5CRFA

Structure of the penicillin-binding protein pona1 from mycobacterium tuberculosis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
395
structure length
386
Chain Sequence
KGPNGLIERQVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTADNTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPETVIQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 1A
publication title Crystal structures of the transpeptidase domain of the Mycobacterium tuberculosis penicillin-binding protein PonA1 reveal potential mechanisms of antibiotic resistance.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Penicillin-binding protein
total genus 114
structure length 386
sequence length 395
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5crfA00
2P9VB 1XX2A 1ZG6A 4WEKA 1E25A 2ZC7A 4GDNA 4OPRA 3C7UA 5E2EA 4M3KA 5M19A 3BECA 1SCWA 4UA9A 4KQRA 5HAPA 3HBRA 3N8LA 4U0TA 4RX2A 4NETA 1NY0A 5FAPA 3IHBA 4OVDA 5GLCA 5AQBA 2PU2A 4PMAA 4DXCA 4S2MA 3TG9A 1MWRA 2IWDA 3HVFA 3IHAA 4FH4A 4GN2A 3S4XA 2Y2JA 1IYQA 4UAAA 2Y59A 4MBFA 3W4PA 4QD4A 3WRZA 5DTSA 2XFTA 1W8QA 1GCEA 4JKTA 4GD8A 4OOYA 1BTLA 5M18A 1Z6FA 4IVIA 3HUOA 4C75A 4IBRA 5HARA 2DRWA 3SS3A 5FQJA 1AXBA 3OZHA 2IWBA 4RX3A 3Q07A 4N1XA 1YM1A 5TR7A 1ESIA 2C5WB 1PI5A 3ZNYA 1JWVA 3OC2A 3OPLA 4GOGA 4GDBA 4LV1A 2Y2OA 1U60A 1NZOA 3AGFA 2V20A 2WAEA 1BSGA 3Q7VB 4OP8A 3UDXA 1IYSA 5FATA 2RL3A 1MY8A 4PM9A 1ES4A 3M2JA 4KZAA 4QB8A 3E2KA 5KMWA 1K54A 4Z9QA 4R4RA 1VQQA 3VSKA 2ZM0A 3DW0A 4WYYA 4JXGA 4S2KA 3ZG5A 4DE1A 1IYPA 1ES3A 2EX8A 4R3JA 5AQAA 4ZAMA 5FASA 2WKHA 3S1YA 2Y55A 4IEDA 5EUAA 5CHMA 3ZNTA 1TDLA 3AGDA 3SH8A 3VOZA 4DXBA 3HLBA 2ZQAA 3WS1A 2EXBA 4OPQA 1ONGA 1GA9A 2OSUA 1XA1A 5GHYA 3QHYA 1KGGA 5JYOA 3MFDA 4KG5A 1K38A 2XDMA 5HX9A 4JF6A 1VM1A 3DTMA 4JF5A 4OQGA 5CRFA 1PWCA 3HLEA 1FR6A 3HLFA 3IF6C 4GZBA 4KZBA 2IWCA 2H10A 3VOYA 3IXGA 3N8SA 3WWXA 5A91A 1HTZA 3O3VA 1E3UD 5U47A 4FH2A 1S6RA 1GHIA 3IWOA 4KENB 1ERMA 4XUXA 3PBTA 4DE0A 1CI8A 4E3IA 3S22A 2QPNA 3LO7A 5EOOA 4B4XA 1MWUA 4BL3A 2CC1A 2WGWB 5CTNA 4BJPA 1K56D 1GHPA 1G68A 2XK1A 2HP5A 4X56A 1WYBA 1M6KA 4EQIA 3N8RA 3P98A 2ZQ8A 1K55C 1LLBA 2WZXA 1PW8A 1N9BA 2Q9NA 1K6RA 4KZ6A 5FSRA 1LL9A 4L0LA 2VGKA 4U3TA 1FCMA 5TFQA 1K4EA 4Y7PA 5FAQA 3TSGA 5EVIB 4KQQA 5CGXA 5EOEA 3SOIA 3AGEA 3GMWA 5G18A 1JVJA 2DCFA 3ISGA 2EFUA 2Y4AA 1NYMA 2Y2GA 3UDFA 1KDSA 3VP0A 1JTGA 3NCKA 3QNBA 1E4DA 1ES2A 2XFSA 3IXHA 4PM8A 5GLAA 4ZJ1A 2X02A 4LCLA 3HLCA 1K56A 2ZM2A 3LY3A 1MKIA 4GNUA 4PPRA 2G2WA 5DTTA 3NIAA 5DF9A 5FQ9A 1XPBA 3O88A 3C7VA 4R1GA 4ZTKA 3ZG8B 2WGIA 2G2UA 2Z2MB 2A49A 4KZ8A 5EVLA 3WRTA 4OLGA 1YMSA 3W4OA 3PBQA 3HLGA 3EQUA 1KDWA 4OH0A 1TEMA 4HEFA 1PZPA 2HP9A 3V5MA 3A3DA 4UHUA 3G30A 3ZG9B 1W8YA 3M6HA 4KG6A 5CERA 3NI9A 4UA7A 2Y2IA 5FA7A 3GSGA 3VP3A 1TDGA 1GHMA 5DTKA 3ZVTA 3ZVWA 5JYPA 3CZDA 4CJNA 3MZEA 1ALQA 2Y2HA 4E3KA 3G4PA 3D4FA 4Q8IA 4OONA 4QU3A 2OV5A 4WBGA 4IBXA 3Q7ZA 2ZC4B 3VP2A 5GLDA 3ZHHA 4RA7A 3RJUA 1TVFA 2V2FF 3CJMA 4K0WA 1LI0A 3NC8A 5CGWA 3BLSA 1GA0A 4KZ3A 2H0TA 4D2OA 4B88A 3IH8A 4S2OA 3NDEA 3V50A 1J9MA 1BLHA 4X6TA 4MEZA 5KSHA 4JXWA 2XR0A 4MNRA 3UDIA 4BENA 3SH9A 4EBPA 3UPPA 3LEZA 3IWQA 4WZ4A 1WYCA 2E8IA 1ZG4A 5FI7A 4S2NC 3V3RA 1K57C 2XQZA 1XP4A 1H5XA 2FFYA 2EX9A 1CEGA 1EI5A 1EWZA 1K55A 2GDNA 3A3FA 4ZDXA 2VGJA 2QMIA 1SDEA 5HAIA 3FWLA 4CPKA 1KVLA 4H8RA 3NDGA 4KZ4A 2Y2MA 2ZC3B 3IWIA 4S2LA 4WELA 5FDHA 1PIOA 2HPBA 3HUNA 3NBLA 4LENA 4E3NA 5AQ9A 3BFEA 2V1ZA 1YQSA 3BFDA 4JXVA 3IH9A 1CI9A 5GL9A 4K0XA 2ZMAA 4P85A 1XGJA 3Q82A 3W4QA 2ZQCA 1K4FA 3IF5A 4WEJA 5KSCA 1WE4A 1FSWA 1BZAA 2XH9A 1PWGA 1ESUA 1ONHA 2XD1A 3CG5A 4C6YA 4DE2A 2ZQ9A 2ZM8A 4E3LA 3VSLA 3I7JA 3UNWA 1NRFA 5M1AA 3MKEA 1DJBA 1YLYA 3SS4A 3BRMA 3BFGA 4ZJ2A 1OMEA 4MLLA 3VMAA 3C4OA 5E2HA 4N9KA 5E43A 5F1GA 3FYZA 3W8KA 5CEDA 5EVIC 1IYOA 5F82A 4R0QA 1KGEA 1MPLA 3LY4A 1KE4A 4OOMA 2EX2A 4BL2A 1YLPA 1HVBA 3BM6A 2X01A 3BLMA 4NK3A 1W7FA 5FQIA 1SHVA 1CEFA 1Y54A 4DDSA 4E3OA 4YFMA 4E3JA 3IQAA 5EPHA 3OCNA 4OPZA 3FZCA 2H5SA 2ZQDA 1W5DA 3A3IA 3QNCA 1O07A 5AQ7A 5CGSA 5A90A 1LL5A 1MXOA 4U0XA 5CXWA 2HDQA 1MWSA 4OQ0A 1PI4A 3BYDA 4GB7A 1SDNA 4OP5A 3UE0A 1BUEA 2QZ6A 2Y2QA 3MZDA 1PZOA 4OOLA 4OQHA 2J8YA 2Z2LB 4O7DA 4YINA 3GRJA 1Q2QA 1KE3A 4KZ7A 4P0MA 1PWDA 1E3UA 2WAFA 5CHJA 1BLSA 1O7EA 2DNSA 4XXRA 3JYIA 3MZFA 4FCFA 1L2SA 2ZJ9A 1CK3A 3E2LA 4GD6A 1H8ZA 1ZC2A 5DF7A 4DF6A 4HESA 4FSFA 4S2NA 1ES5A 1K57A 4F94A 4KZ5A 5J8XA 2WK0A 3Q1FA 3UPNA 3HUMA 4N1HA 4OQIA 1L0DA 2ZLYA 4WM9A 4P87A 3PBNA 1MWTA 3NY4A 4BD0A 2C6WB 3BFCA 1KE0A 1ERQA 1FQGA 1HD8A 5GLBA 1L0EA 3FV7A 3N7WA 1NXYA 1H8YA 5EVID 2ZC5B 4A5RA 5F83A 5A92A 2Y2PA 4X55A 4DDYA 2PU4A 1JWZA 3IT9A 3P09A 5L2FA 4QY6A 1RGZA 1QMEA 1N4OA 3A3EA 2WUQA 2WGWA 2HP6A 1BT5A 3G31A 4PM7A 3M6BA 4KZ9A 1FCOA 4IVKA 5D3OA 4E3MA 5FAOA 4N92A 4ZBEA 5IHVA 3IXBA 1NJ4A 3IF6A 4UA6A 4OLDA 1S0WA 1DJAA 4R3BA 3GV9A 5E2FA 5EECA 4EBNA 3VP1A 3WS5A 1YLWA 5CTMA 5FI2A 1FSYA 2X71A 4HBUA 1IEMA 2HDRA 4OKPA 5FQMA 3DWKA 1YLJA 3WS0A 2Y2LA 2Y2KA 3UN7A 5KZHA 1RCJA 2EFXA 5EVIA 1JTDA 2XLNA 3ZCZA 3OPPA 1Q2PA 3G34A 4S2JA 2J7VA 2OLUA 3MXRA 2UWXA 4WZ5C 3VFHA 1DJCA 4JBFA 4X69A 1FOFA 3PAGA 4BD1A 1KGFA 1L0GA 3UY6A 1PYYA 1G6AA 3C4PA 3OPRA 2BLSA 3GTCA 3SH7A 1BULA 1EROA 2JBFA 2P9VA 3TOIA 3BFFA 3Q81A 4EUZA 2XGNA 2R9XA 3GVBA 3FKVA 5EE8A 1W79A 1ZKJA 3PBOA 4N9LA 3HREA 1XXMA 5A93A 4LCMA 1K6SA 4S2IA 3ITAA 1RGYA 3G2ZA 5HW3A 3SS5A 4PM6A 2JC7A 2JE5A 2J9OA 3PAEA 3GQZA 3O86A 5BOHA 3VP4A 3ZDJA 1YT4A 2ZC6B 5CHUA 2OLVA 1IKGA 5HL1A 3A3JA 1XA7A 4RVAA 5DVAA 1HZOA 4EV4A 2WYXA 4PM5A 4EWFA 2B5RA 2Q9MA 3ZFZA 1FCNA 2ZD8A 4QY5A 4MBKA 1NZUA 3BEBA 4E6WA 3VFFA 4MBHA 1NYYA 2XD5A 1L0FA 3PBSA 3M2KA 3ZG0A 3EQVA 4S2PA 4WMCD 2Y2NA 2A3UA 2WKIA 4K91A 4FD8A 4Y0UA 4DE3A 1JWPA 2RCXA 1DY6A 3ITBA 4BLMA 3ZG7B 3LCEA 1BLPA 3MKFA 1YMXA 3HL9A 2I72A 3O87A 2R9WA 2H0YA 4JF4A 5HAQA 1I5QA 5FQQA 3Q7VA 3UO9A 3PBRA 4C3QA 4JPMA 4LV2A 4QHCA 4BQMA 4P6BA 5FI6A 4LV0A 3DWZA 2WKEA 3OCLA 3V39A 2XF3A 1XGIA 3RXXA 2J9PA 3ZGAB 3N6IA 3C5AA 2JCHA 1MBLA 1IKIA 2EXAA 2Y91A 4B4ZA 5TGFA 1IELA 2WADA 4ID4A 4KG2A 3HLWA 3RXWA 3WS2A 4WMCA 4R23A 2HDSA 5I94A 3G32A 5FQKA 1XKZA 1M40A 3WS4A 3PTEA 1K54C 3IF6B 2BG1A 2HDUA 4Y0OA 1YLZA 1RP5A 4WZ5A 4X53A 3V3SA 4DKIA 3GR2A 2FFFB 4LV3A 3UE1A 5GHXA 1LHYA 3CMZA 1FR1A 3UE3A 1C3BA 4JLFA 4HBTA 3N4IA 2EX6A 4RYEA 4JXSA 1I2WA 5E2GA 3UPOA 5F1FA 2WZZA 1QMFA 1LI9A 2ZQ7A 1I2SA 4KQOA 3MBZA 1PW1A 4XUZA 2XEPA 3G35A 1YLTA 2P74A 2WGVA 4X68A 4DRTA 4Y0TA 4EBLA 1SKFA 5CECA 4GKUA 4ZJ3A 5GHZA 3IXDA 4OPYA 1K25A 3HLDA 3OPHA 3MXSA 5HFOA 5CEBA 1KVMA 5DF8A 4E6XA 4QJGA 3B3XA 3G2YA 2PBYA 4R4SA 1BLCA 3FKWA
chains in the Genus database with same CATH superfamily
4WEKA 1E25A 1ODVA 4GDNA 4OPRA 5AVFA 1STZA 1OTBA 4M3KA 3IHBA 1W63M 4DXCA 4LLOB 2VA0A 2IWDA 4GN2A 3S4XA 2Y59A 3W4PA 1EW0A 1GCEA 1F98A 4C75A 4CLCB 4N1XA 5TR7A 2C5WB 3ZNYA 4G3KA 2Y2OA 2V20A 2VZWA 5HSQA 3UDXA 1IYSA 5FATA 4JGOA 3VSKA 2ZM0A 2GJ3A 2Z6CA 5DJTA 3ZG5A 4DE1A 3IX3A 5AQAA 4DN0A 3UE6A 5CHMA 1T1AA 3ZNTA 3VOZA 4GJ4A 2EXBA 1G6OA 1ONGA 3O5YA 4EXOA 2A24B 4KG5A 2XDMA 4JF6A 1VM1A 3DTMA 4JF5A 1PWCA 3HLEA 1FR6A 3HLFA 1VETA 3IF6C 5G4YA 2IWCA 3IXGA 3N8SA 3QP5A 3CHWP 3WWXA 2WKRA 1HTZA 3IX4A 4FH2A 2PYRA 4XUXA 1ERMA 3PBTA 1IFQA 2HV1A 3S22A 3LO7A 2PYPA 2CC1A 2WGWB 3PHYA 2O9BA 2W1TB 2A2LA 1NLYA 2ZQ8A 4G3WA 1K55C 1PW8A 1OTAA 2Q9NA 5FSRA 2VGKA 1K4EA 4ETXA 1XFNA 2W1RA 4KQQA 5CGXA 4HQAA 3AGEA 2EFUA 4HJ6A 5HWTA 2Y2GA 4ZJ1A 2XFSA 3IXHA 2X02A 2CMNA 2XSSA 2L4RA 3HLCA 4BWIA 3LY3A 1J3WA 4LRZE 4PPRA 2G2WA 3EWKA 5FQ9A 1XPBA 2VX8A 4ZTKA 2GX5A 3S7QA 4KZ8A 5EVLA 4OLGA 1YMSA 5AVEA 4OH0A 1TEMA 5HPFA 3G30A 4ZRRA 3ZG9B 1W8YA 4QWOA 3GSGA 3ZVWA 1GHMA 2Y2HA 3D72A 3G4PA 3QP1A 2BTFP 2ZC4B 3VP2A 5GLDA 3RJUA 1TVFA 1LI0A 3LIEA 1GA0A 1V9ZA 4KZ3A 2H0TA 4D2OA 4B88A 4Y5FA 3V50A 4MEZA 5EFWA 2GNXA 4BENA 3T1RA 1WYCA 2E8IA 3VE3A 3V3RA 3BW6A 2L0WA 2EX9A 2NUPC 2W0NA 2QMIA 1SDEA 3GECA 5HAIA 1KVLA 2MJ6A 4IJGA 3JPUA 2VV8A 4WELA 4DJ2A 2HPBA 3HUNA 4LENA 1YQSA 1V9YA 4NXEA 1OJGA 1PWGA 1ESUA 1ONHA 4PKYA 4II7A 4DE2A 2ZQ9A 1DJBA 1YLYA 4HI4A 4ZJ2A 5L10A 3VMAA 3C4OA 5E2HA 2HGVA 2XA7M 5F1GA 3FYZA 5EVIC 1IYOA 2O0YA 4R0QA 4I3JA 3LY4A 4OOMA 1HVBA 2V1AA 1W7FA 5EPHA 3OCNA 2W3EA 2HDQA 4OQ0A 4OP5A 2P7JA 1BUEA 4R38A 2QZ6A 4Q0JA 1PZOA 3GRJA 4KZ7A 4EETB 2JKRI 1BLSA 2VGLM 4Y17A 1IOUA 4QPRA 1CK3A 1ZC2A 4ARZA 3K2NA 1OTIA 2QYBA 2PT7A 3UPNA 3HUMA 4MN6A 1L0DA 2ZLYA 1OTEA 1GSVA 3S7PA 1MWTA 2AVXA 2C6WB 3DBAA 1FQGA 5GLBA 4HHDA 2E8JA 4MMNA 5EVID 2ZC5B 3C2WA 2PHYA 3LIFA 4H6JA 1TD5A 2HP6A 4WF0A 3T50A 5FAOA 4GCZA 4N92A 4R3BA 1DJAA 4EBNA 4YOFA 1FSYA 3PYPA 1YLJA 2Q0OA 2QJ7A 2Y2KA 2EFXA 1JTDA 2XLNA 3G34A 1VETB 4S2JA 2J7VA 5I5LA 3H82B 2BLSA 1BULA 2KLIA 3Q81A 3GVBA 2M7UA 2G7UA 4S2IA 4YWZA 3PAEA 3T4JA 3DTIA 4Q0IA 1IKGA 3A3JA 4RVAA 5DVAA 1HZOA 2WYXA 3K3CA 3LIDA 2ZD8A 4CLCA 1NZUA 4E6WA 1NYYA 3ZG0A 2INWA 5HD5A 4BLMA 3CI6A 3RH8B 2I72A 5HAQA 5FQQA 4JPMA 3BQ8A 4Y13A 3DWZA 2HJ9C 1XGIA 2QHKA 4B93A 4B4ZA 1XFQA 4KG2A 4ID4A 4WMCA 3F1NB 2HDSA 1XKZA 2HDUA 2UV0E 3GR2A 2A24A 2JKFA 5E2GA 2K31A 5F1FA 2WZZA 1QMFA 2ZQ7A 3MBZA 4XUZA 1OT9A 2V0WA 3FC7A 5CECA 3U4LP 5GHZA 3IXDA 1K25A 3HLDA 5DF8A 4R4SA 4EUVA 1Y28A 2P9VB 1XX2A 1ZG6A 2W1TA 5HDDA 5M19A 5HAPA 3KYQA 3N8LA 4NETA 4HJ4A 4OVDA 2ZMVA 3TW8A 4GHIB 1XJ3A 2NUTC 3C8CA 2Y2JA 4UAAA 4MBFA 2XFTA 1W8QA 4GD8A 5EM1A 5M18A 1Z6FA 1GSWA 5HARA 2DRWA 5FQJA 4RX3A 2EWWA 2H28A 5FL3A 1YM1A 1ESIA 1PI5A 4EQ1A 3OC2A 3OPLA 4GDBA 1U60A 3UMEA 1S1YA 3MF0A 2WAEA 3T4KA 2L1MA 1T18A 4OP8A 3E2KA 1K54A 3DW0A 4WYYA 3KX0X 1IYPA 2EX8A 4R3JA 4ZAMA 5FASA 1L3LA 1T1CA 3WS1A 1BYWA 4ME4A 1GA9A 2OSUA 3QHYA 1K38A 1YPRA 4OQGA 5CRFA 2XROA 3ICYA 2I9VA 4GZBA 4KZBA 3D9YA 1E3UD 5U47A 1GHIA 3IWOA 4DE0A 2JKGA 3A0VA 3KSFA 4H6JB 5HZHA 3R4KA 2XRNA 1G68A 3LICA 1D7EA 4GLQA 1M6KA 4CQHA 3N8RA 5DKLA 1LLBA 1N9BA 2V0UA 1W63Q 1LL9A 4L0LA 1F5MA 1FCMA 4Y7PA 5MC7A 3D3OA 3SOIA 1JVJA 4O0PA 3LR3A 1NYMA 3NOTC 5TJJA 1E4DA 3NECA 1ACFA 3S7NA 1UWPX 5DF9A 3C7VA 4R1GA 3ZG8B 2WGIA 4YNRA 3W4OA 3MFXA 3PBQA 3HLGA 3EQUA 3UB5P 1PZPA 3B47A 3A0SA 3HJIA 2Y2IA 5FA7A 5JYPA 3CUEC 4E3KA 2VV7A 3D4FA 4OONA 2VEAA 4BBVA 2V2FF 3CJMA 2W3FA 3FPVA 3NC8A 3BLSA 1VB6A 4S2OA 4I5SA 3LUQA 4X6TA 5EVEA 4MNRA 3A0RA 3DTKA 3LEZA 1ZG4A 5FI7A 5IT5A 5AJGA 1H5XA 4WUJA 3EEHA 1EWZA 1K55A 2GDNA 1UGUA 2ZOIA 1P9RA 4H8RA 4ESPA 3IWIA 4S2LA 4E3NA 3IBRA 4KUOA 2V9AA 5F6AA 3BFDA 3IH9A 5GL9A 5KSCA 5C5KA 1K4FA 3IF5A 4WEJA 1FSWA 1BZAA 3I7JA 3UNWA 1NRFA 5HWWA 2ZBBA 3OOVA 3H9WA 4MN5A 4N9KA 3H82A 5E43A 3TRCA 1KGEA 3F1PB 1YLPA 4NK3A 4LPZA 4I3AA 4E3OA 4E3JA 5AQ7A 2JKTM 1W5DA 4O8GA 1O07A 1MXOA 4U0XA 5CXWA 1MWSA 1T1BA 3MQ0A 3F1OA 4OQHA 2Z2LB 3C38A 3IBJA 3KYEA 4X25A 1SKOB 1YAXA 3EGXC 3MZFA 5EV0A 4GD6A 1H8ZA 5DF7A 3LI8A 4Y2FA 4HESA 1LT0A 4F94A 5J8XA 3Q1FA 2O99A 5TBMA 5EM0A 3PBNA 3NY4A 1ERQA 2KX6A 3SZTA 1H8MA 4A5RA 5F83A 2Y2PA 4HY8A 5L2FA 1QMEA 1N4OA 3A3EA 4PM7A 3F1NA 3M6BA 4KZ9A 1FCOA 5D3OA 4ZBEA 1NJ4A 1S0WA 3GV9A 1S67L 3VP1A 3WS5A 5FI2A 1DRMA 1DP6A 1IEMA 5FQMA 3MQQA 3WS0A 2Y2LA 3RFBA 1RCJA 5EVIA 3KSIA 3E4PA 4AFIA 2OLUA 3MXRA 4WZ5C 3VFHA 4Y15A 3E98A 4JBFA 4X69A 3PAGA 1OPXA 2VKSA 3UY6A 3LFVA 3GTCA 2JBFA 4XT2B 3OLOA 2P9VA 4BBTA 5A8BA 5G4ZA 2XGNA 4RQ9A 3FKVA 4PAUA 5EE8A 1W79A 2Y79A 3PBOA 3HREA 1D06A 3ITAA 3UB9A 3NULA 4PKYG 1H3QA 2JC7A 2J9OA 3GQZA 3O86A 5HWVA 4GHIA 2ZC6B 3PR6A 4PM5A 4QY5A 1YKDA 1MC0A 3BEBA 2O9CA 3PBSA 2XD5A 5HDSA 4NXFA 3U2AA 2P04A 3EGDC 3BY9A 3QP8A 5J4EA 3TJZC 3LCEA 1BLPA 1YMXA 3O87A 3T4TA 3UO9A 4WLAA 4LV2A 5FI6A 4LV0A 4IUHA 2WKEA 2XF3A 4X1MA 3N6IA 3C5AA 2JCHA 1MBLA 3FPWA 4Z1WA 1IELA 2WADA 3RXWA 4MDZA 5I94A 3G32A 3IF6B 4X1LA 4DKIA 3EOIA 3UE1A 1TF1A 5GHXA 1C3BA 3H7WA 4HBTA 3N4IA 4UQIM 1D1JA 1I2WA 3UMDA 2FZ0A 3G35A 4P6ZM 2P74A 1SKFA 2W27A 3P01A 4L9EA 4OPYA 5HFOA 3OPHA 5CEBA 3B3XA 1MZUA 3FKWA 2ZC7A 5E2EA 1SCWA 4UA9A 4U0TA 4RX2A 5AQBA 2PU2A 4PMAA 4R70A 3UB7A 3IHAA 1IYQA 1LL8A 4QD4A 3WRZA 5DTSA 4OOYA 1BTLA 4IBRA 1G5UA 4G3VA 2IWBA 2IA2A 4HH2A 3LR0A 4GOGA 2FH5A 5K5BA 1XJ4A 2PAVP 3CWFA 1MY8A 1ES4A 3M2JA 4Z9QA 4R4RA 3F1OB 4S2KA 2KOIA 2ZMFA 5EUAA 4IEDA 1TDLA 3AGDA 4DXBA 2PRFA 3HLBA 1DP9A 4OPQA 3QP4A 4HP9A 5JYOA 5TBMB 1TS8A 3K3DA 2M1CA 3B33A 3VOYA 1CF0A 5A91A 3GDIA 4KENB 2V8CA 4GS9A 4E3IA 1CI8A 1MKMA 5EOOA 2BASA 1UWNX 4BL3A 3KSGA 1S1ZA 5CTNA 3ULFA 1K56D 4BJPA 2XK1A 4X56A 1WYBA 4EQIA 2V1BA 3P98A 2WKPA 2J80A 1K6RA 4KZ6A 1OJ5A 4U3TA 2B18A 5TFQA 3W2ZA 4HH3A 5EVIB 5EOEA 5G18A 2DCFA 3ISGA 4NXGA 3LGOA 3VP0A 3QNBA 4PM8A 1ES2A 1ZHHB 3KO6A 2VK3A 1VEUA 2ZM2A 3F1PA 5DTTA 3NIAA 1PNEA 4D60A 2A49A 4MN7A 1KDWA 2HP9A 3V5MA 4UHUA 3IX8A 4UA7A 5CERA 3T1XA 1TDGA 5DTKA 3CZDA 3MZEA 2PR5A 1TS7A 1SKOA 1P0ZA 3MSHA 4QU3A 2OV5A 4WBGA 4F3LA 3Q7ZA 4RA7A 4K0WA 1CJFA 3IH8A 3NDEA 1J9MA 2PD8A 5KSHA 4JXWA 2XR0A 3UDIA 3UPPA 4WZ4A 4EEUA 4EERA 1KOUA 5LBRA 4S2NC 1K57C 2XQZA 1XP4A 2FFYA 1LSVA 4CLCD 3A3FA 4ZDXA 2VGJA 3L7HA 4CPKA 3IS2B 3NDGA 4KZ4A 3VOLA 5F68A 2V1ZA 5J3WA 3H7WB 4K0XA 3DAVA 1FILA 1XGJA 3Q82A 2ZQCA 3MR0A 4DJ3A 1YSPA 2JKRM 2D02A 3CG5A 4C6YA 4E3LA 4R6LA 3VSLA 4EW7A 5M1AA 3MKEA 3BRMA 3BFGA 1OMEA 3HCYA 3W8KA 4HIAA 5CEDA 4XT2A 1MPLA 1KE4A 2EX2A 5L07A 4BL2A 2X01A 1XJ6A 3BLMA 2HJEA 1OT6A 3HJKA 2XA7S 3CUEA 4NXBA 2H5SA 2ZQDA 3QNCA 3A3IA 5CGSA 1LL5A 3LIBA 2KDKA 4OOLA 4YINA 1KE3A 1PWDA 1O7EA 3JYIA 2ZJ9A 4DF6A 2VGLS 4FSFA 1ES5A 4KZ5A 2VLGA 2WK0A 4N1HA 4OQIA 4WM9A 4BD0A 3BFCA 1KE0A 1HD8A 1L0EA 1H8YA 1N9LA 3E4OA 4BBUA 3B42A 4X55A 1JWZA 3IT9A 3P09A 4QY6A 1P9WA 1BT5A 3G31A 2ZOHA 4E3MA 1P97A 5IHVA 3IF6A 4UA6A 2YKHA 5EECA 3BY8A 2P08A 1YLWA 3PXPA 4EEPA 4HBUA 4OKPA 1Z09A 2HDRA 3DWKA 2QJ5A 3UN7A 1Q2PA 5CX7A 3T1QB 2UWXA 3MMHA 4JGPA 4Y3IA 1FOFA 4BD1A 1L0GA 5DJUA 1PYYA 1NWZA 4GS9B 1EROA 4EUZA 3QP2A 4EU0A 3C30A 4FTXA 5A93A 1K6SA 2JN7A 4KQDA 3SS5A 2JE5A 5BOHA 4I39A 3VP4A 1XA7A 1CQAA 4EWFA 2B5RA 2Q9MA 1FCNA 3G6OA 5F5YA 2D01A 3T4OA 4MBHA 3VFFA 1NRJA 3M2KA 4S2PA 1VEUB 2B02A 2LB5A 2WKIA 2Y2NA 3ITBA 2R9WA 4JF4A 3NOUC 4C3QA 3PBRA 4QHCA 4BQMA 4P6BA 3VV4A 1PFLA 3OBFA 2WKQA 3OCLA 3V39A 3T4QA 3ZGAB 3T1SA 1IKIA 2Y91A 3KYZA 2HF6A 3HLWA 4HP4A 4F3LB 4Y0OA 1YLZA 1RP5A 4WZ5A 4X53A 2FFFB 1LHYA 5HL6A 3UE3A 4JLFA 4L9GA 2VV6A 2M7VA 3UPOA 3LR5A 1PW1A 2XEPA 1YLTA 2WGVA 4DRTA 4Y0TA 4GKUA 4ZJ3A 2EA9A 1S4SA 4E6XA 3G2YA 4FUWA 3P7NA 1VHMA 3UB8A 3UB6A 3NHQA 3C7UA 2Z6DA 3BECA 5HPIA 4KQRA 3HBRA 1NY0A 5FAPA 5GLCA 4S2MA 3TG9A 1MWRA 4FOFA 2OAP1 3HVFA 4FH4A 4JKTA 5L8MA 3T4LA 4IVIA 3CITA 3HUOA 1ZTUA 3SS3A 1AXBA 3OZHA 3Q07A 3R7WA 1JWVA 3BJNA 4LV1A 1NZOA 3AGFA 2ZL1B 1S4RA 1BSGA 3Q7VB 4UEYA 3RTYA 3FG8A 4I38A 4Q0HA 5IU1A 2OWJA 2RL3A 4PM9A 4KZAA 4QB8A 5KMWA 1K0KA 2JHEA 2J3TC 5L09A 1VQQA 3S7OA 4GW9A 4JXGA 1JNUA 1ES3A 2WKHA 3S1YA 4K08A 2Y55A 3SH8A 2ZQAA 5FEGA 1XA1A 1Y4OA 1X0OA 5GHYA 2R78A 1H0MA 1KGGA 3MFDA 5HX9A 3T12B 4WN5A 1SZVA 3LEQA 4LGWA 3CAXA 2H10A 3MXQA 5FEFA 3O3VA 1S6RA 3ZYTA 4I3IA 2QPNA 4B4XA 1MWUA 4LRXC 3IS2A 2LB9A 1WA9A 1GHPA 2HP5A 2J3TD 1TS6A 1YSQA 2OAQ1 2PD7A 2WZXA 5IS1A 3NOPC 4KUKA 3V67A 5FAQA 3TSGA 3T4SA 5FDSA 3GMWA 2Y4AA 3E4QA 3UDFA 1KDSA 1JTGA 1AWIA 3NCKA 4NG2A 1F9IA 5GLAA 3ZQ5A 4LCLA 1K56A 5J7EA 2W3HA 1MKIA 4GNUA 2K2NA 5KIZA 1T19A 4NKPA 2PDRA 3QP6A 3O88A 4BMWA 2G2UA 2Z2MB 3CPTA 3WRTA 2J3WA 4HOIA 3JVVA 1GSXA 4HEFA 3A3DA 3M6HA 4KG6A 3NI9A 3VP3A 3ZVTA 4CJNA 1ALQA 4Q8IA 4WL9A 4IBXA 2OWHA 3ZHHA 4JGQA 4O01A 4CLCE 5CGWA 2VJWA 1BLHA 4HJ3A 3SW1A 4MCWA 1LSWA 4HNBA 3SH9A 4EBPA 3IWQA 3LYXA 1CEGA 1EI5A 3FWLA 3TE8A 2YKFA 2Y2MA 2ZC3B 5FDHA 1PIOA 3NBLA 2PBDP 5AQ9A 3BFEA 1LSXA 4JXVA 1CI9A 2ZMAA 4ETZA 4P85A 4L9FA 3W4QA 1PRQA 1WE4A 2XH9A 2XD1A 2V8FA 2ZM8A 1S66L 3SS4A 3L9KA 4MLLA 2Y8HA 2HZ5A 3KSHA 5F82A 3BM6A 5FQIA 1SHVA 1CEFA 1Y54A 4DDSA 4YFMA 3IQAA 4OPZA 3FZCA 5A90A 1PI4A 3BYDA 4GB7A 1SDNA 3UE0A 2K7SA 2Y2QA 3MZDA 2J8YA 4O7DA 1Q2QA 3LI9A 4P0MA 2WAFA 1E3UA 1F2KA 1TS0A 4IHQA 1A0KA 3MQOA 5CHJA 2DNSA 4XXRA 4FCFA 1L2SA 3E2LA 3CLOA 3DTEA 1N9NA 3R7WB 4S2NA 1K57A 4CLCC 4P87A 2DMWA 3FV7A 3N7WA 4M4XA 1NXYA 4LFUA 2OOLA 2JKTI 5A92A 4DDYA 2PU4A 1RGZA 2WUQA 2WGWA 4IVKA 1N9OA 1FIKA 2GZAA 3IXBA 4OLDA 5E2FA 5CTMA 2X71A 4EESA 3BQAA 5KZHA 3ZCZA 3LIAA 3OPPA 1DJCA 4DMZA 5DFYA 3E0YA 1KGFA 1NLZA 3C4PA 1G6AA 3OPRA 3SH7A 3TOIA 3BFFA 2R9XA 1ZKJA 4N9LA 1XXMA 4LCMA 2B95A 1RGYA 3G2ZA 5F69A 5HW3A 4PM6A 4E04A 1OTDA 3ZDJA 1YT4A 2PR6A 3LR4A 5CHUA 2OLVA 5HL1A 3VE4A 4R3AA 4EV4A 4PHTA 3ZFZA 2EWVA 4MBKA 2W3GA 1HLUP 1L0FA 4IUKA 3EQVA 4WMCD 4Y0UA 4K91A 2A3UA 4FD8A 4ARZB 1JWPA 2RCXA 3BWLA 1DY6A 3ZG7B 3MKFA 2O9AA 3HL9A 2H0YA 4B9OA 2ZL1A 1I5QA 3Q7VA 3CPTB 2W3DA 3EEAA 3RXXA 2J9PA 1DP8A 2EXAA 5TGFA 5DFXA 3WS2A 4R23A 5HDCA 5FQKA 5DKKA 1M40A 2ACGA 3WS4A 3PTEA 1K54C 3JVUA 2BG1A 4JGRA 3V3SA 3MS6A 4LV3A 3CMZA 1FR1A 4LRYC 2EX6A 4RYEA 4JXSA 2QKPA 1XJ2A 1LI9A 3NJAA 1I2SA 4KQOA 1G28A 4UQIS 4X68A 4EBLA 2QWSA 3MJQA 3MXSA 1KVMA 4QJGA 2PBYA 4DE3A 4NEED 1BLCA 5HD3A 4P6ZS
chains in the Genus database with same CATH topology
2P9VB 1XX2A 1ZG6A 4WEKA 1E25A 2ZC7A 4GDNA 4OPRA 3C7UA 5E2EA 4M3KA 5M19A 3BECA 1SCWA 4UA9A 4KQRA 5HAPA 3HBRA 3N8LA 4U0TA 4RX2A 4NETA 1NY0A 5FAPA 3IHBA 4OVDA 5GLCA 5AQBA 2PU2A 4PMAA 4DXCA 4S2MA 3TG9A 1MWRA 2IWDA 3HVFA 3IHAA 4FH4A 4GN2A 3S4XA 2Y2JA 1IYQA 4UAAA 2Y59A 4MBFA 3W4PA 4QD4A 3WRZA 5DTSA 2XFTA 1W8QA 1GCEA 4JKTA 4GD8A 4OOYA 1BTLA 5M18A 1Z6FA 4IVIA 3HUOA 4C75A 4IBRA 5HARA 2DRWA 3SS3A 5FQJA 1AXBA 3OZHA 2IWBA 4RX3A 3Q07A 4N1XA 1YM1A 5TR7A 1ESIA 2C5WB 1PI5A 3ZNYA 1JWVA 3OC2A 3OPLA 4GOGA 4GDBA 4LV1A 2Y2OA 1U60A 1NZOA 3AGFA 2V20A 2WAEA 1BSGA 3Q7VB 4OP8A 3UDXA 1IYSA 5FATA 2RL3A 1MY8A 4PM9A 1ES4A 3M2JA 4KZAA 4QB8A 3E2KA 5KMWA 1K54A 4Z9QA 4R4RA 1VQQA 3VSKA 2ZM0A 3DW0A 4WYYA 4JXGA 4S2KA 3ZG5A 4DE1A 1IYPA 1ES3A 2EX8A 4R3JA 5AQAA 4ZAMA 5FASA 2WKHA 3S1YA 2Y55A 4IEDA 5EUAA 5CHMA 3ZNTA 1TDLA 3AGDA 3SH8A 3VOZA 4DXBA 3HLBA 2ZQAA 3WS1A 2EXBA 4OPQA 1ONGA 1GA9A 2OSUA 1XA1A 5GHYA 3QHYA 1KGGA 5JYOA 3MFDA 4KG5A 1K38A 2XDMA 5HX9A 4JF6A 1VM1A 3DTMA 4JF5A 4OQGA 5CRFA 1PWCA 3HLEA 1FR6A 3HLFA 3IF6C 4GZBA 4KZBA 2IWCA 2H10A 3VOYA 3IXGA 3N8SA 3WWXA 5A91A 1HTZA 3O3VA 1E3UD 5U47A 4FH2A 1S6RA 1GHIA 3IWOA 4KENB 1ERMA 4XUXA 3PBTA 4DE0A 1CI8A 4E3IA 3S22A 2QPNA 3LO7A 5EOOA 4B4XA 1MWUA 4BL3A 2CC1A 2WGWB 5CTNA 4BJPA 1K56D 1GHPA 1G68A 2XK1A 2HP5A 4X56A 1WYBA 1M6KA 4EQIA 3N8RA 3P98A 2ZQ8A 1K55C 1LLBA 2WZXA 1PW8A 1N9BA 2Q9NA 1K6RA 4KZ6A 5FSRA 1LL9A 4L0LA 2VGKA 4U3TA 1FCMA 5TFQA 1K4EA 4Y7PA 5FAQA 3TSGA 5EVIB 4KQQA 5CGXA 5EOEA 3SOIA 3AGEA 3GMWA 5G18A 1JVJA 2DCFA 3ISGA 2EFUA 2Y4AA 1NYMA 2Y2GA 3UDFA 1KDSA 3VP0A 1JTGA 3NCKA 3QNBA 1E4DA 1ES2A 2XFSA 3IXHA 4PM8A 5GLAA 4ZJ1A 2X02A 4LCLA 3HLCA 1K56A 2ZM2A 3LY3A 1MKIA 4GNUA 4PPRA 2G2WA 5DTTA 3NIAA 5DF9A 5FQ9A 1XPBA 3O88A 3C7VA 4R1GA 4ZTKA 3ZG8B 2WGIA 2G2UA 2Z2MB 2A49A 4KZ8A 5EVLA 3WRTA 4OLGA 1YMSA 3W4OA 3PBQA 3HLGA 3EQUA 1KDWA 4OH0A 1TEMA 4HEFA 1PZPA 2HP9A 3V5MA 3A3DA 4UHUA 3G30A 3ZG9B 1W8YA 3M6HA 4KG6A 5CERA 3NI9A 4UA7A 2Y2IA 5FA7A 3GSGA 3VP3A 1TDGA 1GHMA 5DTKA 3ZVTA 3ZVWA 5JYPA 3CZDA 4CJNA 3MZEA 1ALQA 2Y2HA 4E3KA 3G4PA 3D4FA 4Q8IA 4OONA 4QU3A 2OV5A 4WBGA 4IBXA 3Q7ZA 2ZC4B 3VP2A 5GLDA 3ZHHA 4RA7A 3RJUA 1TVFA 2V2FF 3CJMA 4K0WA 1LI0A 3NC8A 5CGWA 3BLSA 1GA0A 4KZ3A 2H0TA 4D2OA 4B88A 3IH8A 4S2OA 3NDEA 3V50A 1J9MA 1BLHA 4X6TA 4MEZA 5KSHA 4JXWA 2XR0A 4MNRA 3UDIA 4BENA 3SH9A 4EBPA 3UPPA 3LEZA 3IWQA 4WZ4A 1WYCA 2E8IA 1ZG4A 5FI7A 4S2NC 3V3RA 1K57C 2XQZA 1XP4A 1H5XA 2FFYA 2EX9A 1CEGA 1EI5A 1EWZA 1K55A 2GDNA 3A3FA 4ZDXA 2VGJA 2QMIA 1SDEA 5HAIA 3FWLA 4CPKA 1KVLA 4H8RA 3NDGA 4KZ4A 2Y2MA 2ZC3B 3IWIA 4S2LA 4WELA 5FDHA 1PIOA 2HPBA 3HUNA 3NBLA 4LENA 4E3NA 5AQ9A 3BFEA 2V1ZA 1YQSA 3BFDA 4JXVA 3IH9A 1CI9A 5GL9A 4K0XA 2ZMAA 4P85A 1XGJA 3Q82A 3W4QA 2ZQCA 1K4FA 3IF5A 4WEJA 5KSCA 1WE4A 1FSWA 1BZAA 2XH9A 1PWGA 1ESUA 1ONHA 2XD1A 3CG5A 4C6YA 4DE2A 2ZQ9A 2ZM8A 4E3LA 3VSLA 3I7JA 3UNWA 1NRFA 5M1AA 3MKEA 1DJBA 1YLYA 3SS4A 3BRMA 3BFGA 4ZJ2A 1OMEA 4MLLA 3VMAA 3C4OA 5E2HA 4N9KA 5E43A 5F1GA 3FYZA 3W8KA 5CEDA 5EVIC 1IYOA 5F82A 4R0QA 1KGEA 1MPLA 3LY4A 1KE4A 4OOMA 2EX2A 4BL2A 1YLPA 1HVBA 3BM6A 2X01A 3BLMA 4NK3A 1W7FA 5FQIA 1SHVA 1CEFA 1Y54A 4DDSA 4E3OA 4YFMA 4E3JA 3IQAA 5EPHA 3OCNA 4OPZA 3FZCA 2H5SA 2ZQDA 1W5DA 3A3IA 3QNCA 1O07A 5AQ7A 5CGSA 5A90A 1LL5A 1MXOA 4U0XA 5CXWA 2HDQA 1MWSA 4OQ0A 1PI4A 3BYDA 4GB7A 1SDNA 4OP5A 3UE0A 1BUEA 2QZ6A 2Y2QA 3MZDA 1PZOA 4OOLA 4OQHA 2J8YA 2Z2LB 4O7DA 4YINA 3GRJA 1Q2QA 1KE3A 4KZ7A 4P0MA 1PWDA 1E3UA 2WAFA 5CHJA 1BLSA 1O7EA 2DNSA 4XXRA 3JYIA 3MZFA 4FCFA 1L2SA 2ZJ9A 1CK3A 3E2LA 4GD6A 1H8ZA 1ZC2A 5DF7A 4DF6A 4HESA 4FSFA 4S2NA 1ES5A 1K57A 4F94A 4KZ5A 5J8XA 2WK0A 3Q1FA 3UPNA 3HUMA 4N1HA 4OQIA 1L0DA 2ZLYA 4WM9A 4P87A 3PBNA 1MWTA 3NY4A 4BD0A 2C6WB 3BFCA 1KE0A 1ERQA 1FQGA 1HD8A 5GLBA 1L0EA 3FV7A 3N7WA 1NXYA 1H8YA 5EVID 2ZC5B 4A5RA 5F83A 5A92A 2Y2PA 4X55A 4DDYA 2PU4A 1JWZA 3IT9A 3P09A 5L2FA 4QY6A 1RGZA 1QMEA 1N4OA 3A3EA 2WUQA 2WGWA 2HP6A 1BT5A 3G31A 4PM7A 3M6BA 4KZ9A 1FCOA 4IVKA 5D3OA 4E3MA 5FAOA 4N92A 4ZBEA 5IHVA 3IXBA 1NJ4A 3IF6A 4UA6A 4OLDA 1S0WA 1DJAA 4R3BA 3GV9A 5E2FA 5EECA 4EBNA 3VP1A 3WS5A 1YLWA 5CTMA 5FI2A 1FSYA 2X71A 4HBUA 1IEMA 2HDRA 4OKPA 5FQMA 3DWKA 1YLJA 3WS0A 2Y2LA 2Y2KA 3UN7A 5KZHA 1RCJA 2EFXA 5EVIA 1JTDA 2XLNA 3ZCZA 3OPPA 1Q2PA 3G34A 4S2JA 2J7VA 2OLUA 3MXRA 2UWXA 4WZ5C 3VFHA 1DJCA 4JBFA 4X69A 1FOFA 3PAGA 4BD1A 1KGFA 1L0GA 3UY6A 1PYYA 1G6AA 3C4PA 3OPRA 2BLSA 3GTCA 3SH7A 1BULA 1EROA 2JBFA 2P9VA 3TOIA 3BFFA 3Q81A 4EUZA 2XGNA 2R9XA 3GVBA 3FKVA 5EE8A 1W79A 1ZKJA 3PBOA 4N9LA 3HREA 1XXMA 5A93A 4LCMA 1K6SA 4S2IA 3ITAA 1RGYA 3G2ZA 5HW3A 3SS5A 4PM6A 2JC7A 2JE5A 2J9OA 3PAEA 3GQZA 3O86A 5BOHA 3VP4A 3ZDJA 1YT4A 2ZC6B 5CHUA 2OLVA 1IKGA 5HL1A 3A3JA 1XA7A 4RVAA 5DVAA 1HZOA 4EV4A 2WYXA 4PM5A 4EWFA 2B5RA 2Q9MA 3ZFZA 1FCNA 2ZD8A 4QY5A 4MBKA 1NZUA 3BEBA 4E6WA 3VFFA 4MBHA 1NYYA 2XD5A 1L0FA 3PBSA 3M2KA 3ZG0A 3EQVA 4S2PA 4WMCD 2Y2NA 2A3UA 2WKIA 4K91A 4FD8A 4Y0UA 4DE3A 1JWPA 2RCXA 1DY6A 3ITBA 4BLMA 3ZG7B 3LCEA 1BLPA 3MKFA 1YMXA 3HL9A 2I72A 3O87A 2R9WA 2H0YA 4JF4A 5HAQA 1I5QA 5FQQA 3Q7VA 3UO9A 3PBRA 4C3QA 4JPMA 4LV2A 4QHCA 4BQMA 4P6BA 5FI6A 4LV0A 3DWZA 2WKEA 3OCLA 3V39A 2XF3A 1XGIA 3RXXA 2J9PA 3ZGAB 3N6IA 3C5AA 2JCHA 1MBLA 1IKIA 2EXAA 2Y91A 4B4ZA 5TGFA 1IELA 2WADA 4ID4A 4KG2A 3HLWA 3RXWA 3WS2A 4WMCA 4R23A 2HDSA 5I94A 3G32A 5FQKA 1XKZA 1M40A 3WS4A 3PTEA 1K54C 3IF6B 2BG1A 2HDUA 4Y0OA 1YLZA 1RP5A 4WZ5A 4X53A 3V3SA 4DKIA 3GR2A 2FFFB 4LV3A 3UE1A 5GHXA 1LHYA 3CMZA 1FR1A 3UE3A 1C3BA 4JLFA 4HBTA 3N4IA 2EX6A 4RYEA 4JXSA 1I2WA 5E2GA 3UPOA 5F1FA 2WZZA 1QMFA 1LI9A 2ZQ7A 1I2SA 4KQOA 3MBZA 1PW1A 4XUZA 2XEPA 3G35A 1YLTA 2P74A 2WGVA 4X68A 4DRTA 4Y0TA 4EBLA 1SKFA 5CECA 4GKUA 4ZJ3A 5GHZA 3IXDA 4OPYA 1K25A 3HLDA 3OPHA 3MXSA 5HFOA 5CEBA 1KVMA 5DF8A 4E6XA 4QJGA 3B3XA 3G2YA 2PBYA 4R4SA 1BLCA 3FKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9V B;  1XX2 A;  1ZG6 A;  4WEK A;  1E25 A;  2ZC7 A;  4GDN A;  4OPR A;  3C7U A;  5E2E A;  4M3K A;  5M19 A;  3BEC A;  1SCW A;  4UA9 A;  4KQR A;  5HAP A;  3HBR A;  3N8L A;  4U0T A;  4RX2 A;  4NET A;  1NY0 A;  5FAP A;  3IHB A;  4OVD A;  5GLC A;  5AQB A;  2PU2 A;  4PMA A;  4DXC A;  4S2M A;  3TG9 A;  1MWR A;  2IWD A;  3HVF A;  3IHA A;  4FH4 A;  4GN2 A;  3S4X A;  2Y2J A;  1IYQ A;  4UAA A;  2Y59 A;  4MBF A;  3W4P A;  4QD4 A;  3WRZ A;  5DTS A;  2XFT A;  1W8Q A;  1GCE A;  4JKT A;  4GD8 A;  4OOY A;  1BTL A;  5M18 A;  1Z6F A;  4IVI A;  3HUO A;  4C75 A;  4IBR A;  5HAR A;  2DRW A;  3SS3 A;  5FQJ A;  1AXB A;  3OZH A;  2IWB A;  4RX3 A;  3Q07 A;  4N1X A;  1YM1 A;  5TR7 A;  1ESI A;  2C5W B;  1PI5 A;  3ZNY A;  1JWV A;  3OC2 A;  3OPL A;  4GOG A;  4GDB A;  4LV1 A;  2Y2O A;  1U60 A;  1NZO A;  3AGF A;  2V20 A;  2WAE A;  1BSG A;  3Q7V B;  4OP8 A;  3UDX A;  1IYS A;  5FAT A;  2RL3 A;  1MY8 A;  4PM9 A;  1ES4 A;  3M2J A;  4KZA A;  4QB8 A;  3E2K A;  5KMW A;  1K54 A;  4Z9Q A;  4R4R A;  1VQQ A;  3VSK A;  2ZM0 A;  3DW0 A;  4WYY A;  4JXG A;  4S2K A;  3ZG5 A;  4DE1 A;  1IYP A;  1ES3 A;  2EX8 A;  4R3J A;  5AQA A;  4ZAM A;  5FAS A;  2WKH A;  3S1Y A;  2Y55 A;  4IED A;  5EUA A;  5CHM A;  3ZNT A;  1TDL A;  3AGD A;  3SH8 A;  3VOZ A;  4DXB A;  3HLB A;  2ZQA A;  3WS1 A;  2EXB A;  4OPQ A;  1ONG A;  1GA9 A;  2OSU A;  1XA1 A;  5GHY A;  3QHY A;  1KGG A;  5JYO A;  3MFD A;  4KG5 A;  1K38 A;  2XDM A;  5HX9 A;  4JF6 A;  1VM1 A;  3DTM A;  4JF5 A;  4OQG A;  5CRF A;  1PWC A;  3HLE A;  1FR6 A;  3HLF A;  3IF6 C;  4GZB A;  4KZB A;  2IWC A;  2H10 A;  3VOY A;  3IXG A;  3N8S A;  3WWX A;  5A91 A;  1HTZ A;  3O3V A;  1E3U D;  5U47 A;  4FH2 A;  1S6R A;  1GHI A;  3IWO A;  4KEN B;  1ERM A;  4XUX A;  3PBT A;  4DE0 A;  1CI8 A;  4E3I A;  3S22 A;  2QPN A;  3LO7 A;  5EOO A;  4B4X A;  1MWU A;  4BL3 A;  2CC1 A;  2WGW B;  5CTN A;  4BJP A;  1K56 D;  1GHP A;  1G68 A;  2XK1 A;  2HP5 A;  4X56 A;  1WYB A;  1M6K A;  4EQI A;  3N8R A;  3P98 A;  2ZQ8 A;  1K55 C;  1LLB A;  2WZX A;  1PW8 A;  1N9B A;  2Q9N A;  1K6R A;  4KZ6 A;  5FSR A;  1LL9 A;  4L0L A;  2VGK A;  4U3T A;  1FCM A;  5TFQ A;  1K4E A;  4Y7P A;  5FAQ A;  3TSG A;  5EVI B;  4KQQ A;  5CGX A;  5EOE A;  3SOI A;  3AGE A;  3GMW A;  5G18 A;  1JVJ A;  2DCF A;  3ISG A;  2EFU A;  2Y4A A;  1NYM A;  2Y2G A;  3UDF A;  1KDS A;  3VP0 A;  1JTG A;  3NCK A;  3QNB A;  1E4D A;  1ES2 A;  2XFS A;  3IXH A;  4PM8 A;  5GLA A;  4ZJ1 A;  2X02 A;  4LCL A;  3HLC A;  1K56 A;  2ZM2 A;  3LY3 A;  1MKI A;  4GNU A;  4PPR A;  2G2W A;  5DTT A;  3NIA A;  5DF9 A;  5FQ9 A;  1XPB A;  3O88 A;  3C7V A;  4R1G A;  4ZTK A;  3ZG8 B;  2WGI A;  2G2U A;  2Z2M B;  2A49 A;  4KZ8 A;  5EVL A;  3WRT A;  4OLG A;  1YMS A;  3W4O A;  3PBQ A;  3HLG A;  3EQU A;  1KDW A;  4OH0 A;  1TEM A;  4HEF A;  1PZP A;  2HP9 A;  3V5M A;  3A3D A;  4UHU A;  3G30 A;  3ZG9 B;  1W8Y A;  3M6H A;  4KG6 A;  5CER A;  3NI9 A;  4UA7 A;  2Y2I A;  5FA7 A;  3GSG A;  3VP3 A;  1TDG A;  1GHM A;  5DTK A;  3ZVT A;  3ZVW A;  5JYP A;  3CZD A;  4CJN A;  3MZE A;  1ALQ A;  2Y2H A;  4E3K A;  3G4P A;  3D4F A;  4Q8I A;  4OON A;  4QU3 A;  2OV5 A;  4WBG A;  4IBX A;  3Q7Z A;  2ZC4 B;  3VP2 A;  5GLD A;  3ZHH A;  4RA7 A;  3RJU A;  1TVF A;  2V2F F;  3CJM A;  4K0W A;  1LI0 A;  3NC8 A;  5CGW A;  3BLS A;  1GA0 A;  4KZ3 A;  2H0T A;  4D2O A;  4B88 A;  3IH8 A;  4S2O A;  3NDE A;  3V50 A;  1J9M A;  1BLH A;  4X6T A;  4MEZ A;  5KSH A;  4JXW A;  2XR0 A;  4MNR A;  3UDI A;  4BEN A;  3SH9 A;  4EBP A;  3UPP A;  3LEZ A;  3IWQ A;  4WZ4 A;  1WYC A;  2E8I A;  1ZG4 A;  5FI7 A;  4S2N C;  3V3R A;  1K57 C;  2XQZ A;  1XP4 A;  1H5X A;  2FFY A;  2EX9 A;  1CEG A;  1EI5 A;  1EWZ A;  1K55 A;  2GDN A;  3A3F A;  4ZDX A;  2VGJ A;  2QMI A;  1SDE A;  5HAI A;  3FWL A;  4CPK A;  1KVL A;  4H8R A;  3NDG A;  4KZ4 A;  2Y2M A;  2ZC3 B;  3IWI A;  4S2L A;  4WEL A;  5FDH A;  1PIO A;  2HPB A;  3HUN A;  3NBL A;  4LEN A;  4E3N A;  5AQ9 A;  3BFE A;  2V1Z A;  1YQS A;  3BFD A;  4JXV A;  3IH9 A;  1CI9 A;  5GL9 A;  4K0X A;  2ZMA A;  4P85 A;  1XGJ A;  3Q82 A;  3W4Q A;  2ZQC A;  1K4F A;  3IF5 A;  4WEJ A;  5KSC A;  1WE4 A;  1FSW A;  1BZA A;  2XH9 A;  1PWG A;  1ESU A;  1ONH A;  2XD1 A;  3CG5 A;  4C6Y A;  4DE2 A;  2ZQ9 A;  2ZM8 A;  4E3L A;  3VSL A;  3I7J A;  3UNW A;  1NRF A;  5M1A A;  3MKE A;  1DJB A;  1YLY A;  3SS4 A;  3BRM A;  3BFG A;  4ZJ2 A;  1OME A;  4MLL A;  3VMA A;  3C4O A;  5E2H A;  4N9K A;  5E43 A;  5F1G A;  3FYZ A;  3W8K A;  5CED A;  5EVI C;  1IYO A;  5F82 A;  4R0Q A;  1KGE A;  1MPL A;  3LY4 A;  1KE4 A;  4OOM A;  2EX2 A;  4BL2 A;  1YLP A;  1HVB A;  3BM6 A;  2X01 A;  3BLM A;  4NK3 A;  1W7F A;  5FQI A;  1SHV A;  1CEF A;  1Y54 A;  4DDS A;  4E3O A;  4YFM A;  4E3J A;  3IQA A;  5EPH A;  3OCN A;  4OPZ A;  3FZC A;  2H5S A;  2ZQD A;  1W5D A;  3A3I A;  3QNC A;  1O07 A;  5AQ7 A;  5CGS A;  5A90 A;  1LL5 A;  1MXO A;  4U0X A;  5CXW A;  2HDQ A;  1MWS A;  4OQ0 A;  1PI4 A;  3BYD A;  4GB7 A;  1SDN A;  4OP5 A;  3UE0 A;  1BUE A;  2QZ6 A;  2Y2Q A;  3MZD A;  1PZO A;  4OOL A;  4OQH A;  2J8Y A;  2Z2L B;  4O7D A;  4YIN A;  3GRJ A;  1Q2Q A;  1KE3 A;  4KZ7 A;  4P0M A;  1PWD A;  1E3U A;  2WAF A;  5CHJ A;  1BLS A;  1O7E A;  2DNS A;  4XXR A;  3JYI A;  3MZF A;  4FCF A;  1L2S A;  2ZJ9 A;  1CK3 A;  3E2L A;  4GD6 A;  1H8Z A;  1ZC2 A;  5DF7 A;  4DF6 A;  4HES A;  4FSF A;  4S2N A;  1ES5 A;  1K57 A;  4F94 A;  4KZ5 A;  5J8X A;  2WK0 A;  3Q1F A;  3UPN A;  3HUM A;  4N1H A;  4OQI A;  1L0D A;  2ZLY A;  4WM9 A;  4P87 A;  3PBN A;  1MWT A;  3NY4 A;  4BD0 A;  2C6W B;  3BFC A;  1KE0 A;  1ERQ A;  1FQG A;  1HD8 A;  5GLB A;  1L0E A;  3FV7 A;  3N7W A;  1NXY A;  1H8Y A;  5EVI D;  2ZC5 B;  4A5R A;  5F83 A;  5A92 A;  2Y2P A;  4X55 A;  4DDY A;  2PU4 A;  1JWZ A;  3IT9 A;  3P09 A;  5L2F A;  4QY6 A;  1RGZ A;  1QME A;  1N4O A;  3A3E A;  2WUQ A;  2WGW A;  2HP6 A;  1BT5 A;  3G31 A;  4PM7 A;  3M6B A;  4KZ9 A;  1FCO A;  4IVK A;  5D3O A;  4E3M A;  5FAO A;  4N92 A;  4ZBE A;  5IHV A;  3IXB A;  1NJ4 A;  3IF6 A;  4UA6 A;  4OLD A;  1S0W A;  1DJA A;  4R3B A;  3GV9 A;  5E2F A;  5EEC A;  4EBN A;  3VP1 A;  3WS5 A;  1YLW A;  5CTM A;  5FI2 A;  1FSY A;  2X71 A;  4HBU A;  1IEM A;  2HDR A;  4OKP A;  5FQM A;  3DWK A;  1YLJ A;  3WS0 A;  2Y2L A;  2Y2K A;  3UN7 A;  5KZH A;  1RCJ A;  2EFX A;  5EVI A;  1JTD A;  2XLN A;  3ZCZ A;  3OPP A;  1Q2P A;  3G34 A;  4S2J A;  2J7V A;  2OLU A;  3MXR A;  2UWX A;  4WZ5 C;  3VFH A;  1DJC A;  4JBF A;  4X69 A;  1FOF A;  3PAG A;  4BD1 A;  1KGF A;  1L0G A;  3UY6 A;  1PYY A;  1G6A A;  3C4P A;  3OPR A;  2BLS A;  3GTC A;  3SH7 A;  1BUL A;  1ERO A;  2JBF A;  2P9V A;  3TOI A;  3BFF A;  3Q81 A;  4EUZ A;  2XGN A;  2R9X A;  3GVB A;  3FKV A;  5EE8 A;  1W79 A;  1ZKJ A;  3PBO A;  4N9L A;  3HRE A;  1XXM A;  5A93 A;  4LCM A;  1K6S A;  4S2I A;  3ITA A;  1RGY A;  3G2Z A;  5HW3 A;  3SS5 A;  4PM6 A;  2JC7 A;  2JE5 A;  2J9O A;  3PAE A;  3GQZ A;  3O86 A;  5BOH A;  3VP4 A;  3ZDJ A;  1YT4 A;  2ZC6 B;  5CHU A;  2OLV A;  1IKG A;  5HL1 A;  3A3J A;  1XA7 A;  4RVA A;  5DVA A;  1HZO A;  4EV4 A;  2WYX A;  4PM5 A;  4EWF A;  2B5R A;  2Q9M A;  3ZFZ A;  1FCN A;  2ZD8 A;  4QY5 A;  4MBK A;  1NZU A;  3BEB A;  4E6W A;  3VFF A;  4MBH A;  1NYY A;  2XD5 A;  1L0F A;  3PBS A;  3M2K A;  3ZG0 A;  3EQV A;  4S2P A;  4WMC D;  2Y2N A;  2A3U A;  2WKI A;  4K91 A;  4FD8 A;  4Y0U A;  4DE3 A;  1JWP A;  2RCX A;  1DY6 A;  3ITB A;  4BLM A;  3ZG7 B;  3LCE A;  1BLP A;  3MKF A;  1YMX A;  3HL9 A;  2I72 A;  3O87 A;  2R9W A;  2H0Y A;  4JF4 A;  5HAQ A;  1I5Q A;  5FQQ A;  3Q7V A;  3UO9 A;  3PBR A;  4C3Q A;  4JPM A;  4LV2 A;  4QHC A;  4BQM A;  4P6B A;  5FI6 A;  4LV0 A;  3DWZ A;  2WKE A;  3OCL A;  3V39 A;  2XF3 A;  1XGI A;  3RXX A;  2J9P A;  3ZGA B;  3N6I A;  3C5A A;  2JCH A;  1MBL A;  1IKI A;  2EXA A;  2Y91 A;  4B4Z A;  5TGF A;  1IEL A;  2WAD A;  4ID4 A;  4KG2 A;  3HLW A;  3RXW A;  3WS2 A;  4WMC A;  4R23 A;  2HDS A;  5I94 A;  3G32 A;  5FQK A;  1XKZ A;  1M40 A;  3WS4 A;  3PTE A;  1K54 C;  3IF6 B;  2BG1 A;  2HDU A;  4Y0O A;  1YLZ A;  1RP5 A;  4WZ5 A;  4X53 A;  3V3S A;  4DKI A;  3GR2 A;  2FFF B;  4LV3 A;  3UE1 A;  5GHX A;  1LHY A;  3CMZ A;  1FR1 A;  3UE3 A;  1C3B A;  4JLF A;  4HBT A;  3N4I A;  2EX6 A;  4RYE A;  4JXS A;  1I2W A;  5E2G A;  3UPO A;  5F1F A;  2WZZ A;  1QMF A;  1LI9 A;  2ZQ7 A;  1I2S A;  4KQO A;  3MBZ A;  1PW1 A;  4XUZ A;  2XEP A;  3G35 A;  1YLT A;  2P74 A;  2WGV A;  4X68 A;  4DRT A;  4Y0T A;  4EBL A;  1SKF A;  5CEC A;  4GKU A;  4ZJ3 A;  5GHZ A;  3IXD A;  4OPY A;  1K25 A;  3HLD A;  3OPH A;  3MXS A;  5HFO A;  5CEB A;  1KVM A;  5DF8 A;  4E6X A;  4QJG A;  3B3X A;  3G2Y A;  2PBY A;  4R4S A;  1BLC A;  3FKW A; 
#chains in the Genus database with same CATH topology
 4WEK A;  1E25 A;  1ODV A;  4GDN A;  4OPR A;  5AVF A;  1STZ A;  1OTB A;  4M3K A;  3IHB A;  1W63 M;  4DXC A;  4LLO B;  2VA0 A;  2IWD A;  4GN2 A;  3S4X A;  2Y59 A;  3W4P A;  1EW0 A;  1GCE A;  1F98 A;  4C75 A;  4CLC B;  4N1X A;  5TR7 A;  2C5W B;  3ZNY A;  4G3K A;  2Y2O A;  2V20 A;  2VZW A;  5HSQ A;  3UDX A;  1IYS A;  5FAT A;  4JGO A;  3VSK A;  2ZM0 A;  2GJ3 A;  2Z6C A;  5DJT A;  3ZG5 A;  4DE1 A;  3IX3 A;  5AQA A;  4DN0 A;  3UE6 A;  5CHM A;  1T1A A;  3ZNT A;  3VOZ A;  4GJ4 A;  2EXB A;  1G6O A;  1ONG A;  3O5Y A;  4EXO A;  2A24 B;  4KG5 A;  2XDM A;  4JF6 A;  1VM1 A;  3DTM A;  4JF5 A;  1PWC A;  3HLE A;  1FR6 A;  3HLF A;  1VET A;  3IF6 C;  5G4Y A;  2IWC A;  3IXG A;  3N8S A;  3QP5 A;  3CHW P;  3WWX A;  2WKR A;  1HTZ A;  3IX4 A;  4FH2 A;  2PYR A;  4XUX A;  1ERM A;  3PBT A;  1IFQ A;  2HV1 A;  3S22 A;  3LO7 A;  2PYP A;  2CC1 A;  2WGW B;  3PHY A;  2O9B A;  2W1T B;  2A2L A;  1NLY A;  2ZQ8 A;  4G3W A;  1K55 C;  1PW8 A;  1OTA A;  2Q9N A;  5FSR A;  2VGK A;  1K4E A;  4ETX A;  1XFN A;  2W1R A;  4KQQ A;  5CGX A;  4HQA A;  3AGE A;  2EFU A;  4HJ6 A;  5HWT A;  2Y2G A;  4ZJ1 A;  2XFS A;  3IXH A;  2X02 A;  2CMN A;  2XSS A;  2L4R A;  3HLC A;  4BWI A;  3LY3 A;  1J3W A;  4LRZ E;  4PPR A;  2G2W A;  3EWK A;  5FQ9 A;  1XPB A;  2VX8 A;  4ZTK A;  2GX5 A;  3S7Q A;  4KZ8 A;  5EVL A;  4OLG A;  1YMS A;  5AVE A;  4OH0 A;  1TEM A;  5HPF A;  3G30 A;  4ZRR A;  3ZG9 B;  1W8Y A;  4QWO A;  3GSG A;  3ZVW A;  1GHM A;  2Y2H A;  3D72 A;  3G4P A;  3QP1 A;  2BTF P;  2ZC4 B;  3VP2 A;  5GLD A;  3RJU A;  1TVF A;  1LI0 A;  3LIE A;  1GA0 A;  1V9Z A;  4KZ3 A;  2H0T A;  4D2O A;  4B88 A;  4Y5F A;  3V50 A;  4MEZ A;  5EFW A;  2GNX A;  4BEN A;  3T1R A;  1WYC A;  2E8I A;  3VE3 A;  3V3R A;  3BW6 A;  2L0W A;  2EX9 A;  2NUP C;  2W0N A;  2QMI A;  1SDE A;  3GEC A;  5HAI A;  1KVL A;  2MJ6 A;  4IJG A;  3JPU A;  2VV8 A;  4WEL A;  4DJ2 A;  2HPB A;  3HUN A;  4LEN A;  1YQS A;  1V9Y A;  4NXE A;  1OJG A;  1PWG A;  1ESU A;  1ONH A;  4PKY A;  4II7 A;  4DE2 A;  2ZQ9 A;  1DJB A;  1YLY A;  4HI4 A;  4ZJ2 A;  5L10 A;  3VMA A;  3C4O A;  5E2H A;  2HGV A;  2XA7 M;  5F1G A;  3FYZ A;  5EVI C;  1IYO A;  2O0Y A;  4R0Q A;  4I3J A;  3LY4 A;  4OOM A;  1HVB A;  2V1A A;  1W7F A;  5EPH A;  3OCN A;  2W3E A;  2HDQ A;  4OQ0 A;  4OP5 A;  2P7J A;  1BUE A;  4R38 A;  2QZ6 A;  4Q0J A;  1PZO A;  3GRJ A;  4KZ7 A;  4EET B;  2JKR I;  1BLS A;  2VGL M;  4Y17 A;  1IOU A;  4QPR A;  1CK3 A;  1ZC2 A;  4ARZ A;  3K2N A;  1OTI A;  2QYB A;  2PT7 A;  3UPN A;  3HUM A;  4MN6 A;  1L0D A;  2ZLY A;  1OTE A;  1GSV A;  3S7P A;  1MWT A;  2AVX A;  2C6W B;  3DBA A;  1FQG A;  5GLB A;  4HHD A;  2E8J A;  4MMN A;  5EVI D;  2ZC5 B;  3C2W A;  2PHY A;  3LIF A;  4H6J A;  1TD5 A;  2HP6 A;  4WF0 A;  3T50 A;  5FAO A;  4GCZ A;  4N92 A;  4R3B A;  1DJA A;  4EBN A;  4YOF A;  1FSY A;  3PYP A;  1YLJ A;  2Q0O A;  2QJ7 A;  2Y2K A;  2EFX A;  1JTD A;  2XLN A;  3G34 A;  1VET B;  4S2J A;  2J7V A;  5I5L A;  3H82 B;  2BLS A;  1BUL A;  2KLI A;  3Q81 A;  3GVB A;  2M7U A;  2G7U A;  4S2I A;  4YWZ A;  3PAE A;  3T4J A;  3DTI A;  4Q0I A;  1IKG A;  3A3J A;  4RVA A;  5DVA A;  1HZO A;  2WYX A;  3K3C A;  3LID A;  2ZD8 A;  4CLC A;  1NZU A;  4E6W A;  1NYY A;  3ZG0 A;  2INW A;  5HD5 A;  4BLM A;  3CI6 A;  3RH8 B;  2I72 A;  5HAQ A;  5FQQ A;  4JPM A;  3BQ8 A;  4Y13 A;  3DWZ A;  2HJ9 C;  1XGI A;  2QHK A;  4B93 A;  4B4Z A;  1XFQ A;  4KG2 A;  4ID4 A;  4WMC A;  3F1N B;  2HDS A;  1XKZ A;  2HDU A;  2UV0 E;  3GR2 A;  2A24 A;  2JKF A;  5E2G A;  2K31 A;  5F1F A;  2WZZ A;  1QMF A;  2ZQ7 A;  3MBZ A;  4XUZ A;  1OT9 A;  2V0W A;  3FC7 A;  5CEC A;  3U4L P;  5GHZ A;  3IXD A;  1K25 A;  3HLD A;  5DF8 A;  4R4S A;  4EUV A;  1Y28 A;  2P9V B;  1XX2 A;  1ZG6 A;  2W1T A;  5HDD A;  5M19 A;  5HAP A;  3KYQ A;  3N8L A;  4NET A;  4HJ4 A;  4OVD A;  2ZMV A;  3TW8 A;  4GHI B;  1XJ3 A;  2NUT C;  3C8C A;  2Y2J A;  4UAA A;  4MBF A;  2XFT A;  1W8Q A;  4GD8 A;  5EM1 A;  5M18 A;  1Z6F A;  1GSW A;  5HAR A;  2DRW A;  5FQJ A;  4RX3 A;  2EWW A;  2H28 A;  5FL3 A;  1YM1 A;  1ESI A;  1PI5 A;  4EQ1 A;  3OC2 A;  3OPL A;  4GDB A;  1U60 A;  3UME A;  1S1Y A;  3MF0 A;  2WAE A;  3T4K A;  2L1M A;  1T18 A;  4OP8 A;  3E2K A;  1K54 A;  3DW0 A;  4WYY A;  3KX0 X;  1IYP A;  2EX8 A;  4R3J A;  4ZAM A;  5FAS A;  1L3L A;  1T1C A;  3WS1 A;  1BYW A;  4ME4 A;  1GA9 A;  2OSU A;  3QHY A;  1K38 A;  1YPR A;  4OQG A;  5CRF A;  2XRO A;  3ICY A;  2I9V A;  4GZB A;  4KZB A;  3D9Y A;  1E3U D;  5U47 A;  1GHI A;  3IWO A;  4DE0 A;  2JKG A;  3A0V A;  3KSF A;  4H6J B;  5HZH A;  3R4K A;  2XRN A;  1G68 A;  3LIC A;  1D7E A;  4GLQ A;  1M6K A;  4CQH A;  3N8R A;  5DKL A;  1LLB A;  1N9B A;  2V0U A;  1W63 Q;  1LL9 A;  4L0L A;  1F5M A;  1FCM A;  4Y7P A;  5MC7 A;  3D3O A;  3SOI A;  1JVJ A;  4O0P A;  3LR3 A;  1NYM A;  3NOT C;  5TJJ A;  1E4D A;  3NEC A;  1ACF A;  3S7N A;  1UWP X;  5DF9 A;  3C7V A;  4R1G A;  3ZG8 B;  2WGI A;  4YNR A;  3W4O A;  3MFX A;  3PBQ A;  3HLG A;  3EQU A;  3UB5 P;  1PZP A;  3B47 A;  3A0S A;  3HJI A;  2Y2I A;  5FA7 A;  5JYP A;  3CUE C;  4E3K A;  2VV7 A;  3D4F A;  4OON A;  2VEA A;  4BBV A;  2V2F F;  3CJM A;  2W3F A;  3FPV A;  3NC8 A;  3BLS A;  1VB6 A;  4S2O A;  4I5S A;  3LUQ A;  4X6T A;  5EVE A;  4MNR A;  3A0R A;  3DTK A;  3LEZ A;  1ZG4 A;  5FI7 A;  5IT5 A;  5AJG A;  1H5X A;  4WUJ A;  3EEH A;  1EWZ A;  1K55 A;  2GDN A;  1UGU A;  2ZOI A;  1P9R A;  4H8R A;  4ESP A;  3IWI A;  4S2L A;  4E3N A;  3IBR A;  4KUO A;  2V9A A;  5F6A A;  3BFD A;  3IH9 A;  5GL9 A;  5KSC A;  5C5K A;  1K4F A;  3IF5 A;  4WEJ A;  1FSW A;  1BZA A;  3I7J A;  3UNW A;  1NRF A;  5HWW A;  2ZBB A;  3OOV A;  3H9W A;  4MN5 A;  4N9K A;  3H82 A;  5E43 A;  3TRC A;  1KGE A;  3F1P B;  1YLP A;  4NK3 A;  4LPZ A;  4I3A A;  4E3O A;  4E3J A;  5AQ7 A;  2JKT M;  1W5D A;  4O8G A;  1O07 A;  1MXO A;  4U0X A;  5CXW A;  1MWS A;  1T1B A;  3MQ0 A;  3F1O A;  4OQH A;  2Z2L B;  3C38 A;  3IBJ A;  3KYE A;  4X25 A;  1SKO B;  1YAX A;  3EGX C;  3MZF A;  5EV0 A;  4GD6 A;  1H8Z A;  5DF7 A;  3LI8 A;  4Y2F A;  4HES A;  1LT0 A;  4F94 A;  5J8X A;  3Q1F A;  2O99 A;  5TBM A;  5EM0 A;  3PBN A;  3NY4 A;  1ERQ A;  2KX6 A;  3SZT A;  1H8M A;  4A5R A;  5F83 A;  2Y2P A;  4HY8 A;  5L2F A;  1QME A;  1N4O A;  3A3E A;  4PM7 A;  3F1N A;  3M6B A;  4KZ9 A;  1FCO A;  5D3O A;  4ZBE A;  1NJ4 A;  1S0W A;  3GV9 A;  1S67 L;  3VP1 A;  3WS5 A;  5FI2 A;  1DRM A;  1DP6 A;  1IEM A;  5FQM A;  3MQQ A;  3WS0 A;  2Y2L A;  3RFB A;  1RCJ A;  5EVI A;  3KSI A;  3E4P A;  4AFI A;  2OLU A;  3MXR A;  4WZ5 C;  3VFH A;  4Y15 A;  3E98 A;  4JBF A;  4X69 A;  3PAG A;  1OPX A;  2VKS A;  3UY6 A;  3LFV A;  3GTC A;  2JBF A;  4XT2 B;  3OLO A;  2P9V A;  4BBT A;  5A8B A;  5G4Z A;  2XGN A;  4RQ9 A;  3FKV A;  4PAU A;  5EE8 A;  1W79 A;  2Y79 A;  3PBO A;  3HRE A;  1D06 A;  3ITA A;  3UB9 A;  3NUL A;  4PKY G;  1H3Q A;  2JC7 A;  2J9O A;  3GQZ A;  3O86 A;  5HWV A;  4GHI A;  2ZC6 B;  3PR6 A;  4PM5 A;  4QY5 A;  1YKD A;  1MC0 A;  3BEB A;  2O9C A;  3PBS A;  2XD5 A;  5HDS A;  4NXF A;  3U2A A;  2P04 A;  3EGD C;  3BY9 A;  3QP8 A;  5J4E A;  3TJZ C;  3LCE A;  1BLP A;  1YMX A;  3O87 A;  3T4T A;  3UO9 A;  4WLA A;  4LV2 A;  5FI6 A;  4LV0 A;  4IUH A;  2WKE A;  2XF3 A;  4X1M A;  3N6I A;  3C5A A;  2JCH A;  1MBL A;  3FPW A;  4Z1W A;  1IEL A;  2WAD A;  3RXW A;  4MDZ A;  5I94 A;  3G32 A;  3IF6 B;  4X1L A;  4DKI A;  3EOI A;  3UE1 A;  1TF1 A;  5GHX A;  1C3B A;  3H7W A;  4HBT A;  3N4I A;  4UQI M;  1D1J A;  1I2W A;  3UMD A;  2FZ0 A;  3G35 A;  4P6Z M;  2P74 A;  1SKF A;  2W27 A;  3P01 A;  4L9E A;  4OPY A;  5HFO A;  3OPH A;  5CEB A;  3B3X A;  1MZU A;  3FKW A;  2ZC7 A;  5E2E A;  1SCW A;  4UA9 A;  4U0T A;  4RX2 A;  5AQB A;  2PU2 A;  4PMA A;  4R70 A;  3UB7 A;  3IHA A;  1IYQ A;  1LL8 A;  4QD4 A;  3WRZ A;  5DTS A;  4OOY A;  1BTL A;  4IBR A;  1G5U A;  4G3V A;  2IWB A;  2IA2 A;  4HH2 A;  3LR0 A;  4GOG A;  2FH5 A;  5K5B A;  1XJ4 A;  2PAV P;  3CWF A;  1MY8 A;  1ES4 A;  3M2J A;  4Z9Q A;  4R4R A;  3F1O B;  4S2K A;  2KOI A;  2ZMF A;  5EUA A;  4IED A;  1TDL A;  3AGD A;  4DXB A;  2PRF A;  3HLB A;  1DP9 A;  4OPQ A;  3QP4 A;  4HP9 A;  5JYO A;  5TBM B;  1TS8 A;  3K3D A;  2M1C A;  3B33 A;  3VOY A;  1CF0 A;  5A91 A;  3GDI A;  4KEN B;  2V8C A;  4GS9 A;  4E3I A;  1CI8 A;  1MKM A;  5EOO A;  2BAS A;  1UWN X;  4BL3 A;  3KSG A;  1S1Z A;  5CTN A;  3ULF A;  1K56 D;  4BJP A;  2XK1 A;  4X56 A;  1WYB A;  4EQI A;  2V1B A;  3P98 A;  2WKP A;  2J80 A;  1K6R A;  4KZ6 A;  1OJ5 A;  4U3T A;  2B18 A;  5TFQ A;  3W2Z A;  4HH3 A;  5EVI B;  5EOE A;  5G18 A;  2DCF A;  3ISG A;  4NXG A;  3LGO A;  3VP0 A;  3QNB A;  4PM8 A;  1ES2 A;  1ZHH B;  3KO6 A;  2VK3 A;  1VEU A;  2ZM2 A;  3F1P A;  5DTT A;  3NIA A;  1PNE A;  4D60 A;  2A49 A;  4MN7 A;  1KDW A;  2HP9 A;  3V5M A;  4UHU A;  3IX8 A;  4UA7 A;  5CER A;  3T1X A;  1TDG A;  5DTK A;  3CZD A;  3MZE A;  2PR5 A;  1TS7 A;  1SKO A;  1P0Z A;  3MSH A;  4QU3 A;  2OV5 A;  4WBG A;  4F3L A;  3Q7Z A;  4RA7 A;  4K0W A;  1CJF A;  3IH8 A;  3NDE A;  1J9M A;  2PD8 A;  5KSH A;  4JXW A;  2XR0 A;  3UDI A;  3UPP A;  4WZ4 A;  4EEU A;  4EER A;  1KOU A;  5LBR A;  4S2N C;  1K57 C;  2XQZ A;  1XP4 A;  2FFY A;  1LSV A;  4CLC D;  3A3F A;  4ZDX A;  2VGJ A;  3L7H A;  4CPK A;  3IS2 B;  3NDG A;  4KZ4 A;  3VOL A;  5F68 A;  2V1Z A;  5J3W A;  3H7W B;  4K0X A;  3DAV A;  1FIL A;  1XGJ A;  3Q82 A;  2ZQC A;  3MR0 A;  4DJ3 A;  1YSP A;  2JKR M;  2D02 A;  3CG5 A;  4C6Y A;  4E3L A;  4R6L A;  3VSL A;  4EW7 A;  5M1A A;  3MKE A;  3BRM A;  3BFG A;  1OME A;  3HCY A;  3W8K A;  4HIA A;  5CED A;  4XT2 A;  1MPL A;  1KE4 A;  2EX2 A;  5L07 A;  4BL2 A;  2X01 A;  1XJ6 A;  3BLM A;  2HJE A;  1OT6 A;  3HJK A;  2XA7 S;  3CUE A;  4NXB A;  2H5S A;  2ZQD A;  3QNC A;  3A3I A;  5CGS A;  1LL5 A;  3LIB A;  2KDK A;  4OOL A;  4YIN A;  1KE3 A;  1PWD A;  1O7E A;  3JYI A;  2ZJ9 A;  4DF6 A;  2VGL S;  4FSF A;  1ES5 A;  4KZ5 A;  2VLG A;  2WK0 A;  4N1H A;  4OQI A;  4WM9 A;  4BD0 A;  3BFC A;  1KE0 A;  1HD8 A;  1L0E A;  1H8Y A;  1N9L A;  3E4O A;  4BBU A;  3B42 A;  4X55 A;  1JWZ A;  3IT9 A;  3P09 A;  4QY6 A;  1P9W A;  1BT5 A;  3G31 A;  2ZOH A;  4E3M A;  1P97 A;  5IHV A;  3IF6 A;  4UA6 A;  2YKH A;  5EEC A;  3BY8 A;  2P08 A;  1YLW A;  3PXP A;  4EEP A;  4HBU A;  4OKP A;  1Z09 A;  2HDR A;  3DWK A;  2QJ5 A;  3UN7 A;  1Q2P A;  5CX7 A;  3T1Q B;  2UWX A;  3MMH A;  4JGP A;  4Y3I A;  1FOF A;  4BD1 A;  1L0G A;  5DJU A;  1PYY A;  1NWZ A;  4GS9 B;  1ERO A;  4EUZ A;  3QP2 A;  4EU0 A;  3C30 A;  4FTX A;  5A93 A;  1K6S A;  2JN7 A;  4KQD A;  3SS5 A;  2JE5 A;  5BOH A;  4I39 A;  3VP4 A;  1XA7 A;  1CQA A;  4EWF A;  2B5R A;  2Q9M A;  1FCN A;  3G6O A;  5F5Y A;  2D01 A;  3T4O A;  4MBH A;  3VFF A;  1NRJ A;  3M2K A;  4S2P A;  1VEU B;  2B02 A;  2LB5 A;  2WKI A;  2Y2N A;  3ITB A;  2R9W A;  4JF4 A;  3NOU C;  4C3Q A;  3PBR A;  4QHC A;  4BQM A;  4P6B A;  3VV4 A;  1PFL A;  3OBF A;  2WKQ A;  3OCL A;  3V39 A;  3T4Q A;  3ZGA B;  3T1S A;  1IKI A;  2Y91 A;  3KYZ A;  2HF6 A;  3HLW A;  4HP4 A;  4F3L B;  4Y0O A;  1YLZ A;  1RP5 A;  4WZ5 A;  4X53 A;  2FFF B;  1LHY A;  5HL6 A;  3UE3 A;  4JLF A;  4L9G A;  2VV6 A;  2M7V A;  3UPO A;  3LR5 A;  1PW1 A;  2XEP A;  1YLT A;  2WGV A;  4DRT A;  4Y0T A;  4GKU A;  4ZJ3 A;  2EA9 A;  1S4S A;  4E6X A;  3G2Y A;  4FUW A;  3P7N A;  1VHM A;  3UB8 A;  3UB6 A;  3NHQ A;  3C7U A;  2Z6D A;  3BEC A;  5HPI A;  4KQR A;  3HBR A;  1NY0 A;  5FAP A;  5GLC A;  4S2M A;  3TG9 A;  1MWR A;  4FOF A;  2OAP 1;  3HVF A;  4FH4 A;  4JKT A;  5L8M A;  3T4L A;  4IVI A;  3CIT A;  3HUO A;  1ZTU A;  3SS3 A;  1AXB A;  3OZH A;  3Q07 A;  3R7W A;  1JWV A;  3BJN A;  4LV1 A;  1NZO A;  3AGF A;  2ZL1 B;  1S4R A;  1BSG A;  3Q7V B;  4UEY A;  3RTY A;  3FG8 A;  4I38 A;  4Q0H A;  5IU1 A;  2OWJ A;  2RL3 A;  4PM9 A;  4KZA A;  4QB8 A;  5KMW A;  1K0K A;  2JHE A;  2J3T C;  5L09 A;  1VQQ A;  3S7O A;  4GW9 A;  4JXG A;  1JNU A;  1ES3 A;  2WKH A;  3S1Y A;  4K08 A;  2Y55 A;  3SH8 A;  2ZQA A;  5FEG A;  1XA1 A;  1Y4O A;  1X0O A;  5GHY A;  2R78 A;  1H0M A;  1KGG A;  3MFD A;  5HX9 A;  3T12 B;  4WN5 A;  1SZV A;  3LEQ A;  4LGW A;  3CAX A;  2H10 A;  3MXQ A;  5FEF A;  3O3V A;  1S6R A;  3ZYT A;  4I3I A;  2QPN A;  4B4X A;  1MWU A;  4LRX C;  3IS2 A;  2LB9 A;  1WA9 A;  1GHP A;  2HP5 A;  2J3T D;  1TS6 A;  1YSQ A;  2OAQ 1;  2PD7 A;  2WZX A;  5IS1 A;  3NOP C;  4KUK A;  3V67 A;  5FAQ A;  3TSG A;  3T4S A;  5FDS A;  3GMW A;  2Y4A A;  3E4Q A;  3UDF A;  1KDS A;  1JTG A;  1AWI A;  3NCK A;  4NG2 A;  1F9I A;  5GLA A;  3ZQ5 A;  4LCL A;  1K56 A;  5J7E A;  2W3H A;  1MKI A;  4GNU A;  2K2N A;  5KIZ A;  1T19 A;  4NKP A;  2PDR A;  3QP6 A;  3O88 A;  4BMW A;  2G2U A;  2Z2M B;  3CPT A;  3WRT A;  2J3W A;  4HOI A;  3JVV A;  1GSX A;  4HEF A;  3A3D A;  3M6H A;  4KG6 A;  3NI9 A;  3VP3 A;  3ZVT A;  4CJN A;  1ALQ A;  4Q8I A;  4WL9 A;  4IBX A;  2OWH A;  3ZHH A;  4JGQ A;  4O01 A;  4CLC E;  5CGW A;  2VJW A;  1BLH A;  4HJ3 A;  3SW1 A;  4MCW A;  1LSW A;  4HNB A;  3SH9 A;  4EBP A;  3IWQ A;  3LYX A;  1CEG A;  1EI5 A;  3FWL A;  3TE8 A;  2YKF A;  2Y2M A;  2ZC3 B;  5FDH A;  1PIO A;  3NBL A;  2PBD P;  5AQ9 A;  3BFE A;  1LSX A;  4JXV A;  1CI9 A;  2ZMA A;  4ETZ A;  4P85 A;  4L9F A;  3W4Q A;  1PRQ A;  1WE4 A;  2XH9 A;  2XD1 A;  2V8F A;  2ZM8 A;  1S66 L;  3SS4 A;  3L9K A;  4MLL A;  2Y8H A;  2HZ5 A;  3KSH A;  5F82 A;  3BM6 A;  5FQI A;  1SHV A;  1CEF A;  1Y54 A;  4DDS A;  4YFM A;  3IQA A;  4OPZ A;  3FZC A;  5A90 A;  1PI4 A;  3BYD A;  4GB7 A;  1SDN A;  3UE0 A;  2K7S A;  2Y2Q A;  3MZD A;  2J8Y A;  4O7D A;  1Q2Q A;  3LI9 A;  4P0M A;  2WAF A;  1E3U A;  1F2K A;  1TS0 A;  4IHQ A;  1A0K A;  3MQO A;  5CHJ A;  2DNS A;  4XXR A;  4FCF A;  1L2S A;  3E2L A;  3CLO A;  3DTE A;  1N9N A;  3R7W B;  4S2N A;  1K57 A;  4CLC C;  4P87 A;  2DMW A;  3FV7 A;  3N7W A;  4M4X A;  1NXY A;  4LFU A;  2OOL A;  2JKT I;  5A92 A;  4DDY A;  2PU4 A;  1RGZ A;  2WUQ A;  2WGW A;  4IVK A;  1N9O A;  1FIK A;  2GZA A;  3IXB A;  4OLD A;  5E2F A;  5CTM A;  2X71 A;  4EES A;  3BQA A;  5KZH A;  3ZCZ A;  3LIA A;  3OPP A;  1DJC A;  4DMZ A;  5DFY A;  3E0Y A;  1KGF A;  1NLZ A;  3C4P A;  1G6A A;  3OPR A;  3SH7 A;  3TOI A;  3BFF A;  2R9X A;  1ZKJ A;  4N9L A;  1XXM A;  4LCM A;  2B95 A;  1RGY A;  3G2Z A;  5F69 A;  5HW3 A;  4PM6 A;  4E04 A;  1OTD A;  3ZDJ A;  1YT4 A;  2PR6 A;  3LR4 A;  5CHU A;  2OLV A;  5HL1 A;  3VE4 A;  4R3A A;  4EV4 A;  4PHT A;  3ZFZ A;  2EWV A;  4MBK A;  2W3G A;  1HLU P;  1L0F A;  4IUK A;  3EQV A;  4WMC D;  4Y0U A;  4K91 A;  2A3U A;  4FD8 A;  4ARZ B;  1JWP A;  2RCX A;  3BWL A;  1DY6 A;  3ZG7 B;  3MKF A;  2O9A A;  3HL9 A;  2H0Y A;  4B9O A;  2ZL1 A;  1I5Q A;  3Q7V A;  3CPT B;  2W3D A;  3EEA A;  3RXX A;  2J9P A;  1DP8 A;  2EXA A;  5TGF A;  5DFX A;  3WS2 A;  4R23 A;  5HDC A;  5FQK A;  5DKK A;  1M40 A;  2ACG A;  3WS4 A;  3PTE A;  1K54 C;  3JVU A;  2BG1 A;  4JGR A;  3V3S A;  3MS6 A;  4LV3 A;  3CMZ A;  1FR1 A;  4LRY C;  2EX6 A;  4RYE A;  4JXS A;  2QKP A;  1XJ2 A;  1LI9 A;  3NJA A;  1I2S A;  4KQO A;  1G28 A;  4UQI S;  4X68 A;  4EBL A;  2QWS A;  3MJQ A;  3MXS A;  1KVM A;  4QJG A;  2PBY A;  4DE3 A;  4NEE D;  1BLC A;  5HD3 A;  4P6Z S; 
#chains in the Genus database with same CATH homology
 2P9V B;  1XX2 A;  1ZG6 A;  4WEK A;  1E25 A;  2ZC7 A;  4GDN A;  4OPR A;  3C7U A;  5E2E A;  4M3K A;  5M19 A;  3BEC A;  1SCW A;  4UA9 A;  4KQR A;  5HAP A;  3HBR A;  3N8L A;  4U0T A;  4RX2 A;  4NET A;  1NY0 A;  5FAP A;  3IHB A;  4OVD A;  5GLC A;  5AQB A;  2PU2 A;  4PMA A;  4DXC A;  4S2M A;  3TG9 A;  1MWR A;  2IWD A;  3HVF A;  3IHA A;  4FH4 A;  4GN2 A;  3S4X A;  2Y2J A;  1IYQ A;  4UAA A;  2Y59 A;  4MBF A;  3W4P A;  4QD4 A;  3WRZ A;  5DTS A;  2XFT A;  1W8Q A;  1GCE A;  4JKT A;  4GD8 A;  4OOY A;  1BTL A;  5M18 A;  1Z6F A;  4IVI A;  3HUO A;  4C75 A;  4IBR A;  5HAR A;  2DRW A;  3SS3 A;  5FQJ A;  1AXB A;  3OZH A;  2IWB A;  4RX3 A;  3Q07 A;  4N1X A;  1YM1 A;  5TR7 A;  1ESI A;  2C5W B;  1PI5 A;  3ZNY A;  1JWV A;  3OC2 A;  3OPL A;  4GOG A;  4GDB A;  4LV1 A;  2Y2O A;  1U60 A;  1NZO A;  3AGF A;  2V20 A;  2WAE A;  1BSG A;  3Q7V B;  4OP8 A;  3UDX A;  1IYS A;  5FAT A;  2RL3 A;  1MY8 A;  4PM9 A;  1ES4 A;  3M2J A;  4KZA A;  4QB8 A;  3E2K A;  5KMW A;  1K54 A;  4Z9Q A;  4R4R A;  1VQQ A;  3VSK A;  2ZM0 A;  3DW0 A;  4WYY A;  4JXG A;  4S2K A;  3ZG5 A;  4DE1 A;  1IYP A;  1ES3 A;  2EX8 A;  4R3J A;  5AQA A;  4ZAM A;  5FAS A;  2WKH A;  3S1Y A;  2Y55 A;  4IED A;  5EUA A;  5CHM A;  3ZNT A;  1TDL A;  3AGD A;  3SH8 A;  3VOZ A;  4DXB A;  3HLB A;  2ZQA A;  3WS1 A;  2EXB A;  4OPQ A;  1ONG A;  1GA9 A;  2OSU A;  1XA1 A;  5GHY A;  3QHY A;  1KGG A;  5JYO A;  3MFD A;  4KG5 A;  1K38 A;  2XDM A;  5HX9 A;  4JF6 A;  1VM1 A;  3DTM A;  4JF5 A;  4OQG A;  5CRF A;  1PWC A;  3HLE A;  1FR6 A;  3HLF A;  3IF6 C;  4GZB A;  4KZB A;  2IWC A;  2H10 A;  3VOY A;  3IXG A;  3N8S A;  3WWX A;  5A91 A;  1HTZ A;  3O3V A;  1E3U D;  5U47 A;  4FH2 A;  1S6R A;  1GHI A;  3IWO A;  4KEN B;  1ERM A;  4XUX A;  3PBT A;  4DE0 A;  1CI8 A;  4E3I A;  3S22 A;  2QPN A;  3LO7 A;  5EOO A;  4B4X A;  1MWU A;  4BL3 A;  2CC1 A;  2WGW B;  5CTN A;  4BJP A;  1K56 D;  1GHP A;  1G68 A;  2XK1 A;  2HP5 A;  4X56 A;  1WYB A;  1M6K A;  4EQI A;  3N8R A;  3P98 A;  2ZQ8 A;  1K55 C;  1LLB A;  2WZX A;  1PW8 A;  1N9B A;  2Q9N A;  1K6R A;  4KZ6 A;  5FSR A;  1LL9 A;  4L0L A;  2VGK A;  4U3T A;  1FCM A;  5TFQ A;  1K4E A;  4Y7P A;  5FAQ A;  3TSG A;  5EVI B;  4KQQ A;  5CGX A;  5EOE A;  3SOI A;  3AGE A;  3GMW A;  5G18 A;  1JVJ A;  2DCF A;  3ISG A;  2EFU A;  2Y4A A;  1NYM A;  2Y2G A;  3UDF A;  1KDS A;  3VP0 A;  1JTG A;  3NCK A;  3QNB A;  1E4D A;  1ES2 A;  2XFS A;  3IXH A;  4PM8 A;  5GLA A;  4ZJ1 A;  2X02 A;  4LCL A;  3HLC A;  1K56 A;  2ZM2 A;  3LY3 A;  1MKI A;  4GNU A;  4PPR A;  2G2W A;  5DTT A;  3NIA A;  5DF9 A;  5FQ9 A;  1XPB A;  3O88 A;  3C7V A;  4R1G A;  4ZTK A;  3ZG8 B;  2WGI A;  2G2U A;  2Z2M B;  2A49 A;  4KZ8 A;  5EVL A;  3WRT A;  4OLG A;  1YMS A;  3W4O A;  3PBQ A;  3HLG A;  3EQU A;  1KDW A;  4OH0 A;  1TEM A;  4HEF A;  1PZP A;  2HP9 A;  3V5M A;  3A3D A;  4UHU A;  3G30 A;  3ZG9 B;  1W8Y A;  3M6H A;  4KG6 A;  5CER A;  3NI9 A;  4UA7 A;  2Y2I A;  5FA7 A;  3GSG A;  3VP3 A;  1TDG A;  1GHM A;  5DTK A;  3ZVT A;  3ZVW A;  5JYP A;  3CZD A;  4CJN A;  3MZE A;  1ALQ A;  2Y2H A;  4E3K A;  3G4P A;  3D4F A;  4Q8I A;  4OON A;  4QU3 A;  2OV5 A;  4WBG A;  4IBX A;  3Q7Z A;  2ZC4 B;  3VP2 A;  5GLD A;  3ZHH A;  4RA7 A;  3RJU A;  1TVF A;  2V2F F;  3CJM A;  4K0W A;  1LI0 A;  3NC8 A;  5CGW A;  3BLS A;  1GA0 A;  4KZ3 A;  2H0T A;  4D2O A;  4B88 A;  3IH8 A;  4S2O A;  3NDE A;  3V50 A;  1J9M A;  1BLH A;  4X6T A;  4MEZ A;  5KSH A;  4JXW A;  2XR0 A;  4MNR A;  3UDI A;  4BEN A;  3SH9 A;  4EBP A;  3UPP A;  3LEZ A;  3IWQ A;  4WZ4 A;  1WYC A;  2E8I A;  1ZG4 A;  5FI7 A;  4S2N C;  3V3R A;  1K57 C;  2XQZ A;  1XP4 A;  1H5X A;  2FFY A;  2EX9 A;  1CEG A;  1EI5 A;  1EWZ A;  1K55 A;  2GDN A;  3A3F A;  4ZDX A;  2VGJ A;  2QMI A;  1SDE A;  5HAI A;  3FWL A;  4CPK A;  1KVL A;  4H8R A;  3NDG A;  4KZ4 A;  2Y2M A;  2ZC3 B;  3IWI A;  4S2L A;  4WEL A;  5FDH A;  1PIO A;  2HPB A;  3HUN A;  3NBL A;  4LEN A;  4E3N A;  5AQ9 A;  3BFE A;  2V1Z A;  1YQS A;  3BFD A;  4JXV A;  3IH9 A;  1CI9 A;  5GL9 A;  4K0X A;  2ZMA A;  4P85 A;  1XGJ A;  3Q82 A;  3W4Q A;  2ZQC A;  1K4F A;  3IF5 A;  4WEJ A;  5KSC A;  1WE4 A;  1FSW A;  1BZA A;  2XH9 A;  1PWG A;  1ESU A;  1ONH A;  2XD1 A;  3CG5 A;  4C6Y A;  4DE2 A;  2ZQ9 A;  2ZM8 A;  4E3L A;  3VSL A;  3I7J A;  3UNW A;  1NRF A;  5M1A A;  3MKE A;  1DJB A;  1YLY A;  3SS4 A;  3BRM A;  3BFG A;  4ZJ2 A;  1OME A;  4MLL A;  3VMA A;  3C4O A;  5E2H A;  4N9K A;  5E43 A;  5F1G A;  3FYZ A;  3W8K A;  5CED A;  5EVI C;  1IYO A;  5F82 A;  4R0Q A;  1KGE A;  1MPL A;  3LY4 A;  1KE4 A;  4OOM A;  2EX2 A;  4BL2 A;  1YLP A;  1HVB A;  3BM6 A;  2X01 A;  3BLM A;  4NK3 A;  1W7F A;  5FQI A;  1SHV A;  1CEF A;  1Y54 A;  4DDS A;  4E3O A;  4YFM A;  4E3J A;  3IQA A;  5EPH A;  3OCN A;  4OPZ A;  3FZC A;  2H5S A;  2ZQD A;  1W5D A;  3A3I A;  3QNC A;  1O07 A;  5AQ7 A;  5CGS A;  5A90 A;  1LL5 A;  1MXO A;  4U0X A;  5CXW A;  2HDQ A;  1MWS A;  4OQ0 A;  1PI4 A;  3BYD A;  4GB7 A;  1SDN A;  4OP5 A;  3UE0 A;  1BUE A;  2QZ6 A;  2Y2Q A;  3MZD A;  1PZO A;  4OOL A;  4OQH A;  2J8Y A;  2Z2L B;  4O7D A;  4YIN A;  3GRJ A;  1Q2Q A;  1KE3 A;  4KZ7 A;  4P0M A;  1PWD A;  1E3U A;  2WAF A;  5CHJ A;  1BLS A;  1O7E A;  2DNS A;  4XXR A;  3JYI A;  3MZF A;  4FCF A;  1L2S A;  2ZJ9 A;  1CK3 A;  3E2L A;  4GD6 A;  1H8Z A;  1ZC2 A;  5DF7 A;  4DF6 A;  4HES A;  4FSF A;  4S2N A;  1ES5 A;  1K57 A;  4F94 A;  4KZ5 A;  5J8X A;  2WK0 A;  3Q1F A;  3UPN A;  3HUM A;  4N1H A;  4OQI A;  1L0D A;  2ZLY A;  4WM9 A;  4P87 A;  3PBN A;  1MWT A;  3NY4 A;  4BD0 A;  2C6W B;  3BFC A;  1KE0 A;  1ERQ A;  1FQG A;  1HD8 A;  5GLB A;  1L0E A;  3FV7 A;  3N7W A;  1NXY A;  1H8Y A;  5EVI D;  2ZC5 B;  4A5R A;  5F83 A;  5A92 A;  2Y2P A;  4X55 A;  4DDY A;  2PU4 A;  1JWZ A;  3IT9 A;  3P09 A;  5L2F A;  4QY6 A;  1RGZ A;  1QME A;  1N4O A;  3A3E A;  2WUQ A;  2WGW A;  2HP6 A;  1BT5 A;  3G31 A;  4PM7 A;  3M6B A;  4KZ9 A;  1FCO A;  4IVK A;  5D3O A;  4E3M A;  5FAO A;  4N92 A;  4ZBE A;  5IHV A;  3IXB A;  1NJ4 A;  3IF6 A;  4UA6 A;  4OLD A;  1S0W A;  1DJA A;  4R3B A;  3GV9 A;  5E2F A;  5EEC A;  4EBN A;  3VP1 A;  3WS5 A;  1YLW A;  5CTM A;  5FI2 A;  1FSY A;  2X71 A;  4HBU A;  1IEM A;  2HDR A;  4OKP A;  5FQM A;  3DWK A;  1YLJ A;  3WS0 A;  2Y2L A;  2Y2K A;  3UN7 A;  5KZH A;  1RCJ A;  2EFX A;  5EVI A;  1JTD A;  2XLN A;  3ZCZ A;  3OPP A;  1Q2P A;  3G34 A;  4S2J A;  2J7V A;  2OLU A;  3MXR A;  2UWX A;  4WZ5 C;  3VFH A;  1DJC A;  4JBF A;  4X69 A;  1FOF A;  3PAG A;  4BD1 A;  1KGF A;  1L0G A;  3UY6 A;  1PYY A;  1G6A A;  3C4P A;  3OPR A;  2BLS A;  3GTC A;  3SH7 A;  1BUL A;  1ERO A;  2JBF A;  2P9V A;  3TOI A;  3BFF A;  3Q81 A;  4EUZ A;  2XGN A;  2R9X A;  3GVB A;  3FKV A;  5EE8 A;  1W79 A;  1ZKJ A;  3PBO A;  4N9L A;  3HRE A;  1XXM A;  5A93 A;  4LCM A;  1K6S A;  4S2I A;  3ITA A;  1RGY A;  3G2Z A;  5HW3 A;  3SS5 A;  4PM6 A;  2JC7 A;  2JE5 A;  2J9O A;  3PAE A;  3GQZ A;  3O86 A;  5BOH A;  3VP4 A;  3ZDJ A;  1YT4 A;  2ZC6 B;  5CHU A;  2OLV A;  1IKG A;  5HL1 A;  3A3J A;  1XA7 A;  4RVA A;  5DVA A;  1HZO A;  4EV4 A;  2WYX A;  4PM5 A;  4EWF A;  2B5R A;  2Q9M A;  3ZFZ A;  1FCN A;  2ZD8 A;  4QY5 A;  4MBK A;  1NZU A;  3BEB A;  4E6W A;  3VFF A;  4MBH A;  1NYY A;  2XD5 A;  1L0F A;  3PBS A;  3M2K A;  3ZG0 A;  3EQV A;  4S2P A;  4WMC D;  2Y2N A;  2A3U A;  2WKI A;  4K91 A;  4FD8 A;  4Y0U A;  4DE3 A;  1JWP A;  2RCX A;  1DY6 A;  3ITB A;  4BLM A;  3ZG7 B;  3LCE A;  1BLP A;  3MKF A;  1YMX A;  3HL9 A;  2I72 A;  3O87 A;  2R9W A;  2H0Y A;  4JF4 A;  5HAQ A;  1I5Q A;  5FQQ A;  3Q7V A;  3UO9 A;  3PBR A;  4C3Q A;  4JPM A;  4LV2 A;  4QHC A;  4BQM A;  4P6B A;  5FI6 A;  4LV0 A;  3DWZ A;  2WKE A;  3OCL A;  3V39 A;  2XF3 A;  1XGI A;  3RXX A;  2J9P A;  3ZGA B;  3N6I A;  3C5A A;  2JCH A;  1MBL A;  1IKI A;  2EXA A;  2Y91 A;  4B4Z A;  5TGF A;  1IEL A;  2WAD A;  4ID4 A;  4KG2 A;  3HLW A;  3RXW A;  3WS2 A;  4WMC A;  4R23 A;  2HDS A;  5I94 A;  3G32 A;  5FQK A;  1XKZ A;  1M40 A;  3WS4 A;  3PTE A;  1K54 C;  3IF6 B;  2BG1 A;  2HDU A;  4Y0O A;  1YLZ A;  1RP5 A;  4WZ5 A;  4X53 A;  3V3S A;  4DKI A;  3GR2 A;  2FFF B;  4LV3 A;  3UE1 A;  5GHX A;  1LHY A;  3CMZ A;  1FR1 A;  3UE3 A;  1C3B A;  4JLF A;  4HBT A;  3N4I A;  2EX6 A;  4RYE A;  4JXS A;  1I2W A;  5E2G A;  3UPO A;  5F1F A;  2WZZ A;  1QMF A;  1LI9 A;  2ZQ7 A;  1I2S A;  4KQO A;  3MBZ A;  1PW1 A;  4XUZ A;  2XEP A;  3G35 A;  1YLT A;  2P74 A;  2WGV A;  4X68 A;  4DRT A;  4Y0T A;  4EBL A;  1SKF A;  5CEC A;  4GKU A;  4ZJ3 A;  5GHZ A;  3IXD A;  4OPY A;  1K25 A;  3HLD A;  3OPH A;  3MXS A;  5HFO A;  5CEB A;  1KVM A;  5DF8 A;  4E6X A;  4QJG A;  3B3X A;  3G2Y A;  2PBY A;  4R4S A;  1BLC A;  3FKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...