2XA7S

Ap2 clathrin adaptor core in active complex with cargo peptides
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords ADAPTOR-RELATED PROTEIN COMPLEX 2, ALPHA 2 SUBUNIT
publication title A Large Scale Conformational Change Couples Membrane Recruitment to Cargo Binding in the Ap2 Clathrin Adaptor Complex
pubmed doi rcsb
source organism Rattus norvegicus
total genus 37
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2010-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2xa7S00
2VGLS 2XA7S 4UQIS 1W63M 1W63Q 2JKTM 2JKRM 4P6ZS 2VGLM 2XA7M 3TJZC 4UQIM 4NEED 2FH5A 4P6ZM 1NRJA 2JKTI 2JKRI 2HF6A 5MC7A
chains in the Genus database with same CATH superfamily
1OMEA 1G5UA 2W3FA 3UDXA 1BUEA 1YLTA 3LY4A 4JGOA 4KQDA 4O0PA 3HLEA 5EFWA 4R3JA 1S4RA 3NOTC 4MCWA 2XSSA 3D3OA 4HP9A 2JKFA 3UE3A 2W1RA 4LV0A 5E43A 4EEUA 3P7NA 3K3CA 2OLVA 3NDGA 2XF3A 4NK3A 1VHMA 1N4OA 5F69A 3VOZA 4BBUA 4F3LA 4C3QA 2EX6A 2G2WA 3ZNYA 1XJ6A 4EU0A 3BRMA 1TS0A 1L2SA 3NULA 4EERA 2JKGA 2PT7A 3HLCA 5EOOA 4CLCE 3DTEA 3IBRA 4IVIA 2EX2A 4BMWA 1PZPA 3IX3A 3DTKA 3MXQA 3HUOA 5HAIA 2P04A 3BFEA 4DDSA 1UGUA 2QYBA 2XDMA 3T4TA 2ZQCA 3QP5A 3T4KA 2GX5A 2Y2PA 2JKRM 1BLCA 2QJ7A 1FCMA 4R4RA 2Y2LA 4R70A 2X01A 3QP8A 3FPWA 1VB6A 4GKUA 4CLCC 4IJGA 4WL9A 1IKIA 3ZCZA 3EEAA 3P09A 3PHYA 3WS2A 4GS9A 3MF0A 2VV8A 4HH3A 1F5MA 5HPIA 1V9ZA 2X71A 1RGZA 3HLWA 4P6ZS 3UB6A 3G4PA 4E6WA 3BQ8A 3C38A 1OPXA 5FA7A 1IYPA 2WKEA 5A90A 3G34A 5KZHA 3ZG7B 4HH2A 3U4LP 2PBDP 4B4ZA 2RL3A 3F1NA 5CRFA 2Q9MA 3HBRA 1JTGA 4UQIS 2QJ5A 3UDFA 4I5SA 5DF8A 3AGEA 3CG5A 1P9RA 1STZA 4II7A 3VFFA 1I2WA 5FQJA 3O87A 1BSGA 2YKFA 2Z6DA 1W79A 3NY4A 1N9OA 5I94A 2VGLS 2ZMAA 3Q1FA 4NXEA 5AJGA 5FL3A 5HD5A 3MZEA 1OJ5A 3GDIA 1IYQA 3LGOA 4F3LB 3IWOA 3JVUA 5TBMA 1O7EA 1D1JA 5L07A 3KO6A 4U0TA 4OQHA 1VEUA 2PYRA 1ODVA 3OZHA 1ES5A 2P7JA 4DJ2A 3IX8A 2W3GA 1T18A 2ZOHA 1N9LA 1U60A 3RXWA 3DBAA 3GQZA 3LYXA 2ZQDA 3A3FA 3E98A 2K7SA 4I3AA 4LFUA 1VM1A 1H5XA 2V20A 3HUMA 1GA0A 4H8RA 5FI6A 3Q7ZA 4ID4A 3GSGA 4PM6A 4A5RA 2ZC4B 2PAVP 2KOIA 3LCEA 3BQAA 1CQAA 4AFIA 2P74A 2J3TD 1UWPX 1CEFA 4KG5A 3BY8A 4Y15A 3H7WA 3UN7A 2FFYA 4OP5A 4N1XA 4ZRRA 2HF6A 1EWZA 1SKFA 1QMEA 2ZQ7A 2GZAA 3VFHA 2E8JA 1UWNX 2YKHA 3CHWP 2WAFA 1L0GA 4HBUA 3WS1A 4RX2A 5CX7A 4Y0OA 2ZM8A 2HP5A 2OWJA 2WK0A 2ZLYA 4KZ9A 5DFYA 3LIEA 2GNXA 4WMCD 4YNRA 3CWFA 1J3WA 2Q0OA 2HDQA 2OSUA 1XFQA 3BLSA 5EVIB 2PD8A 2ZM0A 3BJNA 1NRFA 3BFDA 3JPUA 1NLYA 3VP4A 4IHQA 3VV4A 2O9AA 3IQAA 2V9AA 3FG8A 4E3LA 5EVIC 3SW1A 1TF1A 4O01A 1KVLA 4U0XA 5TBMB 1WE4A 2Y59A 1VEUB 3T12B 3O88A 3SS4A 4PMAA 4EQ1A 3VP3A 2GDNA 1A0KA 2XQZA 1H3QA 1MC0A 5EVEA 2WYXA 3VP2A 4LV2A 1LT0A 2ZBBA 4FH4A 4DE2A 3IWQA 2VV7A 4EQIA 4E3NA 1G6OA 3L9KA 1Z09A 4DXCA 4I39A 4IUKA 3MFDA 3BECA 1KGGA 2EX9A 3IH8A 5FQ9A 1BYWA 1MWUA 3FZCA 5FATA 3TE8A 1S1ZA 2J7VA 1F98A 5A91A 5L09A 5HDCA 3CUEA 3RH8B 3TJZC 4X25A 3H7WB 2X02A 4UEYA 3BFCA 4N92A 2FH5A 2Y2JA 2ACGA 3E2KA 4GCZA 2XLNA 5C5KA 3HLFA 3KYEA 1K55A 1RP5A 1PYYA 4H6JA 1GCEA 5E2EA 2W0NA 3JYIA 3CITA 3DTIA 4ME4A 5FSRA 4LCLA 2H28A 2EXAA 4YOFA 1L3LA 3OPHA 4R38A 3OOVA 1K4FA 1TDLA 2WZXA 5CEDA 2XD5A 1LL9A 2WGWA 3IS2B 4G3KA 4S2LA 3LI8A 1JWVA 5HW3A 3L7HA 3UDIA 4WBGA 3GVBA 3B47A 1S67L 1XJ4A 3OPPA 3CAXA 2PRFA 3G2ZA 2B95A 4G3VA 3LR4A 1YLWA 3D72A 1BZAA 2L0WA 3GV9A 3PR6A 3LI9A 4EBPA 4WEJA 4HHDA 5CHJA 2XA7M 3ZFZA 1S1YA 1E4DA 2OLUA 1DP9A 4UA7A 4HJ6A 3ZHHA 2KLIA 4NXFA 4NXGA 1AWIA 4MEZA 1EW0A 4DE3A 1K38A 3G35A 1V9YA 4GNUA 1K0KA 2K31A 5L2FA 1WYBA 5FQMA 2H0YA 2JN7A 3AGFA 4MMNA 4Y7PA 4KQRA 1XX2A 2D01A 5F1GA 3UY6A 4IBRA 4ARZA 5GL9A 3ZDJA 2UWXA 3H82B 3KSFA 4KG6A 5FQQA 5HDDA 4LENA 5KSCA 2V8FA 1JVJA 4K0WA 1NYMA 1K6SA 5EVLA 3CPTA 2Y8HA 4DXBA 4H6JB 1ACFA 4BBTA 3HUNA 4KZ5A 5FQKA 1ERQA 2I72A 3FC7A 2A24A 5FI2A 2Y2IA 4KG2A 4JLFA 4NEED 2HP9A 4EBLA 3KX0X 4O7DA 4CLCD 5DTSA 2WGWB 4BL2A 2HPBA 2XFSA 4OPZA 4XXRA 4JGQA 4WZ5A 2A49A 1NJ4A 1LSVA 5CECA 3I7JA 4ZJ2A 3QP4A 5A8BA 4HEFA 3LR3A 2O0YA 3A3IA 3HL9A 4FCFA 2XRNA 1KGFA 5AQBA 4PKYG 1CEGA 2NUPC 1BLPA 3QP2A 3DWZA 4DJ3A 5TGFA 4FD8A 2V1AA 4HNBA 3PBSA 4N9KA 1PNEA 2J9OA 1FILA 5DTKA 2P9VB 1YMSA 4S2NC 4ZAMA 3DW0A 4BD0A 4JKTA 2XFTA 4P87A 5J4EA 3OPLA 3O3VA 2Y55A 1P0ZA 3NIAA 2ZOIA 5J7EA 1FQGA 1SDNA 2Y2GA 4HP4A 4ETXA 3QNCA 1T1CA 5GLAA 1RGYA 3C2WA 4RA7A 4MBKA 5A93A 4DDYA 1XFNA 3CPTB 4BD1A 1G6AA 3DTMA 5JYPA 4XT2A 4L0LA 2M1CA 1ZKJA 3ZVTA 5HSQA 5HWWA 1JTDA 1S0WA 2V2FF 1LSWA 4MLLA 3GTCA 2JE5A 3LIFA 2D02A 1SCWA 4RYEA 2PDRA 2ZM2A 4X68A 3K2NA 4MDZA 2H5SA 5D3OA 1BULA 1TS7A 4EEPA 4BWIA 3GMWA 2OAQ1 2M7UA 3M6BA 4JXVA 1GSVA 3V5MA 4LV1A 3T50A 1FR1A 4C75A 5HARA 3S1YA 3W4OA 4CPKA 5I5LA 1KOUA 3IXBA 3TSGA 2Y2NA 4Q8IA 1I2SA 1NZUA 1YKDA 2VKSA 3VP1A 2JKTI 2Y91A 3TOIA 2EFXA 5TJJA 3PBRA 4R3AA 4I3IA 5CEBA 3ZYTA 1JNUA 2O9BA 5KSHA 4DF6A 3E4OA 2L1MA 4OONA 1K6RA 1S66L 1XJ3A 4HQAA 2VLGA 4HJ3A 1OTEA 1ZHHB 4HY8A 5F82A 1ZG6A 4I3JA 5EVID 3CLOA 2Y2MA 3IF6A 3DWKA 3NECA 1BT5A 4P85A 2W27A 4HIAA 4K91A 2ZD8A 1YLZA 5AVEA 2UV0E 4Q0JA 4CQHA 1NLZA 2QPNA 1NXYA 1Y28A 1PZOA 3SH8A 4E6XA 1PW8A 3HLDA 2XR0A 2Y2KA 4GN2A 2EWWA 3VE3A 2GJ3A 4MN6A 4WZ4A 1OTDA 5HD3A 1AXBA 3T1SA 2E8IA 3UE1A 5TR7A 3UPNA 4IBXA 1ES4A 4WN5A 4WYYA 4OPRA 4XT2B 3H9WA 2WAEA 1H8MA 4CJNA 4Y0UA 2A2LA 4WUJA 1K54A 4R4SA 1NRJA 3MZDA 3N6IA 4KZ7A 4ZTKA 2C6WB 2IWCA 3C8CA 2PBYA 5HWVA 5BOHA 3QHYA 3TW8A 2VEAA 4QY6A 1M40A 4GS9B 1YQSA 2PD7A 1YPRA 1ZTUA 3UMEA 2XEPA 4LGWA 4X69A 1XA1A 5AQAA 4B88A 3NC8A 3Q7VA 2B5RA 5E2GA 1KDSA 3IXDA 3GR2A 4YFMA 3F1OA 3OPRA 4LCMA 4P6ZM 3F1NB 4Y17A 2ZQ9A 1Y54A 2DRWA 4KQOA 3TRCA 1YLYA 5EPHA 3QP6A 4OPQA 4XUZA 1E3UD 2CMNA 1XA7A 3HJIA 1DJBA 5G4YA 5HAQA 1MZUA 4WMCA 4WM9A 3A0SA 2ZL1A 2AVXA 3IF6B 2W3EA 4E3IA 3P01A 4GB7A 4NETA 3FYZA 1KE4A 3UPPA 2VGLM 2XH9A 2IA2A 4Z9QA 3VMAA 5DVAA 5GHYA 3N8RA 1N9BA 3BW6A 3ICYA 2OWHA 3WS4A 4OPYA 2INWA 3NDEA 5U47A 3F1PA 2Y4AA 5FASA 1HVBA 3NI9A 2WGVA 4BLMA 1O07A 1TVFA 4FTXA 4PPRA 1DY6A 1F2KA 4R6LA 5CGWA 5DFXA 3A3EA 2PR6A 4S2PA 3NJAA 3ZG8B 3IXGA 3CMZA 3VSKA 1DP8A 4JF5A 2R9WA 5IHVA 1G28A 1FSWA 4L9EA 2HZ5A 2ZC3B 4LRYC 3MR0A 4GZBA 3Q81A 2WGIA 1OTAA 4HBTA 3V3RA 2VZWA 1W8YA 4PM7A 4ZBEA 2Z2LB 1MWRA 1K57A 3C4PA 5CTMA 1MKMA 1PIOA 3IWIA 1VQQA 1HTZA 4MNRA 2K2NA 2B02A 3Q7VB 5GLCA 3GECA 3MJQA 5FAQA 3EWKA 3K3DA 4EW7A 4QB8A 4OOYA 4OQGA 3GRJA 4EXOA 3KSGA 4E3OA 1S4SA 4B9OA 1KVMA 3S22A 2PU4A 3A0RA 2Z2MB 3MXRA 5KMWA 5J8XA 3D9YA 5DTTA 4IUHA 3CJMA 3V50A 3LICA 4HJ4A 4PHTA 2PR5A 1YLPA 1YSQA 1M6KA 3MKFA 4I38A 1OT9A 4Y2FA 3W2ZA 3PAEA 3PYPA 1LSXA 2HDUA 3G31A 2KDKA 2Z6CA 1SHVA 3W8KA 4PM5A 3OBFA 4QD4A 4UA6A 5AQ7A 3E0YA 5FI7A 1WYCA 3SS5A 1X0OA 3SS3A 1MWTA 1FSYA 4QY5A 4K0XA 4FH2A 4WELA 3WS0A 1FOFA 3ZG0A 2IWBA 2VA0A 3SOIA 1WA9A 5HZHA 4OLDA 4LPZA 1T19A 5EOEA 4F94A 3IX4A 2JCHA 4ESPA 2G2UA 3A0VA 3KYZA 2QHKA 2ZQ8A 5GLBA 1SKOA 4E3JA 4U3TA 2RCXA 2LB9A 4DN0A 3WS5A 1TS8A 3BLMA 1L0DA 5CERA 3RXXA 1RCJA 4RQ9A 3CUEC 2EFUA 5E2HA 1DRMA 3BEBA 1VETA 5FAOA 4Z1WA 5F6AA 1YT4A 3IHAA 5KIZA 5HAPA 1ALQA 1LI0A 3RFBA 1OTIA 1ZC2A 2O9CA 3WRTA 2L4RA 1K55C 1GA9A 3VOYA 5FQIA 4KENB 1K56D 1DJAA 1ERMA 2BG1A 2XK1A 3HLGA 4UHUA 4EV4A 2JKRI 4Y3IA 1LL8A 3T4QA 4CLCA 1PI4A 1BLHA 4B93A 4FUWA 2KX6A 4KZ4A 2JHEA 3OC2A 4G3WA 1ESIA 4QU3A 1DP6A 2B18A 3N8LA 4S2KA 1ONGA 3HCYA 1XGJA 1K25A 3PTEA 1H0MA 5J3WA 3EEHA 2ZC5B 3W4QA 1NYYA 1OT6A 3BY9A 5GHZA 2PHYA 3HVFA 4KZAA 2VV6A 4OKPA 1NZOA 1MBLA 2ZMVA 4BJPA 3MKEA 1T1AA 5DJTA 5M19A 4JXWA 4S2JA 3MS6A 3U2AA 2BASA 2C5WB 2J3WA 5EV0A 3E4QA 3RTYA 4GLQA 5FAPA 2XGNA 3O5YA 4ZJ3A 3BYDA 2V1BA 5DKKA 4ARZB 1MY8A 3VSLA 1IEMA 1SKOB 3NBLA 3WWXA 4EESA 2PU2A 4S2MA 4M3KA 3SH9A 3MQOA 1ZG4A 1YM1A 2WKPA 2HDSA 5M18A 1H8YA 3PBNA 2WKRA 1VETB 3MMHA 1KGEA 5DKLA 4E04A 3IBJA 2CC1A 3MFXA 2ZMFA 4PM9A 1E25A 5MC7A 1FIKA 2A24B 3ZG5A 3FPVA 5JYOA 2QZ6A 1XJ2A 4R3BA 2ZJ9A 3IHBA 4R0QA 5LBRA 4FSFA 5EM1A 1CI8A 3S4XA 5EECA 3ZVWA 2JC7A 2G7UA 3UB9A 3LIBA 1H8ZA 1HD8A 4MN7A 4KUOA 3MZFA 1P9WA 4GJ4A 5TFQA 1IFQA 3WRZA 3JVVA 3T1XA 3FV7A 4NG2A 4DMZA 4CLCB 3E4PA 2ZC6B 3G32A 4X1LA 3FKVA 1XP4A 1G68A 4BENA 2DCFA 3C7UA 5HL1A 4WEKA 2DMWA 2ZC7A 4WZ5C 2V0UA 2EA9A 3V3SA 4JBFA 3TG9A 4S2OA 2WADA 4JXSA 3UE0A 3PXPA 3HREA 3ITBA 4JPMA 1HZOA 3G2YA 1F9IA 3QNBA 2QKPA 3LR0A 4EBNA 4LRZE 1Z6FA 1IKGA 3M6HA 4RVAA 4R1GA 3S7OA 3O86A 3UMDA 5CTNA 3N7WA 5FDSA 1CJFA 3V39A 1C3BA 5CGXA 4JF6A 4BBVA 3SZTA 3Q07A 5HX9A 4HOIA 2I9VA 2EWVA 4B4XA 5EVIA 3UB8A 3ULFA 1JWPA 3BM6A 3RJUA 1GHMA 3G30A 3Q82A 2WKQA 1GSXA 3T1RA 3EGXC 2P08A 4QHCA 3B33A 1W8QA 5GHXA 5IU1A 4HESA 1FCNA 1PFLA 4NXBA 1GHIA 1MXOA 5CHMA 3PBOA 2Y2HA 3N4IA 3LFVA 2HJ9C 4YWZA 4LRXC 5FEGA 3MQQA 3B42A 5CGSA 2IWDA 4OQ0A 1NWZA 5F83A 1MKIA 1TS6A 4Y13A 1BLSA 4OVDA 2W1TA 3D4FA 4EETB 3T4OA 1Q2QA 1K4EA 2Y79A 3T1QB 3UB5P 4X56A 2LB5A 2HGVA 2OAP1 5DF9A 4R23A 4N1HA 4PKYA 4X55A 1KE0A 3MBZA 4L9GA 3UE6A 5EE8A 1D06A 4Y5FA 4MN5A 5GLDA 4OOLA 4KZ8A 3UPOA 3W4PA 1TEMA 3LUQA 1PW1A 3LEZA 3NHQA 5G4ZA 4YINA 4OOMA 4KUKA 2JKTM 2O99A 1XPBA 2J8YA 4UQIM 3ZNTA 1T1BA 1SDEA 3T4LA 2QWSA 3UNWA 5K5BA 2R78A 1YMXA 1E3UA 4BL3A 2V1ZA 2JBFA 1PWGA 4JXGA 3PAGA 2VGJA 3R4KA 5EM0A 3EGDC 3FWLA 4OH0A 4UAAA 3G6OA 4EUVA 1CF0A 2HV1A 2VGKA 3IS2A 4GHIA 3IF6C 1LI9A 2VX8A 3T4SA 5CHUA 4P6BA 5DF7A 3VE4A 4DE0A 5F68A 2WKIA 3C5AA 3IH9A 3BFFA 5HDSA 2XA7S 1ESUA 1W63M 3MXSA 3LR5A 5DJUA 1HLUP 2QMIA 4N9LA 4IEDA 4O8GA 4GOGA 3ZQ5A 3NCKA 2H0TA 3IT9A 4LLOB 5L10A 2W1TB 4JGPA 1K54C 4Q0IA 3C4OA 5AVFA 3MSHA 2J80A 1IELA 3BWLA 1J9MA 1W7FA 4ZDXA 4NKPA 2PYPA 3IF5A 1CI9A 5F1FA 3P98A 4GD8A 1TD5A 4DKIA 1ES3A 1LHYA 3M2JA 4PAUA 4DRTA 1XXMA 1ES2A 3S7PA 2Y2OA 4M4XA 3V67A 3LO7A 5G18A 2WUQA 3H82A 1S6RA 1JWZA 1BTLA 1GHPA 2J3TC 1GSWA 3F1OB 1KDWA 4X53A 3NOUC 1EI5A 5IS1A 3S7QA 4ETZA 2WZZA 3KSHA 5CXWA 3T4JA 3UB7A 5FEFA 3DAVA 1PWCA 3E2LA 2EX8A 4Q0HA 4D2OA 2NUTC 1EROA 3HLBA 2OV5A 1W63Q 4QJGA 4MBFA 3OCNA 2Q9NA 1CK3A 1IYSA 2V8CA 1P97A 3R7WA 4EUZA 2W3HA 2ZL1B 3IXHA 3MQ0A 5HWTA 5EUAA 1PI5A 1XGIA 1FCOA 5A92A 4L9FA 2EXBA 1N9NA 2WKHA 5HL6A 3VOLA 3BFGA 3HJKA 2J9PA 3EOIA 4GHIB 3CI6A 4BQMA 4IVKA 5F5YA 4WLAA 3ZG9B 1NY0A 4UA9A 3C7VA 2XROA 4LV3A 3KSIA 2M7VA 4XUXA 4JF4A 4PM8A 4DE1A 4E3MA 3OLOA 1ONHA 5IT5A 4P0MA 2VK3A 3CZDA 3PBTA 1PWDA 2FFFB 5AQ9A 4ZJ1A 2A3UA 4OP8A 2DNSA 4C6YA 3F1PB 3FKWA 4WF0A 4HI4A 2HDRA 3EQVA 1YSPA 1LLBA 4GDNA 4KZ6A 2Y2QA 1IYOA 3ITAA 4S2NA 4K08A 2P9VA 4OQIA 5L8MA 5HFOA 4FOFA 1OTBA 2VJWA 4GDBA 1KE3A 2XD1A 3M2KA 4X6TA 1SZVA 1I5QA 1MWSA 1IOUA 4Y0TA 3EQUA 4S2IA 2MJ6A 4KQQA 4QPRA 3LEQA 4KZ3A 1MPLA 4GD6A 2BTFP 5M1AA 4MBHA 1K57C 3OCLA 4QWOA 2W3DA 3A3JA 1YAXA 3PBQA 3UO9A 1QMFA 3ISGA 3S7NA 3KYQA 1W5DA 3LIDA 3SH7A 1Y4OA 4JGRA 2H10A 3QP1A 1K56A 4GW9A 3C30A 3R7WB 1D7EA 1TDGA 1XKZA 3B3XA 1Q2PA 5FDHA 3NOPC 4D60A 3LY3A 2OOLA 5E2FA 2R9XA 2BLSA 1DJCA 4KZBA 4RX3A 2V0WA 3A3DA 2FZ0A 4E3KA 1PRQA 3N8SA 1FR6A 3ZGAB 2HJEA 4X1MA 3LIAA 3VP0A 4EWFA 1L0EA 2ZQAA 5HPFA 3AGDA 1OJGA 1LL5A 4OLGA 1YLJA 1L0FA 2HP6A
chains in the Genus database with same CATH topology
2L0WA 2W3FA 3PR6A 3LI9A 4JGOA 4BBVA 4WEJA 4HHDA 2VGLM 2IA2A 2XA7M 1S1YA 4HOIA 2I9VA 2EWVA 4KQDA 3UB8A 4O0PA 5EFWA 3ULFA 1S4RA 3BW6A 3ICYA 3NOTC 4MCWA 2XSSA 2OWHA 3D3OA 2WKQA 4HP9A 1GSXA 1DP9A 4HJ6A 3UE3A 3EGXC 2P08A 2W1RA 3B33A 2KLIA 4NXFA 4NXGA 2INWA 4EEUA 3P7NA 1EW0A 5IU1A 3K3CA 3F1PA 1V9YA 4NXBA 3PBOA 1VHMA 2K31A 3LFVA 5F69A 4BBUA 4F3LA 4R6LA 2HJ9C 5DFXA 4YWZA 2PR6A 4LRXC 2JN7A 3NJAA 3MQQA 3B42A 4MMNA 1XJ6A 1DP8A 4EU0A 1NWZA 1TS0A 2D01A 1G28A 1TS6A 4ARZA 2W1TA 4EETB 4EERA 3H82B 4L9EA 2PT7A 3T4OA 4LRYC 3KSFA 4CLCE 2Y79A 3IBRA 3MR0A 4BMWA 5HDDA 1OTAA 2VZWA 2LB5A 2HGVA 2Y8HA 2OAP1 3MXQA 4H6JB 2P04A 5DF9A 1MKMA 4BBTA 1UGUA 2QYBA 4PKYA 2K2NA 3T4TA 2B02A 4L9GA 3UE6A 3T4KA 1D06A 2GX5A 3FC7A 3GECA 3MJQA 2A24A 2JKRM 2QJ7A 3EWKA 4MN5A 4Y5FA 3K3DA 4R70A 4OOLA 4EW7A 3FPWA 1VB6A 4NEED 4EXOA 4CLCC 3KSGA 4IJGA 4WL9A 1S4SA 3LUQA 3KX0X 4B9OA 4CLCD 3EEAA 3PHYA 3NHQA 5G4ZA 4GS9A 3MF0A 2VV8A 4HH3A 4JGQA 1F5MA 5HPIA 3A0RA 4OOMA 1V9ZA 4KUKA 1LSVA 2JKTM 2O99A 4P6ZS 3UB6A 4IUHA 4UQIM 1T1BA 3BQ8A 3C38A 3LR3A 3LICA 5A8BA 1OPXA 2O0YA 2QWSA 4HJ4A 2R78A 3T4LA 5K5BA 4PHTA 2PR5A 2XRNA 1YSQA 4HH2A 4PKYG 2NUPC 3F1NA 3R4KA 3EGDC 4I38A 4UQIS 2QJ5A 3G6OA 4EUVA 1OT9A 4Y2FA 4I5SA 3W2ZA 4DJ3A 2HV1A 3PYPA 1LSXA 2V1AA 3IS2A 2KDKA 4HNBA 4GHIA 3PBSA 2Z6CA 2VX8A 1P9RA 1STZA 4II7A 3T4SA 3OBFA 2YKFA 2Z6DA 3VE4A 3E0YA 5F68A 1N9OA 2VGLS 5HDSA 1X0OA 2XA7S 4NXEA 5AJGA 5FL3A 1W63M 5HD5A 3LR5A 4WELA 1OJ5A 3GDIA 5DJUA 4F3LB 5J4EA 3JVUA 2VA0A 4O8GA 1P0ZA 3ZQ5A 5TBMA 1WA9A 2ZOIA 3KO6A 5HZHA 5J7EA 4LPZA 1T19A 2PYRA 4LLOB 2W1TB 4HP4A 1ODVA 4ETXA 4JGPA 4Q0IA 3A0VA 2P7JA 5AVFA 4DJ2A 3KYZA 2W3GA 2J80A 1T18A 2QHKA 2ZOHA 1T1CA 1N9LA 3DBAA 3BWLA 4NKPA 2PYPA 3C2WA 3LYXA 2LB9A 4DN0A 1XFNA 1TS8A 3E98A 2K7SA 4I3AA 4RQ9A 4XT2A 3CUEC 4L0LA 2M1CA 1TD5A 5HSQA 1DRMA 5HWWA 4PAUA 4Z1WA 5F6AA 5KIZA 1LSWA 3S7PA 3RFBA 4M4XA 1OTIA 2O9CA 3V67A 2L4RA 3LIFA 2D02A 3H82A 2KOIA 3BQAA 2PDRA 2J3TC 3F1OB 1GSWA 3NOUC 4AFIA 2J3TD 4MDZA 3K2NA 5IS1A 1UWPX 3S7QA 4ETZA 3BY8A 1TS7A 3H7WA 4EEPA 3KSHA 2JKRI 4ZRRA 2HF6A 3T4JA 4Y3IA 1LL8A 2OAQ1 4BWIA 2M7UA 3UB7A 3T4QA 4Q0HA 2NUTC 1GSVA 2GZAA 1W63Q 3T50A 4CLCA 1UWNX 2YKHA 3OCNA 5I5LA 4B93A 1KOUA 1P97A 3R7WA 2W3HA 2KX6A 1YKDA 3MQ0A 2JHEA 3OC2A 2VKSA 4G3WA 5CX7A 5HWTA 1DP6A 2B18A 2JKTI 4L9FA 2OWJA 3HCYA 1N9NA 5HL6A 5TJJA 3VOLA 3PBRA 3HJKA 5DFYA 3LIEA 3EOIA 2GNXA 4GHIB 4R3AA 4YNRA 3CI6A 4I3IA 3CWFA 3EEHA 5F5YA 5J3WA 4WLAA 3ZYTA 1JNUA 1XFQA 2O9BA 5KSHA 3E4OA 2XROA 2L1MA 2PD8A 1S66L 3KSIA 3BJNA 2M7VA 1XJ3A 1NLYA 1OT6A 4HQAA 3BY9A 4IHQA 3VV4A 2O9AA 2VLGA 4HJ3A 1OTEA 1ZHHB 2PHYA 3OLOA 4HY8A 5IT5A 3PBTA 2V9AA 2VV6A 3FG8A 2ZMVA 3SW1A 4BJPA 5DJTA 1T1AA 4I3JA 3F1PB 3CLOA 1TF1A 4O01A 4WF0A 4HI4A 5TBMB 2W27A 4HIAA 3U2AA 2BASA 5AVEA 2J3WA 3E4QA 3EQVA 1YSPA 3RTYA 4GLQA 4Q0JA 4CQHA 1NLZA 1Y28A 3O5YA 4EQ1A 2V1BA 1H3QA 5DKKA 4ARZB 4K08A 2EWWA 3VE3A 2GJ3A 1MC0A 4MN6A 1OTDA 5HD3A 1LT0A 4EESA 2ZBBA 5L8MA 4FOFA 1OTBA 3MQOA 2VJWA 2VV7A 4WN5A 4XT2B 1G6OA 2WKPA 3H9WA 1H8MA 4I39A 4IUKA 3PBNA 2A2LA 2WKRA 1IOUA 4WUJA 3MMHA 5DKLA 4E04A 3IBJA 1NRJA 3MFXA 2ZMFA 5MC7A 3EQUA 1BYWA 2MJ6A 4QPRA 3TE8A 1S1ZA 2A24B 3C8CA 3FPVA 5HWVA 3TW8A 3OCLA 1F98A 2W3DA 2VEAA 1XJ2A 1YAXA 5HDCA 3CUEA 5LBRA 3RH8B 3TJZC 4FSFA 3H7WB 3PBQA 4UEYA 2G7UA 3UB9A 3LIBA 4MN7A 3S7NA 2FH5A 4KUOA 1P9WA 3KYQA 4GJ4A 4GCZA 4GS9B 3LIDA 1IFQA 2PD7A 5C5KA 4JGRA 3JVVA 1ZTUA 4DMZA 3UMEA 4CLCB 3E4PA 4H6JA 4GW9A 2W0NA 3C30A 3R7WB 4WEKA 2DMWA 1D7EA 3CITA 2V0UA 4ME4A 2EA9A 2H28A 4YOFA 3NOPC 3F1OA 2OOLA 4P6ZM 3PXPA 3F1NB 4R38A 2V0WA 3OOVA 1F9IA 4KQOA 3TRCA 2QKPA 2FZ0A 3LR0A 3IS2B 2CMNA 4LRZE 4G3KA 3LI8A 3HJIA 2HJEA 3LIAA 3B47A 5G4YA 1S67L 1MZUA 3S7OA 1XJ4A 3CAXA 3A0SA 5HPFA 4G3VA 1OJGA 3UMDA 3LR4A 2W3EA 3P01A 3D72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGL S;  2XA7 S;  4UQI S;  1W63 M;  1W63 Q;  2JKT M;  2JKR M;  4P6Z S;  2VGL M;  2XA7 M;  3TJZ C;  4UQI M;  4NEE D;  2FH5 A;  4P6Z M;  1NRJ A;  2JKT I;  2JKR I;  2HF6 A;  5MC7 A; 
#chains in the Genus database with same CATH topology
 1OME A;  1G5U A;  2W3F A;  3UDX A;  1BUE A;  1YLT A;  3LY4 A;  4JGO A;  4KQD A;  4O0P A;  3HLE A;  5EFW A;  4R3J A;  1S4R A;  3NOT C;  4MCW A;  2XSS A;  3D3O A;  4HP9 A;  2JKF A;  3UE3 A;  2W1R A;  4LV0 A;  5E43 A;  4EEU A;  3P7N A;  3K3C A;  2OLV A;  3NDG A;  2XF3 A;  4NK3 A;  1VHM A;  1N4O A;  5F69 A;  3VOZ A;  4BBU A;  4F3L A;  4C3Q A;  2EX6 A;  2G2W A;  3ZNY A;  1XJ6 A;  4EU0 A;  3BRM A;  1TS0 A;  1L2S A;  3NUL A;  4EER A;  2JKG A;  2PT7 A;  3HLC A;  5EOO A;  4CLC E;  3DTE A;  3IBR A;  4IVI A;  2EX2 A;  4BMW A;  1PZP A;  3IX3 A;  3DTK A;  3MXQ A;  3HUO A;  5HAI A;  2P04 A;  3BFE A;  4DDS A;  1UGU A;  2QYB A;  2XDM A;  3T4T A;  2ZQC A;  3QP5 A;  3T4K A;  2GX5 A;  2Y2P A;  2JKR M;  1BLC A;  2QJ7 A;  1FCM A;  4R4R A;  2Y2L A;  4R70 A;  2X01 A;  3QP8 A;  3FPW A;  1VB6 A;  4GKU A;  4CLC C;  4IJG A;  4WL9 A;  1IKI A;  3ZCZ A;  3EEA A;  3P09 A;  3PHY A;  3WS2 A;  4GS9 A;  3MF0 A;  2VV8 A;  4HH3 A;  1F5M A;  5HPI A;  1V9Z A;  2X71 A;  1RGZ A;  3HLW A;  4P6Z S;  3UB6 A;  3G4P A;  4E6W A;  3BQ8 A;  3C38 A;  1OPX A;  5FA7 A;  1IYP A;  2WKE A;  5A90 A;  3G34 A;  5KZH A;  3ZG7 B;  4HH2 A;  3U4L P;  2PBD P;  4B4Z A;  2RL3 A;  3F1N A;  5CRF A;  2Q9M A;  3HBR A;  1JTG A;  4UQI S;  2QJ5 A;  3UDF A;  4I5S A;  5DF8 A;  3AGE A;  3CG5 A;  1P9R A;  1STZ A;  4II7 A;  3VFF A;  1I2W A;  5FQJ A;  3O87 A;  1BSG A;  2YKF A;  2Z6D A;  1W79 A;  3NY4 A;  1N9O A;  5I94 A;  2VGL S;  2ZMA A;  3Q1F A;  4NXE A;  5AJG A;  5FL3 A;  5HD5 A;  3MZE A;  1OJ5 A;  3GDI A;  1IYQ A;  3LGO A;  4F3L B;  3IWO A;  3JVU A;  5TBM A;  1O7E A;  1D1J A;  5L07 A;  3KO6 A;  4U0T A;  4OQH A;  1VEU A;  2PYR A;  1ODV A;  3OZH A;  1ES5 A;  2P7J A;  4DJ2 A;  3IX8 A;  2W3G A;  1T18 A;  2ZOH A;  1N9L A;  1U60 A;  3RXW A;  3DBA A;  3GQZ A;  3LYX A;  2ZQD A;  3A3F A;  3E98 A;  2K7S A;  4I3A A;  4LFU A;  1VM1 A;  1H5X A;  2V20 A;  3HUM A;  1GA0 A;  4H8R A;  5FI6 A;  3Q7Z A;  4ID4 A;  3GSG A;  4PM6 A;  4A5R A;  2ZC4 B;  2PAV P;  2KOI A;  3LCE A;  3BQA A;  1CQA A;  4AFI A;  2P74 A;  2J3T D;  1UWP X;  1CEF A;  4KG5 A;  3BY8 A;  4Y15 A;  3H7W A;  3UN7 A;  2FFY A;  4OP5 A;  4N1X A;  4ZRR A;  2HF6 A;  1EWZ A;  1SKF A;  1QME A;  2ZQ7 A;  2GZA A;  3VFH A;  2E8J A;  1UWN X;  2YKH A;  3CHW P;  2WAF A;  1L0G A;  4HBU A;  3WS1 A;  4RX2 A;  5CX7 A;  4Y0O A;  2ZM8 A;  2HP5 A;  2OWJ A;  2WK0 A;  2ZLY A;  4KZ9 A;  5DFY A;  3LIE A;  2GNX A;  4WMC D;  4YNR A;  3CWF A;  1J3W A;  2Q0O A;  2HDQ A;  2OSU A;  1XFQ A;  3BLS A;  5EVI B;  2PD8 A;  2ZM0 A;  3BJN A;  1NRF A;  3BFD A;  3JPU A;  1NLY A;  3VP4 A;  4IHQ A;  3VV4 A;  2O9A A;  3IQA A;  2V9A A;  3FG8 A;  4E3L A;  5EVI C;  3SW1 A;  1TF1 A;  4O01 A;  1KVL A;  4U0X A;  5TBM B;  1WE4 A;  2Y59 A;  1VEU B;  3T12 B;  3O88 A;  3SS4 A;  4PMA A;  4EQ1 A;  3VP3 A;  2GDN A;  1A0K A;  2XQZ A;  1H3Q A;  1MC0 A;  5EVE A;  2WYX A;  3VP2 A;  4LV2 A;  1LT0 A;  2ZBB A;  4FH4 A;  4DE2 A;  3IWQ A;  2VV7 A;  4EQI A;  4E3N A;  1G6O A;  3L9K A;  1Z09 A;  4DXC A;  4I39 A;  4IUK A;  3MFD A;  3BEC A;  1KGG A;  2EX9 A;  3IH8 A;  5FQ9 A;  1BYW A;  1MWU A;  3FZC A;  5FAT A;  3TE8 A;  1S1Z A;  2J7V A;  1F98 A;  5A91 A;  5L09 A;  5HDC A;  3CUE A;  3RH8 B;  3TJZ C;  4X25 A;  3H7W B;  2X02 A;  4UEY A;  3BFC A;  4N92 A;  2FH5 A;  2Y2J A;  2ACG A;  3E2K A;  4GCZ A;  2XLN A;  5C5K A;  3HLF A;  3KYE A;  1K55 A;  1RP5 A;  1PYY A;  4H6J A;  1GCE A;  5E2E A;  2W0N A;  3JYI A;  3CIT A;  3DTI A;  4ME4 A;  5FSR A;  4LCL A;  2H28 A;  2EXA A;  4YOF A;  1L3L A;  3OPH A;  4R38 A;  3OOV A;  1K4F A;  1TDL A;  2WZX A;  5CED A;  2XD5 A;  1LL9 A;  2WGW A;  3IS2 B;  4G3K A;  4S2L A;  3LI8 A;  1JWV A;  5HW3 A;  3L7H A;  3UDI A;  4WBG A;  3GVB A;  3B47 A;  1S67 L;  1XJ4 A;  3OPP A;  3CAX A;  2PRF A;  3G2Z A;  2B95 A;  4G3V A;  3LR4 A;  1YLW A;  3D72 A;  1BZA A;  2L0W A;  3GV9 A;  3PR6 A;  3LI9 A;  4EBP A;  4WEJ A;  4HHD A;  5CHJ A;  2XA7 M;  3ZFZ A;  1S1Y A;  1E4D A;  2OLU A;  1DP9 A;  4UA7 A;  4HJ6 A;  3ZHH A;  2KLI A;  4NXF A;  4NXG A;  1AWI A;  4MEZ A;  1EW0 A;  4DE3 A;  1K38 A;  3G35 A;  1V9Y A;  4GNU A;  1K0K A;  2K31 A;  5L2F A;  1WYB A;  5FQM A;  2H0Y A;  2JN7 A;  3AGF A;  4MMN A;  4Y7P A;  4KQR A;  1XX2 A;  2D01 A;  5F1G A;  3UY6 A;  4IBR A;  4ARZ A;  5GL9 A;  3ZDJ A;  2UWX A;  3H82 B;  3KSF A;  4KG6 A;  5FQQ A;  5HDD A;  4LEN A;  5KSC A;  2V8F A;  1JVJ A;  4K0W A;  1NYM A;  1K6S A;  5EVL A;  3CPT A;  2Y8H A;  4DXB A;  4H6J B;  1ACF A;  4BBT A;  3HUN A;  4KZ5 A;  5FQK A;  1ERQ A;  2I72 A;  3FC7 A;  2A24 A;  5FI2 A;  2Y2I A;  4KG2 A;  4JLF A;  4NEE D;  2HP9 A;  4EBL A;  3KX0 X;  4O7D A;  4CLC D;  5DTS A;  2WGW B;  4BL2 A;  2HPB A;  2XFS A;  4OPZ A;  4XXR A;  4JGQ A;  4WZ5 A;  2A49 A;  1NJ4 A;  1LSV A;  5CEC A;  3I7J A;  4ZJ2 A;  3QP4 A;  5A8B A;  4HEF A;  3LR3 A;  2O0Y A;  3A3I A;  3HL9 A;  4FCF A;  2XRN A;  1KGF A;  5AQB A;  4PKY G;  1CEG A;  2NUP C;  1BLP A;  3QP2 A;  3DWZ A;  4DJ3 A;  5TGF A;  4FD8 A;  2V1A A;  4HNB A;  3PBS A;  4N9K A;  1PNE A;  2J9O A;  1FIL A;  5DTK A;  2P9V B;  1YMS A;  4S2N C;  4ZAM A;  3DW0 A;  4BD0 A;  4JKT A;  2XFT A;  4P87 A;  5J4E A;  3OPL A;  3O3V A;  2Y55 A;  1P0Z A;  3NIA A;  2ZOI A;  5J7E A;  1FQG A;  1SDN A;  2Y2G A;  4HP4 A;  4ETX A;  3QNC A;  1T1C A;  5GLA A;  1RGY A;  3C2W A;  4RA7 A;  4MBK A;  5A93 A;  4DDY A;  1XFN A;  3CPT B;  4BD1 A;  1G6A A;  3DTM A;  5JYP A;  4XT2 A;  4L0L A;  2M1C A;  1ZKJ A;  3ZVT A;  5HSQ A;  5HWW A;  1JTD A;  1S0W A;  2V2F F;  1LSW A;  4MLL A;  3GTC A;  2JE5 A;  3LIF A;  2D02 A;  1SCW A;  4RYE A;  2PDR A;  2ZM2 A;  4X68 A;  3K2N A;  4MDZ A;  2H5S A;  5D3O A;  1BUL A;  1TS7 A;  4EEP A;  4BWI A;  3GMW A;  2OAQ 1;  2M7U A;  3M6B A;  4JXV A;  1GSV A;  3V5M A;  4LV1 A;  3T50 A;  1FR1 A;  4C75 A;  5HAR A;  3S1Y A;  3W4O A;  4CPK A;  5I5L A;  1KOU A;  3IXB A;  3TSG A;  2Y2N A;  4Q8I A;  1I2S A;  1NZU A;  1YKD A;  2VKS A;  3VP1 A;  2JKT I;  2Y91 A;  3TOI A;  2EFX A;  5TJJ A;  3PBR A;  4R3A A;  4I3I A;  5CEB A;  3ZYT A;  1JNU A;  2O9B A;  5KSH A;  4DF6 A;  3E4O A;  2L1M A;  4OON A;  1K6R A;  1S66 L;  1XJ3 A;  4HQA A;  2VLG A;  4HJ3 A;  1OTE A;  1ZHH B;  4HY8 A;  5F82 A;  1ZG6 A;  4I3J A;  5EVI D;  3CLO A;  2Y2M A;  3IF6 A;  3DWK A;  3NEC A;  1BT5 A;  4P85 A;  2W27 A;  4HIA A;  4K91 A;  2ZD8 A;  1YLZ A;  5AVE A;  2UV0 E;  4Q0J A;  4CQH A;  1NLZ A;  2QPN A;  1NXY A;  1Y28 A;  1PZO A;  3SH8 A;  4E6X A;  1PW8 A;  3HLD A;  2XR0 A;  2Y2K A;  4GN2 A;  2EWW A;  3VE3 A;  2GJ3 A;  4MN6 A;  4WZ4 A;  1OTD A;  5HD3 A;  1AXB A;  3T1S A;  2E8I A;  3UE1 A;  5TR7 A;  3UPN A;  4IBX A;  1ES4 A;  4WN5 A;  4WYY A;  4OPR A;  4XT2 B;  3H9W A;  2WAE A;  1H8M A;  4CJN A;  4Y0U A;  2A2L A;  4WUJ A;  1K54 A;  4R4S A;  1NRJ A;  3MZD A;  3N6I A;  4KZ7 A;  4ZTK A;  2C6W B;  2IWC A;  3C8C A;  2PBY A;  5HWV A;  5BOH A;  3QHY A;  3TW8 A;  2VEA A;  4QY6 A;  1M40 A;  4GS9 B;  1YQS A;  2PD7 A;  1YPR A;  1ZTU A;  3UME A;  2XEP A;  4LGW A;  4X69 A;  1XA1 A;  5AQA A;  4B88 A;  3NC8 A;  3Q7V A;  2B5R A;  5E2G A;  1KDS A;  3IXD A;  3GR2 A;  4YFM A;  3F1O A;  3OPR A;  4LCM A;  4P6Z M;  3F1N B;  4Y17 A;  2ZQ9 A;  1Y54 A;  2DRW A;  4KQO A;  3TRC A;  1YLY A;  5EPH A;  3QP6 A;  4OPQ A;  4XUZ A;  1E3U D;  2CMN A;  1XA7 A;  3HJI A;  1DJB A;  5G4Y A;  5HAQ A;  1MZU A;  4WMC A;  4WM9 A;  3A0S A;  2ZL1 A;  2AVX A;  3IF6 B;  2W3E A;  4E3I A;  3P01 A;  4GB7 A;  4NET A;  3FYZ A;  1KE4 A;  3UPP A;  2VGL M;  2XH9 A;  2IA2 A;  4Z9Q A;  3VMA A;  5DVA A;  5GHY A;  3N8R A;  1N9B A;  3BW6 A;  3ICY A;  2OWH A;  3WS4 A;  4OPY A;  2INW A;  3NDE A;  5U47 A;  3F1P A;  2Y4A A;  5FAS A;  1HVB A;  3NI9 A;  2WGV A;  4BLM A;  1O07 A;  1TVF A;  4FTX A;  4PPR A;  1DY6 A;  1F2K A;  4R6L A;  5CGW A;  5DFX A;  3A3E A;  2PR6 A;  4S2P A;  3NJA A;  3ZG8 B;  3IXG A;  3CMZ A;  3VSK A;  1DP8 A;  4JF5 A;  2R9W A;  5IHV A;  1G28 A;  1FSW A;  4L9E A;  2HZ5 A;  2ZC3 B;  4LRY C;  3MR0 A;  4GZB A;  3Q81 A;  2WGI A;  1OTA A;  4HBT A;  3V3R A;  2VZW A;  1W8Y A;  4PM7 A;  4ZBE A;  2Z2L B;  1MWR A;  1K57 A;  3C4P A;  5CTM A;  1MKM A;  1PIO A;  3IWI A;  1VQQ A;  1HTZ A;  4MNR A;  2K2N A;  2B02 A;  3Q7V B;  5GLC A;  3GEC A;  3MJQ A;  5FAQ A;  3EWK A;  3K3D A;  4EW7 A;  4QB8 A;  4OOY A;  4OQG A;  3GRJ A;  4EXO A;  3KSG A;  4E3O A;  1S4S A;  4B9O A;  1KVM A;  3S22 A;  2PU4 A;  3A0R A;  2Z2M B;  3MXR A;  5KMW A;  5J8X A;  3D9Y A;  5DTT A;  4IUH A;  3CJM A;  3V50 A;  3LIC A;  4HJ4 A;  4PHT A;  2PR5 A;  1YLP A;  1YSQ A;  1M6K A;  3MKF A;  4I38 A;  1OT9 A;  4Y2F A;  3W2Z A;  3PAE A;  3PYP A;  1LSX A;  2HDU A;  3G31 A;  2KDK A;  2Z6C A;  1SHV A;  3W8K A;  4PM5 A;  3OBF A;  4QD4 A;  4UA6 A;  5AQ7 A;  3E0Y A;  5FI7 A;  1WYC A;  3SS5 A;  1X0O A;  3SS3 A;  1MWT A;  1FSY A;  4QY5 A;  4K0X A;  4FH2 A;  4WEL A;  3WS0 A;  1FOF A;  3ZG0 A;  2IWB A;  2VA0 A;  3SOI A;  1WA9 A;  5HZH A;  4OLD A;  4LPZ A;  1T19 A;  5EOE A;  4F94 A;  3IX4 A;  2JCH A;  4ESP A;  2G2U A;  3A0V A;  3KYZ A;  2QHK A;  2ZQ8 A;  5GLB A;  1SKO A;  4E3J A;  4U3T A;  2RCX A;  2LB9 A;  4DN0 A;  3WS5 A;  1TS8 A;  3BLM A;  1L0D A;  5CER A;  3RXX A;  1RCJ A;  4RQ9 A;  3CUE C;  2EFU A;  5E2H A;  1DRM A;  3BEB A;  1VET A;  5FAO A;  4Z1W A;  5F6A A;  1YT4 A;  3IHA A;  5KIZ A;  5HAP A;  1ALQ A;  1LI0 A;  3RFB A;  1OTI A;  1ZC2 A;  2O9C A;  3WRT A;  2L4R A;  1K55 C;  1GA9 A;  3VOY A;  5FQI A;  4KEN B;  1K56 D;  1DJA A;  1ERM A;  2BG1 A;  2XK1 A;  3HLG A;  4UHU A;  4EV4 A;  2JKR I;  4Y3I A;  1LL8 A;  3T4Q A;  4CLC A;  1PI4 A;  1BLH A;  4B93 A;  4FUW A;  2KX6 A;  4KZ4 A;  2JHE A;  3OC2 A;  4G3W A;  1ESI A;  4QU3 A;  1DP6 A;  2B18 A;  3N8L A;  4S2K A;  1ONG A;  3HCY A;  1XGJ A;  1K25 A;  3PTE A;  1H0M A;  5J3W A;  3EEH A;  2ZC5 B;  3W4Q A;  1NYY A;  1OT6 A;  3BY9 A;  5GHZ A;  2PHY A;  3HVF A;  4KZA A;  2VV6 A;  4OKP A;  1NZO A;  1MBL A;  2ZMV A;  4BJP A;  3MKE A;  1T1A A;  5DJT A;  5M19 A;  4JXW A;  4S2J A;  3MS6 A;  3U2A A;  2BAS A;  2C5W B;  2J3W A;  5EV0 A;  3E4Q A;  3RTY A;  4GLQ A;  5FAP A;  2XGN A;  3O5Y A;  4ZJ3 A;  3BYD A;  2V1B A;  5DKK A;  4ARZ B;  1MY8 A;  3VSL A;  1IEM A;  1SKO B;  3NBL A;  3WWX A;  4EES A;  2PU2 A;  4S2M A;  4M3K A;  3SH9 A;  3MQO A;  1ZG4 A;  1YM1 A;  2WKP A;  2HDS A;  5M18 A;  1H8Y A;  3PBN A;  2WKR A;  1VET B;  3MMH A;  1KGE A;  5DKL A;  4E04 A;  3IBJ A;  2CC1 A;  3MFX A;  2ZMF A;  4PM9 A;  1E25 A;  5MC7 A;  1FIK A;  2A24 B;  3ZG5 A;  3FPV A;  5JYO A;  2QZ6 A;  1XJ2 A;  4R3B A;  2ZJ9 A;  3IHB A;  4R0Q A;  5LBR A;  4FSF A;  5EM1 A;  1CI8 A;  3S4X A;  5EEC A;  3ZVW A;  2JC7 A;  2G7U A;  3UB9 A;  3LIB A;  1H8Z A;  1HD8 A;  4MN7 A;  4KUO A;  3MZF A;  1P9W A;  4GJ4 A;  5TFQ A;  1IFQ A;  3WRZ A;  3JVV A;  3T1X A;  3FV7 A;  4NG2 A;  4DMZ A;  4CLC B;  3E4P A;  2ZC6 B;  3G32 A;  4X1L A;  3FKV A;  1XP4 A;  1G68 A;  4BEN A;  2DCF A;  3C7U A;  5HL1 A;  4WEK A;  2DMW A;  2ZC7 A;  4WZ5 C;  2V0U A;  2EA9 A;  3V3S A;  4JBF A;  3TG9 A;  4S2O A;  2WAD A;  4JXS A;  3UE0 A;  3PXP A;  3HRE A;  3ITB A;  4JPM A;  1HZO A;  3G2Y A;  1F9I A;  3QNB A;  2QKP A;  3LR0 A;  4EBN A;  4LRZ E;  1Z6F A;  1IKG A;  3M6H A;  4RVA A;  4R1G A;  3S7O A;  3O86 A;  3UMD A;  5CTN A;  3N7W A;  5FDS A;  1CJF A;  3V39 A;  1C3B A;  5CGX A;  4JF6 A;  4BBV A;  3SZT A;  3Q07 A;  5HX9 A;  4HOI A;  2I9V A;  2EWV A;  4B4X A;  5EVI A;  3UB8 A;  3ULF A;  1JWP A;  3BM6 A;  3RJU A;  1GHM A;  3G30 A;  3Q82 A;  2WKQ A;  1GSX A;  3T1R A;  3EGX C;  2P08 A;  4QHC A;  3B33 A;  1W8Q A;  5GHX A;  5IU1 A;  4HES A;  1FCN A;  1PFL A;  4NXB A;  1GHI A;  1MXO A;  5CHM A;  3PBO A;  2Y2H A;  3N4I A;  3LFV A;  2HJ9 C;  4YWZ A;  4LRX C;  5FEG A;  3MQQ A;  3B42 A;  5CGS A;  2IWD A;  4OQ0 A;  1NWZ A;  5F83 A;  1MKI A;  1TS6 A;  4Y13 A;  1BLS A;  4OVD A;  2W1T A;  3D4F A;  4EET B;  3T4O A;  1Q2Q A;  1K4E A;  2Y79 A;  3T1Q B;  3UB5 P;  4X56 A;  2LB5 A;  2HGV A;  2OAP 1;  5DF9 A;  4R23 A;  4N1H A;  4PKY A;  4X55 A;  1KE0 A;  3MBZ A;  4L9G A;  3UE6 A;  5EE8 A;  1D06 A;  4Y5F A;  4MN5 A;  5GLD A;  4OOL A;  4KZ8 A;  3UPO A;  3W4P A;  1TEM A;  3LUQ A;  1PW1 A;  3LEZ A;  3NHQ A;  5G4Z A;  4YIN A;  4OOM A;  4KUK A;  2JKT M;  2O99 A;  1XPB A;  2J8Y A;  4UQI M;  3ZNT A;  1T1B A;  1SDE A;  3T4L A;  2QWS A;  3UNW A;  5K5B A;  2R78 A;  1YMX A;  1E3U A;  4BL3 A;  2V1Z A;  2JBF A;  1PWG A;  4JXG A;  3PAG A;  2VGJ A;  3R4K A;  5EM0 A;  3EGD C;  3FWL A;  4OH0 A;  4UAA A;  3G6O A;  4EUV A;  1CF0 A;  2HV1 A;  2VGK A;  3IS2 A;  4GHI A;  3IF6 C;  1LI9 A;  2VX8 A;  3T4S A;  5CHU A;  4P6B A;  5DF7 A;  3VE4 A;  4DE0 A;  5F68 A;  2WKI A;  3C5A A;  3IH9 A;  3BFF A;  5HDS A;  2XA7 S;  1ESU A;  1W63 M;  3MXS A;  3LR5 A;  5DJU A;  1HLU P;  2QMI A;  4N9L A;  4IED A;  4O8G A;  4GOG A;  3ZQ5 A;  3NCK A;  2H0T A;  3IT9 A;  4LLO B;  5L10 A;  2W1T B;  4JGP A;  1K54 C;  4Q0I A;  3C4O A;  5AVF A;  3MSH A;  2J80 A;  1IEL A;  3BWL A;  1J9M A;  1W7F A;  4ZDX A;  4NKP A;  2PYP A;  3IF5 A;  1CI9 A;  5F1F A;  3P98 A;  4GD8 A;  1TD5 A;  4DKI A;  1ES3 A;  1LHY A;  3M2J A;  4PAU A;  4DRT A;  1XXM A;  1ES2 A;  3S7P A;  2Y2O A;  4M4X A;  3V67 A;  3LO7 A;  5G18 A;  2WUQ A;  3H82 A;  1S6R A;  1JWZ A;  1BTL A;  1GHP A;  2J3T C;  1GSW A;  3F1O B;  1KDW A;  4X53 A;  3NOU C;  1EI5 A;  5IS1 A;  3S7Q A;  4ETZ A;  2WZZ A;  3KSH A;  5CXW A;  3T4J A;  3UB7 A;  5FEF A;  3DAV A;  1PWC A;  3E2L A;  2EX8 A;  4Q0H A;  4D2O A;  2NUT C;  1ERO A;  3HLB A;  2OV5 A;  1W63 Q;  4QJG A;  4MBF A;  3OCN A;  2Q9N A;  1CK3 A;  1IYS A;  2V8C A;  1P97 A;  3R7W A;  4EUZ A;  2W3H A;  2ZL1 B;  3IXH A;  3MQ0 A;  5HWT A;  5EUA A;  1PI5 A;  1XGI A;  1FCO A;  5A92 A;  4L9F A;  2EXB A;  1N9N A;  2WKH A;  5HL6 A;  3VOL A;  3BFG A;  3HJK A;  2J9P A;  3EOI A;  4GHI B;  3CI6 A;  4BQM A;  4IVK A;  5F5Y A;  4WLA A;  3ZG9 B;  1NY0 A;  4UA9 A;  3C7V A;  2XRO A;  4LV3 A;  3KSI A;  2M7V A;  4XUX A;  4JF4 A;  4PM8 A;  4DE1 A;  4E3M A;  3OLO A;  1ONH A;  5IT5 A;  4P0M A;  2VK3 A;  3CZD A;  3PBT A;  1PWD A;  2FFF B;  5AQ9 A;  4ZJ1 A;  2A3U A;  4OP8 A;  2DNS A;  4C6Y A;  3F1P B;  3FKW A;  4WF0 A;  4HI4 A;  2HDR A;  3EQV A;  1YSP A;  1LLB A;  4GDN A;  4KZ6 A;  2Y2Q A;  1IYO A;  3ITA A;  4S2N A;  4K08 A;  2P9V A;  4OQI A;  5L8M A;  5HFO A;  4FOF A;  1OTB A;  2VJW A;  4GDB A;  1KE3 A;  2XD1 A;  3M2K A;  4X6T A;  1SZV A;  1I5Q A;  1MWS A;  1IOU A;  4Y0T A;  3EQU A;  4S2I A;  2MJ6 A;  4KQQ A;  4QPR A;  3LEQ A;  4KZ3 A;  1MPL A;  4GD6 A;  2BTF P;  5M1A A;  4MBH A;  1K57 C;  3OCL A;  4QWO A;  2W3D A;  3A3J A;  1YAX A;  3PBQ A;  3UO9 A;  1QMF A;  3ISG A;  3S7N A;  3KYQ A;  1W5D A;  3LID A;  3SH7 A;  1Y4O A;  4JGR A;  2H10 A;  3QP1 A;  1K56 A;  4GW9 A;  3C30 A;  3R7W B;  1D7E A;  1TDG A;  1XKZ A;  3B3X A;  1Q2P A;  5FDH A;  3NOP C;  4D60 A;  3LY3 A;  2OOL A;  5E2F A;  2R9X A;  2BLS A;  1DJC A;  4KZB A;  4RX3 A;  2V0W A;  3A3D A;  2FZ0 A;  4E3K A;  1PRQ A;  3N8S A;  1FR6 A;  3ZGA B;  2HJE A;  4X1M A;  3LIA A;  3VP0 A;  4EWF A;  1L0E A;  2ZQA A;  5HPF A;  3AGD A;  1OJG A;  1LL5 A;  4OLG A;  1YLJ A;  1L0F A;  2HP6 A; 
#chains in the Genus database with same CATH homology
 2L0W A;  2W3F A;  3PR6 A;  3LI9 A;  4JGO A;  4BBV A;  4WEJ A;  4HHD A;  2VGL M;  2IA2 A;  2XA7 M;  1S1Y A;  4HOI A;  2I9V A;  2EWV A;  4KQD A;  3UB8 A;  4O0P A;  5EFW A;  3ULF A;  1S4R A;  3BW6 A;  3ICY A;  3NOT C;  4MCW A;  2XSS A;  2OWH A;  3D3O A;  2WKQ A;  4HP9 A;  1GSX A;  1DP9 A;  4HJ6 A;  3UE3 A;  3EGX C;  2P08 A;  2W1R A;  3B33 A;  2KLI A;  4NXF A;  4NXG A;  2INW A;  4EEU A;  3P7N A;  1EW0 A;  5IU1 A;  3K3C A;  3F1P A;  1V9Y A;  4NXB A;  3PBO A;  1VHM A;  2K31 A;  3LFV A;  5F69 A;  4BBU A;  4F3L A;  4R6L A;  2HJ9 C;  5DFX A;  4YWZ A;  2PR6 A;  4LRX C;  2JN7 A;  3NJA A;  3MQQ A;  3B42 A;  4MMN A;  1XJ6 A;  1DP8 A;  4EU0 A;  1NWZ A;  1TS0 A;  2D01 A;  1G28 A;  1TS6 A;  4ARZ A;  2W1T A;  4EET B;  4EER A;  3H82 B;  4L9E A;  2PT7 A;  3T4O A;  4LRY C;  3KSF A;  4CLC E;  2Y79 A;  3IBR A;  3MR0 A;  4BMW A;  5HDD A;  1OTA A;  2VZW A;  2LB5 A;  2HGV A;  2Y8H A;  2OAP 1;  3MXQ A;  4H6J B;  2P04 A;  5DF9 A;  1MKM A;  4BBT A;  1UGU A;  2QYB A;  4PKY A;  2K2N A;  3T4T A;  2B02 A;  4L9G A;  3UE6 A;  3T4K A;  1D06 A;  2GX5 A;  3FC7 A;  3GEC A;  3MJQ A;  2A24 A;  2JKR M;  2QJ7 A;  3EWK A;  4MN5 A;  4Y5F A;  3K3D A;  4R70 A;  4OOL A;  4EW7 A;  3FPW A;  1VB6 A;  4NEE D;  4EXO A;  4CLC C;  3KSG A;  4IJG A;  4WL9 A;  1S4S A;  3LUQ A;  3KX0 X;  4B9O A;  4CLC D;  3EEA A;  3PHY A;  3NHQ A;  5G4Z A;  4GS9 A;  3MF0 A;  2VV8 A;  4HH3 A;  4JGQ A;  1F5M A;  5HPI A;  3A0R A;  4OOM A;  1V9Z A;  4KUK A;  1LSV A;  2JKT M;  2O99 A;  4P6Z S;  3UB6 A;  4IUH A;  4UQI M;  1T1B A;  3BQ8 A;  3C38 A;  3LR3 A;  3LIC A;  5A8B A;  1OPX A;  2O0Y A;  2QWS A;  4HJ4 A;  2R78 A;  3T4L A;  5K5B A;  4PHT A;  2PR5 A;  2XRN A;  1YSQ A;  4HH2 A;  4PKY G;  2NUP C;  3F1N A;  3R4K A;  3EGD C;  4I38 A;  4UQI S;  2QJ5 A;  3G6O A;  4EUV A;  1OT9 A;  4Y2F A;  4I5S A;  3W2Z A;  4DJ3 A;  2HV1 A;  3PYP A;  1LSX A;  2V1A A;  3IS2 A;  2KDK A;  4HNB A;  4GHI A;  3PBS A;  2Z6C A;  2VX8 A;  1P9R A;  1STZ A;  4II7 A;  3T4S A;  3OBF A;  2YKF A;  2Z6D A;  3VE4 A;  3E0Y A;  5F68 A;  1N9O A;  2VGL S;  5HDS A;  1X0O A;  2XA7 S;  4NXE A;  5AJG A;  5FL3 A;  1W63 M;  5HD5 A;  3LR5 A;  4WEL A;  1OJ5 A;  3GDI A;  5DJU A;  4F3L B;  5J4E A;  3JVU A;  2VA0 A;  4O8G A;  1P0Z A;  3ZQ5 A;  5TBM A;  1WA9 A;  2ZOI A;  3KO6 A;  5HZH A;  5J7E A;  4LPZ A;  1T19 A;  2PYR A;  4LLO B;  2W1T B;  4HP4 A;  1ODV A;  4ETX A;  4JGP A;  4Q0I A;  3A0V A;  2P7J A;  5AVF A;  4DJ2 A;  3KYZ A;  2W3G A;  2J80 A;  1T18 A;  2QHK A;  2ZOH A;  1T1C A;  1N9L A;  3DBA A;  3BWL A;  4NKP A;  2PYP A;  3C2W A;  3LYX A;  2LB9 A;  4DN0 A;  1XFN A;  1TS8 A;  3E98 A;  2K7S A;  4I3A A;  4RQ9 A;  4XT2 A;  3CUE C;  4L0L A;  2M1C A;  1TD5 A;  5HSQ A;  1DRM A;  5HWW A;  4PAU A;  4Z1W A;  5F6A A;  5KIZ A;  1LSW A;  3S7P A;  3RFB A;  4M4X A;  1OTI A;  2O9C A;  3V67 A;  2L4R A;  3LIF A;  2D02 A;  3H82 A;  2KOI A;  3BQA A;  2PDR A;  2J3T C;  3F1O B;  1GSW A;  3NOU C;  4AFI A;  2J3T D;  4MDZ A;  3K2N A;  5IS1 A;  1UWP X;  3S7Q A;  4ETZ A;  3BY8 A;  1TS7 A;  3H7W A;  4EEP A;  3KSH A;  2JKR I;  4ZRR A;  2HF6 A;  3T4J A;  4Y3I A;  1LL8 A;  2OAQ 1;  4BWI A;  2M7U A;  3UB7 A;  3T4Q A;  4Q0H A;  2NUT C;  1GSV A;  2GZA A;  1W63 Q;  3T50 A;  4CLC A;  1UWN X;  2YKH A;  3OCN A;  5I5L A;  4B93 A;  1KOU A;  1P97 A;  3R7W A;  2W3H A;  2KX6 A;  1YKD A;  3MQ0 A;  2JHE A;  3OC2 A;  2VKS A;  4G3W A;  5CX7 A;  5HWT A;  1DP6 A;  2B18 A;  2JKT I;  4L9F A;  2OWJ A;  3HCY A;  1N9N A;  5HL6 A;  5TJJ A;  3VOL A;  3PBR A;  3HJK A;  5DFY A;  3LIE A;  3EOI A;  2GNX A;  4GHI B;  4R3A A;  4YNR A;  3CI6 A;  4I3I A;  3CWF A;  3EEH A;  5F5Y A;  5J3W A;  4WLA A;  3ZYT A;  1JNU A;  1XFQ A;  2O9B A;  5KSH A;  3E4O A;  2XRO A;  2L1M A;  2PD8 A;  1S66 L;  3KSI A;  3BJN A;  2M7V A;  1XJ3 A;  1NLY A;  1OT6 A;  4HQA A;  3BY9 A;  4IHQ A;  3VV4 A;  2O9A A;  2VLG A;  4HJ3 A;  1OTE A;  1ZHH B;  2PHY A;  3OLO A;  4HY8 A;  5IT5 A;  3PBT A;  2V9A A;  2VV6 A;  3FG8 A;  2ZMV A;  3SW1 A;  4BJP A;  5DJT A;  1T1A A;  4I3J A;  3F1P B;  3CLO A;  1TF1 A;  4O01 A;  4WF0 A;  4HI4 A;  5TBM B;  2W27 A;  4HIA A;  3U2A A;  2BAS A;  5AVE A;  2J3W A;  3E4Q A;  3EQV A;  1YSP A;  3RTY A;  4GLQ A;  4Q0J A;  4CQH A;  1NLZ A;  1Y28 A;  3O5Y A;  4EQ1 A;  2V1B A;  1H3Q A;  5DKK A;  4ARZ B;  4K08 A;  2EWW A;  3VE3 A;  2GJ3 A;  1MC0 A;  4MN6 A;  1OTD A;  5HD3 A;  1LT0 A;  4EES A;  2ZBB A;  5L8M A;  4FOF A;  1OTB A;  3MQO A;  2VJW A;  2VV7 A;  4WN5 A;  4XT2 B;  1G6O A;  2WKP A;  3H9W A;  1H8M A;  4I39 A;  4IUK A;  3PBN A;  2A2L A;  2WKR A;  1IOU A;  4WUJ A;  3MMH A;  5DKL A;  4E04 A;  3IBJ A;  1NRJ A;  3MFX A;  2ZMF A;  5MC7 A;  3EQU A;  1BYW A;  2MJ6 A;  4QPR A;  3TE8 A;  1S1Z A;  2A24 B;  3C8C A;  3FPV A;  5HWV A;  3TW8 A;  3OCL A;  1F98 A;  2W3D A;  2VEA A;  1XJ2 A;  1YAX A;  5HDC A;  3CUE A;  5LBR A;  3RH8 B;  3TJZ C;  4FSF A;  3H7W B;  3PBQ A;  4UEY A;  2G7U A;  3UB9 A;  3LIB A;  4MN7 A;  3S7N A;  2FH5 A;  4KUO A;  1P9W A;  3KYQ A;  4GJ4 A;  4GCZ A;  4GS9 B;  3LID A;  1IFQ A;  2PD7 A;  5C5K A;  4JGR A;  3JVV A;  1ZTU A;  4DMZ A;  3UME A;  4CLC B;  3E4P A;  4H6J A;  4GW9 A;  2W0N A;  3C30 A;  3R7W B;  4WEK A;  2DMW A;  1D7E A;  3CIT A;  2V0U A;  4ME4 A;  2EA9 A;  2H28 A;  4YOF A;  3NOP C;  3F1O A;  2OOL A;  4P6Z M;  3PXP A;  3F1N B;  4R38 A;  2V0W A;  3OOV A;  1F9I A;  4KQO A;  3TRC A;  2QKP A;  2FZ0 A;  3LR0 A;  3IS2 B;  2CMN A;  4LRZ E;  4G3K A;  3LI8 A;  3HJI A;  2HJE A;  3LIA A;  3B47 A;  5G4Y A;  1S67 L;  1MZU A;  3S7O A;  1XJ4 A;  3CAX A;  3A0S A;  5HPF A;  4G3V A;  1OJG A;  3UMD A;  3LR4 A;  2W3E A;  3P01 A;  3D72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...