5CRFA

Structure of the penicillin-binding protein pona1 from mycobacterium tuberculosis
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
395
structure length
386
Chain Sequence
b'KGPNGLIERQVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSIDPHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDGIKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVAHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLFDASTADNTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANKDAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNETFPKPTEVGGYAGVPPPETVIQPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 1A
publication title Crystal structures of the transpeptidase domain of the Mycobacterium tuberculosis penicillin-binding protein PonA1 reveal potential mechanisms of antibiotic resistance.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Penicillin-binding protein
total genus 114
structure length 386
sequence length 395
chains with identical sequence B, C, D
ec nomenclature ec 2.4.1.129: Peptidoglycan glycosyltransferase.
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5crfA00
5EVIB 4E6XA 3PBOA 3MXSA 2EFUA 1CI9A 4WM9A 1BLCA 1DY6A 1MY8A 4S2OA 1ERQA 2GDNA 3CMZA 1NXYA 3OPPA 1MWSA 2ZM0A 4PPRA 1K25A 1GHPA 4S2LA 4GD8A 5EPHA 3MFDA 5E2EA 1TDLA 2HP6A 3E2KA 4WMCA 1W8QA 2ZQDA 5TFQA 4EBPA 5U47A 3IWOA 1NZUA 2XEPA 4HEFA 5CTNA 3Q7VB 5CGWA 4P0MA 3M2KA 2HDRA 3IXHA 1RP5A 3NDEA 4LV2A 1JWVA 1FCNA 3N4IA 4N9KA 3ZG5A 4OQGA 1ERMA 2ZLYA 2A49A 3VP4A 2ZQCA 2XD5A 4GDBA 2ZQ8A 4UA9A 5EUAA 1LI0A 4KZAA 4OKPA 3N8SA 4CPKA 5FQQA 1EI5A 1L0FA 3NY4A 3HLEA 4R4SA 4E6WA 1Z6FA 3WS5A 1YMSA 3IF6A 1K57A 3MZFA 3G30A 3V50A 1XGIA 3GRJA 3HLGA 5CGSA 1YLWA 1TEMA 1PWCA 3SH9A 1K54C 3ITBA 4JF5A 5AQBA 2XGNA 1YT4A 3C7VA 3VSLA 2ZQ9A 1FSWA 1GCEA 2C6WB 4DKIA 2XF3A 2Y2JA 2EX9A 4JF4A 4UA7A 2H0TA 1PZPA 3ITAA 2FFFB 1LL5A 2OLUA 1CEGA 2R9XA 3O3VA 4NK3A 4MBKA 1DJAA 4U0TA 3DTMA 5DTSA 3M6HA 2DRWA 4FH4A 4JBFA 2Q9MA 1YLZA 1XPBA 2Z2MB 3C7UA 3CG5A 4R4RA 5GHZA 2JC7A 2ZMAA 1ESUA 4X68A 4MBFA 3WS2A 1O07A 4E3IA 1IKIA 3E2LA 3Q82A 5FQ9A 3AGFA 5BOHA 3N7WA 1G68A 3IWIA 2J9PA 4OPZA 5EVIC 3ZDJA 1JWPA 3M6BA 2V2FF 1HVBA 1K55A 4UA6A 2Y2GA 3LY3A 3WRZA 5EOOA 4EQIA 2ZC6B 4IVKA 5FASA 2G2WA 3UDFA 4DE2A 4MBHA 4YINA 2WGWB 1YM1A 3ZG9B 1YLTA 5AQ7A 4S2MA 2EX6A 3IWQA 4KG5A 4PM9A 4PM7A 5CGXA 4DF6A 4E3MA 1KVLA 4BD0A 5JYPA 4EWFA 2Y2IA 1ONGA 2A3UA 3RJUA 4BJPA 3Q1FA 2HDQA 4R0QA 1M40A 5GHXA 4KZ6A 2XK1A 4WEKA 5E2HA 3SH8A 1VQQA 4RVAA 1FCOA 5M19A 1KGFA 2WKIA 3ZFZA 1DJBA 4B88A 1KE4A 3IH9A 4GB7A 4S2KA 2WGIA 3LY4A 4ZJ2A 1XGJA 1LHYA 2ZD8A 4Y0UA 4NETA 2XFTA 3GTCA 3G32A 3S1YA 3O87A 2WAEA 2ZC5B 4KG6A 4WELA 1EWZA 5DTKA 5E2GA 1HZOA 2BG1A 2HDSA 3MZDA 4KQQA 4P85A 3GR2A 4QB8A 1U60A 4OOYA 3RXWA 3WS4A 2Z2LB 4KZ3A 1WYCA 4R23A 4Y7PA 5KZHA 1RGZA 3D4FA 2QPNA 2ZM2A 4BENA 1NYMA 2XH9A 3AGDA 4ZJ3A 3PBSA 1ESIA 1I5QA 1PWDA 3SH7A 5EOEA 2EXBA 3WS1A 1ES2A 3S4XA 5FI6A 4Z9QA 1H5XA 1BLPA 2WKEA 3FZCA 4L0LA 5GLAA 3HLDA 3N6IA 5KSCA 4R3JA 4ZDXA 1XXMA 1NY0A 4FCFA 2G2UA 5CHJA 1PYYA 1GA0A 3VOZA 3IXBA 4R3BA 3NI9A 2JBFA 3GV9A 2QZ6A 2QMIA 1HTZA 3OC2A 5GLCA 5CERA 3VMAA 3ZG7B 4BD1A 1SDNA 1MPLA 4OH0A 2J7VA 4QHCA 2RL3A 5FAPA 4DE3A 3UY6A 4PM5A 3IT9A 2VGJA 4OP5A 5CECA 4OONA 2DNSA 2V1ZA 2Y2PA 4K91A 3AGEA 3VOYA 3N8RA 1NZOA 1IYSA 2HP5A 1Y54A 2PU2A 4K0XA 4U0XA 4BLMA 1LI9A 2XQZA 3I7JA 2VGKA 1QMFA 3B3XA 1CK3A 4JXVA 2H0YA 5AQAA 1CI8A 3NCKA 5A93A 4GDNA 1EROA 1OMEA 5FQIA 1IYQA 3HLFA 4UAAA 2OLVA 4S2JA 2JE5A 3BLSA 3P98A 1FR1A 4X6TA 4C75A 4P6BA 2C5WB 4GZBA 4BL3A 3C5AA 4QJGA 5FAOA 5FI7A 2X71A 3C4OA 1O7EA 1Q2QA 1FR6A 3M2JA 3PAGA 4WZ5A 1LLBA 5FSRA 2RCXA 1JTDA 4S2NA 1BLSA 1ZG4A 2Y2KA 5GHYA 2ZQAA 3G31A 3MZEA 3EQVA 5FA7A 4P87A 1N4OA 4IBRA 3IF6B 3Q7ZA 1K6RA 1TDGA 5FDHA 1ALQA 4QY5A 2IWBA 1IELA 3MBZA 2PBYA 5FQMA 4Q8IA 5E2FA 3Q81A 2XR0A 4N1XA 2P9VA 4HBTA 3IHBA 5DTTA 1ES3A 3A3EA 1BUEA 1KDSA 4DRTA 4ZJ1A 2OSUA 4RX3A 5A91A 1XP4A 4QY6A 3OZHA 1SKFA 1JTGA 3ZHHA 1N9BA 3MKFA 4B4ZA 2Y2OA 1BLHA 5FATA 5F82A 1L0DA 4LV3A 5HAQA 4XXRA 4HESA 4E3NA 4ID4A 1BULA 3UE1A 1I2SA 1IEMA 5M1AA 5CEBA 4LENA 4OVDA 1YLPA 1BT5A 3C4PA 1DJCA 4UHUA 3UO9A 2IWDA 2WKHA 5CTMA 1E25A 5DF7A 1ES4A 3ZVWA 3RXXA 3PBQA 2EXAA 2HDUA 2EX2A 4OPRA 3VFFA 3HUNA 3WWXA 1K4EA 3ZNYA 5CEDA 3ZG8B 3FV7A 5EVID 3ZGAB 1VM1A 2R9WA 4EBNA 4GKUA 4JKTA 1M6KA 1K54A 1SCWA 2FFYA 2WZXA 1YQSA 4KZBA 4OP8A 4QU3A 5TR7A 5CXWA 2Y2QA 3GVBA 1ZG6A 1NJ4A 1BZAA 4O7DA 3QNBA 3ZNTA 3LO7A 4ZTKA 3NIAA 5L2FA 4C6YA 3BFEA 4WYYA 5FQJA 4DXCA 1KVMA 3SS5A 4N1HA 1W5DA 3DWKA 1E4DA 3HVFA 1W7FA 4BL2A 2BLSA 2H5SA 1NRFA 4X69A 1MWRA 5JYOA 1YMXA 3JYIA 3UPPA 5KSHA 1ZC2A 3IF5A 1AXBA 3IF6C 1K57C 4RYEA 3HREA 4EV4A 4OPYA 3V3RA 3G2ZA 1I2WA 3UPNA 4B4XA 1XKZA 4E3OA 4YFMA 3BFCA 3PBNA 2V20A 5EECA 4ZAMA 4DDSA 5HL1A 4FH2A 5EVIA 5AQ9A 2XDMA 4RA7A 1L0GA 2WYXA 1PW8A 2E8IA 3PTEA 2Y55A 3BFFA 4IVIA 3BLMA 4CJNA 5F1GA 2WK0A 4C3QA 3CJMA 3NC8A 4Y0OA 5CRFA 4DDYA 4KG2A 1BTLA 4HBUA 5J8XA 1GA9A 3QNCA 5FQKA 4D2OA 3VFHA 3BFGA 1IYOA 2ZQ7A 3CZDA 4X53A 4QD4A 1PI5A 1WYBA 3Q7VA 2I72A 3HBRA 3G34A 3VP1A 3BEBA 3SS4A 3HLCA 3WRTA 1RGYA 2OV5A 2J8YA 4OQ0A 2CC1A 3IXDA 3ISGA 1PZOA 4KZ5A 1W8YA 2ZC3B 1L2SA 3BYDA 2ZM8A 4JXSA 1K55C 3HUMA 2WADA 4KZ8A 1SHVA 3UNWA 1L0EA 3TOIA 4EUZA 5DF8A 3IXGA 4JPMA 5E43A 1ONHA 3TSGA 1RCJA 3Q07A 3PBTA 4H8RA 1GHIA 1K56D 2ZC7A 3UDIA 4KENB 1IKGA 5M18A 2WUQA 4GD6A 4DE0A 2PU4A 3S22A 4N9LA 5D3OA 1J9MA 3GMWA 4ZBEA 1KE3A 4RX2A 3NDGA 1WE4A 4LV0A 4R1GA 1SDEA 3ZCZA 3W4OA 2Y91A 3OCNA 3HLBA 3HL9A 4WEJA 5DF9A 1XA7A 2Y2NA 4WBGA 3NBLA 5A92A 1E3UD 4GNUA 2Y59A 2JCHA 4GN2A 5GL9A 3UPOA 2X01A 5KMWA 4MNRA 3UE0A 5CHMA 1KE0A 5TGFA 3BM6A 1JVJA 3BFDA 4LCMA 1MXOA 4X56A 1NYYA 3OCLA 4LV1A 2Y2MA 3FKWA 3UDXA 5F83A 4DE1A 3UE3A 1Q2PA 4XUZA 1PW1A 3ZVTA 3G35A 4KQOA 1K56A 1PI4A 2HPBA 3ZG0A 4F94A 4E3JA 1LL9A 2Y4AA 1XX2A 4XUXA 4OOMA 4KZ9A 4LCLA 3W8KA 3HUOA 2P9VB 3DW0A 2WGWA 3IQAA 3HLWA 5DVAA 1FOFA 5EE8A 1S6RA 1CEFA 3FWLA 5HFOA 2UWXA 3IHAA 1JWZA 1KGGA 2Q9NA 1K4FA 1W79A 3PAEA 4OQHA 4OOLA 3PBRA 4U3TA 3LEZA 1KDWA 1FSYA 3GSGA 3GQZA 3IH8A 4FSFA 1TVFA 5IHVA 1KGEA 2XFSA 5GLBA 4E3KA 5I94A 1MWUA 3W4QA 1E3UA 3N8LA 5A90A 2WZZA 4S2PA 3UN7A 1PWGA 2DCFA 5EVLA 3EQUA 3MXRA 4KQRA 4WZ4A 5GLDA 4EBLA 2WAFA 4K0WA 5HAPA 4KZ7A 4X55A 2WGVA 3A3DA 4BQMA 2EX8A 4N92A 3G2YA 1ZKJA 5HARA 4JF6A 1K6SA 1MWTA 2X02A 3O88A 3VP0A 1G6AA 1QMEA 1FQGA 1BSGA 1C3BA 2Y2LA 3OPRA 2ZC4B 5HW3A 4IEDA 3A3JA 5HAIA 4FD8A 1YLJA 4OLGA 3LCEA 1S0WA 2EFXA 1MBLA 3O86A 1PIOA 1YLYA 2IWCA 4KZ4A 4S2IA 1K38A 3FKVA 3V3SA 3V39A 3QHYA 4E3LA 4WMCD 5FI2A 3SOIA 5HX9A 3VP2A 2XD1A 1H8ZA 3W4PA 2B5RA 5F1FA 4Y0TA 3V5MA 2XLNA 3MKEA 3TG9A 1ES5A 3P09A 1IYPA 3FYZA 1MKIA 4DXBA 4PM8A 4WZ5C 2H10A 4S2NC 3BECA 4MEZA 2J9OA 2Y2HA 4JLFA 3A3IA 1FCMA 3DWZA 1XA1A 3OPHA 1H8YA 4JXWA 4MLLA 4OPQA 2ZJ9A 1GHMA 4GOGA 2HP9A 4M3KA 3VSKA 4OQIA 4PM6A 3A3FA 4JXGA 5G18A 4IBXA 3G4PA 3SS3A 3VP3A 1HD8A 3WS0A 3OPLA 4OLDA 5FAQA 4A5RA 5CHUA 3BRMA 2P74A 4PMAA
chains in the Genus database with same CATH superfamily
3MXSA 3EEAA 4WM9A 1DY6A 4BBUA 2GDNA 2ZM0A 4PPRA 4S2LA 2OWJA 1W8QA 4EBPA 3LR3A 3DTIA 4HEFA 3K3CA 5CTNA 3OBFA 2VJWA 2VX8A 3M2KA 4LV2A 2ZL1A 3N4IA 3ZG5A 2ZLYA 1S66L 1CQAA 3E4PA 4GDBA 4KZAA 2Y79A 3GRJA 3T1XA 5AQBA 4CLCC 2WKQA 1MKMA 2C6WB 4DKIA 4I3AA 2Y2JA 3ITAA 4MN6A 1T19A 1N9NA 1W63M 2VLGA 1S1YA 1TS6A 4NK3A 1LSXA 1A0KA 3SW1A 3LUQA 1YLZA 2ZMAA 1P97A 4MBFA 3NJAA 3WS2A 1O07A 5FQ9A 2J9PA 2V2FF 1K55A 3WRZA 1D06A 5FASA 1JNUA 4DE2A 3UMEA 2WGWB 1YM1A 2G7UA 2M7UA 3IWQA 3H7WB 2JKTI 5J3WA 1KVLA 5JYPA 1M40A 5EV0A 1VEUA 3H9WA 2XK1A 3T4OA 4XT2B 4WEKA 4PKYG 4NKPA 4NEED 3SH8A 4RVAA 5M19A 1KGFA 2WKIA 2GX5A 3TJZC 2WGIA 3P7NA 1XGJA 3E98A 4CLCB 4EEPA 3LR0A 2XFTA 3GTCA 3VE4A 4GS9A 2HDSA 2P08A 4KQQA 4QB8A 1U60A 3WS4A 4R23A 3ZYTA 1RGZA 2ZM2A 3SH7A 1XJ3A 1I5QA 1PWDA 3MQOA 5EOEA 5HDCA 3CWFA 3WS1A 4NXEA 4R3JA 2W1RA 2O99A 4IUKA 3IXBA 4L9EA 2QZ6A 4D60A 4BD1A 3OC2A 5GLCA 5FAPA 4DE3A 3T4KA 3C30A 3UY6A 4PM5A 5CECA 3DBAA 2DNSA 2Y2PA 1OTDA 1NZOA 2PU2A 4BLMA 1QMFA 1CK3A 5AQAA 3NCKA 4EU0A 1X0OA 4S2JA 3P98A 1N9OA 4HH3A 1TS0A 3HJKA 3DAVA 4DN0A 4NXFA 5FAOA 3VOLA 2ZL1B 3S7NA 1LLBA 1CF0A 2RCXA 3P01A 1ZG4A 2Y2KA 3MZEA 5FA7A 4P87A 1N4OA 2A24A 4QY5A 3MBZA 5FQMA 4Q8IA 2P9VA 4LRXC 2W1TA 2OSUA 2VV6A 3OZHA 5AJGA 3MFXA 4B4ZA 1BLHA 5FATA 5HAQA 4XXRA 1T18A 1IEMA 1WA9A 1BT5A 3C4PA 3UO9A 2J3TC 2Z6CA 1OT9A 4MN5A 2EX2A 1GSVA 4MMNA 3V67A 5EVID 1VM1A 2R9WA 4GKUA 2O9AA 1K54A 1SCWA 2FFYA 3KSHA 4O8GA 4ZTKA 1VEUB 3NIAA 3EGXC 5L2FA 3BFEA 3SZTA 3DWKA 2NUTC 3HVFA 3UPPA 5KSHA 3IF6C 1K57C 5MC7A 3V3RA 1YKDA 4E3OA 4B4XA 1XKZA 3MR0A 2YKFA 4GS9B 1V9ZA 3HJIA 5EECA 4ZAMA 5HL1A 5EVIA 2QHKA 5AQ9A 4E04A 4IVIA 3BLMA 5F1GA 2K31A 3NC8A 4Y0OA 4HBUA 1CJFA 2V1AA 1GA9A 4Z1WA 4Q0HA 3BEBA 3LIEA 3HLCA 4HOIA 1LSVA 5FEFA 1W8YA 2KX6A 2ZM8A 5DFXA 2HF6A 4KQDA 3LIDA 3BY9A 2WUQA 5HD3A 5D3OA 1J9MA 3NDGA 4LV0A 1F5MA 3W4OA 2BASA 3HLBA 4HY8A 4I38A 4R38A 2Y59A 3KSFA 2K2NA 3A0SA 1JVJA 4LCMA 4IJGA 4X56A 4HQAA 1P9WA 5F83A 5HWWA 2A24B 4E3JA 3TE8A 3CLOA 2P9VB 3DW0A 4JGQA 5DVAA 2JKRI 4EXOA 5EE8A 1SKOA 2W1TB 3FWLA 5HFOA 4OQHA 1S4RA 1W79A 4U3TA 5HD5A 3LEZA 4I5SA 3GQZA 1TVFA 5IHVA 1KGEA 1F2KA 3N8LA 3UN7A 2UV0E 2D02A 5EVLA 2WAFA 3VE3A 4IHQA 3LICA 1K6SA 3O88A 3VP0A 1FQGA 1BSGA 2Y2LA 5HAIA 3E4QA 4OLGA 2EFXA 1PIOA 5DJTA 4GW9A 3V39A 3SOIA 1LSWA 4Y0TA 3MKEA 4CQHA 4L9GA 4M4XA 1F9IA 4WZ5C 2Y2HA 3A3IA 4MLLA 2ZJ9A 1GHMA 2HP9A 4OQIA 4JXGA 4IBXA 3VP3A 3KX0X 3WS0A 5FAQA 4A5RA 5EVIB 4E6XA 2QKPA 5EM1A 2EFUA 3R4KA 3LGOA 3OPPA 1K25A 1GHPA 4GD8A 4ARZB 2HP6A 3T4LA 3UE6A 5CGWA 5G4ZA 4P0MA 2JN7A 2HDRA 3IXHA 4NXGA 1KOUA 2K7SA 1ERMA 2B95A 4GJ4A 2PD8A 2ZQCA 2VZWA 1LI0A 3N8SA 3LIBA 5FQQA 1L0FA 3NY4A 4E6WA 1Z6FA 3WS5A 4HHDA 5FEGA 1XGIA 3SH9A 3QP8A 2INWA 2XGNA 3VSLA 5HWVA 2ZQ9A 3B47A 1LL5A 2R78A 2V8FA 4MBKA 4U0TA 2JKRM 4K08A 3M6HA 2VV7A 4JBFA 2Z2MB 3CG5A 2JC7A 4X68A 3G6OA 3LR5A 3E2LA 4I39A 3N7WA 4OPZA 2Y2GA 2JKFA 2ZC6B 2G2WA 4YINA 1XJ4A 1SKOB 4S2MA 4LRZE 4E3MA 4EWFA 2Y2IA 1ONGA 2HDQA 3L9KA 5E2HA 1FCOA 3ZFZA 2QJ7A 1DJBA 1OTAA 1KE4A 4S2KA 3LY4A 2ZBBA 4II7A 2W3HA 3G32A 3O87A 2WAEA 2BG1A 3MZDA 3QP4A 4R6LA 4KZ3A 1V9YA 2VKSA 3KO6A 5J7EA 2QPNA 1F98A 1ESIA 2A2LA 3S4XA 4Z9QA 2WKEA 3FZCA 4PKYA 3HLDA 2L1MA 1XXMA 3IBRA 4O0PA 1UWPX 2JBFA 2QMIA 3GDIA 2DMWA 3S7OA 3KYEA 2J7VA 2VGJA 2ZOIA 3CUEC 4R3AA 3VOYA 2VA0A 3CHWP 1IYSA 2WKPA 4K0XA 2H0YA 1CI8A 1EROA 3HLFA 2V0UA 1FR1A 4X6TA 2C5WB 5A8BA 3UB8A 3C5AA 5FI7A 1O7EA 1Q2QA 1FR6A 3M2JA 4Q0IA 5FSRA 4G3WA 3LI8A 5GHYA 3QP2A 4LLOB 3EQVA 1K6RA 5FDHA 1IELA 2LB5A 3CI6A 2PBYA 2XR0A 3F1PA 3OOVA 1ES3A 3A3EA 5A91A 4QY6A 4F3LA 3ZHHA 3MKFA 1L0DA 4E3NA 3BW6A 1I2SA 5M1AA 3RTYA 4LENA 1DJCA 3FG8A 5CTMA 5L09A 1LL8A 1ES4A 3PBQA 2PYPA 4OPRA 3WWXA 3BQAA 3ZNYA 2W3GA 3ZG8B 5CEDA 3MSHA 5TR7A 3TRCA 4QU3A 5CXWA 4MCWA 3JVUA 4FUWA 5DKLA 4EW7A 4N1HA 1VB6A 2H5SA 1MWRA 3JYIA 1ZC2A 5IT5A 3HREA 4Y5FA 3G2ZA 4O01A 3EWKA 3UB5P 1FIKA 2GZAA 2WYXA 3PTEA 5CRFA 1BTLA 5J8XA 2PR6A 1IYOA 2ZQ7A 1PFLA 4X53A 4QD4A 1WYBA 3HBRA 3SS4A 3WRTA 2OV5A 4KZ5A 1K55C 4I3IA 3NOPC 3TW8A 4AFIA 2WKRA 5E43A 4YOFA 1RCJA 3FPVA 3Q07A 1K56D 2M1CA 1OTBA 5M18A 5J4EA 3GMWA 5F6AA 1SDEA 2Y91A 4GCZA 3NBLA 5KMWA 4MNRA 5CHMA 2W0NA 4DJ3A 3FKWA 3ZVTA 4XUZA 1PW1A 3G35A 1K56A 4F94A 1LL9A 1XX2A 4XUXA 3CITA 2ZMFA 4LCLA 3HUOA 3IQAA 3F1PB 1FOFA 2ZOHA 2ACGA 3IHAA 4F3LB 3IH8A 4FSFA 3U2AA 3T4SA 2WZZA 2L0WA 3MXRA 4EETB 1DRMA 4WZ4A 5GLDA 2IA2A 4X55A 2VV8A 1ZKJA 5HARA 4JF6A 1G6AA 3OPRA 4IEDA 3A3JA 4CLCE 1YLJA 1NLYA 3LCEA 1S0WA 5FL3A 3O86A 2IWCA 1K38A 3V3SA 2XSSA 3QHYA 4WMCD 5FI2A 3VP2A 1H8ZA 3W4PA 1PRQA 3TG9A 1ES5A 3OLOA 4PM8A 2H10A 2J9OA 4JLFA 1G5UA 1XA1A 4OPQA 5G18A 3SS3A 3DTEA 2NUPC 2O9CA 5CHUA 3D9YA 3E0YA 3PBOA 2H28A 3K2NA 4WLAA 1ODVA 1IFQA 3CMZA 1NXYA 3PXPA 2KDKA 5EVEA 3DTKA 1ZTUA 5EPHA 3MFDA 1TDLA 3E2KA 4WMCA 5U47A 1NZUA 2XEPA 1H0MA 2PYRA 5IS1A 2QYBA 3BQ8A 1RP5A 2XA7M 3KYQA 4HJ4A 3JPUA 2XD5A 5EUAA 1EI5A 1YMSA 3MZFA 3V50A 1ACFA 3HLGA 5CGSA 1YLWA 4B9OA 1TEMA 1PWCA 1K54C 1YT4A 3C7VA 1GCEA 2XF3A 3D3OA 2EX9A 4JF4A 2FFFB 1XJ2A 3O3VA 3QP1A 4EESA 1DJAA 3DTMA 5DTSA 4B93A 1ZHHB 4FH4A 2Q9MA 1XPBA 4MDZA 1IKIA 1YSPA 3Q82A 2LB9A 5BOHA 5I5LA 4LGWA 5EVIC 3ZDJA 4RQ9A 1JWPA 2Y8HA 3M6BA 4G3KA 4UA6A 1HVBA 1Z09A 3LY3A 5EOOA 1XJ6A 4IVKA 3UDFA 5CX7A 1YLTA 5HPFA 5AVEA 4H6JA 4DF6A 2PR5A 4BWIA 1IOUA 3RJUA 3MJQA 4QPRA 1H8MA 4KZ6A 4DMZA 3B33A 3RFBA 4ZJ2A 3BY8A 2ZD8A 4Y0UA 4NETA 4PAUA 4KG6A 1EWZA 4BBVA 2EWVA 1MZUA 3RXWA 4OOYA 4WF0A 4I3JA 1WYCA 4Y7PA 4KUOA 3T1RA 3AGDA 4ZJ3A 3PBSA 2EXBA 1L3LA 5FI6A 4L0LA 2O0YA 5GLAA 5KIZA 3N6IA 5KSCA 3KSIA 4ZDXA 1NY0A 4HP9A 2D01A 3E4OA 5CHJA 1PYYA 3BWLA 1SZVA 3VOZA 2P7JA 3MS6A 4QWOA 4YNRA 5CERA 3ZG7B 4OH0A 3C2WA 3IT9A 4OP5A 4X25A 1DP9A 4K91A 3AGEA 3N8RA 1LI9A 2XQZA 2VGKA 3B3XA 4JXVA 5A93A 1OMEA 1STZA 1IYQA 4UAAA 2OWHA 4MN7A 2JE5A 3BLSA 5HL6A 4C75A 4P6BA 4QJGA 3LEQA 3GECA 1D7EA 4S2NA 3G31A 5F69A 2V0WA 2V1BA 3UB9A 2FZ0A 1TDGA 2PDRA 4JGPA 4GHIA 4HI4A 5E2FA 2OAQ1 4N1XA 4X1MA 4ETXA 3NHQA 2KOIA 3D72A 1KDSA 4DRTA 4CLCD 1JTGA 3B42A 1N9BA 1S4SA 1G6OA 3C38A 3NOUC 4HESA 4ID4A 4OVDA 1YLPA 4UHUA 2GJ3A 2IWDA 3T12B 1T1BA 1T1AA 4HJ3A 3KSGA 3F1OA 1YSQA 3ZVWA 2EXAA 2HDUA 1GSWA 2EWWA 1K4EA 3FV7A 3ZGAB 3NECA 4EBNA 3W2ZA 2WZXA 1YQSA 4H6JB 2Y2QA 4CLCA 2VGLM 3GVBA 4O7DA 3ZNTA 3EGDC 4LRYC 1LT0A 1TF1A 2V8CA 5FQJA 1KVMA 3ZQ5A 1E4DA 4X69A 1NRFA 5JYOA 1YMXA 3CPTA 3IF5A 4EV4A 3UPNA 4YFMA 3BFCA 3FPWA 5L07A 5EM0A 2XDMA 1PW8A 2E8IA 3BFFA 2WK0A 4C3QA 4KG2A 2YKHA 4UQIM 1OTIA 1NRJA 2I9VA 3QNCA 5FQKA 3BFGA 3Q7VA 2I72A 3VP1A 5G4YA 1RGYA 4OQ0A 2CC1A 1NWZA 2ZC3B 4UQIS 5DFYA 3VV4A 4KZ8A 2WADA 1SHVA 3UNWA 4EUZA 5DF8A 3T1QB 3IXGA 4JPMA 1Y28A 3TSGA 3PBTA 2Q0OA 4H8RA 4DE0A 3S22A 4N9LA 4ZBEA 4RX2A 2O9BA 3R7WA 3MQQA 4WN5A 3ZCZA 3FC7A 1XA7A 3MF0A 2QWSA 2JCHA 1N9LA 1DP6A 1AWIA 3CAXA 3O5YA 3UE0A 2W3DA 1KE0A 1H3QA 1MXOA 1TS7A 3OCLA 2Y2MA 3EOIA 3UE3A 1Q2PA 4KQOA 1PI4A 2Y4AA 4NXBA 4GHIB 4KZ9A 3W8KA 1S67L 3IBJA 4EEUA 3HLWA 4JGRA 2KLIA 3H82A 1CEFA 2UWXA 1JWZA 1KGGA 2Q9NA 1K4FA 4OOLA 3U4LP 1FSYA 2JHEA 1BYWA 4R70A 3JVVA 4L9FA 1PWGA 2DCFA 5C5KA 4EBLA 5HAPA 4KZ7A 2WGVA 3A3DA 4BQMA 2EX8A 4LFUA 3QP5A 4BMWA 2X02A 2FH5A 3F1OB 1QMEA 1C3BA 4Y3IA 4UEYA 3F1NA 3NOTC 2ZC4B 2J3TD 5HW3A 3LYXA 5F5YA 4FD8A 2HV1A 2VK3A 4ME4A 1P0ZA 2PRFA 2PD7A 4KZ4A 1YLYA 3FKVA 4E3LA 5HX9A 3V5MA 2XLNA 3A0RA 3P09A 1IYPA 3FYZA 1MKIA 1OPXA 3BECA 4MEZA 2HZ5A 1W63Q 3OPHA 3CPTB 1DP8A 3VSKA 4PM6A 3A3FA 3G4PA 2PHYA 3OPLA 4PHTA 3IX3A 4OLDA 3BRMA 1CI9A 1BLCA 1MY8A 4S2OA 1ERQA 1MWSA 2V9AA 5E2EA 2ZQDA 5TFQA 3IWOA 3LIFA 4ETZA 1XFNA 3Q7VB 3MMHA 3NDEA 5HZHA 1JWVA 1FCNA 1VHMA 4N9KA 4OQGA 2A49A 3VP4A 2BTFP 1K0KA 2ZQ8A 4UA9A 4OKPA 4Y15A 4CPKA 2HJ9C 4R4SA 5DKKA 3HLEA 4HIAA 2B18A 1K57A 3IF6A 3G30A 2B02A 3ITBA 4JF5A 1FSWA 2W27A 1OT6A 4UA7A 2H0TA 1PZPA 2OOLA 2OLUA 3R7WB 1CEGA 4FTXA 2R9XA 2DRWA 2Z6DA 4WL9A 3PHYA 4R4RA 3C7UA 5GHZA 1ESUA 4E3IA 3K3DA 3AGFA 4JGOA 1G68A 1GSXA 3IS2A 3IWIA 3A0VA 4EQIA 1OJGA 4MBHA 2JKTM 5LBRA 4Y17A 2W3FA 3ZG9B 5AQ7A 2EX6A 3H82B 4KG5A 3ICYA 4PM9A 5CGXA 4PM7A 2QJ5A 4BD0A 2A3UA 4BJPA 2P04A 3Q1FA 4R0QA 2EA9A 3KYZA 5GHXA 3BJNA 1VQQA 1YPRA 1G28A 4B88A 3IH9A 4GB7A 1LHYA 4NG2A 5TBMA 3S1YA 2ZC5B 4IUHA 4WELA 3F1NB 5DTKA 5E2GA 4ZRRA 1HZOA 4P85A 3GR2A 2Z2LB 3T4TA 3RH8B 5KZHA 3D4FA 4Q0JA 4WUJA 4BENA 1NYMA 2XH9A 3LR4A 3MXQA 4EUVA 2PBDP 1ES2A 5K5BA 1H5XA 1BLPA 4FCFA 2G2UA 1GA0A 1Y4OA 4R3BA 3NI9A 3GV9A 2PAVP 1HTZA 3VMAA 1SDNA 3S7PA 1MPLA 4ARZA 4QHCA 2RL3A 5IU1A 4OONA 2V1ZA 2HP5A 1Y54A 4U0XA 5EFWA 3T1SA 3EEHA 3I7JA 2J80A 1PNEA 4GDNA 5FQIA 2OLVA 3HCYA 5AVFA 4GZBA 4BL3A 2X71A 3C4OA 3LI9A 5HDSA 2XA7S 3PAGA 4WZ5A 2OAP1 5DJUA 1JTDA 1BLSA 2ZQAA 4IBRA 3IF6B 1OTEA 3Q7ZA 1ALQA 5FDSA 3Q81A 4HBTA 3IHBA 2VEAA 5DTTA 1BUEA 3T4QA 1FILA 1HLUP 4ZJ1A 4RX3A 1XP4A 1SKFA 4Y2FA 5TJJA 2Y2OA 1YAXA 5HWTA 5F82A 4LV3A 1BULA 3UE1A 1UGUA 5CEBA 4HJ6A 5HPIA 2AVXA 2WKHA 3MQ0A 2JKGA 3IS2B 2M7VA 1E25A 5DF7A 2J3WA 3RXXA 3VFFA 3HUNA 1UWNX 4JKTA 1M6KA 3IX4A 4OP8A 4KZBA 1XFQA 1EW0A 1ZG6A 1NJ4A 1BZAA 3QNBA 3LO7A 4X1LA 4C6YA 4WYYA 4DXCA 3SS5A 1W5DA 3T4JA 1VETA 1W7FA 1MC0A 4BL2A 2BLSA 2ZMVA 1AXBA 4RYEA 4OPYA 2MJ6A 4G3VA 5TBMB 1I2WA 4DJ2A 3PBNA 2V20A 4DDSA 4FH2A 4RA7A 1L0GA 5F68A 2Y55A 3LFVA 4CJNA 3CJMA 4DDYA 1TS8A 4D2OA 3VFHA 3CZDA 1NLZA 1PI5A 3G34A 1S1ZA 2J8YA 2XROA 3IXDA 3ISGA 1PZOA 1L2SA 3BYDA 4JXSA 3HUMA 1L0EA 3TOIA 1ONHA 3LIAA 3UB6A 4FOFA 4YWZA 1GHIA 2ZC7A 3UDIA 4KENB 1IKGA 2L4RA 4GD6A 3IX8A 2PU4A 3PR6A 1KE3A 1TD5A 4EQ1A 1WE4A 4R1GA 3T50A 5HSQA 3OCNA 3HL9A 4WEJA 5DF9A 2Y2NA 4WBGA 4HP4A 1OJ5A 2XRNA 1E3UD 4GNUA 5A92A 3UPOA 4GN2A 5GL9A 3QP6A 5L8MA 2X01A 4LPZA 3ULFA 5TGFA 3BM6A 3S7QA 3BFDA 1D1JA 4EERA 3L7HA 1NYYA 4LV1A 3UDXA 4DE1A 4KUKA 4Y13A 2HPBA 3PYPA 3ZG0A 2CMNA 4GLQA 4OOMA 3CUEA 2WGWA 1S6RA 2PT7A 3H7WA 3UMDA 3PAEA 2IWBA 3PBRA 1KDWA 3GSGA 4BBTA 4E3KA 5I94A 2XFSA 5GLBA 1MWUA 3W4QA 1E3UA 4XT2A 5A90A 2W3EA 4S2PA 3EQUA 1P9RA 4P6ZM 4KQRA 4K0WA 1T1CA 4N92A 5L10A 3G2YA 4HH2A 1MWTA 4ESPA 5HDDA 4P6ZS 4HNBA 1MBLA 4S2IA 2VGLS 2XD1A 2B5RA 5F1FA 3C8CA 2HJEA 4DXBA 2E8JA 2GNXA 4S2NC 1VETB 1FCMA 3DWZA 1H8YA 4JXWA 2HGVA 1J3WA 4GOGA 4M3KA 3NULA 1HD8A 3UB7A 2P74A 4PMAA
chains in the Genus database with same CATH topology
5EVIB 4E6XA 3PBOA 3MXSA 2EFUA 1CI9A 4WM9A 1BLCA 1DY6A 1MY8A 4S2OA 1ERQA 2GDNA 3CMZA 1NXYA 3OPPA 1MWSA 2ZM0A 4PPRA 1K25A 1GHPA 4S2LA 4GD8A 5EPHA 3MFDA 5E2EA 1TDLA 2HP6A 3E2KA 4WMCA 1W8QA 2ZQDA 5TFQA 4EBPA 5U47A 3IWOA 1NZUA 2XEPA 4HEFA 5CTNA 3Q7VB 5CGWA 4P0MA 3M2KA 2HDRA 3IXHA 1RP5A 3NDEA 4LV2A 1JWVA 1FCNA 3N4IA 4N9KA 3ZG5A 4OQGA 1ERMA 2ZLYA 2A49A 3VP4A 2ZQCA 2XD5A 4GDBA 2ZQ8A 4UA9A 5EUAA 1LI0A 4KZAA 4OKPA 3N8SA 4CPKA 5FQQA 1EI5A 1L0FA 3NY4A 3HLEA 4R4SA 4E6WA 1Z6FA 3WS5A 1YMSA 3IF6A 1K57A 3MZFA 3G30A 3V50A 1XGIA 3GRJA 3HLGA 5CGSA 1YLWA 1TEMA 1PWCA 3SH9A 1K54C 3ITBA 4JF5A 5AQBA 2XGNA 1YT4A 3C7VA 3VSLA 2ZQ9A 1FSWA 1GCEA 2C6WB 4DKIA 2XF3A 2Y2JA 2EX9A 4JF4A 4UA7A 2H0TA 1PZPA 3ITAA 2FFFB 1LL5A 2OLUA 1CEGA 2R9XA 3O3VA 4NK3A 4MBKA 1DJAA 4U0TA 3DTMA 5DTSA 3M6HA 2DRWA 4FH4A 4JBFA 2Q9MA 1YLZA 1XPBA 2Z2MB 3C7UA 3CG5A 4R4RA 5GHZA 2JC7A 2ZMAA 1ESUA 4X68A 4MBFA 3WS2A 1O07A 4E3IA 1IKIA 3E2LA 3Q82A 5FQ9A 3AGFA 5BOHA 3N7WA 1G68A 3IWIA 2J9PA 4OPZA 5EVIC 3ZDJA 1JWPA 3M6BA 2V2FF 1HVBA 1K55A 4UA6A 2Y2GA 3LY3A 3WRZA 5EOOA 4EQIA 2ZC6B 4IVKA 5FASA 2G2WA 3UDFA 4DE2A 4MBHA 4YINA 2WGWB 1YM1A 3ZG9B 1YLTA 5AQ7A 4S2MA 2EX6A 3IWQA 4KG5A 4PM9A 4PM7A 5CGXA 4DF6A 4E3MA 1KVLA 4BD0A 5JYPA 4EWFA 2Y2IA 1ONGA 2A3UA 3RJUA 4BJPA 3Q1FA 2HDQA 4R0QA 1M40A 5GHXA 4KZ6A 2XK1A 4WEKA 5E2HA 3SH8A 1VQQA 4RVAA 1FCOA 5M19A 1KGFA 2WKIA 3ZFZA 1DJBA 4B88A 1KE4A 3IH9A 4GB7A 4S2KA 2WGIA 3LY4A 4ZJ2A 1XGJA 1LHYA 2ZD8A 4Y0UA 4NETA 2XFTA 3GTCA 3G32A 3S1YA 3O87A 2WAEA 2ZC5B 4KG6A 4WELA 1EWZA 5DTKA 5E2GA 1HZOA 2BG1A 2HDSA 3MZDA 4KQQA 4P85A 3GR2A 4QB8A 1U60A 4OOYA 3RXWA 3WS4A 2Z2LB 4KZ3A 1WYCA 4R23A 4Y7PA 5KZHA 1RGZA 3D4FA 2QPNA 2ZM2A 4BENA 1NYMA 2XH9A 3AGDA 4ZJ3A 3PBSA 1ESIA 1I5QA 1PWDA 3SH7A 5EOEA 2EXBA 3WS1A 1ES2A 3S4XA 5FI6A 4Z9QA 1H5XA 1BLPA 2WKEA 3FZCA 4L0LA 5GLAA 3HLDA 3N6IA 5KSCA 4R3JA 4ZDXA 1XXMA 1NY0A 4FCFA 2G2UA 5CHJA 1PYYA 1GA0A 3VOZA 3IXBA 4R3BA 3NI9A 2JBFA 3GV9A 2QZ6A 2QMIA 1HTZA 3OC2A 5GLCA 5CERA 3VMAA 3ZG7B 4BD1A 1SDNA 1MPLA 4OH0A 2J7VA 4QHCA 2RL3A 5FAPA 4DE3A 3UY6A 4PM5A 3IT9A 2VGJA 4OP5A 5CECA 4OONA 2DNSA 2V1ZA 2Y2PA 4K91A 3AGEA 3VOYA 3N8RA 1NZOA 1IYSA 2HP5A 1Y54A 2PU2A 4K0XA 4U0XA 4BLMA 1LI9A 2XQZA 3I7JA 2VGKA 1QMFA 3B3XA 1CK3A 4JXVA 2H0YA 5AQAA 1CI8A 3NCKA 5A93A 4GDNA 1EROA 1OMEA 5FQIA 1IYQA 3HLFA 4UAAA 2OLVA 4S2JA 2JE5A 3BLSA 3P98A 1FR1A 4X6TA 4C75A 4P6BA 2C5WB 4GZBA 4BL3A 3C5AA 4QJGA 5FAOA 5FI7A 2X71A 3C4OA 1O7EA 1Q2QA 1FR6A 3M2JA 3PAGA 4WZ5A 1LLBA 5FSRA 2RCXA 1JTDA 4S2NA 1BLSA 1ZG4A 2Y2KA 5GHYA 2ZQAA 3G31A 3MZEA 3EQVA 5FA7A 4P87A 1N4OA 4IBRA 3IF6B 3Q7ZA 1K6RA 1TDGA 5FDHA 1ALQA 4QY5A 2IWBA 1IELA 3MBZA 2PBYA 5FQMA 4Q8IA 5E2FA 3Q81A 2XR0A 4N1XA 2P9VA 4HBTA 3IHBA 5DTTA 1ES3A 3A3EA 1BUEA 1KDSA 4DRTA 4ZJ1A 2OSUA 4RX3A 5A91A 1XP4A 4QY6A 3OZHA 1SKFA 1JTGA 3ZHHA 1N9BA 3MKFA 4B4ZA 2Y2OA 1BLHA 5FATA 5F82A 1L0DA 4LV3A 5HAQA 4XXRA 4HESA 4E3NA 4ID4A 1BULA 3UE1A 1I2SA 1IEMA 5M1AA 5CEBA 4LENA 4OVDA 1YLPA 1BT5A 3C4PA 1DJCA 4UHUA 3UO9A 2IWDA 2WKHA 5CTMA 1E25A 5DF7A 1ES4A 3ZVWA 3RXXA 3PBQA 2EXAA 2HDUA 2EX2A 4OPRA 3VFFA 3HUNA 3WWXA 1K4EA 3ZNYA 5CEDA 3ZG8B 3FV7A 5EVID 3ZGAB 1VM1A 2R9WA 4EBNA 4GKUA 4JKTA 1M6KA 1K54A 1SCWA 2FFYA 2WZXA 1YQSA 4KZBA 4OP8A 4QU3A 5TR7A 5CXWA 2Y2QA 3GVBA 1ZG6A 1NJ4A 1BZAA 4O7DA 3QNBA 3ZNTA 3LO7A 4ZTKA 3NIAA 5L2FA 4C6YA 3BFEA 4WYYA 5FQJA 4DXCA 1KVMA 3SS5A 4N1HA 1W5DA 3DWKA 1E4DA 3HVFA 1W7FA 4BL2A 2BLSA 2H5SA 1NRFA 4X69A 1MWRA 5JYOA 1YMXA 3JYIA 3UPPA 5KSHA 1ZC2A 3IF5A 1AXBA 3IF6C 1K57C 4RYEA 3HREA 4EV4A 4OPYA 3V3RA 3G2ZA 1I2WA 3UPNA 4B4XA 1XKZA 4E3OA 4YFMA 3BFCA 3PBNA 2V20A 5EECA 4ZAMA 4DDSA 5HL1A 4FH2A 5EVIA 5AQ9A 2XDMA 4RA7A 1L0GA 2WYXA 1PW8A 2E8IA 3PTEA 2Y55A 3BFFA 4IVIA 3BLMA 4CJNA 5F1GA 2WK0A 4C3QA 3CJMA 3NC8A 4Y0OA 5CRFA 4DDYA 4KG2A 1BTLA 4HBUA 5J8XA 1GA9A 3QNCA 5FQKA 4D2OA 3VFHA 3BFGA 1IYOA 2ZQ7A 3CZDA 4X53A 4QD4A 1PI5A 1WYBA 3Q7VA 2I72A 3HBRA 3G34A 3VP1A 3BEBA 3SS4A 3HLCA 3WRTA 1RGYA 2OV5A 2J8YA 4OQ0A 2CC1A 3IXDA 3ISGA 1PZOA 4KZ5A 1W8YA 2ZC3B 1L2SA 3BYDA 2ZM8A 4JXSA 1K55C 3HUMA 2WADA 4KZ8A 1SHVA 3UNWA 1L0EA 3TOIA 4EUZA 5DF8A 3IXGA 4JPMA 5E43A 1ONHA 3TSGA 1RCJA 3Q07A 3PBTA 4H8RA 1GHIA 1K56D 2ZC7A 3UDIA 4KENB 1IKGA 5M18A 2WUQA 4GD6A 4DE0A 2PU4A 3S22A 4N9LA 5D3OA 1J9MA 3GMWA 4ZBEA 1KE3A 4RX2A 3NDGA 1WE4A 4LV0A 4R1GA 1SDEA 3ZCZA 3W4OA 2Y91A 3OCNA 3HLBA 3HL9A 4WEJA 5DF9A 1XA7A 2Y2NA 4WBGA 3NBLA 5A92A 1E3UD 4GNUA 2Y59A 2JCHA 4GN2A 5GL9A 3UPOA 2X01A 5KMWA 4MNRA 3UE0A 5CHMA 1KE0A 5TGFA 3BM6A 1JVJA 3BFDA 4LCMA 1MXOA 4X56A 1NYYA 3OCLA 4LV1A 2Y2MA 3FKWA 3UDXA 5F83A 4DE1A 3UE3A 1Q2PA 4XUZA 1PW1A 3ZVTA 3G35A 4KQOA 1K56A 1PI4A 2HPBA 3ZG0A 4F94A 4E3JA 1LL9A 2Y4AA 1XX2A 4XUXA 4OOMA 4KZ9A 4LCLA 3W8KA 3HUOA 2P9VB 3DW0A 2WGWA 3IQAA 3HLWA 5DVAA 1FOFA 5EE8A 1S6RA 1CEFA 3FWLA 5HFOA 2UWXA 3IHAA 1JWZA 1KGGA 2Q9NA 1K4FA 1W79A 3PAEA 4OQHA 4OOLA 3PBRA 4U3TA 3LEZA 1KDWA 1FSYA 3GSGA 3GQZA 3IH8A 4FSFA 1TVFA 5IHVA 1KGEA 2XFSA 5GLBA 4E3KA 5I94A 1MWUA 3W4QA 1E3UA 3N8LA 5A90A 2WZZA 4S2PA 3UN7A 1PWGA 2DCFA 5EVLA 3EQUA 3MXRA 4KQRA 4WZ4A 5GLDA 4EBLA 2WAFA 4K0WA 5HAPA 4KZ7A 4X55A 2WGVA 3A3DA 4BQMA 2EX8A 4N92A 3G2YA 1ZKJA 5HARA 4JF6A 1K6SA 1MWTA 2X02A 3O88A 3VP0A 1G6AA 1QMEA 1FQGA 1BSGA 1C3BA 2Y2LA 3OPRA 2ZC4B 5HW3A 4IEDA 3A3JA 5HAIA 4FD8A 1YLJA 4OLGA 3LCEA 1S0WA 2EFXA 1MBLA 3O86A 1PIOA 1YLYA 2IWCA 4KZ4A 4S2IA 1K38A 3FKVA 3V3SA 3V39A 3QHYA 4E3LA 4WMCD 5FI2A 3SOIA 5HX9A 3VP2A 2XD1A 1H8ZA 3W4PA 2B5RA 5F1FA 4Y0TA 3V5MA 2XLNA 3MKEA 3TG9A 1ES5A 3P09A 1IYPA 3FYZA 1MKIA 4DXBA 4PM8A 4WZ5C 2H10A 4S2NC 3BECA 4MEZA 2J9OA 2Y2HA 4JLFA 3A3IA 1FCMA 3DWZA 1XA1A 3OPHA 1H8YA 4JXWA 4MLLA 4OPQA 2ZJ9A 1GHMA 4GOGA 2HP9A 4M3KA 3VSKA 4OQIA 4PM6A 3A3FA 4JXGA 5G18A 4IBXA 3G4PA 3SS3A 3VP3A 1HD8A 3WS0A 3OPLA 4OLDA 5FAQA 4A5RA 5CHUA 3BRMA 2P74A 4PMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVI B;  4E6X A;  3PBO A;  3MXS A;  2EFU A;  1CI9 A;  4WM9 A;  1BLC A;  1DY6 A;  1MY8 A;  4S2O A;  1ERQ A;  2GDN A;  3CMZ A;  1NXY A;  3OPP A;  1MWS A;  2ZM0 A;  4PPR A;  1K25 A;  1GHP A;  4S2L A;  4GD8 A;  5EPH A;  3MFD A;  5E2E A;  1TDL A;  2HP6 A;  3E2K A;  4WMC A;  1W8Q A;  2ZQD A;  5TFQ A;  4EBP A;  5U47 A;  3IWO A;  1NZU A;  2XEP A;  4HEF A;  5CTN A;  3Q7V B;  5CGW A;  4P0M A;  3M2K A;  2HDR A;  3IXH A;  1RP5 A;  3NDE A;  4LV2 A;  1JWV A;  1FCN A;  3N4I A;  4N9K A;  3ZG5 A;  4OQG A;  1ERM A;  2ZLY A;  2A49 A;  3VP4 A;  2ZQC A;  2XD5 A;  4GDB A;  2ZQ8 A;  4UA9 A;  5EUA A;  1LI0 A;  4KZA A;  4OKP A;  3N8S A;  4CPK A;  5FQQ A;  1EI5 A;  1L0F A;  3NY4 A;  3HLE A;  4R4S A;  4E6W A;  1Z6F A;  3WS5 A;  1YMS A;  3IF6 A;  1K57 A;  3MZF A;  3G30 A;  3V50 A;  1XGI A;  3GRJ A;  3HLG A;  5CGS A;  1YLW A;  1TEM A;  1PWC A;  3SH9 A;  1K54 C;  3ITB A;  4JF5 A;  5AQB A;  2XGN A;  1YT4 A;  3C7V A;  3VSL A;  2ZQ9 A;  1FSW A;  1GCE A;  2C6W B;  4DKI A;  2XF3 A;  2Y2J A;  2EX9 A;  4JF4 A;  4UA7 A;  2H0T A;  1PZP A;  3ITA A;  2FFF B;  1LL5 A;  2OLU A;  1CEG A;  2R9X A;  3O3V A;  4NK3 A;  4MBK A;  1DJA A;  4U0T A;  3DTM A;  5DTS A;  3M6H A;  2DRW A;  4FH4 A;  4JBF A;  2Q9M A;  1YLZ A;  1XPB A;  2Z2M B;  3C7U A;  3CG5 A;  4R4R A;  5GHZ A;  2JC7 A;  2ZMA A;  1ESU A;  4X68 A;  4MBF A;  3WS2 A;  1O07 A;  4E3I A;  1IKI A;  3E2L A;  3Q82 A;  5FQ9 A;  3AGF A;  5BOH A;  3N7W A;  1G68 A;  3IWI A;  2J9P A;  4OPZ A;  5EVI C;  3ZDJ A;  1JWP A;  3M6B A;  2V2F F;  1HVB A;  1K55 A;  4UA6 A;  2Y2G A;  3LY3 A;  3WRZ A;  5EOO A;  4EQI A;  2ZC6 B;  4IVK A;  5FAS A;  2G2W A;  3UDF A;  4DE2 A;  4MBH A;  4YIN A;  2WGW B;  1YM1 A;  3ZG9 B;  1YLT A;  5AQ7 A;  4S2M A;  2EX6 A;  3IWQ A;  4KG5 A;  4PM9 A;  4PM7 A;  5CGX A;  4DF6 A;  4E3M A;  1KVL A;  4BD0 A;  5JYP A;  4EWF A;  2Y2I A;  1ONG A;  2A3U A;  3RJU A;  4BJP A;  3Q1F A;  2HDQ A;  4R0Q A;  1M40 A;  5GHX A;  4KZ6 A;  2XK1 A;  4WEK A;  5E2H A;  3SH8 A;  1VQQ A;  4RVA A;  1FCO A;  5M19 A;  1KGF A;  2WKI A;  3ZFZ A;  1DJB A;  4B88 A;  1KE4 A;  3IH9 A;  4GB7 A;  4S2K A;  2WGI A;  3LY4 A;  4ZJ2 A;  1XGJ A;  1LHY A;  2ZD8 A;  4Y0U A;  4NET A;  2XFT A;  3GTC A;  3G32 A;  3S1Y A;  3O87 A;  2WAE A;  2ZC5 B;  4KG6 A;  4WEL A;  1EWZ A;  5DTK A;  5E2G A;  1HZO A;  2BG1 A;  2HDS A;  3MZD A;  4KQQ A;  4P85 A;  3GR2 A;  4QB8 A;  1U60 A;  4OOY A;  3RXW A;  3WS4 A;  2Z2L B;  4KZ3 A;  1WYC A;  4R23 A;  4Y7P A;  5KZH A;  1RGZ A;  3D4F A;  2QPN A;  2ZM2 A;  4BEN A;  1NYM A;  2XH9 A;  3AGD A;  4ZJ3 A;  3PBS A;  1ESI A;  1I5Q A;  1PWD A;  3SH7 A;  5EOE A;  2EXB A;  3WS1 A;  1ES2 A;  3S4X A;  5FI6 A;  4Z9Q A;  1H5X A;  1BLP A;  2WKE A;  3FZC A;  4L0L A;  5GLA A;  3HLD A;  3N6I A;  5KSC A;  4R3J A;  4ZDX A;  1XXM A;  1NY0 A;  4FCF A;  2G2U A;  5CHJ A;  1PYY A;  1GA0 A;  3VOZ A;  3IXB A;  4R3B A;  3NI9 A;  2JBF A;  3GV9 A;  2QZ6 A;  2QMI A;  1HTZ A;  3OC2 A;  5GLC A;  5CER A;  3VMA A;  3ZG7 B;  4BD1 A;  1SDN A;  1MPL A;  4OH0 A;  2J7V A;  4QHC A;  2RL3 A;  5FAP A;  4DE3 A;  3UY6 A;  4PM5 A;  3IT9 A;  2VGJ A;  4OP5 A;  5CEC A;  4OON A;  2DNS A;  2V1Z A;  2Y2P A;  4K91 A;  3AGE A;  3VOY A;  3N8R A;  1NZO A;  1IYS A;  2HP5 A;  1Y54 A;  2PU2 A;  4K0X A;  4U0X A;  4BLM A;  1LI9 A;  2XQZ A;  3I7J A;  2VGK A;  1QMF A;  3B3X A;  1CK3 A;  4JXV A;  2H0Y A;  5AQA A;  1CI8 A;  3NCK A;  5A93 A;  4GDN A;  1ERO A;  1OME A;  5FQI A;  1IYQ A;  3HLF A;  4UAA A;  2OLV A;  4S2J A;  2JE5 A;  3BLS A;  3P98 A;  1FR1 A;  4X6T A;  4C75 A;  4P6B A;  2C5W B;  4GZB A;  4BL3 A;  3C5A A;  4QJG A;  5FAO A;  5FI7 A;  2X71 A;  3C4O A;  1O7E A;  1Q2Q A;  1FR6 A;  3M2J A;  3PAG A;  4WZ5 A;  1LLB A;  5FSR A;  2RCX A;  1JTD A;  4S2N A;  1BLS A;  1ZG4 A;  2Y2K A;  5GHY A;  2ZQA A;  3G31 A;  3MZE A;  3EQV A;  5FA7 A;  4P87 A;  1N4O A;  4IBR A;  3IF6 B;  3Q7Z A;  1K6R A;  1TDG A;  5FDH A;  1ALQ A;  4QY5 A;  2IWB A;  1IEL A;  3MBZ A;  2PBY A;  5FQM A;  4Q8I A;  5E2F A;  3Q81 A;  2XR0 A;  4N1X A;  2P9V A;  4HBT A;  3IHB A;  5DTT A;  1ES3 A;  3A3E A;  1BUE A;  1KDS A;  4DRT A;  4ZJ1 A;  2OSU A;  4RX3 A;  5A91 A;  1XP4 A;  4QY6 A;  3OZH A;  1SKF A;  1JTG A;  3ZHH A;  1N9B A;  3MKF A;  4B4Z A;  2Y2O A;  1BLH A;  5FAT A;  5F82 A;  1L0D A;  4LV3 A;  5HAQ A;  4XXR A;  4HES A;  4E3N A;  4ID4 A;  1BUL A;  3UE1 A;  1I2S A;  1IEM A;  5M1A A;  5CEB A;  4LEN A;  4OVD A;  1YLP A;  1BT5 A;  3C4P A;  1DJC A;  4UHU A;  3UO9 A;  2IWD A;  2WKH A;  5CTM A;  1E25 A;  5DF7 A;  1ES4 A;  3ZVW A;  3RXX A;  3PBQ A;  2EXA A;  2HDU A;  2EX2 A;  4OPR A;  3VFF A;  3HUN A;  3WWX A;  1K4E A;  3ZNY A;  5CED A;  3ZG8 B;  3FV7 A;  5EVI D;  3ZGA B;  1VM1 A;  2R9W A;  4EBN A;  4GKU A;  4JKT A;  1M6K A;  1K54 A;  1SCW A;  2FFY A;  2WZX A;  1YQS A;  4KZB A;  4OP8 A;  4QU3 A;  5TR7 A;  5CXW A;  2Y2Q A;  3GVB A;  1ZG6 A;  1NJ4 A;  1BZA A;  4O7D A;  3QNB A;  3ZNT A;  3LO7 A;  4ZTK A;  3NIA A;  5L2F A;  4C6Y A;  3BFE A;  4WYY A;  5FQJ A;  4DXC A;  1KVM A;  3SS5 A;  4N1H A;  1W5D A;  3DWK A;  1E4D A;  3HVF A;  1W7F A;  4BL2 A;  2BLS A;  2H5S A;  1NRF A;  4X69 A;  1MWR A;  5JYO A;  1YMX A;  3JYI A;  3UPP A;  5KSH A;  1ZC2 A;  3IF5 A;  1AXB A;  3IF6 C;  1K57 C;  4RYE A;  3HRE A;  4EV4 A;  4OPY A;  3V3R A;  3G2Z A;  1I2W A;  3UPN A;  4B4X A;  1XKZ A;  4E3O A;  4YFM A;  3BFC A;  3PBN A;  2V20 A;  5EEC A;  4ZAM A;  4DDS A;  5HL1 A;  4FH2 A;  5EVI A;  5AQ9 A;  2XDM A;  4RA7 A;  1L0G A;  2WYX A;  1PW8 A;  2E8I A;  3PTE A;  2Y55 A;  3BFF A;  4IVI A;  3BLM A;  4CJN A;  5F1G A;  2WK0 A;  4C3Q A;  3CJM A;  3NC8 A;  4Y0O A;  5CRF A;  4DDY A;  4KG2 A;  1BTL A;  4HBU A;  5J8X A;  1GA9 A;  3QNC A;  5FQK A;  4D2O A;  3VFH A;  3BFG A;  1IYO A;  2ZQ7 A;  3CZD A;  4X53 A;  4QD4 A;  1PI5 A;  1WYB A;  3Q7V A;  2I72 A;  3HBR A;  3G34 A;  3VP1 A;  3BEB A;  3SS4 A;  3HLC A;  3WRT A;  1RGY A;  2OV5 A;  2J8Y A;  4OQ0 A;  2CC1 A;  3IXD A;  3ISG A;  1PZO A;  4KZ5 A;  1W8Y A;  2ZC3 B;  1L2S A;  3BYD A;  2ZM8 A;  4JXS A;  1K55 C;  3HUM A;  2WAD A;  4KZ8 A;  1SHV A;  3UNW A;  1L0E A;  3TOI A;  4EUZ A;  5DF8 A;  3IXG A;  4JPM A;  5E43 A;  1ONH A;  3TSG A;  1RCJ A;  3Q07 A;  3PBT A;  4H8R A;  1GHI A;  1K56 D;  2ZC7 A;  3UDI A;  4KEN B;  1IKG A;  5M18 A;  2WUQ A;  4GD6 A;  4DE0 A;  2PU4 A;  3S22 A;  4N9L A;  5D3O A;  1J9M A;  3GMW A;  4ZBE A;  1KE3 A;  4RX2 A;  3NDG A;  1WE4 A;  4LV0 A;  4R1G A;  1SDE A;  3ZCZ A;  3W4O A;  2Y91 A;  3OCN A;  3HLB A;  3HL9 A;  4WEJ A;  5DF9 A;  1XA7 A;  2Y2N A;  4WBG A;  3NBL A;  5A92 A;  1E3U D;  4GNU A;  2Y59 A;  2JCH A;  4GN2 A;  5GL9 A;  3UPO A;  2X01 A;  5KMW A;  4MNR A;  3UE0 A;  5CHM A;  1KE0 A;  5TGF A;  3BM6 A;  1JVJ A;  3BFD A;  4LCM A;  1MXO A;  4X56 A;  1NYY A;  3OCL A;  4LV1 A;  2Y2M A;  3FKW A;  3UDX A;  5F83 A;  4DE1 A;  3UE3 A;  1Q2P A;  4XUZ A;  1PW1 A;  3ZVT A;  3G35 A;  4KQO A;  1K56 A;  1PI4 A;  2HPB A;  3ZG0 A;  4F94 A;  4E3J A;  1LL9 A;  2Y4A A;  1XX2 A;  4XUX A;  4OOM A;  4KZ9 A;  4LCL A;  3W8K A;  3HUO A;  2P9V B;  3DW0 A;  2WGW A;  3IQA A;  3HLW A;  5DVA A;  1FOF A;  5EE8 A;  1S6R A;  1CEF A;  3FWL A;  5HFO A;  2UWX A;  3IHA A;  1JWZ A;  1KGG A;  2Q9N A;  1K4F A;  1W79 A;  3PAE A;  4OQH A;  4OOL A;  3PBR A;  4U3T A;  3LEZ A;  1KDW A;  1FSY A;  3GSG A;  3GQZ A;  3IH8 A;  4FSF A;  1TVF A;  5IHV A;  1KGE A;  2XFS A;  5GLB A;  4E3K A;  5I94 A;  1MWU A;  3W4Q A;  1E3U A;  3N8L A;  5A90 A;  2WZZ A;  4S2P A;  3UN7 A;  1PWG A;  2DCF A;  5EVL A;  3EQU A;  3MXR A;  4KQR A;  4WZ4 A;  5GLD A;  4EBL A;  2WAF A;  4K0W A;  5HAP A;  4KZ7 A;  4X55 A;  2WGV A;  3A3D A;  4BQM A;  2EX8 A;  4N92 A;  3G2Y A;  1ZKJ A;  5HAR A;  4JF6 A;  1K6S A;  1MWT A;  2X02 A;  3O88 A;  3VP0 A;  1G6A A;  1QME A;  1FQG A;  1BSG A;  1C3B A;  2Y2L A;  3OPR A;  2ZC4 B;  5HW3 A;  4IED A;  3A3J A;  5HAI A;  4FD8 A;  1YLJ A;  4OLG A;  3LCE A;  1S0W A;  2EFX A;  1MBL A;  3O86 A;  1PIO A;  1YLY A;  2IWC A;  4KZ4 A;  4S2I A;  1K38 A;  3FKV A;  3V3S A;  3V39 A;  3QHY A;  4E3L A;  4WMC D;  5FI2 A;  3SOI A;  5HX9 A;  3VP2 A;  2XD1 A;  1H8Z A;  3W4P A;  2B5R A;  5F1F A;  4Y0T A;  3V5M A;  2XLN A;  3MKE A;  3TG9 A;  1ES5 A;  3P09 A;  1IYP A;  3FYZ A;  1MKI A;  4DXB A;  4PM8 A;  4WZ5 C;  2H10 A;  4S2N C;  3BEC A;  4MEZ A;  2J9O A;  2Y2H A;  4JLF A;  3A3I A;  1FCM A;  3DWZ A;  1XA1 A;  3OPH A;  1H8Y A;  4JXW A;  4MLL A;  4OPQ A;  2ZJ9 A;  1GHM A;  4GOG A;  2HP9 A;  4M3K A;  3VSK A;  4OQI A;  4PM6 A;  3A3F A;  4JXG A;  5G18 A;  4IBX A;  3G4P A;  3SS3 A;  3VP3 A;  1HD8 A;  3WS0 A;  3OPL A;  4OLD A;  5FAQ A;  4A5R A;  5CHU A;  3BRM A;  2P74 A;  4PMA A; 
#chains in the Genus database with same CATH topology
 3MXS A;  3EEA A;  4WM9 A;  1DY6 A;  4BBU A;  2GDN A;  2ZM0 A;  4PPR A;  4S2L A;  2OWJ A;  1W8Q A;  4EBP A;  3LR3 A;  3DTI A;  4HEF A;  3K3C A;  5CTN A;  3OBF A;  2VJW A;  2VX8 A;  3M2K A;  4LV2 A;  2ZL1 A;  3N4I A;  3ZG5 A;  2ZLY A;  1S66 L;  1CQA A;  3E4P A;  4GDB A;  4KZA A;  2Y79 A;  3GRJ A;  3T1X A;  5AQB A;  4CLC C;  2WKQ A;  1MKM A;  2C6W B;  4DKI A;  4I3A A;  2Y2J A;  3ITA A;  4MN6 A;  1T19 A;  1N9N A;  1W63 M;  2VLG A;  1S1Y A;  1TS6 A;  4NK3 A;  1LSX A;  1A0K A;  3SW1 A;  3LUQ A;  1YLZ A;  2ZMA A;  1P97 A;  4MBF A;  3NJA A;  3WS2 A;  1O07 A;  5FQ9 A;  2J9P A;  2V2F F;  1K55 A;  3WRZ A;  1D06 A;  5FAS A;  1JNU A;  4DE2 A;  3UME A;  2WGW B;  1YM1 A;  2G7U A;  2M7U A;  3IWQ A;  3H7W B;  2JKT I;  5J3W A;  1KVL A;  5JYP A;  1M40 A;  5EV0 A;  1VEU A;  3H9W A;  2XK1 A;  3T4O A;  4XT2 B;  4WEK A;  4PKY G;  4NKP A;  4NEE D;  3SH8 A;  4RVA A;  5M19 A;  1KGF A;  2WKI A;  2GX5 A;  3TJZ C;  2WGI A;  3P7N A;  1XGJ A;  3E98 A;  4CLC B;  4EEP A;  3LR0 A;  2XFT A;  3GTC A;  3VE4 A;  4GS9 A;  2HDS A;  2P08 A;  4KQQ A;  4QB8 A;  1U60 A;  3WS4 A;  4R23 A;  3ZYT A;  1RGZ A;  2ZM2 A;  3SH7 A;  1XJ3 A;  1I5Q A;  1PWD A;  3MQO A;  5EOE A;  5HDC A;  3CWF A;  3WS1 A;  4NXE A;  4R3J A;  2W1R A;  2O99 A;  4IUK A;  3IXB A;  4L9E A;  2QZ6 A;  4D60 A;  4BD1 A;  3OC2 A;  5GLC A;  5FAP A;  4DE3 A;  3T4K A;  3C30 A;  3UY6 A;  4PM5 A;  5CEC A;  3DBA A;  2DNS A;  2Y2P A;  1OTD A;  1NZO A;  2PU2 A;  4BLM A;  1QMF A;  1CK3 A;  5AQA A;  3NCK A;  4EU0 A;  1X0O A;  4S2J A;  3P98 A;  1N9O A;  4HH3 A;  1TS0 A;  3HJK A;  3DAV A;  4DN0 A;  4NXF A;  5FAO A;  3VOL A;  2ZL1 B;  3S7N A;  1LLB A;  1CF0 A;  2RCX A;  3P01 A;  1ZG4 A;  2Y2K A;  3MZE A;  5FA7 A;  4P87 A;  1N4O A;  2A24 A;  4QY5 A;  3MBZ A;  5FQM A;  4Q8I A;  2P9V A;  4LRX C;  2W1T A;  2OSU A;  2VV6 A;  3OZH A;  5AJG A;  3MFX A;  4B4Z A;  1BLH A;  5FAT A;  5HAQ A;  4XXR A;  1T18 A;  1IEM A;  1WA9 A;  1BT5 A;  3C4P A;  3UO9 A;  2J3T C;  2Z6C A;  1OT9 A;  4MN5 A;  2EX2 A;  1GSV A;  4MMN A;  3V67 A;  5EVI D;  1VM1 A;  2R9W A;  4GKU A;  2O9A A;  1K54 A;  1SCW A;  2FFY A;  3KSH A;  4O8G A;  4ZTK A;  1VEU B;  3NIA A;  3EGX C;  5L2F A;  3BFE A;  3SZT A;  3DWK A;  2NUT C;  3HVF A;  3UPP A;  5KSH A;  3IF6 C;  1K57 C;  5MC7 A;  3V3R A;  1YKD A;  4E3O A;  4B4X A;  1XKZ A;  3MR0 A;  2YKF A;  4GS9 B;  1V9Z A;  3HJI A;  5EEC A;  4ZAM A;  5HL1 A;  5EVI A;  2QHK A;  5AQ9 A;  4E04 A;  4IVI A;  3BLM A;  5F1G A;  2K31 A;  3NC8 A;  4Y0O A;  4HBU A;  1CJF A;  2V1A A;  1GA9 A;  4Z1W A;  4Q0H A;  3BEB A;  3LIE A;  3HLC A;  4HOI A;  1LSV A;  5FEF A;  1W8Y A;  2KX6 A;  2ZM8 A;  5DFX A;  2HF6 A;  4KQD A;  3LID A;  3BY9 A;  2WUQ A;  5HD3 A;  5D3O A;  1J9M A;  3NDG A;  4LV0 A;  1F5M A;  3W4O A;  2BAS A;  3HLB A;  4HY8 A;  4I38 A;  4R38 A;  2Y59 A;  3KSF A;  2K2N A;  3A0S A;  1JVJ A;  4LCM A;  4IJG A;  4X56 A;  4HQA A;  1P9W A;  5F83 A;  5HWW A;  2A24 B;  4E3J A;  3TE8 A;  3CLO A;  2P9V B;  3DW0 A;  4JGQ A;  5DVA A;  2JKR I;  4EXO A;  5EE8 A;  1SKO A;  2W1T B;  3FWL A;  5HFO A;  4OQH A;  1S4R A;  1W79 A;  4U3T A;  5HD5 A;  3LEZ A;  4I5S A;  3GQZ A;  1TVF A;  5IHV A;  1KGE A;  1F2K A;  3N8L A;  3UN7 A;  2UV0 E;  2D02 A;  5EVL A;  2WAF A;  3VE3 A;  4IHQ A;  3LIC A;  1K6S A;  3O88 A;  3VP0 A;  1FQG A;  1BSG A;  2Y2L A;  5HAI A;  3E4Q A;  4OLG A;  2EFX A;  1PIO A;  5DJT A;  4GW9 A;  3V39 A;  3SOI A;  1LSW A;  4Y0T A;  3MKE A;  4CQH A;  4L9G A;  4M4X A;  1F9I A;  4WZ5 C;  2Y2H A;  3A3I A;  4MLL A;  2ZJ9 A;  1GHM A;  2HP9 A;  4OQI A;  4JXG A;  4IBX A;  3VP3 A;  3KX0 X;  3WS0 A;  5FAQ A;  4A5R A;  5EVI B;  4E6X A;  2QKP A;  5EM1 A;  2EFU A;  3R4K A;  3LGO A;  3OPP A;  1K25 A;  1GHP A;  4GD8 A;  4ARZ B;  2HP6 A;  3T4L A;  3UE6 A;  5CGW A;  5G4Z A;  4P0M A;  2JN7 A;  2HDR A;  3IXH A;  4NXG A;  1KOU A;  2K7S A;  1ERM A;  2B95 A;  4GJ4 A;  2PD8 A;  2ZQC A;  2VZW A;  1LI0 A;  3N8S A;  3LIB A;  5FQQ A;  1L0F A;  3NY4 A;  4E6W A;  1Z6F A;  3WS5 A;  4HHD A;  5FEG A;  1XGI A;  3SH9 A;  3QP8 A;  2INW A;  2XGN A;  3VSL A;  5HWV A;  2ZQ9 A;  3B47 A;  1LL5 A;  2R78 A;  2V8F A;  4MBK A;  4U0T A;  2JKR M;  4K08 A;  3M6H A;  2VV7 A;  4JBF A;  2Z2M B;  3CG5 A;  2JC7 A;  4X68 A;  3G6O A;  3LR5 A;  3E2L A;  4I39 A;  3N7W A;  4OPZ A;  2Y2G A;  2JKF A;  2ZC6 B;  2G2W A;  4YIN A;  1XJ4 A;  1SKO B;  4S2M A;  4LRZ E;  4E3M A;  4EWF A;  2Y2I A;  1ONG A;  2HDQ A;  3L9K A;  5E2H A;  1FCO A;  3ZFZ A;  2QJ7 A;  1DJB A;  1OTA A;  1KE4 A;  4S2K A;  3LY4 A;  2ZBB A;  4II7 A;  2W3H A;  3G32 A;  3O87 A;  2WAE A;  2BG1 A;  3MZD A;  3QP4 A;  4R6L A;  4KZ3 A;  1V9Y A;  2VKS A;  3KO6 A;  5J7E A;  2QPN A;  1F98 A;  1ESI A;  2A2L A;  3S4X A;  4Z9Q A;  2WKE A;  3FZC A;  4PKY A;  3HLD A;  2L1M A;  1XXM A;  3IBR A;  4O0P A;  1UWP X;  2JBF A;  2QMI A;  3GDI A;  2DMW A;  3S7O A;  3KYE A;  2J7V A;  2VGJ A;  2ZOI A;  3CUE C;  4R3A A;  3VOY A;  2VA0 A;  3CHW P;  1IYS A;  2WKP A;  4K0X A;  2H0Y A;  1CI8 A;  1ERO A;  3HLF A;  2V0U A;  1FR1 A;  4X6T A;  2C5W B;  5A8B A;  3UB8 A;  3C5A A;  5FI7 A;  1O7E A;  1Q2Q A;  1FR6 A;  3M2J A;  4Q0I A;  5FSR A;  4G3W A;  3LI8 A;  5GHY A;  3QP2 A;  4LLO B;  3EQV A;  1K6R A;  5FDH A;  1IEL A;  2LB5 A;  3CI6 A;  2PBY A;  2XR0 A;  3F1P A;  3OOV A;  1ES3 A;  3A3E A;  5A91 A;  4QY6 A;  4F3L A;  3ZHH A;  3MKF A;  1L0D A;  4E3N A;  3BW6 A;  1I2S A;  5M1A A;  3RTY A;  4LEN A;  1DJC A;  3FG8 A;  5CTM A;  5L09 A;  1LL8 A;  1ES4 A;  3PBQ A;  2PYP A;  4OPR A;  3WWX A;  3BQA A;  3ZNY A;  2W3G A;  3ZG8 B;  5CED A;  3MSH A;  5TR7 A;  3TRC A;  4QU3 A;  5CXW A;  4MCW A;  3JVU A;  4FUW A;  5DKL A;  4EW7 A;  4N1H A;  1VB6 A;  2H5S A;  1MWR A;  3JYI A;  1ZC2 A;  5IT5 A;  3HRE A;  4Y5F A;  3G2Z A;  4O01 A;  3EWK A;  3UB5 P;  1FIK A;  2GZA A;  2WYX A;  3PTE A;  5CRF A;  1BTL A;  5J8X A;  2PR6 A;  1IYO A;  2ZQ7 A;  1PFL A;  4X53 A;  4QD4 A;  1WYB A;  3HBR A;  3SS4 A;  3WRT A;  2OV5 A;  4KZ5 A;  1K55 C;  4I3I A;  3NOP C;  3TW8 A;  4AFI A;  2WKR A;  5E43 A;  4YOF A;  1RCJ A;  3FPV A;  3Q07 A;  1K56 D;  2M1C A;  1OTB A;  5M18 A;  5J4E A;  3GMW A;  5F6A A;  1SDE A;  2Y91 A;  4GCZ A;  3NBL A;  5KMW A;  4MNR A;  5CHM A;  2W0N A;  4DJ3 A;  3FKW A;  3ZVT A;  4XUZ A;  1PW1 A;  3G35 A;  1K56 A;  4F94 A;  1LL9 A;  1XX2 A;  4XUX A;  3CIT A;  2ZMF A;  4LCL A;  3HUO A;  3IQA A;  3F1P B;  1FOF A;  2ZOH A;  2ACG A;  3IHA A;  4F3L B;  3IH8 A;  4FSF A;  3U2A A;  3T4S A;  2WZZ A;  2L0W A;  3MXR A;  4EET B;  1DRM A;  4WZ4 A;  5GLD A;  2IA2 A;  4X55 A;  2VV8 A;  1ZKJ A;  5HAR A;  4JF6 A;  1G6A A;  3OPR A;  4IED A;  3A3J A;  4CLC E;  1YLJ A;  1NLY A;  3LCE A;  1S0W A;  5FL3 A;  3O86 A;  2IWC A;  1K38 A;  3V3S A;  2XSS A;  3QHY A;  4WMC D;  5FI2 A;  3VP2 A;  1H8Z A;  3W4P A;  1PRQ A;  3TG9 A;  1ES5 A;  3OLO A;  4PM8 A;  2H10 A;  2J9O A;  4JLF A;  1G5U A;  1XA1 A;  4OPQ A;  5G18 A;  3SS3 A;  3DTE A;  2NUP C;  2O9C A;  5CHU A;  3D9Y A;  3E0Y A;  3PBO A;  2H28 A;  3K2N A;  4WLA A;  1ODV A;  1IFQ A;  3CMZ A;  1NXY A;  3PXP A;  2KDK A;  5EVE A;  3DTK A;  1ZTU A;  5EPH A;  3MFD A;  1TDL A;  3E2K A;  4WMC A;  5U47 A;  1NZU A;  2XEP A;  1H0M A;  2PYR A;  5IS1 A;  2QYB A;  3BQ8 A;  1RP5 A;  2XA7 M;  3KYQ A;  4HJ4 A;  3JPU A;  2XD5 A;  5EUA A;  1EI5 A;  1YMS A;  3MZF A;  3V50 A;  1ACF A;  3HLG A;  5CGS A;  1YLW A;  4B9O A;  1TEM A;  1PWC A;  1K54 C;  1YT4 A;  3C7V A;  1GCE A;  2XF3 A;  3D3O A;  2EX9 A;  4JF4 A;  2FFF B;  1XJ2 A;  3O3V A;  3QP1 A;  4EES A;  1DJA A;  3DTM A;  5DTS A;  4B93 A;  1ZHH B;  4FH4 A;  2Q9M A;  1XPB A;  4MDZ A;  1IKI A;  1YSP A;  3Q82 A;  2LB9 A;  5BOH A;  5I5L A;  4LGW A;  5EVI C;  3ZDJ A;  4RQ9 A;  1JWP A;  2Y8H A;  3M6B A;  4G3K A;  4UA6 A;  1HVB A;  1Z09 A;  3LY3 A;  5EOO A;  1XJ6 A;  4IVK A;  3UDF A;  5CX7 A;  1YLT A;  5HPF A;  5AVE A;  4H6J A;  4DF6 A;  2PR5 A;  4BWI A;  1IOU A;  3RJU A;  3MJQ A;  4QPR A;  1H8M A;  4KZ6 A;  4DMZ A;  3B33 A;  3RFB A;  4ZJ2 A;  3BY8 A;  2ZD8 A;  4Y0U A;  4NET A;  4PAU A;  4KG6 A;  1EWZ A;  4BBV A;  2EWV A;  1MZU A;  3RXW A;  4OOY A;  4WF0 A;  4I3J A;  1WYC A;  4Y7P A;  4KUO A;  3T1R A;  3AGD A;  4ZJ3 A;  3PBS A;  2EXB A;  1L3L A;  5FI6 A;  4L0L A;  2O0Y A;  5GLA A;  5KIZ A;  3N6I A;  5KSC A;  3KSI A;  4ZDX A;  1NY0 A;  4HP9 A;  2D01 A;  3E4O A;  5CHJ A;  1PYY A;  3BWL A;  1SZV A;  3VOZ A;  2P7J A;  3MS6 A;  4QWO A;  4YNR A;  5CER A;  3ZG7 B;  4OH0 A;  3C2W A;  3IT9 A;  4OP5 A;  4X25 A;  1DP9 A;  4K91 A;  3AGE A;  3N8R A;  1LI9 A;  2XQZ A;  2VGK A;  3B3X A;  4JXV A;  5A93 A;  1OME A;  1STZ A;  1IYQ A;  4UAA A;  2OWH A;  4MN7 A;  2JE5 A;  3BLS A;  5HL6 A;  4C75 A;  4P6B A;  4QJG A;  3LEQ A;  3GEC A;  1D7E A;  4S2N A;  3G31 A;  5F69 A;  2V0W A;  2V1B A;  3UB9 A;  2FZ0 A;  1TDG A;  2PDR A;  4JGP A;  4GHI A;  4HI4 A;  5E2F A;  2OAQ 1;  4N1X A;  4X1M A;  4ETX A;  3NHQ A;  2KOI A;  3D72 A;  1KDS A;  4DRT A;  4CLC D;  1JTG A;  3B42 A;  1N9B A;  1S4S A;  1G6O A;  3C38 A;  3NOU C;  4HES A;  4ID4 A;  4OVD A;  1YLP A;  4UHU A;  2GJ3 A;  2IWD A;  3T12 B;  1T1B A;  1T1A A;  4HJ3 A;  3KSG A;  3F1O A;  1YSQ A;  3ZVW A;  2EXA A;  2HDU A;  1GSW A;  2EWW A;  1K4E A;  3FV7 A;  3ZGA B;  3NEC A;  4EBN A;  3W2Z A;  2WZX A;  1YQS A;  4H6J B;  2Y2Q A;  4CLC A;  2VGL M;  3GVB A;  4O7D A;  3ZNT A;  3EGD C;  4LRY C;  1LT0 A;  1TF1 A;  2V8C A;  5FQJ A;  1KVM A;  3ZQ5 A;  1E4D A;  4X69 A;  1NRF A;  5JYO A;  1YMX A;  3CPT A;  3IF5 A;  4EV4 A;  3UPN A;  4YFM A;  3BFC A;  3FPW A;  5L07 A;  5EM0 A;  2XDM A;  1PW8 A;  2E8I A;  3BFF A;  2WK0 A;  4C3Q A;  4KG2 A;  2YKH A;  4UQI M;  1OTI A;  1NRJ A;  2I9V A;  3QNC A;  5FQK A;  3BFG A;  3Q7V A;  2I72 A;  3VP1 A;  5G4Y A;  1RGY A;  4OQ0 A;  2CC1 A;  1NWZ A;  2ZC3 B;  4UQI S;  5DFY A;  3VV4 A;  4KZ8 A;  2WAD A;  1SHV A;  3UNW A;  4EUZ A;  5DF8 A;  3T1Q B;  3IXG A;  4JPM A;  1Y28 A;  3TSG A;  3PBT A;  2Q0O A;  4H8R A;  4DE0 A;  3S22 A;  4N9L A;  4ZBE A;  4RX2 A;  2O9B A;  3R7W A;  3MQQ A;  4WN5 A;  3ZCZ A;  3FC7 A;  1XA7 A;  3MF0 A;  2QWS A;  2JCH A;  1N9L A;  1DP6 A;  1AWI A;  3CAX A;  3O5Y A;  3UE0 A;  2W3D A;  1KE0 A;  1H3Q A;  1MXO A;  1TS7 A;  3OCL A;  2Y2M A;  3EOI A;  3UE3 A;  1Q2P A;  4KQO A;  1PI4 A;  2Y4A A;  4NXB A;  4GHI B;  4KZ9 A;  3W8K A;  1S67 L;  3IBJ A;  4EEU A;  3HLW A;  4JGR A;  2KLI A;  3H82 A;  1CEF A;  2UWX A;  1JWZ A;  1KGG A;  2Q9N A;  1K4F A;  4OOL A;  3U4L P;  1FSY A;  2JHE A;  1BYW A;  4R70 A;  3JVV A;  4L9F A;  1PWG A;  2DCF A;  5C5K A;  4EBL A;  5HAP A;  4KZ7 A;  2WGV A;  3A3D A;  4BQM A;  2EX8 A;  4LFU A;  3QP5 A;  4BMW A;  2X02 A;  2FH5 A;  3F1O B;  1QME A;  1C3B A;  4Y3I A;  4UEY A;  3F1N A;  3NOT C;  2ZC4 B;  2J3T D;  5HW3 A;  3LYX A;  5F5Y A;  4FD8 A;  2HV1 A;  2VK3 A;  4ME4 A;  1P0Z A;  2PRF A;  2PD7 A;  4KZ4 A;  1YLY A;  3FKV A;  4E3L A;  5HX9 A;  3V5M A;  2XLN A;  3A0R A;  3P09 A;  1IYP A;  3FYZ A;  1MKI A;  1OPX A;  3BEC A;  4MEZ A;  2HZ5 A;  1W63 Q;  3OPH A;  3CPT B;  1DP8 A;  3VSK A;  4PM6 A;  3A3F A;  3G4P A;  2PHY A;  3OPL A;  4PHT A;  3IX3 A;  4OLD A;  3BRM A;  1CI9 A;  1BLC A;  1MY8 A;  4S2O A;  1ERQ A;  1MWS A;  2V9A A;  5E2E A;  2ZQD A;  5TFQ A;  3IWO A;  3LIF A;  4ETZ A;  1XFN A;  3Q7V B;  3MMH A;  3NDE A;  5HZH A;  1JWV A;  1FCN A;  1VHM A;  4N9K A;  4OQG A;  2A49 A;  3VP4 A;  2BTF P;  1K0K A;  2ZQ8 A;  4UA9 A;  4OKP A;  4Y15 A;  4CPK A;  2HJ9 C;  4R4S A;  5DKK A;  3HLE A;  4HIA A;  2B18 A;  1K57 A;  3IF6 A;  3G30 A;  2B02 A;  3ITB A;  4JF5 A;  1FSW A;  2W27 A;  1OT6 A;  4UA7 A;  2H0T A;  1PZP A;  2OOL A;  2OLU A;  3R7W B;  1CEG A;  4FTX A;  2R9X A;  2DRW A;  2Z6D A;  4WL9 A;  3PHY A;  4R4R A;  3C7U A;  5GHZ A;  1ESU A;  4E3I A;  3K3D A;  3AGF A;  4JGO A;  1G68 A;  1GSX A;  3IS2 A;  3IWI A;  3A0V A;  4EQI A;  1OJG A;  4MBH A;  2JKT M;  5LBR A;  4Y17 A;  2W3F A;  3ZG9 B;  5AQ7 A;  2EX6 A;  3H82 B;  4KG5 A;  3ICY A;  4PM9 A;  5CGX A;  4PM7 A;  2QJ5 A;  4BD0 A;  2A3U A;  4BJP A;  2P04 A;  3Q1F A;  4R0Q A;  2EA9 A;  3KYZ A;  5GHX A;  3BJN A;  1VQQ A;  1YPR A;  1G28 A;  4B88 A;  3IH9 A;  4GB7 A;  1LHY A;  4NG2 A;  5TBM A;  3S1Y A;  2ZC5 B;  4IUH A;  4WEL A;  3F1N B;  5DTK A;  5E2G A;  4ZRR A;  1HZO A;  4P85 A;  3GR2 A;  2Z2L B;  3T4T A;  3RH8 B;  5KZH A;  3D4F A;  4Q0J A;  4WUJ A;  4BEN A;  1NYM A;  2XH9 A;  3LR4 A;  3MXQ A;  4EUV A;  2PBD P;  1ES2 A;  5K5B A;  1H5X A;  1BLP A;  4FCF A;  2G2U A;  1GA0 A;  1Y4O A;  4R3B A;  3NI9 A;  3GV9 A;  2PAV P;  1HTZ A;  3VMA A;  1SDN A;  3S7P A;  1MPL A;  4ARZ A;  4QHC A;  2RL3 A;  5IU1 A;  4OON A;  2V1Z A;  2HP5 A;  1Y54 A;  4U0X A;  5EFW A;  3T1S A;  3EEH A;  3I7J A;  2J80 A;  1PNE A;  4GDN A;  5FQI A;  2OLV A;  3HCY A;  5AVF A;  4GZB A;  4BL3 A;  2X71 A;  3C4O A;  3LI9 A;  5HDS A;  2XA7 S;  3PAG A;  4WZ5 A;  2OAP 1;  5DJU A;  1JTD A;  1BLS A;  2ZQA A;  4IBR A;  3IF6 B;  1OTE A;  3Q7Z A;  1ALQ A;  5FDS A;  3Q81 A;  4HBT A;  3IHB A;  2VEA A;  5DTT A;  1BUE A;  3T4Q A;  1FIL A;  1HLU P;  4ZJ1 A;  4RX3 A;  1XP4 A;  1SKF A;  4Y2F A;  5TJJ A;  2Y2O A;  1YAX A;  5HWT A;  5F82 A;  4LV3 A;  1BUL A;  3UE1 A;  1UGU A;  5CEB A;  4HJ6 A;  5HPI A;  2AVX A;  2WKH A;  3MQ0 A;  2JKG A;  3IS2 B;  2M7V A;  1E25 A;  5DF7 A;  2J3W A;  3RXX A;  3VFF A;  3HUN A;  1UWN X;  4JKT A;  1M6K A;  3IX4 A;  4OP8 A;  4KZB A;  1XFQ A;  1EW0 A;  1ZG6 A;  1NJ4 A;  1BZA A;  3QNB A;  3LO7 A;  4X1L A;  4C6Y A;  4WYY A;  4DXC A;  3SS5 A;  1W5D A;  3T4J A;  1VET A;  1W7F A;  1MC0 A;  4BL2 A;  2BLS A;  2ZMV A;  1AXB A;  4RYE A;  4OPY A;  2MJ6 A;  4G3V A;  5TBM B;  1I2W A;  4DJ2 A;  3PBN A;  2V20 A;  4DDS A;  4FH2 A;  4RA7 A;  1L0G A;  5F68 A;  2Y55 A;  3LFV A;  4CJN A;  3CJM A;  4DDY A;  1TS8 A;  4D2O A;  3VFH A;  3CZD A;  1NLZ A;  1PI5 A;  3G34 A;  1S1Z A;  2J8Y A;  2XRO A;  3IXD A;  3ISG A;  1PZO A;  1L2S A;  3BYD A;  4JXS A;  3HUM A;  1L0E A;  3TOI A;  1ONH A;  3LIA A;  3UB6 A;  4FOF A;  4YWZ A;  1GHI A;  2ZC7 A;  3UDI A;  4KEN B;  1IKG A;  2L4R A;  4GD6 A;  3IX8 A;  2PU4 A;  3PR6 A;  1KE3 A;  1TD5 A;  4EQ1 A;  1WE4 A;  4R1G A;  3T50 A;  5HSQ A;  3OCN A;  3HL9 A;  4WEJ A;  5DF9 A;  2Y2N A;  4WBG A;  4HP4 A;  1OJ5 A;  2XRN A;  1E3U D;  4GNU A;  5A92 A;  3UPO A;  4GN2 A;  5GL9 A;  3QP6 A;  5L8M A;  2X01 A;  4LPZ A;  3ULF A;  5TGF A;  3BM6 A;  3S7Q A;  3BFD A;  1D1J A;  4EER A;  3L7H A;  1NYY A;  4LV1 A;  3UDX A;  4DE1 A;  4KUK A;  4Y13 A;  2HPB A;  3PYP A;  3ZG0 A;  2CMN A;  4GLQ A;  4OOM A;  3CUE A;  2WGW A;  1S6R A;  2PT7 A;  3H7W A;  3UMD A;  3PAE A;  2IWB A;  3PBR A;  1KDW A;  3GSG A;  4BBT A;  4E3K A;  5I94 A;  2XFS A;  5GLB A;  1MWU A;  3W4Q A;  1E3U A;  4XT2 A;  5A90 A;  2W3E A;  4S2P A;  3EQU A;  1P9R A;  4P6Z M;  4KQR A;  4K0W A;  1T1C A;  4N92 A;  5L10 A;  3G2Y A;  4HH2 A;  1MWT A;  4ESP A;  5HDD A;  4P6Z S;  4HNB A;  1MBL A;  4S2I A;  2VGL S;  2XD1 A;  2B5R A;  5F1F A;  3C8C A;  2HJE A;  4DXB A;  2E8J A;  2GNX A;  4S2N C;  1VET B;  1FCM A;  3DWZ A;  1H8Y A;  4JXW A;  2HGV A;  1J3W A;  4GOG A;  4M3K A;  3NUL A;  1HD8 A;  3UB7 A;  2P74 A;  4PMA A; 
#chains in the Genus database with same CATH homology
 5EVI B;  4E6X A;  3PBO A;  3MXS A;  2EFU A;  1CI9 A;  4WM9 A;  1BLC A;  1DY6 A;  1MY8 A;  4S2O A;  1ERQ A;  2GDN A;  3CMZ A;  1NXY A;  3OPP A;  1MWS A;  2ZM0 A;  4PPR A;  1K25 A;  1GHP A;  4S2L A;  4GD8 A;  5EPH A;  3MFD A;  5E2E A;  1TDL A;  2HP6 A;  3E2K A;  4WMC A;  1W8Q A;  2ZQD A;  5TFQ A;  4EBP A;  5U47 A;  3IWO A;  1NZU A;  2XEP A;  4HEF A;  5CTN A;  3Q7V B;  5CGW A;  4P0M A;  3M2K A;  2HDR A;  3IXH A;  1RP5 A;  3NDE A;  4LV2 A;  1JWV A;  1FCN A;  3N4I A;  4N9K A;  3ZG5 A;  4OQG A;  1ERM A;  2ZLY A;  2A49 A;  3VP4 A;  2ZQC A;  2XD5 A;  4GDB A;  2ZQ8 A;  4UA9 A;  5EUA A;  1LI0 A;  4KZA A;  4OKP A;  3N8S A;  4CPK A;  5FQQ A;  1EI5 A;  1L0F A;  3NY4 A;  3HLE A;  4R4S A;  4E6W A;  1Z6F A;  3WS5 A;  1YMS A;  3IF6 A;  1K57 A;  3MZF A;  3G30 A;  3V50 A;  1XGI A;  3GRJ A;  3HLG A;  5CGS A;  1YLW A;  1TEM A;  1PWC A;  3SH9 A;  1K54 C;  3ITB A;  4JF5 A;  5AQB A;  2XGN A;  1YT4 A;  3C7V A;  3VSL A;  2ZQ9 A;  1FSW A;  1GCE A;  2C6W B;  4DKI A;  2XF3 A;  2Y2J A;  2EX9 A;  4JF4 A;  4UA7 A;  2H0T A;  1PZP A;  3ITA A;  2FFF B;  1LL5 A;  2OLU A;  1CEG A;  2R9X A;  3O3V A;  4NK3 A;  4MBK A;  1DJA A;  4U0T A;  3DTM A;  5DTS A;  3M6H A;  2DRW A;  4FH4 A;  4JBF A;  2Q9M A;  1YLZ A;  1XPB A;  2Z2M B;  3C7U A;  3CG5 A;  4R4R A;  5GHZ A;  2JC7 A;  2ZMA A;  1ESU A;  4X68 A;  4MBF A;  3WS2 A;  1O07 A;  4E3I A;  1IKI A;  3E2L A;  3Q82 A;  5FQ9 A;  3AGF A;  5BOH A;  3N7W A;  1G68 A;  3IWI A;  2J9P A;  4OPZ A;  5EVI C;  3ZDJ A;  1JWP A;  3M6B A;  2V2F F;  1HVB A;  1K55 A;  4UA6 A;  2Y2G A;  3LY3 A;  3WRZ A;  5EOO A;  4EQI A;  2ZC6 B;  4IVK A;  5FAS A;  2G2W A;  3UDF A;  4DE2 A;  4MBH A;  4YIN A;  2WGW B;  1YM1 A;  3ZG9 B;  1YLT A;  5AQ7 A;  4S2M A;  2EX6 A;  3IWQ A;  4KG5 A;  4PM9 A;  4PM7 A;  5CGX A;  4DF6 A;  4E3M A;  1KVL A;  4BD0 A;  5JYP A;  4EWF A;  2Y2I A;  1ONG A;  2A3U A;  3RJU A;  4BJP A;  3Q1F A;  2HDQ A;  4R0Q A;  1M40 A;  5GHX A;  4KZ6 A;  2XK1 A;  4WEK A;  5E2H A;  3SH8 A;  1VQQ A;  4RVA A;  1FCO A;  5M19 A;  1KGF A;  2WKI A;  3ZFZ A;  1DJB A;  4B88 A;  1KE4 A;  3IH9 A;  4GB7 A;  4S2K A;  2WGI A;  3LY4 A;  4ZJ2 A;  1XGJ A;  1LHY A;  2ZD8 A;  4Y0U A;  4NET A;  2XFT A;  3GTC A;  3G32 A;  3S1Y A;  3O87 A;  2WAE A;  2ZC5 B;  4KG6 A;  4WEL A;  1EWZ A;  5DTK A;  5E2G A;  1HZO A;  2BG1 A;  2HDS A;  3MZD A;  4KQQ A;  4P85 A;  3GR2 A;  4QB8 A;  1U60 A;  4OOY A;  3RXW A;  3WS4 A;  2Z2L B;  4KZ3 A;  1WYC A;  4R23 A;  4Y7P A;  5KZH A;  1RGZ A;  3D4F A;  2QPN A;  2ZM2 A;  4BEN A;  1NYM A;  2XH9 A;  3AGD A;  4ZJ3 A;  3PBS A;  1ESI A;  1I5Q A;  1PWD A;  3SH7 A;  5EOE A;  2EXB A;  3WS1 A;  1ES2 A;  3S4X A;  5FI6 A;  4Z9Q A;  1H5X A;  1BLP A;  2WKE A;  3FZC A;  4L0L A;  5GLA A;  3HLD A;  3N6I A;  5KSC A;  4R3J A;  4ZDX A;  1XXM A;  1NY0 A;  4FCF A;  2G2U A;  5CHJ A;  1PYY A;  1GA0 A;  3VOZ A;  3IXB A;  4R3B A;  3NI9 A;  2JBF A;  3GV9 A;  2QZ6 A;  2QMI A;  1HTZ A;  3OC2 A;  5GLC A;  5CER A;  3VMA A;  3ZG7 B;  4BD1 A;  1SDN A;  1MPL A;  4OH0 A;  2J7V A;  4QHC A;  2RL3 A;  5FAP A;  4DE3 A;  3UY6 A;  4PM5 A;  3IT9 A;  2VGJ A;  4OP5 A;  5CEC A;  4OON A;  2DNS A;  2V1Z A;  2Y2P A;  4K91 A;  3AGE A;  3VOY A;  3N8R A;  1NZO A;  1IYS A;  2HP5 A;  1Y54 A;  2PU2 A;  4K0X A;  4U0X A;  4BLM A;  1LI9 A;  2XQZ A;  3I7J A;  2VGK A;  1QMF A;  3B3X A;  1CK3 A;  4JXV A;  2H0Y A;  5AQA A;  1CI8 A;  3NCK A;  5A93 A;  4GDN A;  1ERO A;  1OME A;  5FQI A;  1IYQ A;  3HLF A;  4UAA A;  2OLV A;  4S2J A;  2JE5 A;  3BLS A;  3P98 A;  1FR1 A;  4X6T A;  4C75 A;  4P6B A;  2C5W B;  4GZB A;  4BL3 A;  3C5A A;  4QJG A;  5FAO A;  5FI7 A;  2X71 A;  3C4O A;  1O7E A;  1Q2Q A;  1FR6 A;  3M2J A;  3PAG A;  4WZ5 A;  1LLB A;  5FSR A;  2RCX A;  1JTD A;  4S2N A;  1BLS A;  1ZG4 A;  2Y2K A;  5GHY A;  2ZQA A;  3G31 A;  3MZE A;  3EQV A;  5FA7 A;  4P87 A;  1N4O A;  4IBR A;  3IF6 B;  3Q7Z A;  1K6R A;  1TDG A;  5FDH A;  1ALQ A;  4QY5 A;  2IWB A;  1IEL A;  3MBZ A;  2PBY A;  5FQM A;  4Q8I A;  5E2F A;  3Q81 A;  2XR0 A;  4N1X A;  2P9V A;  4HBT A;  3IHB A;  5DTT A;  1ES3 A;  3A3E A;  1BUE A;  1KDS A;  4DRT A;  4ZJ1 A;  2OSU A;  4RX3 A;  5A91 A;  1XP4 A;  4QY6 A;  3OZH A;  1SKF A;  1JTG A;  3ZHH A;  1N9B A;  3MKF A;  4B4Z A;  2Y2O A;  1BLH A;  5FAT A;  5F82 A;  1L0D A;  4LV3 A;  5HAQ A;  4XXR A;  4HES A;  4E3N A;  4ID4 A;  1BUL A;  3UE1 A;  1I2S A;  1IEM A;  5M1A A;  5CEB A;  4LEN A;  4OVD A;  1YLP A;  1BT5 A;  3C4P A;  1DJC A;  4UHU A;  3UO9 A;  2IWD A;  2WKH A;  5CTM A;  1E25 A;  5DF7 A;  1ES4 A;  3ZVW A;  3RXX A;  3PBQ A;  2EXA A;  2HDU A;  2EX2 A;  4OPR A;  3VFF A;  3HUN A;  3WWX A;  1K4E A;  3ZNY A;  5CED A;  3ZG8 B;  3FV7 A;  5EVI D;  3ZGA B;  1VM1 A;  2R9W A;  4EBN A;  4GKU A;  4JKT A;  1M6K A;  1K54 A;  1SCW A;  2FFY A;  2WZX A;  1YQS A;  4KZB A;  4OP8 A;  4QU3 A;  5TR7 A;  5CXW A;  2Y2Q A;  3GVB A;  1ZG6 A;  1NJ4 A;  1BZA A;  4O7D A;  3QNB A;  3ZNT A;  3LO7 A;  4ZTK A;  3NIA A;  5L2F A;  4C6Y A;  3BFE A;  4WYY A;  5FQJ A;  4DXC A;  1KVM A;  3SS5 A;  4N1H A;  1W5D A;  3DWK A;  1E4D A;  3HVF A;  1W7F A;  4BL2 A;  2BLS A;  2H5S A;  1NRF A;  4X69 A;  1MWR A;  5JYO A;  1YMX A;  3JYI A;  3UPP A;  5KSH A;  1ZC2 A;  3IF5 A;  1AXB A;  3IF6 C;  1K57 C;  4RYE A;  3HRE A;  4EV4 A;  4OPY A;  3V3R A;  3G2Z A;  1I2W A;  3UPN A;  4B4X A;  1XKZ A;  4E3O A;  4YFM A;  3BFC A;  3PBN A;  2V20 A;  5EEC A;  4ZAM A;  4DDS A;  5HL1 A;  4FH2 A;  5EVI A;  5AQ9 A;  2XDM A;  4RA7 A;  1L0G A;  2WYX A;  1PW8 A;  2E8I A;  3PTE A;  2Y55 A;  3BFF A;  4IVI A;  3BLM A;  4CJN A;  5F1G A;  2WK0 A;  4C3Q A;  3CJM A;  3NC8 A;  4Y0O A;  5CRF A;  4DDY A;  4KG2 A;  1BTL A;  4HBU A;  5J8X A;  1GA9 A;  3QNC A;  5FQK A;  4D2O A;  3VFH A;  3BFG A;  1IYO A;  2ZQ7 A;  3CZD A;  4X53 A;  4QD4 A;  1PI5 A;  1WYB A;  3Q7V A;  2I72 A;  3HBR A;  3G34 A;  3VP1 A;  3BEB A;  3SS4 A;  3HLC A;  3WRT A;  1RGY A;  2OV5 A;  2J8Y A;  4OQ0 A;  2CC1 A;  3IXD A;  3ISG A;  1PZO A;  4KZ5 A;  1W8Y A;  2ZC3 B;  1L2S A;  3BYD A;  2ZM8 A;  4JXS A;  1K55 C;  3HUM A;  2WAD A;  4KZ8 A;  1SHV A;  3UNW A;  1L0E A;  3TOI A;  4EUZ A;  5DF8 A;  3IXG A;  4JPM A;  5E43 A;  1ONH A;  3TSG A;  1RCJ A;  3Q07 A;  3PBT A;  4H8R A;  1GHI A;  1K56 D;  2ZC7 A;  3UDI A;  4KEN B;  1IKG A;  5M18 A;  2WUQ A;  4GD6 A;  4DE0 A;  2PU4 A;  3S22 A;  4N9L A;  5D3O A;  1J9M A;  3GMW A;  4ZBE A;  1KE3 A;  4RX2 A;  3NDG A;  1WE4 A;  4LV0 A;  4R1G A;  1SDE A;  3ZCZ A;  3W4O A;  2Y91 A;  3OCN A;  3HLB A;  3HL9 A;  4WEJ A;  5DF9 A;  1XA7 A;  2Y2N A;  4WBG A;  3NBL A;  5A92 A;  1E3U D;  4GNU A;  2Y59 A;  2JCH A;  4GN2 A;  5GL9 A;  3UPO A;  2X01 A;  5KMW A;  4MNR A;  3UE0 A;  5CHM A;  1KE0 A;  5TGF A;  3BM6 A;  1JVJ A;  3BFD A;  4LCM A;  1MXO A;  4X56 A;  1NYY A;  3OCL A;  4LV1 A;  2Y2M A;  3FKW A;  3UDX A;  5F83 A;  4DE1 A;  3UE3 A;  1Q2P A;  4XUZ A;  1PW1 A;  3ZVT A;  3G35 A;  4KQO A;  1K56 A;  1PI4 A;  2HPB A;  3ZG0 A;  4F94 A;  4E3J A;  1LL9 A;  2Y4A A;  1XX2 A;  4XUX A;  4OOM A;  4KZ9 A;  4LCL A;  3W8K A;  3HUO A;  2P9V B;  3DW0 A;  2WGW A;  3IQA A;  3HLW A;  5DVA A;  1FOF A;  5EE8 A;  1S6R A;  1CEF A;  3FWL A;  5HFO A;  2UWX A;  3IHA A;  1JWZ A;  1KGG A;  2Q9N A;  1K4F A;  1W79 A;  3PAE A;  4OQH A;  4OOL A;  3PBR A;  4U3T A;  3LEZ A;  1KDW A;  1FSY A;  3GSG A;  3GQZ A;  3IH8 A;  4FSF A;  1TVF A;  5IHV A;  1KGE A;  2XFS A;  5GLB A;  4E3K A;  5I94 A;  1MWU A;  3W4Q A;  1E3U A;  3N8L A;  5A90 A;  2WZZ A;  4S2P A;  3UN7 A;  1PWG A;  2DCF A;  5EVL A;  3EQU A;  3MXR A;  4KQR A;  4WZ4 A;  5GLD A;  4EBL A;  2WAF A;  4K0W A;  5HAP A;  4KZ7 A;  4X55 A;  2WGV A;  3A3D A;  4BQM A;  2EX8 A;  4N92 A;  3G2Y A;  1ZKJ A;  5HAR A;  4JF6 A;  1K6S A;  1MWT A;  2X02 A;  3O88 A;  3VP0 A;  1G6A A;  1QME A;  1FQG A;  1BSG A;  1C3B A;  2Y2L A;  3OPR A;  2ZC4 B;  5HW3 A;  4IED A;  3A3J A;  5HAI A;  4FD8 A;  1YLJ A;  4OLG A;  3LCE A;  1S0W A;  2EFX A;  1MBL A;  3O86 A;  1PIO A;  1YLY A;  2IWC A;  4KZ4 A;  4S2I A;  1K38 A;  3FKV A;  3V3S A;  3V39 A;  3QHY A;  4E3L A;  4WMC D;  5FI2 A;  3SOI A;  5HX9 A;  3VP2 A;  2XD1 A;  1H8Z A;  3W4P A;  2B5R A;  5F1F A;  4Y0T A;  3V5M A;  2XLN A;  3MKE A;  3TG9 A;  1ES5 A;  3P09 A;  1IYP A;  3FYZ A;  1MKI A;  4DXB A;  4PM8 A;  4WZ5 C;  2H10 A;  4S2N C;  3BEC A;  4MEZ A;  2J9O A;  2Y2H A;  4JLF A;  3A3I A;  1FCM A;  3DWZ A;  1XA1 A;  3OPH A;  1H8Y A;  4JXW A;  4MLL A;  4OPQ A;  2ZJ9 A;  1GHM A;  4GOG A;  2HP9 A;  4M3K A;  3VSK A;  4OQI A;  4PM6 A;  3A3F A;  4JXG A;  5G18 A;  4IBX A;  3G4P A;  3SS3 A;  3VP3 A;  1HD8 A;  3WS0 A;  3OPL A;  4OLD A;  5FAQ A;  4A5R A;  5CHU A;  3BRM A;  2P74 A;  4PMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...