5CRFA

Structure of the penicillin-binding protein pona1 from mycobacterium tuberculosis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
395
structure length
386
Chain Sequence
KGPNGLIERQVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTADNTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPETVIQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the transpeptidase domain of the Mycobacterium tuberculosis penicillin-binding protein PonA1 reveal potential mechanisms of antibiotic resistance.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Penicillin-binding protein
molecule keywords Penicillin-binding protein 1A
total genus 114
structure length 386
sequence length 395
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5crfA00
3GV9A 5FQQA 4GDBA 4OQIA 1CI8A 4P87A 4ZDXA 1I2WA 2H0YA 3G34A 4P0MA 2JBFA 4X56A 4XUXA 3NIAA 3NY4A 3SS3A 5FA7A 2WZZA 4PMAA 4QB8A 3CZDA 4ZTKA 4ZJ3A 2Y2HA 3Q82A 1C3BA 1IKIA 1CK3A 2BG1A 3ZG0A 4WZ5C 3TG9A 4DXCA 3G31A 4B4XA 5EUAA 1FR6A 2Y2JA 3S4XA 2WADA 5BOHA 1I2SA 5FSRA 2H5SA 1PZOA 5AQBA 3LY4A 5HAQA 5M1AA 3RJUA 3CG5A 1RCJA 1MY8A 1YT4A 1TVFA 4QHCA 1NYYA 2R9WA 3GVBA 3HBRA 3NDEA 3UY6A 3WRZA 5A90A 1PW1A 5FATA 4N9KA 1PWDA 2XLNA 1M6KA 4E6WA 3ZNTA 1K56D 5GLDA 3MXSA 2HDSA 4OQGA 2Y55A 2HP5A 4DE0A 3IHBA 1W5DA 3IHAA 4OOYA 4GNUA 2Q9MA 5DVAA 4FCFA 4JPMA 2IWBA 2OV5A 3VP1A 5CEDA 5FDHA 3SH7A 3UE0A 4QJGA 3HLFA 2XK1A 2Y2KA 4WMCD 4R3BA 1TDGA 2H10A 1G68A 1PI5A 1ES4A 2ZC3B 3A3DA 1XGIA 4GOGA 1L0GA 3ZFZA 4OQHA 4KG6A 2HP9A 3IF6C 4X6TA 4KG5A 1Y54A 4GDNA 2V20A 3VSLA 4K0XA 5FAOA 1FOFA 3W4OA 4E3OA 3O87A 4DXBA 4EBNA 4WZ4A 3G4PA 3PBQA 4JF5A 5GLBA 1KE0A 3MBZA 4KZ7A 3CMZA 4DRTA 3BECA 2ZM0A 1EROA 4M3KA 1ZC2A 1K56A 5GLAA 1H8YA 2P9VA 3HLWA 4R1GA 4KQRA 4ZJ2A 1JTDA 4UA9A 4XXRA 4OLGA 5GHXA 4EBPA 2QMIA 1XA7A 4JXGA 1FQGA 3HUOA 4OH0A 3Q7VA 3Q7ZA 2VGKA 5EE8A 3IH9A 2P74A 1W7FA 4WMCA 2XR0A 4DF6A 1BLHA 4JXVA 3IWOA 5E43A 3B3XA 2HDQA 3V50A 2XEPA 2XFTA 5CECA 2Y2MA 1ES5A 1GCEA 3PBRA 5EPHA 1JWPA 2WZXA 4JF6A 3QNCA 4K91A 1BUEA 3HUMA 4EUZA 2OLVA 1DJCA 2XQZA 2G2WA 1KGFA 3GMWA 3IH8A 3MKFA 1IYQA 3IQAA 3P98A 1CEGA 1I5QA 4N9LA 4OKPA 4LCMA 2EXAA 4R4RA 5CRFA 3ZDJA 2ZQ7A 2EX2A 3G30A 1H5XA 1CI9A 2V1ZA 3WWXA 4UA6A 4GZBA 3WS0A 3WRTA 4Q8IA 3O88A 4S2JA 1ONHA 3UE1A 1EI5A 4JXWA 4OONA 3Q81A 5CGXA 5CEBA 3Q07A 4N1HA 5EECA 4RX2A 5TGFA 3HVFA 4WZ5A 3VP2A 1ERMA 2WKIA 5CHMA 5GHZA 4E3JA 4OPZA 5TR7A 1O7EA 1BLPA 2WAEA 3UNWA 2Y91A 4BL2A 3PAEA 3CJMA 1NYMA 2Z2LB 3OC2A 3W8KA 1YLTA 2WGVA 3HREA 1WE4A 3AGFA 3HLDA 3WS5A 1SHVA 3C4PA 2BLSA 3VSKA 4ID4A 3HLGA 4S2NA 5E2FA 2ZLYA 1ES3A 2X02A 1ZKJA 2JE5A 1IEMA 3LO7A 3N7WA 1K54C 1Z6FA 5DTKA 4GD6A 1KGEA 4OLDA 2EXBA 2WKEA 1XPBA 3ZVWA 4BD1A 4MNRA 5FASA 3IXDA 1HD8A 5J8XA 3Q7VB 3DWZA 3ZVTA 1K4FA 3E2LA 4FD8A 3MKEA 5GL9A 4Z9QA 3V5MA 1JWZA 2Y59A 2ZQ9A 3NI9A 5HAPA 4S2PA 1LL5A 3FKWA 2EFUA 4RYEA 1H8ZA 2XF3A 2V2FF 2ZQDA 5D3OA 2XGNA 1FCNA 4KZ5A 4E6XA 1L0DA 3MZEA 4LCLA 1PYYA 3GTCA 1MBLA 4E3NA 1MWUA 5M18A 2A49A 4FSFA 5EVLA 1SCWA 1E3UA 4LV3A 4RX3A 3IF6B 1MPLA 3S1YA 3VOZA 3VMAA 4S2IA 1TDLA 2WAFA 4U0TA 3OCNA 4NK3A 4EBLA 3IWQA 3ZHHA 2ZM2A 1LI9A 4JF4A 3NCKA 4K0WA 4PM7A 4PPRA 1NZUA 1N4OA 4HEFA 5EVIC 1FR1A 1ESUA 1KE3A 4C3QA 4F94A 4QY6A 1VM1A 3BRMA 5FQKA 4DE3A 3ITBA 5F1FA 3M2JA 5FI6A 4BL3A 5EVIA 3VFFA 1LL9A 3HL9A 2HDRA 5CXWA 1N9BA 4KZBA 3OPHA 4EWFA 3WS1A 1QMFA 4GN2A 1FCOA 4R0QA 5CHJA 3SH8A 1HVBA 2Y2LA 4Y7PA 5U47A 1BLCA 2Z2MB 4Y0TA 3NC8A 1CEFA 1RP5A 3UPOA 1Q2PA 4KG2A 3IF6A 3AGDA 1FSYA 4C6YA 4GB7A 3M2KA 4GKUA 3W4PA 3O3VA 4MBFA 1JVJA 2Y2NA 1YLYA 1MWSA 4BD0A 1WYBA 1K55C 2I72A 3NDGA 2RCXA 3C5AA 2DRWA 3N6IA 1PWGA 4FH2A 4LV2A 2P9VB 3PBOA 2IWCA 3A3JA 1SDEA 3QHYA 2OSUA 4S2MA 2PBYA 4JLFA 3DTMA 4KZ9A 3VP3A 3ZGAB 4R3JA 2ZD8A 2JC7A 4N1XA 1LLBA 4UAAA 2EFXA 2ZMAA 3FWLA 1W8QA 1YLWA 4QY5A 1PIOA 4OPRA 5FQ9A 1BULA 1DJBA 3MFDA 3W4QA 3ZCZA 2J9PA 4HESA 3G32A 3IXGA 1AXBA 3PTEA 4KZ8A 4GD8A 5AQ9A 3V39A 4S2LA 1EWZA 1ZG6A 3FV7A 1XXMA 1QMEA 5DF8A 1K6RA 5F82A 3BFEA 2WGWA 1L2SA 4DDSA 1NY0A 1YQSA 4MBKA 4P6BA 1BZAA 2WUQA 2J9OA 3TOIA 5FQJA 3NBLA 3E2KA 5HX9A 1MWTA 3SH9A 4D2OA 4E3KA 1KVMA 2Y2QA 3A3FA 4WELA 3PBNA 5AQ7A 5F1GA 4LENA 4S2KA 4X55A 5CTNA 3HLCA 5KMWA 2ZC4B 3A3IA 3C4OA 1K38A 4BJPA 4JXSA 1YLZA 3ITAA 4IVKA 4KQQA 3PBSA 3GQZA 3ZG7B 2GDNA 3IF5A 3A3EA 4OOMA 3IT9A 4HBTA 5AQAA 5GLCA 4B88A 2ZC5B 2Y2GA 4WEJA 3HLBA 5CTMA 2Y4AA 4DDYA 1IYOA 2X71A 2ZQ8A 3BFGA 2QZ6A 5E2HA 1XGJA 1S0WA 2B5RA 3WS4A 4CJNA 4LV1A 4YINA 4OOLA 5F83A 2WKHA 1IKGA 2Y2IA 4IBXA 4MEZA 3OZHA 1E25A 1JWVA 1KDWA 1YMSA 3UPPA 3FZCA 2EX8A 4ZJ1A 3UO9A 3FKVA 1HZOA 1W8YA 5CGSA 2PU2A 5DF9A 3SS4A 1XP4A 4CPKA 1GA9A 1MWRA 2G2UA 3DW0A 4JKTA 2JCHA 3C7VA 1E3UD 4KZ3A 4U3TA 1DJAA 3O86A 1YM1A 3UE3A 4E3IA 3Q1FA 3WS2A 4WYYA 1SDNA 3BFDA 2A3UA 2VGJA 3I7JA 4EV4A 4S2NC 5A92A 1FCMA 1PW8A 4P85A 1JTGA 5FI7A 5L2FA 3ZG5A 2WYXA 1S6RA 4B4ZA 3UDFA 3IWIA 5CGWA 3VP4A 1PI4A 3MZDA 4E3MA 4OVDA 1K6SA 1XX2A 1SKFA 2HDUA 2J8YA 5G18A 1KE4A 4L0LA 3JYIA 2IWDA 5EVID 3G2YA 4H8RA 4E3LA 5FQMA 2CC1A 5HL1A 3D4FA 3EQUA 3G2ZA 4IVIA 3UDXA 2DNSA 2DCFA 1GHIA 2FFYA 1K57A 4ZAMA 5M19A 4KZ6A 5KZHA 3SOIA 3DWKA 3UN7A 5E2EA 3RXWA 1ALQA 3OCLA 1L0EA 3AGEA 4Y0OA 4O7DA 3S22A 5FI2A 3VOYA 3P09A 4IEDA 5CERA 3ZNYA 2ZQCA 1RGYA 5EVIB 2RL3A 3HUNA 2Y2OA 5IHVA 5KSHA 3FYZA 2ZQAA 4KZAA 3GSGA 4A5RA 1K4EA 3BM6A 2Q9NA 3PBTA 4PM5A 1K57C 1J9MA 4PM6A 1RGZA 5DF7A 2R9XA 4FH4A 1NJ4A 2ZC7A 5DTTA 1K55A 2ZM8A 4RVAA 3BEBA 4DE2A 1BLSA 3GRJA 2WGIA 3ZG9B 2EX6A 1E4DA 4PM9A 3MXRA 2C5WB 4LV0A 4OP5A 5TFQA 5JYOA 4DKIA 1ES2A 4R4SA 1KDSA 3IXBA 2XD5A 1ESIA 2HP6A 1MXOA 4WBGA 1YLPA 2XDMA 3LY3A 3LEZA 4OP8A 4OPQA 1BT5A 1PZPA 3OPLA 4S2OA 1KGGA 1IYSA 1OMEA 2E8IA 1ZG4A 4KQOA 1XA1A 4OPYA 2X01A 3HLEA 5GHYA 4KENB 3MZFA 4XUZA 3UPNA 1MKIA 1GA0A 1XKZA 5CHUA 1M40A 4IBRA 1HTZA 2Y2PA 4JBFA 3TSGA 5HW3A 2ZC6B 2OLUA 5A91A 4HBUA 1G6AA 4Y0UA 4YFMA 3N8RA 4U0XA 2XFSA 2ZJ9A 4X69A 4WEKA 4R23A 3VFHA 3RXXA 2WK0A 4NETA 3BFFA 5EOOA 4QD4A 3QNBA 4DE1A 3C7UA 3IXHA 4UHUA 2UWXA 5HFOA 1GHPA 1LHYA 5HAIA 3BFCA 5E2GA 1BSGA 4C75A 4BENA 3M6BA 3VP0A 1NZOA 3ZG8B 3BLMA 3G35A 1IYPA 4MLLA 4ZBEA 5HARA 4X68A 2FFFB 3N8LA 1NXYA 1YLJA 3OPRA 1GHMA 1YMXA 1DY6A 2QPNA 3PAGA 5FAQA 1IELA 4N92A 3BYDA 1Q2QA 1NRFA 3LCEA 2HPBA 3ISGA 5DTSA 4BLMA 4MBHA 1WYCA 3GR2A 3EQVA 5A93A 2XD1A 2C6WB 1U60A 4OQ0A 4PM8A 1LI0A 3V3RA 1O07A 5I94A 1PWCA 4QU3A 4RA7A 1ONGA 3N4IA 4WM9A 5JYPA 1L0FA 1W79A 2WGWB 3V3SA 2XH9A 1FSWA 4EQIA 4X53A 2PU4A 1K54A 1K25A 3SS5A 3BLSA 2EX9A 1ERQA 4KZ4A 3OPPA 4BQMA 1KVLA 5FAPA 5KSCA 4UA7A 5EOEA 1BTLA 2J7VA 5FQIA 1VQQA 3UDIA 3M6HA 1TEMA 3N8SA 2H0TA
chains in the Genus database with same CATH superfamily
5FQQA 4L9EA 2H0YA 2JBFA 3A0RA 1NLZA 3NIAA 4ZJ3A 1VETA 1CK3A 2Z6CA 5EUAA 3LI8A 3S4XA 4CLCB 2H5SA 5AQBA 1SKOB 2W3DA 4O0PA 2L4RA 2P7JA 4IUKA 3IBRA 1TVFA 2R9WA 1KOUA 1PW1A 1XFNA 4HOIA 5AJGA 3NOTC 3UE6A 4WL9A 3MXSA 4OQGA 4DE0A 3A0VA 2Q9MA 5DVAA 2IWBA 4QJGA 3L9KA 2GJ3A 4BWIA 1ES4A 2ZC3B 1XGIA 4BMWA 1Y54A 3W4OA 4E3OA 5FAOA 4HH3A 4DRTA 3PYPA 1K56A 3VE3A 4PHTA 1JTDA 3PR6A 4JXGA 2P74A 1F5MA 4GLQA 5E43A 3B3XA 4Q0IA 2Y2MA 5EPHA 1JWPA 2WZXA 4KUKA 1UWPX 1BUEA 2OAQ1 3HUMA 2L1MA 4EUZA 1DJCA 2G2WA 2XQZA 3GMWA 3IH8A 3RXXA 3T4JA 4LCMA 4R4RA 4DN0A 5J7EA 1FILA 2EX2A 1H5XA 2V1ZA 3WWXA 4GZBA 2YKFA 5I5LA 4CLCA 3P7NA 2O9BA 4FUWA 3VP2A 3KYEA 4E3JA 1O7EA 1BLPA 3UNWA 2Y91A 3PAEA 1T19A 2Z2LB 2M1CA 3PXPA 3C30A 3HREA 4P6ZS 3HLGA 5E2FA 1ES3A 1ZKJA 1IEMA 4AFIA 2QJ5A 1S67L 5J3WA 4MNRA 3DTEA 1HD8A 3CUEC 3Q7VB 3DWZA 3LI9A 3V5MA 1JWZA 2ZQ9A 3NI9A 4S2PA 3DTIA 4E6XA 1L0DA 4LCLA 1NRJA 1DRMA 2QWSA 4LV3A 3S1YA 1MPLA 5G4ZA 1X0OA 4U0TA 3S7NA 3LFVA 4JGQA 2VEAA 4HEFA 2A24B 1FIKA 1ESUA 1KE3A 1NLYA 4F94A 3ITBA 5F1FA 3M2JA 2PR6A 5EVIA 4IJGA 1N9BA 4KZBA 3WS1A 3G6OA 4R0QA 3SH8A 1HVBA 1BLCA 3DBAA 3NC8A 1CEFA 4EEUA 3W4PA 1T1AA 4O8GA 1HLUP 4L9FA 2VZWA 1WYBA 4BD0A 2UV0E 3H82A 3N6IA 3A3JA 2OSUA 3D9YA 2JN7A 3DTMA 4NG2A 3ZGAB 2ZD8A 2JC7A 5HDSA 2J3TC 1P0ZA 3FWLA 1YLWA 3KYZA 1DJBA 4EEPA 2PBDP 4KZ8A 2XROA 4S2LA 1CF0A 1XXMA 1QMEA 4MN6A 4MBKA 4P6BA 3T4SA 5FQJA 1MWTA 3SH9A 4D2OA 2Y2QA 3A3FA 2OWJA 3PBNA 3MR0A 4Y13A 1S4RA 3C4OA 1K38A 2FZ0A 4JXSA 1G6OA 3PBSA 4UQIM 1JNUA 4HBTA 5AQAA 3DTKA 5CTMA 3OOVA 1UGUA 2KDKA 2ZQ8A 4R70A 5E2HA 1V9ZA 3VE4A 1J3WA 1P9WA 4IBXA 3UB5P 2EX8A 1OPXA 1HZOA 1V9YA 2V8FA 3T1QB 1OJGA 2G2UA 4JKTA 3C7VA 4U3TA 3UE3A 4E3IA 3WS2A 1SDNA 2VX8A 4S2NC 5A92A 5FI7A 2WYXA 3H7WA 1K6SA 1SKFA 5G18A 1VEUB 2IWDA 4DMZA 2LB5A 5HWTA 1GSWA 2W1RA 4Q0HA 3E4QA 1GHIA 2FFYA 4HHDA 5M19A 3KSHA 2VKSA 4LPZA 5E2EA 4IEDA 3ZNYA 2B18A 2JKFA 2RL3A 5KSHA 2ZQAA 3T12B 1K57C 4JGPA 5DF7A 5DTTA 4DE2A 1P97A 3GRJA 2WGIA 2EX6A 4PM9A 3MXRA 2C5WB 5JYOA 3MQQA 3KSGA 1KDSA 3IXBA 5AVEA 2HP6A 4OP8A 4GHIA 1PZPA 4S2OA 2X01A 2VA0A 4EERA 5GHYA 4KENB 4XUZA 1MKIA 2V1BA 4JBFA 3TSGA 4HBUA 4U0XA 3IX3A 4WEKA 3NJAA 3VFHA 1T1BA 5DFXA 1DP8A 5EOOA 4QD4A 3QNBA 3IXHA 2UWXA 1GHPA 3TE8A 3M6BA 3ZG8B 1N9NA 3BLMA 1IYPA 1NXYA 1GHMA 5FAQA 1IELA 4N92A 2OOLA 4MBHA 4OQ0A 3LIBA 5JYPA 5G4YA 1L0FA 3V3SA 2XH9A 4X53A 4KZ4A 4CLCC 5KSCA 5FAPA 4NXFA 1LL8A 3D72A 4RQ9A 3H9WA 1VQQA 2ZOIA 3BY9A 3GDIA 4GDBA 4OQIA 3NULA 3G34A 3D3OA 2WZZA 3A0SA 4DJ2A 2Y2HA 3LICA 3Q82A 2G7UA 4WZ5C 3TG9A 4DXCA 2WADA 5BOHA 5HAQA 3RJUA 1T18A 3UY6A 5HSQA 4QHCA 3GVBA 5A90A 3QP8A 5FATA 1M6KA 4E6WA 3JVVA 5IT5A 3HJIA 2KOIA 2Y55A 2HP5A 1YSPA 3IHAA 4FCFA 4JPMA 5CEDA 3SH7A 3UE0A 2ZBBA 1G68A 3A3DA 5A8BA 1L0GA 2WKQA 4KG5A 3VSLA 2V20A 1F9IA 3G4PA 3PBQA 3CPTB 3MBZA 3CMZA 2ZM0A 1EROA 1PRQA 1H8YA 2P9VA 4R1GA 5EM1A 4KQRA 1ODVA 4ZJ2A 4UA9A 4OLGA 2QMIA 1XA7A 3HUOA 4ARZB 1VB6A 3Q7ZA 3HCYA 4WMCA 4DF6A 1BLHA 3IWOA 2BTFP 2XEPA 5CECA 1ES5A 3BQ8A 2J80A 2PYPA 1P9RA 4PAUA 5CRFA 1CEGA 3B42A 3ZDJA 3G30A 1CI9A 1A0KA 3WRTA 3O88A 4S2JA 2INWA 5CEBA 3Q07A 3H7WB 1ERMA 2WKIA 5CHMA 5TR7A 4FOFA 4BL2A 3OC2A 4Y2FA 3AGFA 3WS5A 1SHVA 2BLSA 2PT7A 4S2NA 1TS8A 3PHYA 2ZLYA 2VGLS 4R6LA 3LO7A 5HPIA 2OAP1 1KGEA 4OLDA 3FPVA 3ZVWA 3IXDA 1XJ2A 4KQDA 3V67A 4DJ3A 1K4FA 4HQAA 3EEHA 3MKEA 4Z9QA 2Y59A 1ACFA 3TW8A 4RYEA 3UB8A 5D3OA 4LLOB 3MZEA 2MJ6A 1PYYA 5F68A 1MWUA 3IF6B 4LFUA 4S2IA 1TDLA 4XT2A 2WAFA 4NK3A 4EBLA 3MJQA 4Z1WA 3ZHHA 2ZM2A 1LI9A 4ESPA 2GNXA 1NZUA 4MN7A 1FR1A 1VM1A 3BRMA 1N9OA 1N9LA 5FQKA 4DE3A 3UMDA 4IUHA 4GS9A 5CXWA 3OPHA 4EWFA 4GN2A 5CHJA 2M7UA 3UPOA 3R4KA 4MBFA 5FL3A 1MWSA 3NDGA 2RCXA 4WF0A 3SW1A 4FH2A 3PBOA 4HJ4A 3RH8B 3QHYA 4S2MA 4GJ4A 3E4OA 3LIFA 2J3WA 1MC0A 4UAAA 2VV8A 2EFXA 3LR3A 1PIOA 4K08A 3MFDA 3W4QA 2J9PA 3G32A 3IXGA 1AXBA 2HJEA 3PTEA 5AQ9A 3FV7A 1K6RA 1NY0A 2WUQA 2J9OA 3NBLA 2O99A 1KVMA 5AQ7A 5F1GA 4LENA 4S2KA 5TJJA 3HLCA 2PRFA 3A3IA 2IA2A 3IF5A 2PD8A 4YNRA 3HLBA 2Y4AA 4GW9A 1LSXA 4UEYA 3HJKA 3F1OB 2B5RA 4YINA 2WKHA 1IKGA 1G5UA 1KDWA 1YMSA 3FZCA 4ZJ1A 2HZ5A 2KX6A 3CUEA 1TS0A 2PU2A 5DF9A 2Y8HA 4EXOA 4CPKA 1GA9A 3DW0A 2ZL1B 1VETB 3O86A 4CQHA 2VK3A 4LGWA 2VGJA 1FCMA 1JTGA 5L2FA 1VEUA 4B4ZA 3UDFA 5CGWA 4E3MA 2HDUA 1MZUA 2P04A 3MQ0A 4L0LA 3G2YA 4WN5A 3E0YA 4IVIA 2DNSA 4YWZA 4H6JB 2V0WA 2D02A 4ZAMA 4MMNA 4KZ6A 3SOIA 3UN7A 1ALQA 1L0EA 3S22A 4O7DA 5HWWA 1RGYA 5IHVA 1CQAA 3GSGA 1K4EA 3PBTA 1J9MA 3MQOA 4HNBA 1RGZA 1NJ4A 2PHYA 2W3HA 5K5BA 1L3LA 2CMNA 5TFQA 1YPRA 3QP2A 4KUOA 4ETZA 2VLGA 4NXGA 4WBGA 1MXOA 3LY3A 3LEZA 1BT5A 3OPLA 1OMEA 4KQOA 2ZL1A 3HLEA 1XJ6A 3UPNA 1XKZA 5CHUA 2VV7A 1HTZA 2Y2PA 2ZC6B 5A91A 2HGVA 2ZJ9A 1OTIA 3CAXA 4WUJA 3T50A 4QPRA 2BASA 2V1AA 3BFFA 3U4LP 4ARZA 4DE1A 4I3AA 5HAIA 3BFCA 4H6JA 1ZTUA 2W0NA 1IFQA 4MLLA 4X68A 2FFFB 1YLJA 5HZHA 1YMXA 4F3LA 2YKHA 3KX0X 3BYDA 1NRFA 3ZYTA 3ISGA 5DTSA 1VHMA 1MKMA 4GS9B 2XD1A 5A93A 1U60A 4PM8A 3LIAA 4RA7A 2WGWB 3IBJA 1TS6A 4ZRRA 1LSVA 5DJTA 1KVLA 5EOEA 2J7VA 4Q0JA 3M6HA 1TEMA 1F98A 2H0TA 3GV9A 4P87A 4ZDXA 4P0MA 4X56A 1G28A 3NY4A 5FA7A 4QB8A 4ZTKA 3CZDA 3ZQ5A 1C3BA 1IKIA 3T4QA 2BG1A 3CHWP 1CJFA 2W3GA 3G31A 1FR6A 5EVEA 4B4XA 4B9OA 3MFXA 3OBFA 4II7A 5FSRA 1PZOA 3LY4A 5M1AA 5L09A 3LUQA 1OJ5A 1W63M 1RCJA 1DP6A 1MY8A 1NYYA 2W1TA 3WRZA 1K56D 5GLDA 2HDSA 1W5DA 4D60A 3VP1A 5FDHA 3HLFA 2XK1A 5HD3A 1PI5A 3ZFZA 4Y17A 4KG6A 3IF6C 4E04A 4GDNA 3LIEA 3O87A 4WZ4A 4FTXA 4JF5A 1KE0A 4KZ7A 1ZC2A 1S1YA 2HV1A 1UWNX 1TD5A 1LSWA 5EE8A 5CX7A 1W7FA 2XRNA 3JVUA 4Y15A 3NOUC 4JXVA 3V50A 2I9VA 4JF6A 3QNCA 2OLVA 1KGFA 3MKFA 4OKPA 1STZA 2XSSA 2EXAA 2V0UA 2HJ9C 3WS0A 3U2AA 3UMEA 3Q81A 5CGXA 5EECA 1DP9A 4RX2A 3ULFA 3HVFA 4PKYG 5GHZA 4OPZA 2NUTC 1OT6A 2WAEA 1NYMA 3W8KA 4EESA 1YLTA 3HLDA 2VJWA 3C4PA 3VSKA 4ID4A 2X02A 1K54C 2OWHA 2ZMVA 5DTKA 4GD6A 2EXBA 2W3FA 1XPBA 3EGXC 4EETB 5FASA 4PKYA 5HDCA 5J8XA 3KYQA 4NXBA 3ZVTA 3ICYA 4FD8A 5F5YA 4HP4A 2PYRA 3S7PA 4IHQA 2EFUA 2XF3A 2V2FF 2ZQDA 3GECA 4BBVA 2XGNA 4KZ5A 4CLCE 3LGOA 3GTCA 2A49A 5EVLA 1OTDA 2V8CA 5TBMA 3BWLA 4FSFA 3TRCA 3VMAA 2PR5A 2WKRA 5LBRA 4HH2A 4WLAA 3FC7A 3NCKA 4K0WA 2Q0OA 4C3QA 4QY6A 3VFFA 1LL9A 1GSXA 4HY8A 4HI4A 1QMFA 1FCOA 4Y7PA 4JGRA 5U47A 1RP5A 3IF6A 1FSYA 1EW0A 4GKUA 3M2KA 3O3VA 3LIDA 1JVJA 4MDZA 1YLYA 1K0KA 1K55C 3C5AA 1ZHHB 1PNEA 1PWGA 2P9VB 2IWCA 3F1NB 2PBYA 3IX4A 3VP3A 4N1XA 1LLBA 3R7WA 3CI6A 2JKRI 1SZVA 1W8QA 4QY5A 5FQ9A 4OPRA 3ZCZA 4HESA 3L7HA 3F1OA 4GD8A 1EWZA 4P6ZM 3BFEA 5F82A 4DDSA 1L2SA 1YQSA 4CLCD 3E2KA 2B02A 4E3KA 4WELA 2K2NA 4ME4A 4QWOA 2O9AA 4UQIS 5KMWA 2ZC4B 3BJNA 4BJPA 3H82B 2DMWA 4OOMA 4LRYC 3BW6A 3IT9A 5GLCA 4WEJA 3BFGA 2QZ6A 1XGJA 1S0WA 5F83A 3OZHA 3UO9A 3FKVA 3DAVA 1W8YA 3LR4A 4EQ1A 1MWRA 1E3UD 2W1TB 1YM1A 4WYYA 3I7JA 1S66L 4P85A 3K3DA 1S6RA 4I5SA 2K7SA 3VP4A 1PI4A 2QHKA 4OVDA 1XX2A 3F1PA 5C5KA 3JYIA 3KSIA 4H8RA 4E3LA 5FQMA 5HL1A 3QP6A 4HJ6A 3SZTA 1K57A 4X1LA 5L10A 3RXWA 2EWVA 3AGEA 5FI2A 3T1RA 3VOYA 5CERA 5EVIB 3HUNA 3BM6A 2Q9NA 4PM5A 2AVXA 4FH4A 2ZC7A 2O9CA 4RVAA 1BLSA 3ZG9B 1E4DA 5EFWA 2XD5A 1SKOA 1YLPA 4O01A 4R3AA 4OPQA 1XJ4A 2E8IA 3CITA 5J4EA 1ZG4A 3EGDC 3MZFA 1M40A 1PFLA 5DKLA 4IBRA 5HW3A 2OLUA 1G6AA 4Y0UA 3N8RA 4X69A 2EA9A 2XFSA 4R23A 2WK0A 1H0MA 4EW7A 5AVFA 2W27A 4I39A 3BQAA 5HFOA 1LHYA 5E2GA 1BSGA 4C75A 4XT2B 3VP0A 3MXQA 1NZOA 4JGOA 3G35A 3W2ZA 4ZBEA 5HARA 3N8LA 3OPRA 3QP1A 1Q2QA 3NECA 1OTAA 2EWWA 2HPBA 5DJUA 1WYCA 1F2KA 2C6WB 2ZOHA 2A2LA 4MCWA 1LI0A 1W63Q 5I94A 1ONGA 3N4IA 1FSWA 2PU4A 3BLSA 5F69A 3OPPA 2QJ7A 4UA7A 4I3IA 5FQIA 3T4TA 3TJZC 3N8SA 3ZG7B 3JPUA 3T1SA 3KO6A 1CI8A 1I2WA 4HJ3A 4X25A 4XUXA 3SS3A 2VGLM 3T4KA 4PMAA 3O5YA 3ZG0A 3T1XA 2Y2JA 2ZMFA 1I2SA 3FG8A 4YOFA 3T4OA 3KSFA 3IX8A 5HDDA 2B95A 3CG5A 1YT4A 3FPWA 5MC7A 3HBRA 3NDEA 4EUVA 4N9KA 1PWDA 2XLNA 1TF1A 1XJ3A 3ZNTA 5FEFA 3C38A 3IHBA 1LT0A 2V9AA 4OOYA 4GNUA 2OV5A 4GCZA 2Y2KA 4X1MA 3VOLA 4WMCD 4G3VA 4R3BA 1TDGA 1IOUA 2H10A 4GOGA 4OQHA 2HP9A 4X6TA 4F3LB 3K3CA 4K0XA 4DXBA 1FOFA 4L9GA 4EBNA 4LRXC 5GLBA 4M4XA 1TS7A 3BECA 4M3KA 5GLAA 3HLWA 3MF0A 2O0YA 5FEGA 4XXRA 5GHXA 4EBPA 4OH0A 1FQGA 5F6AA 5L8MA 3Q7VA 2VGKA 3IH9A 4LRZE 2XR0A 3CLOA 4HIAA 3UB9A 3NOPC 3QP5A 2GX5A 2HDQA 2XFTA 1GCEA 3PBRA 5HWVA 4K91A 2E8JA 4BLMA 3P98A 1IYQA 3IQAA 1I5QA 4N9LA 3QP4A 2ACGA 2ZQ7A 2QKPA 3E4PA 4Q8IA 4UA6A 1ONHA 3UE1A 1EI5A 3EOIA 4JXWA 4OONA 1WA9A 3F1PB 3K2NA 4N1HA 5TGFA 4WZ5A 5TBMB 3CJMA 2WGVA 1WE4A 2A24A 2P08A 2JE5A 3B33A 3N7WA 1Z6FA 3B47A 2WKEA 4BD1A 2GZAA 3E2LA 5GL9A 2FH5A 5HAPA 5HPFA 1LL5A 2JKGA 3FKWA 2L0WA 1H8ZA 1S1ZA 1FCNA 2H28A 4E3NA 1MBLA 4BBUA 5M18A 1SCWA 5HL6A 1E3UA 4RX3A 2Z6DA 3VOZA 1D1JA 4I38A 3OCNA 3IWQA 4JF4A 2KLIA 3IS2B 4PM7A 4PPRA 1N4OA 5EVIC 1Y28A 2LB9A 5FI6A 4BL3A 3HL9A 2HDRA 3MS6A 2Y79A 4ETXA 2Y2LA 2Z2MB 5DKKA 4Y0TA 1D06A 1Q2PA 4KG2A 3AGDA 3R7WB 4GB7A 4C6YA 3CPTA 2NUPC 2Y2NA 3RTYA 2I72A 2DRWA 4LV2A 1SDEA 4JLFA 3LYXA 3EEAA 4KZ9A 4R3JA 2ZMAA 3C8CA 5FDSA 1BULA 2K31A 2HF6A 3V39A 1ZG6A 5DF8A 2WGWA 3S7QA 1BZAA 3TOIA 5HX9A 4BBTA 3E98A 4NKPA 3NHQA 4X55A 5CTNA 1S4SA 5DFYA 1YLZA 3ITAA 4IVKA 4KQQA 3GQZA 2GDNA 1YAXA 4G3KA 3A3EA 4B88A 2ZC5B 2Y2GA 3T4LA 4DDYA 1IYOA 2X71A 4G3WA 3BY8A 3UB7A 3WS4A 4CJNA 4LV1A 4OOLA 2Y2IA 4MEZA 2XA7M 1E25A 1JWVA 5HD5A 3UPPA 4B93A 5CGSA 2PD7A 4HP9A 3SS4A 4Y3IA 1XP4A 3C2WA 2JCHA 4KZ3A 1DJAA 3Q1FA 3EWKA 3BFDA 2A3UA 4EV4A 1PW8A 1OTBA 3S7OA 2J3TD 3ZG5A 2JKTI 3IWIA 3LR5A 3MZDA 1GSVA 3LEQA 4Y5FA 2J8YA 1KE4A 5IU1A 5EVID 4R38A 5KIZA 2CC1A 3D4FA 3EQUA 3G2ZA 3UDXA 2DCFA 2R78A 4NEED 1T1CA 2VV6A 2PDRA 5KZHA 3DWKA 2JHEA 3OCLA 4Y0OA 1YKDA 3P09A 2ZQCA 2PAVP 1AWIA 2Y2OA 3FYZA 4KZAA 4A5RA 3CWFA 4PM6A 2XA7S 2M7VA 3F1NA 2R9XA 1K55A 2ZM8A 3BEBA 5L07A 3MMHA 4LV0A 4OP5A 4DKIA 4R4SA 1ES2A 1NWZA 3LR0A 1ESIA 2XDMA 1KGGA 1IYSA 1XA1A 4OPYA 3RFBA 3VV4A 2QYBA 1YSQA 1GA0A 1D7EA 2WKPA 1Y4OA 4I3JA 4EU0A 4YFMA 2JKRM 5IS1A 4MN5A 3OLOA 4NETA 1BYWA 2D01A 3C7UA 2W3EA 4UHUA 4GHIB 4BENA 2JKTM 1H3QA 3UB6A 3MSHA 2QPNA 1DY6A 3PAGA 1H8MA 3LCEA 4NXEA 3GR2A 3EQVA 3V3RA 1O07A 3P01A 1PWCA 4QU3A 4WM9A 1OT9A 1W79A 4EQIA 3SS5A 1K54A 1K25A 1XFQA 1Z09A 1OTEA 1ERQA 2EX9A 5EM0A 4BQMA 3IS2A 1BTLA 3UDIA 5EV0A
chains in the Genus database with same CATH topology
3GV9A 5FQQA 4GDBA 4OQIA 1CI8A 4P87A 4ZDXA 1I2WA 2H0YA 3G34A 4P0MA 2JBFA 4X56A 4XUXA 3NIAA 3NY4A 3SS3A 5FA7A 2WZZA 4PMAA 4QB8A 3CZDA 4ZTKA 4ZJ3A 2Y2HA 3Q82A 1C3BA 1IKIA 1CK3A 2BG1A 3ZG0A 4WZ5C 3TG9A 4DXCA 3G31A 4B4XA 5EUAA 1FR6A 2Y2JA 3S4XA 2WADA 5BOHA 1I2SA 5FSRA 2H5SA 1PZOA 5AQBA 3LY4A 5HAQA 5M1AA 3RJUA 3CG5A 1RCJA 1MY8A 1YT4A 1TVFA 4QHCA 1NYYA 2R9WA 3GVBA 3HBRA 3NDEA 3UY6A 3WRZA 5A90A 1PW1A 5FATA 4N9KA 1PWDA 2XLNA 1M6KA 4E6WA 3ZNTA 1K56D 5GLDA 3MXSA 2HDSA 4OQGA 2Y55A 2HP5A 4DE0A 3IHBA 1W5DA 3IHAA 4OOYA 4GNUA 2Q9MA 5DVAA 4FCFA 4JPMA 2IWBA 2OV5A 3VP1A 5CEDA 5FDHA 3SH7A 3UE0A 4QJGA 3HLFA 2XK1A 2Y2KA 4WMCD 4R3BA 1TDGA 2H10A 1G68A 1PI5A 1ES4A 2ZC3B 3A3DA 1XGIA 4GOGA 1L0GA 3ZFZA 4OQHA 4KG6A 2HP9A 3IF6C 4X6TA 4KG5A 1Y54A 4GDNA 2V20A 3VSLA 4K0XA 5FAOA 1FOFA 3W4OA 4E3OA 3O87A 4DXBA 4EBNA 4WZ4A 3G4PA 3PBQA 4JF5A 5GLBA 1KE0A 3MBZA 4KZ7A 3CMZA 4DRTA 3BECA 2ZM0A 1EROA 4M3KA 1ZC2A 1K56A 5GLAA 1H8YA 2P9VA 3HLWA 4R1GA 4KQRA 4ZJ2A 1JTDA 4UA9A 4XXRA 4OLGA 5GHXA 4EBPA 2QMIA 1XA7A 4JXGA 1FQGA 3HUOA 4OH0A 3Q7VA 3Q7ZA 2VGKA 5EE8A 3IH9A 2P74A 1W7FA 4WMCA 2XR0A 4DF6A 1BLHA 4JXVA 3IWOA 5E43A 3B3XA 2HDQA 3V50A 2XEPA 2XFTA 5CECA 2Y2MA 1ES5A 1GCEA 3PBRA 5EPHA 1JWPA 2WZXA 4JF6A 3QNCA 4K91A 1BUEA 3HUMA 4EUZA 2OLVA 1DJCA 2XQZA 2G2WA 1KGFA 3GMWA 3IH8A 3MKFA 1IYQA 3IQAA 3P98A 1CEGA 1I5QA 4N9LA 4OKPA 4LCMA 2EXAA 4R4RA 5CRFA 3ZDJA 2ZQ7A 2EX2A 3G30A 1H5XA 1CI9A 2V1ZA 3WWXA 4UA6A 4GZBA 3WS0A 3WRTA 4Q8IA 3O88A 4S2JA 1ONHA 3UE1A 1EI5A 4JXWA 4OONA 3Q81A 5CGXA 5CEBA 3Q07A 4N1HA 5EECA 4RX2A 5TGFA 3HVFA 4WZ5A 3VP2A 1ERMA 2WKIA 5CHMA 5GHZA 4E3JA 4OPZA 5TR7A 1O7EA 1BLPA 2WAEA 3UNWA 2Y91A 4BL2A 3PAEA 3CJMA 1NYMA 2Z2LB 3OC2A 3W8KA 1YLTA 2WGVA 3HREA 1WE4A 3AGFA 3HLDA 3WS5A 1SHVA 3C4PA 2BLSA 3VSKA 4ID4A 3HLGA 4S2NA 5E2FA 2ZLYA 1ES3A 2X02A 1ZKJA 2JE5A 1IEMA 3LO7A 3N7WA 1K54C 1Z6FA 5DTKA 4GD6A 1KGEA 4OLDA 2EXBA 2WKEA 1XPBA 3ZVWA 4BD1A 4MNRA 5FASA 3IXDA 1HD8A 5J8XA 3Q7VB 3DWZA 3ZVTA 1K4FA 3E2LA 4FD8A 3MKEA 5GL9A 4Z9QA 3V5MA 1JWZA 2Y59A 2ZQ9A 3NI9A 5HAPA 4S2PA 1LL5A 3FKWA 2EFUA 4RYEA 1H8ZA 2XF3A 2V2FF 2ZQDA 5D3OA 2XGNA 1FCNA 4KZ5A 4E6XA 1L0DA 3MZEA 4LCLA 1PYYA 3GTCA 1MBLA 4E3NA 1MWUA 5M18A 2A49A 4FSFA 5EVLA 1SCWA 1E3UA 4LV3A 4RX3A 3IF6B 1MPLA 3S1YA 3VOZA 3VMAA 4S2IA 1TDLA 2WAFA 4U0TA 3OCNA 4NK3A 4EBLA 3IWQA 3ZHHA 2ZM2A 1LI9A 4JF4A 3NCKA 4K0WA 4PM7A 4PPRA 1NZUA 1N4OA 4HEFA 5EVIC 1FR1A 1ESUA 1KE3A 4C3QA 4F94A 4QY6A 1VM1A 3BRMA 5FQKA 4DE3A 3ITBA 5F1FA 3M2JA 5FI6A 4BL3A 5EVIA 3VFFA 1LL9A 3HL9A 2HDRA 5CXWA 1N9BA 4KZBA 3OPHA 4EWFA 3WS1A 1QMFA 4GN2A 1FCOA 4R0QA 5CHJA 3SH8A 1HVBA 2Y2LA 4Y7PA 5U47A 1BLCA 2Z2MB 4Y0TA 3NC8A 1CEFA 1RP5A 3UPOA 1Q2PA 4KG2A 3IF6A 3AGDA 1FSYA 4C6YA 4GB7A 3M2KA 4GKUA 3W4PA 3O3VA 4MBFA 1JVJA 2Y2NA 1YLYA 1MWSA 4BD0A 1WYBA 1K55C 2I72A 3NDGA 2RCXA 3C5AA 2DRWA 3N6IA 1PWGA 4FH2A 4LV2A 2P9VB 3PBOA 2IWCA 3A3JA 1SDEA 3QHYA 2OSUA 4S2MA 2PBYA 4JLFA 3DTMA 4KZ9A 3VP3A 3ZGAB 4R3JA 2ZD8A 2JC7A 4N1XA 1LLBA 4UAAA 2EFXA 2ZMAA 3FWLA 1W8QA 1YLWA 4QY5A 1PIOA 4OPRA 5FQ9A 1BULA 1DJBA 3MFDA 3W4QA 3ZCZA 2J9PA 4HESA 3G32A 3IXGA 1AXBA 3PTEA 4KZ8A 4GD8A 5AQ9A 3V39A 4S2LA 1EWZA 1ZG6A 3FV7A 1XXMA 1QMEA 5DF8A 1K6RA 5F82A 3BFEA 2WGWA 1L2SA 4DDSA 1NY0A 1YQSA 4MBKA 4P6BA 1BZAA 2WUQA 2J9OA 3TOIA 5FQJA 3NBLA 3E2KA 5HX9A 1MWTA 3SH9A 4D2OA 4E3KA 1KVMA 2Y2QA 3A3FA 4WELA 3PBNA 5AQ7A 5F1GA 4LENA 4S2KA 4X55A 5CTNA 3HLCA 5KMWA 2ZC4B 3A3IA 3C4OA 1K38A 4BJPA 4JXSA 1YLZA 3ITAA 4IVKA 4KQQA 3PBSA 3GQZA 3ZG7B 2GDNA 3IF5A 3A3EA 4OOMA 3IT9A 4HBTA 5AQAA 5GLCA 4B88A 2ZC5B 2Y2GA 4WEJA 3HLBA 5CTMA 2Y4AA 4DDYA 1IYOA 2X71A 2ZQ8A 3BFGA 2QZ6A 5E2HA 1XGJA 1S0WA 2B5RA 3WS4A 4CJNA 4LV1A 4YINA 4OOLA 5F83A 2WKHA 1IKGA 2Y2IA 4IBXA 4MEZA 3OZHA 1E25A 1JWVA 1KDWA 1YMSA 3UPPA 3FZCA 2EX8A 4ZJ1A 3UO9A 3FKVA 1HZOA 1W8YA 5CGSA 2PU2A 5DF9A 3SS4A 1XP4A 4CPKA 1GA9A 1MWRA 2G2UA 3DW0A 4JKTA 2JCHA 3C7VA 1E3UD 4KZ3A 4U3TA 1DJAA 3O86A 1YM1A 3UE3A 4E3IA 3Q1FA 3WS2A 4WYYA 1SDNA 3BFDA 2A3UA 2VGJA 3I7JA 4EV4A 4S2NC 5A92A 1FCMA 1PW8A 4P85A 1JTGA 5FI7A 5L2FA 3ZG5A 2WYXA 1S6RA 4B4ZA 3UDFA 3IWIA 5CGWA 3VP4A 1PI4A 3MZDA 4E3MA 4OVDA 1K6SA 1XX2A 1SKFA 2HDUA 2J8YA 5G18A 1KE4A 4L0LA 3JYIA 2IWDA 5EVID 3G2YA 4H8RA 4E3LA 5FQMA 2CC1A 5HL1A 3D4FA 3EQUA 3G2ZA 4IVIA 3UDXA 2DNSA 2DCFA 1GHIA 2FFYA 1K57A 4ZAMA 5M19A 4KZ6A 5KZHA 3SOIA 3DWKA 3UN7A 5E2EA 3RXWA 1ALQA 3OCLA 1L0EA 3AGEA 4Y0OA 4O7DA 3S22A 5FI2A 3VOYA 3P09A 4IEDA 5CERA 3ZNYA 2ZQCA 1RGYA 5EVIB 2RL3A 3HUNA 2Y2OA 5IHVA 5KSHA 3FYZA 2ZQAA 4KZAA 3GSGA 4A5RA 1K4EA 3BM6A 2Q9NA 3PBTA 4PM5A 1K57C 1J9MA 4PM6A 1RGZA 5DF7A 2R9XA 4FH4A 1NJ4A 2ZC7A 5DTTA 1K55A 2ZM8A 4RVAA 3BEBA 4DE2A 1BLSA 3GRJA 2WGIA 3ZG9B 2EX6A 1E4DA 4PM9A 3MXRA 2C5WB 4LV0A 4OP5A 5TFQA 5JYOA 4DKIA 1ES2A 4R4SA 1KDSA 3IXBA 2XD5A 1ESIA 2HP6A 1MXOA 4WBGA 1YLPA 2XDMA 3LY3A 3LEZA 4OP8A 4OPQA 1BT5A 1PZPA 3OPLA 4S2OA 1KGGA 1IYSA 1OMEA 2E8IA 1ZG4A 4KQOA 1XA1A 4OPYA 2X01A 3HLEA 5GHYA 4KENB 3MZFA 4XUZA 3UPNA 1MKIA 1GA0A 1XKZA 5CHUA 1M40A 4IBRA 1HTZA 2Y2PA 4JBFA 3TSGA 5HW3A 2ZC6B 2OLUA 5A91A 4HBUA 1G6AA 4Y0UA 4YFMA 3N8RA 4U0XA 2XFSA 2ZJ9A 4X69A 4WEKA 4R23A 3VFHA 3RXXA 2WK0A 4NETA 3BFFA 5EOOA 4QD4A 3QNBA 4DE1A 3C7UA 3IXHA 4UHUA 2UWXA 5HFOA 1GHPA 1LHYA 5HAIA 3BFCA 5E2GA 1BSGA 4C75A 4BENA 3M6BA 3VP0A 1NZOA 3ZG8B 3BLMA 3G35A 1IYPA 4MLLA 4ZBEA 5HARA 4X68A 2FFFB 3N8LA 1NXYA 1YLJA 3OPRA 1GHMA 1YMXA 1DY6A 2QPNA 3PAGA 5FAQA 1IELA 4N92A 3BYDA 1Q2QA 1NRFA 3LCEA 2HPBA 3ISGA 5DTSA 4BLMA 4MBHA 1WYCA 3GR2A 3EQVA 5A93A 2XD1A 2C6WB 1U60A 4OQ0A 4PM8A 1LI0A 3V3RA 1O07A 5I94A 1PWCA 4QU3A 4RA7A 1ONGA 3N4IA 4WM9A 5JYPA 1L0FA 1W79A 2WGWB 3V3SA 2XH9A 1FSWA 4EQIA 4X53A 2PU4A 1K54A 1K25A 3SS5A 3BLSA 2EX9A 1ERQA 4KZ4A 3OPPA 4BQMA 1KVLA 5FAPA 5KSCA 4UA7A 5EOEA 1BTLA 2J7VA 5FQIA 1VQQA 3UDIA 3M6HA 1TEMA 3N8SA 2H0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV9 A;  5FQQ A;  4GDB A;  4OQI A;  1CI8 A;  4P87 A;  4ZDX A;  1I2W A;  2H0Y A;  3G34 A;  4P0M A;  2JBF A;  4X56 A;  4XUX A;  3NIA A;  3NY4 A;  3SS3 A;  5FA7 A;  2WZZ A;  4PMA A;  4QB8 A;  3CZD A;  4ZTK A;  4ZJ3 A;  2Y2H A;  3Q82 A;  1C3B A;  1IKI A;  1CK3 A;  2BG1 A;  3ZG0 A;  4WZ5 C;  3TG9 A;  4DXC A;  3G31 A;  4B4X A;  5EUA A;  1FR6 A;  2Y2J A;  3S4X A;  2WAD A;  5BOH A;  1I2S A;  5FSR A;  2H5S A;  1PZO A;  5AQB A;  3LY4 A;  5HAQ A;  5M1A A;  3RJU A;  3CG5 A;  1RCJ A;  1MY8 A;  1YT4 A;  1TVF A;  4QHC A;  1NYY A;  2R9W A;  3GVB A;  3HBR A;  3NDE A;  3UY6 A;  3WRZ A;  5A90 A;  1PW1 A;  5FAT A;  4N9K A;  1PWD A;  2XLN A;  1M6K A;  4E6W A;  3ZNT A;  1K56 D;  5GLD A;  3MXS A;  2HDS A;  4OQG A;  2Y55 A;  2HP5 A;  4DE0 A;  3IHB A;  1W5D A;  3IHA A;  4OOY A;  4GNU A;  2Q9M A;  5DVA A;  4FCF A;  4JPM A;  2IWB A;  2OV5 A;  3VP1 A;  5CED A;  5FDH A;  3SH7 A;  3UE0 A;  4QJG A;  3HLF A;  2XK1 A;  2Y2K A;  4WMC D;  4R3B A;  1TDG A;  2H10 A;  1G68 A;  1PI5 A;  1ES4 A;  2ZC3 B;  3A3D A;  1XGI A;  4GOG A;  1L0G A;  3ZFZ A;  4OQH A;  4KG6 A;  2HP9 A;  3IF6 C;  4X6T A;  4KG5 A;  1Y54 A;  4GDN A;  2V20 A;  3VSL A;  4K0X A;  5FAO A;  1FOF A;  3W4O A;  4E3O A;  3O87 A;  4DXB A;  4EBN A;  4WZ4 A;  3G4P A;  3PBQ A;  4JF5 A;  5GLB A;  1KE0 A;  3MBZ A;  4KZ7 A;  3CMZ A;  4DRT A;  3BEC A;  2ZM0 A;  1ERO A;  4M3K A;  1ZC2 A;  1K56 A;  5GLA A;  1H8Y A;  2P9V A;  3HLW A;  4R1G A;  4KQR A;  4ZJ2 A;  1JTD A;  4UA9 A;  4XXR A;  4OLG A;  5GHX A;  4EBP A;  2QMI A;  1XA7 A;  4JXG A;  1FQG A;  3HUO A;  4OH0 A;  3Q7V A;  3Q7Z A;  2VGK A;  5EE8 A;  3IH9 A;  2P74 A;  1W7F A;  4WMC A;  2XR0 A;  4DF6 A;  1BLH A;  4JXV A;  3IWO A;  5E43 A;  3B3X A;  2HDQ A;  3V50 A;  2XEP A;  2XFT A;  5CEC A;  2Y2M A;  1ES5 A;  1GCE A;  3PBR A;  5EPH A;  1JWP A;  2WZX A;  4JF6 A;  3QNC A;  4K91 A;  1BUE A;  3HUM A;  4EUZ A;  2OLV A;  1DJC A;  2XQZ A;  2G2W A;  1KGF A;  3GMW A;  3IH8 A;  3MKF A;  1IYQ A;  3IQA A;  3P98 A;  1CEG A;  1I5Q A;  4N9L A;  4OKP A;  4LCM A;  2EXA A;  4R4R A;  5CRF A;  3ZDJ A;  2ZQ7 A;  2EX2 A;  3G30 A;  1H5X A;  1CI9 A;  2V1Z A;  3WWX A;  4UA6 A;  4GZB A;  3WS0 A;  3WRT A;  4Q8I A;  3O88 A;  4S2J A;  1ONH A;  3UE1 A;  1EI5 A;  4JXW A;  4OON A;  3Q81 A;  5CGX A;  5CEB A;  3Q07 A;  4N1H A;  5EEC A;  4RX2 A;  5TGF A;  3HVF A;  4WZ5 A;  3VP2 A;  1ERM A;  2WKI A;  5CHM A;  5GHZ A;  4E3J A;  4OPZ A;  5TR7 A;  1O7E A;  1BLP A;  2WAE A;  3UNW A;  2Y91 A;  4BL2 A;  3PAE A;  3CJM A;  1NYM A;  2Z2L B;  3OC2 A;  3W8K A;  1YLT A;  2WGV A;  3HRE A;  1WE4 A;  3AGF A;  3HLD A;  3WS5 A;  1SHV A;  3C4P A;  2BLS A;  3VSK A;  4ID4 A;  3HLG A;  4S2N A;  5E2F A;  2ZLY A;  1ES3 A;  2X02 A;  1ZKJ A;  2JE5 A;  1IEM A;  3LO7 A;  3N7W A;  1K54 C;  1Z6F A;  5DTK A;  4GD6 A;  1KGE A;  4OLD A;  2EXB A;  2WKE A;  1XPB A;  3ZVW A;  4BD1 A;  4MNR A;  5FAS A;  3IXD A;  1HD8 A;  5J8X A;  3Q7V B;  3DWZ A;  3ZVT A;  1K4F A;  3E2L A;  4FD8 A;  3MKE A;  5GL9 A;  4Z9Q A;  3V5M A;  1JWZ A;  2Y59 A;  2ZQ9 A;  3NI9 A;  5HAP A;  4S2P A;  1LL5 A;  3FKW A;  2EFU A;  4RYE A;  1H8Z A;  2XF3 A;  2V2F F;  2ZQD A;  5D3O A;  2XGN A;  1FCN A;  4KZ5 A;  4E6X A;  1L0D A;  3MZE A;  4LCL A;  1PYY A;  3GTC A;  1MBL A;  4E3N A;  1MWU A;  5M18 A;  2A49 A;  4FSF A;  5EVL A;  1SCW A;  1E3U A;  4LV3 A;  4RX3 A;  3IF6 B;  1MPL A;  3S1Y A;  3VOZ A;  3VMA A;  4S2I A;  1TDL A;  2WAF A;  4U0T A;  3OCN A;  4NK3 A;  4EBL A;  3IWQ A;  3ZHH A;  2ZM2 A;  1LI9 A;  4JF4 A;  3NCK A;  4K0W A;  4PM7 A;  4PPR A;  1NZU A;  1N4O A;  4HEF A;  5EVI C;  1FR1 A;  1ESU A;  1KE3 A;  4C3Q A;  4F94 A;  4QY6 A;  1VM1 A;  3BRM A;  5FQK A;  4DE3 A;  3ITB A;  5F1F A;  3M2J A;  5FI6 A;  4BL3 A;  5EVI A;  3VFF A;  1LL9 A;  3HL9 A;  2HDR A;  5CXW A;  1N9B A;  4KZB A;  3OPH A;  4EWF A;  3WS1 A;  1QMF A;  4GN2 A;  1FCO A;  4R0Q A;  5CHJ A;  3SH8 A;  1HVB A;  2Y2L A;  4Y7P A;  5U47 A;  1BLC A;  2Z2M B;  4Y0T A;  3NC8 A;  1CEF A;  1RP5 A;  3UPO A;  1Q2P A;  4KG2 A;  3IF6 A;  3AGD A;  1FSY A;  4C6Y A;  4GB7 A;  3M2K A;  4GKU A;  3W4P A;  3O3V A;  4MBF A;  1JVJ A;  2Y2N A;  1YLY A;  1MWS A;  4BD0 A;  1WYB A;  1K55 C;  2I72 A;  3NDG A;  2RCX A;  3C5A A;  2DRW A;  3N6I A;  1PWG A;  4FH2 A;  4LV2 A;  2P9V B;  3PBO A;  2IWC A;  3A3J A;  1SDE A;  3QHY A;  2OSU A;  4S2M A;  2PBY A;  4JLF A;  3DTM A;  4KZ9 A;  3VP3 A;  3ZGA B;  4R3J A;  2ZD8 A;  2JC7 A;  4N1X A;  1LLB A;  4UAA A;  2EFX A;  2ZMA A;  3FWL A;  1W8Q A;  1YLW A;  4QY5 A;  1PIO A;  4OPR A;  5FQ9 A;  1BUL A;  1DJB A;  3MFD A;  3W4Q A;  3ZCZ A;  2J9P A;  4HES A;  3G32 A;  3IXG A;  1AXB A;  3PTE A;  4KZ8 A;  4GD8 A;  5AQ9 A;  3V39 A;  4S2L A;  1EWZ A;  1ZG6 A;  3FV7 A;  1XXM A;  1QME A;  5DF8 A;  1K6R A;  5F82 A;  3BFE A;  2WGW A;  1L2S A;  4DDS A;  1NY0 A;  1YQS A;  4MBK A;  4P6B A;  1BZA A;  2WUQ A;  2J9O A;  3TOI A;  5FQJ A;  3NBL A;  3E2K A;  5HX9 A;  1MWT A;  3SH9 A;  4D2O A;  4E3K A;  1KVM A;  2Y2Q A;  3A3F A;  4WEL A;  3PBN A;  5AQ7 A;  5F1G A;  4LEN A;  4S2K A;  4X55 A;  5CTN A;  3HLC A;  5KMW A;  2ZC4 B;  3A3I A;  3C4O A;  1K38 A;  4BJP A;  4JXS A;  1YLZ A;  3ITA A;  4IVK A;  4KQQ A;  3PBS A;  3GQZ A;  3ZG7 B;  2GDN A;  3IF5 A;  3A3E A;  4OOM A;  3IT9 A;  4HBT A;  5AQA A;  5GLC A;  4B88 A;  2ZC5 B;  2Y2G A;  4WEJ A;  3HLB A;  5CTM A;  2Y4A A;  4DDY A;  1IYO A;  2X71 A;  2ZQ8 A;  3BFG A;  2QZ6 A;  5E2H A;  1XGJ A;  1S0W A;  2B5R A;  3WS4 A;  4CJN A;  4LV1 A;  4YIN A;  4OOL A;  5F83 A;  2WKH A;  1IKG A;  2Y2I A;  4IBX A;  4MEZ A;  3OZH A;  1E25 A;  1JWV A;  1KDW A;  1YMS A;  3UPP A;  3FZC A;  2EX8 A;  4ZJ1 A;  3UO9 A;  3FKV A;  1HZO A;  1W8Y A;  5CGS A;  2PU2 A;  5DF9 A;  3SS4 A;  1XP4 A;  4CPK A;  1GA9 A;  1MWR A;  2G2U A;  3DW0 A;  4JKT A;  2JCH A;  3C7V A;  1E3U D;  4KZ3 A;  4U3T A;  1DJA A;  3O86 A;  1YM1 A;  3UE3 A;  4E3I A;  3Q1F A;  3WS2 A;  4WYY A;  1SDN A;  3BFD A;  2A3U A;  2VGJ A;  3I7J A;  4EV4 A;  4S2N C;  5A92 A;  1FCM A;  1PW8 A;  4P85 A;  1JTG A;  5FI7 A;  5L2F A;  3ZG5 A;  2WYX A;  1S6R A;  4B4Z A;  3UDF A;  3IWI A;  5CGW A;  3VP4 A;  1PI4 A;  3MZD A;  4E3M A;  4OVD A;  1K6S A;  1XX2 A;  1SKF A;  2HDU A;  2J8Y A;  5G18 A;  1KE4 A;  4L0L A;  3JYI A;  2IWD A;  5EVI D;  3G2Y A;  4H8R A;  4E3L A;  5FQM A;  2CC1 A;  5HL1 A;  3D4F A;  3EQU A;  3G2Z A;  4IVI A;  3UDX A;  2DNS A;  2DCF A;  1GHI A;  2FFY A;  1K57 A;  4ZAM A;  5M19 A;  4KZ6 A;  5KZH A;  3SOI A;  3DWK A;  3UN7 A;  5E2E A;  3RXW A;  1ALQ A;  3OCL A;  1L0E A;  3AGE A;  4Y0O A;  4O7D A;  3S22 A;  5FI2 A;  3VOY A;  3P09 A;  4IED A;  5CER A;  3ZNY A;  2ZQC A;  1RGY A;  5EVI B;  2RL3 A;  3HUN A;  2Y2O A;  5IHV A;  5KSH A;  3FYZ A;  2ZQA A;  4KZA A;  3GSG A;  4A5R A;  1K4E A;  3BM6 A;  2Q9N A;  3PBT A;  4PM5 A;  1K57 C;  1J9M A;  4PM6 A;  1RGZ A;  5DF7 A;  2R9X A;  4FH4 A;  1NJ4 A;  2ZC7 A;  5DTT A;  1K55 A;  2ZM8 A;  4RVA A;  3BEB A;  4DE2 A;  1BLS A;  3GRJ A;  2WGI A;  3ZG9 B;  2EX6 A;  1E4D A;  4PM9 A;  3MXR A;  2C5W B;  4LV0 A;  4OP5 A;  5TFQ A;  5JYO A;  4DKI A;  1ES2 A;  4R4S A;  1KDS A;  3IXB A;  2XD5 A;  1ESI A;  2HP6 A;  1MXO A;  4WBG A;  1YLP A;  2XDM A;  3LY3 A;  3LEZ A;  4OP8 A;  4OPQ A;  1BT5 A;  1PZP A;  3OPL A;  4S2O A;  1KGG A;  1IYS A;  1OME A;  2E8I A;  1ZG4 A;  4KQO A;  1XA1 A;  4OPY A;  2X01 A;  3HLE A;  5GHY A;  4KEN B;  3MZF A;  4XUZ A;  3UPN A;  1MKI A;  1GA0 A;  1XKZ A;  5CHU A;  1M40 A;  4IBR A;  1HTZ A;  2Y2P A;  4JBF A;  3TSG A;  5HW3 A;  2ZC6 B;  2OLU A;  5A91 A;  4HBU A;  1G6A A;  4Y0U A;  4YFM A;  3N8R A;  4U0X A;  2XFS A;  2ZJ9 A;  4X69 A;  4WEK A;  4R23 A;  3VFH A;  3RXX A;  2WK0 A;  4NET A;  3BFF A;  5EOO A;  4QD4 A;  3QNB A;  4DE1 A;  3C7U A;  3IXH A;  4UHU A;  2UWX A;  5HFO A;  1GHP A;  1LHY A;  5HAI A;  3BFC A;  5E2G A;  1BSG A;  4C75 A;  4BEN A;  3M6B A;  3VP0 A;  1NZO A;  3ZG8 B;  3BLM A;  3G35 A;  1IYP A;  4MLL A;  4ZBE A;  5HAR A;  4X68 A;  2FFF B;  3N8L A;  1NXY A;  1YLJ A;  3OPR A;  1GHM A;  1YMX A;  1DY6 A;  2QPN A;  3PAG A;  5FAQ A;  1IEL A;  4N92 A;  3BYD A;  1Q2Q A;  1NRF A;  3LCE A;  2HPB A;  3ISG A;  5DTS A;  4BLM A;  4MBH A;  1WYC A;  3GR2 A;  3EQV A;  5A93 A;  2XD1 A;  2C6W B;  1U60 A;  4OQ0 A;  4PM8 A;  1LI0 A;  3V3R A;  1O07 A;  5I94 A;  1PWC A;  4QU3 A;  4RA7 A;  1ONG A;  3N4I A;  4WM9 A;  5JYP A;  1L0F A;  1W79 A;  2WGW B;  3V3S A;  2XH9 A;  1FSW A;  4EQI A;  4X53 A;  2PU4 A;  1K54 A;  1K25 A;  3SS5 A;  3BLS A;  2EX9 A;  1ERQ A;  4KZ4 A;  3OPP A;  4BQM A;  1KVL A;  5FAP A;  5KSC A;  4UA7 A;  5EOE A;  1BTL A;  2J7V A;  5FQI A;  1VQQ A;  3UDI A;  3M6H A;  1TEM A;  3N8S A;  2H0T A; 
#chains in the Genus database with same CATH topology
 5FQQ A;  4L9E A;  2H0Y A;  2JBF A;  3A0R A;  1NLZ A;  3NIA A;  4ZJ3 A;  1VET A;  1CK3 A;  2Z6C A;  5EUA A;  3LI8 A;  3S4X A;  4CLC B;  2H5S A;  5AQB A;  1SKO B;  2W3D A;  4O0P A;  2L4R A;  2P7J A;  4IUK A;  3IBR A;  1TVF A;  2R9W A;  1KOU A;  1PW1 A;  1XFN A;  4HOI A;  5AJG A;  3NOT C;  3UE6 A;  4WL9 A;  3MXS A;  4OQG A;  4DE0 A;  3A0V A;  2Q9M A;  5DVA A;  2IWB A;  4QJG A;  3L9K A;  2GJ3 A;  4BWI A;  1ES4 A;  2ZC3 B;  1XGI A;  4BMW A;  1Y54 A;  3W4O A;  4E3O A;  5FAO A;  4HH3 A;  4DRT A;  3PYP A;  1K56 A;  3VE3 A;  4PHT A;  1JTD A;  3PR6 A;  4JXG A;  2P74 A;  1F5M A;  4GLQ A;  5E43 A;  3B3X A;  4Q0I A;  2Y2M A;  5EPH A;  1JWP A;  2WZX A;  4KUK A;  1UWP X;  1BUE A;  2OAQ 1;  3HUM A;  2L1M A;  4EUZ A;  1DJC A;  2G2W A;  2XQZ A;  3GMW A;  3IH8 A;  3RXX A;  3T4J A;  4LCM A;  4R4R A;  4DN0 A;  5J7E A;  1FIL A;  2EX2 A;  1H5X A;  2V1Z A;  3WWX A;  4GZB A;  2YKF A;  5I5L A;  4CLC A;  3P7N A;  2O9B A;  4FUW A;  3VP2 A;  3KYE A;  4E3J A;  1O7E A;  1BLP A;  3UNW A;  2Y91 A;  3PAE A;  1T19 A;  2Z2L B;  2M1C A;  3PXP A;  3C30 A;  3HRE A;  4P6Z S;  3HLG A;  5E2F A;  1ES3 A;  1ZKJ A;  1IEM A;  4AFI A;  2QJ5 A;  1S67 L;  5J3W A;  4MNR A;  3DTE A;  1HD8 A;  3CUE C;  3Q7V B;  3DWZ A;  3LI9 A;  3V5M A;  1JWZ A;  2ZQ9 A;  3NI9 A;  4S2P A;  3DTI A;  4E6X A;  1L0D A;  4LCL A;  1NRJ A;  1DRM A;  2QWS A;  4LV3 A;  3S1Y A;  1MPL A;  5G4Z A;  1X0O A;  4U0T A;  3S7N A;  3LFV A;  4JGQ A;  2VEA A;  4HEF A;  2A24 B;  1FIK A;  1ESU A;  1KE3 A;  1NLY A;  4F94 A;  3ITB A;  5F1F A;  3M2J A;  2PR6 A;  5EVI A;  4IJG A;  1N9B A;  4KZB A;  3WS1 A;  3G6O A;  4R0Q A;  3SH8 A;  1HVB A;  1BLC A;  3DBA A;  3NC8 A;  1CEF A;  4EEU A;  3W4P A;  1T1A A;  4O8G A;  1HLU P;  4L9F A;  2VZW A;  1WYB A;  4BD0 A;  2UV0 E;  3H82 A;  3N6I A;  3A3J A;  2OSU A;  3D9Y A;  2JN7 A;  3DTM A;  4NG2 A;  3ZGA B;  2ZD8 A;  2JC7 A;  5HDS A;  2J3T C;  1P0Z A;  3FWL A;  1YLW A;  3KYZ A;  1DJB A;  4EEP A;  2PBD P;  4KZ8 A;  2XRO A;  4S2L A;  1CF0 A;  1XXM A;  1QME A;  4MN6 A;  4MBK A;  4P6B A;  3T4S A;  5FQJ A;  1MWT A;  3SH9 A;  4D2O A;  2Y2Q A;  3A3F A;  2OWJ A;  3PBN A;  3MR0 A;  4Y13 A;  1S4R A;  3C4O A;  1K38 A;  2FZ0 A;  4JXS A;  1G6O A;  3PBS A;  4UQI M;  1JNU A;  4HBT A;  5AQA A;  3DTK A;  5CTM A;  3OOV A;  1UGU A;  2KDK A;  2ZQ8 A;  4R70 A;  5E2H A;  1V9Z A;  3VE4 A;  1J3W A;  1P9W A;  4IBX A;  3UB5 P;  2EX8 A;  1OPX A;  1HZO A;  1V9Y A;  2V8F A;  3T1Q B;  1OJG A;  2G2U A;  4JKT A;  3C7V A;  4U3T A;  3UE3 A;  4E3I A;  3WS2 A;  1SDN A;  2VX8 A;  4S2N C;  5A92 A;  5FI7 A;  2WYX A;  3H7W A;  1K6S A;  1SKF A;  5G18 A;  1VEU B;  2IWD A;  4DMZ A;  2LB5 A;  5HWT A;  1GSW A;  2W1R A;  4Q0H A;  3E4Q A;  1GHI A;  2FFY A;  4HHD A;  5M19 A;  3KSH A;  2VKS A;  4LPZ A;  5E2E A;  4IED A;  3ZNY A;  2B18 A;  2JKF A;  2RL3 A;  5KSH A;  2ZQA A;  3T12 B;  1K57 C;  4JGP A;  5DF7 A;  5DTT A;  4DE2 A;  1P97 A;  3GRJ A;  2WGI A;  2EX6 A;  4PM9 A;  3MXR A;  2C5W B;  5JYO A;  3MQQ A;  3KSG A;  1KDS A;  3IXB A;  5AVE A;  2HP6 A;  4OP8 A;  4GHI A;  1PZP A;  4S2O A;  2X01 A;  2VA0 A;  4EER A;  5GHY A;  4KEN B;  4XUZ A;  1MKI A;  2V1B A;  4JBF A;  3TSG A;  4HBU A;  4U0X A;  3IX3 A;  4WEK A;  3NJA A;  3VFH A;  1T1B A;  5DFX A;  1DP8 A;  5EOO A;  4QD4 A;  3QNB A;  3IXH A;  2UWX A;  1GHP A;  3TE8 A;  3M6B A;  3ZG8 B;  1N9N A;  3BLM A;  1IYP A;  1NXY A;  1GHM A;  5FAQ A;  1IEL A;  4N92 A;  2OOL A;  4MBH A;  4OQ0 A;  3LIB A;  5JYP A;  5G4Y A;  1L0F A;  3V3S A;  2XH9 A;  4X53 A;  4KZ4 A;  4CLC C;  5KSC A;  5FAP A;  4NXF A;  1LL8 A;  3D72 A;  4RQ9 A;  3H9W A;  1VQQ A;  2ZOI A;  3BY9 A;  3GDI A;  4GDB A;  4OQI A;  3NUL A;  3G34 A;  3D3O A;  2WZZ A;  3A0S A;  4DJ2 A;  2Y2H A;  3LIC A;  3Q82 A;  2G7U A;  4WZ5 C;  3TG9 A;  4DXC A;  2WAD A;  5BOH A;  5HAQ A;  3RJU A;  1T18 A;  3UY6 A;  5HSQ A;  4QHC A;  3GVB A;  5A90 A;  3QP8 A;  5FAT A;  1M6K A;  4E6W A;  3JVV A;  5IT5 A;  3HJI A;  2KOI A;  2Y55 A;  2HP5 A;  1YSP A;  3IHA A;  4FCF A;  4JPM A;  5CED A;  3SH7 A;  3UE0 A;  2ZBB A;  1G68 A;  3A3D A;  5A8B A;  1L0G A;  2WKQ A;  4KG5 A;  3VSL A;  2V20 A;  1F9I A;  3G4P A;  3PBQ A;  3CPT B;  3MBZ A;  3CMZ A;  2ZM0 A;  1ERO A;  1PRQ A;  1H8Y A;  2P9V A;  4R1G A;  5EM1 A;  4KQR A;  1ODV A;  4ZJ2 A;  4UA9 A;  4OLG A;  2QMI A;  1XA7 A;  3HUO A;  4ARZ B;  1VB6 A;  3Q7Z A;  3HCY A;  4WMC A;  4DF6 A;  1BLH A;  3IWO A;  2BTF P;  2XEP A;  5CEC A;  1ES5 A;  3BQ8 A;  2J80 A;  2PYP A;  1P9R A;  4PAU A;  5CRF A;  1CEG A;  3B42 A;  3ZDJ A;  3G30 A;  1CI9 A;  1A0K A;  3WRT A;  3O88 A;  4S2J A;  2INW A;  5CEB A;  3Q07 A;  3H7W B;  1ERM A;  2WKI A;  5CHM A;  5TR7 A;  4FOF A;  4BL2 A;  3OC2 A;  4Y2F A;  3AGF A;  3WS5 A;  1SHV A;  2BLS A;  2PT7 A;  4S2N A;  1TS8 A;  3PHY A;  2ZLY A;  2VGL S;  4R6L A;  3LO7 A;  5HPI A;  2OAP 1;  1KGE A;  4OLD A;  3FPV A;  3ZVW A;  3IXD A;  1XJ2 A;  4KQD A;  3V67 A;  4DJ3 A;  1K4F A;  4HQA A;  3EEH A;  3MKE A;  4Z9Q A;  2Y59 A;  1ACF A;  3TW8 A;  4RYE A;  3UB8 A;  5D3O A;  4LLO B;  3MZE A;  2MJ6 A;  1PYY A;  5F68 A;  1MWU A;  3IF6 B;  4LFU A;  4S2I A;  1TDL A;  4XT2 A;  2WAF A;  4NK3 A;  4EBL A;  3MJQ A;  4Z1W A;  3ZHH A;  2ZM2 A;  1LI9 A;  4ESP A;  2GNX A;  1NZU A;  4MN7 A;  1FR1 A;  1VM1 A;  3BRM A;  1N9O A;  1N9L A;  5FQK A;  4DE3 A;  3UMD A;  4IUH A;  4GS9 A;  5CXW A;  3OPH A;  4EWF A;  4GN2 A;  5CHJ A;  2M7U A;  3UPO A;  3R4K A;  4MBF A;  5FL3 A;  1MWS A;  3NDG A;  2RCX A;  4WF0 A;  3SW1 A;  4FH2 A;  3PBO A;  4HJ4 A;  3RH8 B;  3QHY A;  4S2M A;  4GJ4 A;  3E4O A;  3LIF A;  2J3W A;  1MC0 A;  4UAA A;  2VV8 A;  2EFX A;  3LR3 A;  1PIO A;  4K08 A;  3MFD A;  3W4Q A;  2J9P A;  3G32 A;  3IXG A;  1AXB A;  2HJE A;  3PTE A;  5AQ9 A;  3FV7 A;  1K6R A;  1NY0 A;  2WUQ A;  2J9O A;  3NBL A;  2O99 A;  1KVM A;  5AQ7 A;  5F1G A;  4LEN A;  4S2K A;  5TJJ A;  3HLC A;  2PRF A;  3A3I A;  2IA2 A;  3IF5 A;  2PD8 A;  4YNR A;  3HLB A;  2Y4A A;  4GW9 A;  1LSX A;  4UEY A;  3HJK A;  3F1O B;  2B5R A;  4YIN A;  2WKH A;  1IKG A;  1G5U A;  1KDW A;  1YMS A;  3FZC A;  4ZJ1 A;  2HZ5 A;  2KX6 A;  3CUE A;  1TS0 A;  2PU2 A;  5DF9 A;  2Y8H A;  4EXO A;  4CPK A;  1GA9 A;  3DW0 A;  2ZL1 B;  1VET B;  3O86 A;  4CQH A;  2VK3 A;  4LGW A;  2VGJ A;  1FCM A;  1JTG A;  5L2F A;  1VEU A;  4B4Z A;  3UDF A;  5CGW A;  4E3M A;  2HDU A;  1MZU A;  2P04 A;  3MQ0 A;  4L0L A;  3G2Y A;  4WN5 A;  3E0Y A;  4IVI A;  2DNS A;  4YWZ A;  4H6J B;  2V0W A;  2D02 A;  4ZAM A;  4MMN A;  4KZ6 A;  3SOI A;  3UN7 A;  1ALQ A;  1L0E A;  3S22 A;  4O7D A;  5HWW A;  1RGY A;  5IHV A;  1CQA A;  3GSG A;  1K4E A;  3PBT A;  1J9M A;  3MQO A;  4HNB A;  1RGZ A;  1NJ4 A;  2PHY A;  2W3H A;  5K5B A;  1L3L A;  2CMN A;  5TFQ A;  1YPR A;  3QP2 A;  4KUO A;  4ETZ A;  2VLG A;  4NXG A;  4WBG A;  1MXO A;  3LY3 A;  3LEZ A;  1BT5 A;  3OPL A;  1OME A;  4KQO A;  2ZL1 A;  3HLE A;  1XJ6 A;  3UPN A;  1XKZ A;  5CHU A;  2VV7 A;  1HTZ A;  2Y2P A;  2ZC6 B;  5A91 A;  2HGV A;  2ZJ9 A;  1OTI A;  3CAX A;  4WUJ A;  3T50 A;  4QPR A;  2BAS A;  2V1A A;  3BFF A;  3U4L P;  4ARZ A;  4DE1 A;  4I3A A;  5HAI A;  3BFC A;  4H6J A;  1ZTU A;  2W0N A;  1IFQ A;  4MLL A;  4X68 A;  2FFF B;  1YLJ A;  5HZH A;  1YMX A;  4F3L A;  2YKH A;  3KX0 X;  3BYD A;  1NRF A;  3ZYT A;  3ISG A;  5DTS A;  1VHM A;  1MKM A;  4GS9 B;  2XD1 A;  5A93 A;  1U60 A;  4PM8 A;  3LIA A;  4RA7 A;  2WGW B;  3IBJ A;  1TS6 A;  4ZRR A;  1LSV A;  5DJT A;  1KVL A;  5EOE A;  2J7V A;  4Q0J A;  3M6H A;  1TEM A;  1F98 A;  2H0T A;  3GV9 A;  4P87 A;  4ZDX A;  4P0M A;  4X56 A;  1G28 A;  3NY4 A;  5FA7 A;  4QB8 A;  4ZTK A;  3CZD A;  3ZQ5 A;  1C3B A;  1IKI A;  3T4Q A;  2BG1 A;  3CHW P;  1CJF A;  2W3G A;  3G31 A;  1FR6 A;  5EVE A;  4B4X A;  4B9O A;  3MFX A;  3OBF A;  4II7 A;  5FSR A;  1PZO A;  3LY4 A;  5M1A A;  5L09 A;  3LUQ A;  1OJ5 A;  1W63 M;  1RCJ A;  1DP6 A;  1MY8 A;  1NYY A;  2W1T A;  3WRZ A;  1K56 D;  5GLD A;  2HDS A;  1W5D A;  4D60 A;  3VP1 A;  5FDH A;  3HLF A;  2XK1 A;  5HD3 A;  1PI5 A;  3ZFZ A;  4Y17 A;  4KG6 A;  3IF6 C;  4E04 A;  4GDN A;  3LIE A;  3O87 A;  4WZ4 A;  4FTX A;  4JF5 A;  1KE0 A;  4KZ7 A;  1ZC2 A;  1S1Y A;  2HV1 A;  1UWN X;  1TD5 A;  1LSW A;  5EE8 A;  5CX7 A;  1W7F A;  2XRN A;  3JVU A;  4Y15 A;  3NOU C;  4JXV A;  3V50 A;  2I9V A;  4JF6 A;  3QNC A;  2OLV A;  1KGF A;  3MKF A;  4OKP A;  1STZ A;  2XSS A;  2EXA A;  2V0U A;  2HJ9 C;  3WS0 A;  3U2A A;  3UME A;  3Q81 A;  5CGX A;  5EEC A;  1DP9 A;  4RX2 A;  3ULF A;  3HVF A;  4PKY G;  5GHZ A;  4OPZ A;  2NUT C;  1OT6 A;  2WAE A;  1NYM A;  3W8K A;  4EES A;  1YLT A;  3HLD A;  2VJW A;  3C4P A;  3VSK A;  4ID4 A;  2X02 A;  1K54 C;  2OWH A;  2ZMV A;  5DTK A;  4GD6 A;  2EXB A;  2W3F A;  1XPB A;  3EGX C;  4EET B;  5FAS A;  4PKY A;  5HDC A;  5J8X A;  3KYQ A;  4NXB A;  3ZVT A;  3ICY A;  4FD8 A;  5F5Y A;  4HP4 A;  2PYR A;  3S7P A;  4IHQ A;  2EFU A;  2XF3 A;  2V2F F;  2ZQD A;  3GEC A;  4BBV A;  2XGN A;  4KZ5 A;  4CLC E;  3LGO A;  3GTC A;  2A49 A;  5EVL A;  1OTD A;  2V8C A;  5TBM A;  3BWL A;  4FSF A;  3TRC A;  3VMA A;  2PR5 A;  2WKR A;  5LBR A;  4HH2 A;  4WLA A;  3FC7 A;  3NCK A;  4K0W A;  2Q0O A;  4C3Q A;  4QY6 A;  3VFF A;  1LL9 A;  1GSX A;  4HY8 A;  4HI4 A;  1QMF A;  1FCO A;  4Y7P A;  4JGR A;  5U47 A;  1RP5 A;  3IF6 A;  1FSY A;  1EW0 A;  4GKU A;  3M2K A;  3O3V A;  3LID A;  1JVJ A;  4MDZ A;  1YLY A;  1K0K A;  1K55 C;  3C5A A;  1ZHH B;  1PNE A;  1PWG A;  2P9V B;  2IWC A;  3F1N B;  2PBY A;  3IX4 A;  3VP3 A;  4N1X A;  1LLB A;  3R7W A;  3CI6 A;  2JKR I;  1SZV A;  1W8Q A;  4QY5 A;  5FQ9 A;  4OPR A;  3ZCZ A;  4HES A;  3L7H A;  3F1O A;  4GD8 A;  1EWZ A;  4P6Z M;  3BFE A;  5F82 A;  4DDS A;  1L2S A;  1YQS A;  4CLC D;  3E2K A;  2B02 A;  4E3K A;  4WEL A;  2K2N A;  4ME4 A;  4QWO A;  2O9A A;  4UQI S;  5KMW A;  2ZC4 B;  3BJN A;  4BJP A;  3H82 B;  2DMW A;  4OOM A;  4LRY C;  3BW6 A;  3IT9 A;  5GLC A;  4WEJ A;  3BFG A;  2QZ6 A;  1XGJ A;  1S0W A;  5F83 A;  3OZH A;  3UO9 A;  3FKV A;  3DAV A;  1W8Y A;  3LR4 A;  4EQ1 A;  1MWR A;  1E3U D;  2W1T B;  1YM1 A;  4WYY A;  3I7J A;  1S66 L;  4P85 A;  3K3D A;  1S6R A;  4I5S A;  2K7S A;  3VP4 A;  1PI4 A;  2QHK A;  4OVD A;  1XX2 A;  3F1P A;  5C5K A;  3JYI A;  3KSI A;  4H8R A;  4E3L A;  5FQM A;  5HL1 A;  3QP6 A;  4HJ6 A;  3SZT A;  1K57 A;  4X1L A;  5L10 A;  3RXW A;  2EWV A;  3AGE A;  5FI2 A;  3T1R A;  3VOY A;  5CER A;  5EVI B;  3HUN A;  3BM6 A;  2Q9N A;  4PM5 A;  2AVX A;  4FH4 A;  2ZC7 A;  2O9C A;  4RVA A;  1BLS A;  3ZG9 B;  1E4D A;  5EFW A;  2XD5 A;  1SKO A;  1YLP A;  4O01 A;  4R3A A;  4OPQ A;  1XJ4 A;  2E8I A;  3CIT A;  5J4E A;  1ZG4 A;  3EGD C;  3MZF A;  1M40 A;  1PFL A;  5DKL A;  4IBR A;  5HW3 A;  2OLU A;  1G6A A;  4Y0U A;  3N8R A;  4X69 A;  2EA9 A;  2XFS A;  4R23 A;  2WK0 A;  1H0M A;  4EW7 A;  5AVF A;  2W27 A;  4I39 A;  3BQA A;  5HFO A;  1LHY A;  5E2G A;  1BSG A;  4C75 A;  4XT2 B;  3VP0 A;  3MXQ A;  1NZO A;  4JGO A;  3G35 A;  3W2Z A;  4ZBE A;  5HAR A;  3N8L A;  3OPR A;  3QP1 A;  1Q2Q A;  3NEC A;  1OTA A;  2EWW A;  2HPB A;  5DJU A;  1WYC A;  1F2K A;  2C6W B;  2ZOH A;  2A2L A;  4MCW A;  1LI0 A;  1W63 Q;  5I94 A;  1ONG A;  3N4I A;  1FSW A;  2PU4 A;  3BLS A;  5F69 A;  3OPP A;  2QJ7 A;  4UA7 A;  4I3I A;  5FQI A;  3T4T A;  3TJZ C;  3N8S A;  3ZG7 B;  3JPU A;  3T1S A;  3KO6 A;  1CI8 A;  1I2W A;  4HJ3 A;  4X25 A;  4XUX A;  3SS3 A;  2VGL M;  3T4K A;  4PMA A;  3O5Y A;  3ZG0 A;  3T1X A;  2Y2J A;  2ZMF A;  1I2S A;  3FG8 A;  4YOF A;  3T4O A;  3KSF A;  3IX8 A;  5HDD A;  2B95 A;  3CG5 A;  1YT4 A;  3FPW A;  5MC7 A;  3HBR A;  3NDE A;  4EUV A;  4N9K A;  1PWD A;  2XLN A;  1TF1 A;  1XJ3 A;  3ZNT A;  5FEF A;  3C38 A;  3IHB A;  1LT0 A;  2V9A A;  4OOY A;  4GNU A;  2OV5 A;  4GCZ A;  2Y2K A;  4X1M A;  3VOL A;  4WMC D;  4G3V A;  4R3B A;  1TDG A;  1IOU A;  2H10 A;  4GOG A;  4OQH A;  2HP9 A;  4X6T A;  4F3L B;  3K3C A;  4K0X A;  4DXB A;  1FOF A;  4L9G A;  4EBN A;  4LRX C;  5GLB A;  4M4X A;  1TS7 A;  3BEC A;  4M3K A;  5GLA A;  3HLW A;  3MF0 A;  2O0Y A;  5FEG A;  4XXR A;  5GHX A;  4EBP A;  4OH0 A;  1FQG A;  5F6A A;  5L8M A;  3Q7V A;  2VGK A;  3IH9 A;  4LRZ E;  2XR0 A;  3CLO A;  4HIA A;  3UB9 A;  3NOP C;  3QP5 A;  2GX5 A;  2HDQ A;  2XFT A;  1GCE A;  3PBR A;  5HWV A;  4K91 A;  2E8J A;  4BLM A;  3P98 A;  1IYQ A;  3IQA A;  1I5Q A;  4N9L A;  3QP4 A;  2ACG A;  2ZQ7 A;  2QKP A;  3E4P A;  4Q8I A;  4UA6 A;  1ONH A;  3UE1 A;  1EI5 A;  3EOI A;  4JXW A;  4OON A;  1WA9 A;  3F1P B;  3K2N A;  4N1H A;  5TGF A;  4WZ5 A;  5TBM B;  3CJM A;  2WGV A;  1WE4 A;  2A24 A;  2P08 A;  2JE5 A;  3B33 A;  3N7W A;  1Z6F A;  3B47 A;  2WKE A;  4BD1 A;  2GZA A;  3E2L A;  5GL9 A;  2FH5 A;  5HAP A;  5HPF A;  1LL5 A;  2JKG A;  3FKW A;  2L0W A;  1H8Z A;  1S1Z A;  1FCN A;  2H28 A;  4E3N A;  1MBL A;  4BBU A;  5M18 A;  1SCW A;  5HL6 A;  1E3U A;  4RX3 A;  2Z6D A;  3VOZ A;  1D1J A;  4I38 A;  3OCN A;  3IWQ A;  4JF4 A;  2KLI A;  3IS2 B;  4PM7 A;  4PPR A;  1N4O A;  5EVI C;  1Y28 A;  2LB9 A;  5FI6 A;  4BL3 A;  3HL9 A;  2HDR A;  3MS6 A;  2Y79 A;  4ETX A;  2Y2L A;  2Z2M B;  5DKK A;  4Y0T A;  1D06 A;  1Q2P A;  4KG2 A;  3AGD A;  3R7W B;  4GB7 A;  4C6Y A;  3CPT A;  2NUP C;  2Y2N A;  3RTY A;  2I72 A;  2DRW A;  4LV2 A;  1SDE A;  4JLF A;  3LYX A;  3EEA A;  4KZ9 A;  4R3J A;  2ZMA A;  3C8C A;  5FDS A;  1BUL A;  2K31 A;  2HF6 A;  3V39 A;  1ZG6 A;  5DF8 A;  2WGW A;  3S7Q A;  1BZA A;  3TOI A;  5HX9 A;  4BBT A;  3E98 A;  4NKP A;  3NHQ A;  4X55 A;  5CTN A;  1S4S A;  5DFY A;  1YLZ A;  3ITA A;  4IVK A;  4KQQ A;  3GQZ A;  2GDN A;  1YAX A;  4G3K A;  3A3E A;  4B88 A;  2ZC5 B;  2Y2G A;  3T4L A;  4DDY A;  1IYO A;  2X71 A;  4G3W A;  3BY8 A;  3UB7 A;  3WS4 A;  4CJN A;  4LV1 A;  4OOL A;  2Y2I A;  4MEZ A;  2XA7 M;  1E25 A;  1JWV A;  5HD5 A;  3UPP A;  4B93 A;  5CGS A;  2PD7 A;  4HP9 A;  3SS4 A;  4Y3I A;  1XP4 A;  3C2W A;  2JCH A;  4KZ3 A;  1DJA A;  3Q1F A;  3EWK A;  3BFD A;  2A3U A;  4EV4 A;  1PW8 A;  1OTB A;  3S7O A;  2J3T D;  3ZG5 A;  2JKT I;  3IWI A;  3LR5 A;  3MZD A;  1GSV A;  3LEQ A;  4Y5F A;  2J8Y A;  1KE4 A;  5IU1 A;  5EVI D;  4R38 A;  5KIZ A;  2CC1 A;  3D4F A;  3EQU A;  3G2Z A;  3UDX A;  2DCF A;  2R78 A;  4NEE D;  1T1C A;  2VV6 A;  2PDR A;  5KZH A;  3DWK A;  2JHE A;  3OCL A;  4Y0O A;  1YKD A;  3P09 A;  2ZQC A;  2PAV P;  1AWI A;  2Y2O A;  3FYZ A;  4KZA A;  4A5R A;  3CWF A;  4PM6 A;  2XA7 S;  2M7V A;  3F1N A;  2R9X A;  1K55 A;  2ZM8 A;  3BEB A;  5L07 A;  3MMH A;  4LV0 A;  4OP5 A;  4DKI A;  4R4S A;  1ES2 A;  1NWZ A;  3LR0 A;  1ESI A;  2XDM A;  1KGG A;  1IYS A;  1XA1 A;  4OPY A;  3RFB A;  3VV4 A;  2QYB A;  1YSQ A;  1GA0 A;  1D7E A;  2WKP A;  1Y4O A;  4I3J A;  4EU0 A;  4YFM A;  2JKR M;  5IS1 A;  4MN5 A;  3OLO A;  4NET A;  1BYW A;  2D01 A;  3C7U A;  2W3E A;  4UHU A;  4GHI B;  4BEN A;  2JKT M;  1H3Q A;  3UB6 A;  3MSH A;  2QPN A;  1DY6 A;  3PAG A;  1H8M A;  3LCE A;  4NXE A;  3GR2 A;  3EQV A;  3V3R A;  1O07 A;  3P01 A;  1PWC A;  4QU3 A;  4WM9 A;  1OT9 A;  1W79 A;  4EQI A;  3SS5 A;  1K54 A;  1K25 A;  1XFQ A;  1Z09 A;  1OTE A;  1ERQ A;  2EX9 A;  5EM0 A;  4BQM A;  3IS2 A;  1BTL A;  3UDI A;  5EV0 A; 
#chains in the Genus database with same CATH homology
 3GV9 A;  5FQQ A;  4GDB A;  4OQI A;  1CI8 A;  4P87 A;  4ZDX A;  1I2W A;  2H0Y A;  3G34 A;  4P0M A;  2JBF A;  4X56 A;  4XUX A;  3NIA A;  3NY4 A;  3SS3 A;  5FA7 A;  2WZZ A;  4PMA A;  4QB8 A;  3CZD A;  4ZTK A;  4ZJ3 A;  2Y2H A;  3Q82 A;  1C3B A;  1IKI A;  1CK3 A;  2BG1 A;  3ZG0 A;  4WZ5 C;  3TG9 A;  4DXC A;  3G31 A;  4B4X A;  5EUA A;  1FR6 A;  2Y2J A;  3S4X A;  2WAD A;  5BOH A;  1I2S A;  5FSR A;  2H5S A;  1PZO A;  5AQB A;  3LY4 A;  5HAQ A;  5M1A A;  3RJU A;  3CG5 A;  1RCJ A;  1MY8 A;  1YT4 A;  1TVF A;  4QHC A;  1NYY A;  2R9W A;  3GVB A;  3HBR A;  3NDE A;  3UY6 A;  3WRZ A;  5A90 A;  1PW1 A;  5FAT A;  4N9K A;  1PWD A;  2XLN A;  1M6K A;  4E6W A;  3ZNT A;  1K56 D;  5GLD A;  3MXS A;  2HDS A;  4OQG A;  2Y55 A;  2HP5 A;  4DE0 A;  3IHB A;  1W5D A;  3IHA A;  4OOY A;  4GNU A;  2Q9M A;  5DVA A;  4FCF A;  4JPM A;  2IWB A;  2OV5 A;  3VP1 A;  5CED A;  5FDH A;  3SH7 A;  3UE0 A;  4QJG A;  3HLF A;  2XK1 A;  2Y2K A;  4WMC D;  4R3B A;  1TDG A;  2H10 A;  1G68 A;  1PI5 A;  1ES4 A;  2ZC3 B;  3A3D A;  1XGI A;  4GOG A;  1L0G A;  3ZFZ A;  4OQH A;  4KG6 A;  2HP9 A;  3IF6 C;  4X6T A;  4KG5 A;  1Y54 A;  4GDN A;  2V20 A;  3VSL A;  4K0X A;  5FAO A;  1FOF A;  3W4O A;  4E3O A;  3O87 A;  4DXB A;  4EBN A;  4WZ4 A;  3G4P A;  3PBQ A;  4JF5 A;  5GLB A;  1KE0 A;  3MBZ A;  4KZ7 A;  3CMZ A;  4DRT A;  3BEC A;  2ZM0 A;  1ERO A;  4M3K A;  1ZC2 A;  1K56 A;  5GLA A;  1H8Y A;  2P9V A;  3HLW A;  4R1G A;  4KQR A;  4ZJ2 A;  1JTD A;  4UA9 A;  4XXR A;  4OLG A;  5GHX A;  4EBP A;  2QMI A;  1XA7 A;  4JXG A;  1FQG A;  3HUO A;  4OH0 A;  3Q7V A;  3Q7Z A;  2VGK A;  5EE8 A;  3IH9 A;  2P74 A;  1W7F A;  4WMC A;  2XR0 A;  4DF6 A;  1BLH A;  4JXV A;  3IWO A;  5E43 A;  3B3X A;  2HDQ A;  3V50 A;  2XEP A;  2XFT A;  5CEC A;  2Y2M A;  1ES5 A;  1GCE A;  3PBR A;  5EPH A;  1JWP A;  2WZX A;  4JF6 A;  3QNC A;  4K91 A;  1BUE A;  3HUM A;  4EUZ A;  2OLV A;  1DJC A;  2XQZ A;  2G2W A;  1KGF A;  3GMW A;  3IH8 A;  3MKF A;  1IYQ A;  3IQA A;  3P98 A;  1CEG A;  1I5Q A;  4N9L A;  4OKP A;  4LCM A;  2EXA A;  4R4R A;  5CRF A;  3ZDJ A;  2ZQ7 A;  2EX2 A;  3G30 A;  1H5X A;  1CI9 A;  2V1Z A;  3WWX A;  4UA6 A;  4GZB A;  3WS0 A;  3WRT A;  4Q8I A;  3O88 A;  4S2J A;  1ONH A;  3UE1 A;  1EI5 A;  4JXW A;  4OON A;  3Q81 A;  5CGX A;  5CEB A;  3Q07 A;  4N1H A;  5EEC A;  4RX2 A;  5TGF A;  3HVF A;  4WZ5 A;  3VP2 A;  1ERM A;  2WKI A;  5CHM A;  5GHZ A;  4E3J A;  4OPZ A;  5TR7 A;  1O7E A;  1BLP A;  2WAE A;  3UNW A;  2Y91 A;  4BL2 A;  3PAE A;  3CJM A;  1NYM A;  2Z2L B;  3OC2 A;  3W8K A;  1YLT A;  2WGV A;  3HRE A;  1WE4 A;  3AGF A;  3HLD A;  3WS5 A;  1SHV A;  3C4P A;  2BLS A;  3VSK A;  4ID4 A;  3HLG A;  4S2N A;  5E2F A;  2ZLY A;  1ES3 A;  2X02 A;  1ZKJ A;  2JE5 A;  1IEM A;  3LO7 A;  3N7W A;  1K54 C;  1Z6F A;  5DTK A;  4GD6 A;  1KGE A;  4OLD A;  2EXB A;  2WKE A;  1XPB A;  3ZVW A;  4BD1 A;  4MNR A;  5FAS A;  3IXD A;  1HD8 A;  5J8X A;  3Q7V B;  3DWZ A;  3ZVT A;  1K4F A;  3E2L A;  4FD8 A;  3MKE A;  5GL9 A;  4Z9Q A;  3V5M A;  1JWZ A;  2Y59 A;  2ZQ9 A;  3NI9 A;  5HAP A;  4S2P A;  1LL5 A;  3FKW A;  2EFU A;  4RYE A;  1H8Z A;  2XF3 A;  2V2F F;  2ZQD A;  5D3O A;  2XGN A;  1FCN A;  4KZ5 A;  4E6X A;  1L0D A;  3MZE A;  4LCL A;  1PYY A;  3GTC A;  1MBL A;  4E3N A;  1MWU A;  5M18 A;  2A49 A;  4FSF A;  5EVL A;  1SCW A;  1E3U A;  4LV3 A;  4RX3 A;  3IF6 B;  1MPL A;  3S1Y A;  3VOZ A;  3VMA A;  4S2I A;  1TDL A;  2WAF A;  4U0T A;  3OCN A;  4NK3 A;  4EBL A;  3IWQ A;  3ZHH A;  2ZM2 A;  1LI9 A;  4JF4 A;  3NCK A;  4K0W A;  4PM7 A;  4PPR A;  1NZU A;  1N4O A;  4HEF A;  5EVI C;  1FR1 A;  1ESU A;  1KE3 A;  4C3Q A;  4F94 A;  4QY6 A;  1VM1 A;  3BRM A;  5FQK A;  4DE3 A;  3ITB A;  5F1F A;  3M2J A;  5FI6 A;  4BL3 A;  5EVI A;  3VFF A;  1LL9 A;  3HL9 A;  2HDR A;  5CXW A;  1N9B A;  4KZB A;  3OPH A;  4EWF A;  3WS1 A;  1QMF A;  4GN2 A;  1FCO A;  4R0Q A;  5CHJ A;  3SH8 A;  1HVB A;  2Y2L A;  4Y7P A;  5U47 A;  1BLC A;  2Z2M B;  4Y0T A;  3NC8 A;  1CEF A;  1RP5 A;  3UPO A;  1Q2P A;  4KG2 A;  3IF6 A;  3AGD A;  1FSY A;  4C6Y A;  4GB7 A;  3M2K A;  4GKU A;  3W4P A;  3O3V A;  4MBF A;  1JVJ A;  2Y2N A;  1YLY A;  1MWS A;  4BD0 A;  1WYB A;  1K55 C;  2I72 A;  3NDG A;  2RCX A;  3C5A A;  2DRW A;  3N6I A;  1PWG A;  4FH2 A;  4LV2 A;  2P9V B;  3PBO A;  2IWC A;  3A3J A;  1SDE A;  3QHY A;  2OSU A;  4S2M A;  2PBY A;  4JLF A;  3DTM A;  4KZ9 A;  3VP3 A;  3ZGA B;  4R3J A;  2ZD8 A;  2JC7 A;  4N1X A;  1LLB A;  4UAA A;  2EFX A;  2ZMA A;  3FWL A;  1W8Q A;  1YLW A;  4QY5 A;  1PIO A;  4OPR A;  5FQ9 A;  1BUL A;  1DJB A;  3MFD A;  3W4Q A;  3ZCZ A;  2J9P A;  4HES A;  3G32 A;  3IXG A;  1AXB A;  3PTE A;  4KZ8 A;  4GD8 A;  5AQ9 A;  3V39 A;  4S2L A;  1EWZ A;  1ZG6 A;  3FV7 A;  1XXM A;  1QME A;  5DF8 A;  1K6R A;  5F82 A;  3BFE A;  2WGW A;  1L2S A;  4DDS A;  1NY0 A;  1YQS A;  4MBK A;  4P6B A;  1BZA A;  2WUQ A;  2J9O A;  3TOI A;  5FQJ A;  3NBL A;  3E2K A;  5HX9 A;  1MWT A;  3SH9 A;  4D2O A;  4E3K A;  1KVM A;  2Y2Q A;  3A3F A;  4WEL A;  3PBN A;  5AQ7 A;  5F1G A;  4LEN A;  4S2K A;  4X55 A;  5CTN A;  3HLC A;  5KMW A;  2ZC4 B;  3A3I A;  3C4O A;  1K38 A;  4BJP A;  4JXS A;  1YLZ A;  3ITA A;  4IVK A;  4KQQ A;  3PBS A;  3GQZ A;  3ZG7 B;  2GDN A;  3IF5 A;  3A3E A;  4OOM A;  3IT9 A;  4HBT A;  5AQA A;  5GLC A;  4B88 A;  2ZC5 B;  2Y2G A;  4WEJ A;  3HLB A;  5CTM A;  2Y4A A;  4DDY A;  1IYO A;  2X71 A;  2ZQ8 A;  3BFG A;  2QZ6 A;  5E2H A;  1XGJ A;  1S0W A;  2B5R A;  3WS4 A;  4CJN A;  4LV1 A;  4YIN A;  4OOL A;  5F83 A;  2WKH A;  1IKG A;  2Y2I A;  4IBX A;  4MEZ A;  3OZH A;  1E25 A;  1JWV A;  1KDW A;  1YMS A;  3UPP A;  3FZC A;  2EX8 A;  4ZJ1 A;  3UO9 A;  3FKV A;  1HZO A;  1W8Y A;  5CGS A;  2PU2 A;  5DF9 A;  3SS4 A;  1XP4 A;  4CPK A;  1GA9 A;  1MWR A;  2G2U A;  3DW0 A;  4JKT A;  2JCH A;  3C7V A;  1E3U D;  4KZ3 A;  4U3T A;  1DJA A;  3O86 A;  1YM1 A;  3UE3 A;  4E3I A;  3Q1F A;  3WS2 A;  4WYY A;  1SDN A;  3BFD A;  2A3U A;  2VGJ A;  3I7J A;  4EV4 A;  4S2N C;  5A92 A;  1FCM A;  1PW8 A;  4P85 A;  1JTG A;  5FI7 A;  5L2F A;  3ZG5 A;  2WYX A;  1S6R A;  4B4Z A;  3UDF A;  3IWI A;  5CGW A;  3VP4 A;  1PI4 A;  3MZD A;  4E3M A;  4OVD A;  1K6S A;  1XX2 A;  1SKF A;  2HDU A;  2J8Y A;  5G18 A;  1KE4 A;  4L0L A;  3JYI A;  2IWD A;  5EVI D;  3G2Y A;  4H8R A;  4E3L A;  5FQM A;  2CC1 A;  5HL1 A;  3D4F A;  3EQU A;  3G2Z A;  4IVI A;  3UDX A;  2DNS A;  2DCF A;  1GHI A;  2FFY A;  1K57 A;  4ZAM A;  5M19 A;  4KZ6 A;  5KZH A;  3SOI A;  3DWK A;  3UN7 A;  5E2E A;  3RXW A;  1ALQ A;  3OCL A;  1L0E A;  3AGE A;  4Y0O A;  4O7D A;  3S22 A;  5FI2 A;  3VOY A;  3P09 A;  4IED A;  5CER A;  3ZNY A;  2ZQC A;  1RGY A;  5EVI B;  2RL3 A;  3HUN A;  2Y2O A;  5IHV A;  5KSH A;  3FYZ A;  2ZQA A;  4KZA A;  3GSG A;  4A5R A;  1K4E A;  3BM6 A;  2Q9N A;  3PBT A;  4PM5 A;  1K57 C;  1J9M A;  4PM6 A;  1RGZ A;  5DF7 A;  2R9X A;  4FH4 A;  1NJ4 A;  2ZC7 A;  5DTT A;  1K55 A;  2ZM8 A;  4RVA A;  3BEB A;  4DE2 A;  1BLS A;  3GRJ A;  2WGI A;  3ZG9 B;  2EX6 A;  1E4D A;  4PM9 A;  3MXR A;  2C5W B;  4LV0 A;  4OP5 A;  5TFQ A;  5JYO A;  4DKI A;  1ES2 A;  4R4S A;  1KDS A;  3IXB A;  2XD5 A;  1ESI A;  2HP6 A;  1MXO A;  4WBG A;  1YLP A;  2XDM A;  3LY3 A;  3LEZ A;  4OP8 A;  4OPQ A;  1BT5 A;  1PZP A;  3OPL A;  4S2O A;  1KGG A;  1IYS A;  1OME A;  2E8I A;  1ZG4 A;  4KQO A;  1XA1 A;  4OPY A;  2X01 A;  3HLE A;  5GHY A;  4KEN B;  3MZF A;  4XUZ A;  3UPN A;  1MKI A;  1GA0 A;  1XKZ A;  5CHU A;  1M40 A;  4IBR A;  1HTZ A;  2Y2P A;  4JBF A;  3TSG A;  5HW3 A;  2ZC6 B;  2OLU A;  5A91 A;  4HBU A;  1G6A A;  4Y0U A;  4YFM A;  3N8R A;  4U0X A;  2XFS A;  2ZJ9 A;  4X69 A;  4WEK A;  4R23 A;  3VFH A;  3RXX A;  2WK0 A;  4NET A;  3BFF A;  5EOO A;  4QD4 A;  3QNB A;  4DE1 A;  3C7U A;  3IXH A;  4UHU A;  2UWX A;  5HFO A;  1GHP A;  1LHY A;  5HAI A;  3BFC A;  5E2G A;  1BSG A;  4C75 A;  4BEN A;  3M6B A;  3VP0 A;  1NZO A;  3ZG8 B;  3BLM A;  3G35 A;  1IYP A;  4MLL A;  4ZBE A;  5HAR A;  4X68 A;  2FFF B;  3N8L A;  1NXY A;  1YLJ A;  3OPR A;  1GHM A;  1YMX A;  1DY6 A;  2QPN A;  3PAG A;  5FAQ A;  1IEL A;  4N92 A;  3BYD A;  1Q2Q A;  1NRF A;  3LCE A;  2HPB A;  3ISG A;  5DTS A;  4BLM A;  4MBH A;  1WYC A;  3GR2 A;  3EQV A;  5A93 A;  2XD1 A;  2C6W B;  1U60 A;  4OQ0 A;  4PM8 A;  1LI0 A;  3V3R A;  1O07 A;  5I94 A;  1PWC A;  4QU3 A;  4RA7 A;  1ONG A;  3N4I A;  4WM9 A;  5JYP A;  1L0F A;  1W79 A;  2WGW B;  3V3S A;  2XH9 A;  1FSW A;  4EQI A;  4X53 A;  2PU4 A;  1K54 A;  1K25 A;  3SS5 A;  3BLS A;  2EX9 A;  1ERQ A;  4KZ4 A;  3OPP A;  4BQM A;  1KVL A;  5FAP A;  5KSC A;  4UA7 A;  5EOE A;  1BTL A;  2J7V A;  5FQI A;  1VQQ A;  3UDI A;  3M6H A;  1TEM A;  3N8S A;  2H0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...