5CRFA

Structure of the penicillin-binding protein pona1 from mycobacterium tuberculosis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
395
structure length
386
Chain Sequence
KGPNGLIERQVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTADNTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPETVIQPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 1A
publication title Crystal structures of the transpeptidase domain of the Mycobacterium tuberculosis penicillin-binding protein PonA1 reveal potential mechanisms of antibiotic resistance.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Penicillin-binding protein
total genus 114
structure length 386
sequence length 395
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5crfA00
1PWDA 3UPPA 2Y2IA 4R3BA 1BTLA 1LLBA 4S2KA 4L0LA 2EFXA 1BLCA 1W7FA 4LV0A 5FQIA 2XD5A 1E25A 1GHIA 5CHMA 3HL9A 5EVIB 2WAFA 5JYPA 5KSCA 4S2NC 2XLNA 4HEFA 4QHCA 3C7VA 5GHYA 2EXBA 1NJ4A 3AGDA 1PI5A 3IXBA 1BT5A 4N1XA 1I2WA 1E4DA 1JTGA 4PM7A 5FDHA 5TFQA 1TEMA 5EOOA 3IH9A 3A3DA 4C6YA 1QMFA 1JWZA 4KG6A 1IKGA 3GVBA 4UAAA 3ZFZA 2WZXA 4LCLA 3Q07A 4WM9A 3V3RA 3BECA 3HUNA 1K56A 1K25A 4DXCA 1K54C 2X71A 4RX3A 3DWZA 2HDQA 3V50A 3S22A 1K4EA 3TSGA 3CG5A 3IXDA 4C75A 4K0XA 4RVAA 4P87A 2J8YA 2H10A 5FQJA 1G68A 5FATA 1IYOA 3SH7A 5G18A 1KGFA 3S4XA 4N9KA 3ZG8B 2OLUA 3ZDJA 2XH9A 3Q1FA 1YLPA 3RXWA 3LCEA 5HFOA 2Y2JA 3NCKA 5CHUA 1GA9A 4U0XA 4PMAA 5EVIC 4WZ4A 1K56D 5CEBA 4N92A 1SDEA 2ZD8A 2V1ZA 2WKIA 3PBOA 3A3FA 5FQMA 2QZ6A 2H0YA 5HAPA 2OLVA 1Q2PA 2Y2KA 2Y2MA 2Y91A 3A3IA 3N7WA 4R4SA 1CK3A 1G6AA 4XUZA 3N4IA 3QHYA 4S2NA 1IYQA 4DF6A 3IHAA 3GTCA 4B4XA 4KZAA 4EBLA 2EX6A 1N9BA 5M1AA 3CZDA 3PBNA 3G35A 1YM1A 4OPQA 1E3UA 5HARA 3G30A 5AQBA 1M40A 4EV4A 1GHPA 2GDNA 2Y4AA 3HLDA 4GNUA 4DE3A 3MXRA 2OV5A 3G32A 2VGKA 4BENA 1MY8A 3SH8A 4MLLA 2FFFB 1DJBA 3Q82A 1K55A 4OLGA 5A93A 5FI2A 3Q7VB 2A3UA 2ZC3B 1XPBA 2XFSA 1K54A 5DF7A 3WRTA 3WS1A 2ZC4B 2WKHA 3LY4A 1XA7A 3HBRA 3HLBA 5FA7A 5D3OA 4JF4A 4KQRA 4MBFA 1U60A 1CI9A 3EQUA 4BD1A 1TDGA 1K6RA 1LL5A 1VQQA 2IWCA 1E3UD 1EI5A 1XKZA 1FR6A 2QMIA 3VFHA 4LCMA 1IEMA 1OMEA 1C3BA 2WYXA 3V3SA 4LV2A 3G2ZA 4HBUA 3E2KA 4KZ6A 3E2LA 1O07A 5AQAA 4EUZA 4UA6A 1YMSA 3OCNA 1Q2QA 1LHYA 4S2IA 5CXWA 5DF9A 1TVFA 1HTZA 2C6WB 1KDSA 4CPKA 3HUMA 3GR2A 1L0EA 4DE0A 3SS3A 5GLDA 1ONGA 5U47A 4OP8A 3IXHA 1FCMA 4PM6A 1YLJA 4HESA 1ALQA 1Z6FA 3SS4A 4QJGA 1S6RA 5F1GA 1IKIA 1L0DA 4QU3A 3ZG7B 1W79A 3GV9A 2HDSA 1MBLA 3HLEA 4OONA 1YLWA 4ZBEA 2FFYA 3ZG9B 1M6KA 1Y54A 2BLSA 4N1HA 4OOYA 4QY6A 4R0QA 2ZLYA 5CRFA 3JYIA 5A92A 3G31A 1CEFA 1TDLA 4X6TA 3UDXA 4DRTA 2WUQA 4OQGA 4B4ZA 3BFEA 2V20A 5CTNA 5E43A 5HW3A 1ES2A 3OCLA 2WGVA 5FAPA 3PBSA 1PI4A 5FSRA 2P9VB 4B88A 1HVBA 3MZEA 5GHXA 4GZBA 2X02A 4WZ5C 5CECA 3ISGA 5KSHA 2HP6A 4GB7A 1GHMA 2EX9A 1LL9A 2V2FF 3FYZA 1W8QA 3HREA 3RXXA 3W4OA 2J9PA 4JF6A 2XFTA 2Y2LA 3TG9A 1S0WA 3N6IA 3Q81A 1RGYA 5CEDA 1IYPA 3IQAA 2WK0A 1BLPA 1XP4A 2ZQ9A 1BLHA 4R23A 4WEJA 3LO7A 4YINA 3C4OA 3VOZA 1GCEA 1QMEA 4X53A 2DNSA 1PW1A 3OC2A 1NRFA 4OPRA 4U0TA 3V5MA 4OQIA 3IF6A 3BEBA 4QB8A 3NY4A 5CGSA 1ERQA 1JTDA 1K38A 2HP5A 1WYCA 3A3JA 3PBQA 3PBTA 5DTSA 1PZOA 1MXOA 5EECA 2DCFA 4GDBA 1IELA 1XGJA 3BFCA 4KENB 4DE2A 3Q7VA 5TGFA 1KE4A 1YQSA 2XDMA 2ZM2A 3HLGA 4KZ8A 4ZTKA 1BZAA 4P85A 4E3OA 2RL3A 1CI8A 2ZC6B 4Y7PA 4MEZA 4YFMA 4CJNA 5FI6A 1HD8A 3VP4A 3BRMA 1FSWA 1SDNA 5GL9A 1YLZA 4JXWA 1KVLA 2Y2GA 4IEDA 4JF5A 4X69A 3V39A 2B5RA 4R3JA 3VSKA 1PIOA 1LI9A 3CJMA 5FQ9A 5GLAA 4PM8A 4S2JA 3MBZA 2UWXA 4MNRA 5KMWA 3SOIA 1MWSA 3NBLA 4N9LA 4OLDA 4Y0TA 3DW0A 1ZG4A 3O87A 2XEPA 4WYYA 1ESUA 4XUXA 4GDNA 1ZG6A 2XK1A 2JCHA 5DF8A 5FI7A 1FSYA 1K4FA 1ES3A 2G2UA 1IYSA 3Q7ZA 1FQGA 2PBYA 3MXSA 4IVKA 5CGXA 5EUAA 2WGWA 3BFDA 2Z2LB 3GSGA 4M3KA 5FAQA 1SCWA 1FCOA 5I94A 4S2PA 1ES4A 4JXSA 1I5QA 3VFFA 1PZPA 3W4QA 4Z9QA 3UDIA 3PTEA 5CERA 3ZNTA 3LY3A 4EBNA 3BYDA 5J8XA 3HLFA 3PAGA 3UDFA 4XXRA 2ZQCA 4FH4A 1N4OA 2C5WB 3OPLA 4P0MA 4FH2A 3UE1A 5CGWA 2WAEA 3VOYA 4S2MA 3IHBA 1CEGA 5EVIA 5FAOA 1YMXA 5EE8A 3WWXA 3IWQA 3IWOA 3ZNYA 3MKFA 2Y2NA 3M2JA 1KE3A 4KZ3A 4KZ7A 4JLFA 4FD8A 2H5SA 2OSUA 2ZQAA 5BOHA 3FKWA 3C5AA 4KG2A 3IWIA 1XA1A 3FWLA 3NC8A 2XQZA 4BLMA 3D4FA 4R4RA 4QY5A 5CHJA 2RCXA 4GD8A 1KE0A 3N8LA 2ZQDA 4NK3A 4ZDXA 3C4PA 4ZAMA 3S1YA 4S2OA 3GQZA 3UE0A 3W8KA 3UY6A 3QNCA 2R9XA 5CTMA 5EVLA 3VMAA 3HLWA 1MKIA 5EOEA 5EVID 2R9WA 4WBGA 3ITAA 4ZJ1A 4H8RA 3WRZA 4UA7A 4PM5A 1H8YA 2EX2A 3MKEA 1L0FA 4JXGA 1KGEA 3UN7A 3MZDA 1WE4A 2J9OA 3NIAA 4EWFA 3N8RA 4KZ9A 3BLSA 2H0TA 3CMZA 3G2YA 3FV7A 4PM9A 5DTKA 1NYYA 5AQ9A 3W4PA 2WKEA 1KGGA 1K57C 2ZM0A 1NZOA 4UHUA 2J7VA 4WELA 3VP3A 4E3MA 1LI0A 3HUOA 3ZCZA 1DY6A 3P09A 1SKFA 1MPLA 1EROA 1KVMA 5HAIA 2XF3A 3FZCA 1RCJA 4O7DA 4EQIA 3IF5A 3EQVA 2I72A 3VSLA 5FQQA 4PPRA 2WADA 5E2FA 1FCNA 2WZZA 4E6WA 2HDUA 1XX2A 3DWKA 1MWRA 2ZC5B 4LENA 1JWPA 3M6BA 2VGJA 3HVFA 5A91A 4Q8IA 2HP9A 1JWVA 4BQMA 1H5XA 4OQ0A 3BLMA 4ZJ2A 3UNWA 5M18A 4EBPA 4OPZA 2Y2HA 1ERMA 4ID4A 5EPHA 2HPBA 2IWBA 2X01A 1MWUA 2IWDA 2Y2PA 4KQOA 4QD4A 5HAQA 4LV1A 2ZJ9A 4E3KA 4X55A 2JBFA 3BM6A 3VP0A 1K55C 4JKTA 3UPNA 4FSFA 4Y0OA 3AGFA 4ZJ3A 1MWTA 1BLSA 3WS5A 3UO9A 4GD6A 4WMCA 3UE3A 2P74A 3QNBA 4Y0UA 3PBRA 3NI9A 2WGIA 4KZ4A 4OKPA 4OVDA 1ZKJA 3RJUA 2JC7A 2Z2MB 4F94A 3B3XA 4P6BA 1BULA 3IXGA 4DDYA 1BSGA 3PAEA 1YLYA 2PU4A 1ES5A 4C3QA 1J9MA 2XD1A 2CC1A 3I7JA 3ZVWA 4UA9A 3VP2A 4WZ5A 2Y2QA 5HX9A 3O3VA 4OP5A 4U3TA 2G2WA 1W8YA 3OZHA 1K57A 3WS0A 1FR1A 4WEKA 4MBHA 4BD0A 3ZG0A 1W5DA 1PWCA 1AXBA 1BUEA 1GA0A 4OQHA 5IHVA 1NZUA 3GRJA 4KZBA 1ZC2A 4WMCD 3FKVA 3NDGA 4OH0A 3C7UA 3ZHHA 1EWZA 2EX8A 2ZC7A 4NETA 2JE5A 4OOMA 3ZG5A 1K6SA 4GOGA 4HBTA 3O86A 1ESIA 3WS2A 2EFUA 3MZFA 1H8ZA 3N8SA 4LV3A 4MBKA 4GN2A 4E3LA 4OPYA 2QPNA 5FASA 3P98A 5E2GA 4BL3A 1O7EA 3GMWA 4JPMA 1HZOA 2Q9NA 3IF6B 5A90A 1I2SA 4R1GA 4IVIA 4E3NA 4DE1A 5F1FA 1DJAA 4JBFA 4D2OA 4E3JA 4S2LA 2DRWA 1NXYA 4K91A 4E3IA 3AGEA 3IT9A 1FOFA 1PYYA 3G4PA 4RX2A 4X56A 3A3EA 3OPHA 4X68A 4KG5A 1JVJA 2P9VA 2PU2A 5GLCA 4JXVA 4DKIA 2EXAA 4BL2A 1SHVA 5L2FA 2Q9MA 5GLBA 3OPRA 3UPOA 1KDWA 1DJCA 1ONHA 2E8IA 3M2KA 4GKUA 2ZMAA 1NYMA 2ZM8A 5M19A 4OOLA 5E2HA 1L0GA 4KQQA 3M6HA 5AQ7A 2XR0A 3ZGAB 4A5RA 2Y59A 4DDSA 3ITBA 4IBXA 1NY0A 1YLTA 3BFGA 3HLCA 3OPPA 3WS4A 3SS5A 5FQKA 2HDRA 5F83A 4E6XA 3NDEA 5GHZA 3DTMA 3LEZA 1L2SA 5E2EA 2BG1A 3ZVTA 4K0WA 3O88A 4RA7A 1YT4A 2Y2OA 4FCFA 1PW8A 2A49A 3BFFA 4RYEA 1WYBA 5DVAA 5JYOA 1VM1A 4IBRA 4KZ5A 1XGIA 3IF6C 5KZHA 3TOIA 2ZQ8A 3IH8A 5TR7A 2WGWB 3SH9A 5HL1A 5DTTA 4BJPA 2XGNA 1PWGA 3G34A 5F82A 3VP1A 1XXMA 1RGZA 2ZQ7A 1RP5A 4DXBA 3MFDA 2Y55A
chains in the Genus database with same CATH superfamily
2Y2IA 2NUPC 1BTLA 1BLCA 2OAQ1 4LV0A 4S2NC 4HEFA 4QHCA 1OTBA 2EXBA 3IXBA 5EM1A 4N1XA 1WA9A 1I2WA 1JTGA 4MCWA 5FL3A 1QMFA 4BBTA 1JWZA 3ZFZA 4LRXC 4EU0A 4F3LB 4RX3A 3DWZA 4I3JA 3IS2B 1Z09A 4P87A 2V1AA 2J8YA 2H10A 4NG2A 5FQJA 2EWVA 1TS8A 3ZDJA 2QKPA 1YLPA 4Y17A 4BMWA 5CHUA 1YPRA 2BASA 4U0XA 4WZ4A 5EVEA 5CEBA 4N92A 2ZD8A 2V1ZA 1VB6A 3PBOA 5FQMA 4NEED 2QZ6A 2OLVA 1Q2PA 2KLIA 2L0WA 3A3IA 4DN0A 1CK3A 1G6AA 4R3AA 3QHYA 4S2NA 4DF6A 3GTCA 3RH8B 5HPFA 3T1SA 5M1AA 4OPQA 3T4QA 2KOIA 5HARA 1X0OA 4DE3A 3G32A 4BENA 2JKTM 2B02A 4LPZA 2Y79A 2A3UA 2ZC3B 3WRTA 3R4KA 2ZC4B 1MKMA 3LY4A 2A24A 2W1TB 4KQRA 3LR4A 4BD1A 1TDGA 2IWCA 3EEHA 2PD8A 1E3UD 2QMIA 3V3SA 2KX6A 3G2ZA 1YMSA 3CAXA 1Q2QA 4S2IA 1DP8A 3HUMA 3GR2A 1L0EA 4RQ9A 4HP4A 2W3DA 5HWWA 1N9LA 5GLDA 1T1CA 4O01A 3IXHA 2QWSA 3SS4A 3TRCA 3GV9A 2HDSA 4OONA 1M6KA 4N1HA 5CRFA 1TDLA 2DMWA 4X6TA 4DRTA 2GX5A 5CTNA 3OCLA 2WKPA 3PBSA 1HVBA 1YKDA 3G6OA 2FH5A 4WZ5C 5HD3A 4NXGA 2B95A 3EEAA 3FYZA 2J9PA 4HH3A 3IQAA 1BLPA 1BLHA 2KDKA 3C4OA 1GCEA 1QMEA 1J3WA 2JKRI 3LYXA 1NWZA 2DNSA 4U0TA 2D02A 3IF6A 4HY8A 3PBQA 3A3JA 4EETB 3CLOA 4GDBA 5L8MA 4HIAA 1OJ5A 3JPUA 5TGFA 4KZ8A 1BZAA 4P85A 4MEZA 3VP4A 3BRMA 1FSWA 2Y2GA 4IEDA 4X69A 3V39A 5K5BA 4R3JA 2PD7A 1LI9A 1YAXA 3CJMA 4S2JA 4WF0A 5KMWA 3SOIA 3NBLA 1YSPA 4OLDA 3DW0A 1ZG4A 2XEPA 2JCHA 3Q7ZA 1FQGA 2PBYA 3MXSA 2WGWA 2MJ6A 3BFDA 3GSGA 4M3KA 5FAQA 3LR5A 3TE8A 2JKRM 3UDIA 5CERA 3LY3A 3HLFA 2ZOHA 4FUWA 3F1OB 3F1NA 4FH2A 3MXQA 3CI6A 4X1LA 3IWQA 2LB9A 1LSVA 3T50A 4KZ3A 5BOHA 4JLFA 4FD8A 2H5SA 2ZQAA 3T4SA 4G3WA 2RCXA 4YOFA 4GD8A 2ZQDA 3S1YA 1K0KA 4S2OA 3LR3A 3NECA 3UE0A 3W8KA 2R9XA 3HLWA 1MKIA 2PBDP 1OJGA 3KSIA 5EOEA 5EVID 3TJZC 4WBGA 3ITAA 4JGPA 2CMNA 1IFQA 5HZHA 3UN7A 3MZDA 1WE4A 3S7OA 3B42A 3NIAA 3N8RA 2B18A 2ZL1B 4PM9A 5DTKA 5AQ9A 3T1RA 1KGGA 4ZRRA 5G4YA 3D3OA 3UMDA 3VP3A 4E3MA 4HI4A 3HUOA 5HDCA 3ZCZA 1SKFA 5HAIA 3FZCA 1RCJA 1XFQA 2WZZA 2ZBBA 4EUVA 4LENA 5F68A 1ODVA 3HVFA 3T4TA 2HP9A 4BQMA 3UNWA 4LRZE 4ID4A 2Y2PA 2IWDA 4QD4A 1DP6A 2ZJ9A 1MC0A 4R70A 4JKTA 3AGFA 1BLSA 1T1BA 3WS5A 4Y0UA 3RJUA 2Z2MB 4F94A 2IA2A 4DDYA 1BSGA 1Y28A 2WKRA 1KOUA 1ES5A 3KSHA 1SKOA 2O99A 2Y2QA 2G2WA 1FR1A 4HHDA 5DJUA 1PWCA 3NHQA 1AXBA 1BUEA 1GA0A 2BTFP 5TBMB 3NDGA 3C7UA 4Q0JA 3ZHHA 1EWZA 4NETA 2JE5A 1OT6A 1ESIA 4HNBA 3P98A 1HZOA 1T1AA 3QP2A 2VGLS 1DJAA 1P0ZA 4S2LA 2DRWA 4RX2A 1F5MA 1LL8A 3H9WA 4EEPA 4X68A 4KG5A 1JVJA 5GLCA 4JXVA 4DKIA 1SHVA 2ZL1A 4CLCD 5GLBA 3OPRA 1OT9A 2Q0OA 1DJCA 4GKUA 2E8IA 3EOIA 4HOIA 3LGOA 4KQQA 3ZGAB 4A5RA 4DDSA 1YLTA 1N9OA 3DTMA 1L2SA 5E2EA 2GNXA 4RA7A 1YT4A 1BYWA 5EM0A 4FCFA 1WYBA 1VM1A 4KZ5A 5DKLA 1UWNX 3IH8A 3U2AA 2PDRA 5DTTA 2J80A 2XGNA 3MJQA 1RGZA 2L1MA 5EV0A 3S7PA 4R3BA 2EFXA 4K08A 3OBFA 5FQIA 1E25A 5CHMA 3HL9A 5EVIB 2WAFA 2XLNA 4Y2FA 3CWFA 3LIAA 5GHYA 2QYBA 1PI5A 1AWIA 1TEMA 4C6YA 5TBMA 3UB5P 1IKGA 2Y8HA 4LCLA 4WM9A 2HF6A 3HUNA 1K54C 3V50A 2HDQA 3CG5A 3CUEC 1G68A 5FATA 1IYOA 3SH7A 5G18A 1KGFA 4N9KA 1V9ZA 3KYEA 2XH9A 3LCEA 3MSHA 3LIFA 4PMAA 5EVIC 4D60A 1K56D 4EQ1A 4G3VA 2WKIA 3L9KA 2M7VA 2H0YA 5HAPA 2Y2KA 4I3IA 2Y2MA 4XUZA 5A8BA 4I39A 1N9BA 2YKHA 3PBNA 1YM1A 1H0MA 1ACFA 3HLDA 4GNUA 2OV5A 1MZUA 1MY8A 3SH8A 1D7EA 3Q82A 4ETXA 2XFSA 1K54A 4GHIB 5FA7A 1OTDA 4JF4A 1CI9A 1EI5A 1IEMA 3ICYA 4LV2A 3MQQA 4HBUA 3GECA 4WN5A 3PYPA 3OLOA 1TVFA 2JKFA 2QJ7A 5EFWA 2C6WB 1KDSA 4CPKA 1OTIA 3SS3A 3B33A 1ONGA 5HWTA 1FCMA 1L0DA 4WLAA 4QU3A 4BBVA 1MBLA 3HLEA 1YLWA 1Y54A 4OOYA 1S67L 1CEFA 2WUQA 4B4ZA 2D01A 2V20A 3RTYA 3K3DA 2W1RA 4UQIS 2P9VB 3TW8A 4GZBA 5CECA 3ISGA 5KSHA 1GHMA 3CPTA 1LL9A 2V2FF 2JKTI 3HREA 3LIDA 3TG9A 4XT2A 3Q81A 1RGYA 2ZQ9A 4KUKA 1PW1A 3OC2A 1TF1A 4OQIA 4LGWA 4NXFA 3NY4A 1WYCA 1PZOA 1NLYA 2JHEA 2XDMA 2ZM2A 2HJ9C 5F6AA 4GHIA 2ZC6B 2WKQA 4YFMA 4CJNA 5GL9A 1XFNA 4FOFA 3LICA 4Q0HA 3VSKA 2UWXA 4JGOA 4Y0TA 1ZG6A 2VV8A 3DBAA 1IYSA 5EUAA 5CGXA 2EA9A 4Y15A 1SCWA 4S2PA 3K2NA 4Z9QA 1DP9A 3PTEA 3QP6A 3PAGA 3UDFA 4XXRA 1NRJA 3OPLA 2C5WB 3UE1A 2WAEA 3VOYA 3IHBA 4E04A 1DRMA 2VV6A 1UWPX 5DFXA 2OSUA 3E0YA 3NOUC 4B9OA 3NC8A 3MFXA 1IOUA 4NK3A 3N8LA 5AVFA 1T18A 3BY8A 3C4PA 4ZAMA 1PNEA 3EGDC 4F3LA 3MS6A 1S66L 3IS2A 2R9WA 4H8RA 1SZVA 2EX2A 3VV4A 3V67A 4KZ9A 3BLSA 3CMZA 3W4PA 4UHUA 4PKYA 1XJ3A 3IX3A 3MR0A 1KVMA 1TS7A 1TS6A 4O7DA 4EQIA 3IF5A 4PPRA 2GJ3A 5L07A 2HDUA 3DWKA 2ZC5B 3M6BA 2GZAA 1JWVA 4ZJ2A 5M18A 1VETB 2IWBA 1MWUA 5F69A 4KQOA 4LV1A 1PRQA 1K55C 3UPNA 4Y0OA 4ZJ3A 1MWTA 4GD6A 2J3WA 4WMCA 1GSVA 3NI9A 2W1TA 2JC7A 3B3XA 4P6BA 5HDSA 3T1QB 3IXGA 4GJ4A 2PU4A 1J9MA 2CC1A 3VP2A 4WZ5A 4OP5A 3NOTC 4U3TA 3KSFA 1W8YA 4MBHA 1D1JA 4OQHA 1ZC2A 4GS9B 4CQHA 3H82B 2VKSA 5HL6A 2HJEA 1K6SA 1OTAA 4HBTA 3WS2A 1H8ZA 1FILA 4LV3A 4GN2A 5AJGA 4OPYA 4E3LA 2OAP1 5FASA 1O7EA 2Q9NA 4Y3IA 4DE1A 4MN7A 4E3JA 4K91A 4E3IA 4NXEA 4NXBA 2PU2A 2Q9MA 1KDWA 2W27A 3M2KA 4DJ2A 1LSXA 1LSWA 3WS4A 3H7WB 1LT0A 2BG1A 4K0WA 2V8CA 1PW8A 2A49A 4RYEA 1CQAA 3T12B 5KZHA 4R6LA 5TR7A 5HL1A 1PWGA 2W3HA 4O8GA 4MDZA 4DXBA 3MFDA 3PR6A 4L0LA 5KIZA 4L9GA 3DAVA 1GHIA 3C7VA 1NJ4A 1E4DA 3DTIA 5FDHA 5TFQA 5EOOA 3VE3A 2ZOIA 3IH9A 3PXPA 3E4QA 3H82A 3V3RA 3BECA 4DXCA 1FIKA 2X71A 3S7NA 1K4EA 2OWHA 4RVAA 3A0SA 3F1OA 2VEAA 3D9YA 2M1CA 4PHTA 2OLUA 1TS0A 3LIEA 3HCYA 3RXWA 2Y2JA 3NCKA 2YKFA 2INWA 1SDEA 2QHKA 1STZA 1W63Q 3N7WA 4Z1WA 3N4IA 1IYQA 3IHAA 4B4XA 4EBLA 4KZAA 5CX7A 2K31A 3C8CA 1ZTUA 2W3EA 3H7WA 3CZDA 3G35A 1E3UA 4WL9A 4I5SA 2Y4AA 5J7EA 2JN7A 4UQIM 4MLLA 3Q7VB 1XPBA 2WKHA 5D3OA 4EXOA 1U60A 3EQUA 1HLUP 1LL5A 2UV0E 5HPIA 1XKZA 1FR6A 4ESPA 4EEUA 3BQ8A 2WYXA 1C3BA 3T4LA 3B47A 4KZ6A 3E2KA 4EUZA 1LHYA 2Z6CA 5CXWA 5DF9A 1HTZA 2P08A 2HV1A 4DE0A 1YLJA 4ARZB 4HESA 1ALQA 1S6RA 2VX8A 5F1GA 1IKIA 5HSQA 1W79A 4ZBEA 2FFYA 2M7UA 4II7A 3FPWA 5A92A 3UDXA 4GLQA 5HW3A 5E43A 2WGVA 5FAPA 3O5YA 1PI4A 2I9VA 5FSRA 3UB9A 4B88A 3MZEA 5GHXA 2OOLA 1G5UA 3C2WA 2K2NA 4GB7A 2EX9A 3KSGA 1W8QA 3RXXA 3W4OA 4JF6A 2Y2LA 1S0WA 3N6IA 1EW0A 5CEDA 4Y5FA 1IYPA 2WK0A 4R23A 3LO7A 1P9WA 4X53A 4HJ4A 4OPRA 3BEBA 4JGRA 4DMZA 3LUQA 1ERQA 2HP5A 5DTSA 3PBTA 4LRYC 1XGJA 2PT7A 3T4JA 3Q7VA 1KE4A 3BW6A 2V0UA 3UB6A 4E3OA 1CI8A 3NOPC 4EW7A 5FI6A 5J3WA 2V8FA 3MQ0A 3T4OA 1KVLA 4JF5A 4YWZA 3JVUA 2XRNA 5GLAA 3KO6A 4PM8A 3MBZA 4MNRA 2XSSA 1CJFA 4WYYA 1ESUA 4XUXA 1G28A 4GDNA 3P7NA 5FI7A 1ES3A 4AFIA 4ARZA 1FCOA 1YSQA 1ES4A 1S4RA 3FPVA 1I5QA 4JXSA 1N9NA 3CUEA 3W4QA 3LIBA 3BYDA 5J8XA 2ZQCA 2W0NA 4P0MA 4S2MA 1CEGA 5EVIA 5FAOA 1YMXA 5EE8A 3WWXA 2XA7S 3IWOA 3ZNYA 3MKFA 3M2JA 1KE3A 4KZ7A 4ME4A 3QP4A 4KG2A 1XA1A 2XQZA 4BLMA 5CHJA 2PRFA 3IBRA 4CLCB 4ZDXA 4IJGA 4MN6A 3GQZA 3UY6A 1H8MA 3VMAA 4PM5A 4O0PA 1H8YA 1GSWA 4JXGA 3C38A 3W2ZA 2J9OA 2A24B 2H0TA 5FEFA 3G2YA 1NYYA 3A0RA 1K57C 2R78A 1LI0A 3KYZA 3LI8A 3EQVA 2I72A 2J3TD 2V0WA 4R38A 4CLCC 2WADA 5E2FA 1XX2A 1JWPA 2VGJA 4HP9A 4CLCE 1H5XA 4OQ0A 4EBPA 4G3KA 5EPHA 2HPBA 2X01A 4IUKA 3CITA 5HAQA 3BWLA 4E3KA 3VP0A 4FSFA 4X25A 3SZTA 3NJAA 2P74A 4KQDA 3PBRA 2WGIA 4OKPA 1ZKJA 1BULA 5HWVA 1YLYA 1XJ4A 4UA9A 1S4SA 2PAVP 3OZHA 1K57A 3WS0A 3QP5A 3ZG0A 1W5DA 3GRJA 3FKVA 2O0YA 4OH0A 2G7UA 4Y13A 2ZC7A 3DTEA 3ZG5A 4CLCA 4MBKA 1F9IA 2QPNA 2H28A 5E2GA 4BL3A 3GMWA 4JPMA 2PHYA 5L10A 3IF6B 1I2SA 4DJ3A 5F1FA 4JBFA 4IUHA 3IT9A 2P9VA 2OWJA 2EXAA 5F5YA 5L2FA 4LFUA 3ULFA 1ONHA 2ZM8A 3LEQA 5E2HA 1L0GA 2P7JA 4L9EA 5AQ7A 2Y59A 3ITBA 1NY0A 3BFGA 3HLCA 3OPPA 3SS5A 2HDRA 5GHZA 3ZVTA 3O88A 3ZYTA 2Y2OA 5IS1A 3JVVA 3EGXC 5JYOA 3UMEA 3IF6C 3TOIA 2WGWB 5I5LA 2VJWA 4ETZA 4BJPA 3G34A 3FG8A 2ZQ7A 3OOVA 1PWDA 4GW9A 3UPPA 1LLBA 4S2KA 3F1NB 3IX8A 1W7FA 2XD5A 5JYPA 5KSCA 3AGDA 2VGLM 1BT5A 4PM7A 2W3GA 3T1XA 5AVEA 3A3DA 4KG6A 3GVBA 4UAAA 2WZXA 1UGUA 2ACGA 3Q07A 3F1PB 2A2LA 1K56A 1K25A 3S22A 3TSGA 2VLGA 3IXDA 5C5KA 4C75A 4K0XA 4JGQA 3S4XA 3ZG8B 5G4ZA 1W63M 3Q1FA 4EESA 5HFOA 4P6ZS 1GA9A 4L9FA 3A3FA 3K3CA 5MC7A 2Y91A 4R4SA 2EX6A 3G30A 5AQBA 1M40A 2ZMVA 4EV4A 5HDDA 1GHPA 2GDNA 3R7WB 3MXRA 2VGKA 2FFFB 1DJBA 4OLGA 1K55A 5A93A 5FI2A 5DF7A 2LB5A 3WS1A 2J3TC 3MQOA 4MMNA 2PYRA 1D06A 1XA7A 3HBRA 3HLBA 4MBFA 4BWIA 1K6RA 1VQQA 2FZ0A 3VFHA 4LCMA 1OMEA 5DFYA 1SKOB 3E2LA 1O07A 4HJ3A 5AQAA 2ZMFA 4UA6A 3OCNA 5FEGA 3RFBA 5FDSA 4QPRA 2HGVA 3LR0A 4UEYA 2Z6DA 5U47A 4OP8A 1VETA 4PM6A 5DJTA 3BJNA 1Z6FA 4QJGA 3D72A 3F1PA 4QWOA 3ZG7B 1NLZA 3E4PA 3ZG9B 2BLSA 4QY6A 4R0QA 2ZLYA 3JYIA 3G31A 1P97A 4OQGA 3BFEA 1ES2A 3IX4A 4IHQA 2X02A 1P9RA 3KYQA 2HP6A 3LFVA 3E4OA 3GDIA 2JKGA 4GS9A 2XFTA 1XP4A 4WEJA 1XJ6A 4YINA 5IT5A 3VOZA 1NRFA 3V5MA 4QB8A 1TD5A 4LLOB 3R7WA 5CGSA 1JTDA 1K38A 5EECA 1MXOA 2DCFA 1L3LA 1IELA 2XA7M 3HJKA 4KUOA 3BFCA 2V9AA 1V9YA 4KENB 4DE2A 2AVXA 4PKYG 1YQSA 3HLGA 4ZTKA 4HJ6A 2RL3A 2PYPA 4Y7PA 1HD8A 3DTKA 1SDNA 4B93A 3U4LP 1YLZA 4JXWA 1ZHHB 4EERA 3L7HA 3EWKA 2B5RA 3E98A 3C30A 1PIOA 2W3FA 5FQ9A 1MWSA 4N9LA 3O87A 2XK1A 3MF0A 5DF8A 1FSYA 1K4FA 2G2UA 4IVKA 2O9BA 2Z2LB 5I94A 5IU1A 3VFFA 3QP8A 4M4XA 1PZPA 3ZNTA 4EBNA 3ZQ5A 4FH4A 1N4OA 5CGWA 4FTXA 3IBJA 5HD5A 4NKPA 2O9AA 5L09A 3UE6A 2Y2NA 4GCZA 5DKKA 3FKWA 3C5AA 3IWIA 3NULA 4X1MA 2NUTC 3FWLA 1Y4OA 3D4FA 4R4RA 4QY5A 1KE0A 4YNRA 3QNCA 5CTMA 5EVLA 4ZJ1A 5LBRA 3WRZA 4UA7A 1S1ZA 3MKEA 1L0FA 1KGEA 3FC7A 3PHYA 2E8JA 4EWFA 1H3QA 1G6OA 3FV7A 2WKEA 2ZM0A 1NZOA 4WELA 2J7VA 3HJIA 1DY6A 3P09A 1MPLA 1EROA 3LI9A 2XF3A 1OPXA 3KX0X 3VSLA 5FQQA 4Q0IA 1FCNA 4E6WA 1MWRA 1VEUB 5A91A 4Q8IA 1VHMA 4HQAA 3BLMA 2P04A 4OPZA 2Y2HA 1ERMA 1T19A 1OTEA 2VK3A 4X55A 2JBFA 3BM6A 3SW1A 4I3AA 3UO9A 3UE3A 3QNBA 2V1BA 4H6JB 4KZ4A 4OVDA 3MMHA 3PAEA 1JNUA 2O9CA 1A0KA 4C3QA 2XD1A 3I7JA 3ZVWA 5HX9A 2VA0A 3O3VA 1GSXA 4BD0A 4WEKA 3CPTB 5IHVA 1NZUA 4KZBA 4WMCD 4XT2B 2EX8A 4OOMA 2PR6A 3UB7A 4GOGA 3O86A 1XJ2A 2EFUA 1F98A 3BQAA 3MZFA 3N8SA 3T4KA 4I38A 4BBUA 1CF0A 5A90A 5J4EA 3P01A 4R1GA 4IVIA 4E3NA 2L4RA 4D2OA 1NXYA 4WUJA 3AGEA 3BY9A 1FOFA 1PYYA 3G4PA 4X56A 3A3EA 3OPHA 3VOLA 2VV7A 1PFLA 2XROA 2K7SA 4BL2A 4MN5A 3UB8A 3UPOA 3S7QA 3CHWP 2ZMAA 1NYMA 2VZWA 5M19A 4OOLA 2HZ5A 3M6HA 2XR0A 4IBXA 2QJ5A 5FQKA 5F83A 4E6XA 3NDEA 3VE4A 3LEZA 5TJJA 3BFFA 1VEUA 5DVAA 4IBRA 1XGIA 2ZQ8A 3SH9A 1F2KA 4P6ZM 3QP1A 2EWWA 4HH2A 5F82A 3VP1A 2PR5A 1S1YA 1XXMA 4PAUA 1RP5A 3A0VA 2Y55A 4H6JA
chains in the Genus database with same CATH topology
1PWDA 3UPPA 2Y2IA 4R3BA 1BTLA 1LLBA 4S2KA 4L0LA 2EFXA 1BLCA 1W7FA 4LV0A 5FQIA 2XD5A 1E25A 1GHIA 5CHMA 3HL9A 5EVIB 2WAFA 5JYPA 5KSCA 4S2NC 2XLNA 4HEFA 4QHCA 3C7VA 5GHYA 2EXBA 1NJ4A 3AGDA 1PI5A 3IXBA 1BT5A 4N1XA 1I2WA 1E4DA 1JTGA 4PM7A 5FDHA 5TFQA 1TEMA 5EOOA 3IH9A 3A3DA 4C6YA 1QMFA 1JWZA 4KG6A 1IKGA 3GVBA 4UAAA 3ZFZA 2WZXA 4LCLA 3Q07A 4WM9A 3V3RA 3BECA 3HUNA 1K56A 1K25A 4DXCA 1K54C 2X71A 4RX3A 3DWZA 2HDQA 3V50A 3S22A 1K4EA 3TSGA 3CG5A 3IXDA 4C75A 4K0XA 4RVAA 4P87A 2J8YA 2H10A 5FQJA 1G68A 5FATA 1IYOA 3SH7A 5G18A 1KGFA 3S4XA 4N9KA 3ZG8B 2OLUA 3ZDJA 2XH9A 3Q1FA 1YLPA 3RXWA 3LCEA 5HFOA 2Y2JA 3NCKA 5CHUA 1GA9A 4U0XA 4PMAA 5EVIC 4WZ4A 1K56D 5CEBA 4N92A 1SDEA 2ZD8A 2V1ZA 2WKIA 3PBOA 3A3FA 5FQMA 2QZ6A 2H0YA 5HAPA 2OLVA 1Q2PA 2Y2KA 2Y2MA 2Y91A 3A3IA 3N7WA 4R4SA 1CK3A 1G6AA 4XUZA 3N4IA 3QHYA 4S2NA 1IYQA 4DF6A 3IHAA 3GTCA 4B4XA 4KZAA 4EBLA 2EX6A 1N9BA 5M1AA 3CZDA 3PBNA 3G35A 1YM1A 4OPQA 1E3UA 5HARA 3G30A 5AQBA 1M40A 4EV4A 1GHPA 2GDNA 2Y4AA 3HLDA 4GNUA 4DE3A 3MXRA 2OV5A 3G32A 2VGKA 4BENA 1MY8A 3SH8A 4MLLA 2FFFB 1DJBA 3Q82A 1K55A 4OLGA 5A93A 5FI2A 3Q7VB 2A3UA 2ZC3B 1XPBA 2XFSA 1K54A 5DF7A 3WRTA 3WS1A 2ZC4B 2WKHA 3LY4A 1XA7A 3HBRA 3HLBA 5FA7A 5D3OA 4JF4A 4KQRA 4MBFA 1U60A 1CI9A 3EQUA 4BD1A 1TDGA 1K6RA 1LL5A 1VQQA 2IWCA 1E3UD 1EI5A 1XKZA 1FR6A 2QMIA 3VFHA 4LCMA 1IEMA 1OMEA 1C3BA 2WYXA 3V3SA 4LV2A 3G2ZA 4HBUA 3E2KA 4KZ6A 3E2LA 1O07A 5AQAA 4EUZA 4UA6A 1YMSA 3OCNA 1Q2QA 1LHYA 4S2IA 5CXWA 5DF9A 1TVFA 1HTZA 2C6WB 1KDSA 4CPKA 3HUMA 3GR2A 1L0EA 4DE0A 3SS3A 5GLDA 1ONGA 5U47A 4OP8A 3IXHA 1FCMA 4PM6A 1YLJA 4HESA 1ALQA 1Z6FA 3SS4A 4QJGA 1S6RA 5F1GA 1IKIA 1L0DA 4QU3A 3ZG7B 1W79A 3GV9A 2HDSA 1MBLA 3HLEA 4OONA 1YLWA 4ZBEA 2FFYA 3ZG9B 1M6KA 1Y54A 2BLSA 4N1HA 4OOYA 4QY6A 4R0QA 2ZLYA 5CRFA 3JYIA 5A92A 3G31A 1CEFA 1TDLA 4X6TA 3UDXA 4DRTA 2WUQA 4OQGA 4B4ZA 3BFEA 2V20A 5CTNA 5E43A 5HW3A 1ES2A 3OCLA 2WGVA 5FAPA 3PBSA 1PI4A 5FSRA 2P9VB 4B88A 1HVBA 3MZEA 5GHXA 4GZBA 2X02A 4WZ5C 5CECA 3ISGA 5KSHA 2HP6A 4GB7A 1GHMA 2EX9A 1LL9A 2V2FF 3FYZA 1W8QA 3HREA 3RXXA 3W4OA 2J9PA 4JF6A 2XFTA 2Y2LA 3TG9A 1S0WA 3N6IA 3Q81A 1RGYA 5CEDA 1IYPA 3IQAA 2WK0A 1BLPA 1XP4A 2ZQ9A 1BLHA 4R23A 4WEJA 3LO7A 4YINA 3C4OA 3VOZA 1GCEA 1QMEA 4X53A 2DNSA 1PW1A 3OC2A 1NRFA 4OPRA 4U0TA 3V5MA 4OQIA 3IF6A 3BEBA 4QB8A 3NY4A 5CGSA 1ERQA 1JTDA 1K38A 2HP5A 1WYCA 3A3JA 3PBQA 3PBTA 5DTSA 1PZOA 1MXOA 5EECA 2DCFA 4GDBA 1IELA 1XGJA 3BFCA 4KENB 4DE2A 3Q7VA 5TGFA 1KE4A 1YQSA 2XDMA 2ZM2A 3HLGA 4KZ8A 4ZTKA 1BZAA 4P85A 4E3OA 2RL3A 1CI8A 2ZC6B 4Y7PA 4MEZA 4YFMA 4CJNA 5FI6A 1HD8A 3VP4A 3BRMA 1FSWA 1SDNA 5GL9A 1YLZA 4JXWA 1KVLA 2Y2GA 4IEDA 4JF5A 4X69A 3V39A 2B5RA 4R3JA 3VSKA 1PIOA 1LI9A 3CJMA 5FQ9A 5GLAA 4PM8A 4S2JA 3MBZA 2UWXA 4MNRA 5KMWA 3SOIA 1MWSA 3NBLA 4N9LA 4OLDA 4Y0TA 3DW0A 1ZG4A 3O87A 2XEPA 4WYYA 1ESUA 4XUXA 4GDNA 1ZG6A 2XK1A 2JCHA 5DF8A 5FI7A 1FSYA 1K4FA 1ES3A 2G2UA 1IYSA 3Q7ZA 1FQGA 2PBYA 3MXSA 4IVKA 5CGXA 5EUAA 2WGWA 3BFDA 2Z2LB 3GSGA 4M3KA 5FAQA 1SCWA 1FCOA 5I94A 4S2PA 1ES4A 4JXSA 1I5QA 3VFFA 1PZPA 3W4QA 4Z9QA 3UDIA 3PTEA 5CERA 3ZNTA 3LY3A 4EBNA 3BYDA 5J8XA 3HLFA 3PAGA 3UDFA 4XXRA 2ZQCA 4FH4A 1N4OA 2C5WB 3OPLA 4P0MA 4FH2A 3UE1A 5CGWA 2WAEA 3VOYA 4S2MA 3IHBA 1CEGA 5EVIA 5FAOA 1YMXA 5EE8A 3WWXA 3IWQA 3IWOA 3ZNYA 3MKFA 2Y2NA 3M2JA 1KE3A 4KZ3A 4KZ7A 4JLFA 4FD8A 2H5SA 2OSUA 2ZQAA 5BOHA 3FKWA 3C5AA 4KG2A 3IWIA 1XA1A 3FWLA 3NC8A 2XQZA 4BLMA 3D4FA 4R4RA 4QY5A 5CHJA 2RCXA 4GD8A 1KE0A 3N8LA 2ZQDA 4NK3A 4ZDXA 3C4PA 4ZAMA 3S1YA 4S2OA 3GQZA 3UE0A 3W8KA 3UY6A 3QNCA 2R9XA 5CTMA 5EVLA 3VMAA 3HLWA 1MKIA 5EOEA 5EVID 2R9WA 4WBGA 3ITAA 4ZJ1A 4H8RA 3WRZA 4UA7A 4PM5A 1H8YA 2EX2A 3MKEA 1L0FA 4JXGA 1KGEA 3UN7A 3MZDA 1WE4A 2J9OA 3NIAA 4EWFA 3N8RA 4KZ9A 3BLSA 2H0TA 3CMZA 3G2YA 3FV7A 4PM9A 5DTKA 1NYYA 5AQ9A 3W4PA 2WKEA 1KGGA 1K57C 2ZM0A 1NZOA 4UHUA 2J7VA 4WELA 3VP3A 4E3MA 1LI0A 3HUOA 3ZCZA 1DY6A 3P09A 1SKFA 1MPLA 1EROA 1KVMA 5HAIA 2XF3A 3FZCA 1RCJA 4O7DA 4EQIA 3IF5A 3EQVA 2I72A 3VSLA 5FQQA 4PPRA 2WADA 5E2FA 1FCNA 2WZZA 4E6WA 2HDUA 1XX2A 3DWKA 1MWRA 2ZC5B 4LENA 1JWPA 3M6BA 2VGJA 3HVFA 5A91A 4Q8IA 2HP9A 1JWVA 4BQMA 1H5XA 4OQ0A 3BLMA 4ZJ2A 3UNWA 5M18A 4EBPA 4OPZA 2Y2HA 1ERMA 4ID4A 5EPHA 2HPBA 2IWBA 2X01A 1MWUA 2IWDA 2Y2PA 4KQOA 4QD4A 5HAQA 4LV1A 2ZJ9A 4E3KA 4X55A 2JBFA 3BM6A 3VP0A 1K55C 4JKTA 3UPNA 4FSFA 4Y0OA 3AGFA 4ZJ3A 1MWTA 1BLSA 3WS5A 3UO9A 4GD6A 4WMCA 3UE3A 2P74A 3QNBA 4Y0UA 3PBRA 3NI9A 2WGIA 4KZ4A 4OKPA 4OVDA 1ZKJA 3RJUA 2JC7A 2Z2MB 4F94A 3B3XA 4P6BA 1BULA 3IXGA 4DDYA 1BSGA 3PAEA 1YLYA 2PU4A 1ES5A 4C3QA 1J9MA 2XD1A 2CC1A 3I7JA 3ZVWA 4UA9A 3VP2A 4WZ5A 2Y2QA 5HX9A 3O3VA 4OP5A 4U3TA 2G2WA 1W8YA 3OZHA 1K57A 3WS0A 1FR1A 4WEKA 4MBHA 4BD0A 3ZG0A 1W5DA 1PWCA 1AXBA 1BUEA 1GA0A 4OQHA 5IHVA 1NZUA 3GRJA 4KZBA 1ZC2A 4WMCD 3FKVA 3NDGA 4OH0A 3C7UA 3ZHHA 1EWZA 2EX8A 2ZC7A 4NETA 2JE5A 4OOMA 3ZG5A 1K6SA 4GOGA 4HBTA 3O86A 1ESIA 3WS2A 2EFUA 3MZFA 1H8ZA 3N8SA 4LV3A 4MBKA 4GN2A 4E3LA 4OPYA 2QPNA 5FASA 3P98A 5E2GA 4BL3A 1O7EA 3GMWA 4JPMA 1HZOA 2Q9NA 3IF6B 5A90A 1I2SA 4R1GA 4IVIA 4E3NA 4DE1A 5F1FA 1DJAA 4JBFA 4D2OA 4E3JA 4S2LA 2DRWA 1NXYA 4K91A 4E3IA 3AGEA 3IT9A 1FOFA 1PYYA 3G4PA 4RX2A 4X56A 3A3EA 3OPHA 4X68A 4KG5A 1JVJA 2P9VA 2PU2A 5GLCA 4JXVA 4DKIA 2EXAA 4BL2A 1SHVA 5L2FA 2Q9MA 5GLBA 3OPRA 3UPOA 1KDWA 1DJCA 1ONHA 2E8IA 3M2KA 4GKUA 2ZMAA 1NYMA 2ZM8A 5M19A 4OOLA 5E2HA 1L0GA 4KQQA 3M6HA 5AQ7A 2XR0A 3ZGAB 4A5RA 2Y59A 4DDSA 3ITBA 4IBXA 1NY0A 1YLTA 3BFGA 3HLCA 3OPPA 3WS4A 3SS5A 5FQKA 2HDRA 5F83A 4E6XA 3NDEA 5GHZA 3DTMA 3LEZA 1L2SA 5E2EA 2BG1A 3ZVTA 4K0WA 3O88A 4RA7A 1YT4A 2Y2OA 4FCFA 1PW8A 2A49A 3BFFA 4RYEA 1WYBA 5DVAA 5JYOA 1VM1A 4IBRA 4KZ5A 1XGIA 3IF6C 5KZHA 3TOIA 2ZQ8A 3IH8A 5TR7A 2WGWB 3SH9A 5HL1A 5DTTA 4BJPA 2XGNA 1PWGA 3G34A 5F82A 3VP1A 1XXMA 1RGZA 2ZQ7A 1RP5A 4DXBA 3MFDA 2Y55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PWD A;  3UPP A;  2Y2I A;  4R3B A;  1BTL A;  1LLB A;  4S2K A;  4L0L A;  2EFX A;  1BLC A;  1W7F A;  4LV0 A;  5FQI A;  2XD5 A;  1E25 A;  1GHI A;  5CHM A;  3HL9 A;  5EVI B;  2WAF A;  5JYP A;  5KSC A;  4S2N C;  2XLN A;  4HEF A;  4QHC A;  3C7V A;  5GHY A;  2EXB A;  1NJ4 A;  3AGD A;  1PI5 A;  3IXB A;  1BT5 A;  4N1X A;  1I2W A;  1E4D A;  1JTG A;  4PM7 A;  5FDH A;  5TFQ A;  1TEM A;  5EOO A;  3IH9 A;  3A3D A;  4C6Y A;  1QMF A;  1JWZ A;  4KG6 A;  1IKG A;  3GVB A;  4UAA A;  3ZFZ A;  2WZX A;  4LCL A;  3Q07 A;  4WM9 A;  3V3R A;  3BEC A;  3HUN A;  1K56 A;  1K25 A;  4DXC A;  1K54 C;  2X71 A;  4RX3 A;  3DWZ A;  2HDQ A;  3V50 A;  3S22 A;  1K4E A;  3TSG A;  3CG5 A;  3IXD A;  4C75 A;  4K0X A;  4RVA A;  4P87 A;  2J8Y A;  2H10 A;  5FQJ A;  1G68 A;  5FAT A;  1IYO A;  3SH7 A;  5G18 A;  1KGF A;  3S4X A;  4N9K A;  3ZG8 B;  2OLU A;  3ZDJ A;  2XH9 A;  3Q1F A;  1YLP A;  3RXW A;  3LCE A;  5HFO A;  2Y2J A;  3NCK A;  5CHU A;  1GA9 A;  4U0X A;  4PMA A;  5EVI C;  4WZ4 A;  1K56 D;  5CEB A;  4N92 A;  1SDE A;  2ZD8 A;  2V1Z A;  2WKI A;  3PBO A;  3A3F A;  5FQM A;  2QZ6 A;  2H0Y A;  5HAP A;  2OLV A;  1Q2P A;  2Y2K A;  2Y2M A;  2Y91 A;  3A3I A;  3N7W A;  4R4S A;  1CK3 A;  1G6A A;  4XUZ A;  3N4I A;  3QHY A;  4S2N A;  1IYQ A;  4DF6 A;  3IHA A;  3GTC A;  4B4X A;  4KZA A;  4EBL A;  2EX6 A;  1N9B A;  5M1A A;  3CZD A;  3PBN A;  3G35 A;  1YM1 A;  4OPQ A;  1E3U A;  5HAR A;  3G30 A;  5AQB A;  1M40 A;  4EV4 A;  1GHP A;  2GDN A;  2Y4A A;  3HLD A;  4GNU A;  4DE3 A;  3MXR A;  2OV5 A;  3G32 A;  2VGK A;  4BEN A;  1MY8 A;  3SH8 A;  4MLL A;  2FFF B;  1DJB A;  3Q82 A;  1K55 A;  4OLG A;  5A93 A;  5FI2 A;  3Q7V B;  2A3U A;  2ZC3 B;  1XPB A;  2XFS A;  1K54 A;  5DF7 A;  3WRT A;  3WS1 A;  2ZC4 B;  2WKH A;  3LY4 A;  1XA7 A;  3HBR A;  3HLB A;  5FA7 A;  5D3O A;  4JF4 A;  4KQR A;  4MBF A;  1U60 A;  1CI9 A;  3EQU A;  4BD1 A;  1TDG A;  1K6R A;  1LL5 A;  1VQQ A;  2IWC A;  1E3U D;  1EI5 A;  1XKZ A;  1FR6 A;  2QMI A;  3VFH A;  4LCM A;  1IEM A;  1OME A;  1C3B A;  2WYX A;  3V3S A;  4LV2 A;  3G2Z A;  4HBU A;  3E2K A;  4KZ6 A;  3E2L A;  1O07 A;  5AQA A;  4EUZ A;  4UA6 A;  1YMS A;  3OCN A;  1Q2Q A;  1LHY A;  4S2I A;  5CXW A;  5DF9 A;  1TVF A;  1HTZ A;  2C6W B;  1KDS A;  4CPK A;  3HUM A;  3GR2 A;  1L0E A;  4DE0 A;  3SS3 A;  5GLD A;  1ONG A;  5U47 A;  4OP8 A;  3IXH A;  1FCM A;  4PM6 A;  1YLJ A;  4HES A;  1ALQ A;  1Z6F A;  3SS4 A;  4QJG A;  1S6R A;  5F1G A;  1IKI A;  1L0D A;  4QU3 A;  3ZG7 B;  1W79 A;  3GV9 A;  2HDS A;  1MBL A;  3HLE A;  4OON A;  1YLW A;  4ZBE A;  2FFY A;  3ZG9 B;  1M6K A;  1Y54 A;  2BLS A;  4N1H A;  4OOY A;  4QY6 A;  4R0Q A;  2ZLY A;  5CRF A;  3JYI A;  5A92 A;  3G31 A;  1CEF A;  1TDL A;  4X6T A;  3UDX A;  4DRT A;  2WUQ A;  4OQG A;  4B4Z A;  3BFE A;  2V20 A;  5CTN A;  5E43 A;  5HW3 A;  1ES2 A;  3OCL A;  2WGV A;  5FAP A;  3PBS A;  1PI4 A;  5FSR A;  2P9V B;  4B88 A;  1HVB A;  3MZE A;  5GHX A;  4GZB A;  2X02 A;  4WZ5 C;  5CEC A;  3ISG A;  5KSH A;  2HP6 A;  4GB7 A;  1GHM A;  2EX9 A;  1LL9 A;  2V2F F;  3FYZ A;  1W8Q A;  3HRE A;  3RXX A;  3W4O A;  2J9P A;  4JF6 A;  2XFT A;  2Y2L A;  3TG9 A;  1S0W A;  3N6I A;  3Q81 A;  1RGY A;  5CED A;  1IYP A;  3IQA A;  2WK0 A;  1BLP A;  1XP4 A;  2ZQ9 A;  1BLH A;  4R23 A;  4WEJ A;  3LO7 A;  4YIN A;  3C4O A;  3VOZ A;  1GCE A;  1QME A;  4X53 A;  2DNS A;  1PW1 A;  3OC2 A;  1NRF A;  4OPR A;  4U0T A;  3V5M A;  4OQI A;  3IF6 A;  3BEB A;  4QB8 A;  3NY4 A;  5CGS A;  1ERQ A;  1JTD A;  1K38 A;  2HP5 A;  1WYC A;  3A3J A;  3PBQ A;  3PBT A;  5DTS A;  1PZO A;  1MXO A;  5EEC A;  2DCF A;  4GDB A;  1IEL A;  1XGJ A;  3BFC A;  4KEN B;  4DE2 A;  3Q7V A;  5TGF A;  1KE4 A;  1YQS A;  2XDM A;  2ZM2 A;  3HLG A;  4KZ8 A;  4ZTK A;  1BZA A;  4P85 A;  4E3O A;  2RL3 A;  1CI8 A;  2ZC6 B;  4Y7P A;  4MEZ A;  4YFM A;  4CJN A;  5FI6 A;  1HD8 A;  3VP4 A;  3BRM A;  1FSW A;  1SDN A;  5GL9 A;  1YLZ A;  4JXW A;  1KVL A;  2Y2G A;  4IED A;  4JF5 A;  4X69 A;  3V39 A;  2B5R A;  4R3J A;  3VSK A;  1PIO A;  1LI9 A;  3CJM A;  5FQ9 A;  5GLA A;  4PM8 A;  4S2J A;  3MBZ A;  2UWX A;  4MNR A;  5KMW A;  3SOI A;  1MWS A;  3NBL A;  4N9L A;  4OLD A;  4Y0T A;  3DW0 A;  1ZG4 A;  3O87 A;  2XEP A;  4WYY A;  1ESU A;  4XUX A;  4GDN A;  1ZG6 A;  2XK1 A;  2JCH A;  5DF8 A;  5FI7 A;  1FSY A;  1K4F A;  1ES3 A;  2G2U A;  1IYS A;  3Q7Z A;  1FQG A;  2PBY A;  3MXS A;  4IVK A;  5CGX A;  5EUA A;  2WGW A;  3BFD A;  2Z2L B;  3GSG A;  4M3K A;  5FAQ A;  1SCW A;  1FCO A;  5I94 A;  4S2P A;  1ES4 A;  4JXS A;  1I5Q A;  3VFF A;  1PZP A;  3W4Q A;  4Z9Q A;  3UDI A;  3PTE A;  5CER A;  3ZNT A;  3LY3 A;  4EBN A;  3BYD A;  5J8X A;  3HLF A;  3PAG A;  3UDF A;  4XXR A;  2ZQC A;  4FH4 A;  1N4O A;  2C5W B;  3OPL A;  4P0M A;  4FH2 A;  3UE1 A;  5CGW A;  2WAE A;  3VOY A;  4S2M A;  3IHB A;  1CEG A;  5EVI A;  5FAO A;  1YMX A;  5EE8 A;  3WWX A;  3IWQ A;  3IWO A;  3ZNY A;  3MKF A;  2Y2N A;  3M2J A;  1KE3 A;  4KZ3 A;  4KZ7 A;  4JLF A;  4FD8 A;  2H5S A;  2OSU A;  2ZQA A;  5BOH A;  3FKW A;  3C5A A;  4KG2 A;  3IWI A;  1XA1 A;  3FWL A;  3NC8 A;  2XQZ A;  4BLM A;  3D4F A;  4R4R A;  4QY5 A;  5CHJ A;  2RCX A;  4GD8 A;  1KE0 A;  3N8L A;  2ZQD A;  4NK3 A;  4ZDX A;  3C4P A;  4ZAM A;  3S1Y A;  4S2O A;  3GQZ A;  3UE0 A;  3W8K A;  3UY6 A;  3QNC A;  2R9X A;  5CTM A;  5EVL A;  3VMA A;  3HLW A;  1MKI A;  5EOE A;  5EVI D;  2R9W A;  4WBG A;  3ITA A;  4ZJ1 A;  4H8R A;  3WRZ A;  4UA7 A;  4PM5 A;  1H8Y A;  2EX2 A;  3MKE A;  1L0F A;  4JXG A;  1KGE A;  3UN7 A;  3MZD A;  1WE4 A;  2J9O A;  3NIA A;  4EWF A;  3N8R A;  4KZ9 A;  3BLS A;  2H0T A;  3CMZ A;  3G2Y A;  3FV7 A;  4PM9 A;  5DTK A;  1NYY A;  5AQ9 A;  3W4P A;  2WKE A;  1KGG A;  1K57 C;  2ZM0 A;  1NZO A;  4UHU A;  2J7V A;  4WEL A;  3VP3 A;  4E3M A;  1LI0 A;  3HUO A;  3ZCZ A;  1DY6 A;  3P09 A;  1SKF A;  1MPL A;  1ERO A;  1KVM A;  5HAI A;  2XF3 A;  3FZC A;  1RCJ A;  4O7D A;  4EQI A;  3IF5 A;  3EQV A;  2I72 A;  3VSL A;  5FQQ A;  4PPR A;  2WAD A;  5E2F A;  1FCN A;  2WZZ A;  4E6W A;  2HDU A;  1XX2 A;  3DWK A;  1MWR A;  2ZC5 B;  4LEN A;  1JWP A;  3M6B A;  2VGJ A;  3HVF A;  5A91 A;  4Q8I A;  2HP9 A;  1JWV A;  4BQM A;  1H5X A;  4OQ0 A;  3BLM A;  4ZJ2 A;  3UNW A;  5M18 A;  4EBP A;  4OPZ A;  2Y2H A;  1ERM A;  4ID4 A;  5EPH A;  2HPB A;  2IWB A;  2X01 A;  1MWU A;  2IWD A;  2Y2P A;  4KQO A;  4QD4 A;  5HAQ A;  4LV1 A;  2ZJ9 A;  4E3K A;  4X55 A;  2JBF A;  3BM6 A;  3VP0 A;  1K55 C;  4JKT A;  3UPN A;  4FSF A;  4Y0O A;  3AGF A;  4ZJ3 A;  1MWT A;  1BLS A;  3WS5 A;  3UO9 A;  4GD6 A;  4WMC A;  3UE3 A;  2P74 A;  3QNB A;  4Y0U A;  3PBR A;  3NI9 A;  2WGI A;  4KZ4 A;  4OKP A;  4OVD A;  1ZKJ A;  3RJU A;  2JC7 A;  2Z2M B;  4F94 A;  3B3X A;  4P6B A;  1BUL A;  3IXG A;  4DDY A;  1BSG A;  3PAE A;  1YLY A;  2PU4 A;  1ES5 A;  4C3Q A;  1J9M A;  2XD1 A;  2CC1 A;  3I7J A;  3ZVW A;  4UA9 A;  3VP2 A;  4WZ5 A;  2Y2Q A;  5HX9 A;  3O3V A;  4OP5 A;  4U3T A;  2G2W A;  1W8Y A;  3OZH A;  1K57 A;  3WS0 A;  1FR1 A;  4WEK A;  4MBH A;  4BD0 A;  3ZG0 A;  1W5D A;  1PWC A;  1AXB A;  1BUE A;  1GA0 A;  4OQH A;  5IHV A;  1NZU A;  3GRJ A;  4KZB A;  1ZC2 A;  4WMC D;  3FKV A;  3NDG A;  4OH0 A;  3C7U A;  3ZHH A;  1EWZ A;  2EX8 A;  2ZC7 A;  4NET A;  2JE5 A;  4OOM A;  3ZG5 A;  1K6S A;  4GOG A;  4HBT A;  3O86 A;  1ESI A;  3WS2 A;  2EFU A;  3MZF A;  1H8Z A;  3N8S A;  4LV3 A;  4MBK A;  4GN2 A;  4E3L A;  4OPY A;  2QPN A;  5FAS A;  3P98 A;  5E2G A;  4BL3 A;  1O7E A;  3GMW A;  4JPM A;  1HZO A;  2Q9N A;  3IF6 B;  5A90 A;  1I2S A;  4R1G A;  4IVI A;  4E3N A;  4DE1 A;  5F1F A;  1DJA A;  4JBF A;  4D2O A;  4E3J A;  4S2L A;  2DRW A;  1NXY A;  4K91 A;  4E3I A;  3AGE A;  3IT9 A;  1FOF A;  1PYY A;  3G4P A;  4RX2 A;  4X56 A;  3A3E A;  3OPH A;  4X68 A;  4KG5 A;  1JVJ A;  2P9V A;  2PU2 A;  5GLC A;  4JXV A;  4DKI A;  2EXA A;  4BL2 A;  1SHV A;  5L2F A;  2Q9M A;  5GLB A;  3OPR A;  3UPO A;  1KDW A;  1DJC A;  1ONH A;  2E8I A;  3M2K A;  4GKU A;  2ZMA A;  1NYM A;  2ZM8 A;  5M19 A;  4OOL A;  5E2H A;  1L0G A;  4KQQ A;  3M6H A;  5AQ7 A;  2XR0 A;  3ZGA B;  4A5R A;  2Y59 A;  4DDS A;  3ITB A;  4IBX A;  1NY0 A;  1YLT A;  3BFG A;  3HLC A;  3OPP A;  3WS4 A;  3SS5 A;  5FQK A;  2HDR A;  5F83 A;  4E6X A;  3NDE A;  5GHZ A;  3DTM A;  3LEZ A;  1L2S A;  5E2E A;  2BG1 A;  3ZVT A;  4K0W A;  3O88 A;  4RA7 A;  1YT4 A;  2Y2O A;  4FCF A;  1PW8 A;  2A49 A;  3BFF A;  4RYE A;  1WYB A;  5DVA A;  5JYO A;  1VM1 A;  4IBR A;  4KZ5 A;  1XGI A;  3IF6 C;  5KZH A;  3TOI A;  2ZQ8 A;  3IH8 A;  5TR7 A;  2WGW B;  3SH9 A;  5HL1 A;  5DTT A;  4BJP A;  2XGN A;  1PWG A;  3G34 A;  5F82 A;  3VP1 A;  1XXM A;  1RGZ A;  2ZQ7 A;  1RP5 A;  4DXB A;  3MFD A;  2Y55 A; 
#chains in the Genus database with same CATH topology
 2Y2I A;  2NUP C;  1BTL A;  1BLC A;  2OAQ 1;  4LV0 A;  4S2N C;  4HEF A;  4QHC A;  1OTB A;  2EXB A;  3IXB A;  5EM1 A;  4N1X A;  1WA9 A;  1I2W A;  1JTG A;  4MCW A;  5FL3 A;  1QMF A;  4BBT A;  1JWZ A;  3ZFZ A;  4LRX C;  4EU0 A;  4F3L B;  4RX3 A;  3DWZ A;  4I3J A;  3IS2 B;  1Z09 A;  4P87 A;  2V1A A;  2J8Y A;  2H10 A;  4NG2 A;  5FQJ A;  2EWV A;  1TS8 A;  3ZDJ A;  2QKP A;  1YLP A;  4Y17 A;  4BMW A;  5CHU A;  1YPR A;  2BAS A;  4U0X A;  4WZ4 A;  5EVE A;  5CEB A;  4N92 A;  2ZD8 A;  2V1Z A;  1VB6 A;  3PBO A;  5FQM A;  4NEE D;  2QZ6 A;  2OLV A;  1Q2P A;  2KLI A;  2L0W A;  3A3I A;  4DN0 A;  1CK3 A;  1G6A A;  4R3A A;  3QHY A;  4S2N A;  4DF6 A;  3GTC A;  3RH8 B;  5HPF A;  3T1S A;  5M1A A;  4OPQ A;  3T4Q A;  2KOI A;  5HAR A;  1X0O A;  4DE3 A;  3G32 A;  4BEN A;  2JKT M;  2B02 A;  4LPZ A;  2Y79 A;  2A3U A;  2ZC3 B;  3WRT A;  3R4K A;  2ZC4 B;  1MKM A;  3LY4 A;  2A24 A;  2W1T B;  4KQR A;  3LR4 A;  4BD1 A;  1TDG A;  2IWC A;  3EEH A;  2PD8 A;  1E3U D;  2QMI A;  3V3S A;  2KX6 A;  3G2Z A;  1YMS A;  3CAX A;  1Q2Q A;  4S2I A;  1DP8 A;  3HUM A;  3GR2 A;  1L0E A;  4RQ9 A;  4HP4 A;  2W3D A;  5HWW A;  1N9L A;  5GLD A;  1T1C A;  4O01 A;  3IXH A;  2QWS A;  3SS4 A;  3TRC A;  3GV9 A;  2HDS A;  4OON A;  1M6K A;  4N1H A;  5CRF A;  1TDL A;  2DMW A;  4X6T A;  4DRT A;  2GX5 A;  5CTN A;  3OCL A;  2WKP A;  3PBS A;  1HVB A;  1YKD A;  3G6O A;  2FH5 A;  4WZ5 C;  5HD3 A;  4NXG A;  2B95 A;  3EEA A;  3FYZ A;  2J9P A;  4HH3 A;  3IQA A;  1BLP A;  1BLH A;  2KDK A;  3C4O A;  1GCE A;  1QME A;  1J3W A;  2JKR I;  3LYX A;  1NWZ A;  2DNS A;  4U0T A;  2D02 A;  3IF6 A;  4HY8 A;  3PBQ A;  3A3J A;  4EET B;  3CLO A;  4GDB A;  5L8M A;  4HIA A;  1OJ5 A;  3JPU A;  5TGF A;  4KZ8 A;  1BZA A;  4P85 A;  4MEZ A;  3VP4 A;  3BRM A;  1FSW A;  2Y2G A;  4IED A;  4X69 A;  3V39 A;  5K5B A;  4R3J A;  2PD7 A;  1LI9 A;  1YAX A;  3CJM A;  4S2J A;  4WF0 A;  5KMW A;  3SOI A;  3NBL A;  1YSP A;  4OLD A;  3DW0 A;  1ZG4 A;  2XEP A;  2JCH A;  3Q7Z A;  1FQG A;  2PBY A;  3MXS A;  2WGW A;  2MJ6 A;  3BFD A;  3GSG A;  4M3K A;  5FAQ A;  3LR5 A;  3TE8 A;  2JKR M;  3UDI A;  5CER A;  3LY3 A;  3HLF A;  2ZOH A;  4FUW A;  3F1O B;  3F1N A;  4FH2 A;  3MXQ A;  3CI6 A;  4X1L A;  3IWQ A;  2LB9 A;  1LSV A;  3T50 A;  4KZ3 A;  5BOH A;  4JLF A;  4FD8 A;  2H5S A;  2ZQA A;  3T4S A;  4G3W A;  2RCX A;  4YOF A;  4GD8 A;  2ZQD A;  3S1Y A;  1K0K A;  4S2O A;  3LR3 A;  3NEC A;  3UE0 A;  3W8K A;  2R9X A;  3HLW A;  1MKI A;  2PBD P;  1OJG A;  3KSI A;  5EOE A;  5EVI D;  3TJZ C;  4WBG A;  3ITA A;  4JGP A;  2CMN A;  1IFQ A;  5HZH A;  3UN7 A;  3MZD A;  1WE4 A;  3S7O A;  3B42 A;  3NIA A;  3N8R A;  2B18 A;  2ZL1 B;  4PM9 A;  5DTK A;  5AQ9 A;  3T1R A;  1KGG A;  4ZRR A;  5G4Y A;  3D3O A;  3UMD A;  3VP3 A;  4E3M A;  4HI4 A;  3HUO A;  5HDC A;  3ZCZ A;  1SKF A;  5HAI A;  3FZC A;  1RCJ A;  1XFQ A;  2WZZ A;  2ZBB A;  4EUV A;  4LEN A;  5F68 A;  1ODV A;  3HVF A;  3T4T A;  2HP9 A;  4BQM A;  3UNW A;  4LRZ E;  4ID4 A;  2Y2P A;  2IWD A;  4QD4 A;  1DP6 A;  2ZJ9 A;  1MC0 A;  4R70 A;  4JKT A;  3AGF A;  1BLS A;  1T1B A;  3WS5 A;  4Y0U A;  3RJU A;  2Z2M B;  4F94 A;  2IA2 A;  4DDY A;  1BSG A;  1Y28 A;  2WKR A;  1KOU A;  1ES5 A;  3KSH A;  1SKO A;  2O99 A;  2Y2Q A;  2G2W A;  1FR1 A;  4HHD A;  5DJU A;  1PWC A;  3NHQ A;  1AXB A;  1BUE A;  1GA0 A;  2BTF P;  5TBM B;  3NDG A;  3C7U A;  4Q0J A;  3ZHH A;  1EWZ A;  4NET A;  2JE5 A;  1OT6 A;  1ESI A;  4HNB A;  3P98 A;  1HZO A;  1T1A A;  3QP2 A;  2VGL S;  1DJA A;  1P0Z A;  4S2L A;  2DRW A;  4RX2 A;  1F5M A;  1LL8 A;  3H9W A;  4EEP A;  4X68 A;  4KG5 A;  1JVJ A;  5GLC A;  4JXV A;  4DKI A;  1SHV A;  2ZL1 A;  4CLC D;  5GLB A;  3OPR A;  1OT9 A;  2Q0O A;  1DJC A;  4GKU A;  2E8I A;  3EOI A;  4HOI A;  3LGO A;  4KQQ A;  3ZGA B;  4A5R A;  4DDS A;  1YLT A;  1N9O A;  3DTM A;  1L2S A;  5E2E A;  2GNX A;  4RA7 A;  1YT4 A;  1BYW A;  5EM0 A;  4FCF A;  1WYB A;  1VM1 A;  4KZ5 A;  5DKL A;  1UWN X;  3IH8 A;  3U2A A;  2PDR A;  5DTT A;  2J80 A;  2XGN A;  3MJQ A;  1RGZ A;  2L1M A;  5EV0 A;  3S7P A;  4R3B A;  2EFX A;  4K08 A;  3OBF A;  5FQI A;  1E25 A;  5CHM A;  3HL9 A;  5EVI B;  2WAF A;  2XLN A;  4Y2F A;  3CWF A;  3LIA A;  5GHY A;  2QYB A;  1PI5 A;  1AWI A;  1TEM A;  4C6Y A;  5TBM A;  3UB5 P;  1IKG A;  2Y8H A;  4LCL A;  4WM9 A;  2HF6 A;  3HUN A;  1K54 C;  3V50 A;  2HDQ A;  3CG5 A;  3CUE C;  1G68 A;  5FAT A;  1IYO A;  3SH7 A;  5G18 A;  1KGF A;  4N9K A;  1V9Z A;  3KYE A;  2XH9 A;  3LCE A;  3MSH A;  3LIF A;  4PMA A;  5EVI C;  4D60 A;  1K56 D;  4EQ1 A;  4G3V A;  2WKI A;  3L9K A;  2M7V A;  2H0Y A;  5HAP A;  2Y2K A;  4I3I A;  2Y2M A;  4XUZ A;  5A8B A;  4I39 A;  1N9B A;  2YKH A;  3PBN A;  1YM1 A;  1H0M A;  1ACF A;  3HLD A;  4GNU A;  2OV5 A;  1MZU A;  1MY8 A;  3SH8 A;  1D7E A;  3Q82 A;  4ETX A;  2XFS A;  1K54 A;  4GHI B;  5FA7 A;  1OTD A;  4JF4 A;  1CI9 A;  1EI5 A;  1IEM A;  3ICY A;  4LV2 A;  3MQQ A;  4HBU A;  3GEC A;  4WN5 A;  3PYP A;  3OLO A;  1TVF A;  2JKF A;  2QJ7 A;  5EFW A;  2C6W B;  1KDS A;  4CPK A;  1OTI A;  3SS3 A;  3B33 A;  1ONG A;  5HWT A;  1FCM A;  1L0D A;  4WLA A;  4QU3 A;  4BBV A;  1MBL A;  3HLE A;  1YLW A;  1Y54 A;  4OOY A;  1S67 L;  1CEF A;  2WUQ A;  4B4Z A;  2D01 A;  2V20 A;  3RTY A;  3K3D A;  2W1R A;  4UQI S;  2P9V B;  3TW8 A;  4GZB A;  5CEC A;  3ISG A;  5KSH A;  1GHM A;  3CPT A;  1LL9 A;  2V2F F;  2JKT I;  3HRE A;  3LID A;  3TG9 A;  4XT2 A;  3Q81 A;  1RGY A;  2ZQ9 A;  4KUK A;  1PW1 A;  3OC2 A;  1TF1 A;  4OQI A;  4LGW A;  4NXF A;  3NY4 A;  1WYC A;  1PZO A;  1NLY A;  2JHE A;  2XDM A;  2ZM2 A;  2HJ9 C;  5F6A A;  4GHI A;  2ZC6 B;  2WKQ A;  4YFM A;  4CJN A;  5GL9 A;  1XFN A;  4FOF A;  3LIC A;  4Q0H A;  3VSK A;  2UWX A;  4JGO A;  4Y0T A;  1ZG6 A;  2VV8 A;  3DBA A;  1IYS A;  5EUA A;  5CGX A;  2EA9 A;  4Y15 A;  1SCW A;  4S2P A;  3K2N A;  4Z9Q A;  1DP9 A;  3PTE A;  3QP6 A;  3PAG A;  3UDF A;  4XXR A;  1NRJ A;  3OPL A;  2C5W B;  3UE1 A;  2WAE A;  3VOY A;  3IHB A;  4E04 A;  1DRM A;  2VV6 A;  1UWP X;  5DFX A;  2OSU A;  3E0Y A;  3NOU C;  4B9O A;  3NC8 A;  3MFX A;  1IOU A;  4NK3 A;  3N8L A;  5AVF A;  1T18 A;  3BY8 A;  3C4P A;  4ZAM A;  1PNE A;  3EGD C;  4F3L A;  3MS6 A;  1S66 L;  3IS2 A;  2R9W A;  4H8R A;  1SZV A;  2EX2 A;  3VV4 A;  3V67 A;  4KZ9 A;  3BLS A;  3CMZ A;  3W4P A;  4UHU A;  4PKY A;  1XJ3 A;  3IX3 A;  3MR0 A;  1KVM A;  1TS7 A;  1TS6 A;  4O7D A;  4EQI A;  3IF5 A;  4PPR A;  2GJ3 A;  5L07 A;  2HDU A;  3DWK A;  2ZC5 B;  3M6B A;  2GZA A;  1JWV A;  4ZJ2 A;  5M18 A;  1VET B;  2IWB A;  1MWU A;  5F69 A;  4KQO A;  4LV1 A;  1PRQ A;  1K55 C;  3UPN A;  4Y0O A;  4ZJ3 A;  1MWT A;  4GD6 A;  2J3W A;  4WMC A;  1GSV A;  3NI9 A;  2W1T A;  2JC7 A;  3B3X A;  4P6B A;  5HDS A;  3T1Q B;  3IXG A;  4GJ4 A;  2PU4 A;  1J9M A;  2CC1 A;  3VP2 A;  4WZ5 A;  4OP5 A;  3NOT C;  4U3T A;  3KSF A;  1W8Y A;  4MBH A;  1D1J A;  4OQH A;  1ZC2 A;  4GS9 B;  4CQH A;  3H82 B;  2VKS A;  5HL6 A;  2HJE A;  1K6S A;  1OTA A;  4HBT A;  3WS2 A;  1H8Z A;  1FIL A;  4LV3 A;  4GN2 A;  5AJG A;  4OPY A;  4E3L A;  2OAP 1;  5FAS A;  1O7E A;  2Q9N A;  4Y3I A;  4DE1 A;  4MN7 A;  4E3J A;  4K91 A;  4E3I A;  4NXE A;  4NXB A;  2PU2 A;  2Q9M A;  1KDW A;  2W27 A;  3M2K A;  4DJ2 A;  1LSX A;  1LSW A;  3WS4 A;  3H7W B;  1LT0 A;  2BG1 A;  4K0W A;  2V8C A;  1PW8 A;  2A49 A;  4RYE A;  1CQA A;  3T12 B;  5KZH A;  4R6L A;  5TR7 A;  5HL1 A;  1PWG A;  2W3H A;  4O8G A;  4MDZ A;  4DXB A;  3MFD A;  3PR6 A;  4L0L A;  5KIZ A;  4L9G A;  3DAV A;  1GHI A;  3C7V A;  1NJ4 A;  1E4D A;  3DTI A;  5FDH A;  5TFQ A;  5EOO A;  3VE3 A;  2ZOI A;  3IH9 A;  3PXP A;  3E4Q A;  3H82 A;  3V3R A;  3BEC A;  4DXC A;  1FIK A;  2X71 A;  3S7N A;  1K4E A;  2OWH A;  4RVA A;  3A0S A;  3F1O A;  2VEA A;  3D9Y A;  2M1C A;  4PHT A;  2OLU A;  1TS0 A;  3LIE A;  3HCY A;  3RXW A;  2Y2J A;  3NCK A;  2YKF A;  2INW A;  1SDE A;  2QHK A;  1STZ A;  1W63 Q;  3N7W A;  4Z1W A;  3N4I A;  1IYQ A;  3IHA A;  4B4X A;  4EBL A;  4KZA A;  5CX7 A;  2K31 A;  3C8C A;  1ZTU A;  2W3E A;  3H7W A;  3CZD A;  3G35 A;  1E3U A;  4WL9 A;  4I5S A;  2Y4A A;  5J7E A;  2JN7 A;  4UQI M;  4MLL A;  3Q7V B;  1XPB A;  2WKH A;  5D3O A;  4EXO A;  1U60 A;  3EQU A;  1HLU P;  1LL5 A;  2UV0 E;  5HPI A;  1XKZ A;  1FR6 A;  4ESP A;  4EEU A;  3BQ8 A;  2WYX A;  1C3B A;  3T4L A;  3B47 A;  4KZ6 A;  3E2K A;  4EUZ A;  1LHY A;  2Z6C A;  5CXW A;  5DF9 A;  1HTZ A;  2P08 A;  2HV1 A;  4DE0 A;  1YLJ A;  4ARZ B;  4HES A;  1ALQ A;  1S6R A;  2VX8 A;  5F1G A;  1IKI A;  5HSQ A;  1W79 A;  4ZBE A;  2FFY A;  2M7U A;  4II7 A;  3FPW A;  5A92 A;  3UDX A;  4GLQ A;  5HW3 A;  5E43 A;  2WGV A;  5FAP A;  3O5Y A;  1PI4 A;  2I9V A;  5FSR A;  3UB9 A;  4B88 A;  3MZE A;  5GHX A;  2OOL A;  1G5U A;  3C2W A;  2K2N A;  4GB7 A;  2EX9 A;  3KSG A;  1W8Q A;  3RXX A;  3W4O A;  4JF6 A;  2Y2L A;  1S0W A;  3N6I A;  1EW0 A;  5CED A;  4Y5F A;  1IYP A;  2WK0 A;  4R23 A;  3LO7 A;  1P9W A;  4X53 A;  4HJ4 A;  4OPR A;  3BEB A;  4JGR A;  4DMZ A;  3LUQ A;  1ERQ A;  2HP5 A;  5DTS A;  3PBT A;  4LRY C;  1XGJ A;  2PT7 A;  3T4J A;  3Q7V A;  1KE4 A;  3BW6 A;  2V0U A;  3UB6 A;  4E3O A;  1CI8 A;  3NOP C;  4EW7 A;  5FI6 A;  5J3W A;  2V8F A;  3MQ0 A;  3T4O A;  1KVL A;  4JF5 A;  4YWZ A;  3JVU A;  2XRN A;  5GLA A;  3KO6 A;  4PM8 A;  3MBZ A;  4MNR A;  2XSS A;  1CJF A;  4WYY A;  1ESU A;  4XUX A;  1G28 A;  4GDN A;  3P7N A;  5FI7 A;  1ES3 A;  4AFI A;  4ARZ A;  1FCO A;  1YSQ A;  1ES4 A;  1S4R A;  3FPV A;  1I5Q A;  4JXS A;  1N9N A;  3CUE A;  3W4Q A;  3LIB A;  3BYD A;  5J8X A;  2ZQC A;  2W0N A;  4P0M A;  4S2M A;  1CEG A;  5EVI A;  5FAO A;  1YMX A;  5EE8 A;  3WWX A;  2XA7 S;  3IWO A;  3ZNY A;  3MKF A;  3M2J A;  1KE3 A;  4KZ7 A;  4ME4 A;  3QP4 A;  4KG2 A;  1XA1 A;  2XQZ A;  4BLM A;  5CHJ A;  2PRF A;  3IBR A;  4CLC B;  4ZDX A;  4IJG A;  4MN6 A;  3GQZ A;  3UY6 A;  1H8M A;  3VMA A;  4PM5 A;  4O0P A;  1H8Y A;  1GSW A;  4JXG A;  3C38 A;  3W2Z A;  2J9O A;  2A24 B;  2H0T A;  5FEF A;  3G2Y A;  1NYY A;  3A0R A;  1K57 C;  2R78 A;  1LI0 A;  3KYZ A;  3LI8 A;  3EQV A;  2I72 A;  2J3T D;  2V0W A;  4R38 A;  4CLC C;  2WAD A;  5E2F A;  1XX2 A;  1JWP A;  2VGJ A;  4HP9 A;  4CLC E;  1H5X A;  4OQ0 A;  4EBP A;  4G3K A;  5EPH A;  2HPB A;  2X01 A;  4IUK A;  3CIT A;  5HAQ A;  3BWL A;  4E3K A;  3VP0 A;  4FSF A;  4X25 A;  3SZT A;  3NJA A;  2P74 A;  4KQD A;  3PBR A;  2WGI A;  4OKP A;  1ZKJ A;  1BUL A;  5HWV A;  1YLY A;  1XJ4 A;  4UA9 A;  1S4S A;  2PAV P;  3OZH A;  1K57 A;  3WS0 A;  3QP5 A;  3ZG0 A;  1W5D A;  3GRJ A;  3FKV A;  2O0Y A;  4OH0 A;  2G7U A;  4Y13 A;  2ZC7 A;  3DTE A;  3ZG5 A;  4CLC A;  4MBK A;  1F9I A;  2QPN A;  2H28 A;  5E2G A;  4BL3 A;  3GMW A;  4JPM A;  2PHY A;  5L10 A;  3IF6 B;  1I2S A;  4DJ3 A;  5F1F A;  4JBF A;  4IUH A;  3IT9 A;  2P9V A;  2OWJ A;  2EXA A;  5F5Y A;  5L2F A;  4LFU A;  3ULF A;  1ONH A;  2ZM8 A;  3LEQ A;  5E2H A;  1L0G A;  2P7J A;  4L9E A;  5AQ7 A;  2Y59 A;  3ITB A;  1NY0 A;  3BFG A;  3HLC A;  3OPP A;  3SS5 A;  2HDR A;  5GHZ A;  3ZVT A;  3O88 A;  3ZYT A;  2Y2O A;  5IS1 A;  3JVV A;  3EGX C;  5JYO A;  3UME A;  3IF6 C;  3TOI A;  2WGW B;  5I5L A;  2VJW A;  4ETZ A;  4BJP A;  3G34 A;  3FG8 A;  2ZQ7 A;  3OOV A;  1PWD A;  4GW9 A;  3UPP A;  1LLB A;  4S2K A;  3F1N B;  3IX8 A;  1W7F A;  2XD5 A;  5JYP A;  5KSC A;  3AGD A;  2VGL M;  1BT5 A;  4PM7 A;  2W3G A;  3T1X A;  5AVE A;  3A3D A;  4KG6 A;  3GVB A;  4UAA A;  2WZX A;  1UGU A;  2ACG A;  3Q07 A;  3F1P B;  2A2L A;  1K56 A;  1K25 A;  3S22 A;  3TSG A;  2VLG A;  3IXD A;  5C5K A;  4C75 A;  4K0X A;  4JGQ A;  3S4X A;  3ZG8 B;  5G4Z A;  1W63 M;  3Q1F A;  4EES A;  5HFO A;  4P6Z S;  1GA9 A;  4L9F A;  3A3F A;  3K3C A;  5MC7 A;  2Y91 A;  4R4S A;  2EX6 A;  3G30 A;  5AQB A;  1M40 A;  2ZMV A;  4EV4 A;  5HDD A;  1GHP A;  2GDN A;  3R7W B;  3MXR A;  2VGK A;  2FFF B;  1DJB A;  4OLG A;  1K55 A;  5A93 A;  5FI2 A;  5DF7 A;  2LB5 A;  3WS1 A;  2J3T C;  3MQO A;  4MMN A;  2PYR A;  1D06 A;  1XA7 A;  3HBR A;  3HLB A;  4MBF A;  4BWI A;  1K6R A;  1VQQ A;  2FZ0 A;  3VFH A;  4LCM A;  1OME A;  5DFY A;  1SKO B;  3E2L A;  1O07 A;  4HJ3 A;  5AQA A;  2ZMF A;  4UA6 A;  3OCN A;  5FEG A;  3RFB A;  5FDS A;  4QPR A;  2HGV A;  3LR0 A;  4UEY A;  2Z6D A;  5U47 A;  4OP8 A;  1VET A;  4PM6 A;  5DJT A;  3BJN A;  1Z6F A;  4QJG A;  3D72 A;  3F1P A;  4QWO A;  3ZG7 B;  1NLZ A;  3E4P A;  3ZG9 B;  2BLS A;  4QY6 A;  4R0Q A;  2ZLY A;  3JYI A;  3G31 A;  1P97 A;  4OQG A;  3BFE A;  1ES2 A;  3IX4 A;  4IHQ A;  2X02 A;  1P9R A;  3KYQ A;  2HP6 A;  3LFV A;  3E4O A;  3GDI A;  2JKG A;  4GS9 A;  2XFT A;  1XP4 A;  4WEJ A;  1XJ6 A;  4YIN A;  5IT5 A;  3VOZ A;  1NRF A;  3V5M A;  4QB8 A;  1TD5 A;  4LLO B;  3R7W A;  5CGS A;  1JTD A;  1K38 A;  5EEC A;  1MXO A;  2DCF A;  1L3L A;  1IEL A;  2XA7 M;  3HJK A;  4KUO A;  3BFC A;  2V9A A;  1V9Y A;  4KEN B;  4DE2 A;  2AVX A;  4PKY G;  1YQS A;  3HLG A;  4ZTK A;  4HJ6 A;  2RL3 A;  2PYP A;  4Y7P A;  1HD8 A;  3DTK A;  1SDN A;  4B93 A;  3U4L P;  1YLZ A;  4JXW A;  1ZHH B;  4EER A;  3L7H A;  3EWK A;  2B5R A;  3E98 A;  3C30 A;  1PIO A;  2W3F A;  5FQ9 A;  1MWS A;  4N9L A;  3O87 A;  2XK1 A;  3MF0 A;  5DF8 A;  1FSY A;  1K4F A;  2G2U A;  4IVK A;  2O9B A;  2Z2L B;  5I94 A;  5IU1 A;  3VFF A;  3QP8 A;  4M4X A;  1PZP A;  3ZNT A;  4EBN A;  3ZQ5 A;  4FH4 A;  1N4O A;  5CGW A;  4FTX A;  3IBJ A;  5HD5 A;  4NKP A;  2O9A A;  5L09 A;  3UE6 A;  2Y2N A;  4GCZ A;  5DKK A;  3FKW A;  3C5A A;  3IWI A;  3NUL A;  4X1M A;  2NUT C;  3FWL A;  1Y4O A;  3D4F A;  4R4R A;  4QY5 A;  1KE0 A;  4YNR A;  3QNC A;  5CTM A;  5EVL A;  4ZJ1 A;  5LBR A;  3WRZ A;  4UA7 A;  1S1Z A;  3MKE A;  1L0F A;  1KGE A;  3FC7 A;  3PHY A;  2E8J A;  4EWF A;  1H3Q A;  1G6O A;  3FV7 A;  2WKE A;  2ZM0 A;  1NZO A;  4WEL A;  2J7V A;  3HJI A;  1DY6 A;  3P09 A;  1MPL A;  1ERO A;  3LI9 A;  2XF3 A;  1OPX A;  3KX0 X;  3VSL A;  5FQQ A;  4Q0I A;  1FCN A;  4E6W A;  1MWR A;  1VEU B;  5A91 A;  4Q8I A;  1VHM A;  4HQA A;  3BLM A;  2P04 A;  4OPZ A;  2Y2H A;  1ERM A;  1T19 A;  1OTE A;  2VK3 A;  4X55 A;  2JBF A;  3BM6 A;  3SW1 A;  4I3A A;  3UO9 A;  3UE3 A;  3QNB A;  2V1B A;  4H6J B;  4KZ4 A;  4OVD A;  3MMH A;  3PAE A;  1JNU A;  2O9C A;  1A0K A;  4C3Q A;  2XD1 A;  3I7J A;  3ZVW A;  5HX9 A;  2VA0 A;  3O3V A;  1GSX A;  4BD0 A;  4WEK A;  3CPT B;  5IHV A;  1NZU A;  4KZB A;  4WMC D;  4XT2 B;  2EX8 A;  4OOM A;  2PR6 A;  3UB7 A;  4GOG A;  3O86 A;  1XJ2 A;  2EFU A;  1F98 A;  3BQA A;  3MZF A;  3N8S A;  3T4K A;  4I38 A;  4BBU A;  1CF0 A;  5A90 A;  5J4E A;  3P01 A;  4R1G A;  4IVI A;  4E3N A;  2L4R A;  4D2O A;  1NXY A;  4WUJ A;  3AGE A;  3BY9 A;  1FOF A;  1PYY A;  3G4P A;  4X56 A;  3A3E A;  3OPH A;  3VOL A;  2VV7 A;  1PFL A;  2XRO A;  2K7S A;  4BL2 A;  4MN5 A;  3UB8 A;  3UPO A;  3S7Q A;  3CHW P;  2ZMA A;  1NYM A;  2VZW A;  5M19 A;  4OOL A;  2HZ5 A;  3M6H A;  2XR0 A;  4IBX A;  2QJ5 A;  5FQK A;  5F83 A;  4E6X A;  3NDE A;  3VE4 A;  3LEZ A;  5TJJ A;  3BFF A;  1VEU A;  5DVA A;  4IBR A;  1XGI A;  2ZQ8 A;  3SH9 A;  1F2K A;  4P6Z M;  3QP1 A;  2EWW A;  4HH2 A;  5F82 A;  3VP1 A;  2PR5 A;  1S1Y A;  1XXM A;  4PAU A;  1RP5 A;  3A0V A;  2Y55 A;  4H6J A; 
#chains in the Genus database with same CATH homology
 1PWD A;  3UPP A;  2Y2I A;  4R3B A;  1BTL A;  1LLB A;  4S2K A;  4L0L A;  2EFX A;  1BLC A;  1W7F A;  4LV0 A;  5FQI A;  2XD5 A;  1E25 A;  1GHI A;  5CHM A;  3HL9 A;  5EVI B;  2WAF A;  5JYP A;  5KSC A;  4S2N C;  2XLN A;  4HEF A;  4QHC A;  3C7V A;  5GHY A;  2EXB A;  1NJ4 A;  3AGD A;  1PI5 A;  3IXB A;  1BT5 A;  4N1X A;  1I2W A;  1E4D A;  1JTG A;  4PM7 A;  5FDH A;  5TFQ A;  1TEM A;  5EOO A;  3IH9 A;  3A3D A;  4C6Y A;  1QMF A;  1JWZ A;  4KG6 A;  1IKG A;  3GVB A;  4UAA A;  3ZFZ A;  2WZX A;  4LCL A;  3Q07 A;  4WM9 A;  3V3R A;  3BEC A;  3HUN A;  1K56 A;  1K25 A;  4DXC A;  1K54 C;  2X71 A;  4RX3 A;  3DWZ A;  2HDQ A;  3V50 A;  3S22 A;  1K4E A;  3TSG A;  3CG5 A;  3IXD A;  4C75 A;  4K0X A;  4RVA A;  4P87 A;  2J8Y A;  2H10 A;  5FQJ A;  1G68 A;  5FAT A;  1IYO A;  3SH7 A;  5G18 A;  1KGF A;  3S4X A;  4N9K A;  3ZG8 B;  2OLU A;  3ZDJ A;  2XH9 A;  3Q1F A;  1YLP A;  3RXW A;  3LCE A;  5HFO A;  2Y2J A;  3NCK A;  5CHU A;  1GA9 A;  4U0X A;  4PMA A;  5EVI C;  4WZ4 A;  1K56 D;  5CEB A;  4N92 A;  1SDE A;  2ZD8 A;  2V1Z A;  2WKI A;  3PBO A;  3A3F A;  5FQM A;  2QZ6 A;  2H0Y A;  5HAP A;  2OLV A;  1Q2P A;  2Y2K A;  2Y2M A;  2Y91 A;  3A3I A;  3N7W A;  4R4S A;  1CK3 A;  1G6A A;  4XUZ A;  3N4I A;  3QHY A;  4S2N A;  1IYQ A;  4DF6 A;  3IHA A;  3GTC A;  4B4X A;  4KZA A;  4EBL A;  2EX6 A;  1N9B A;  5M1A A;  3CZD A;  3PBN A;  3G35 A;  1YM1 A;  4OPQ A;  1E3U A;  5HAR A;  3G30 A;  5AQB A;  1M40 A;  4EV4 A;  1GHP A;  2GDN A;  2Y4A A;  3HLD A;  4GNU A;  4DE3 A;  3MXR A;  2OV5 A;  3G32 A;  2VGK A;  4BEN A;  1MY8 A;  3SH8 A;  4MLL A;  2FFF B;  1DJB A;  3Q82 A;  1K55 A;  4OLG A;  5A93 A;  5FI2 A;  3Q7V B;  2A3U A;  2ZC3 B;  1XPB A;  2XFS A;  1K54 A;  5DF7 A;  3WRT A;  3WS1 A;  2ZC4 B;  2WKH A;  3LY4 A;  1XA7 A;  3HBR A;  3HLB A;  5FA7 A;  5D3O A;  4JF4 A;  4KQR A;  4MBF A;  1U60 A;  1CI9 A;  3EQU A;  4BD1 A;  1TDG A;  1K6R A;  1LL5 A;  1VQQ A;  2IWC A;  1E3U D;  1EI5 A;  1XKZ A;  1FR6 A;  2QMI A;  3VFH A;  4LCM A;  1IEM A;  1OME A;  1C3B A;  2WYX A;  3V3S A;  4LV2 A;  3G2Z A;  4HBU A;  3E2K A;  4KZ6 A;  3E2L A;  1O07 A;  5AQA A;  4EUZ A;  4UA6 A;  1YMS A;  3OCN A;  1Q2Q A;  1LHY A;  4S2I A;  5CXW A;  5DF9 A;  1TVF A;  1HTZ A;  2C6W B;  1KDS A;  4CPK A;  3HUM A;  3GR2 A;  1L0E A;  4DE0 A;  3SS3 A;  5GLD A;  1ONG A;  5U47 A;  4OP8 A;  3IXH A;  1FCM A;  4PM6 A;  1YLJ A;  4HES A;  1ALQ A;  1Z6F A;  3SS4 A;  4QJG A;  1S6R A;  5F1G A;  1IKI A;  1L0D A;  4QU3 A;  3ZG7 B;  1W79 A;  3GV9 A;  2HDS A;  1MBL A;  3HLE A;  4OON A;  1YLW A;  4ZBE A;  2FFY A;  3ZG9 B;  1M6K A;  1Y54 A;  2BLS A;  4N1H A;  4OOY A;  4QY6 A;  4R0Q A;  2ZLY A;  5CRF A;  3JYI A;  5A92 A;  3G31 A;  1CEF A;  1TDL A;  4X6T A;  3UDX A;  4DRT A;  2WUQ A;  4OQG A;  4B4Z A;  3BFE A;  2V20 A;  5CTN A;  5E43 A;  5HW3 A;  1ES2 A;  3OCL A;  2WGV A;  5FAP A;  3PBS A;  1PI4 A;  5FSR A;  2P9V B;  4B88 A;  1HVB A;  3MZE A;  5GHX A;  4GZB A;  2X02 A;  4WZ5 C;  5CEC A;  3ISG A;  5KSH A;  2HP6 A;  4GB7 A;  1GHM A;  2EX9 A;  1LL9 A;  2V2F F;  3FYZ A;  1W8Q A;  3HRE A;  3RXX A;  3W4O A;  2J9P A;  4JF6 A;  2XFT A;  2Y2L A;  3TG9 A;  1S0W A;  3N6I A;  3Q81 A;  1RGY A;  5CED A;  1IYP A;  3IQA A;  2WK0 A;  1BLP A;  1XP4 A;  2ZQ9 A;  1BLH A;  4R23 A;  4WEJ A;  3LO7 A;  4YIN A;  3C4O A;  3VOZ A;  1GCE A;  1QME A;  4X53 A;  2DNS A;  1PW1 A;  3OC2 A;  1NRF A;  4OPR A;  4U0T A;  3V5M A;  4OQI A;  3IF6 A;  3BEB A;  4QB8 A;  3NY4 A;  5CGS A;  1ERQ A;  1JTD A;  1K38 A;  2HP5 A;  1WYC A;  3A3J A;  3PBQ A;  3PBT A;  5DTS A;  1PZO A;  1MXO A;  5EEC A;  2DCF A;  4GDB A;  1IEL A;  1XGJ A;  3BFC A;  4KEN B;  4DE2 A;  3Q7V A;  5TGF A;  1KE4 A;  1YQS A;  2XDM A;  2ZM2 A;  3HLG A;  4KZ8 A;  4ZTK A;  1BZA A;  4P85 A;  4E3O A;  2RL3 A;  1CI8 A;  2ZC6 B;  4Y7P A;  4MEZ A;  4YFM A;  4CJN A;  5FI6 A;  1HD8 A;  3VP4 A;  3BRM A;  1FSW A;  1SDN A;  5GL9 A;  1YLZ A;  4JXW A;  1KVL A;  2Y2G A;  4IED A;  4JF5 A;  4X69 A;  3V39 A;  2B5R A;  4R3J A;  3VSK A;  1PIO A;  1LI9 A;  3CJM A;  5FQ9 A;  5GLA A;  4PM8 A;  4S2J A;  3MBZ A;  2UWX A;  4MNR A;  5KMW A;  3SOI A;  1MWS A;  3NBL A;  4N9L A;  4OLD A;  4Y0T A;  3DW0 A;  1ZG4 A;  3O87 A;  2XEP A;  4WYY A;  1ESU A;  4XUX A;  4GDN A;  1ZG6 A;  2XK1 A;  2JCH A;  5DF8 A;  5FI7 A;  1FSY A;  1K4F A;  1ES3 A;  2G2U A;  1IYS A;  3Q7Z A;  1FQG A;  2PBY A;  3MXS A;  4IVK A;  5CGX A;  5EUA A;  2WGW A;  3BFD A;  2Z2L B;  3GSG A;  4M3K A;  5FAQ A;  1SCW A;  1FCO A;  5I94 A;  4S2P A;  1ES4 A;  4JXS A;  1I5Q A;  3VFF A;  1PZP A;  3W4Q A;  4Z9Q A;  3UDI A;  3PTE A;  5CER A;  3ZNT A;  3LY3 A;  4EBN A;  3BYD A;  5J8X A;  3HLF A;  3PAG A;  3UDF A;  4XXR A;  2ZQC A;  4FH4 A;  1N4O A;  2C5W B;  3OPL A;  4P0M A;  4FH2 A;  3UE1 A;  5CGW A;  2WAE A;  3VOY A;  4S2M A;  3IHB A;  1CEG A;  5EVI A;  5FAO A;  1YMX A;  5EE8 A;  3WWX A;  3IWQ A;  3IWO A;  3ZNY A;  3MKF A;  2Y2N A;  3M2J A;  1KE3 A;  4KZ3 A;  4KZ7 A;  4JLF A;  4FD8 A;  2H5S A;  2OSU A;  2ZQA A;  5BOH A;  3FKW A;  3C5A A;  4KG2 A;  3IWI A;  1XA1 A;  3FWL A;  3NC8 A;  2XQZ A;  4BLM A;  3D4F A;  4R4R A;  4QY5 A;  5CHJ A;  2RCX A;  4GD8 A;  1KE0 A;  3N8L A;  2ZQD A;  4NK3 A;  4ZDX A;  3C4P A;  4ZAM A;  3S1Y A;  4S2O A;  3GQZ A;  3UE0 A;  3W8K A;  3UY6 A;  3QNC A;  2R9X A;  5CTM A;  5EVL A;  3VMA A;  3HLW A;  1MKI A;  5EOE A;  5EVI D;  2R9W A;  4WBG A;  3ITA A;  4ZJ1 A;  4H8R A;  3WRZ A;  4UA7 A;  4PM5 A;  1H8Y A;  2EX2 A;  3MKE A;  1L0F A;  4JXG A;  1KGE A;  3UN7 A;  3MZD A;  1WE4 A;  2J9O A;  3NIA A;  4EWF A;  3N8R A;  4KZ9 A;  3BLS A;  2H0T A;  3CMZ A;  3G2Y A;  3FV7 A;  4PM9 A;  5DTK A;  1NYY A;  5AQ9 A;  3W4P A;  2WKE A;  1KGG A;  1K57 C;  2ZM0 A;  1NZO A;  4UHU A;  2J7V A;  4WEL A;  3VP3 A;  4E3M A;  1LI0 A;  3HUO A;  3ZCZ A;  1DY6 A;  3P09 A;  1SKF A;  1MPL A;  1ERO A;  1KVM A;  5HAI A;  2XF3 A;  3FZC A;  1RCJ A;  4O7D A;  4EQI A;  3IF5 A;  3EQV A;  2I72 A;  3VSL A;  5FQQ A;  4PPR A;  2WAD A;  5E2F A;  1FCN A;  2WZZ A;  4E6W A;  2HDU A;  1XX2 A;  3DWK A;  1MWR A;  2ZC5 B;  4LEN A;  1JWP A;  3M6B A;  2VGJ A;  3HVF A;  5A91 A;  4Q8I A;  2HP9 A;  1JWV A;  4BQM A;  1H5X A;  4OQ0 A;  3BLM A;  4ZJ2 A;  3UNW A;  5M18 A;  4EBP A;  4OPZ A;  2Y2H A;  1ERM A;  4ID4 A;  5EPH A;  2HPB A;  2IWB A;  2X01 A;  1MWU A;  2IWD A;  2Y2P A;  4KQO A;  4QD4 A;  5HAQ A;  4LV1 A;  2ZJ9 A;  4E3K A;  4X55 A;  2JBF A;  3BM6 A;  3VP0 A;  1K55 C;  4JKT A;  3UPN A;  4FSF A;  4Y0O A;  3AGF A;  4ZJ3 A;  1MWT A;  1BLS A;  3WS5 A;  3UO9 A;  4GD6 A;  4WMC A;  3UE3 A;  2P74 A;  3QNB A;  4Y0U A;  3PBR A;  3NI9 A;  2WGI A;  4KZ4 A;  4OKP A;  4OVD A;  1ZKJ A;  3RJU A;  2JC7 A;  2Z2M B;  4F94 A;  3B3X A;  4P6B A;  1BUL A;  3IXG A;  4DDY A;  1BSG A;  3PAE A;  1YLY A;  2PU4 A;  1ES5 A;  4C3Q A;  1J9M A;  2XD1 A;  2CC1 A;  3I7J A;  3ZVW A;  4UA9 A;  3VP2 A;  4WZ5 A;  2Y2Q A;  5HX9 A;  3O3V A;  4OP5 A;  4U3T A;  2G2W A;  1W8Y A;  3OZH A;  1K57 A;  3WS0 A;  1FR1 A;  4WEK A;  4MBH A;  4BD0 A;  3ZG0 A;  1W5D A;  1PWC A;  1AXB A;  1BUE A;  1GA0 A;  4OQH A;  5IHV A;  1NZU A;  3GRJ A;  4KZB A;  1ZC2 A;  4WMC D;  3FKV A;  3NDG A;  4OH0 A;  3C7U A;  3ZHH A;  1EWZ A;  2EX8 A;  2ZC7 A;  4NET A;  2JE5 A;  4OOM A;  3ZG5 A;  1K6S A;  4GOG A;  4HBT A;  3O86 A;  1ESI A;  3WS2 A;  2EFU A;  3MZF A;  1H8Z A;  3N8S A;  4LV3 A;  4MBK A;  4GN2 A;  4E3L A;  4OPY A;  2QPN A;  5FAS A;  3P98 A;  5E2G A;  4BL3 A;  1O7E A;  3GMW A;  4JPM A;  1HZO A;  2Q9N A;  3IF6 B;  5A90 A;  1I2S A;  4R1G A;  4IVI A;  4E3N A;  4DE1 A;  5F1F A;  1DJA A;  4JBF A;  4D2O A;  4E3J A;  4S2L A;  2DRW A;  1NXY A;  4K91 A;  4E3I A;  3AGE A;  3IT9 A;  1FOF A;  1PYY A;  3G4P A;  4RX2 A;  4X56 A;  3A3E A;  3OPH A;  4X68 A;  4KG5 A;  1JVJ A;  2P9V A;  2PU2 A;  5GLC A;  4JXV A;  4DKI A;  2EXA A;  4BL2 A;  1SHV A;  5L2F A;  2Q9M A;  5GLB A;  3OPR A;  3UPO A;  1KDW A;  1DJC A;  1ONH A;  2E8I A;  3M2K A;  4GKU A;  2ZMA A;  1NYM A;  2ZM8 A;  5M19 A;  4OOL A;  5E2H A;  1L0G A;  4KQQ A;  3M6H A;  5AQ7 A;  2XR0 A;  3ZGA B;  4A5R A;  2Y59 A;  4DDS A;  3ITB A;  4IBX A;  1NY0 A;  1YLT A;  3BFG A;  3HLC A;  3OPP A;  3WS4 A;  3SS5 A;  5FQK A;  2HDR A;  5F83 A;  4E6X A;  3NDE A;  5GHZ A;  3DTM A;  3LEZ A;  1L2S A;  5E2E A;  2BG1 A;  3ZVT A;  4K0W A;  3O88 A;  4RA7 A;  1YT4 A;  2Y2O A;  4FCF A;  1PW8 A;  2A49 A;  3BFF A;  4RYE A;  1WYB A;  5DVA A;  5JYO A;  1VM1 A;  4IBR A;  4KZ5 A;  1XGI A;  3IF6 C;  5KZH A;  3TOI A;  2ZQ8 A;  3IH8 A;  5TR7 A;  2WGW B;  3SH9 A;  5HL1 A;  5DTT A;  4BJP A;  2XGN A;  1PWG A;  3G34 A;  5F82 A;  3VP1 A;  1XXM A;  1RGZ A;  2ZQ7 A;  1RP5 A;  4DXB A;  3MFD A;  2Y55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...