3D9YA

Crystal structure of profilin from schizosaccharomyces pombe
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
126
structure length
126
Chain Sequence
SWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGTGIILAGQKYITIRAEGRSIYGKLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALADYLVGVGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Profilin
publication title Incompatibility with Formin Cdc12p Prevents Human Profilin from Substituting for Fission Yeast Profilin: INSIGHTS FROM CRYSTAL STRUCTURES OF FISSION YEAST PROFILIN.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 38
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3d9yA00
3LGOA 2HZ5A 3T1RA 1G5UA 3T1SA 1CJFA 2JKFA 3CHWP 5FEGA 4ESPA 1VEUB 4FUWA 1ACFA 5EVEA 1K0KA 3T12B 4X1LA 3UB5P 4D60A 1SKOA 3T1XA 1SZVA 3LEQA 5FDSA 2ZL1A 3U4LP 3L7HA 3CPTB 3KYEA 1VETA 3NULA 1CQAA 1PRQA 1D1JA 1VEUA 5EM1A 1Z09A 5EM0A 5FEFA 3MS6A 5EV0A 1A0KA 1Y4OA 3D9YA 1CF0A 1PFLA 2PBDP 1J3WA 2E8JA 1F2KA 1AWIA 3CPTA 3MSHA 2BTFP 1FIKA 4FTXA 2PRFA 2ACGA 1SKOB 4X1MA 2JKGA 2VK3A 3T1QB 4X25A 4QWOA 2ZL1B 3NECA 1FILA 2PAVP 1YPRA 2V8CA 2V8FA 3L9KA 2B95A 1HLUP 1VETB 3DAVA 1PNEA
chains in the Genus database with same CATH superfamily
2H28A 1IYSA 4IBXA 5HAIA 3E2KA 4UQIM 1S1YA 3OBFA 2O0YA 2VV8A 4CLCB 2XLNA 4QHCA 2C6WB 4DE2A 1W7FA 3JVVA 3IXHA 3HCYA 3GSGA 3O87A 3TW8A 3C30A 3ZG5A 3UE3A 2J9OA 5HWVA 5I94A 3UPOA 1L0FA 4K08A 1STZA 3VFHA 3NJAA 4EERA 3C5AA 2HP9A 4IUHA 2XFSA 3EGDC 2Y2HA 1YLPA 1GSWA 1H8ZA 2I9VA 1JWZA 2EWVA 2Q9MA 4ZRRA 3EOIA 4Q0HA 3KO6A 5EVIB 1CQAA 2X71A 3D72A 3F1OA 3NOUC 3HVFA 1K57A 3E4OA 5J7EA 4NKPA 3CG5A 4QY5A 2VKSA 3WS2A 3A3EA 4HP9A 4JXGA 3P7NA 4ZAMA 3G32A 4XUXA 2BTFP 2GDNA 2C5WB 1K54C 2ACGA 3VOLA 5AQ7A 4OVDA 4GCZA 4P87A 3RH8B 1EROA 3OZHA 3QP4A 5IS1A 1DP6A 1E3UD 3ZG7B 1BTLA 3L9KA 4B93A 2EX9A 1TS6A 3W4OA 3MXQA 4GJ4A 4Z9QA 3T1RA 4OOLA 1UWNX 4RYEA 4RX2A 4GLQA 5CHUA 1H8MA 1ZC2A 3NOPC 1XA1A 4E6WA 4JF6A 4BD0A 2GX5A 1H0MA 4E3KA 4L0LA 3LY4A 1G6AA 3BWLA 5J3WA 1FCOA 4CLCD 3NCKA 1T18A 3ZFZA 4X1LA 1IYPA 3W8KA 3H82B 4EU0A 3LIFA 3EWKA 5K5BA 4KG2A 4R4SA 3P01A 5HARA 4EQ1A 4RVAA 2H5SA 1YT4A 3R7WA 4R38A 4Y5FA 1VETA 4BD1A 2DRWA 3TRCA 1VM1A 4ARZA 4OPQA 5EV0A 3DWKA 2RCXA 1BLCA 1Y4OA 1YQSA 3VSKA 3C4PA 3G4PA 3D4FA 5EVID 3Q7VA 3C38A 5CGWA 1S66L 1K55C 2XF3A 2Y2QA 4GKUA 4IJGA 5F83A 2WGWA 5GHYA 1YSPA 3T4LA 2JKTM 2QZ6A 1Q2QA 3NECA 2Z6CA 3VE3A 4MN7A 1WYBA 2ZQ9A 5L10A 4XXRA 1MZUA 5I5LA 2IWBA 1EWZA 1F9IA 4X68A 1L2SA 2DCFA 1JWVA 1OT6A 4Q0IA 5F68A 1P9WA 2A49A 1L0DA 4OPRA 2IWDA 2JKFA 4HH2A 1OJGA 5F69A 1E25A 3SW1A 1V9ZA 1IEMA 2Y2GA 3GV9A 1LL9A 3S1YA 1YAXA 1CI8A 4PPRA 4JXVA 4XT2B 4JBFA 3DBAA 3UDXA 4FSFA 1KE4A 5TFQA 5A92A 2AVXA 4IVIA 2J3TC 4R1GA 2VEAA 3FV7A 2ZD8A 4H6JA 2ZMFA 2PU2A 5FQIA 3BQAA 1NJ4A 2BG1A 3G2ZA 3VOZA 3OCNA 1OTAA 3A3FA 3N8RA 1ES4A 1ZTUA 1MBLA 2XDMA 5HSQA 2K2NA 3IX8A 1XJ4A 3V5MA 2E8JA 2P9VA 1F2KA 2OV5A 5HDCA 4WEJA 1S4SA 1DJBA 2JN7A 1PZOA 5CX7A 2UV0E 1KVLA 3VV4A 3OOVA 3UPPA 4MBKA 5TBMB 4N1XA 2HJEA 4LV3A 2V8CA 3BLMA 2QMIA 4O8GA 3O88A 1U60A 1QMFA 3IH8A 1IFQA 2V1BA 3PBQA 1G28A 5LBRA 1KOUA 5TBMA 3T1SA 1XJ3A 1AXBA 3BFFA 4HH3A 2G2UA 4Y7PA 3VP1A 1FR1A 3SS4A 3QP6A 3PXPA 5F82A 4ESPA 3KYZA 4E3JA 3UB7A 1MWTA 5CRFA 3LR5A 5HL1A 4NXGA 4I38A 3T1XA 1K55A 2V0WA 2WKQA 5TJJA 3UDIA 5GHZA 1FOFA 2V1AA 4CQHA 3BY9A 3E98A 1TDLA 5G4ZA 1OTBA 3UB9A 2B18A 3H7WB 2B5RA 1LL8A 3ZVWA 3RXXA 4LPZA 2X02A 1TS7A 4U0TA 4EBPA 5G4YA 2XR0A 3LEZA 3CITA 2E8IA 2WGVA 2JKRI 4P6BA 5HZHA 2NUTC 1ESIA 1FIKA 2A24B 3EEAA 1D06A 3PBOA 5HPFA 1GHMA 1BLPA 4UHUA 1S0WA 1WA9A 2VGKA 3FYZA 1JVJA 4PM7A 4JPMA 4QD4A 1TF1A 5CTNA 1MWUA 4S2NC 3MR0A 4WELA 4LLOB 3T4OA 2D02A 4Y17A 4CLCC 4DMZA 4BBVA 4HHDA 4PM9A 2A24A 1XGIA 2Z2MB 3QP8A 3MFXA 3BJNA 5FA7A 3NBLA 5J8XA 4MN5A 1O7EA 1CJFA 1XFNA 4EWFA 5KIZA 3CHWP 1DY6A 2ZOHA 3MFDA 2EX2A 1BZAA 1ZG4A 5EVLA 1KGGA 4Y3IA 5EVEA 2K7SA 3UB5P 4D60A 3LI9A 2HPBA 4DKIA 5EVIC 5A93A 3ZGAB 4DXCA 1DJCA 1W8QA 1LL5A 2ZQDA 3IXDA 3IXBA 2VZWA 4S2JA 3G34A 3WRTA 2VX8A 3F1NA 2A3UA 2M7VA 3QP5A 4FOFA 3NDEA 2ZMVA 5KSCA 5KSHA 3GDIA 4LRZE 3QHYA 5FL3A 4Z1WA 2PDRA 2XROA 4WL9A 5HAPA 2JBFA 1YMSA 4E3IA 4WEKA 5L8MA 3ISGA 1WE4A 1ES2A 4HP4A 2ZL1B 4KQRA 2XH9A 3ZHHA 2WYXA 3FWLA 4UA7A 3UY6A 2M7UA 1PYYA 1ALQA 3V39A 1MC0A 3LR0A 5HAQA 4DRTA 3O3VA 1D7EA 3GVBA 3QP2A 2JC7A 2XRNA 3P09A 4MBFA 4JKTA 4YWZA 3SS5A 2PBYA 2W1RA 3MZFA 3BEBA 1PW1A 1ZHHB 1E3UA 1QMEA 4KQDA 1W8YA 4FCFA 4KZ6A 4N9LA 3NOTC 2OLUA 3S7QA 2ZC4B 2ZQCA 3BFEA 1J9MA 2EFUA 1T1AA 3IQAA 4OLDA 5IU1A 3IHAA 4I5SA 1GHPA 3PTEA 3QNCA 1LSVA 3LR4A 4YFMA 3U4LP 3P98A 4HNBA 3L7HA 1N9LA 3C8CA 4R23A 3CPTB 3BECA 1OMEA 4C6YA 1I5QA 3NULA 1IYQA 2OLVA 3LCEA 5A90A 4S2NA 4FH4A 1JWPA 3SH8A 5EM0A 5DTTA 4EEUA 5G18A 4PKYG 4CLCA 5FQKA 2WKEA 3A3IA 2VLGA 2VGJA 2CC1A 3OPLA 4KENB 3CPTA 3LR3A 2K31A 5DF7A 1S4RA 1F98A 4M3KA 2PR5A 1SKOB 2WAFA 1SDNA 3IBRA 2ZLYA 2EX8A 1ODVA 4IBRA 5CGSA 2ZC7A 5DTSA 4WF0A 4WMCD 3UB8A 4YOFA 5DF8A 4B9OA 4ZBEA 4BJPA 1RGZA 5EVIA 1S67L 2VJWA 1W79A 3DTIA 3MQOA 1P9RA 2INWA 3A3DA 2XQZA 4Y15A 1BT5A 1FSYA 5FAOA 2OSUA 3IF6C 3HJKA 3E4QA 3A3JA 1VHMA 3HUOA 5HDDA 2GJ3A 1MKIA 3DTKA 2QJ5A 2FZ0A 2KX6A 3IX4A 2J3WA 1YM1A 3A0SA 2WGIA 4G3WA 2IA2A 1DP9A 4MEZA 2OOLA 1MWSA 3VP3A 1FR6A 4NXEA 4Y0UA 2ZC6B 5M18A 4M4XA 4LV1A 2KDKA 1TS0A 4R3BA 3VE4A 1BLHA 1DJAA 3K3CA 4PAUA 3C7UA 3BYDA 3DTMA 3MMHA 1XJ6A 1W63M 3MF0A 2IWCA 4Q0JA 1KGEA 5DFXA 4ETXA 3RFBA 2LB5A 1TD5A 2HV1A 4LENA 2WKRA 1SCWA 2Y2PA 2PRFA 4KZ4A 1K56D 1P97A 2P7JA 3H82A 3T4QA 4QWOA 4LGWA 2PAVP 4E3NA 5F5YA 1PZPA 4QJGA 1G6OA 4X6TA 5F1GA 3DW0A 1PWCA 1YLZA 3HLFA 2JKTI 1X0OA 3TJZC 4I3AA 4OQHA 4BWIA 4II7A 3BFDA 2D01A 3M2JA 1SHVA 3N7WA 3FKWA 4HIAA 4RQ9A 1ESUA 2OWJA 2XGNA 2R9XA 1UWPX 4UAAA 5HFOA 2QKPA 2ZMAA 3T4SA 1Q2PA 2ZQ7A 1IOUA 1IYOA 4OQGA 4WZ5C 3VFFA 4MCWA 4NK3A 4S2PA 1C3BA 1JNUA 3MBZA 4RA7A 3VP4A 2HP5A 4OPZA 3IF6B 3OPHA 2WUQA 5DJTA 5EM1A 1YLWA 1G68A 3A0RA 1PWDA 3NHQA 4BL2A 3BM6A 2Y79A 3CWFA 5FASA 1PFLA 2YKHA 2W3EA 4HESA 1K54A 3PHYA 5EOEA 5FI6A 3LIDA 1BUEA 3EGXC 4I3JA 3M2KA 4EBLA 4MDZA 3BFCA 3M6BA 4HJ6A 3PYPA 5DFYA 3LICA 4XT2A 1JTGA 3GQZA 2WKPA 5JYOA 4GZBA 4R4RA 1T1CA 2XSSA 1PWGA 5GHXA 5FAQA 3VOYA 2LB9A 1ONGA 5CHMA 4JF5A 5JYPA 1LLBA 4ID4A 4NEED 4Y13A 1LSWA 4OPYA 3WS1A 4OKPA 3IWOA 4EW7A 1CEGA 3NY4A 3S7PA 2DMWA 3KSHA 1LI0A 4BBUA 3Q1FA 5EE8A 2VA0A 1ES3A 1K0KA 3SH9A 2EXAA 3KSFA 3AGDA 4LCMA 2WAEA 2UWXA 4LCLA 4GOGA 3FC7A 3CZDA 1XKZA 1E4DA 1TDGA 5FAPA 3HLBA 1NZOA 4K0XA 3M6HA 4EUZA 2QJ7A 1XXMA 3KYEA 2KOIA 1ZKJA 2DNSA 4JF4A 4CPKA 3TOIA 3CMZA 3JVUA 1RP5A 2O9BA 3G6OA 3FG8A 2W27A 5GL9A 1N9BA 2ZBBA 5GLBA 5CGXA 3PBSA 3RTYA 1S6RA 3IS2B 5AQBA 4HOIA 3HUNA 2JHEA 3UNWA 4IVKA 2PR6A 5EUAA 1KE3A 4E3OA 1YLYA 4JGQA 3VP2A 4O0PA 5DJUA 3N4IA 4LRYC 3LUQA 4S2KA 1T19A 1ZG6A 1UGUA 5AQAA 4X1MA 2WKIA 2I72A 3W2ZA 1ES5A 5FATA 4X25A 4Y2FA 3EQVA 3IBJA 2Y2IA 5E2HA 5AQ9A 1FILA 2HGVA 3W4PA 1YPRA 4ZJ2A 2V8FA 2L4RA 3O86A 3ZNTA 1SDEA 1MXOA 2W1TB 1NZUA 5DKLA 5M19A 2V2FF 4KUOA 4P85A 5FI2A 1FQGA 4YNRA 4X55A 3H7WA 2OAP1 4WZ5A 5DF9A 1G5UA 4R6LA 3ZG8B 3LFVA 3ZDJA 4L9EA 4UEYA 5U47A 4CLCE 4DDYA 4YINA 5DVAA 3Q82A 1FCNA 3LYXA 2PD8A 2JKRM 2X01A 3K2NA 3KSIA 3LIBA 3EQUA 4N92A 3ICYA 4OONA 4QY6A 4WUJA 2PYPA 2RL3A 3S7OA 4S2IA 2FFYA 4FD8A 3HUMA 2GZAA 5GLDA 1HVBA 4HJ4A 4PKYA 4ZJ1A 2A2LA 4DN0A 4BL3A 3WS5A 1KE0A 4FH2A 4R70A 4K0WA 5TGFA 3B3XA 3H9WA 4R3JA 2ZC3B 4L9FA 3ZQ5A 5FEFA 1KDSA 4JLFA 1VB6A 4DF6A 3FZCA 3D9YA 4F3LB 1NYMA 1OPXA 3A0VA 4BLMA 5D3OA 3G35A 3BW6A 2XEPA 2VGLS 3HJIA 3LIAA 2L1MA 2VK3A 5GLCA 2Y4AA 3CUEC 3HLEA 3IHBA 5CTMA 4EUVA 5CEDA 1OTIA 4HBUA 1YLJA 2B95A 1TEMA 1T1BA 2ZQ8A 2HZ5A 4KZ5A 3SS3A 5FDHA 3BLSA 1MWRA 5HD5A 4PM5A 4O01A 4EBNA 5IT5A 2VGLM 5CHJA 3UPNA 4HQAA 3ZVTA 4OP5A 3C4OA 3F1PB 2FFFB 1NWZA 2Y59A 4WMCA 5HWTA 4E3MA 3T12B 3S4XA 1OT9A 2OAQ1 1HZOA 1PI4A 2PU4A 2Q0OA 3MXSA 1SZVA 3ZYTA 2JE5A 2H0YA 4N9KA 1PW8A 2Y8HA 2ZL1A 4BQMA 1K25A 3K3DA 1LHYA 4GHIB 2M1CA 5L09A 4KQQA 2NUPC 1PRQA 1TS8A 2MJ6A 1XA7A 4MBHA 5IHVA 3FKVA 3DWZA 1N9OA 1I2WA 3UE6A 1L0GA 3MS6A 4EESA 3BFGA 3VMAA 1MY8A 5FI7A 2Z2LB 3BY8A 1BSGA 3MSHA 4GW9A 3KYQA 1DRMA 4OOYA 5FQQA 5CXWA 1N9NA 1NY0A 2ZM8A 3EEHA 4DE0A 4DJ2A 3E4PA 3VP0A 4DXBA 3IT9A 3IXGA 3F1OB 1YLTA 2W3HA 4BBTA 4E6XA 4UA9A 4LFUA 4HI4A 2FH5A 2KLIA 2Q9NA 1LT0A 2HDSA 4R3AA 1ONHA 3UMEA 2W3DA 2EXBA 1NXYA 4WM9A 4A5RA 4EXOA 4DE3A 1XP4A 4X56A 1K56A 4GDBA 3N8SA 2ZC5B 5HW3A 4MNRA 1ACFA 3E0YA 4HBTA 4AFIA 5E2FA 1SKOA 3PBRA 5A8BA 1PI5A 4RX3A 2OWHA 1M40A 3B33A 5KMWA 4GN2A 1Y28A 5J4EA 3KSGA 1H8YA 4HEFA 2CMNA 3CUEA 3ITBA 2BASA 4R0QA 2W3FA 2XA7S 5C5KA 2H10A 3WS0A 2G7UA 1FCMA 4BMWA 3LIEA 3LO7A 3T4JA 4IEDA 3PBTA 3UB6A 5CEBA 4QB8A 4L9GA 1NRFA 3Q07A 3I7JA 3BRMA 1H3QA 1OTEA 3AGEA 3MQQA 3SH7A 2P04A 3T4KA 4C3QA 3IF5A 1RGYA 4E3LA 1YMXA 3R7WB 4XUZA 4GS9B 2Y55A 2PYRA 1VETB 3LY3A 2XA7M 4OH0A 3S22A 3TG9A 5EPHA 3QNBA 3RXWA 5HPIA 2Y2LA 5FQ9A 1XPBA 4ETZA 3ULFA 4B88A 4GDNA 4ARZB 3NC8A 1K6SA 1KVMA 1K4FA 3C7VA 2V20A 1LSXA 3UN7A 3Q7VB 2VV6A 4P0MA 4CJNA 1SKFA 4EV4A 3VSLA 3NIAA 2Y2MA 3PAGA 4GS9A 2P08A 3IWQA 5FEGA 2ZJ9A 4EETB 3O5YA 1I2SA 1RCJA 2EX6A 5AVEA 2WGWB 3OPRA 3LI8A 5MC7A 3TE8A 4I39A 4GD8A 1S1ZA 2EWWA 5HD3A 4KG6A 3N8LA 1K38A 1ERQA 1HTZA 4JXWA 5EFWA 3U2AA 1NYYA 5CECA 2WZXA 4U3TA 4NXBA 1MKMA 1O07A 3HBRA 3HL9A 3CLOA 5HWWA 2V0UA 1D1JA 1H5XA 2Y2KA 1OTDA 4NETA 3WRZA 4PMAA 4F94A 3GMWA 1YKDA 4OP8A 2HJ9C 3PR6A 2PBDP 5TR7A 4X53A 5A91A 4NXFA 4ZTKA 3B47A 2XD5A 5HL6A 2O9AA 4EQIA 2ZOIA 1YSQA 4DE1A 1ERMA 5CERA 3G2YA 3ZNYA 4BENA 3SZTA 4H6JB 1XX2A 3UMDA 5E2GA 1NRJA 3V3SA 5DKKA 3HLWA 3IF6A 3R4KA 3TSGA 4G3KA 1IELA 2J80A 2P74A 4KUKA 2B02A 2V1ZA 2P9VB 2VV7A 2Y2OA 2ZM2A 4GB7A 1KGFA 1VEUB 4U0XA 3E2LA 3UDFA 5EOOA 3JPUA 4JGRA 3GRJA 2WZZA 3NDGA 4S2MA 2J7VA 3UE1A 4B4XA 2XD1A 3ZG9B 3GTCA 3LEQA 5GLAA 5HDSA 5FDSA 1CEFA 4KQOA 3IH9A 4Y0OA 4LV0A 4DJ3A 2O99A 1WYCA 4KZBA 1VEUA 4DDSA 3IWIA 4LV2A 2R78A 3UE0A 3V67A 1FSWA 2BLSA 3FPWA 4ME4A 4UA6A 1XFQA 5FQJA 4P6ZS 2YKFA 3C2WA 1V9YA 5FSRA 2W3GA 4WYYA 2Y2JA 2HDRA 2ZM0A 4FTXA 4D2OA 3ZCZA 2JKGA 1DP8A 2EFXA 3MXRA 2O9CA 4EEPA 4N1HA 4H8RA 4IHQA 5E43A 5KZHA 3T4TA 3ZG0A 5BOHA 1BYWA 3LGOA 3CAXA 4Q8IA 4OLGA 2V9AA 3HREA 1XGJA 4P6ZM 3GR2A 4K91A 1BLSA 3PAEA 4G3VA 4IUKA 3IS2A 3HLDA 4KZ7A 1GCEA 1EI5A 3KX0X 3OPPA 1CK3A 2W0NA 4E04A 4OQIA 3BQ8A 1LI9A 3D3OA 5AVFA 3RJUA 1K6RA 1GHIA 1IKGA 3MQ0A 1W63Q 4GD6A 2Y2NA 4QPRA 2HDQA 4WBGA 2W1TA 2J9PA 3CJMA 1GA9A 3HLCA 1Z09A 3V50A 3WS4A 5F1FA 4S2OA 1HD8A 1A0KA 1F5MA 2PHYA 4NG2A 1OJ5A 3N6IA 3HLGA 1MPLA 4O7DA 3MZDA 5E2EA 4KZ9A 3QP1A 1BULA 3W4QA 3NI9A 3AGFA 1K57C 2QHKA 2XK1A 1GSVA 5F6AA 3IX3A 1Z6FA 3JYIA 3Q7ZA 4KZ3A 4MLLA 2J8YA 1PNEA 5AJGA 1GA0A 3SOIA 4GNUA 1EW0A 2XFTA 1Y54A 3OC2A 5L07A 3F1NB 3MZEA 1M6KA 5FQMA 4B4ZA 4S2LA 1CI9A 3OCLA 4MMNA 1TVFA 4PHTA 2PD7A 2EA9A 5EECA 2QWSA 4F3LA 1W5DA 2ZQAA 3S7NA 1JTDA 3V3RA 4ZDXA 4WZ4A 1P0ZA 3MJQA 2WK0A 4FUWA 4HJ3A 1IKIA 2WADA 4QU3A 1N4OA 4MN6A 3DTEA 4KZAA 3Q81A 3G31A 3G30A 3B42A 1K4EA 2QYBA 1L3LA 4WN5A 4X69A 2GNXA 4C75A 1PIOA 4JGPA 2Y91A 1NLYA 4KZ8A 4PM6A 4Y0TA 3FPVA 5HX9A 4PM8A 3GECA 1GSXA 3CI6A 1VQQA 4I3IA 3UO9A 2PT7A 2QPNA 5L2FA 1CF0A 2WKHA 4UQIS 3ITAA 5M1AA 4LRXC 1J3WA 2L0WA 2J3TD 1AWIA 4WLAA 1XJ2A 2G2WA 3F1PA 4KG5A 5DTKA 3T50A 2Z6DA 2HP6A 2R9WA 4JXSA 3T1QB 1NLZA 2HF6A 2JCHA 2HDUA 3MKFA 4HY8A 3OLOA 3PBNA 3WWXA 4OQ0A 4OOMA 2H0TA 3MKEA 1HLUP 1L0EA 3DAVA 1KDWA 4ZJ3A 4GHIA 4JGOA
chains in the Genus database with same CATH topology
3LGOA 2HZ5A 3T1RA 1G5UA 3T1SA 1CJFA 2JKFA 3CHWP 5FEGA 4ESPA 1VEUB 4FUWA 1ACFA 5EVEA 1K0KA 3T12B 4X1LA 3UB5P 4D60A 1SKOA 3T1XA 1SZVA 3LEQA 5FDSA 2ZL1A 3U4LP 3L7HA 3CPTB 3KYEA 1VETA 3NULA 1CQAA 1PRQA 1D1JA 1VEUA 5EM1A 1Z09A 5EM0A 5FEFA 3MS6A 5EV0A 1A0KA 1Y4OA 3D9YA 1CF0A 1PFLA 2PBDP 1J3WA 2E8JA 1F2KA 1AWIA 3CPTA 3MSHA 2BTFP 1FIKA 4FTXA 2PRFA 2ACGA 1SKOB 4X1MA 2JKGA 2VK3A 3T1QB 4X25A 4QWOA 2ZL1B 3NECA 1FILA 2PAVP 1YPRA 2V8CA 2V8FA 3L9KA 2B95A 1HLUP 1VETB 3DAVA 1PNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGO A;  2HZ5 A;  3T1R A;  1G5U A;  3T1S A;  1CJF A;  2JKF A;  3CHW P;  5FEG A;  4ESP A;  1VEU B;  4FUW A;  1ACF A;  5EVE A;  1K0K A;  3T12 B;  4X1L A;  3UB5 P;  4D60 A;  1SKO A;  3T1X A;  1SZV A;  3LEQ A;  5FDS A;  2ZL1 A;  3U4L P;  3L7H A;  3CPT B;  3KYE A;  1VET A;  3NUL A;  1CQA A;  1PRQ A;  1D1J A;  1VEU A;  5EM1 A;  1Z09 A;  5EM0 A;  5FEF A;  3MS6 A;  5EV0 A;  1A0K A;  1Y4O A;  3D9Y A;  1CF0 A;  1PFL A;  2PBD P;  1J3W A;  2E8J A;  1F2K A;  1AWI A;  3CPT A;  3MSH A;  2BTF P;  1FIK A;  4FTX A;  2PRF A;  2ACG A;  1SKO B;  4X1M A;  2JKG A;  2VK3 A;  3T1Q B;  4X25 A;  4QWO A;  2ZL1 B;  3NEC A;  1FIL A;  2PAV P;  1YPR A;  2V8C A;  2V8F A;  3L9K A;  2B95 A;  1HLU P;  1VET B;  3DAV A;  1PNE A; 
#chains in the Genus database with same CATH topology
 2H28 A;  1IYS A;  4IBX A;  5HAI A;  3E2K A;  4UQI M;  1S1Y A;  3OBF A;  2O0Y A;  2VV8 A;  4CLC B;  2XLN A;  4QHC A;  2C6W B;  4DE2 A;  1W7F A;  3JVV A;  3IXH A;  3HCY A;  3GSG A;  3O87 A;  3TW8 A;  3C30 A;  3ZG5 A;  3UE3 A;  2J9O A;  5HWV A;  5I94 A;  3UPO A;  1L0F A;  4K08 A;  1STZ A;  3VFH A;  3NJA A;  4EER A;  3C5A A;  2HP9 A;  4IUH A;  2XFS A;  3EGD C;  2Y2H A;  1YLP A;  1GSW A;  1H8Z A;  2I9V A;  1JWZ A;  2EWV A;  2Q9M A;  4ZRR A;  3EOI A;  4Q0H A;  3KO6 A;  5EVI B;  1CQA A;  2X71 A;  3D72 A;  3F1O A;  3NOU C;  3HVF A;  1K57 A;  3E4O A;  5J7E A;  4NKP A;  3CG5 A;  4QY5 A;  2VKS A;  3WS2 A;  3A3E A;  4HP9 A;  4JXG A;  3P7N A;  4ZAM A;  3G32 A;  4XUX A;  2BTF P;  2GDN A;  2C5W B;  1K54 C;  2ACG A;  3VOL A;  5AQ7 A;  4OVD A;  4GCZ A;  4P87 A;  3RH8 B;  1ERO A;  3OZH A;  3QP4 A;  5IS1 A;  1DP6 A;  1E3U D;  3ZG7 B;  1BTL A;  3L9K A;  4B93 A;  2EX9 A;  1TS6 A;  3W4O A;  3MXQ A;  4GJ4 A;  4Z9Q A;  3T1R A;  4OOL A;  1UWN X;  4RYE A;  4RX2 A;  4GLQ A;  5CHU A;  1H8M A;  1ZC2 A;  3NOP C;  1XA1 A;  4E6W A;  4JF6 A;  4BD0 A;  2GX5 A;  1H0M A;  4E3K A;  4L0L A;  3LY4 A;  1G6A A;  3BWL A;  5J3W A;  1FCO A;  4CLC D;  3NCK A;  1T18 A;  3ZFZ A;  4X1L A;  1IYP A;  3W8K A;  3H82 B;  4EU0 A;  3LIF A;  3EWK A;  5K5B A;  4KG2 A;  4R4S A;  3P01 A;  5HAR A;  4EQ1 A;  4RVA A;  2H5S A;  1YT4 A;  3R7W A;  4R38 A;  4Y5F A;  1VET A;  4BD1 A;  2DRW A;  3TRC A;  1VM1 A;  4ARZ A;  4OPQ A;  5EV0 A;  3DWK A;  2RCX A;  1BLC A;  1Y4O A;  1YQS A;  3VSK A;  3C4P A;  3G4P A;  3D4F A;  5EVI D;  3Q7V A;  3C38 A;  5CGW A;  1S66 L;  1K55 C;  2XF3 A;  2Y2Q A;  4GKU A;  4IJG A;  5F83 A;  2WGW A;  5GHY A;  1YSP A;  3T4L A;  2JKT M;  2QZ6 A;  1Q2Q A;  3NEC A;  2Z6C A;  3VE3 A;  4MN7 A;  1WYB A;  2ZQ9 A;  5L10 A;  4XXR A;  1MZU A;  5I5L A;  2IWB A;  1EWZ A;  1F9I A;  4X68 A;  1L2S A;  2DCF A;  1JWV A;  1OT6 A;  4Q0I A;  5F68 A;  1P9W A;  2A49 A;  1L0D A;  4OPR A;  2IWD A;  2JKF A;  4HH2 A;  1OJG A;  5F69 A;  1E25 A;  3SW1 A;  1V9Z A;  1IEM A;  2Y2G A;  3GV9 A;  1LL9 A;  3S1Y A;  1YAX A;  1CI8 A;  4PPR A;  4JXV A;  4XT2 B;  4JBF A;  3DBA A;  3UDX A;  4FSF A;  1KE4 A;  5TFQ A;  5A92 A;  2AVX A;  4IVI A;  2J3T C;  4R1G A;  2VEA A;  3FV7 A;  2ZD8 A;  4H6J A;  2ZMF A;  2PU2 A;  5FQI A;  3BQA A;  1NJ4 A;  2BG1 A;  3G2Z A;  3VOZ A;  3OCN A;  1OTA A;  3A3F A;  3N8R A;  1ES4 A;  1ZTU A;  1MBL A;  2XDM A;  5HSQ A;  2K2N A;  3IX8 A;  1XJ4 A;  3V5M A;  2E8J A;  2P9V A;  1F2K A;  2OV5 A;  5HDC A;  4WEJ A;  1S4S A;  1DJB A;  2JN7 A;  1PZO A;  5CX7 A;  2UV0 E;  1KVL A;  3VV4 A;  3OOV A;  3UPP A;  4MBK A;  5TBM B;  4N1X A;  2HJE A;  4LV3 A;  2V8C A;  3BLM A;  2QMI A;  4O8G A;  3O88 A;  1U60 A;  1QMF A;  3IH8 A;  1IFQ A;  2V1B A;  3PBQ A;  1G28 A;  5LBR A;  1KOU A;  5TBM A;  3T1S A;  1XJ3 A;  1AXB A;  3BFF A;  4HH3 A;  2G2U A;  4Y7P A;  3VP1 A;  1FR1 A;  3SS4 A;  3QP6 A;  3PXP A;  5F82 A;  4ESP A;  3KYZ A;  4E3J A;  3UB7 A;  1MWT A;  5CRF A;  3LR5 A;  5HL1 A;  4NXG A;  4I38 A;  3T1X A;  1K55 A;  2V0W A;  2WKQ A;  5TJJ A;  3UDI A;  5GHZ A;  1FOF A;  2V1A A;  4CQH A;  3BY9 A;  3E98 A;  1TDL A;  5G4Z A;  1OTB A;  3UB9 A;  2B18 A;  3H7W B;  2B5R A;  1LL8 A;  3ZVW A;  3RXX A;  4LPZ A;  2X02 A;  1TS7 A;  4U0T A;  4EBP A;  5G4Y A;  2XR0 A;  3LEZ A;  3CIT A;  2E8I A;  2WGV A;  2JKR I;  4P6B A;  5HZH A;  2NUT C;  1ESI A;  1FIK A;  2A24 B;  3EEA A;  1D06 A;  3PBO A;  5HPF A;  1GHM A;  1BLP A;  4UHU A;  1S0W A;  1WA9 A;  2VGK A;  3FYZ A;  1JVJ A;  4PM7 A;  4JPM A;  4QD4 A;  1TF1 A;  5CTN A;  1MWU A;  4S2N C;  3MR0 A;  4WEL A;  4LLO B;  3T4O A;  2D02 A;  4Y17 A;  4CLC C;  4DMZ A;  4BBV A;  4HHD A;  4PM9 A;  2A24 A;  1XGI A;  2Z2M B;  3QP8 A;  3MFX A;  3BJN A;  5FA7 A;  3NBL A;  5J8X A;  4MN5 A;  1O7E A;  1CJF A;  1XFN A;  4EWF A;  5KIZ A;  3CHW P;  1DY6 A;  2ZOH A;  3MFD A;  2EX2 A;  1BZA A;  1ZG4 A;  5EVL A;  1KGG A;  4Y3I A;  5EVE A;  2K7S A;  3UB5 P;  4D60 A;  3LI9 A;  2HPB A;  4DKI A;  5EVI C;  5A93 A;  3ZGA B;  4DXC A;  1DJC A;  1W8Q A;  1LL5 A;  2ZQD A;  3IXD A;  3IXB A;  2VZW A;  4S2J A;  3G34 A;  3WRT A;  2VX8 A;  3F1N A;  2A3U A;  2M7V A;  3QP5 A;  4FOF A;  3NDE A;  2ZMV A;  5KSC A;  5KSH A;  3GDI A;  4LRZ E;  3QHY A;  5FL3 A;  4Z1W A;  2PDR A;  2XRO A;  4WL9 A;  5HAP A;  2JBF A;  1YMS A;  4E3I A;  4WEK A;  5L8M A;  3ISG A;  1WE4 A;  1ES2 A;  4HP4 A;  2ZL1 B;  4KQR A;  2XH9 A;  3ZHH A;  2WYX A;  3FWL A;  4UA7 A;  3UY6 A;  2M7U A;  1PYY A;  1ALQ A;  3V39 A;  1MC0 A;  3LR0 A;  5HAQ A;  4DRT A;  3O3V A;  1D7E A;  3GVB A;  3QP2 A;  2JC7 A;  2XRN A;  3P09 A;  4MBF A;  4JKT A;  4YWZ A;  3SS5 A;  2PBY A;  2W1R A;  3MZF A;  3BEB A;  1PW1 A;  1ZHH B;  1E3U A;  1QME A;  4KQD A;  1W8Y A;  4FCF A;  4KZ6 A;  4N9L A;  3NOT C;  2OLU A;  3S7Q A;  2ZC4 B;  2ZQC A;  3BFE A;  1J9M A;  2EFU A;  1T1A A;  3IQA A;  4OLD A;  5IU1 A;  3IHA A;  4I5S A;  1GHP A;  3PTE A;  3QNC A;  1LSV A;  3LR4 A;  4YFM A;  3U4L P;  3P98 A;  4HNB A;  3L7H A;  1N9L A;  3C8C A;  4R23 A;  3CPT B;  3BEC A;  1OME A;  4C6Y A;  1I5Q A;  3NUL A;  1IYQ A;  2OLV A;  3LCE A;  5A90 A;  4S2N A;  4FH4 A;  1JWP A;  3SH8 A;  5EM0 A;  5DTT A;  4EEU A;  5G18 A;  4PKY G;  4CLC A;  5FQK A;  2WKE A;  3A3I A;  2VLG A;  2VGJ A;  2CC1 A;  3OPL A;  4KEN B;  3CPT A;  3LR3 A;  2K31 A;  5DF7 A;  1S4R A;  1F98 A;  4M3K A;  2PR5 A;  1SKO B;  2WAF A;  1SDN A;  3IBR A;  2ZLY A;  2EX8 A;  1ODV A;  4IBR A;  5CGS A;  2ZC7 A;  5DTS A;  4WF0 A;  4WMC D;  3UB8 A;  4YOF A;  5DF8 A;  4B9O A;  4ZBE A;  4BJP A;  1RGZ A;  5EVI A;  1S67 L;  2VJW A;  1W79 A;  3DTI A;  3MQO A;  1P9R A;  2INW A;  3A3D A;  2XQZ A;  4Y15 A;  1BT5 A;  1FSY A;  5FAO A;  2OSU A;  3IF6 C;  3HJK A;  3E4Q A;  3A3J A;  1VHM A;  3HUO A;  5HDD A;  2GJ3 A;  1MKI A;  3DTK A;  2QJ5 A;  2FZ0 A;  2KX6 A;  3IX4 A;  2J3W A;  1YM1 A;  3A0S A;  2WGI A;  4G3W A;  2IA2 A;  1DP9 A;  4MEZ A;  2OOL A;  1MWS A;  3VP3 A;  1FR6 A;  4NXE A;  4Y0U A;  2ZC6 B;  5M18 A;  4M4X A;  4LV1 A;  2KDK A;  1TS0 A;  4R3B A;  3VE4 A;  1BLH A;  1DJA A;  3K3C A;  4PAU A;  3C7U A;  3BYD A;  3DTM A;  3MMH A;  1XJ6 A;  1W63 M;  3MF0 A;  2IWC A;  4Q0J A;  1KGE A;  5DFX A;  4ETX A;  3RFB A;  2LB5 A;  1TD5 A;  2HV1 A;  4LEN A;  2WKR A;  1SCW A;  2Y2P A;  2PRF A;  4KZ4 A;  1K56 D;  1P97 A;  2P7J A;  3H82 A;  3T4Q A;  4QWO A;  4LGW A;  2PAV P;  4E3N A;  5F5Y A;  1PZP A;  4QJG A;  1G6O A;  4X6T A;  5F1G A;  3DW0 A;  1PWC A;  1YLZ A;  3HLF A;  2JKT I;  1X0O A;  3TJZ C;  4I3A A;  4OQH A;  4BWI A;  4II7 A;  3BFD A;  2D01 A;  3M2J A;  1SHV A;  3N7W A;  3FKW A;  4HIA A;  4RQ9 A;  1ESU A;  2OWJ A;  2XGN A;  2R9X A;  1UWP X;  4UAA A;  5HFO A;  2QKP A;  2ZMA A;  3T4S A;  1Q2P A;  2ZQ7 A;  1IOU A;  1IYO A;  4OQG A;  4WZ5 C;  3VFF A;  4MCW A;  4NK3 A;  4S2P A;  1C3B A;  1JNU A;  3MBZ A;  4RA7 A;  3VP4 A;  2HP5 A;  4OPZ A;  3IF6 B;  3OPH A;  2WUQ A;  5DJT A;  5EM1 A;  1YLW A;  1G68 A;  3A0R A;  1PWD A;  3NHQ A;  4BL2 A;  3BM6 A;  2Y79 A;  3CWF A;  5FAS A;  1PFL A;  2YKH A;  2W3E A;  4HES A;  1K54 A;  3PHY A;  5EOE A;  5FI6 A;  3LID A;  1BUE A;  3EGX C;  4I3J A;  3M2K A;  4EBL A;  4MDZ A;  3BFC A;  3M6B A;  4HJ6 A;  3PYP A;  5DFY A;  3LIC A;  4XT2 A;  1JTG A;  3GQZ A;  2WKP A;  5JYO A;  4GZB A;  4R4R A;  1T1C A;  2XSS A;  1PWG A;  5GHX A;  5FAQ A;  3VOY A;  2LB9 A;  1ONG A;  5CHM A;  4JF5 A;  5JYP A;  1LLB A;  4ID4 A;  4NEE D;  4Y13 A;  1LSW A;  4OPY A;  3WS1 A;  4OKP A;  3IWO A;  4EW7 A;  1CEG A;  3NY4 A;  3S7P A;  2DMW A;  3KSH A;  1LI0 A;  4BBU A;  3Q1F A;  5EE8 A;  2VA0 A;  1ES3 A;  1K0K A;  3SH9 A;  2EXA A;  3KSF A;  3AGD A;  4LCM A;  2WAE A;  2UWX A;  4LCL A;  4GOG A;  3FC7 A;  3CZD A;  1XKZ A;  1E4D A;  1TDG A;  5FAP A;  3HLB A;  1NZO A;  4K0X A;  3M6H A;  4EUZ A;  2QJ7 A;  1XXM A;  3KYE A;  2KOI A;  1ZKJ A;  2DNS A;  4JF4 A;  4CPK A;  3TOI A;  3CMZ A;  3JVU A;  1RP5 A;  2O9B A;  3G6O A;  3FG8 A;  2W27 A;  5GL9 A;  1N9B A;  2ZBB A;  5GLB A;  5CGX A;  3PBS A;  3RTY A;  1S6R A;  3IS2 B;  5AQB A;  4HOI A;  3HUN A;  2JHE A;  3UNW A;  4IVK A;  2PR6 A;  5EUA A;  1KE3 A;  4E3O A;  1YLY A;  4JGQ A;  3VP2 A;  4O0P A;  5DJU A;  3N4I A;  4LRY C;  3LUQ A;  4S2K A;  1T19 A;  1ZG6 A;  1UGU A;  5AQA A;  4X1M A;  2WKI A;  2I72 A;  3W2Z A;  1ES5 A;  5FAT A;  4X25 A;  4Y2F A;  3EQV A;  3IBJ A;  2Y2I A;  5E2H A;  5AQ9 A;  1FIL A;  2HGV A;  3W4P A;  1YPR A;  4ZJ2 A;  2V8F A;  2L4R A;  3O86 A;  3ZNT A;  1SDE A;  1MXO A;  2W1T B;  1NZU A;  5DKL A;  5M19 A;  2V2F F;  4KUO A;  4P85 A;  5FI2 A;  1FQG A;  4YNR A;  4X55 A;  3H7W A;  2OAP 1;  4WZ5 A;  5DF9 A;  1G5U A;  4R6L A;  3ZG8 B;  3LFV A;  3ZDJ A;  4L9E A;  4UEY A;  5U47 A;  4CLC E;  4DDY A;  4YIN A;  5DVA A;  3Q82 A;  1FCN A;  3LYX A;  2PD8 A;  2JKR M;  2X01 A;  3K2N A;  3KSI A;  3LIB A;  3EQU A;  4N92 A;  3ICY A;  4OON A;  4QY6 A;  4WUJ A;  2PYP A;  2RL3 A;  3S7O A;  4S2I A;  2FFY A;  4FD8 A;  3HUM A;  2GZA A;  5GLD A;  1HVB A;  4HJ4 A;  4PKY A;  4ZJ1 A;  2A2L A;  4DN0 A;  4BL3 A;  3WS5 A;  1KE0 A;  4FH2 A;  4R70 A;  4K0W A;  5TGF A;  3B3X A;  3H9W A;  4R3J A;  2ZC3 B;  4L9F A;  3ZQ5 A;  5FEF A;  1KDS A;  4JLF A;  1VB6 A;  4DF6 A;  3FZC A;  3D9Y A;  4F3L B;  1NYM A;  1OPX A;  3A0V A;  4BLM A;  5D3O A;  3G35 A;  3BW6 A;  2XEP A;  2VGL S;  3HJI A;  3LIA A;  2L1M A;  2VK3 A;  5GLC A;  2Y4A A;  3CUE C;  3HLE A;  3IHB A;  5CTM A;  4EUV A;  5CED A;  1OTI A;  4HBU A;  1YLJ A;  2B95 A;  1TEM A;  1T1B A;  2ZQ8 A;  2HZ5 A;  4KZ5 A;  3SS3 A;  5FDH A;  3BLS A;  1MWR A;  5HD5 A;  4PM5 A;  4O01 A;  4EBN A;  5IT5 A;  2VGL M;  5CHJ A;  3UPN A;  4HQA A;  3ZVT A;  4OP5 A;  3C4O A;  3F1P B;  2FFF B;  1NWZ A;  2Y59 A;  4WMC A;  5HWT A;  4E3M A;  3T12 B;  3S4X A;  1OT9 A;  2OAQ 1;  1HZO A;  1PI4 A;  2PU4 A;  2Q0O A;  3MXS A;  1SZV A;  3ZYT A;  2JE5 A;  2H0Y A;  4N9K A;  1PW8 A;  2Y8H A;  2ZL1 A;  4BQM A;  1K25 A;  3K3D A;  1LHY A;  4GHI B;  2M1C A;  5L09 A;  4KQQ A;  2NUP C;  1PRQ A;  1TS8 A;  2MJ6 A;  1XA7 A;  4MBH A;  5IHV A;  3FKV A;  3DWZ A;  1N9O A;  1I2W A;  3UE6 A;  1L0G A;  3MS6 A;  4EES A;  3BFG A;  3VMA A;  1MY8 A;  5FI7 A;  2Z2L B;  3BY8 A;  1BSG A;  3MSH A;  4GW9 A;  3KYQ A;  1DRM A;  4OOY A;  5FQQ A;  5CXW A;  1N9N A;  1NY0 A;  2ZM8 A;  3EEH A;  4DE0 A;  4DJ2 A;  3E4P A;  3VP0 A;  4DXB A;  3IT9 A;  3IXG A;  3F1O B;  1YLT A;  2W3H A;  4BBT A;  4E6X A;  4UA9 A;  4LFU A;  4HI4 A;  2FH5 A;  2KLI A;  2Q9N A;  1LT0 A;  2HDS A;  4R3A A;  1ONH A;  3UME A;  2W3D A;  2EXB A;  1NXY A;  4WM9 A;  4A5R A;  4EXO A;  4DE3 A;  1XP4 A;  4X56 A;  1K56 A;  4GDB A;  3N8S A;  2ZC5 B;  5HW3 A;  4MNR A;  1ACF A;  3E0Y A;  4HBT A;  4AFI A;  5E2F A;  1SKO A;  3PBR A;  5A8B A;  1PI5 A;  4RX3 A;  2OWH A;  1M40 A;  3B33 A;  5KMW A;  4GN2 A;  1Y28 A;  5J4E A;  3KSG A;  1H8Y A;  4HEF A;  2CMN A;  3CUE A;  3ITB A;  2BAS A;  4R0Q A;  2W3F A;  2XA7 S;  5C5K A;  2H10 A;  3WS0 A;  2G7U A;  1FCM A;  4BMW A;  3LIE A;  3LO7 A;  3T4J A;  4IED A;  3PBT A;  3UB6 A;  5CEB A;  4QB8 A;  4L9G A;  1NRF A;  3Q07 A;  3I7J A;  3BRM A;  1H3Q A;  1OTE A;  3AGE A;  3MQQ A;  3SH7 A;  2P04 A;  3T4K A;  4C3Q A;  3IF5 A;  1RGY A;  4E3L A;  1YMX A;  3R7W B;  4XUZ A;  4GS9 B;  2Y55 A;  2PYR A;  1VET B;  3LY3 A;  2XA7 M;  4OH0 A;  3S22 A;  3TG9 A;  5EPH A;  3QNB A;  3RXW A;  5HPI A;  2Y2L A;  5FQ9 A;  1XPB A;  4ETZ A;  3ULF A;  4B88 A;  4GDN A;  4ARZ B;  3NC8 A;  1K6S A;  1KVM A;  1K4F A;  3C7V A;  2V20 A;  1LSX A;  3UN7 A;  3Q7V B;  2VV6 A;  4P0M A;  4CJN A;  1SKF A;  4EV4 A;  3VSL A;  3NIA A;  2Y2M A;  3PAG A;  4GS9 A;  2P08 A;  3IWQ A;  5FEG A;  2ZJ9 A;  4EET B;  3O5Y A;  1I2S A;  1RCJ A;  2EX6 A;  5AVE A;  2WGW B;  3OPR A;  3LI8 A;  5MC7 A;  3TE8 A;  4I39 A;  4GD8 A;  1S1Z A;  2EWW A;  5HD3 A;  4KG6 A;  3N8L A;  1K38 A;  1ERQ A;  1HTZ A;  4JXW A;  5EFW A;  3U2A A;  1NYY A;  5CEC A;  2WZX A;  4U3T A;  4NXB A;  1MKM A;  1O07 A;  3HBR A;  3HL9 A;  3CLO A;  5HWW A;  2V0U A;  1D1J A;  1H5X A;  2Y2K A;  1OTD A;  4NET A;  3WRZ A;  4PMA A;  4F94 A;  3GMW A;  1YKD A;  4OP8 A;  2HJ9 C;  3PR6 A;  2PBD P;  5TR7 A;  4X53 A;  5A91 A;  4NXF A;  4ZTK A;  3B47 A;  2XD5 A;  5HL6 A;  2O9A A;  4EQI A;  2ZOI A;  1YSQ A;  4DE1 A;  1ERM A;  5CER A;  3G2Y A;  3ZNY A;  4BEN A;  3SZT A;  4H6J B;  1XX2 A;  3UMD A;  5E2G A;  1NRJ A;  3V3S A;  5DKK A;  3HLW A;  3IF6 A;  3R4K A;  3TSG A;  4G3K A;  1IEL A;  2J80 A;  2P74 A;  4KUK A;  2B02 A;  2V1Z A;  2P9V B;  2VV7 A;  2Y2O A;  2ZM2 A;  4GB7 A;  1KGF A;  1VEU B;  4U0X A;  3E2L A;  3UDF A;  5EOO A;  3JPU A;  4JGR A;  3GRJ A;  2WZZ A;  3NDG A;  4S2M A;  2J7V A;  3UE1 A;  4B4X A;  2XD1 A;  3ZG9 B;  3GTC A;  3LEQ A;  5GLA A;  5HDS A;  5FDS A;  1CEF A;  4KQO A;  3IH9 A;  4Y0O A;  4LV0 A;  4DJ3 A;  2O99 A;  1WYC A;  4KZB A;  1VEU A;  4DDS A;  3IWI A;  4LV2 A;  2R78 A;  3UE0 A;  3V67 A;  1FSW A;  2BLS A;  3FPW A;  4ME4 A;  4UA6 A;  1XFQ A;  5FQJ A;  4P6Z S;  2YKF A;  3C2W A;  1V9Y A;  5FSR A;  2W3G A;  4WYY A;  2Y2J A;  2HDR A;  2ZM0 A;  4FTX A;  4D2O A;  3ZCZ A;  2JKG A;  1DP8 A;  2EFX A;  3MXR A;  2O9C A;  4EEP A;  4N1H A;  4H8R A;  4IHQ A;  5E43 A;  5KZH A;  3T4T A;  3ZG0 A;  5BOH A;  1BYW A;  3LGO A;  3CAX A;  4Q8I A;  4OLG A;  2V9A A;  3HRE A;  1XGJ A;  4P6Z M;  3GR2 A;  4K91 A;  1BLS A;  3PAE A;  4G3V A;  4IUK A;  3IS2 A;  3HLD A;  4KZ7 A;  1GCE A;  1EI5 A;  3KX0 X;  3OPP A;  1CK3 A;  2W0N A;  4E04 A;  4OQI A;  3BQ8 A;  1LI9 A;  3D3O A;  5AVF A;  3RJU A;  1K6R A;  1GHI A;  1IKG A;  3MQ0 A;  1W63 Q;  4GD6 A;  2Y2N A;  4QPR A;  2HDQ A;  4WBG A;  2W1T A;  2J9P A;  3CJM A;  1GA9 A;  3HLC A;  1Z09 A;  3V50 A;  3WS4 A;  5F1F A;  4S2O A;  1HD8 A;  1A0K A;  1F5M A;  2PHY A;  4NG2 A;  1OJ5 A;  3N6I A;  3HLG A;  1MPL A;  4O7D A;  3MZD A;  5E2E A;  4KZ9 A;  3QP1 A;  1BUL A;  3W4Q A;  3NI9 A;  3AGF A;  1K57 C;  2QHK A;  2XK1 A;  1GSV A;  5F6A A;  3IX3 A;  1Z6F A;  3JYI A;  3Q7Z A;  4KZ3 A;  4MLL A;  2J8Y A;  1PNE A;  5AJG A;  1GA0 A;  3SOI A;  4GNU A;  1EW0 A;  2XFT A;  1Y54 A;  3OC2 A;  5L07 A;  3F1N B;  3MZE A;  1M6K A;  5FQM A;  4B4Z A;  4S2L A;  1CI9 A;  3OCL A;  4MMN A;  1TVF A;  4PHT A;  2PD7 A;  2EA9 A;  5EEC A;  2QWS A;  4F3L A;  1W5D A;  2ZQA A;  3S7N A;  1JTD A;  3V3R A;  4ZDX A;  4WZ4 A;  1P0Z A;  3MJQ A;  2WK0 A;  4FUW A;  4HJ3 A;  1IKI A;  2WAD A;  4QU3 A;  1N4O A;  4MN6 A;  3DTE A;  4KZA A;  3Q81 A;  3G31 A;  3G30 A;  3B42 A;  1K4E A;  2QYB A;  1L3L A;  4WN5 A;  4X69 A;  2GNX A;  4C75 A;  1PIO A;  4JGP A;  2Y91 A;  1NLY A;  4KZ8 A;  4PM6 A;  4Y0T A;  3FPV A;  5HX9 A;  4PM8 A;  3GEC A;  1GSX A;  3CI6 A;  1VQQ A;  4I3I A;  3UO9 A;  2PT7 A;  2QPN A;  5L2F A;  1CF0 A;  2WKH A;  4UQI S;  3ITA A;  5M1A A;  4LRX C;  1J3W A;  2L0W A;  2J3T D;  1AWI A;  4WLA A;  1XJ2 A;  2G2W A;  3F1P A;  4KG5 A;  5DTK A;  3T50 A;  2Z6D A;  2HP6 A;  2R9W A;  4JXS A;  3T1Q B;  1NLZ A;  2HF6 A;  2JCH A;  2HDU A;  3MKF A;  4HY8 A;  3OLO A;  3PBN A;  3WWX A;  4OQ0 A;  4OOM A;  2H0T A;  3MKE A;  1HLU P;  1L0E A;  3DAV A;  1KDW A;  4ZJ3 A;  4GHI A;  4JGO A; 
#chains in the Genus database with same CATH homology
 3LGO A;  2HZ5 A;  3T1R A;  1G5U A;  3T1S A;  1CJF A;  2JKF A;  3CHW P;  5FEG A;  4ESP A;  1VEU B;  4FUW A;  1ACF A;  5EVE A;  1K0K A;  3T12 B;  4X1L A;  3UB5 P;  4D60 A;  1SKO A;  3T1X A;  1SZV A;  3LEQ A;  5FDS A;  2ZL1 A;  3U4L P;  3L7H A;  3CPT B;  3KYE A;  1VET A;  3NUL A;  1CQA A;  1PRQ A;  1D1J A;  1VEU A;  5EM1 A;  1Z09 A;  5EM0 A;  5FEF A;  3MS6 A;  5EV0 A;  1A0K A;  1Y4O A;  3D9Y A;  1CF0 A;  1PFL A;  2PBD P;  1J3W A;  2E8J A;  1F2K A;  1AWI A;  3CPT A;  3MSH A;  2BTF P;  1FIK A;  4FTX A;  2PRF A;  2ACG A;  1SKO B;  4X1M A;  2JKG A;  2VK3 A;  3T1Q B;  4X25 A;  4QWO A;  2ZL1 B;  3NEC A;  1FIL A;  2PAV P;  1YPR A;  2V8C A;  2V8F A;  3L9K A;  2B95 A;  1HLU P;  1VET B;  3DAV A;  1PNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...