3D9YA

Crystal structure of profilin from schizosaccharomyces pombe
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
126
structure length
126
Chain Sequence
SWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGTGIILAGQKYITIRAEGRSIYGKLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALADYLVGVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin
publication title Incompatibility with Formin Cdc12p Prevents Human Profilin from Substituting for Fission Yeast Profilin: INSIGHTS FROM CRYSTAL STRUCTURES OF FISSION YEAST PROFILIN.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Protein binding
total genus 38
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3d9yA00
3DAVA 2BTFP 3NULA 1CJFA 1PRQA 1VEUB 3CPTA 1PNEA 2ZL1B 1YPRA 2VK3A 3LEQA 4QWOA 5EM0A 5FDSA 3NECA 3D9YA 1VETB 1SKOB 4X1LA 2B95A 2PRFA 1AWIA 4FTXA 3KYEA 1FILA 2PBDP 2JKFA 1ACFA 3T1QB 1PFLA 1CF0A 5EVEA 3T1SA 4X1MA 1VEUA 4ESPA 2JKGA 5FEGA 2ZL1A 1HLUP 1CQAA 3T1RA 3MSHA 1FIKA 3L7HA 1VETA 1SKOA 4FUWA 3CHWP 2HZ5A 3L9KA 3MS6A 4D60A 1G5UA 2ACGA 4X25A 2V8CA 3T1XA 5FEFA 5EM1A 1SZVA 1K0KA 2V8FA 1A0KA 3UB5P 3CPTB 1F2KA 3U4LP 3LGOA 3T12B 1D1JA 1Y4OA 5EV0A 2E8JA 1J3WA 1Z09A 2PAVP
chains in the Genus database with same CATH superfamily
1W5DA 3NOTC 2R9WA 1CI8A 3VP1A 3V39A 1W63M 3GECA 2Y2OA 4O0PA 3ZG9B 5CHJA 4XXRA 4R70A 5F1FA 3UO9A 1YMSA 4D2OA 3IWOA 2VKSA 5J8XA 3R4KA 4WMCD 4KZ5A 3NDEA 2VK3A 1OTAA 1PZOA 3LIAA 3P09A 2W1TA 3VMAA 3ZVTA 4OH0A 2W3HA 1OMEA 4EBNA 5HL1A 3JYIA 3VV4A 3PBNA 4HIAA 5DVAA 4X1LA 4ZJ1A 4IVIA 1E3UD 3GMWA 5U47A 2EWWA 4MBFA 4Q8IA 1MC0A 5FQ9A 4LV1A 4BL3A 3IT9A 2C6WB 2OWHA 2J7VA 2PBYA 2L0WA 1LL5A 5EECA 3KSHA 2H0TA 1VEUA 2Y59A 4DRTA 4GHIA 1UGUA 4WLAA 1FCMA 1F9IA 4NKPA 3Q7ZA 5F69A 3ZDJA 1XP4A 3OBFA 3B3XA 4CJNA 4MDZA 3WS5A 5IHVA 5A92A 5M19A 1ES3A 2WUQA 5GHZA 2ZQDA 2ZC7A 3OLOA 4BL2A 3H7WA 2OWJA 1IYPA 1K0KA 4PKYA 2P9VA 5DKLA 2VX8A 4QY5A 4ZRRA 3Q7VA 4H8RA 2XK1A 3RXWA 4Z9QA 4KZ4A 4EEUA 3LI9A 5HPIA 4NETA 3IHAA 2L4RA 1N9LA 1UWPX 4H6JA 1JWPA 3BFGA 4BJPA 1Q2PA 2V2FF 3MXQA 4MN6A 1LSVA 5CX7A 3F1OB 4MLLA 3A3IA 1CJFA 2HJ9C 2WAFA 4ZJ2A 1XKZA 4UEYA 3EQUA 4RQ9A 3HLDA 1PNEA 5EVLA 1I5QA 2PT7A 4U0TA 5DFYA 2EX8A 5DFXA 3OCLA 2ZMVA 4K91A 4F3LA 2EFUA 3CLOA 1ZG4A 4PAUA 3ZFZA 1MWUA 3BFCA 3T4TA 3LIEA 1YLWA 1KVMA 3O86A 5CEBA 4X1MA 3IBRA 1L0DA 4R3BA 3MBZA 4MEZA 3GSGA 5HPFA 3VP2A 3FC7A 1ESUA 4LRZE 2V0WA 2HZ5A 4HJ6A 5A8BA 1M40A 5GLAA 3SS4A 2XA7M 4MBHA 4B4XA 3PAEA 2YKFA 4B4ZA 1N9BA 2HJEA 3PYPA 1W63Q 5HZHA 3K3CA 1LLBA 3QP8A 2XD1A 2DMWA 5DTSA 4L0LA 2PU4A 1FCNA 3EWKA 4ETZA 3CAXA 1HZOA 2PR6A 1C3BA 2QJ5A 2JKTM 1X0OA 3W2ZA 4DXCA 2R9XA 3FZCA 1T1CA 3ZG5A 4N9KA 3G31A 3QP2A 1BLPA 2Y55A 2PYPA 3FWLA 5F83A 2ZLYA 2WGVA 3NHQA 4DE0A 4E3KA 4HH3A 3LR4A 1QMEA 1W8YA 5DTKA 3DBAA 3MQ0A 2W27A 3U2AA 1IOUA 2Y2KA 2OAP1 3LO7A 4HBUA 3V67A 2ZC4B 5EVIB 2PBDP 1YQSA 1LI0A 4L9FA 3MKEA 1OPXA 1WYCA 1ERQA 2A2LA 2XF3A 1PZPA 5AQAA 4OOLA 1FIKA 1QMFA 4HP4A 1HTZA 2W3FA 2WKEA 3SH8A 5F6AA 5KSCA 2OLUA 3O87A 3N6IA 1NJ4A 1AXBA 2Y2NA 4KQDA 4WUJA 2Q9MA 4WF0A 3PR6A 4C6YA 3B47A 4QHCA 4GS9A 4N92A 1LL9A 3UPNA 3V3RA 3DW0A 1Y4OA 4EBPA 4HI4A 4BENA 5TGFA 4S2MA 5DTTA 4LFUA 3VFFA 3F1PA 2QJ7A 3EEAA 1P9WA 2IWDA 2XD5A 4QPRA 3D72A 2KLIA 2ZJ9A 4NXEA 3ZGAB 4RX3A 5IU1A 2L1MA 3TE8A 4P85A 2ZL1B 2Z2MB 4R23A 4MMNA 2K7SA 4UAAA 5HAIA 3UMDA 1K54C 3NECA 4PM9A 5EPHA 4B88A 1FCOA 1S1ZA 1DY6A 2RCXA 4IVKA 3CITA 4CLCC 4LCLA 1OT6A 2G2UA 2JC7A 4PMAA 2XR0A 5HWWA 2JKGA 1PIOA 4Y0OA 3A3FA 4PM6A 4JKTA 1CQAA 5KMWA 2XROA 2PHYA 3E0YA 2OV5A 5HD5A 5FI7A 3KSIA 4C3QA 5FQKA 4GKUA 5CGWA 1G6OA 1G5UA 5GHYA 3C5AA 1P9RA 5HWTA 1TVFA 5HSQA 4WEKA 4ZJ3A 1BSGA 4DDYA 4OKPA 5FA7A 4JXGA 1GSXA 1MBLA 4GNUA 2B18A 3BJNA 3HLCA 4O01A 2GZAA 1S0WA 5G4YA 1S67L 3G32A 2Z2LB 3VOLA 3NDGA 4WL9A 1ONGA 4S2KA 3QP1A 1IYOA 1TF1A 1PWCA 1SDEA 2BTFP 3E98A 4HH2A 4OOYA 3EQVA 4WELA 1P97A 2ZC6B 5AQBA 4YFMA 3LY3A 3E4OA 2I72A 4GB7A 3SH7A 3PBRA 4I38A 2V1AA 1PRQA 2VJWA 5DJUA 1YSQA 2UV0E 1G68A 4F94A 4Y7PA 1MKMA 1H8MA 4YNRA 1SCWA 4GOGA 4QWOA 2HF6A 3IF5A 2BG1A 4I3JA 5L8MA 5TBMB 2FFFB 1O07A 2VLGA 2GJ3A 4FTXA 1K54A 4OQHA 3KYEA 3UNWA 4EUVA 3IF6B 1FILA 2JKFA 4ARZB 3MZDA 4IJGA 4E6XA 3H9WA 5FAQA 5FQIA 1KE3A 4XT2B 1H3QA 2ZBBA 1Y54A 2PDRA 3NY4A 2ZOIA 4KZ8A 1K38A 3L7HA 1PW1A 2OSUA 2Y2PA 2XEPA 4BBVA 4X53A 4KZ3A 4LV3A 1EWZA 3QP6A 1XXMA 5HFOA 4X25A 3C4OA 1JTGA 1FQGA 5A91A 1G28A 2Z6DA 3BLSA 3RJUA 3IQAA 3BQ8A 5J7EA 3A3JA 3UE1A 1RGZA 4OPRA 3NC8A 1IYQA 2VV6A 2LB5A 4XUXA 4EUZA 3D3OA 1F98A 3ITBA 5TFQA 4DE3A 2MJ6A 1GA9A 1KE0A 3BYDA 1CEGA 5E2EA 4WZ4A 1DJAA 4JGQA 4OONA 5G18A 1KDSA 2HDUA 5L09A 4GW9A 4HY8A 1H8ZA 3CPTA 5AQ9A 3M2KA 2V1BA 2XH9A 3LEQA 5CGXA 3BECA 4A5RA 5M1AA 1YLTA 5FDSA 1SKOB 5AVEA 3T4LA 2LB9A 4DJ3A 4DDSA 4PHTA 2HP6A 3CJMA 4JF5A 4EERA 3LIBA 4O8GA 1YT4A 1XJ2A 3E2LA 1V9ZA 3NCKA 1JVJA 4Z1WA 2CC1A 3QNBA 2FH5A 4E6WA 3Q1FA 2WGWA 3MSHA 1S4RA 4KZ6A 5F68A 4HEFA 3IS2A 3IWQA 2W3GA 2P7JA 5J4EA 3TSGA 4E04A 3W4OA 3TJZC 4UA6A 2OOLA 4RA7A 1L2SA 5J3WA 3RTYA 1BULA 2XGNA 3B42A 3G2YA 3OPHA 5KIZA 3WS0A 1NRFA 4BBUA 2ZM2A 1K55A 2EX6A 4P6BA 4AFIA 3UPPA 2EWVA 4JXSA 4FSFA 1W8QA 3SW1A 4Y17A 1GHIA 3VE3A 2WAEA 4R3AA 4FD8A 2Y2GA 3K3DA 2WGIA 3UY6A 3HUOA 4S2PA 2Q0OA 4Y3IA 1XJ6A 3C7VA 1XX2A 4BMWA 5E2HA 4EU0A 5AJGA 1XJ4A 3KSFA 4OQGA 4S2OA 3FKVA 4LCMA 1DP8A 4GJ4A 3IH9A 3HLBA 3RXXA 4KQQA 2A3UA 1T18A 3AGFA 2PRFA 2PR5A 3V3SA 3BRMA 3IBJA 2VA0A 3FV7A 2QMIA 3C2WA 3H82A 4WN5A 3VP3A 3ZNYA 1WA9A 4NXGA 2I9VA 1S6RA 3G2ZA 3UPOA 1O7EA 1K4EA 4D60A 4ZBEA 4CLCD 1G6AA 1NYYA 1I2SA 4HJ4A 3VOYA 2XDMA 3HL9A 4DXBA 1BLSA 3V5MA 3CMZA 1FSWA 4EW7A 1JTDA 3MJQA 5HWVA 2Y2QA 2A24B 2EFXA 2H5SA 1BLCA 3C4PA 3MF0A 1GSVA 1KOUA 1CI9A 1TEMA 2OAQ1 3A0VA 4UHUA 3UDFA 4CQHA 3LR0A 3W4PA 3F1NB 1NWZA 4MBKA 3R7WA 4OQ0A 3IX3A 5DF8A 4WZ5C 4EEPA 1Y28A 4IHQA 1TDGA 5CGSA 1L0GA 2V9AA 1OT9A 3N8LA 3T50A 4I39A 3NOUC 4GD6A 4ETXA 1YSPA 2NUTC 4GD8A 4DN0A 4MN7A 1YPRA 4YOFA 4IBXA 5DF9A 1L0FA 5HDDA 5A90A 4I3IA 4K0XA 5C5KA 1M6KA 2D01A 4Q0HA 3ZYTA 3MZEA 4P0MA 3S22A 4QB8A 4BD1A 2G7UA 2JN7A 1PFLA 3KSGA 3ITAA 3Q81A 3NI9A 4FOFA 1KGGA 1OTDA 1PI4A 4IUHA 5CXWA 3LEZA 2DRWA 3ZVWA 4JGPA 4GDNA 3IHBA 4PM7A 3CHWP 4P6ZM 4S2NA 2Y8HA 5F5YA 1VHMA 3P7NA 4EBLA 1YMXA 2JHEA 4OPQA 3S7OA 2IA2A 2GX5A 5EE8A 1D7EA 3PTEA 2B5RA 4WEJA 4UQIM 4OP5A 3LGOA 3FKWA 4S2LA 4X55A 4CLCB 4EV4A 3S7QA 3HCYA 4GZBA 1S1YA 3G34A 1GHPA 1DRMA 4Q0JA 2Y4AA 3LYXA 5HARA 3OPPA 4WZ5A 3IWIA 4R38A 5FQMA 3SOIA 3NJAA 1XA1A 2VV7A 4E3OA 3BY9A 3DTMA 3D9YA 1VETB 1OTEA 2ZMFA 4M4XA 2B95A 2WKQA 5FL3A 1XA7A 1K57C 3F1OA 1ACFA 3O88A 4G3KA 3CUEA 3CWFA 5EVEA 5HW3A 3VE4A 3T1SA 2Y2IA 3BLMA 5FQJA 4ESPA 1NLZA 2XLNA 5L2FA 3IX4A 4DF6A 3LFVA 2Y91A 5EVIC 1FSYA 4FUWA 5CECA 5FI6A 5CERA 3NIAA 3ULFA 2ACGA 1FR6A 4JXVA 3LR3A 2Y79A 2ZQAA 3SS5A 4S2JA 2Q9NA 3BWLA 2Y2LA 3SZTA 2V8FA 4NG2A 2JKTI 2ZOHA 4M3KA 5E2GA 3PAGA 1E3UA 1ZTUA 4RVAA 1XPBA 2Y2MA 4CPKA 1Q2QA 3VP0A 2W1TB 1S4SA 4I3AA 2PD8A 1XFNA 4KUKA 4WBGA 1H0MA 3UB7A 2VV8A 1HD8A 2PAVP 2X71A 5L10A 3DAVA 4UA9A 4KG2A 3DWKA 2M1CA 3NULA 4HQAA 3OOVA 2Z6CA 3IXDA 4LLOB 1I2WA 4K08A 4PPRA 4JBFA 2KOIA 1VEUB 4UA7A 2HDRA 3OPRA 4GHIB 4K0WA 4R0QA 5EM0A 4ME4A 4P6ZS 4QY6A 4Q0IA 3MFDA 2AVXA 4U0XA 4Y0UA 3MR0A 5FAOA 4JGRA 3SS3A 5HD3A 1JWZA 4EWFA 4Y0TA 3KO6A 3N8SA 3VP4A 1T1AA 2ZD8A 3H7WB 3IX8A 4DMZA 1K57A 2P9VB 3WS2A 4UQIS 4GCZA 4OOMA 1HLUP 3Q7VB 3S7NA 3T4OA 5IT5A 5GLBA 2R78A 4Y15A 4XUZA 4KG5A 3K2NA 3MXRA 3M2JA 1NRJA 1V9YA 4H6JB 3UB6A 5EVIA 4BWIA 1YLYA 3ZHHA 1OTIA 4EQIA 3PBTA 4WM9A 3PBOA 3BM6A 5AVFA 3UB8A 4DE1A 1STZA 4LENA 2J9PA 3UMEA 3P01A 2J8YA 5FATA 1D1JA 5KZHA 3MKFA 1ZHHB 5TJJA 4JXWA 1K55C 1IEMA 2VZWA 4F3LB 2GNXA 2ZM8A 2W0NA 4KZAA 3HUMA 4R3JA 4R1GA 3QHYA 5DF7A 2K31A 3UDIA 1LL8A 1N9NA 1KGEA 2J3TC 5EOOA 3MQQA 1LI9A 3JVUA 4E3LA 1BTLA 5HX9A 3GV9A 4EXOA 1SDNA 3WWXA 3E4PA 4FH2A 4I5SA 3HBRA 3ZG7B 2ZQ9A 1EROA 3V50A 1D06A 2X02A 3IXBA 1VQQA 4S2IA 2WKPA 4DE2A 4B93A 3S7PA 2ZL1A 1MXOA 3JPUA 1XGJA 4HESA 3IF6C 3N4IA 5K5BA 1MWTA 1ZC2A 3NBLA 1BYWA 3DWZA 3C8CA 2V8CA 4KENB 1MPLA 5JYPA 4BD0A 5I5LA 2QPNA 1A0KA 3PBQA 1H8YA 2WZZA 3PXPA 5CTMA 2JE5A 1NY0A 1PW8A 3KYZA 3A0SA 4Y2FA 4KQRA 2XFSA 4N1XA 4N1HA 4R6LA 4X6TA 3BFDA 4DKIA 1L3LA 3CZDA 1WE4A 1SKFA 4JF4A 5HAQA 4FCFA 3KYQA 3HVFA 4OP8A 2WKHA 3LCEA 2P04A 4QJGA 4R4SA 3UE0A 3T4SA 2HDQA 2ZQCA 4U3TA 3QP4A 1GCEA 3HLGA 5FSRA 2WK0A 3IH8A 2P08A 3IXHA 1AWIA 3C7UA 1HVBA 2JCHA 1YLPA 2QWSA 2GDNA 4EQ1A 1IKIA 1LSXA 4NXBA 2FFYA 3D4FA 4E3JA 3GR2A 1IYSA 2Y2JA 1MZUA 1Z6FA 5L07A 2W3DA 4GS9B 2H10A 2QZ6A 5HL6A 5TBMA 4RYEA 4KZ9A 1LT0A 3JVVA 5EUAA 3W4QA 3L9KA 2EX2A 3MS6A 3VSLA 1ALQA 3IF6A 5CRFA 3BFFA 3A3DA 4ARZA 2VEAA 1VM1A 5FQQA 1YM1A 4JGOA 1NYMA 3F1PB 1K56A 1VB6A 4XT2A 4S2NC 1RGYA 3UB9A 5EVID 2W3EA 2EXAA 1TS7A 3HJIA 3TG9A 3BFEA 3OCNA 2QHKA 2WKRA 2XQZA 3OZHA 3FPVA 3DTEA 1ODVA 5FAPA 3QP5A 2ZC3B 2P74A 3BW6A 5GHXA 2VGLM 1SHVA 3GVBA 2JKRM 3LIFA 1J9MA 1YAXA 3ICYA 1ES5A 3EGXC 3FG8A 4B9OA 3MFXA 1ZG6A 4EESA 1W79A 1RP5A 2M7UA 3T4KA 5GLDA 1ES2A 4G3WA 3MXSA 1RCJA 1GSWA 3SH9A 2ZMAA 5HAPA 2HDSA 1TDLA 4LV2A 3UE6A 3W8KA 1F5MA 1OJ5A 3DTIA 1H5XA 1PWDA 3A0RA 3ZCZA 2QKPA 3MZFA 4ZTKA 4OLGA 3ZQ5A 1K4FA 4E3IA 3UN7A 5GLCA 3AGEA 3PBSA 4YWZA 3TOIA 1NXYA 4E3NA 1IKGA 4DJ2A 1CK3A 2HP9A 3NOPC 5GL9A 3ZNTA 4II7A 3CUEC 1FOFA 2HP5A 5A93A 1SKOA 2V1ZA 4NK3A 2DNSA 1EW0A 3RH8B 5LBRA 2O9AA 1ERMA 1KVLA 3VFHA 2D02A 3T1XA 1NZOA 5CTNA 5CHUA 3MMHA 2KDKA 4JLFA 5EM1A 2WKIA 4HOIA 3LY4A 1MWSA 2JBFA 3M6BA 3UB5P 5KSHA 1K6SA 3BEBA 3N8RA 1W7FA 1CEFA 2HGVA 4LRYC 5E2FA 3M6HA 2XRNA 5HDSA 3Q82A 4FH4A 1MY8A 1KDWA 2INWA 3TRCA 2E8JA 2HV1A 1Z09A 1OTBA 3GDIA 4JF6A 4OPYA 2O9CA 2IWCA 3O5YA 5DJTA 3CG5A 1OJGA 3EGDC 4KUOA 2O0YA 2ZC5B 4HHDA 3HLEA 2XSSA 2ZM0A 3ZG8B 5HDCA 1T19A 4LPZA 1LHYA 4NEED 5MC7A 2H0YA 1WYBA 3DTKA 4LGWA 2OLVA 2VGJA 3EOIA 4GLQA 3N7WA 2J3TD 3T1QB 5I94A 3RFBA 1NZUA 4MN5A 1KE4A 2J9OA 3HJKA 2ZQ7A 2KX6A 5FEGA 3GRJA 5EFWA 2XFTA 3B33A 2J3WA 3CI6A 1TS8A 4X68A 1PI5A 4MNRA 3LR5A 3Q07A 1GHMA 3A3EA 4L9GA 4IEDA 2JKRI 3VSKA 4NXFA 2WZXA 3E2KA 1BUEA 2VGLS 1SZVA 2EA9A 4OPZA 3I7JA 4N9LA 3QNCA 3S4XA 5JYOA 1ESIA 1IELA 4LRXC 5D3OA 3ZG0A 3HUNA 3AGDA 1PWGA 3CPTB 1F2KA 1E25A 4HNBA 4PM8A 3U4LP 4HJ3A 3T12B 4YINA 4HP9A 1U60A 1JWVA 2IWBA 4QU3A 4IBRA 4WMCA 1J3WA 4IUKA 1K56D 4WYYA 2XA7S 1EI5A 2G2WA 4ID4A 1L0EA 3C38A 3GQZA 1GA0A 2A24A 3T4JA 1LSWA 5F82A 2H28A 3E4QA 3UDXA 1XFQA 1PYYA 1KGFA 5CEDA 2WGWB 3OC2A 4X69A 4OLDA 3F1NA 3IS2B 4JPMA 2WADA 3G35A 4MCWA 5TR7A 1DJBA 1TS6A 1XJ3A 2RL3A 3LUQA 1DP9A 1IFQA 1ONHA 2C5WB 1NLYA 1K25A 4BBTA 1CF0A 3LICA 2K2NA 3GTCA 5E43A 4C75A 2W1RA 4X56A 1YLZA 1BZAA 2UWXA 3G6OA 1TD5A 4L9EA 3T1RA 1N9OA 1JNUA 2VGKA 4PKYG 1MKIA 1S66L 3OPLA 2HPBA 2E8IA 3O3VA 5F1GA 2Y2HA 5FASA 5EOEA 3WS1A 2CMNA 5IS1A 1MWRA 5FEFA 4Y5FA 4KZBA 4EETB 2V20A 1UWNX 5FI2A 1K6RA 3G4PA 3WRZA 2QYBA 2NUPC 4ZDXA 1ZKJA 4HBTA 5EV0A 3G30A 4PM5A 5DKKA 4R4RA 1DJCA 5M18A 1P0ZA 4BLMA 5BOHA 2DCFA 3FYZA 4QD4A 3T4QA 2O9BA 3H82B 4LV0A 3HREA 2PYRA 2M7VA 3PHYA 3UE3A 3IXGA 4OQIA 4CLCA 3LIDA 4KG6A 3HLWA 4BQMA 3EEHA 2X01A 4OVDA 3VOZA 3HLFA 2J80A 4ZAMA 1BLHA 2ZQ8A 5CHMA 3ISGA 1XGIA 1BT5A 3P98A 2A49A 4Y13A 4KQOA 2PD7A 3WS4A 3MQOA 2BLSA 4G3VA 3C30A 1FR1A 1TS0A 2BASA 3FPWA 1YLJA 1ES4A 2WYXA 3TW8A 1VETA 3LI8A 5AQ7A 3R7WB 4RX2A 4GN2A 4E3MA 2EX9A 3BY8A 3S1YA 4P87A 1DP6A 2EXBA 4GDBA 5FDHA 4CLCE 4KZ7A 2O99A 2PU2A 1N4OA 2B02A 5G4ZA 3KX0X 1YKDA 2V0UA 1E4DA 2YKHA 3BQAA 3WRTA 4O7DA 2FZ0A 1T1BA
chains in the Genus database with same CATH topology
3DAVA 2BTFP 3NULA 1CJFA 1PRQA 1VEUB 3CPTA 1PNEA 2ZL1B 1YPRA 2VK3A 3LEQA 4QWOA 5EM0A 5FDSA 3NECA 3D9YA 1VETB 1SKOB 4X1LA 2B95A 2PRFA 1AWIA 4FTXA 3KYEA 1FILA 2PBDP 2JKFA 1ACFA 3T1QB 1PFLA 1CF0A 5EVEA 3T1SA 4X1MA 1VEUA 4ESPA 2JKGA 5FEGA 2ZL1A 1HLUP 1CQAA 3T1RA 3MSHA 1FIKA 3L7HA 1VETA 1SKOA 4FUWA 3CHWP 2HZ5A 3L9KA 3MS6A 4D60A 1G5UA 2ACGA 4X25A 2V8CA 3T1XA 5FEFA 5EM1A 1SZVA 1K0KA 2V8FA 1A0KA 3UB5P 3CPTB 1F2KA 3U4LP 3LGOA 3T12B 1D1JA 1Y4OA 5EV0A 2E8JA 1J3WA 1Z09A 2PAVP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DAV A;  2BTF P;  3NUL A;  1CJF A;  1PRQ A;  1VEU B;  3CPT A;  1PNE A;  2ZL1 B;  1YPR A;  2VK3 A;  3LEQ A;  4QWO A;  5EM0 A;  5FDS A;  3NEC A;  3D9Y A;  1VET B;  1SKO B;  4X1L A;  2B95 A;  2PRF A;  1AWI A;  4FTX A;  3KYE A;  1FIL A;  2PBD P;  2JKF A;  1ACF A;  3T1Q B;  1PFL A;  1CF0 A;  5EVE A;  3T1S A;  4X1M A;  1VEU A;  4ESP A;  2JKG A;  5FEG A;  2ZL1 A;  1HLU P;  1CQA A;  3T1R A;  3MSH A;  1FIK A;  3L7H A;  1VET A;  1SKO A;  4FUW A;  3CHW P;  2HZ5 A;  3L9K A;  3MS6 A;  4D60 A;  1G5U A;  2ACG A;  4X25 A;  2V8C A;  3T1X A;  5FEF A;  5EM1 A;  1SZV A;  1K0K A;  2V8F A;  1A0K A;  3UB5 P;  3CPT B;  1F2K A;  3U4L P;  3LGO A;  3T12 B;  1D1J A;  1Y4O A;  5EV0 A;  2E8J A;  1J3W A;  1Z09 A;  2PAV P; 
#chains in the Genus database with same CATH topology
 1W5D A;  3NOT C;  2R9W A;  1CI8 A;  3VP1 A;  3V39 A;  1W63 M;  3GEC A;  2Y2O A;  4O0P A;  3ZG9 B;  5CHJ A;  4XXR A;  4R70 A;  5F1F A;  3UO9 A;  1YMS A;  4D2O A;  3IWO A;  2VKS A;  5J8X A;  3R4K A;  4WMC D;  4KZ5 A;  3NDE A;  2VK3 A;  1OTA A;  1PZO A;  3LIA A;  3P09 A;  2W1T A;  3VMA A;  3ZVT A;  4OH0 A;  2W3H A;  1OME A;  4EBN A;  5HL1 A;  3JYI A;  3VV4 A;  3PBN A;  4HIA A;  5DVA A;  4X1L A;  4ZJ1 A;  4IVI A;  1E3U D;  3GMW A;  5U47 A;  2EWW A;  4MBF A;  4Q8I A;  1MC0 A;  5FQ9 A;  4LV1 A;  4BL3 A;  3IT9 A;  2C6W B;  2OWH A;  2J7V A;  2PBY A;  2L0W A;  1LL5 A;  5EEC A;  3KSH A;  2H0T A;  1VEU A;  2Y59 A;  4DRT A;  4GHI A;  1UGU A;  4WLA A;  1FCM A;  1F9I A;  4NKP A;  3Q7Z A;  5F69 A;  3ZDJ A;  1XP4 A;  3OBF A;  3B3X A;  4CJN A;  4MDZ A;  3WS5 A;  5IHV A;  5A92 A;  5M19 A;  1ES3 A;  2WUQ A;  5GHZ A;  2ZQD A;  2ZC7 A;  3OLO A;  4BL2 A;  3H7W A;  2OWJ A;  1IYP A;  1K0K A;  4PKY A;  2P9V A;  5DKL A;  2VX8 A;  4QY5 A;  4ZRR A;  3Q7V A;  4H8R A;  2XK1 A;  3RXW A;  4Z9Q A;  4KZ4 A;  4EEU A;  3LI9 A;  5HPI A;  4NET A;  3IHA A;  2L4R A;  1N9L A;  1UWP X;  4H6J A;  1JWP A;  3BFG A;  4BJP A;  1Q2P A;  2V2F F;  3MXQ A;  4MN6 A;  1LSV A;  5CX7 A;  3F1O B;  4MLL A;  3A3I A;  1CJF A;  2HJ9 C;  2WAF A;  4ZJ2 A;  1XKZ A;  4UEY A;  3EQU A;  4RQ9 A;  3HLD A;  1PNE A;  5EVL A;  1I5Q A;  2PT7 A;  4U0T A;  5DFY A;  2EX8 A;  5DFX A;  3OCL A;  2ZMV A;  4K91 A;  4F3L A;  2EFU A;  3CLO A;  1ZG4 A;  4PAU A;  3ZFZ A;  1MWU A;  3BFC A;  3T4T A;  3LIE A;  1YLW A;  1KVM A;  3O86 A;  5CEB A;  4X1M A;  3IBR A;  1L0D A;  4R3B A;  3MBZ A;  4MEZ A;  3GSG A;  5HPF A;  3VP2 A;  3FC7 A;  1ESU A;  4LRZ E;  2V0W A;  2HZ5 A;  4HJ6 A;  5A8B A;  1M40 A;  5GLA A;  3SS4 A;  2XA7 M;  4MBH A;  4B4X A;  3PAE A;  2YKF A;  4B4Z A;  1N9B A;  2HJE A;  3PYP A;  1W63 Q;  5HZH A;  3K3C A;  1LLB A;  3QP8 A;  2XD1 A;  2DMW A;  5DTS A;  4L0L A;  2PU4 A;  1FCN A;  3EWK A;  4ETZ A;  3CAX A;  1HZO A;  2PR6 A;  1C3B A;  2QJ5 A;  2JKT M;  1X0O A;  3W2Z A;  4DXC A;  2R9X A;  3FZC A;  1T1C A;  3ZG5 A;  4N9K A;  3G31 A;  3QP2 A;  1BLP A;  2Y55 A;  2PYP A;  3FWL A;  5F83 A;  2ZLY A;  2WGV A;  3NHQ A;  4DE0 A;  4E3K A;  4HH3 A;  3LR4 A;  1QME A;  1W8Y A;  5DTK A;  3DBA A;  3MQ0 A;  2W27 A;  3U2A A;  1IOU A;  2Y2K A;  2OAP 1;  3LO7 A;  4HBU A;  3V67 A;  2ZC4 B;  5EVI B;  2PBD P;  1YQS A;  1LI0 A;  4L9F A;  3MKE A;  1OPX A;  1WYC A;  1ERQ A;  2A2L A;  2XF3 A;  1PZP A;  5AQA A;  4OOL A;  1FIK A;  1QMF A;  4HP4 A;  1HTZ A;  2W3F A;  2WKE A;  3SH8 A;  5F6A A;  5KSC A;  2OLU A;  3O87 A;  3N6I A;  1NJ4 A;  1AXB A;  2Y2N A;  4KQD A;  4WUJ A;  2Q9M A;  4WF0 A;  3PR6 A;  4C6Y A;  3B47 A;  4QHC A;  4GS9 A;  4N92 A;  1LL9 A;  3UPN A;  3V3R A;  3DW0 A;  1Y4O A;  4EBP A;  4HI4 A;  4BEN A;  5TGF A;  4S2M A;  5DTT A;  4LFU A;  3VFF A;  3F1P A;  2QJ7 A;  3EEA A;  1P9W A;  2IWD A;  2XD5 A;  4QPR A;  3D72 A;  2KLI A;  2ZJ9 A;  4NXE A;  3ZGA B;  4RX3 A;  5IU1 A;  2L1M A;  3TE8 A;  4P85 A;  2ZL1 B;  2Z2M B;  4R23 A;  4MMN A;  2K7S A;  4UAA A;  5HAI A;  3UMD A;  1K54 C;  3NEC A;  4PM9 A;  5EPH A;  4B88 A;  1FCO A;  1S1Z A;  1DY6 A;  2RCX A;  4IVK A;  3CIT A;  4CLC C;  4LCL A;  1OT6 A;  2G2U A;  2JC7 A;  4PMA A;  2XR0 A;  5HWW A;  2JKG A;  1PIO A;  4Y0O A;  3A3F A;  4PM6 A;  4JKT A;  1CQA A;  5KMW A;  2XRO A;  2PHY A;  3E0Y A;  2OV5 A;  5HD5 A;  5FI7 A;  3KSI A;  4C3Q A;  5FQK A;  4GKU A;  5CGW A;  1G6O A;  1G5U A;  5GHY A;  3C5A A;  1P9R A;  5HWT A;  1TVF A;  5HSQ A;  4WEK A;  4ZJ3 A;  1BSG A;  4DDY A;  4OKP A;  5FA7 A;  4JXG A;  1GSX A;  1MBL A;  4GNU A;  2B18 A;  3BJN A;  3HLC A;  4O01 A;  2GZA A;  1S0W A;  5G4Y A;  1S67 L;  3G32 A;  2Z2L B;  3VOL A;  3NDG A;  4WL9 A;  1ONG A;  4S2K A;  3QP1 A;  1IYO A;  1TF1 A;  1PWC A;  1SDE A;  2BTF P;  3E98 A;  4HH2 A;  4OOY A;  3EQV A;  4WEL A;  1P97 A;  2ZC6 B;  5AQB A;  4YFM A;  3LY3 A;  3E4O A;  2I72 A;  4GB7 A;  3SH7 A;  3PBR A;  4I38 A;  2V1A A;  1PRQ A;  2VJW A;  5DJU A;  1YSQ A;  2UV0 E;  1G68 A;  4F94 A;  4Y7P A;  1MKM A;  1H8M A;  4YNR A;  1SCW A;  4GOG A;  4QWO A;  2HF6 A;  3IF5 A;  2BG1 A;  4I3J A;  5L8M A;  5TBM B;  2FFF B;  1O07 A;  2VLG A;  2GJ3 A;  4FTX A;  1K54 A;  4OQH A;  3KYE A;  3UNW A;  4EUV A;  3IF6 B;  1FIL A;  2JKF A;  4ARZ B;  3MZD A;  4IJG A;  4E6X A;  3H9W A;  5FAQ A;  5FQI A;  1KE3 A;  4XT2 B;  1H3Q A;  2ZBB A;  1Y54 A;  2PDR A;  3NY4 A;  2ZOI A;  4KZ8 A;  1K38 A;  3L7H A;  1PW1 A;  2OSU A;  2Y2P A;  2XEP A;  4BBV A;  4X53 A;  4KZ3 A;  4LV3 A;  1EWZ A;  3QP6 A;  1XXM A;  5HFO A;  4X25 A;  3C4O A;  1JTG A;  1FQG A;  5A91 A;  1G28 A;  2Z6D A;  3BLS A;  3RJU A;  3IQA A;  3BQ8 A;  5J7E A;  3A3J A;  3UE1 A;  1RGZ A;  4OPR A;  3NC8 A;  1IYQ A;  2VV6 A;  2LB5 A;  4XUX A;  4EUZ A;  3D3O A;  1F98 A;  3ITB A;  5TFQ A;  4DE3 A;  2MJ6 A;  1GA9 A;  1KE0 A;  3BYD A;  1CEG A;  5E2E A;  4WZ4 A;  1DJA A;  4JGQ A;  4OON A;  5G18 A;  1KDS A;  2HDU A;  5L09 A;  4GW9 A;  4HY8 A;  1H8Z A;  3CPT A;  5AQ9 A;  3M2K A;  2V1B A;  2XH9 A;  3LEQ A;  5CGX A;  3BEC A;  4A5R A;  5M1A A;  1YLT A;  5FDS A;  1SKO B;  5AVE A;  3T4L A;  2LB9 A;  4DJ3 A;  4DDS A;  4PHT A;  2HP6 A;  3CJM A;  4JF5 A;  4EER A;  3LIB A;  4O8G A;  1YT4 A;  1XJ2 A;  3E2L A;  1V9Z A;  3NCK A;  1JVJ A;  4Z1W A;  2CC1 A;  3QNB A;  2FH5 A;  4E6W A;  3Q1F A;  2WGW A;  3MSH A;  1S4R A;  4KZ6 A;  5F68 A;  4HEF A;  3IS2 A;  3IWQ A;  2W3G A;  2P7J A;  5J4E A;  3TSG A;  4E04 A;  3W4O A;  3TJZ C;  4UA6 A;  2OOL A;  4RA7 A;  1L2S A;  5J3W A;  3RTY A;  1BUL A;  2XGN A;  3B42 A;  3G2Y A;  3OPH A;  5KIZ A;  3WS0 A;  1NRF A;  4BBU A;  2ZM2 A;  1K55 A;  2EX6 A;  4P6B A;  4AFI A;  3UPP A;  2EWV A;  4JXS A;  4FSF A;  1W8Q A;  3SW1 A;  4Y17 A;  1GHI A;  3VE3 A;  2WAE A;  4R3A A;  4FD8 A;  2Y2G A;  3K3D A;  2WGI A;  3UY6 A;  3HUO A;  4S2P A;  2Q0O A;  4Y3I A;  1XJ6 A;  3C7V A;  1XX2 A;  4BMW A;  5E2H A;  4EU0 A;  5AJG A;  1XJ4 A;  3KSF A;  4OQG A;  4S2O A;  3FKV A;  4LCM A;  1DP8 A;  4GJ4 A;  3IH9 A;  3HLB A;  3RXX A;  4KQQ A;  2A3U A;  1T18 A;  3AGF A;  2PRF A;  2PR5 A;  3V3S A;  3BRM A;  3IBJ A;  2VA0 A;  3FV7 A;  2QMI A;  3C2W A;  3H82 A;  4WN5 A;  3VP3 A;  3ZNY A;  1WA9 A;  4NXG A;  2I9V A;  1S6R A;  3G2Z A;  3UPO A;  1O7E A;  1K4E A;  4D60 A;  4ZBE A;  4CLC D;  1G6A A;  1NYY A;  1I2S A;  4HJ4 A;  3VOY A;  2XDM A;  3HL9 A;  4DXB A;  1BLS A;  3V5M A;  3CMZ A;  1FSW A;  4EW7 A;  1JTD A;  3MJQ A;  5HWV A;  2Y2Q A;  2A24 B;  2EFX A;  2H5S A;  1BLC A;  3C4P A;  3MF0 A;  1GSV A;  1KOU A;  1CI9 A;  1TEM A;  2OAQ 1;  3A0V A;  4UHU A;  3UDF A;  4CQH A;  3LR0 A;  3W4P A;  3F1N B;  1NWZ A;  4MBK A;  3R7W A;  4OQ0 A;  3IX3 A;  5DF8 A;  4WZ5 C;  4EEP A;  1Y28 A;  4IHQ A;  1TDG A;  5CGS A;  1L0G A;  2V9A A;  1OT9 A;  3N8L A;  3T50 A;  4I39 A;  3NOU C;  4GD6 A;  4ETX A;  1YSP A;  2NUT C;  4GD8 A;  4DN0 A;  4MN7 A;  1YPR A;  4YOF A;  4IBX A;  5DF9 A;  1L0F A;  5HDD A;  5A90 A;  4I3I A;  4K0X A;  5C5K A;  1M6K A;  2D01 A;  4Q0H A;  3ZYT A;  3MZE A;  4P0M A;  3S22 A;  4QB8 A;  4BD1 A;  2G7U A;  2JN7 A;  1PFL A;  3KSG A;  3ITA A;  3Q81 A;  3NI9 A;  4FOF A;  1KGG A;  1OTD A;  1PI4 A;  4IUH A;  5CXW A;  3LEZ A;  2DRW A;  3ZVW A;  4JGP A;  4GDN A;  3IHB A;  4PM7 A;  3CHW P;  4P6Z M;  4S2N A;  2Y8H A;  5F5Y A;  1VHM A;  3P7N A;  4EBL A;  1YMX A;  2JHE A;  4OPQ A;  3S7O A;  2IA2 A;  2GX5 A;  5EE8 A;  1D7E A;  3PTE A;  2B5R A;  4WEJ A;  4UQI M;  4OP5 A;  3LGO A;  3FKW A;  4S2L A;  4X55 A;  4CLC B;  4EV4 A;  3S7Q A;  3HCY A;  4GZB A;  1S1Y A;  3G34 A;  1GHP A;  1DRM A;  4Q0J A;  2Y4A A;  3LYX A;  5HAR A;  3OPP A;  4WZ5 A;  3IWI A;  4R38 A;  5FQM A;  3SOI A;  3NJA A;  1XA1 A;  2VV7 A;  4E3O A;  3BY9 A;  3DTM A;  3D9Y A;  1VET B;  1OTE A;  2ZMF A;  4M4X A;  2B95 A;  2WKQ A;  5FL3 A;  1XA7 A;  1K57 C;  3F1O A;  1ACF A;  3O88 A;  4G3K A;  3CUE A;  3CWF A;  5EVE A;  5HW3 A;  3VE4 A;  3T1S A;  2Y2I A;  3BLM A;  5FQJ A;  4ESP A;  1NLZ A;  2XLN A;  5L2F A;  3IX4 A;  4DF6 A;  3LFV A;  2Y91 A;  5EVI C;  1FSY A;  4FUW A;  5CEC A;  5FI6 A;  5CER A;  3NIA A;  3ULF A;  2ACG A;  1FR6 A;  4JXV A;  3LR3 A;  2Y79 A;  2ZQA A;  3SS5 A;  4S2J A;  2Q9N A;  3BWL A;  2Y2L A;  3SZT A;  2V8F A;  4NG2 A;  2JKT I;  2ZOH A;  4M3K A;  5E2G A;  3PAG A;  1E3U A;  1ZTU A;  4RVA A;  1XPB A;  2Y2M A;  4CPK A;  1Q2Q A;  3VP0 A;  2W1T B;  1S4S A;  4I3A A;  2PD8 A;  1XFN A;  4KUK A;  4WBG A;  1H0M A;  3UB7 A;  2VV8 A;  1HD8 A;  2PAV P;  2X71 A;  5L10 A;  3DAV A;  4UA9 A;  4KG2 A;  3DWK A;  2M1C A;  3NUL A;  4HQA A;  3OOV A;  2Z6C A;  3IXD A;  4LLO B;  1I2W A;  4K08 A;  4PPR A;  4JBF A;  2KOI A;  1VEU B;  4UA7 A;  2HDR A;  3OPR A;  4GHI B;  4K0W A;  4R0Q A;  5EM0 A;  4ME4 A;  4P6Z S;  4QY6 A;  4Q0I A;  3MFD A;  2AVX A;  4U0X A;  4Y0U A;  3MR0 A;  5FAO A;  4JGR A;  3SS3 A;  5HD3 A;  1JWZ A;  4EWF A;  4Y0T A;  3KO6 A;  3N8S A;  3VP4 A;  1T1A A;  2ZD8 A;  3H7W B;  3IX8 A;  4DMZ A;  1K57 A;  2P9V B;  3WS2 A;  4UQI S;  4GCZ A;  4OOM A;  1HLU P;  3Q7V B;  3S7N A;  3T4O A;  5IT5 A;  5GLB A;  2R78 A;  4Y15 A;  4XUZ A;  4KG5 A;  3K2N A;  3MXR A;  3M2J A;  1NRJ A;  1V9Y A;  4H6J B;  3UB6 A;  5EVI A;  4BWI A;  1YLY A;  3ZHH A;  1OTI A;  4EQI A;  3PBT A;  4WM9 A;  3PBO A;  3BM6 A;  5AVF A;  3UB8 A;  4DE1 A;  1STZ A;  4LEN A;  2J9P A;  3UME A;  3P01 A;  2J8Y A;  5FAT A;  1D1J A;  5KZH A;  3MKF A;  1ZHH B;  5TJJ A;  4JXW A;  1K55 C;  1IEM A;  2VZW A;  4F3L B;  2GNX A;  2ZM8 A;  2W0N A;  4KZA A;  3HUM A;  4R3J A;  4R1G A;  3QHY A;  5DF7 A;  2K31 A;  3UDI A;  1LL8 A;  1N9N A;  1KGE A;  2J3T C;  5EOO A;  3MQQ A;  1LI9 A;  3JVU A;  4E3L A;  1BTL A;  5HX9 A;  3GV9 A;  4EXO A;  1SDN A;  3WWX A;  3E4P A;  4FH2 A;  4I5S A;  3HBR A;  3ZG7 B;  2ZQ9 A;  1ERO A;  3V50 A;  1D06 A;  2X02 A;  3IXB A;  1VQQ A;  4S2I A;  2WKP A;  4DE2 A;  4B93 A;  3S7P A;  2ZL1 A;  1MXO A;  3JPU A;  1XGJ A;  4HES A;  3IF6 C;  3N4I A;  5K5B A;  1MWT A;  1ZC2 A;  3NBL A;  1BYW A;  3DWZ A;  3C8C A;  2V8C A;  4KEN B;  1MPL A;  5JYP A;  4BD0 A;  5I5L A;  2QPN A;  1A0K A;  3PBQ A;  1H8Y A;  2WZZ A;  3PXP A;  5CTM A;  2JE5 A;  1NY0 A;  1PW8 A;  3KYZ A;  3A0S A;  4Y2F A;  4KQR A;  2XFS A;  4N1X A;  4N1H A;  4R6L A;  4X6T A;  3BFD A;  4DKI A;  1L3L A;  3CZD A;  1WE4 A;  1SKF A;  4JF4 A;  5HAQ A;  4FCF A;  3KYQ A;  3HVF A;  4OP8 A;  2WKH A;  3LCE A;  2P04 A;  4QJG A;  4R4S A;  3UE0 A;  3T4S A;  2HDQ A;  2ZQC A;  4U3T A;  3QP4 A;  1GCE A;  3HLG A;  5FSR A;  2WK0 A;  3IH8 A;  2P08 A;  3IXH A;  1AWI A;  3C7U A;  1HVB A;  2JCH A;  1YLP A;  2QWS A;  2GDN A;  4EQ1 A;  1IKI A;  1LSX A;  4NXB A;  2FFY A;  3D4F A;  4E3J A;  3GR2 A;  1IYS A;  2Y2J A;  1MZU A;  1Z6F A;  5L07 A;  2W3D A;  4GS9 B;  2H10 A;  2QZ6 A;  5HL6 A;  5TBM A;  4RYE A;  4KZ9 A;  1LT0 A;  3JVV A;  5EUA A;  3W4Q A;  3L9K A;  2EX2 A;  3MS6 A;  3VSL A;  1ALQ A;  3IF6 A;  5CRF A;  3BFF A;  3A3D A;  4ARZ A;  2VEA A;  1VM1 A;  5FQQ A;  1YM1 A;  4JGO A;  1NYM A;  3F1P B;  1K56 A;  1VB6 A;  4XT2 A;  4S2N C;  1RGY A;  3UB9 A;  5EVI D;  2W3E A;  2EXA A;  1TS7 A;  3HJI A;  3TG9 A;  3BFE A;  3OCN A;  2QHK A;  2WKR A;  2XQZ A;  3OZH A;  3FPV A;  3DTE A;  1ODV A;  5FAP A;  3QP5 A;  2ZC3 B;  2P74 A;  3BW6 A;  5GHX A;  2VGL M;  1SHV A;  3GVB A;  2JKR M;  3LIF A;  1J9M A;  1YAX A;  3ICY A;  1ES5 A;  3EGX C;  3FG8 A;  4B9O A;  3MFX A;  1ZG6 A;  4EES A;  1W79 A;  1RP5 A;  2M7U A;  3T4K A;  5GLD A;  1ES2 A;  4G3W A;  3MXS A;  1RCJ A;  1GSW A;  3SH9 A;  2ZMA A;  5HAP A;  2HDS A;  1TDL A;  4LV2 A;  3UE6 A;  3W8K A;  1F5M A;  1OJ5 A;  3DTI A;  1H5X A;  1PWD A;  3A0R A;  3ZCZ A;  2QKP A;  3MZF A;  4ZTK A;  4OLG A;  3ZQ5 A;  1K4F A;  4E3I A;  3UN7 A;  5GLC A;  3AGE A;  3PBS A;  4YWZ A;  3TOI A;  1NXY A;  4E3N A;  1IKG A;  4DJ2 A;  1CK3 A;  2HP9 A;  3NOP C;  5GL9 A;  3ZNT A;  4II7 A;  3CUE C;  1FOF A;  2HP5 A;  5A93 A;  1SKO A;  2V1Z A;  4NK3 A;  2DNS A;  1EW0 A;  3RH8 B;  5LBR A;  2O9A A;  1ERM A;  1KVL A;  3VFH A;  2D02 A;  3T1X A;  1NZO A;  5CTN A;  5CHU A;  3MMH A;  2KDK A;  4JLF A;  5EM1 A;  2WKI A;  4HOI A;  3LY4 A;  1MWS A;  2JBF A;  3M6B A;  3UB5 P;  5KSH A;  1K6S A;  3BEB A;  3N8R A;  1W7F A;  1CEF A;  2HGV A;  4LRY C;  5E2F A;  3M6H A;  2XRN A;  5HDS A;  3Q82 A;  4FH4 A;  1MY8 A;  1KDW A;  2INW A;  3TRC A;  2E8J A;  2HV1 A;  1Z09 A;  1OTB A;  3GDI A;  4JF6 A;  4OPY A;  2O9C A;  2IWC A;  3O5Y A;  5DJT A;  3CG5 A;  1OJG A;  3EGD C;  4KUO A;  2O0Y A;  2ZC5 B;  4HHD A;  3HLE A;  2XSS A;  2ZM0 A;  3ZG8 B;  5HDC A;  1T19 A;  4LPZ A;  1LHY A;  4NEE D;  5MC7 A;  2H0Y A;  1WYB A;  3DTK A;  4LGW A;  2OLV A;  2VGJ A;  3EOI A;  4GLQ A;  3N7W A;  2J3T D;  3T1Q B;  5I94 A;  3RFB A;  1NZU A;  4MN5 A;  1KE4 A;  2J9O A;  3HJK A;  2ZQ7 A;  2KX6 A;  5FEG A;  3GRJ A;  5EFW A;  2XFT A;  3B33 A;  2J3W A;  3CI6 A;  1TS8 A;  4X68 A;  1PI5 A;  4MNR A;  3LR5 A;  3Q07 A;  1GHM A;  3A3E A;  4L9G A;  4IED A;  2JKR I;  3VSK A;  4NXF A;  2WZX A;  3E2K A;  1BUE A;  2VGL S;  1SZV A;  2EA9 A;  4OPZ A;  3I7J A;  4N9L A;  3QNC A;  3S4X A;  5JYO A;  1ESI A;  1IEL A;  4LRX C;  5D3O A;  3ZG0 A;  3HUN A;  3AGD A;  1PWG A;  3CPT B;  1F2K A;  1E25 A;  4HNB A;  4PM8 A;  3U4L P;  4HJ3 A;  3T12 B;  4YIN A;  4HP9 A;  1U60 A;  1JWV A;  2IWB A;  4QU3 A;  4IBR A;  4WMC A;  1J3W A;  4IUK A;  1K56 D;  4WYY A;  2XA7 S;  1EI5 A;  2G2W A;  4ID4 A;  1L0E A;  3C38 A;  3GQZ A;  1GA0 A;  2A24 A;  3T4J A;  1LSW A;  5F82 A;  2H28 A;  3E4Q A;  3UDX A;  1XFQ A;  1PYY A;  1KGF A;  5CED A;  2WGW B;  3OC2 A;  4X69 A;  4OLD A;  3F1N A;  3IS2 B;  4JPM A;  2WAD A;  3G35 A;  4MCW A;  5TR7 A;  1DJB A;  1TS6 A;  1XJ3 A;  2RL3 A;  3LUQ A;  1DP9 A;  1IFQ A;  1ONH A;  2C5W B;  1NLY A;  1K25 A;  4BBT A;  1CF0 A;  3LIC A;  2K2N A;  3GTC A;  5E43 A;  4C75 A;  2W1R A;  4X56 A;  1YLZ A;  1BZA A;  2UWX A;  3G6O A;  1TD5 A;  4L9E A;  3T1R A;  1N9O A;  1JNU A;  2VGK A;  4PKY G;  1MKI A;  1S66 L;  3OPL A;  2HPB A;  2E8I A;  3O3V A;  5F1G A;  2Y2H A;  5FAS A;  5EOE A;  3WS1 A;  2CMN A;  5IS1 A;  1MWR A;  5FEF A;  4Y5F A;  4KZB A;  4EET B;  2V20 A;  1UWN X;  5FI2 A;  1K6R A;  3G4P A;  3WRZ A;  2QYB A;  2NUP C;  4ZDX A;  1ZKJ A;  4HBT A;  5EV0 A;  3G30 A;  4PM5 A;  5DKK A;  4R4R A;  1DJC A;  5M18 A;  1P0Z A;  4BLM A;  5BOH A;  2DCF A;  3FYZ A;  4QD4 A;  3T4Q A;  2O9B A;  3H82 B;  4LV0 A;  3HRE A;  2PYR A;  2M7V A;  3PHY A;  3UE3 A;  3IXG A;  4OQI A;  4CLC A;  3LID A;  4KG6 A;  3HLW A;  4BQM A;  3EEH A;  2X01 A;  4OVD A;  3VOZ A;  3HLF A;  2J80 A;  4ZAM A;  1BLH A;  2ZQ8 A;  5CHM A;  3ISG A;  1XGI A;  1BT5 A;  3P98 A;  2A49 A;  4Y13 A;  4KQO A;  2PD7 A;  3WS4 A;  3MQO A;  2BLS A;  4G3V A;  3C30 A;  1FR1 A;  1TS0 A;  2BAS A;  3FPW A;  1YLJ A;  1ES4 A;  2WYX A;  3TW8 A;  1VET A;  3LI8 A;  5AQ7 A;  3R7W B;  4RX2 A;  4GN2 A;  4E3M A;  2EX9 A;  3BY8 A;  3S1Y A;  4P87 A;  1DP6 A;  2EXB A;  4GDB A;  5FDH A;  4CLC E;  4KZ7 A;  2O99 A;  2PU2 A;  1N4O A;  2B02 A;  5G4Z A;  3KX0 X;  1YKD A;  2V0U A;  1E4D A;  2YKH A;  3BQA A;  3WRT A;  4O7D A;  2FZ0 A;  1T1B A; 
#chains in the Genus database with same CATH homology
 3DAV A;  2BTF P;  3NUL A;  1CJF A;  1PRQ A;  1VEU B;  3CPT A;  1PNE A;  2ZL1 B;  1YPR A;  2VK3 A;  3LEQ A;  4QWO A;  5EM0 A;  5FDS A;  3NEC A;  3D9Y A;  1VET B;  1SKO B;  4X1L A;  2B95 A;  2PRF A;  1AWI A;  4FTX A;  3KYE A;  1FIL A;  2PBD P;  2JKF A;  1ACF A;  3T1Q B;  1PFL A;  1CF0 A;  5EVE A;  3T1S A;  4X1M A;  1VEU A;  4ESP A;  2JKG A;  5FEG A;  2ZL1 A;  1HLU P;  1CQA A;  3T1R A;  3MSH A;  1FIK A;  3L7H A;  1VET A;  1SKO A;  4FUW A;  3CHW P;  2HZ5 A;  3L9K A;  3MS6 A;  4D60 A;  1G5U A;  2ACG A;  4X25 A;  2V8C A;  3T1X A;  5FEF A;  5EM1 A;  1SZV A;  1K0K A;  2V8F A;  1A0K A;  3UB5 P;  3CPT B;  1F2K A;  3U4L P;  3LGO A;  3T12 B;  1D1J A;  1Y4O A;  5EV0 A;  2E8J A;  1J3W A;  1Z09 A;  2PAV P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...