A 1X0OA 3OLOA 4CLCD 4B9OA 1T19A 1P9WA 3F1PA 4Q0HA 2LB9A 2CMNA 3EQVA 4NXEA 3PBQA 1ZTUA 4YNRA 3LI8A 3S7QA 1KOUA 5F68A 1T1BA 4HI4A 4O0PA 3MMHA 5HPIA 5HWTA 4EQ1A 1DRMA 3TW8A 3OCLA 3LIDA 4I3IA 1BYWA 5KIZA 2O9BA 3KSGA 2VGLS 3LIEA 1OJ5A 2A24A 3C38A 1P9RA 3KSHA 2V0WA 1Y28A 3PHYA 4GW9A 4Q0JA 4UQIM 4DJ2A 5HWVA 4GCZA 3T4QA 2L1MA 3W2ZA 2YKFA 2GZAA 5J3WA 4DJ3A 2ZOIA 5IT5A 4R38A 1GSVA 1OTBA 3GDIA 3T4LA 3G6OA 3H7WA 2J80A 3LR4A 4PAUA 1OT9A 2D01A 1TS8A 2LB5A 4KUOA 5HDDA 4HP9A 4CLCC 4EESA 4EU0A 3KSIA 3FPVA 3NHQA 2P04A 3HJIA 2HJ9C 2VV7A 5FL3A 4GS9A 2GX5A 4PKYA 1IOUA 1LT0A 2WKQA 4K08A 1V9ZA 2A2LA 1G28A 2VKSA 3EQUA 4ZRRA 4LLOB 1DP8A 3GECA 1OTDA 5IS1A 4GHIB 1XJ2A 1ODVA 4EERA 1JNUA 4HJ4A 3F1OA 1LL8A 2K7SA 1OT6A 4BBUA 4F3LA 5AJGA 3NJAA 2EWVA 2I9VA 3KX0X 5MC7A 4L0LA 2L0WA 3MJQA 4JGQA 3CAXA 3SW1A 2Y8HA 1TS0A 5HZHA 2J3TD 3OC2A 4BWIA 2VEAA 4H6JA 2XRNA 4CQHA 2W1TB 1YAXA 4AFIA 2M1CA 3O5YA 4GJ4A 2W27A 4P6ZS 4LRYC 5F6AA 4M4XA 5AVEA 3D3OA 2Y79A 1IFQA 2K31A 2QJ5A 5TBMA 3NOPC 3MF0A 3T4OA 2KDKA 2VA0A 5HWWA 2W3FA 4I3AA 3LIFA 1YSQA 2W3HA 5DKLA 4MN6A 3MFXA 2HGVA 3FPWA 3H7WB 2R78A 3PBOA 4WEJA 3LR0A 4FOFA 1UGUA 1W63Q 4UQIS 5IU1A 1VHMA 1F5MA 1XFQA 3LFVA 1OJGA 5TJJA 4MN5A 4R6LA 5F69A 4YWZA 2W1TA 1N9LA 2J3TC 4NXGA 2QYBA 3BQ8A 4GS9B 2NUPC 2GNXA 2PD7A 1OTIA 2XA7M 1TS6A 3T4SA 1S1ZA 3P01A 2JKRM 3K2NA 5A8BA 4HP4A 3TRCA 3LUQA 3EEHA 3MR0A 1P0ZA 4Z1WA 2QJ7A 4HJ6A 2DMWA 1NWZA 3PR6A 2H28A 4MMNA 1S66L 3F1OB 5F5YA 4F3LB 5G4YA 4HJ3A 4CLCE 1NRJA 1GSWA 1LSXA 2D02A 2O9AA 4MN7A 4RQ9A 4WELA 4L9GA 4BMWA 2KLIA 2O99A 2V9AA 2VLGA 3C2WA 4IUKA 4H6JB 2G7UA 1OTAA 4ETXA 2ZMFA 5AVFA 3S7OA 3R7WA 1D7EA 4CLCA 2PD8A 4NXBA 3UMDA 3CUEC 3CWFA 2JHEA 1MKMA 1N9OA 2ZOHA 5TBMB 3TJZC 2PR5A 3IBJA 5DJTA 3T4KA 5HSQA 1OTEA 4WLAA 1NLYA 2VJWA 4FSFA 4WEKA 3T4JA 2IA2A 3IS2B 4I3JA 1GSXA 2VGLM 1S4SA 2QHKA 4PHTA 5CX7A 3E4PA 2NUTC 2GJ3A 4HH3A 2JKRI 4HIAA 2PR6A 4JGRA 3OBFA 3OCNA 4I5SA 4O01A 2OAQ1 4EEPA 3H82A 2V1AA 3HCYA 2HF6A 1OPXA 4LRXC 2OAP1 2W1RA 3BY9A 3P7NA 2QKPA 5DFYA 3B47A 1W63M 3MQ0A 2QWSA 3LIAA 4DMZA 2FH5A 2VV8A 3LICA 4OOLA 3KSFA 3K3CA 1S1YA 4EW7A 3UE3A 3CI6A 4HOIA 4G3VA 4BBVA 3EGXC 4KUKA 3VE4A 3F1NA 1XJ3A 4E04A 4LRZE 3B33A 3VOLA 4HNBA 5DF9A 4Y2FA 2VZWA 4ETZA 1T1AA 3IS2A 3PYPA 4KQOA 4DN0A 5HL6A 2PHYA 5J4EA 4PKYG 2XA7S 3PBSA 3R4KA 3T4TA 1XJ6A 4IHQA 4JGOA 3NOUC 4NXFA 4EEUA 2KX6A 2M7UA 4EXOA 2WKPA 1XJ4A 1LSVA 1TF1A 3RTYA 3FG8A 3R7WB 2JKTM 3K3DA 4CLCB 4IJGA 1YSPA 2OOLA 2W3DA 3MQOA 4O8GA 4ARZA 4EETB 1T1CA 4HY8A 3PBNA 4I38A 3LR3A 3ULFA 1TD5A 1LSWA 3CITA 4MDZA 3S7PA 3A0VA 3T50A 1TS7A 4P6ZM 3BY8A 4Y3IA 2INWA 3HJKA 4NKPA 4ME4A 2Z6DA 3C8CA 3LI9A 2V1BA 3H9WA 3LIBA 2P7JA 2HJEA 3EGDC 3JVVA 2W0NA 3C30A 3E0YA 5I5LA 3VE3A 3OOVA 2ZMVA 1P97A 5DJUA 3JVUA 4XT2A 5LBRA 4L9EA 1G6OA 4I39A 4WUJA 2YKHA 5K5BA 3H82B 4WL9A 4UEYA 2B18A 3BJNA 1D06A 1UWPX 3LR5A 3E98A 1N9NA 2W3EA 1ZHHB 5DFXA 3E4OA 4EUVA 5HPFA 2PYPA 1VB6A 4II7A 2EWWA 3UB9A 2VV6A 3CUEA 2Z6CA 1H8MA 2PT7A 3KYZA 3EEAA 3F1NB 4G3KA 2PYRA 4HQAA 2JKTI 5L8MA 2P08A 3U2AA 4Q0IA 4Y5FA 4BJPA 2O0YA 2MJ6A 5J7EA 3TE8A 5G4ZA 3UB7A 1YKDA 2JN7A 3PBRA 4WN5A 4BBTA 3KO6A 3CLOA 1DP9A 3MXQA 3V67A 4ARZB 4R3AA 4YOFA 2XROA 4HHDA 4R70A 3DBAA 1UWNX 5HDCA 3S7NA 5EFWA 4KQDA 3A0SA 3EOIA 4OOMA 4IUHA 1EW0A 3F1PB 1T18A 1V9YA 1NLZA 3D72A 4JGPA 1H3QA 2V0UA 3EWKA 4GLQA 2EA9A 2M7VA 3ZQ5A 3BQAA 3BW6A 3PXPA 2FZ0A 3ICYA 4XT2B 2KOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XA7 M;  2XA7 S;  1W63 M;  2JKR M;  2FH5 A;  4P6Z M;  2VGL M;  4P6Z S;  2VGL S;  2JKR I;  4UQI M;  4UQI S;  1W63 Q;  4NEE D;  5MC7 A;  2JKT M;  1NRJ A;  2HF6 A;  3TJZ C;  2JKT I; 
#chains in the Genus database with same CATH topology
 2XSS A;  3A3J A;  2JE5 A;  1F98 A;  2BAS A;  3PBT A;  3A0R A;  5FQJ A;  1S67 L;  1K6S A;  2EX9 A;  3FV7 A;  2XR0 A;  5DKK A;  5M18 A;  5AQA A;  2J3W A;  2W3G A;  3UB6 A;  1I5Q A;  4NEE D;  4BL2 A;  3C4O A;  2WKR A;  1MC0 A;  2O9C A;  3BRM A;  3G2Y A;  4WF0 A;  3IBR A;  1VQQ A;  4GHI A;  4KG6 A;  4LCM A;  1S4R A;  3LYX A;  3NOT C;  2VX8 A;  4R1G A;  4L9F A;  1WA9 A;  3BFD A;  3OLO A;  4CLC D;  2Y2M A;  5EPH A;  2CMN A;  3EQV A;  4NXE A;  1XX2 A;  2ZC4 B;  1KOU A;  3V3S A;  1T1B A;  4O0P A;  5HPI A;  4EQ1 A;  5DTT A;  3TW8 A;  3LID A;  2ZQA A;  2UWX A;  1L0E A;  3HLW A;  3L7H A;  3LIE A;  3KSH A;  2V0W A;  3PHY A;  4UQI M;  2C5W B;  1BTL A;  3T4Q A;  4EQI A;  4DJ3 A;  5IT5 A;  4R38 A;  1OTB A;  5FEG A;  1K54 C;  2A49 A;  3C7U A;  4JF5 A;  4OON A;  2X71 A;  4PAU A;  1OT9 A;  2LB5 A;  3PTE A;  4KUO A;  2XD5 A;  2FFY A;  4LFU A;  4QB8 A;  4QWO A;  1L3L A;  1GHI A;  4R3J A;  5AQB A;  4RA7 A;  1NRF A;  3Q82 A;  1TDG A;  4ZBE A;  1SDN A;  1DP8 A;  3MZD A;  1YT4 A;  4E3K A;  4GHI B;  5AQ9 A;  3F1O A;  3ZVW A;  4HES A;  3T1R A;  4BBU A;  4F3L A;  5AJG A;  3ZG0 A;  3BEB A;  5GHY A;  3ZDJ A;  3MJQ A;  1TS0 A;  3I7J A;  4BWI A;  3AGF A;  3ZHH A;  2VEA A;  2WZZ A;  2XRN A;  4AFI A;  2M1C A;  1K56 D;  3MZE A;  5F6A A;  5AVE A;  4RX3 A;  3TG9 A;  1K57 C;  2P74 A;  1CJF A;  3GVB A;  2K31 A;  2QJ5 A;  5TBM A;  1CF0 A;  3LY4 A;  3IWI A;  5CHJ A;  3E2L A;  1H8Y A;  1IEM A;  3MFX A;  4JPM A;  4LGW A;  1KE4 A;  2JKF A;  2R78 A;  2ZC6 B;  3A3E A;  4UQI S;  5IU1 A;  4DE0 A;  2ZJ9 A;  3SZT A;  1OJG A;  4S2O A;  2ZC5 B;  1ERM A;  5F69 A;  2NUP C;  3BQ8 A;  1MWS A;  2RCX A;  3ZNY A;  2XA7 M;  4KEN B;  1S1Z A;  3P01 A;  4OQH A;  3MR0 A;  3IX4 A;  3S4X A;  1NWZ A;  1ES2 A;  3F1O B;  5F5Y A;  3ZGA B;  4F3L B;  4IBX A;  1NRJ A;  2ZC3 B;  2R9W A;  4GN2 A;  4WZ5 A;  1LSX A;  4MN7 A;  4BMW A;  4L9G A;  4QU3 A;  2V9A A;  1TEM A;  4IUK A;  4KG2 A;  3DWK A;  1OTA A;  1E3U D;  1RGZ A;  3S7O A;  1XA7 A;  4WM9 A;  3ISG A;  4PMA A;  2OSU A;  1JTD A;  3CWF A;  2WAE A;  4LV2 A;  5E2F A;  2ZOH A;  1LL5 A;  4HEF A;  1I2W A;  5TBM B;  3T4K A;  3W4P A;  4R23 A;  5EVI C;  3FZC A;  4I3J A;  3QP1 A;  1S4S A;  2QHK A;  4S2J A;  4YIN A;  3E4P A;  3LO7 A;  4HIA A;  4R4R A;  3OPP A;  4JGR A;  2OV5 A;  1RGY A;  4EEP A;  2Y2I A;  3HCY A;  4GKU A;  1W5D A;  3VSK A;  4LRX C;  2OAP 1;  1YLJ A;  1A0K A;  5EUA A;  4N9K A;  5FQI A;  1W63 M;  3MQ0 A;  3FYZ A;  3LIC A;  3KSF A;  1DJC A;  5TR7 A;  4G3V A;  3BYD A;  4S2L A;  3F1N A;  1ES4 A;  5A91 A;  1J3W A;  1SKO A;  5GLA A;  4HNB A;  2ZC7 A;  1FCN A;  2VZW A;  2H5S A;  1PWC A;  3C7V A;  4KQO A;  5HL6 A;  3VMA A;  1ONG A;  3W8K A;  5J4E A;  2XA7 S;  3BFC A;  3PBS A;  3W4O A;  4N92 A;  5CXW A;  4IHQ A;  5L10 A;  4MBK A;  2KX6 A;  1MXO A;  3M6B A;  4EXO A;  2I72 A;  3VP2 A;  2WGW A;  1W8Y A;  2JKT M;  3MS6 A;  1Q2P A;  4ARZ A;  4OQG A;  1T1C A;  4HY8 A;  2PU2 A;  1PW1 A;  2EX6 A;  3LR3 A;  3ULF A;  3CIT A;  2ZQ9 A;  3IF6 C;  3TSG A;  1TS7 A;  4P6Z M;  4Y3I A;  5HAQ A;  2Z6D A;  3C8C A;  3LI9 A;  2Y2K A;  3GR2 A;  3E0Y A;  3T1Q B;  3JVU A;  4KZ9 A;  3SS3 A;  4XT2 A;  5LBR A;  4L9E A;  1G6O A;  4OPY A;  4E3L A;  4UEY A;  4R4S A;  2B18 A;  4OP5 A;  4KQR A;  1GA9 A;  3LR5 A;  3E98 A;  3MXR A;  4DKI A;  4EUV A;  5HPF A;  3CUE A;  3MSH A;  2WZX A;  4XUX A;  4N1H A;  1H8M A;  1ES5 A;  3EEA A;  3F1N B;  1SKO B;  1PI4 A;  3IT9 A;  4HQA A;  5JYO A;  1N9B A;  2V20 A;  1ZG6 A;  3ZG5 A;  4Y5F A;  2MJ6 A;  4BD0 A;  4EBP A;  3IH9 A;  5CRF A;  3Q07 A;  1IYP A;  3Q81 A;  5FQ9 A;  2H0Y A;  2WGW B;  5I94 A;  1L0G A;  3V67 A;  4ARZ B;  1CI9 A;  3N6I A;  4HHD A;  5AQ7 A;  1H8Z A;  2ZLY A;  3NBL A;  4K0W A;  1T18 A;  4JXW A;  1ERQ A;  1V9Y A;  1FR6 A;  1W7F A;  1O07 A;  4GLQ A;  3BW6 A;  3PXP A;  2FZ0 A;  3ICY A;  1JVJ A;  4PM6 A;  3D9Y A;  4XT2 B;  2KOI A;  2J8Y A;  1YPR A;  4JXV A;  2V8F A;  3VV4 A;  2IWB A;  1TDL A;  3UME A;  3NDE A;  1ESU A;  5F83 A;  5HD3 A;  1GA0 A;  1LI0 A;  2B02 A;  3B42 A;  3VP0 A;  4MCW A;  2JC7 A;  4DE1 A;  2A24 B;  1F9I A;  3IH8 A;  3UE6 A;  4QPR A;  4S2N C;  4G3W A;  1K0K A;  1STZ A;  3N8S A;  4LEN A;  4JBF A;  3CJM A;  4B9O A;  1T19 A;  1P9W A;  2P9V A;  5A93 A;  5GL9 A;  2X02 A;  1PWG A;  2Y2Q A;  1NXY A;  3MBZ A;  3QP5 A;  3RXX A;  1YLZ A;  3S7Q A;  4HI4 A;  3QHY A;  4X69 A;  1F2K A;  3M2K A;  1PFL A;  3KSG A;  4MBF A;  2VGL S;  2A3U A;  4KQQ A;  4GW9 A;  3UN7 A;  3GSG A;  5HWV A;  5CTN A;  3P09 A;  1K25 A;  1NZO A;  1FSW A;  2YKF A;  1HTZ A;  1GSV A;  2PBY A;  3M2J A;  3T4L A;  3H7W A;  3HVF A;  4EU0 A;  3FPV A;  4QY6 A;  1ALQ A;  3HJI A;  2VV7 A;  3SS4 A;  1LT0 A;  3SH7 A;  4Q8I A;  1V9Z A;  2XH9 A;  2A2L A;  3AGE A;  2VKS A;  3EQU A;  4KZA A;  3HBR A;  1PW8 A;  3GEC A;  5EM0 A;  5IS1 A;  3G4P A;  1XJ2 A;  4X68 A;  4EER A;  4HJ4 A;  3MFD A;  2K7S A;  1KVL A;  1E3U A;  1M40 A;  5L07 A;  5GHZ A;  3IX8 A;  2P9V B;  1ZG4 A;  2L0W A;  3CAX A;  4DE3 A;  4X25 A;  3OC2 A;  1BLS A;  4H6J A;  1K55 C;  3HLF A;  3ZG8 B;  2W1T B;  1O7E A;  3QNB A;  4GJ4 A;  4CJN A;  5HW3 A;  3WS4 A;  1U60 A;  1ZKJ A;  4EBN A;  2KDK A;  3MKE A;  2VA0 A;  2QMI A;  3LIF A;  2ZMA A;  2J9O A;  1SCW A;  3NUL A;  3OPH A;  2Y59 A;  3H7W B;  3IXB A;  4WEJ A;  3LR0 A;  4FOF A;  1KGG A;  1W63 Q;  1XXM A;  1F5M A;  1XFQ A;  3LFV A;  5TJJ A;  4RX2 A;  1HVB A;  4MN5 A;  2XF3 A;  4P6B A;  2QPN A;  2HDU A;  2J3T C;  3VP4 A;  4DXC A;  1OTI A;  4PM9 A;  4JXS A;  4BQM A;  2CC1 A;  3VFH A;  4HP4 A;  4Z1W A;  2EXB A;  2QJ7 A;  3IWQ A;  1PYY A;  4MMN A;  2WAD A;  4ESP A;  3S22 A;  3WWX A;  5G4Y A;  4HJ3 A;  4LV1 A;  4U0T A;  3IHA A;  1WYB A;  4PM7 A;  2O9A A;  4OOY A;  5E43 A;  5EV0 A;  3FKV A;  4BL3 A;  1K54 A;  1IEL A;  3W4Q A;  2VLG A;  4H6J B;  3Q1F A;  2G7U A;  5FQM A;  2AVX A;  5AVF A;  4KZ7 A;  4EV4 A;  3BFF A;  2PD8 A;  4IVK A;  4X1L A;  2JHE A;  1N9O A;  1M6K A;  4B4Z A;  3TJZ C;  2PR5 A;  4IBR A;  3HLD A;  4WLA A;  1NLY A;  2VJW A;  4HBU A;  4WEK A;  3ZG7 B;  2XLN A;  5HAR A;  2WKH A;  2GJ3 A;  4LV0 A;  1KVM A;  2RL3 A;  3NIA A;  3FWL A;  3IXG A;  3OCN A;  4I5S A;  4O01 A;  2OAQ 1;  4DE2 A;  5HFO A;  5DTK A;  3H82 A;  5U47 A;  1XP4 A;  2HF6 A;  5FQQ A;  3T12 B;  5KZH A;  5FAS A;  3NEC A;  4S2P A;  4Y17 A;  2QWS A;  3CG5 A;  4NET A;  4QHC A;  3K3C A;  1ACF A;  5EVE A;  4BBV A;  1K57 A;  2WAF A;  4Y7P A;  1GHP A;  1J9M A;  3B33 A;  2WKI A;  3NC8 A;  4ETZ A;  4OPR A;  3G31 A;  4DN0 A;  2G2W A;  1ZC2 A;  2HDQ A;  3BLM A;  1XJ6 A;  1VM1 A;  4XXR A;  1BUE A;  3GMW A;  2V8C A;  4X1M A;  2WKP A;  4PM8 A;  4NK3 A;  3FG8 A;  1ESI A;  3HLE A;  1YSP A;  2W3D A;  2ZQD A;  4B88 A;  1K4E A;  3OPR A;  5E2H A;  4X56 A;  1TD5 A;  1LSW A;  1MBL A;  4FD8 A;  3PAG A;  3A0V A;  3BY8 A;  1SHV A;  2INW A;  3HJK A;  4Y13 A;  4ME4 A;  3A3I A;  5E2G A;  1S6R A;  2H10 A;  5FQK A;  4NG2 A;  3HRE A;  2W0N A;  3C30 A;  3OOV A;  5KSC A;  5DJU A;  2ZL1 B;  4WBG A;  5FSR A;  2YKH A;  3H82 B;  1PI5 A;  2ZM8 A;  1WE4 A;  4GOG A;  3P98 A;  3GQZ A;  4ZDX A;  1LI9 A;  5F1G A;  1ZHH B;  3LEZ A;  5DFX A;  1L0D A;  3UDF A;  3BFG A;  1IYQ A;  3RXW A;  1FCM A;  2PT7 A;  5FEF A;  4G3K A;  4O7D A;  2PYR A;  2JKT I;  4X6T A;  5GLD A;  5EVI A;  2UV0 E;  4OKP A;  4Q0I A;  5HAP A;  5EM1 A;  2PU4 A;  2XFT A;  5G4Z A;  3UB7 A;  1MPL A;  3N7W A;  1PIO A;  2WGV A;  5DF7 A;  2HDR A;  2XD1 A;  4WN5 A;  1Z09 A;  4S2I A;  3MXQ A;  3ZG9 B;  3LGO A;  4X53 A;  5HDC A;  4S2M A;  2V2F F;  2IWD A;  4IUH A;  1YQS A;  3F1P B;  1GCE A;  4PPR A;  3HUO A;  1NLZ A;  5CEC A;  1MKI A;  1H3Q A;  1RP5 A;  2EA9 A;  2M7V A;  2BG1 A;  5CTM A;  5KSH A;  2ACG A;  4MBH A;  3ZYT A;  5L09 A;  1Y4O A;  2HPB A;  3E4Q A;  5FAT A;  2Y55 A;  1C3B A;  2EXA A;  2ZBB A;  1DJA A;  2Y2N A;  3SOI A;  3UB8 A;  3IX3 A;  5C5K A;  1ES3 A;  4ZJ2 A;  4OQ0 A;  3GRJ A;  1MZU A;  3FC7 A;  3IF6 A;  3MQQ A;  2K2N A;  4LPZ A;  3BWL A;  5EVI B;  2PDR A;  2VGK A;  3Q7Z A;  3O87 A;  3PBQ A;  4E3J A;  1ZTU A;  5FA7 A;  5F68 A;  2JKG A;  5GHX A;  2PBD P;  4JXG A;  3MMH A;  5HWT A;  1DRM A;  3CHW P;  1MY8 A;  3BLS A;  4DRT A;  4IED A;  2XGN A;  3UO9 A;  2X01 A;  2HZ5 A;  4C6Y A;  1OJ5 A;  2A24 A;  3V39 A;  3C38 A;  1P9R A;  4DJ2 A;  1Y28 A;  4KZ4 A;  2OLV A;  3W2Z A;  1LLB A;  4P0M A;  2GZA A;  2HP6 A;  5J3W A;  1I2S A;  5E2E A;  2R9X A;  2ZOI A;  3L9K A;  3GDI A;  1JTG A;  1FCO A;  1FQG A;  5A92 A;  5EEC A;  1N4O A;  3VOZ A;  4E6X A;  4HP9 A;  5FDH A;  4CLC C;  4EES A;  3UE0 A;  3NHQ A;  2P04 A;  3UB5 P;  2HJ9 C;  1BLH A;  5FL3 A;  4GS9 A;  1XA1 A;  5D3O A;  3QP8 A;  1IOU A;  3N8R A;  4OQI A;  4LLO B;  5TGF A;  3UPP A;  1IYS A;  3SH8 A;  1JNU A;  1YLY A;  2DNS A;  1OT6 A;  3IF6 B;  3NJA A;  1CK3 A;  4DF6 A;  2I9V A;  3QP6 A;  3KX0 X;  2HP5 A;  2Y2L A;  1QMF A;  1K38 A;  4EBL A;  5HZH A;  5GLB A;  1CQA A;  1W8Q A;  1PNE A;  5CER A;  3O5Y A;  2W27 A;  4P6Z S;  4LRY C;  2Y2G A;  3D3O A;  3N4I A;  1IFQ A;  1H5X A;  2Y2O A;  3ZFZ A;  5EOO A;  4LV3 A;  2Y2H A;  1HD8 A;  3MF0 A;  3Q7V A;  3T4O A;  1JWP A;  5L2F A;  4GZB A;  4S2N A;  1VEU A;  4OP8 A;  5HWW A;  1YLT A;  2W3F A;  3HUM A;  3DTI A;  4GD8 A;  5DKL A;  1G68 A;  2HGV A;  2JBF A;  2BTF P;  1VET A;  2Y4A A;  1UGU A;  1HZO A;  3S1Y A;  5EVL A;  4WMC A;  4XUZ A;  1KE0 A;  3IXH A;  4UA9 A;  4R6L A;  4D2O A;  2J9P A;  1N9L A;  2W1T A;  3ZCZ A;  2QYB A;  4GS9 B;  5EVI D;  4QJG A;  2PD7 A;  4CPK A;  4K0X A;  3T4S A;  2JKR M;  5A8B A;  1QME A;  1KGE A;  1BZA A;  4MNR A;  3TRC A;  3EEH A;  5CGW A;  4HJ6 A;  1EI5 A;  2H28 A;  2DRW A;  1S66 L;  4ZJ3 A;  4CLC E;  3QP4 A;  3UPO A;  2D02 A;  4WEL A;  2KLI A;  2O99 A;  4GB7 A;  1BT5 A;  1HLU P;  2ZM0 A;  1XGJ A;  3T1X A;  5CGS A;  1AWI A;  3R7W A;  1D7E A;  4DDS A;  4QY5 A;  2GDN A;  1MKM A;  3RJU A;  4OLG A;  4KZ8 A;  3OPL A;  2ZQ8 A;  5HSQ A;  4EUZ A;  3Q7V B;  4FSF A;  2IA2 A;  3IS2 B;  1VEU B;  3WS0 A;  1GSX A;  2WK0 A;  4K91 A;  1KDS A;  3T1S A;  3V5M A;  1VET B;  3HUN A;  3FKW A;  2V1A A;  1OPX A;  2HDS A;  3VP3 A;  1K55 A;  2QKP A;  5DFY A;  4R3B A;  5DVA A;  4DMZ A;  3LEQ A;  4C75 A;  3G32 A;  4OOL A;  4M3K A;  1S1Y A;  4EW7 A;  3UE3 A;  3CI6 A;  4KUK A;  3VE4 A;  2E8J A;  4E04 A;  3NI9 A;  5A90 A;  3PYP A;  1DJB A;  4UA7 A;  2PHY A;  5DF8 A;  4PKY G;  4JLF A;  2VK3 A;  1YLW A;  3T4T A;  4NXF A;  2V1Z A;  2G2U A;  2M7U A;  1L0F A;  1LSV A;  4P87 A;  1TF1 A;  2B95 A;  3RTY A;  3R7W B;  4BLM A;  2OOL A;  3MQO A;  4KG5 A;  5G18 A;  1IKI A;  3NCK A;  3PBN A;  4I38 A;  3IXD A;  2Q9M A;  4FH2 A;  4NKP A;  4GDB A;  2H0T A;  3A3D A;  5HAI A;  2PAV P;  3VE3 A;  3ZNT A;  2ZMV A;  3HLC A;  1D06 A;  1UWP X;  3UNW A;  4JF4 A;  2W3E A;  1LL9 A;  2XQZ A;  3WRT A;  3E4O A;  4FCF A;  2PYP A;  1VB6 A;  3DWZ A;  4FTX A;  1XGI A;  4RYE A;  3KYZ A;  1MWR A;  1Z6F A;  5J8X A;  3AGD A;  2O0Y A;  4P85 A;  3TE8 A;  5CEB A;  5DTS A;  4BD1 A;  5FAQ A;  1LHY A;  2XFS A;  3O3V A;  1YKD A;  2JN7 A;  4LCL A;  2ZL1 A;  4BBT A;  2DCF A;  1PRQ A;  3CLO A;  2XK1 A;  3GTC A;  1PZP A;  4HBT A;  4OPQ A;  4R70 A;  3DBA A;  1UWN X;  3S7N A;  5EFW A;  3ITB A;  4KZB A;  3A0S A;  4E3M A;  1G5U A;  4E3O A;  3EOI A;  4WMC D;  4OOM A;  2Q0O A;  1CI8 A;  2V0U A;  3ZQ5 A;  3BQA A;  5CHU A;  4UAA A;  1Y54 A;  2OWJ A;  3IHB A;  5HL1 A;  4Z9Q A;  5HD5 A;  3UY6 A;  3WS1 A;  3CMZ A;  2PRF A;  1DP6 A;  5FI7 A;  2OWH A;  3WS2 A;  2HV1 A;  1XFN A;  3DAV A;  2L4R A;  4HH2 A;  4B93 A;  4B4X A;  3KYQ A;  3D4F A;  4FH4 A;  5FAO A;  4UA6 A;  3UDX A;  1JWV A;  5FI6 A;  3RFB A;  1NY0 A;  4ID4 A;  4IVI A;  4ZTK A;  3VSL A;  3SS5 A;  3G35 A;  3RH8 B;  5HDS A;  1X0O A;  1NYM A;  4Q0H A;  3F1P A;  2LB9 A;  3WS5 A;  4YNR A;  1NZU A;  3LI8 A;  3DTM A;  1BUL A;  1Q2Q A;  3VFF A;  3OCL A;  4I3I A;  1BYW A;  5JYP A;  3BEC A;  5KIZ A;  5FAP A;  1D1J A;  2WYX A;  2O9B A;  4X55 A;  3LY3 A;  4D60 A;  4JKT A;  4Q0J A;  1G6A A;  4GCZ A;  4U0X A;  1E4D A;  1EWZ A;  2L1M A;  5EOE A;  4WZ5 C;  2ZD8 A;  4RVA A;  3MKF A;  4OVD A;  1NJ4 A;  2B5R A;  1NYY A;  3G6O A;  2J80 A;  3LR4 A;  2D01 A;  1TS8 A;  5HDD A;  3IQA A;  2BLS A;  3KSI A;  4OPZ A;  4UHU A;  2GX5 A;  2J7V A;  5BOH A;  3G34 A;  4PKY A;  4MLL A;  2WKQ A;  4K08 A;  1ONH A;  1G28 A;  4ZRR A;  1W79 A;  1OTD A;  1ODV A;  1LL8 A;  4GDN A;  2XEP A;  1JWZ A;  2Y91 A;  4DDY A;  2EWV A;  1FIK A;  1SZV A;  5MC7 A;  3MZF A;  4L0L A;  4JGQ A;  3SW1 A;  2Y8H A;  1FR1 A;  2J3T D;  1OME A;  1CEF A;  4CQH A;  1YAX A;  3G2Z A;  4KZ5 A;  4MEZ A;  4Y0T A;  4M4X A;  2Y79 A;  3M6H A;  4E3N A;  3NOP C;  3SH9 A;  3C4P A;  4YFM A;  3QP2 A;  1KE3 A;  3HLB A;  4N9L A;  2Z2M B;  2Y2J A;  1BLC A;  4WYY A;  4I3A A;  1YLP A;  1YSQ A;  1H0M A;  2W3H A;  4MN6 A;  1FOF A;  3FPW A;  3PBO A;  2XDM A;  1IYO A;  2Z2L B;  1VHM A;  1YMX A;  3ZVT A;  1TVF A;  3V50 A;  5EE8 A;  3NDG A;  3LCE A;  2ZM2 A;  4YWZ A;  4NXG A;  3WRZ A;  4C3Q A;  1FIL A;  2GNX A;  5F82 A;  3HLG A;  1TS6 A;  5IHV A;  4Y0U A;  3K2N A;  3DTK A;  4E3I A;  3A3F A;  5CED A;  3DTE A;  3LUQ A;  4FUW A;  4EWF A;  1P0Z A;  3C5A A;  3TOI A;  3PR6 A;  2DMW A;  3GV9 A;  1GHM A;  4ZJ1 A;  1K4F A;  5TFQ A;  1GSW A;  3E2K A;  1FSY A;  1KDW A;  4RQ9 A;  1ERO A;  1YMS A;  2OLU A;  3C2W A;  1KGF A;  4Y0O A;  4ETX A;  2ZMF A;  5HX9 A;  4CLC A;  4NXB A;  3UMD A;  2QZ6 A;  3CUE C;  3VOY A;  1CEG A;  1XPB A;  4A5R A;  2EX2 A;  2Y2P A;  2WKE A;  1K6R A;  3IBJ A;  5DJT A;  1OTE A;  3T4J A;  2VGL M;  2EFU A;  4PHT A;  5CX7 A;  2NUT C;  3O86 A;  4HH3 A;  2JKR I;  2PR6 A;  3OBF A;  3JYI A;  3OZH A;  3DW0 A;  2W1R A;  3BY9 A;  1SDE A;  2ZQC A;  4KZ6 A;  3P7N A;  1PWD A;  3B47 A;  1L2S A;  4S2K A;  3LIA A;  3IWO A;  2E8I A;  2FH5 A;  2VV8 A;  1YM1 A;  3UDI A;  3CPT A;  4H8R A;  4Y15 A;  4HOI A;  1WYC A;  3QNC A;  3EGX C;  1RCJ A;  1XJ3 A;  3MXS A;  3UE1 A;  3UPN A;  4LRZ E;  5M1A A;  3VOL A;  4R0Q A;  5DF9 A;  4Y2F A;  1T1A A;  3IS2 A;  3ITA A;  2Q9N A;  4BEN A;  3R4K A;  4JGO A;  3NOU C;  4GNU A;  4N1X A;  4EEU A;  3VP1 A;  1XJ4 A;  4KZ3 A;  3K3D A;  4CLC B;  4IJG A;  4O8G A;  2EX8 A;  4EET B;  4PM5 A;  2WGI A;  5FDS A;  3PAE A;  4MDZ A;  3S7P A;  3T50 A;  1MWU A;  5M19 A;  1K56 A;  3B3X A;  2V1B A;  3H9W A;  3LIB A;  2P7J A;  2HJE A;  3EGD C;  3JVV A;  1SKF A;  4OH0 A;  5I5L A;  3BM6 A;  3O88 A;  1P97 A;  5CHM A;  4E6W A;  3G30 A;  4I39 A;  2JCH A;  4WUJ A;  5K5B A;  4WL9 A;  3BJN A;  5KMW A;  4F94 A;  4U3T A;  1N9N A;  2EFX A;  3BFE A;  2VGJ A;  1BLP A;  3CPT B;  4II7 A;  1AXB A;  2EWW A;  2VV6 A;  5FI2 A;  3UB9 A;  2IWC A;  2Z6C A;  5CGX A;  1S0W A;  5F1F A;  5L8M A;  3CZD A;  1DY6 A;  2P08 A;  3U2A A;  4BJP A;  3NY4 A;  5J7E A;  1XKZ A;  4ZAM A;  3N8L A;  4QD4 A;  5GLC A;  2C6W B;  1BSG A;  4DXB A;  2HP9 A;  3PBR A;  3IF5 A;  3V3R A;  2FFF B;  3KO6 A;  1DP9 A;  3JPU A;  4OLD A;  3HL9 A;  1MWT A;  4R3A A;  4YOF A;  2XRO A;  1E25 A;  2ZQ7 A;  1PZO A;  3KYE A;  3U4L P;  4KQD A;  4GD6 A;  1EW0 A;  4WZ4 A;  3D72 A;  4JGP A;  3EWK A;  4JF6 A;  2WUQ A;  1IKG A; 
#chains in the Genus database with same CATH homology
 2OWJ A;  2XSS A;  5KSH A;  3ZYT A;  5HD5 A;  1F98 A;  2BAS A;  3PBT A;  3A0R A;  3VV4 A;  1S67 L;  3E4Q A;  3UME A;  5DKK A;  1DP6 A;  2J3W A;  5HD3 A;  2W3G A;  2OWH A;  3UB6 A;  2B02 A;  3B42 A;  4NEE D;  4MCW A;  2HV1 A;  1XFN A;  2A24 B;  2ZBB A;  1F9I A;  2L4R A;  2WKR A;  3UB8 A;  1MC0 A;  2O9C A;  4HH2 A;  4QPR A;  3UE6 A;  4B93 A;  3KYQ A;  4WF0 A;  5C5K A;  3IBR A;  4G3W A;  4GHI A;  3RFB A;  1S4R A;  1MZU A;  3LYX A;  1STZ A;  3FC7 A;  3MQQ A;  2K2N A;  3NOT C;  4LPZ A;  2VX8 A;  3BWL A;  4L9F A;  3RH8 B;  2PDR A;  5HDS A;  1WA9 A;  1X0O A;  3OLO A;  4CLC D;  4B9O A;  1T19 A;  1P9W A;  3F1P A;  4Q0H A;  2LB9 A;  2CMN A;  3EQV A;  4NXE A;  3PBQ A;  1ZTU A;  4YNR A;  3LI8 A;  3S7Q A;  1KOU A;  5F68 A;  1T1B A;  4HI4 A;  4O0P A;  3MMH A;  5HPI A;  5HWT A;  4EQ1 A;  1DRM A;  3TW8 A;  3OCL A;  3LID A;  4I3I A;  1BYW A;  5KIZ A;  2O9B A;  3KSG A;  2VGL S;  3LIE A;  1OJ5 A;  2A24 A;  3C38 A;  1P9R A;  3KSH A;  2V0W A;  1Y28 A;  3PHY A;  4GW9 A;  4Q0J A;  4UQI M;  4DJ2 A;  5HWV A;  4GCZ A;  3T4Q A;  2L1M A;  3W2Z A;  2YKF A;  2GZA A;  5J3W A;  4DJ3 A;  2ZOI A;  5IT5 A;  4R38 A;  1GSV A;  1OTB A;  3GDI A;  3T4L A;  3G6O A;  3H7W A;  2J80 A;  3LR4 A;  4PAU A;  1OT9 A;  2D01 A;  1TS8 A;  2LB5 A;  4KUO A;  5HDD A;  4HP9 A;  4CLC C;  4EES A;  4EU0 A;  3KSI A;  3FPV A;  3NHQ A;  2P04 A;  3HJI A;  2HJ9 C;  2VV7 A;  5FL3 A;  4GS9 A;  2GX5 A;  4PKY A;  1IOU A;  1LT0 A;  2WKQ A;  4K08 A;  1V9Z A;  2A2L A;  1G28 A;  2VKS A;  3EQU A;  4ZRR A;  4LLO B;  1DP8 A;  3GEC A;  1OTD A;  5IS1 A;  4GHI B;  1XJ2 A;  1ODV A;  4EER A;  1JNU A;  4HJ4 A;  3F1O A;  1LL8 A;  2K7S A;  1OT6 A;  4BBU A;  4F3L A;  5AJG A;  3NJA A;  2EWV A;  2I9V A;  3KX0 X;  5MC7 A;  4L0L A;  2L0W A;  3MJQ A;  4JGQ A;  3CAX A;  3SW1 A;  2Y8H A;  1TS0 A;  5HZH A;  2J3T D;  3OC2 A;  4BWI A;  2VEA A;  4H6J A;  2XRN A;  4CQH A;  2W1T B;  1YAX A;  4AFI A;  2M1C A;  3O5Y A;  4GJ4 A;  2W27 A;  4P6Z S;  4LRY C;  5F6A A;  4M4X A;  5AVE A;  3D3O A;  2Y79 A;  1IFQ A;  2K31 A;  2QJ5 A;  5TBM A;  3NOP C;  3MF0 A;  3T4O A;  2KDK A;  2VA0 A;  5HWW A;  2W3F A;  4I3A A;  3LIF A;  1YSQ A;  2W3H A;  5DKL A;  4MN6 A;  3MFX A;  2HGV A;  3FPW A;  3H7W B;  2R78 A;  3PBO A;  4WEJ A;  3LR0 A;  4FOF A;  1UGU A;  1W63 Q;  4UQI S;  5IU1 A;  1VHM A;  1F5M A;  1XFQ A;  3LFV A;  1OJG A;  5TJJ A;  4MN5 A;  4R6L A;  5F69 A;  4YWZ A;  2W1T A;  1N9L A;  2J3T C;  4NXG A;  2QYB A;  3BQ8 A;  4GS9 B;  2NUP C;  2GNX A;  2PD7 A;  1OTI A;  2XA7 M;  1TS6 A;  3T4S A;  1S1Z A;  3P01 A;  2JKR M;  3K2N A;  5A8B A;  4HP4 A;  3TRC A;  3LUQ A;  3EEH A;  3MR0 A;  1P0Z A;  4Z1W A;  2QJ7 A;  4HJ6 A;  2DMW A;  1NWZ A;  3PR6 A;  2H28 A;  4MMN A;  1S66 L;  3F1O B;  5F5Y A;  4F3L B;  5G4Y A;  4HJ3 A;  4CLC E;  1NRJ A;  1GSW A;  1LSX A;  2D02 A;  2O9A A;  4MN7 A;  4RQ9 A;  4WEL A;  4L9G A;  4BMW A;  2KLI A;  2O99 A;  2V9A A;  2VLG A;  3C2W A;  4IUK A;  4H6J B;  2G7U A;  1OTA A;  4ETX A;  2ZMF A;  5AVF A;  3S7O A;  3R7W A;  1D7E A;  4CLC A;  2PD8 A;  4NXB A;  3UMD A;  3CUE C;  3CWF A;  2JHE A;  1MKM A;  1N9O A;  2ZOH A;  5TBM B;  3TJZ C;  2PR5 A;  3IBJ A;  5DJT A;  3T4K A;  5HSQ A;  1OTE A;  4WLA A;  1NLY A;  2VJW A;  4FSF A;  4WEK A;  3T4J A;  2IA2 A;  3IS2 B;  4I3J A;  1GSX A;  2VGL M;  1S4S A;  2QHK A;  4PHT A;  5CX7 A;  3E4P A;  2NUT C;  2GJ3 A;  4HH3 A;  2JKR I;  4HIA A;  2PR6 A;  4JGR A;  3OBF A;  3OCN A;  4I5S A;  4O01 A;  2OAQ 1;  4EEP A;  3H82 A;  2V1A A;  3HCY A;  2HF6 A;  1OPX A;  4LRX C;  2OAP 1;  2W1R A;  3BY9 A;  3P7N A;  2QKP A;  5DFY A;  3B47 A;  1W63 M;  3MQ0 A;  2QWS A;  3LIA A;  4DMZ A;  2FH5 A;  2VV8 A;  3LIC A;  4OOL A;  3KSF A;  3K3C A;  1S1Y A;  4EW7 A;  3UE3 A;  3CI6 A;  4HOI A;  4G3V A;  4BBV A;  3EGX C;  4KUK A;  3VE4 A;  3F1N A;  1XJ3 A;  4E04 A;  4LRZ E;  3B33 A;  3VOL A;  4HNB A;  5DF9 A;  4Y2F A;  2VZW A;  4ETZ A;  1T1A A;  3IS2 A;  3PYP A;  4KQO A;  4DN0 A;  5HL6 A;  2PHY A;  5J4E A;  4PKY G;  2XA7 S;  3PBS A;  3R4K A;  3T4T A;  1XJ6 A;  4IHQ A;  4JGO A;  3NOU C;  4NXF A;  4EEU A;  2KX6 A;  2M7U A;  4EXO A;  2WKP A;  1XJ4 A;  1LSV A;  1TF1 A;  3RTY A;  3FG8 A;  3R7W B;  2JKT M;  3K3D A;  4CLC B;  4IJG A;  1YSP A;  2OOL A;  2W3D A;  3MQO A;  4O8G A;  4ARZ A;  4EET B;  1T1C A;  4HY8 A;  3PBN A;  4I38 A;  3LR3 A;  3ULF A;  1TD5 A;  1LSW A;  3CIT A;  4MDZ A;  3S7P A;  3A0V A;  3T50 A;  1TS7 A;  4P6Z M;  3BY8 A;  4Y3I A;  2INW A;  3HJK A;  4NKP A;  4ME4 A;  2Z6D A;  3C8C A;  3LI9 A;  2V1B A;  3H9W A;  3LIB A;  2P7J A;  2HJE A;  3EGD C;  3JVV A;  2W0N A;  3C30 A;  3E0Y A;  5I5L A;  3VE3 A;  3OOV A;  2ZMV A;  1P97 A;  5DJU A;  3JVU A;  4XT2 A;  5LBR A;  4L9E A;  1G6O A;  4I39 A;  4WUJ A;  2YKH A;  5K5B A;  3H82 B;  4WL9 A;  4UEY A;  2B18 A;  3BJN A;  1D06 A;  1UWP X;  3LR5 A;  3E98 A;  1N9N A;  2W3E A;  1ZHH B;  5DFX A;  3E4O A;  4EUV A;  5HPF A;  2PYP A;  1VB6 A;  4II7 A;  2EWW A;  3UB9 A;  2VV6 A;  3CUE A;  2Z6C A;  1H8M A;  2PT7 A;  3KYZ A;  3EEA A;  3F1N B;  4G3K A;  2PYR A;  4HQA A;  2JKT I;  5L8M A;  2P08 A;  3U2A A;  4Q0I A;  4Y5F A;  4BJP A;  2O0Y A;  2MJ6 A;  5J7E A;  3TE8 A;  5G4Z A;  3UB7 A;  1YKD A;  2JN7 A;  3PBR A;  4WN5 A;  4BBT A;  3KO6 A;  3CLO A;  1DP9 A;  3MXQ A;  3V67 A;  4ARZ B;  4R3A A;  4YOF A;  2XRO A;  4HHD A;  4R70 A;  3DBA A;  1UWN X;  5HDC A;  3S7N A;  5EFW A;  4KQD A;  3A0S A;  3EOI A;  4OOM A;  4IUH A;  1EW0 A;  3F1P B;  1T18 A;  1V9Y A;  1NLZ A;  3D72 A;  4JGP A;  1H3Q A;  2V0U A;  3EWK A;  4GLQ A;  2EA9 A;  2M7V A;  3ZQ5 A;  3BQA A;  3BW6 A;  3PXP A;  2FZ0 A;  3ICY A;  4XT2 B;  2KOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...