4LV3A

Ampc beta-lactamase in complex with (3,5-di-tert-butylphenyl) boronic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Covalent docking of large libraries for the discovery of chemical probes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 112
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4lv3A00
1Y54A 2Y2QA 4ZJ1A 1DJBA 3I7JA 3ITBA 1PW8A 4X56A 3N7WA 1H5XA 4K0XA 4DDYA 4BD0A 4FD8A 5GHXA 4IVIA 4WELA 4IBXA 3IWIA 3BECA 2ZC7A 3M2KA 3PBOA 5EPHA 2FFFB 4GZBA 4HESA 1NZOA 4OOMA 4WEJA 2Y4AA 4R23A 5GHZA 1K4EA 1NJ4A 3SH8A 4BLMA 5KSCA 4EBNA 5CEBA 2WADA 3W4QA 2ZQCA 3UY6A 4LV3A 1OMEA 3O86A 2HP5A 3GTCA 1TVFA 3LY4A 2X02A 3IF6B 4UA9A 1RCJA 5FQIA 4DE0A 2J9OA 3IXHA 4B4ZA 2Y59A 3ITAA 4Z9QA 2XQZA 3N8SA 5CGSA 4P85A 4R3BA 3ZG8B 1W8YA 1YLWA 1FCMA 2WAFA 3AGDA 2Y2HA 4Q8IA 3GVBA 5FQQA 4R1GA 3S22A 4DE1A 4UAAA 5JYPA 1ES4A 2BG1A 5FAQA 1FSYA 3OPHA 1MWRA 2XD1A 3Q82A 3S4XA 4PM5A 5CHMA 5GLAA 1YLPA 5FQ9A 1BSGA 3LO7A 2A49A 4FCFA 4YINA 4P6BA 1ES3A 1H8ZA 1GHPA 1FR1A 2Y2KA 3HUOA 1W8QA 3IHAA 3E2KA 5E2FA 1O7EA 1PIOA 4EWFA 2WK0A 5E43A 3RXXA 4DRTA 1FSWA 4ZAMA 2XGNA 5CEDA 4S2KA 2ZJ9A 1WE4A 5IHVA 1LI9A 3VFFA 3ZHHA 1I2WA 3JYIA 1W5DA 3SS5A 2PBYA 2VGKA 5EOEA 1MY8A 4IVKA 2I72A 3A3IA 1HZOA 4BENA 2EX9A 5CXWA 1IKIA 3WS5A 5CHUA 3ZFZA 1XP4A 4NETA 4Y7PA 3BYDA 2E8IA 3WS4A 3IH8A 4S2OA 3Q7VB 3NBLA 3N8RA 3BFFA 4OKPA 3UO9A 1ESUA 3SH9A 5CECA 1I2SA 3HVFA 5A90A 1LL9A 4PPRA 5AQ7A 2XEPA 2DCFA 2WGWB 2Y2NA 1ERMA 2RCXA 4D2OA 1M6KA 3DW0A 3N6IA 3P09A 5KMWA 1GA0A 5FDHA 4OH0A 3UPNA 3GMWA 2XLNA 1L2SA 3UDFA 5A93A 5A91A 4KZAA 1K25A 4OQ0A 2Y2JA 3LEZA 5E2HA 4OLDA 2P9VA 3B3XA 5CHJA 4JXSA 2WGIA 2J7VA 3G4PA 1SKFA 4OPZA 4KQRA 4S2MA 2V20A 3HLDA 2QMIA 4RVAA 1K6RA 3GR2A 3VP2A 5BOHA 4KG6A 5HFOA 2OLVA 1CK3A 3N8LA 5FAPA 4BL2A 4GD8A 3NIAA 4OOYA 3WRTA 4CJNA 2PU4A 3BLSA 3CG5A 3CJMA 3DTMA 5CTMA 1KGGA 2ZQAA 1EI5A 1BULA 3BFEA 4MBHA 4S2JA 5DF8A 1L0FA 3C5AA 1NYYA 4JXWA 3ZVTA 4RA7A 5E2GA 2RL3A 1CEGA 1PI5A 4EQIA 2EFUA 5G18A 1XGIA 1NY0A 1L0GA 3PBQA 3VP1A 4DKIA 2ZM0A 4C75A 1PWCA 1K6SA 2WGVA 4X6TA 2HDQA 1GCEA 3V5MA 3C7UA 3M6HA 3UE1A 3OPRA 1PZOA 5FAOA 4XUXA 5D3OA 2HDUA 5EVIC 2XR0A 3MKEA 2Y2IA 4GB7A 2ZC5B 4WMCA 2Z2MB 4WYYA 2C6WB 4JKTA 3PAEA 4KZ4A 3IT9A 1XX2A 3A3FA 4E3LA 1RGYA 3IH9A 5EVLA 1YQSA 4OP5A 5EE8A 1Q2PA 2IWDA 3VOZA 3ZVWA 3IXBA 5EVIA 1MPLA 4OLGA 2QZ6A 3MBZA 1QMFA 1DJCA 4WM9A 3UDXA 1ALQA 4JXVA 4QY5A 3C4PA 1JTGA 1NRFA 4R3JA 3G31A 1CEFA 2HP9A 2ZM2A 2ZQDA 2XF3A 1DJAA 1NXYA 4E6WA 3ZNTA 3PBNA 4MNRA 3MZDA 4R4RA 4UA6A 2ZLYA 3FKWA 3HREA 1E4DA 1MBLA 2H10A 3BFCA 2EXBA 3VFHA 5M18A 3ZCZA 4IEDA 4JXGA 1JWZA 1ZKJA 1K38A 5CTNA 1GHIA 1L0EA 4EBLA 2B5RA 4IBRA 2Z2LB 4PM8A 5GHYA 3RJUA 3VMAA 4E3OA 2Q9MA 1MKIA 4GD6A 5HAPA 3FYZA 1KDSA 4OP8A 1BUEA 1XA7A 3VP4A 1FCNA 1XKZA 1JWVA 3HLEA 4O7DA 1YMSA 4LCLA 3SH7A 1JTDA 3GSGA 2ZM8A 4WMCD 4KQQA 3V3RA 3ZG7B 5JYOA 3M6BA 1LI0A 4S2IA 5HAIA 3BEBA 1N4OA 3MXRA 5GLBA 2HP6A 3M2JA 4P0MA 5A92A 4WZ4A 2WUQA 5U47A 4KZ7A 5CGXA 1RGZA 1TDLA 3IWQA 5HAQA 4RX3A 4JF5A 3WS0A 2R9WA 4ZDXA 2EX6A 4Y0OA 3HUNA 2P9VB 4E6XA 5GL9A 2A3UA 1IYPA 1ES5A 5EVID 2ZC4B 1AXBA 2Y2PA 5GLCA 2XH9A 4E3NA 4EV4A 2G2UA 4NK3A 3NY4A 2CC1A 2EX2A 2ZC3B 3V39A 2Y91A 2JBFA 3W4OA 3G34A 1EROA 3OPLA 3NC8A 3FWLA 3QHYA 2HDRA 2OLUA 4U3TA 4KZ9A 1IYOA 3UN7A 4B4XA 4N9LA 4S2LA 5FASA 4K91A 3DWKA 1BLSA 4LV1A 1JVJA 2GDNA 4RX2A 4DF6A 1S0WA 3FZCA 1KDWA 1PWGA 1I5QA 4N92A 3BM6A 1MWUA 3VSLA 4LCMA 2Y2GA 3C7VA 2EX8A 4OPRA 2ZD8A 2J9PA 3HLGA 4OQGA 4PM6A 5TGFA 1PYYA 3VSKA 5KZHA 2UWXA 4E3JA 1N9BA 4LV0A 2PU2A 1YMXA 4QU3A 1PWDA 4C6YA 4UA7A 3E2LA 4KZ5A 2BLSA 4HEFA 1EWZA 4MEZA 4OPQA 3OCNA 3WS1A 3AGEA 2ZQ7A 4WZ5A 4OQIA 4LENA 1ZG4A 5FI2A 3UE0A 1YM1A 2H5SA 3UPOA 3PBSA 4BQMA 4N1XA 3HL9A 1HD8A 5DF9A 4JBFA 5EVIB 2EFXA 3D4FA 3SOIA 3SS3A 3CMZA 4ID4A 3GRJA 4H8RA 1S6RA 2H0YA 2XFTA 1JWPA 1FQGA 3WS2A 3WRZA 3ZG0A 3IXGA 2DNSA 4U0XA 4JF4A 4GOGA 4EBPA 1YLJA 1ESIA 1KVMA 3PBRA 5F1GA 2ZC6B 4PM7A 4QY6A 3OPPA 3OC2A 4MBFA 3A3DA 1XGJA 1K54C 1U60A 4BJPA 1G6AA 5FQKA 2HDSA 3IF5A 3W4PA 4GKUA 1ES2A 4HBUA 2R9XA 1BZAA 2ZMAA 4FSFA 1LHYA 4OQHA 3UE3A 3WWXA 4Y0TA 1KGFA 1CI8A 1K4FA 4E3IA 2XK1A 2Y2MA 5HL1A 3UDIA 1ERQA 3BFGA 3N4IA 4YFMA 2X01A 3VP0A 3PAGA 3NDGA 3Q1FA 4JF6A 3W8KA 4MLLA 2JC7A 1K54A 1YLTA 4OONA 5DVAA 2WKHA 1MWTA 3HUMA 5AQBA 3GV9A 3ZNYA 5CERA 2IWCA 2Y55A 3VP3A 3PTEA 1IELA 4LV2A 3MFDA 2WZZA 4GDNA 1K57C 4X68A 3TG9A 3HLCA 3Q81A 4QHCA 4MBKA 4OOLA 2WAEA 3DWZA 4DE2A 1KVLA 1QMEA 3UNWA 1FOFA 2C5WB 4C3QA 4KZBA 1RP5A 2FFYA 5M19A 2X71A 2ZQ8A 4PM9A 4WEKA 4ZJ3A 3ZG9B 4GDBA 3NCKA 2XFSA 1FR6A 3MXSA 3HLFA 3NDEA 1K57A 2Y2OA 3FKVA 1BTLA 1GA9A 4ZJ2A 3IXDA 2V1ZA 3G32A 4WBGA 3CZDA 3FV7A 4OPYA 1L0DA 1KE4A 5DF7A 1SDNA 1YT4A 2OSUA 1KE0A 1DY6A 1HVBA 3O88A 4QB8A 1MXOA 4ZTKA 3PBTA 3O87A 2Q9NA 3EQUA 2WZXA 5F83A 3OCLA 5TFQA 1WYCA 3ZG5A 4R4SA 4DE3A 1BLHA 1PI4A 4X53A 1K55C 1C3BA 1TDGA 4S2NC 5DTSA 5HW3A 3IF6C 1IKGA 1GHMA 1W79A 3ZGAB 5EOOA 1NZUA 4DXBA 5KSHA 4E3MA 1ONHA 1ZG6A 1YLYA 4FH2A 5AQ9A 4B88A 2XDMA 5HX9A 3A3EA 1KE3A 1M40A 3C4OA 2WYXA 2IWBA 4X69A 3BLMA 1IYSA 4QD4A 4BL3A 4KG2A 3Q07A 3A3JA 3ZDJA 5FI7A 5FQJA 1BLCA 2DRWA 4GNUA 4K0WA 5FI6A 4CPKA 4FH4A 1K55A 4S2NA 5F1FA 1HTZA 1XA1A 5DTTA 3IF6A 3ISGA 4L0LA 4DDSA 1PW1A 5AQAA 4QJGA 3V3SA 5CGWA 5F82A 1SCWA 3IHBA 4WZ5C 1ZC2A 3NI9A 1LL5A 5CRFA 1SDEA 2Y2LA 3TSGA 5EUAA 1VQQA 3BFDA 3SS4A 3G2YA 1CI9A 1XPBA 2WKIA 2WKEA 4F94A 3MZEA 3UPPA 4A5RA 3VOYA 4DXCA 5M1AA 3OZHA 3Q7ZA 1PZPA 4ZBEA 4PMAA 1E25A 1H8YA 1K56A 2HPBA 4GN2A 3S1YA 5L2FA 1IYQA 1O07A 1E3UA 4BD1A 4Y0UA 3HBRA 5J8XA 1J9MA 2XD5A 4N9KA 1MWSA 2QPNA 3G35A 5FQMA 4OVDA 4KZ3A 3O3VA 3TOIA 1BT5A 1NYMA 2V2FF 4KQOA 4RYEA 3P98A 1VM1A 3V50A 1KGEA 2H0TA 3IWOA 1Z6FA 4P87A 5TR7A 2OV5A 4JPMA 3Q7VA 3G30A 2JCHA 1G68A 3GQZA 3HLBA 1BLPA 4JLFA 5HARA 4R0QA 4E3KA 3RXWA 4XUZA 2EXAA 5FSRA 3G2ZA 2J8YA 5FATA 3MZFA 3LY3A 4UHUA 5EECA 2VGJA 5FA7A 2WGWA 2ZQ9A 1ONGA 1SHVA 1XXMA 3QNCA 5E2EA 4XXRA 2JE5A 4KZ6A 4KZ8A 4N1HA 4S2PA 4HBTA 1Q2QA 1TEMA 3HLWA 1YLZA 1WYBA 4KG5A 1W7FA 4M3KA 3QNBA 4EUZA 1LLBA 3LCEA 4U0TA 3IQAA 3MKFA 5I94A 2P74A 5DTKA 1K56D 3EQVA 4X55A 3AGFA 4KENB 1E3UD 1IEMA 5GLDA 2G2WA 3BRMA 1FCOA
chains in the Genus database with same CATH superfamily
4ZJ1A 1DJBA 2ZC7A 3M2KA 5HDSA 5EPHA 4GZBA 4OOMA 5CX7A 1YPRA 1LSVA 2X02A 4NXGA 4UA9A 5FQIA 2J9OA 3N8SA 1OJGA 3IX8A 3MSHA 1VB6A 4P85A 4CLCD 4R3BA 1W8YA 2JKGA 2Y2HA 5AJGA 4Q8IA 3NJAA 2OAQ1 1H8MA 4DE1A 4UAAA 3E4OA 3TRCA 3OPHA 1MWRA 2XD1A 3Q82A 5GLAA 4UQIS 1YLPA 3BQ8A 3IHAA 4DRTA 3T4LA 1IFQA 2ZJ9A 1WE4A 3VFFA 3BW6A 3ZHHA 4GS9A 3SS5A 2PBYA 2VGKA 5F68A 1S4SA 3U4LP 1HZOA 5CHUA 3BYDA 2PHYA 5HSQA 4PKYG 3K3DA 3LICA 3N8RA 1W63Q 3T1SA 4EUVA 1LL9A 1S4RA 2DCFA 2PR5A 3F1OB 3DW0A 4LFUA 3P09A 4OH0A 3UPNA 3GMWA 5A91A 1XFQA 2ZMVA 2INWA 4JXSA 4OPZA 3G4PA 1SKFA 3UE6A 2MJ6A 4S2MA 4RVAA 1K6RA 5BOHA 2OLVA 2Q0OA 1VHMA 4EEPA 1PNEA 4CJNA 3DTMA 1EI5A 5MC7A 3KSIA 1CEGA 2EFUA 3PBQA 1K6SA 2VJWA 3C7UA 3M6HA 3UE1A 1PZOA 2HGVA 2HDUA 5EVIC 2XR0A 3MKEA 2PDRA 2Z2MB 4MN7A 3IH9A 1GSVA 1MPLA 3MBZA 4EW7A 4R3JA 3G31A 4GS9B 1NXYA 4UA6A 2ZLYA 3HREA 1MBLA 2EXBA 3ZCZA 4LRXC 4IEDA 1EW0A 1ZKJA 4PM8A 3UB6A 5GHYA 4KQDA 1MKIA 3LEQA 3VP4A 4I38A 3HLEA 4BBVA 2VGLM 4O01A 3B33A 3BQAA 4KQQA 4DJ2A 3M6BA 1LI0A 3QP2A 5HAIA 1N4OA 2HP6A 3M2JA 3WS0A 4JF5A 2PBDP 2R9WA 2EX6A 2ZOHA 4Y0OA 2XH9A 2EWVA 4E3NA 2G2UA 2CC1A 2Y91A 2JBFA 2R78A 3FWLA 3QHYA 4KZ9A 2JKTI 4PKYA 3DWKA 1JVJA 1V9ZA 3FZCA 4CQHA 1PWGA 2KDKA 3B42A 4N92A 3TW8A 1MWUA 2EX8A 3LUQA 4QU3A 4C6YA 4OPQA 5DFYA 1YAXA 2ZQ7A 3UE0A 3UPOA 4HOIA 3PBSA 3ULFA 1S1ZA 4N1XA 4JBFA 3D4FA 5F6AA 1S6RA 2P08A 1UWNX 1FQGA 3ZG0A 4JF4A 1YLJA 5DJUA 1ESIA 1KVMA 3PBRA 5F1GA 2ZC6B 3IBRA 4MBFA 1TD5A 1K54C 1U60A 1G6AA 3IF5A 4HY8A 1ES2A 4JGQA 2FH5A 4OQHA 4Y0TA 1K4FA 2XK1A 4NG2A 2O0YA 1ERQA 1F5MA 5EM1A 5DVAA 5AQBA 3VP3A 5HWWA 4AFIA 3PTEA 4LV2A 3MFDA 1NLYA 4GDNA 1K57C 4X68A 4X25A 3TG9A 3Q81A 4QHCA 3V67A 2WAEA 3EGDC 2X71A 4WEKA 4ZJ3A 4GDBA 4WL9A 2D01A 2KX6A 3E4PA 3FKVA 1GA9A 4WBGA 4OPYA 2PAVP 3O88A 4QB8A 1MXOA 2Q9NA 3EQUA 1OT9A 3DBAA 2V1AA 5TFQA 4R4SA 1C3BA 3LR3A 1IKGA 1NZUA 5AQ9A 1YLYA 4B88A 4QD4A 3KSHA 5FQJA 1BLCA 2E8JA 4K0WA 1N9NA 4M4XA 5DTTA 3IF6A 1PW1A 4QJGA 4NEED 3NI9A 1LL5A 5CRFA 1SDEA 1VQQA 3BFDA 2WKEA 4F94A 4LLOB 2M7VA 1OJ5A 3Q7ZA 4ZBEA 1E25A 1O07A 4BD1A 4GLQA 1MWSA 2QPNA 3O3VA 3FC7A 4KQOA 4RYEA 3P98A 3V50A 1KGEA 3UMEA 4CLCC 2OV5A 4QWOA 3MF0A 3G30A 2XROA 3HLBA 5FL3A 3T12B 4O0PA 4XUZA 1G5UA 4PAUA 2J8YA 2VGJA 5FA7A 3QNCA 1ONGA 1XXMA 5E2EA 2ACGA 1STZA 1OTDA 4N1HA 1YLZA 1ACFA 4M3KA 3DAVA 3LR5A 1LLBA 3LCEA 4U0TA 2P74A 2YKFA 5DTKA 4H6JA 4X55A 3AGFA 4KENB 1IEMA 2G2WA 1Y54A 2Y2QA 3LIAA 3NULA 1PW8A 2OWHA 3MQ0A 3R4KA 4K0XA 4DDYA 4EERA 4IVIA 4WELA 3BECA 1S66L 1S1YA 2FFFB 4L9FA 2KOIA 3ZG7B 4WEJA 3SH8A 4R23A 5GHZA 1K4EA 5KSCA 5CEBA 2WADA 3W4QA 2ZQCA 3UY6A 3QP4A 3LY4A 1TVFA 3IF6B 2ZMFA 4DE0A 2Y59A 3CWFA 4IJGA 5CGSA 3ZG8B 3S22A 2D02A 3S4XA 1FSYA 3S7NA 5CHMA 3LO7A 2A49A 2HJ9C 1H8ZA 1W8QA 1DRMA 3KO6A 1O7EA 1PIOA 2VGLS 5E43A 5CEDA 4ZAMA 4NXEA 3T1XA 1LI9A 2NUTC 4IVKA 3C2WA 3ZFZA 3A0SA 1XP4A 4NETA 3WS4A 2QYBA 3BFFA 3UO9A 5FEFA 4MN6A 1I2SA 4DMZA 5AQ7A 2Y2NA 2XA7S 3C8CA 1XFNA 4HJ4A 4HQAA 2J3WA 3BJNA 2XLNA 4H6JB 2XSSA 5E2HA 2P9VA 2QKPA 5CHJA 2BASA 5HFOA 1CK3A 3N8LA 5HL6A 4GD8A 3WRTA 2W27A 3CG5A 3CJMA 4QPRA 1KGGA 1MZUA 4P6ZM 1NYYA 2W3HA 3ZVTA 4EQIA 1F2KA 1NY0A 1PWCA 4HJ3A 4X6TA 2HDQA 4FOFA 3V5MA 4ESPA 4HP9A 2Y2IA 1WA9A 4WMCA 3QP1A 2KLIA 3PAEA 4Y15A 3IT9A 1UWPX 4E3LA 5EVLA 4E04A 1YQSA 4WF0A 5EE8A 1MKMA 1Q2PA 2IWDA 3VOZA 5EVIA 4WM9A 1ALQA 3C4PA 1JTGA 1NRFA 2PYRA 2HP9A 1DJAA 3IBJA 2PT7A 3ZNTA 4MNRA 1AWIA 4EU0A 1E4DA 2H10A 3CPTB 5CTNA 4FTXA 1TS7A 5IT5A 5HWVA 4MDZA 4GHIA 4OP8A 1FCNA 1JWVA 4XT2B 4LCLA 3PHYA 3SH7A 3GSGA 5JYOA 3KX0X 5GLBA 4G3KA 5A92A 2W0NA 4BBUA 2VZWA 5U47A 2PYPA 1RGZA 1TDLA 5HAQA 1D1JA 4RX3A 3HUNA 2P9VB 2A3UA 1ES5A 3BWLA 2A2LA 3D9YA 1TF1A 3EEHA 2ZC3B 3V39A 3OPLA 3NC8A 2HDRA 3R7WA 4YWZA 4UEYA 1IYOA 4EXOA 3UN7A 5FASA 4K91A 1Y4OA 1BLSA 2GDNA 1S0WA 2O9CA 1KDWA 2LB9A 2NUPC 3LIEA 1I5QA 4BBTA 4LCMA 3IX4A 3HLGA 4OQGA 3QP8A 1W63M 2W1RA 4E3JA 1N9BA 2PU2A 1YMXA 4UA7A 2BLSA 1EWZA 3OCNA 2B95A 4WZ5A 5EFWA 4LENA 3MXQA 5FI2A 1YM1A 1UGUA 3VE3A 3K3CA 1NWZA 3HL9A 2GX5A 5EVIB 2EFXA 2VV6A 3SOIA 1XJ3A 5L07A 3CMZA 3F1NA 4R38A 2QJ5A 3WS2A 3WRZA 4RQ9A 4GOGA 4EBPA 3G6OA 4PM7A 2K2NA 4QY6A 4Y5FA 4BJPA 2HDSA 2ZMAA 2CMNA 3WWXA 1CI8A 4GHIB 3BFGA 3N4IA 2X01A 3VP0A 1T18A 1P97A 1K54A 4OONA 5CERA 2IWCA 5IS1A 2Z6CA 4EEUA 1G6OA 4NKPA 4MBKA 2DMWA 4OOLA 3DWZA 1QMEA 1FOFA 2C5WB 2J80A 3E0YA 1RP5A 4K08A 5DFXA 3NCKA 2HZ5A 1T1BA 2HJEA 3NDEA 3R7WB 1K57A 4JGOA 1PFLA 1BTLA 4ZJ2A 5EV0A 2V1ZA 1H3QA 3CZDA 5G4YA 1L0DA 1KE4A 5DF7A 4EETB 3OLOA 1DY6A 3PBTA 3O87A 1WYCA 3UMDA 3ZG5A 2L1MA 4X53A 5DTSA 2JN7A 3LIDA 2PD7A 3ZGAB 4DXBA 2XDMA 3TJZC 4X69A 3BLMA 1IYSA 4KG2A 3A3JA 5FI7A 1L3LA 5F5YA 4FH4A 3MR0A 5F1FA 1XA1A 3HCYA 3ISGA 3F1NB 3V3SA 3IHBA 4WZ5C 1ZC2A 5EVEA 2Y2LA 5EUAA 4G3VA 2HV1A 1LSXA 3SS4A 1CI9A 3MZEA 3NHQA 4A5RA 3LGOA 1SZVA 5A8BA 4PMAA 2VV8A 1H8YA 5L2FA 3MQQA 1E3UA 5J8XA 1F98A 1G28A 5FQMA 4OVDA 1XJ4A 3TE8A 1IOUA 5AVFA 4II7A 3KSGA 4R70A 3JVVA 3MJQA 3RXWA 2EXAA 5FSRA 3G2ZA 4X1MA 3LY3A 4UHUA 4DN0A 4HP4A 4P6ZS 4CLCA 2JE5A 4KZ6A 4S2PA 4HBTA 1Q2QA 1TEMA 1WYBA 5J4EA 4CLCE 2WKPA 3QP6A 1DP9A 4Q0JA 1K56D 3EQVA 5F69A 4DDSA 3ITBA 4X56A 4Y3IA 3T4SA 3N7WA 1H5XA 4FD8A 4EESA 3OBFA 1TS0A 1NZOA 3LR4A 4BLMA 1NJ4A 4EBNA 1OMEA 2V0UA 2HP5A 3GTCA 2ZOIA 2XQZA 3W2ZA 1VETA 1P0ZA 2M1CA 2WAFA 3AGDA 5EM0A 5FQQA 4Q0HA 4HH2A 5JYPA 1CJFA 1ES4A 4PM5A 5FQ9A 1BSGA 4P6BA 1FR1A 2Y2KA 4R3AA 2WK0A 3RXXA 3RTYA 3FG8A 2XGNA 4S2KA 3LI9A 2ZL1A 5IHVA 3JYIA 1W5DA 4L9GA 2GJ3A 2I72A 2UV0E 1S67L 3E98A 2EX9A 3EGXC 5CXWA 1IKIA 3WS5A 4Y7PA 4Z1WA 3H7WA 2E8IA 3IH8A 1ESUA 3SH9A 5CECA 5A90A 2XEPA 4Y13A 1ERMA 2RCXA 4CLCB 1M6KA 1ZHHB 3N6IA 4YNRA 1DP8A 2VLGA 5KMWA 1GA0A 3EOIA 5FDHA 1Y28A 4KZAA 1K25A 4OQ0A 3NOTC 4LPZA 4KQRA 2V20A 3HLDA 2QMIA 3VP2A 4KG6A 2QJ7A 4DJ3A 3NIAA 2PU4A 3BLSA 5CTMA 2ZQAA 2PD8A 4S2JA 1L0FA 3C5AA 1DP6A 2AVXA 3L9KA 3T4KA 4RA7A 5E2GA 5G18A 5HDCA 1XGIA 1L0GA 4C75A 2WGVA 1VETB 3OPRA 5FAOA 4XUXA 5D3OA 4I3AA 4GB7A 2W3GA 2ZC5B 5HD3A 4WYYA 4FUWA 2V8FA 4OP5A 3ZVWA 4OLGA 2QZ6A 1DJCA 3UDXA 4JXVA 2ZL1B 4QY5A 2WKRA 2ZQDA 3HJKA 4E6WA 3PBNA 3H9WA 3FKWA 5M18A 1OTIA 3H7WB 4JXGA 1JWZA 3T4OA 1K38A 1GHIA 1OTBA 1L0EA 2B5RA 4IBRA 2Z2LB 2EWWA 3RJUA 2Y79A 5HAPA 3FYZA 1KDSA 1XA7A 5HPFA 3IS2B 3SZTA 2ZM8A 1P9WA 3BEBA 4YOFA 5CGXA 2IA2A 4ETZA 4ZDXA 1T19A 2ZC4B 2Y2PA 5GLCA 3VE4A 3CPTA 3JPUA 3B47A 3NY4A 3GDIA 3G34A 1OTAA 5J3WA 3CI6A 3CUEA 4U3TA 4B4XA 2K7SA 2L0WA 2BTFP 1Z09A 4XT2A 4RX2A 4DF6A 1LT0A 3C38A 3BM6A 3T1RA 3VSLA 4EQ1A 2Y2GA 3UB9A 2ZD8A 2J9PA 2O9AA 4PM6A 5KZHA 1TS6A 2JKTM 4KZ5A 4HEFA 4MEZA 3AGEA 1ZG4A 2V0WA 4IUKA 2PRFA 3CHWP 1MC0A 2JKRM 1BYWA 3T4TA 5DF9A 5HPIA 3GRJA 4HNBA 4IUHA 3UB5P 2XFTA 1JWPA 4MMNA 3RH8B 4NXFA 3IXGA 4U0XA 4WLAA 1XGJA 5L09A 2GNXA 5FQKA 4G3WA 4GKUA 5HWTA 2R9XA 3UE3A 3O5YA 5HL1A 2Z6DA 3PAGA 4JF6A 2J3TD 4MLLA 2G7UA 1YLTA 3HUMA 3GV9A 3GECA 2Y55A 1IELA 2WZZA 2GZAA 4JGPA 3HLCA 4DE2A 1KVLA 2FFYA 5M19A 2ZQ8A 4PM9A 3NOPC 3ZG9B 3EWKA 4L9EA 4HJ6A 1FR6A 2Y2OA 3IXDA 3G32A 5FEGA 3IX3A 3ZQ5A 1KE0A 1HVBA 2I9VA 4ZTKA 4GJ4A 3KSFA 4ETXA 3CUEC 1BLHA 1PI4A 3E4QA 1K55C 4S2NC 4X1LA 2VV7A 5HW3A 1GHMA 3S7QA 5KSHA 1ONHA 4FH2A 2LB5A 4I39A 3PR6A 5HX9A 3A3EA 1KE3A 1M40A 2WYXA 3LIBA 4WN5A 2DRWA 3A0RA 4CPKA 4F3LA 1HTZA 1OTEA 3T1QB 5TBMA 5AQAA 2W3DA 4HHDA 3TSGA 2Y8HA 2WKIA 1JNUA 3F1PA 3UPPA 3UB8A 3VOYA 3CITA 3PYPA 2W3EA 3S1YA 2HPBA 4Y0UA 3NECA 4N9KA 3G35A 4BWIA 1SKOA 4KZ3A 3TOIA 1BT5A 2V2FF 5TJJA 2H0TA 3IWOA 4I5SA 1HLUP 4LRZE 5DJTA 3Q7VA 2VX8A 3SW1A 3GQZA 1BLPA 4JLFA 5HARA 4R0QA 4LGWA 3LR0A 1CF0A 2WGWA 4XXRA 4KZ8A 1NLZA 1YSQA 3QNBA 4EUZA 4BMWA 4D60A 3MKFA 5I94A 1K0KA 2ZBBA 2OOLA 5GLDA 3BRMA 5FAQA 1FCOA 3I7JA 4BD0A 5GHXA 4IBXA 3IWIA 3PBOA 5K5BA 1VEUA 4HESA 5AVEA 2Y4AA 1T1AA 1N9OA 4LV3A 3O86A 4F3LB 1RCJA 5TBMB 3LI8A 3IXHA 4B4ZA 3ITAA 4Z9QA 3S7PA 5LBRA 3RFBA 3ZYTA 1YLWA 1FCMA 3GVBA 4R1GA 2BG1A 3F1PB 2L4RA 4FCFA 4YINA 1ES3A 2B18A 2VA0A 1GHPA 1YKDA 3HUOA 3E2KA 5E2FA 4EWFA 4KUKA 1FSWA 3FPVA 1SKOB 5HZHA 5FDSA 3H82A 1I2WA 5EOEA 1MY8A 3A3IA 2K31A 4BENA 3LYXA 4B9OA 4S2OA 3Q7VB 3NBLA 4OKPA 2HF6A 5L8MA 4HIAA 3HVFA 4PPRA 2O99A 2WGWB 2XA7M 4D2OA 4Y17A 1T1CA 2JKRI 1L2SA 3UDFA 5A93A 3QP5A 2W3FA 2Y2JA 3LEZA 2FZ0A 4OLDA 3B3XA 4HI4A 2WGIA 2J7VA 5I5LA 3GR2A 1ZTUA 4GCZA 5FAPA 4BL2A 4OOYA 1VEUB 3ICYA 1BULA 3BFEA 4MBHA 5L10A 5DF8A 2XRNA 4JXWA 2RL3A 1PI5A 3VP1A 4DKIA 2ZM0A 1GCEA 3DTIA 2C6WB 4JKTA 1CQAA 4KZ4A 1XX2A 3A3FA 1RGYA 1A0KA 5HD5A 3P7NA 3IXBA 3MQOA 2V1BA 1QMFA 3MS6A 2VEAA 4WUJA 3OOVA 3H82B 1CEFA 2ZM2A 2XF3A 2P04A 3MZDA 4R4RA 3VFHA 3BFCA 2V9AA 4NXBA 3BY8A 4EBLA 3VMAA 3KYZA 4E3OA 2Q9MA 4GD6A 4UQIM 2QHKA 1BUEA 4JGRA 1XKZA 4O7DA 1F9IA 1YMSA 1JTDA 4WMCD 3V3RA 4Y2FA 4S2IA 3MXRA 4P0MA 4WZ4A 2WUQA 4KZ7A 3IWQA 4E6XA 5GL9A 1IYPA 5EVID 1AXBA 4EV4A 4NK3A 2PR6A 2EX2A 3EEAA 3W4OA 1EROA 4ARZA 1NRJA 3A0VA 2H28A 2OLUA 2VK3A 1FIKA 4ME4A 4ZRRA 4N9LA 4S2LA 4IHQA 2M7UA 4GW9A 4Q0IA 2J3TC 5C5KA 4LV1A 1D06A 3IS2A 3C7VA 4OPRA 5TGFA 1PYYA 3VSKA 3D72A 3KYEA 2UWXA 4LV0A 3VV4A 1PWDA 3E2LA 3WS1A 4OQIA 3VOLA 2H5SA 3PXPA 4BQMA 1HD8A 3FPWA 3SS3A 4ID4A 4H8RA 2H0YA 1H0MA 1D7EA 2WKQA 3CAXA 5DKKA 2DNSA 3OPPA 3OC2A 2B02A 3A3DA 1N9LA 1XJ6A 2EA9A 4LRYC 3W4PA 4HBUA 1BZAA 4FSFA 1LHYA 1YSPA 3MMHA 1KGFA 4E3IA 4B93A 2Y2MA 5HDDA 3UDIA 4YFMA 3NDGA 3Q1FA 3T50A 3W8KA 1V9YA 2JC7A 3JVUA 3ZNYA 2WKHA 1MWTA 4KUOA 2OAP1 3C30A 1OPXA 2W1TA 2A24A 5KIZA 3T4QA 3UNWA 4C3QA 3P01A 4KZBA 4I3JA 5IU1A 1XJ2A 3KYQA 2XFSA 3MXSA 4ARZB 3HLFA 3MFXA 3DTEA 4R6LA 1P9RA 4I3IA 3FV7A 3U2AA 1SDNA 1YT4A 2OSUA 3BY9A 2JKFA 2WZXA 5F83A 3OCLA 3CLOA 3K2NA 4O8GA 1LL8A 4DE3A 1TDGA 1KOUA 3IF6C 1W79A 5EOOA 4E3MA 1ZG6A 2JHEA 3C4OA 2IWBA 5G4ZA 4BL3A 1LSWA 3Q07A 3ZDJA 3LFVA 4GNUA 3S7OA 2YKHA 2O9BA 5FI6A 1GSXA 1J3WA 1K55A 4S2NA 4L0LA 5CGWA 5F82A 1SCWA 1PRQA 3HJIA 4MN5A 1OT6A 3G2YA 1XPBA 3NOUC 4DXCA 5M1AA 3OZHA 1ODVA 1PZPA 2VKSA 1K56A 4GN2A 1IYQA 2QWSA 3HBRA 1J9MA 2XD5A 4MCWA 1FILA 3L7HA 3UB7A 1NYMA 1VM1A 1Z6FA 2OWJA 4P87A 2W1TB 2A24B 5TR7A 4JPMA 2JCHA 1G68A 4E3KA 5J7EA 4HH3A 5FATA 5DKLA 3MZFA 2P7JA 1GSWA 5EECA 2ZQ9A 1SHVA 1TS8A 2V8CA 3F1OA 4PHTA 3HLWA 3D3OA 3DTKA 4KG5A 1W7FA 1X0OA 3IQAA 3T4JA 3LIFA 1E3UD
chains in the Genus database with same CATH topology
1Y54A 2Y2QA 4ZJ1A 1DJBA 3I7JA 3ITBA 1PW8A 4X56A 3N7WA 1H5XA 4K0XA 4DDYA 4BD0A 4FD8A 5GHXA 4IVIA 4WELA 4IBXA 3IWIA 3BECA 2ZC7A 3M2KA 3PBOA 5EPHA 2FFFB 4GZBA 4HESA 1NZOA 4OOMA 4WEJA 2Y4AA 4R23A 5GHZA 1K4EA 1NJ4A 3SH8A 4BLMA 5KSCA 4EBNA 5CEBA 2WADA 3W4QA 2ZQCA 3UY6A 4LV3A 1OMEA 3O86A 2HP5A 3GTCA 1TVFA 3LY4A 2X02A 3IF6B 4UA9A 1RCJA 5FQIA 4DE0A 2J9OA 3IXHA 4B4ZA 2Y59A 3ITAA 4Z9QA 2XQZA 3N8SA 5CGSA 4P85A 4R3BA 3ZG8B 1W8YA 1YLWA 1FCMA 2WAFA 3AGDA 2Y2HA 4Q8IA 3GVBA 5FQQA 4R1GA 3S22A 4DE1A 4UAAA 5JYPA 1ES4A 2BG1A 5FAQA 1FSYA 3OPHA 1MWRA 2XD1A 3Q82A 3S4XA 4PM5A 5CHMA 5GLAA 1YLPA 5FQ9A 1BSGA 3LO7A 2A49A 4FCFA 4YINA 4P6BA 1ES3A 1H8ZA 1GHPA 1FR1A 2Y2KA 3HUOA 1W8QA 3IHAA 3E2KA 5E2FA 1O7EA 1PIOA 4EWFA 2WK0A 5E43A 3RXXA 4DRTA 1FSWA 4ZAMA 2XGNA 5CEDA 4S2KA 2ZJ9A 1WE4A 5IHVA 1LI9A 3VFFA 3ZHHA 1I2WA 3JYIA 1W5DA 3SS5A 2PBYA 2VGKA 5EOEA 1MY8A 4IVKA 2I72A 3A3IA 1HZOA 4BENA 2EX9A 5CXWA 1IKIA 3WS5A 5CHUA 3ZFZA 1XP4A 4NETA 4Y7PA 3BYDA 2E8IA 3WS4A 3IH8A 4S2OA 3Q7VB 3NBLA 3N8RA 3BFFA 4OKPA 3UO9A 1ESUA 3SH9A 5CECA 1I2SA 3HVFA 5A90A 1LL9A 4PPRA 5AQ7A 2XEPA 2DCFA 2WGWB 2Y2NA 1ERMA 2RCXA 4D2OA 1M6KA 3DW0A 3N6IA 3P09A 5KMWA 1GA0A 5FDHA 4OH0A 3UPNA 3GMWA 2XLNA 1L2SA 3UDFA 5A93A 5A91A 4KZAA 1K25A 4OQ0A 2Y2JA 3LEZA 5E2HA 4OLDA 2P9VA 3B3XA 5CHJA 4JXSA 2WGIA 2J7VA 3G4PA 1SKFA 4OPZA 4KQRA 4S2MA 2V20A 3HLDA 2QMIA 4RVAA 1K6RA 3GR2A 3VP2A 5BOHA 4KG6A 5HFOA 2OLVA 1CK3A 3N8LA 5FAPA 4BL2A 4GD8A 3NIAA 4OOYA 3WRTA 4CJNA 2PU4A 3BLSA 3CG5A 3CJMA 3DTMA 5CTMA 1KGGA 2ZQAA 1EI5A 1BULA 3BFEA 4MBHA 4S2JA 5DF8A 1L0FA 3C5AA 1NYYA 4JXWA 3ZVTA 4RA7A 5E2GA 2RL3A 1CEGA 1PI5A 4EQIA 2EFUA 5G18A 1XGIA 1NY0A 1L0GA 3PBQA 3VP1A 4DKIA 2ZM0A 4C75A 1PWCA 1K6SA 2WGVA 4X6TA 2HDQA 1GCEA 3V5MA 3C7UA 3M6HA 3UE1A 3OPRA 1PZOA 5FAOA 4XUXA 5D3OA 2HDUA 5EVIC 2XR0A 3MKEA 2Y2IA 4GB7A 2ZC5B 4WMCA 2Z2MB 4WYYA 2C6WB 4JKTA 3PAEA 4KZ4A 3IT9A 1XX2A 3A3FA 4E3LA 1RGYA 3IH9A 5EVLA 1YQSA 4OP5A 5EE8A 1Q2PA 2IWDA 3VOZA 3ZVWA 3IXBA 5EVIA 1MPLA 4OLGA 2QZ6A 3MBZA 1QMFA 1DJCA 4WM9A 3UDXA 1ALQA 4JXVA 4QY5A 3C4PA 1JTGA 1NRFA 4R3JA 3G31A 1CEFA 2HP9A 2ZM2A 2ZQDA 2XF3A 1DJAA 1NXYA 4E6WA 3ZNTA 3PBNA 4MNRA 3MZDA 4R4RA 4UA6A 2ZLYA 3FKWA 3HREA 1E4DA 1MBLA 2H10A 3BFCA 2EXBA 3VFHA 5M18A 3ZCZA 4IEDA 4JXGA 1JWZA 1ZKJA 1K38A 5CTNA 1GHIA 1L0EA 4EBLA 2B5RA 4IBRA 2Z2LB 4PM8A 5GHYA 3RJUA 3VMAA 4E3OA 2Q9MA 1MKIA 4GD6A 5HAPA 3FYZA 1KDSA 4OP8A 1BUEA 1XA7A 3VP4A 1FCNA 1XKZA 1JWVA 3HLEA 4O7DA 1YMSA 4LCLA 3SH7A 1JTDA 3GSGA 2ZM8A 4WMCD 4KQQA 3V3RA 3ZG7B 5JYOA 3M6BA 1LI0A 4S2IA 5HAIA 3BEBA 1N4OA 3MXRA 5GLBA 2HP6A 3M2JA 4P0MA 5A92A 4WZ4A 2WUQA 5U47A 4KZ7A 5CGXA 1RGZA 1TDLA 3IWQA 5HAQA 4RX3A 4JF5A 3WS0A 2R9WA 4ZDXA 2EX6A 4Y0OA 3HUNA 2P9VB 4E6XA 5GL9A 2A3UA 1IYPA 1ES5A 5EVID 2ZC4B 1AXBA 2Y2PA 5GLCA 2XH9A 4E3NA 4EV4A 2G2UA 4NK3A 3NY4A 2CC1A 2EX2A 2ZC3B 3V39A 2Y91A 2JBFA 3W4OA 3G34A 1EROA 3OPLA 3NC8A 3FWLA 3QHYA 2HDRA 2OLUA 4U3TA 4KZ9A 1IYOA 3UN7A 4B4XA 4N9LA 4S2LA 5FASA 4K91A 3DWKA 1BLSA 4LV1A 1JVJA 2GDNA 4RX2A 4DF6A 1S0WA 3FZCA 1KDWA 1PWGA 1I5QA 4N92A 3BM6A 1MWUA 3VSLA 4LCMA 2Y2GA 3C7VA 2EX8A 4OPRA 2ZD8A 2J9PA 3HLGA 4OQGA 4PM6A 5TGFA 1PYYA 3VSKA 5KZHA 2UWXA 4E3JA 1N9BA 4LV0A 2PU2A 1YMXA 4QU3A 1PWDA 4C6YA 4UA7A 3E2LA 4KZ5A 2BLSA 4HEFA 1EWZA 4MEZA 4OPQA 3OCNA 3WS1A 3AGEA 2ZQ7A 4WZ5A 4OQIA 4LENA 1ZG4A 5FI2A 3UE0A 1YM1A 2H5SA 3UPOA 3PBSA 4BQMA 4N1XA 3HL9A 1HD8A 5DF9A 4JBFA 5EVIB 2EFXA 3D4FA 3SOIA 3SS3A 3CMZA 4ID4A 3GRJA 4H8RA 1S6RA 2H0YA 2XFTA 1JWPA 1FQGA 3WS2A 3WRZA 3ZG0A 3IXGA 2DNSA 4U0XA 4JF4A 4GOGA 4EBPA 1YLJA 1ESIA 1KVMA 3PBRA 5F1GA 2ZC6B 4PM7A 4QY6A 3OPPA 3OC2A 4MBFA 3A3DA 1XGJA 1K54C 1U60A 4BJPA 1G6AA 5FQKA 2HDSA 3IF5A 3W4PA 4GKUA 1ES2A 4HBUA 2R9XA 1BZAA 2ZMAA 4FSFA 1LHYA 4OQHA 3UE3A 3WWXA 4Y0TA 1KGFA 1CI8A 1K4FA 4E3IA 2XK1A 2Y2MA 5HL1A 3UDIA 1ERQA 3BFGA 3N4IA 4YFMA 2X01A 3VP0A 3PAGA 3NDGA 3Q1FA 4JF6A 3W8KA 4MLLA 2JC7A 1K54A 1YLTA 4OONA 5DVAA 2WKHA 1MWTA 3HUMA 5AQBA 3GV9A 3ZNYA 5CERA 2IWCA 2Y55A 3VP3A 3PTEA 1IELA 4LV2A 3MFDA 2WZZA 4GDNA 1K57C 4X68A 3TG9A 3HLCA 3Q81A 4QHCA 4MBKA 4OOLA 2WAEA 3DWZA 4DE2A 1KVLA 1QMEA 3UNWA 1FOFA 2C5WB 4C3QA 4KZBA 1RP5A 2FFYA 5M19A 2X71A 2ZQ8A 4PM9A 4WEKA 4ZJ3A 3ZG9B 4GDBA 3NCKA 2XFSA 1FR6A 3MXSA 3HLFA 3NDEA 1K57A 2Y2OA 3FKVA 1BTLA 1GA9A 4ZJ2A 3IXDA 2V1ZA 3G32A 4WBGA 3CZDA 3FV7A 4OPYA 1L0DA 1KE4A 5DF7A 1SDNA 1YT4A 2OSUA 1KE0A 1DY6A 1HVBA 3O88A 4QB8A 1MXOA 4ZTKA 3PBTA 3O87A 2Q9NA 3EQUA 2WZXA 5F83A 3OCLA 5TFQA 1WYCA 3ZG5A 4R4SA 4DE3A 1BLHA 1PI4A 4X53A 1K55C 1C3BA 1TDGA 4S2NC 5DTSA 5HW3A 3IF6C 1IKGA 1GHMA 1W79A 3ZGAB 5EOOA 1NZUA 4DXBA 5KSHA 4E3MA 1ONHA 1ZG6A 1YLYA 4FH2A 5AQ9A 4B88A 2XDMA 5HX9A 3A3EA 1KE3A 1M40A 3C4OA 2WYXA 2IWBA 4X69A 3BLMA 1IYSA 4QD4A 4BL3A 4KG2A 3Q07A 3A3JA 3ZDJA 5FI7A 5FQJA 1BLCA 2DRWA 4GNUA 4K0WA 5FI6A 4CPKA 4FH4A 1K55A 4S2NA 5F1FA 1HTZA 1XA1A 5DTTA 3IF6A 3ISGA 4L0LA 4DDSA 1PW1A 5AQAA 4QJGA 3V3SA 5CGWA 5F82A 1SCWA 3IHBA 4WZ5C 1ZC2A 3NI9A 1LL5A 5CRFA 1SDEA 2Y2LA 3TSGA 5EUAA 1VQQA 3BFDA 3SS4A 3G2YA 1CI9A 1XPBA 2WKIA 2WKEA 4F94A 3MZEA 3UPPA 4A5RA 3VOYA 4DXCA 5M1AA 3OZHA 3Q7ZA 1PZPA 4ZBEA 4PMAA 1E25A 1H8YA 1K56A 2HPBA 4GN2A 3S1YA 5L2FA 1IYQA 1O07A 1E3UA 4BD1A 4Y0UA 3HBRA 5J8XA 1J9MA 2XD5A 4N9KA 1MWSA 2QPNA 3G35A 5FQMA 4OVDA 4KZ3A 3O3VA 3TOIA 1BT5A 1NYMA 2V2FF 4KQOA 4RYEA 3P98A 1VM1A 3V50A 1KGEA 2H0TA 3IWOA 1Z6FA 4P87A 5TR7A 2OV5A 4JPMA 3Q7VA 3G30A 2JCHA 1G68A 3GQZA 3HLBA 1BLPA 4JLFA 5HARA 4R0QA 4E3KA 3RXWA 4XUZA 2EXAA 5FSRA 3G2ZA 2J8YA 5FATA 3MZFA 3LY3A 4UHUA 5EECA 2VGJA 5FA7A 2WGWA 2ZQ9A 1ONGA 1SHVA 1XXMA 3QNCA 5E2EA 4XXRA 2JE5A 4KZ6A 4KZ8A 4N1HA 4S2PA 4HBTA 1Q2QA 1TEMA 3HLWA 1YLZA 1WYBA 4KG5A 1W7FA 4M3KA 3QNBA 4EUZA 1LLBA 3LCEA 4U0TA 3IQAA 3MKFA 5I94A 2P74A 5DTKA 1K56D 3EQVA 4X55A 3AGFA 4KENB 1E3UD 1IEMA 5GLDA 2G2WA 3BRMA 1FCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y54 A;  2Y2Q A;  4ZJ1 A;  1DJB A;  3I7J A;  3ITB A;  1PW8 A;  4X56 A;  3N7W A;  1H5X A;  4K0X A;  4DDY A;  4BD0 A;  4FD8 A;  5GHX A;  4IVI A;  4WEL A;  4IBX A;  3IWI A;  3BEC A;  2ZC7 A;  3M2K A;  3PBO A;  5EPH A;  2FFF B;  4GZB A;  4HES A;  1NZO A;  4OOM A;  4WEJ A;  2Y4A A;  4R23 A;  5GHZ A;  1K4E A;  1NJ4 A;  3SH8 A;  4BLM A;  5KSC A;  4EBN A;  5CEB A;  2WAD A;  3W4Q A;  2ZQC A;  3UY6 A;  4LV3 A;  1OME A;  3O86 A;  2HP5 A;  3GTC A;  1TVF A;  3LY4 A;  2X02 A;  3IF6 B;  4UA9 A;  1RCJ A;  5FQI A;  4DE0 A;  2J9O A;  3IXH A;  4B4Z A;  2Y59 A;  3ITA A;  4Z9Q A;  2XQZ A;  3N8S A;  5CGS A;  4P85 A;  4R3B A;  3ZG8 B;  1W8Y A;  1YLW A;  1FCM A;  2WAF A;  3AGD A;  2Y2H A;  4Q8I A;  3GVB A;  5FQQ A;  4R1G A;  3S22 A;  4DE1 A;  4UAA A;  5JYP A;  1ES4 A;  2BG1 A;  5FAQ A;  1FSY A;  3OPH A;  1MWR A;  2XD1 A;  3Q82 A;  3S4X A;  4PM5 A;  5CHM A;  5GLA A;  1YLP A;  5FQ9 A;  1BSG A;  3LO7 A;  2A49 A;  4FCF A;  4YIN A;  4P6B A;  1ES3 A;  1H8Z A;  1GHP A;  1FR1 A;  2Y2K A;  3HUO A;  1W8Q A;  3IHA A;  3E2K A;  5E2F A;  1O7E A;  1PIO A;  4EWF A;  2WK0 A;  5E43 A;  3RXX A;  4DRT A;  1FSW A;  4ZAM A;  2XGN A;  5CED A;  4S2K A;  2ZJ9 A;  1WE4 A;  5IHV A;  1LI9 A;  3VFF A;  3ZHH A;  1I2W A;  3JYI A;  1W5D A;  3SS5 A;  2PBY A;  2VGK A;  5EOE A;  1MY8 A;  4IVK A;  2I72 A;  3A3I A;  1HZO A;  4BEN A;  2EX9 A;  5CXW A;  1IKI A;  3WS5 A;  5CHU A;  3ZFZ A;  1XP4 A;  4NET A;  4Y7P A;  3BYD A;  2E8I A;  3WS4 A;  3IH8 A;  4S2O A;  3Q7V B;  3NBL A;  3N8R A;  3BFF A;  4OKP A;  3UO9 A;  1ESU A;  3SH9 A;  5CEC A;  1I2S A;  3HVF A;  5A90 A;  1LL9 A;  4PPR A;  5AQ7 A;  2XEP A;  2DCF A;  2WGW B;  2Y2N A;  1ERM A;  2RCX A;  4D2O A;  1M6K A;  3DW0 A;  3N6I A;  3P09 A;  5KMW A;  1GA0 A;  5FDH A;  4OH0 A;  3UPN A;  3GMW A;  2XLN A;  1L2S A;  3UDF A;  5A93 A;  5A91 A;  4KZA A;  1K25 A;  4OQ0 A;  2Y2J A;  3LEZ A;  5E2H A;  4OLD A;  2P9V A;  3B3X A;  5CHJ A;  4JXS A;  2WGI A;  2J7V A;  3G4P A;  1SKF A;  4OPZ A;  4KQR A;  4S2M A;  2V20 A;  3HLD A;  2QMI A;  4RVA A;  1K6R A;  3GR2 A;  3VP2 A;  5BOH A;  4KG6 A;  5HFO A;  2OLV A;  1CK3 A;  3N8L A;  5FAP A;  4BL2 A;  4GD8 A;  3NIA A;  4OOY A;  3WRT A;  4CJN A;  2PU4 A;  3BLS A;  3CG5 A;  3CJM A;  3DTM A;  5CTM A;  1KGG A;  2ZQA A;  1EI5 A;  1BUL A;  3BFE A;  4MBH A;  4S2J A;  5DF8 A;  1L0F A;  3C5A A;  1NYY A;  4JXW A;  3ZVT A;  4RA7 A;  5E2G A;  2RL3 A;  1CEG A;  1PI5 A;  4EQI A;  2EFU A;  5G18 A;  1XGI A;  1NY0 A;  1L0G A;  3PBQ A;  3VP1 A;  4DKI A;  2ZM0 A;  4C75 A;  1PWC A;  1K6S A;  2WGV A;  4X6T A;  2HDQ A;  1GCE A;  3V5M A;  3C7U A;  3M6H A;  3UE1 A;  3OPR A;  1PZO A;  5FAO A;  4XUX A;  5D3O A;  2HDU A;  5EVI C;  2XR0 A;  3MKE A;  2Y2I A;  4GB7 A;  2ZC5 B;  4WMC A;  2Z2M B;  4WYY A;  2C6W B;  4JKT A;  3PAE A;  4KZ4 A;  3IT9 A;  1XX2 A;  3A3F A;  4E3L A;  1RGY A;  3IH9 A;  5EVL A;  1YQS A;  4OP5 A;  5EE8 A;  1Q2P A;  2IWD A;  3VOZ A;  3ZVW A;  3IXB A;  5EVI A;  1MPL A;  4OLG A;  2QZ6 A;  3MBZ A;  1QMF A;  1DJC A;  4WM9 A;  3UDX A;  1ALQ A;  4JXV A;  4QY5 A;  3C4P A;  1JTG A;  1NRF A;  4R3J A;  3G31 A;  1CEF A;  2HP9 A;  2ZM2 A;  2ZQD A;  2XF3 A;  1DJA A;  1NXY A;  4E6W A;  3ZNT A;  3PBN A;  4MNR A;  3MZD A;  4R4R A;  4UA6 A;  2ZLY A;  3FKW A;  3HRE A;  1E4D A;  1MBL A;  2H10 A;  3BFC A;  2EXB A;  3VFH A;  5M18 A;  3ZCZ A;  4IED A;  4JXG A;  1JWZ A;  1ZKJ A;  1K38 A;  5CTN A;  1GHI A;  1L0E A;  4EBL A;  2B5R A;  4IBR A;  2Z2L B;  4PM8 A;  5GHY A;  3RJU A;  3VMA A;  4E3O A;  2Q9M A;  1MKI A;  4GD6 A;  5HAP A;  3FYZ A;  1KDS A;  4OP8 A;  1BUE A;  1XA7 A;  3VP4 A;  1FCN A;  1XKZ A;  1JWV A;  3HLE A;  4O7D A;  1YMS A;  4LCL A;  3SH7 A;  1JTD A;  3GSG A;  2ZM8 A;  4WMC D;  4KQQ A;  3V3R A;  3ZG7 B;  5JYO A;  3M6B A;  1LI0 A;  4S2I A;  5HAI A;  3BEB A;  1N4O A;  3MXR A;  5GLB A;  2HP6 A;  3M2J A;  4P0M A;  5A92 A;  4WZ4 A;  2WUQ A;  5U47 A;  4KZ7 A;  5CGX A;  1RGZ A;  1TDL A;  3IWQ A;  5HAQ A;  4RX3 A;  4JF5 A;  3WS0 A;  2R9W A;  4ZDX A;  2EX6 A;  4Y0O A;  3HUN A;  2P9V B;  4E6X A;  5GL9 A;  2A3U A;  1IYP A;  1ES5 A;  5EVI D;  2ZC4 B;  1AXB A;  2Y2P A;  5GLC A;  2XH9 A;  4E3N A;  4EV4 A;  2G2U A;  4NK3 A;  3NY4 A;  2CC1 A;  2EX2 A;  2ZC3 B;  3V39 A;  2Y91 A;  2JBF A;  3W4O A;  3G34 A;  1ERO A;  3OPL A;  3NC8 A;  3FWL A;  3QHY A;  2HDR A;  2OLU A;  4U3T A;  4KZ9 A;  1IYO A;  3UN7 A;  4B4X A;  4N9L A;  4S2L A;  5FAS A;  4K91 A;  3DWK A;  1BLS A;  4LV1 A;  1JVJ A;  2GDN A;  4RX2 A;  4DF6 A;  1S0W A;  3FZC A;  1KDW A;  1PWG A;  1I5Q A;  4N92 A;  3BM6 A;  1MWU A;  3VSL A;  4LCM A;  2Y2G A;  3C7V A;  2EX8 A;  4OPR A;  2ZD8 A;  2J9P A;  3HLG A;  4OQG A;  4PM6 A;  5TGF A;  1PYY A;  3VSK A;  5KZH A;  2UWX A;  4E3J A;  1N9B A;  4LV0 A;  2PU2 A;  1YMX A;  4QU3 A;  1PWD A;  4C6Y A;  4UA7 A;  3E2L A;  4KZ5 A;  2BLS A;  4HEF A;  1EWZ A;  4MEZ A;  4OPQ A;  3OCN A;  3WS1 A;  3AGE A;  2ZQ7 A;  4WZ5 A;  4OQI A;  4LEN A;  1ZG4 A;  5FI2 A;  3UE0 A;  1YM1 A;  2H5S A;  3UPO A;  3PBS A;  4BQM A;  4N1X A;  3HL9 A;  1HD8 A;  5DF9 A;  4JBF A;  5EVI B;  2EFX A;  3D4F A;  3SOI A;  3SS3 A;  3CMZ A;  4ID4 A;  3GRJ A;  4H8R A;  1S6R A;  2H0Y A;  2XFT A;  1JWP A;  1FQG A;  3WS2 A;  3WRZ A;  3ZG0 A;  3IXG A;  2DNS A;  4U0X A;  4JF4 A;  4GOG A;  4EBP A;  1YLJ A;  1ESI A;  1KVM A;  3PBR A;  5F1G A;  2ZC6 B;  4PM7 A;  4QY6 A;  3OPP A;  3OC2 A;  4MBF A;  3A3D A;  1XGJ A;  1K54 C;  1U60 A;  4BJP A;  1G6A A;  5FQK A;  2HDS A;  3IF5 A;  3W4P A;  4GKU A;  1ES2 A;  4HBU A;  2R9X A;  1BZA A;  2ZMA A;  4FSF A;  1LHY A;  4OQH A;  3UE3 A;  3WWX A;  4Y0T A;  1KGF A;  1CI8 A;  1K4F A;  4E3I A;  2XK1 A;  2Y2M A;  5HL1 A;  3UDI A;  1ERQ A;  3BFG A;  3N4I A;  4YFM A;  2X01 A;  3VP0 A;  3PAG A;  3NDG A;  3Q1F A;  4JF6 A;  3W8K A;  4MLL A;  2JC7 A;  1K54 A;  1YLT A;  4OON A;  5DVA A;  2WKH A;  1MWT A;  3HUM A;  5AQB A;  3GV9 A;  3ZNY A;  5CER A;  2IWC A;  2Y55 A;  3VP3 A;  3PTE A;  1IEL A;  4LV2 A;  3MFD A;  2WZZ A;  4GDN A;  1K57 C;  4X68 A;  3TG9 A;  3HLC A;  3Q81 A;  4QHC A;  4MBK A;  4OOL A;  2WAE A;  3DWZ A;  4DE2 A;  1KVL A;  1QME A;  3UNW A;  1FOF A;  2C5W B;  4C3Q A;  4KZB A;  1RP5 A;  2FFY A;  5M19 A;  2X71 A;  2ZQ8 A;  4PM9 A;  4WEK A;  4ZJ3 A;  3ZG9 B;  4GDB A;  3NCK A;  2XFS A;  1FR6 A;  3MXS A;  3HLF A;  3NDE A;  1K57 A;  2Y2O A;  3FKV A;  1BTL A;  1GA9 A;  4ZJ2 A;  3IXD A;  2V1Z A;  3G32 A;  4WBG A;  3CZD A;  3FV7 A;  4OPY A;  1L0D A;  1KE4 A;  5DF7 A;  1SDN A;  1YT4 A;  2OSU A;  1KE0 A;  1DY6 A;  1HVB A;  3O88 A;  4QB8 A;  1MXO A;  4ZTK A;  3PBT A;  3O87 A;  2Q9N A;  3EQU A;  2WZX A;  5F83 A;  3OCL A;  5TFQ A;  1WYC A;  3ZG5 A;  4R4S A;  4DE3 A;  1BLH A;  1PI4 A;  4X53 A;  1K55 C;  1C3B A;  1TDG A;  4S2N C;  5DTS A;  5HW3 A;  3IF6 C;  1IKG A;  1GHM A;  1W79 A;  3ZGA B;  5EOO A;  1NZU A;  4DXB A;  5KSH A;  4E3M A;  1ONH A;  1ZG6 A;  1YLY A;  4FH2 A;  5AQ9 A;  4B88 A;  2XDM A;  5HX9 A;  3A3E A;  1KE3 A;  1M40 A;  3C4O A;  2WYX A;  2IWB A;  4X69 A;  3BLM A;  1IYS A;  4QD4 A;  4BL3 A;  4KG2 A;  3Q07 A;  3A3J A;  3ZDJ A;  5FI7 A;  5FQJ A;  1BLC A;  2DRW A;  4GNU A;  4K0W A;  5FI6 A;  4CPK A;  4FH4 A;  1K55 A;  4S2N A;  5F1F A;  1HTZ A;  1XA1 A;  5DTT A;  3IF6 A;  3ISG A;  4L0L A;  4DDS A;  1PW1 A;  5AQA A;  4QJG A;  3V3S A;  5CGW A;  5F82 A;  1SCW A;  3IHB A;  4WZ5 C;  1ZC2 A;  3NI9 A;  1LL5 A;  5CRF A;  1SDE A;  2Y2L A;  3TSG A;  5EUA A;  1VQQ A;  3BFD A;  3SS4 A;  3G2Y A;  1CI9 A;  1XPB A;  2WKI A;  2WKE A;  4F94 A;  3MZE A;  3UPP A;  4A5R A;  3VOY A;  4DXC A;  5M1A A;  3OZH A;  3Q7Z A;  1PZP A;  4ZBE A;  4PMA A;  1E25 A;  1H8Y A;  1K56 A;  2HPB A;  4GN2 A;  3S1Y A;  5L2F A;  1IYQ A;  1O07 A;  1E3U A;  4BD1 A;  4Y0U A;  3HBR A;  5J8X A;  1J9M A;  2XD5 A;  4N9K A;  1MWS A;  2QPN A;  3G35 A;  5FQM A;  4OVD A;  4KZ3 A;  3O3V A;  3TOI A;  1BT5 A;  1NYM A;  2V2F F;  4KQO A;  4RYE A;  3P98 A;  1VM1 A;  3V50 A;  1KGE A;  2H0T A;  3IWO A;  1Z6F A;  4P87 A;  5TR7 A;  2OV5 A;  4JPM A;  3Q7V A;  3G30 A;  2JCH A;  1G68 A;  3GQZ A;  3HLB A;  1BLP A;  4JLF A;  5HAR A;  4R0Q A;  4E3K A;  3RXW A;  4XUZ A;  2EXA A;  5FSR A;  3G2Z A;  2J8Y A;  5FAT A;  3MZF A;  3LY3 A;  4UHU A;  5EEC A;  2VGJ A;  5FA7 A;  2WGW A;  2ZQ9 A;  1ONG A;  1SHV A;  1XXM A;  3QNC A;  5E2E A;  4XXR A;  2JE5 A;  4KZ6 A;  4KZ8 A;  4N1H A;  4S2P A;  4HBT A;  1Q2Q A;  1TEM A;  3HLW A;  1YLZ A;  1WYB A;  4KG5 A;  1W7F A;  4M3K A;  3QNB A;  4EUZ A;  1LLB A;  3LCE A;  4U0T A;  3IQA A;  3MKF A;  5I94 A;  2P74 A;  5DTK A;  1K56 D;  3EQV A;  4X55 A;  3AGF A;  4KEN B;  1E3U D;  1IEM A;  5GLD A;  2G2W A;  3BRM A;  1FCO A; 
#chains in the Genus database with same CATH topology
 4ZJ1 A;  1DJB A;  2ZC7 A;  3M2K A;  5HDS A;  5EPH A;  4GZB A;  4OOM A;  5CX7 A;  1YPR A;  1LSV A;  2X02 A;  4NXG A;  4UA9 A;  5FQI A;  2J9O A;  3N8S A;  1OJG A;  3IX8 A;  3MSH A;  1VB6 A;  4P85 A;  4CLC D;  4R3B A;  1W8Y A;  2JKG A;  2Y2H A;  5AJG A;  4Q8I A;  3NJA A;  2OAQ 1;  1H8M A;  4DE1 A;  4UAA A;  3E4O A;  3TRC A;  3OPH A;  1MWR A;  2XD1 A;  3Q82 A;  5GLA A;  4UQI S;  1YLP A;  3BQ8 A;  3IHA A;  4DRT A;  3T4L A;  1IFQ A;  2ZJ9 A;  1WE4 A;  3VFF A;  3BW6 A;  3ZHH A;  4GS9 A;  3SS5 A;  2PBY A;  2VGK A;  5F68 A;  1S4S A;  3U4L P;  1HZO A;  5CHU A;  3BYD A;  2PHY A;  5HSQ A;  4PKY G;  3K3D A;  3LIC A;  3N8R A;  1W63 Q;  3T1S A;  4EUV A;  1LL9 A;  1S4R A;  2DCF A;  2PR5 A;  3F1O B;  3DW0 A;  4LFU A;  3P09 A;  4OH0 A;  3UPN A;  3GMW A;  5A91 A;  1XFQ A;  2ZMV A;  2INW A;  4JXS A;  4OPZ A;  3G4P A;  1SKF A;  3UE6 A;  2MJ6 A;  4S2M A;  4RVA A;  1K6R A;  5BOH A;  2OLV A;  2Q0O A;  1VHM A;  4EEP A;  1PNE A;  4CJN A;  3DTM A;  1EI5 A;  5MC7 A;  3KSI A;  1CEG A;  2EFU A;  3PBQ A;  1K6S A;  2VJW A;  3C7U A;  3M6H A;  3UE1 A;  1PZO A;  2HGV A;  2HDU A;  5EVI C;  2XR0 A;  3MKE A;  2PDR A;  2Z2M B;  4MN7 A;  3IH9 A;  1GSV A;  1MPL A;  3MBZ A;  4EW7 A;  4R3J A;  3G31 A;  4GS9 B;  1NXY A;  4UA6 A;  2ZLY A;  3HRE A;  1MBL A;  2EXB A;  3ZCZ A;  4LRX C;  4IED A;  1EW0 A;  1ZKJ A;  4PM8 A;  3UB6 A;  5GHY A;  4KQD A;  1MKI A;  3LEQ A;  3VP4 A;  4I38 A;  3HLE A;  4BBV A;  2VGL M;  4O01 A;  3B33 A;  3BQA A;  4KQQ A;  4DJ2 A;  3M6B A;  1LI0 A;  3QP2 A;  5HAI A;  1N4O A;  2HP6 A;  3M2J A;  3WS0 A;  4JF5 A;  2PBD P;  2R9W A;  2EX6 A;  2ZOH A;  4Y0O A;  2XH9 A;  2EWV A;  4E3N A;  2G2U A;  2CC1 A;  2Y91 A;  2JBF A;  2R78 A;  3FWL A;  3QHY A;  4KZ9 A;  2JKT I;  4PKY A;  3DWK A;  1JVJ A;  1V9Z A;  3FZC A;  4CQH A;  1PWG A;  2KDK A;  3B42 A;  4N92 A;  3TW8 A;  1MWU A;  2EX8 A;  3LUQ A;  4QU3 A;  4C6Y A;  4OPQ A;  5DFY A;  1YAX A;  2ZQ7 A;  3UE0 A;  3UPO A;  4HOI A;  3PBS A;  3ULF A;  1S1Z A;  4N1X A;  4JBF A;  3D4F A;  5F6A A;  1S6R A;  2P08 A;  1UWN X;  1FQG A;  3ZG0 A;  4JF4 A;  1YLJ A;  5DJU A;  1ESI A;  1KVM A;  3PBR A;  5F1G A;  2ZC6 B;  3IBR A;  4MBF A;  1TD5 A;  1K54 C;  1U60 A;  1G6A A;  3IF5 A;  4HY8 A;  1ES2 A;  4JGQ A;  2FH5 A;  4OQH A;  4Y0T A;  1K4F A;  2XK1 A;  4NG2 A;  2O0Y A;  1ERQ A;  1F5M A;  5EM1 A;  5DVA A;  5AQB A;  3VP3 A;  5HWW A;  4AFI A;  3PTE A;  4LV2 A;  3MFD A;  1NLY A;  4GDN A;  1K57 C;  4X68 A;  4X25 A;  3TG9 A;  3Q81 A;  4QHC A;  3V67 A;  2WAE A;  3EGD C;  2X71 A;  4WEK A;  4ZJ3 A;  4GDB A;  4WL9 A;  2D01 A;  2KX6 A;  3E4P A;  3FKV A;  1GA9 A;  4WBG A;  4OPY A;  2PAV P;  3O88 A;  4QB8 A;  1MXO A;  2Q9N A;  3EQU A;  1OT9 A;  3DBA A;  2V1A A;  5TFQ A;  4R4S A;  1C3B A;  3LR3 A;  1IKG A;  1NZU A;  5AQ9 A;  1YLY A;  4B88 A;  4QD4 A;  3KSH A;  5FQJ A;  1BLC A;  2E8J A;  4K0W A;  1N9N A;  4M4X A;  5DTT A;  3IF6 A;  1PW1 A;  4QJG A;  4NEE D;  3NI9 A;  1LL5 A;  5CRF A;  1SDE A;  1VQQ A;  3BFD A;  2WKE A;  4F94 A;  4LLO B;  2M7V A;  1OJ5 A;  3Q7Z A;  4ZBE A;  1E25 A;  1O07 A;  4BD1 A;  4GLQ A;  1MWS A;  2QPN A;  3O3V A;  3FC7 A;  4KQO A;  4RYE A;  3P98 A;  3V50 A;  1KGE A;  3UME A;  4CLC C;  2OV5 A;  4QWO A;  3MF0 A;  3G30 A;  2XRO A;  3HLB A;  5FL3 A;  3T12 B;  4O0P A;  4XUZ A;  1G5U A;  4PAU A;  2J8Y A;  2VGJ A;  5FA7 A;  3QNC A;  1ONG A;  1XXM A;  5E2E A;  2ACG A;  1STZ A;  1OTD A;  4N1H A;  1YLZ A;  1ACF A;  4M3K A;  3DAV A;  3LR5 A;  1LLB A;  3LCE A;  4U0T A;  2P74 A;  2YKF A;  5DTK A;  4H6J A;  4X55 A;  3AGF A;  4KEN B;  1IEM A;  2G2W A;  1Y54 A;  2Y2Q A;  3LIA A;  3NUL A;  1PW8 A;  2OWH A;  3MQ0 A;  3R4K A;  4K0X A;  4DDY A;  4EER A;  4IVI A;  4WEL A;  3BEC A;  1S66 L;  1S1Y A;  2FFF B;  4L9F A;  2KOI A;  3ZG7 B;  4WEJ A;  3SH8 A;  4R23 A;  5GHZ A;  1K4E A;  5KSC A;  5CEB A;  2WAD A;  3W4Q A;  2ZQC A;  3UY6 A;  3QP4 A;  3LY4 A;  1TVF A;  3IF6 B;  2ZMF A;  4DE0 A;  2Y59 A;  3CWF A;  4IJG A;  5CGS A;  3ZG8 B;  3S22 A;  2D02 A;  3S4X A;  1FSY A;  3S7N A;  5CHM A;  3LO7 A;  2A49 A;  2HJ9 C;  1H8Z A;  1W8Q A;  1DRM A;  3KO6 A;  1O7E A;  1PIO A;  2VGL S;  5E43 A;  5CED A;  4ZAM A;  4NXE A;  3T1X A;  1LI9 A;  2NUT C;  4IVK A;  3C2W A;  3ZFZ A;  3A0S A;  1XP4 A;  4NET A;  3WS4 A;  2QYB A;  3BFF A;  3UO9 A;  5FEF A;  4MN6 A;  1I2S A;  4DMZ A;  5AQ7 A;  2Y2N A;  2XA7 S;  3C8C A;  1XFN A;  4HJ4 A;  4HQA A;  2J3W A;  3BJN A;  2XLN A;  4H6J B;  2XSS A;  5E2H A;  2P9V A;  2QKP A;  5CHJ A;  2BAS A;  5HFO A;  1CK3 A;  3N8L A;  5HL6 A;  4GD8 A;  3WRT A;  2W27 A;  3CG5 A;  3CJM A;  4QPR A;  1KGG A;  1MZU A;  4P6Z M;  1NYY A;  2W3H A;  3ZVT A;  4EQI A;  1F2K A;  1NY0 A;  1PWC A;  4HJ3 A;  4X6T A;  2HDQ A;  4FOF A;  3V5M A;  4ESP A;  4HP9 A;  2Y2I A;  1WA9 A;  4WMC A;  3QP1 A;  2KLI A;  3PAE A;  4Y15 A;  3IT9 A;  1UWP X;  4E3L A;  5EVL A;  4E04 A;  1YQS A;  4WF0 A;  5EE8 A;  1MKM A;  1Q2P A;  2IWD A;  3VOZ A;  5EVI A;  4WM9 A;  1ALQ A;  3C4P A;  1JTG A;  1NRF A;  2PYR A;  2HP9 A;  1DJA A;  3IBJ A;  2PT7 A;  3ZNT A;  4MNR A;  1AWI A;  4EU0 A;  1E4D A;  2H10 A;  3CPT B;  5CTN A;  4FTX A;  1TS7 A;  5IT5 A;  5HWV A;  4MDZ A;  4GHI A;  4OP8 A;  1FCN A;  1JWV A;  4XT2 B;  4LCL A;  3PHY A;  3SH7 A;  3GSG A;  5JYO A;  3KX0 X;  5GLB A;  4G3K A;  5A92 A;  2W0N A;  4BBU A;  2VZW A;  5U47 A;  2PYP A;  1RGZ A;  1TDL A;  5HAQ A;  1D1J A;  4RX3 A;  3HUN A;  2P9V B;  2A3U A;  1ES5 A;  3BWL A;  2A2L A;  3D9Y A;  1TF1 A;  3EEH A;  2ZC3 B;  3V39 A;  3OPL A;  3NC8 A;  2HDR A;  3R7W A;  4YWZ A;  4UEY A;  1IYO A;  4EXO A;  3UN7 A;  5FAS A;  4K91 A;  1Y4O A;  1BLS A;  2GDN A;  1S0W A;  2O9C A;  1KDW A;  2LB9 A;  2NUP C;  3LIE A;  1I5Q A;  4BBT A;  4LCM A;  3IX4 A;  3HLG A;  4OQG A;  3QP8 A;  1W63 M;  2W1R A;  4E3J A;  1N9B A;  2PU2 A;  1YMX A;  4UA7 A;  2BLS A;  1EWZ A;  3OCN A;  2B95 A;  4WZ5 A;  5EFW A;  4LEN A;  3MXQ A;  5FI2 A;  1YM1 A;  1UGU A;  3VE3 A;  3K3C A;  1NWZ A;  3HL9 A;  2GX5 A;  5EVI B;  2EFX A;  2VV6 A;  3SOI A;  1XJ3 A;  5L07 A;  3CMZ A;  3F1N A;  4R38 A;  2QJ5 A;  3WS2 A;  3WRZ A;  4RQ9 A;  4GOG A;  4EBP A;  3G6O A;  4PM7 A;  2K2N A;  4QY6 A;  4Y5F A;  4BJP A;  2HDS A;  2ZMA A;  2CMN A;  3WWX A;  1CI8 A;  4GHI B;  3BFG A;  3N4I A;  2X01 A;  3VP0 A;  1T18 A;  1P97 A;  1K54 A;  4OON A;  5CER A;  2IWC A;  5IS1 A;  2Z6C A;  4EEU A;  1G6O A;  4NKP A;  4MBK A;  2DMW A;  4OOL A;  3DWZ A;  1QME A;  1FOF A;  2C5W B;  2J80 A;  3E0Y A;  1RP5 A;  4K08 A;  5DFX A;  3NCK A;  2HZ5 A;  1T1B A;  2HJE A;  3NDE A;  3R7W B;  1K57 A;  4JGO A;  1PFL A;  1BTL A;  4ZJ2 A;  5EV0 A;  2V1Z A;  1H3Q A;  3CZD A;  5G4Y A;  1L0D A;  1KE4 A;  5DF7 A;  4EET B;  3OLO A;  1DY6 A;  3PBT A;  3O87 A;  1WYC A;  3UMD A;  3ZG5 A;  2L1M A;  4X53 A;  5DTS A;  2JN7 A;  3LID A;  2PD7 A;  3ZGA B;  4DXB A;  2XDM A;  3TJZ C;  4X69 A;  3BLM A;  1IYS A;  4KG2 A;  3A3J A;  5FI7 A;  1L3L A;  5F5Y A;  4FH4 A;  3MR0 A;  5F1F A;  1XA1 A;  3HCY A;  3ISG A;  3F1N B;  3V3S A;  3IHB A;  4WZ5 C;  1ZC2 A;  5EVE A;  2Y2L A;  5EUA A;  4G3V A;  2HV1 A;  1LSX A;  3SS4 A;  1CI9 A;  3MZE A;  3NHQ A;  4A5R A;  3LGO A;  1SZV A;  5A8B A;  4PMA A;  2VV8 A;  1H8Y A;  5L2F A;  3MQQ A;  1E3U A;  5J8X A;  1F98 A;  1G28 A;  5FQM A;  4OVD A;  1XJ4 A;  3TE8 A;  1IOU A;  5AVF A;  4II7 A;  3KSG A;  4R70 A;  3JVV A;  3MJQ A;  3RXW A;  2EXA A;  5FSR A;  3G2Z A;  4X1M A;  3LY3 A;  4UHU A;  4DN0 A;  4HP4 A;  4P6Z S;  4CLC A;  2JE5 A;  4KZ6 A;  4S2P A;  4HBT A;  1Q2Q A;  1TEM A;  1WYB A;  5J4E A;  4CLC E;  2WKP A;  3QP6 A;  1DP9 A;  4Q0J A;  1K56 D;  3EQV A;  5F69 A;  4DDS A;  3ITB A;  4X56 A;  4Y3I A;  3T4S A;  3N7W A;  1H5X A;  4FD8 A;  4EES A;  3OBF A;  1TS0 A;  1NZO A;  3LR4 A;  4BLM A;  1NJ4 A;  4EBN A;  1OME A;  2V0U A;  2HP5 A;  3GTC A;  2ZOI A;  2XQZ A;  3W2Z A;  1VET A;  1P0Z A;  2M1C A;  2WAF A;  3AGD A;  5EM0 A;  5FQQ A;  4Q0H A;  4HH2 A;  5JYP A;  1CJF A;  1ES4 A;  4PM5 A;  5FQ9 A;  1BSG A;  4P6B A;  1FR1 A;  2Y2K A;  4R3A A;  2WK0 A;  3RXX A;  3RTY A;  3FG8 A;  2XGN A;  4S2K A;  3LI9 A;  2ZL1 A;  5IHV A;  3JYI A;  1W5D A;  4L9G A;  2GJ3 A;  2I72 A;  2UV0 E;  1S67 L;  3E98 A;  2EX9 A;  3EGX C;  5CXW A;  1IKI A;  3WS5 A;  4Y7P A;  4Z1W A;  3H7W A;  2E8I A;  3IH8 A;  1ESU A;  3SH9 A;  5CEC A;  5A90 A;  2XEP A;  4Y13 A;  1ERM A;  2RCX A;  4CLC B;  1M6K A;  1ZHH B;  3N6I A;  4YNR A;  1DP8 A;  2VLG A;  5KMW A;  1GA0 A;  3EOI A;  5FDH A;  1Y28 A;  4KZA A;  1K25 A;  4OQ0 A;  3NOT C;  4LPZ A;  4KQR A;  2V20 A;  3HLD A;  2QMI A;  3VP2 A;  4KG6 A;  2QJ7 A;  4DJ3 A;  3NIA A;  2PU4 A;  3BLS A;  5CTM A;  2ZQA A;  2PD8 A;  4S2J A;  1L0F A;  3C5A A;  1DP6 A;  2AVX A;  3L9K A;  3T4K A;  4RA7 A;  5E2G A;  5G18 A;  5HDC A;  1XGI A;  1L0G A;  4C75 A;  2WGV A;  1VET B;  3OPR A;  5FAO A;  4XUX A;  5D3O A;  4I3A A;  4GB7 A;  2W3G A;  2ZC5 B;  5HD3 A;  4WYY A;  4FUW A;  2V8F A;  4OP5 A;  3ZVW A;  4OLG A;  2QZ6 A;  1DJC A;  3UDX A;  4JXV A;  2ZL1 B;  4QY5 A;  2WKR A;  2ZQD A;  3HJK A;  4E6W A;  3PBN A;  3H9W A;  3FKW A;  5M18 A;  1OTI A;  3H7W B;  4JXG A;  1JWZ A;  3T4O A;  1K38 A;  1GHI A;  1OTB A;  1L0E A;  2B5R A;  4IBR A;  2Z2L B;  2EWW A;  3RJU A;  2Y79 A;  5HAP A;  3FYZ A;  1KDS A;  1XA7 A;  5HPF A;  3IS2 B;  3SZT A;  2ZM8 A;  1P9W A;  3BEB A;  4YOF A;  5CGX A;  2IA2 A;  4ETZ A;  4ZDX A;  1T19 A;  2ZC4 B;  2Y2P A;  5GLC A;  3VE4 A;  3CPT A;  3JPU A;  3B47 A;  3NY4 A;  3GDI A;  3G34 A;  1OTA A;  5J3W A;  3CI6 A;  3CUE A;  4U3T A;  4B4X A;  2K7S A;  2L0W A;  2BTF P;  1Z09 A;  4XT2 A;  4RX2 A;  4DF6 A;  1LT0 A;  3C38 A;  3BM6 A;  3T1R A;  3VSL A;  4EQ1 A;  2Y2G A;  3UB9 A;  2ZD8 A;  2J9P A;  2O9A A;  4PM6 A;  5KZH A;  1TS6 A;  2JKT M;  4KZ5 A;  4HEF A;  4MEZ A;  3AGE A;  1ZG4 A;  2V0W A;  4IUK A;  2PRF A;  3CHW P;  1MC0 A;  2JKR M;  1BYW A;  3T4T A;  5DF9 A;  5HPI A;  3GRJ A;  4HNB A;  4IUH A;  3UB5 P;  2XFT A;  1JWP A;  4MMN A;  3RH8 B;  4NXF A;  3IXG A;  4U0X A;  4WLA A;  1XGJ A;  5L09 A;  2GNX A;  5FQK A;  4G3W A;  4GKU A;  5HWT A;  2R9X A;  3UE3 A;  3O5Y A;  5HL1 A;  2Z6D A;  3PAG A;  4JF6 A;  2J3T D;  4MLL A;  2G7U A;  1YLT A;  3HUM A;  3GV9 A;  3GEC A;  2Y55 A;  1IEL A;  2WZZ A;  2GZA A;  4JGP A;  3HLC A;  4DE2 A;  1KVL A;  2FFY A;  5M19 A;  2ZQ8 A;  4PM9 A;  3NOP C;  3ZG9 B;  3EWK A;  4L9E A;  4HJ6 A;  1FR6 A;  2Y2O A;  3IXD A;  3G32 A;  5FEG A;  3IX3 A;  3ZQ5 A;  1KE0 A;  1HVB A;  2I9V A;  4ZTK A;  4GJ4 A;  3KSF A;  4ETX A;  3CUE C;  1BLH A;  1PI4 A;  3E4Q A;  1K55 C;  4S2N C;  4X1L A;  2VV7 A;  5HW3 A;  1GHM A;  3S7Q A;  5KSH A;  1ONH A;  4FH2 A;  2LB5 A;  4I39 A;  3PR6 A;  5HX9 A;  3A3E A;  1KE3 A;  1M40 A;  2WYX A;  3LIB A;  4WN5 A;  2DRW A;  3A0R A;  4CPK A;  4F3L A;  1HTZ A;  1OTE A;  3T1Q B;  5TBM A;  5AQA A;  2W3D A;  4HHD A;  3TSG A;  2Y8H A;  2WKI A;  1JNU A;  3F1P A;  3UPP A;  3UB8 A;  3VOY A;  3CIT A;  3PYP A;  2W3E A;  3S1Y A;  2HPB A;  4Y0U A;  3NEC A;  4N9K A;  3G35 A;  4BWI A;  1SKO A;  4KZ3 A;  3TOI A;  1BT5 A;  2V2F F;  5TJJ A;  2H0T A;  3IWO A;  4I5S A;  1HLU P;  4LRZ E;  5DJT A;  3Q7V A;  2VX8 A;  3SW1 A;  3GQZ A;  1BLP A;  4JLF A;  5HAR A;  4R0Q A;  4LGW A;  3LR0 A;  1CF0 A;  2WGW A;  4XXR A;  4KZ8 A;  1NLZ A;  1YSQ A;  3QNB A;  4EUZ A;  4BMW A;  4D60 A;  3MKF A;  5I94 A;  1K0K A;  2ZBB A;  2OOL A;  5GLD A;  3BRM A;  5FAQ A;  1FCO A;  3I7J A;  4BD0 A;  5GHX A;  4IBX A;  3IWI A;  3PBO A;  5K5B A;  1VEU A;  4HES A;  5AVE A;  2Y4A A;  1T1A A;  1N9O A;  4LV3 A;  3O86 A;  4F3L B;  1RCJ A;  5TBM B;  3LI8 A;  3IXH A;  4B4Z A;  3ITA A;  4Z9Q A;  3S7P A;  5LBR A;  3RFB A;  3ZYT A;  1YLW A;  1FCM A;  3GVB A;  4R1G A;  2BG1 A;  3F1P B;  2L4R A;  4FCF A;  4YIN A;  1ES3 A;  2B18 A;  2VA0 A;  1GHP A;  1YKD A;  3HUO A;  3E2K A;  5E2F A;  4EWF A;  4KUK A;  1FSW A;  3FPV A;  1SKO B;  5HZH A;  5FDS A;  3H82 A;  1I2W A;  5EOE A;  1MY8 A;  3A3I A;  2K31 A;  4BEN A;  3LYX A;  4B9O A;  4S2O A;  3Q7V B;  3NBL A;  4OKP A;  2HF6 A;  5L8M A;  4HIA A;  3HVF A;  4PPR A;  2O99 A;  2WGW B;  2XA7 M;  4D2O A;  4Y17 A;  1T1C A;  2JKR I;  1L2S A;  3UDF A;  5A93 A;  3QP5 A;  2W3F A;  2Y2J A;  3LEZ A;  2FZ0 A;  4OLD A;  3B3X A;  4HI4 A;  2WGI A;  2J7V A;  5I5L A;  3GR2 A;  1ZTU A;  4GCZ A;  5FAP A;  4BL2 A;  4OOY A;  1VEU B;  3ICY A;  1BUL A;  3BFE A;  4MBH A;  5L10 A;  5DF8 A;  2XRN A;  4JXW A;  2RL3 A;  1PI5 A;  3VP1 A;  4DKI A;  2ZM0 A;  1GCE A;  3DTI A;  2C6W B;  4JKT A;  1CQA A;  4KZ4 A;  1XX2 A;  3A3F A;  1RGY A;  1A0K A;  5HD5 A;  3P7N A;  3IXB A;  3MQO A;  2V1B A;  1QMF A;  3MS6 A;  2VEA A;  4WUJ A;  3OOV A;  3H82 B;  1CEF A;  2ZM2 A;  2XF3 A;  2P04 A;  3MZD A;  4R4R A;  3VFH A;  3BFC A;  2V9A A;  4NXB A;  3BY8 A;  4EBL A;  3VMA A;  3KYZ A;  4E3O A;  2Q9M A;  4GD6 A;  4UQI M;  2QHK A;  1BUE A;  4JGR A;  1XKZ A;  4O7D A;  1F9I A;  1YMS A;  1JTD A;  4WMC D;  3V3R A;  4Y2F A;  4S2I A;  3MXR A;  4P0M A;  4WZ4 A;  2WUQ A;  4KZ7 A;  3IWQ A;  4E6X A;  5GL9 A;  1IYP A;  5EVI D;  1AXB A;  4EV4 A;  4NK3 A;  2PR6 A;  2EX2 A;  3EEA A;  3W4O A;  1ERO A;  4ARZ A;  1NRJ A;  3A0V A;  2H28 A;  2OLU A;  2VK3 A;  1FIK A;  4ME4 A;  4ZRR A;  4N9L A;  4S2L A;  4IHQ A;  2M7U A;  4GW9 A;  4Q0I A;  2J3T C;  5C5K A;  4LV1 A;  1D06 A;  3IS2 A;  3C7V A;  4OPR A;  5TGF A;  1PYY A;  3VSK A;  3D72 A;  3KYE A;  2UWX A;  4LV0 A;  3VV4 A;  1PWD A;  3E2L A;  3WS1 A;  4OQI A;  3VOL A;  2H5S A;  3PXP A;  4BQM A;  1HD8 A;  3FPW A;  3SS3 A;  4ID4 A;  4H8R A;  2H0Y A;  1H0M A;  1D7E A;  2WKQ A;  3CAX A;  5DKK A;  2DNS A;  3OPP A;  3OC2 A;  2B02 A;  3A3D A;  1N9L A;  1XJ6 A;  2EA9 A;  4LRY C;  3W4P A;  4HBU A;  1BZA A;  4FSF A;  1LHY A;  1YSP A;  3MMH A;  1KGF A;  4E3I A;  4B93 A;  2Y2M A;  5HDD A;  3UDI A;  4YFM A;  3NDG A;  3Q1F A;  3T50 A;  3W8K A;  1V9Y A;  2JC7 A;  3JVU A;  3ZNY A;  2WKH A;  1MWT A;  4KUO A;  2OAP 1;  3C30 A;  1OPX A;  2W1T A;  2A24 A;  5KIZ A;  3T4Q A;  3UNW A;  4C3Q A;  3P01 A;  4KZB A;  4I3J A;  5IU1 A;  1XJ2 A;  3KYQ A;  2XFS A;  3MXS A;  4ARZ B;  3HLF A;  3MFX A;  3DTE A;  4R6L A;  1P9R A;  4I3I A;  3FV7 A;  3U2A A;  1SDN A;  1YT4 A;  2OSU A;  3BY9 A;  2JKF A;  2WZX A;  5F83 A;  3OCL A;  3CLO A;  3K2N A;  4O8G A;  1LL8 A;  4DE3 A;  1TDG A;  1KOU A;  3IF6 C;  1W79 A;  5EOO A;  4E3M A;  1ZG6 A;  2JHE A;  3C4O A;  2IWB A;  5G4Z A;  4BL3 A;  1LSW A;  3Q07 A;  3ZDJ A;  3LFV A;  4GNU A;  3S7O A;  2YKH A;  2O9B A;  5FI6 A;  1GSX A;  1J3W A;  1K55 A;  4S2N A;  4L0L A;  5CGW A;  5F82 A;  1SCW A;  1PRQ A;  3HJI A;  4MN5 A;  1OT6 A;  3G2Y A;  1XPB A;  3NOU C;  4DXC A;  5M1A A;  3OZH A;  1ODV A;  1PZP A;  2VKS A;  1K56 A;  4GN2 A;  1IYQ A;  2QWS A;  3HBR A;  1J9M A;  2XD5 A;  4MCW A;  1FIL A;  3L7H A;  3UB7 A;  1NYM A;  1VM1 A;  1Z6F A;  2OWJ A;  4P87 A;  2W1T B;  2A24 B;  5TR7 A;  4JPM A;  2JCH A;  1G68 A;  4E3K A;  5J7E A;  4HH3 A;  5FAT A;  5DKL A;  3MZF A;  2P7J A;  1GSW A;  5EEC A;  2ZQ9 A;  1SHV A;  1TS8 A;  2V8C A;  3F1O A;  4PHT A;  3HLW A;  3D3O A;  3DTK A;  4KG5 A;  1W7F A;  1X0O A;  3IQA A;  3T4J A;  3LIF A;  1E3U D; 
#chains in the Genus database with same CATH homology
 1Y54 A;  2Y2Q A;  4ZJ1 A;  1DJB A;  3I7J A;  3ITB A;  1PW8 A;  4X56 A;  3N7W A;  1H5X A;  4K0X A;  4DDY A;  4BD0 A;  4FD8 A;  5GHX A;  4IVI A;  4WEL A;  4IBX A;  3IWI A;  3BEC A;  2ZC7 A;  3M2K A;  3PBO A;  5EPH A;  2FFF B;  4GZB A;  4HES A;  1NZO A;  4OOM A;  4WEJ A;  2Y4A A;  4R23 A;  5GHZ A;  1K4E A;  1NJ4 A;  3SH8 A;  4BLM A;  5KSC A;  4EBN A;  5CEB A;  2WAD A;  3W4Q A;  2ZQC A;  3UY6 A;  4LV3 A;  1OME A;  3O86 A;  2HP5 A;  3GTC A;  1TVF A;  3LY4 A;  2X02 A;  3IF6 B;  4UA9 A;  1RCJ A;  5FQI A;  4DE0 A;  2J9O A;  3IXH A;  4B4Z A;  2Y59 A;  3ITA A;  4Z9Q A;  2XQZ A;  3N8S A;  5CGS A;  4P85 A;  4R3B A;  3ZG8 B;  1W8Y A;  1YLW A;  1FCM A;  2WAF A;  3AGD A;  2Y2H A;  4Q8I A;  3GVB A;  5FQQ A;  4R1G A;  3S22 A;  4DE1 A;  4UAA A;  5JYP A;  1ES4 A;  2BG1 A;  5FAQ A;  1FSY A;  3OPH A;  1MWR A;  2XD1 A;  3Q82 A;  3S4X A;  4PM5 A;  5CHM A;  5GLA A;  1YLP A;  5FQ9 A;  1BSG A;  3LO7 A;  2A49 A;  4FCF A;  4YIN A;  4P6B A;  1ES3 A;  1H8Z A;  1GHP A;  1FR1 A;  2Y2K A;  3HUO A;  1W8Q A;  3IHA A;  3E2K A;  5E2F A;  1O7E A;  1PIO A;  4EWF A;  2WK0 A;  5E43 A;  3RXX A;  4DRT A;  1FSW A;  4ZAM A;  2XGN A;  5CED A;  4S2K A;  2ZJ9 A;  1WE4 A;  5IHV A;  1LI9 A;  3VFF A;  3ZHH A;  1I2W A;  3JYI A;  1W5D A;  3SS5 A;  2PBY A;  2VGK A;  5EOE A;  1MY8 A;  4IVK A;  2I72 A;  3A3I A;  1HZO A;  4BEN A;  2EX9 A;  5CXW A;  1IKI A;  3WS5 A;  5CHU A;  3ZFZ A;  1XP4 A;  4NET A;  4Y7P A;  3BYD A;  2E8I A;  3WS4 A;  3IH8 A;  4S2O A;  3Q7V B;  3NBL A;  3N8R A;  3BFF A;  4OKP A;  3UO9 A;  1ESU A;  3SH9 A;  5CEC A;  1I2S A;  3HVF A;  5A90 A;  1LL9 A;  4PPR A;  5AQ7 A;  2XEP A;  2DCF A;  2WGW B;  2Y2N A;  1ERM A;  2RCX A;  4D2O A;  1M6K A;  3DW0 A;  3N6I A;  3P09 A;  5KMW A;  1GA0 A;  5FDH A;  4OH0 A;  3UPN A;  3GMW A;  2XLN A;  1L2S A;  3UDF A;  5A93 A;  5A91 A;  4KZA A;  1K25 A;  4OQ0 A;  2Y2J A;  3LEZ A;  5E2H A;  4OLD A;  2P9V A;  3B3X A;  5CHJ A;  4JXS A;  2WGI A;  2J7V A;  3G4P A;  1SKF A;  4OPZ A;  4KQR A;  4S2M A;  2V20 A;  3HLD A;  2QMI A;  4RVA A;  1K6R A;  3GR2 A;  3VP2 A;  5BOH A;  4KG6 A;  5HFO A;  2OLV A;  1CK3 A;  3N8L A;  5FAP A;  4BL2 A;  4GD8 A;  3NIA A;  4OOY A;  3WRT A;  4CJN A;  2PU4 A;  3BLS A;  3CG5 A;  3CJM A;  3DTM A;  5CTM A;  1KGG A;  2ZQA A;  1EI5 A;  1BUL A;  3BFE A;  4MBH A;  4S2J A;  5DF8 A;  1L0F A;  3C5A A;  1NYY A;  4JXW A;  3ZVT A;  4RA7 A;  5E2G A;  2RL3 A;  1CEG A;  1PI5 A;  4EQI A;  2EFU A;  5G18 A;  1XGI A;  1NY0 A;  1L0G A;  3PBQ A;  3VP1 A;  4DKI A;  2ZM0 A;  4C75 A;  1PWC A;  1K6S A;  2WGV A;  4X6T A;  2HDQ A;  1GCE A;  3V5M A;  3C7U A;  3M6H A;  3UE1 A;  3OPR A;  1PZO A;  5FAO A;  4XUX A;  5D3O A;  2HDU A;  5EVI C;  2XR0 A;  3MKE A;  2Y2I A;  4GB7 A;  2ZC5 B;  4WMC A;  2Z2M B;  4WYY A;  2C6W B;  4JKT A;  3PAE A;  4KZ4 A;  3IT9 A;  1XX2 A;  3A3F A;  4E3L A;  1RGY A;  3IH9 A;  5EVL A;  1YQS A;  4OP5 A;  5EE8 A;  1Q2P A;  2IWD A;  3VOZ A;  3ZVW A;  3IXB A;  5EVI A;  1MPL A;  4OLG A;  2QZ6 A;  3MBZ A;  1QMF A;  1DJC A;  4WM9 A;  3UDX A;  1ALQ A;  4JXV A;  4QY5 A;  3C4P A;  1JTG A;  1NRF A;  4R3J A;  3G31 A;  1CEF A;  2HP9 A;  2ZM2 A;  2ZQD A;  2XF3 A;  1DJA A;  1NXY A;  4E6W A;  3ZNT A;  3PBN A;  4MNR A;  3MZD A;  4R4R A;  4UA6 A;  2ZLY A;  3FKW A;  3HRE A;  1E4D A;  1MBL A;  2H10 A;  3BFC A;  2EXB A;  3VFH A;  5M18 A;  3ZCZ A;  4IED A;  4JXG A;  1JWZ A;  1ZKJ A;  1K38 A;  5CTN A;  1GHI A;  1L0E A;  4EBL A;  2B5R A;  4IBR A;  2Z2L B;  4PM8 A;  5GHY A;  3RJU A;  3VMA A;  4E3O A;  2Q9M A;  1MKI A;  4GD6 A;  5HAP A;  3FYZ A;  1KDS A;  4OP8 A;  1BUE A;  1XA7 A;  3VP4 A;  1FCN A;  1XKZ A;  1JWV A;  3HLE A;  4O7D A;  1YMS A;  4LCL A;  3SH7 A;  1JTD A;  3GSG A;  2ZM8 A;  4WMC D;  4KQQ A;  3V3R A;  3ZG7 B;  5JYO A;  3M6B A;  1LI0 A;  4S2I A;  5HAI A;  3BEB A;  1N4O A;  3MXR A;  5GLB A;  2HP6 A;  3M2J A;  4P0M A;  5A92 A;  4WZ4 A;  2WUQ A;  5U47 A;  4KZ7 A;  5CGX A;  1RGZ A;  1TDL A;  3IWQ A;  5HAQ A;  4RX3 A;  4JF5 A;  3WS0 A;  2R9W A;  4ZDX A;  2EX6 A;  4Y0O A;  3HUN A;  2P9V B;  4E6X A;  5GL9 A;  2A3U A;  1IYP A;  1ES5 A;  5EVI D;  2ZC4 B;  1AXB A;  2Y2P A;  5GLC A;  2XH9 A;  4E3N A;  4EV4 A;  2G2U A;  4NK3 A;  3NY4 A;  2CC1 A;  2EX2 A;  2ZC3 B;  3V39 A;  2Y91 A;  2JBF A;  3W4O A;  3G34 A;  1ERO A;  3OPL A;  3NC8 A;  3FWL A;  3QHY A;  2HDR A;  2OLU A;  4U3T A;  4KZ9 A;  1IYO A;  3UN7 A;  4B4X A;  4N9L A;  4S2L A;  5FAS A;  4K91 A;  3DWK A;  1BLS A;  4LV1 A;  1JVJ A;  2GDN A;  4RX2 A;  4DF6 A;  1S0W A;  3FZC A;  1KDW A;  1PWG A;  1I5Q A;  4N92 A;  3BM6 A;  1MWU A;  3VSL A;  4LCM A;  2Y2G A;  3C7V A;  2EX8 A;  4OPR A;  2ZD8 A;  2J9P A;  3HLG A;  4OQG A;  4PM6 A;  5TGF A;  1PYY A;  3VSK A;  5KZH A;  2UWX A;  4E3J A;  1N9B A;  4LV0 A;  2PU2 A;  1YMX A;  4QU3 A;  1PWD A;  4C6Y A;  4UA7 A;  3E2L A;  4KZ5 A;  2BLS A;  4HEF A;  1EWZ A;  4MEZ A;  4OPQ A;  3OCN A;  3WS1 A;  3AGE A;  2ZQ7 A;  4WZ5 A;  4OQI A;  4LEN A;  1ZG4 A;  5FI2 A;  3UE0 A;  1YM1 A;  2H5S A;  3UPO A;  3PBS A;  4BQM A;  4N1X A;  3HL9 A;  1HD8 A;  5DF9 A;  4JBF A;  5EVI B;  2EFX A;  3D4F A;  3SOI A;  3SS3 A;  3CMZ A;  4ID4 A;  3GRJ A;  4H8R A;  1S6R A;  2H0Y A;  2XFT A;  1JWP A;  1FQG A;  3WS2 A;  3WRZ A;  3ZG0 A;  3IXG A;  2DNS A;  4U0X A;  4JF4 A;  4GOG A;  4EBP A;  1YLJ A;  1ESI A;  1KVM A;  3PBR A;  5F1G A;  2ZC6 B;  4PM7 A;  4QY6 A;  3OPP A;  3OC2 A;  4MBF A;  3A3D A;  1XGJ A;  1K54 C;  1U60 A;  4BJP A;  1G6A A;  5FQK A;  2HDS A;  3IF5 A;  3W4P A;  4GKU A;  1ES2 A;  4HBU A;  2R9X A;  1BZA A;  2ZMA A;  4FSF A;  1LHY A;  4OQH A;  3UE3 A;  3WWX A;  4Y0T A;  1KGF A;  1CI8 A;  1K4F A;  4E3I A;  2XK1 A;  2Y2M A;  5HL1 A;  3UDI A;  1ERQ A;  3BFG A;  3N4I A;  4YFM A;  2X01 A;  3VP0 A;  3PAG A;  3NDG A;  3Q1F A;  4JF6 A;  3W8K A;  4MLL A;  2JC7 A;  1K54 A;  1YLT A;  4OON A;  5DVA A;  2WKH A;  1MWT A;  3HUM A;  5AQB A;  3GV9 A;  3ZNY A;  5CER A;  2IWC A;  2Y55 A;  3VP3 A;  3PTE A;  1IEL A;  4LV2 A;  3MFD A;  2WZZ A;  4GDN A;  1K57 C;  4X68 A;  3TG9 A;  3HLC A;  3Q81 A;  4QHC A;  4MBK A;  4OOL A;  2WAE A;  3DWZ A;  4DE2 A;  1KVL A;  1QME A;  3UNW A;  1FOF A;  2C5W B;  4C3Q A;  4KZB A;  1RP5 A;  2FFY A;  5M19 A;  2X71 A;  2ZQ8 A;  4PM9 A;  4WEK A;  4ZJ3 A;  3ZG9 B;  4GDB A;  3NCK A;  2XFS A;  1FR6 A;  3MXS A;  3HLF A;  3NDE A;  1K57 A;  2Y2O A;  3FKV A;  1BTL A;  1GA9 A;  4ZJ2 A;  3IXD A;  2V1Z A;  3G32 A;  4WBG A;  3CZD A;  3FV7 A;  4OPY A;  1L0D A;  1KE4 A;  5DF7 A;  1SDN A;  1YT4 A;  2OSU A;  1KE0 A;  1DY6 A;  1HVB A;  3O88 A;  4QB8 A;  1MXO A;  4ZTK A;  3PBT A;  3O87 A;  2Q9N A;  3EQU A;  2WZX A;  5F83 A;  3OCL A;  5TFQ A;  1WYC A;  3ZG5 A;  4R4S A;  4DE3 A;  1BLH A;  1PI4 A;  4X53 A;  1K55 C;  1C3B A;  1TDG A;  4S2N C;  5DTS A;  5HW3 A;  3IF6 C;  1IKG A;  1GHM A;  1W79 A;  3ZGA B;  5EOO A;  1NZU A;  4DXB A;  5KSH A;  4E3M A;  1ONH A;  1ZG6 A;  1YLY A;  4FH2 A;  5AQ9 A;  4B88 A;  2XDM A;  5HX9 A;  3A3E A;  1KE3 A;  1M40 A;  3C4O A;  2WYX A;  2IWB A;  4X69 A;  3BLM A;  1IYS A;  4QD4 A;  4BL3 A;  4KG2 A;  3Q07 A;  3A3J A;  3ZDJ A;  5FI7 A;  5FQJ A;  1BLC A;  2DRW A;  4GNU A;  4K0W A;  5FI6 A;  4CPK A;  4FH4 A;  1K55 A;  4S2N A;  5F1F A;  1HTZ A;  1XA1 A;  5DTT A;  3IF6 A;  3ISG A;  4L0L A;  4DDS A;  1PW1 A;  5AQA A;  4QJG A;  3V3S A;  5CGW A;  5F82 A;  1SCW A;  3IHB A;  4WZ5 C;  1ZC2 A;  3NI9 A;  1LL5 A;  5CRF A;  1SDE A;  2Y2L A;  3TSG A;  5EUA A;  1VQQ A;  3BFD A;  3SS4 A;  3G2Y A;  1CI9 A;  1XPB A;  2WKI A;  2WKE A;  4F94 A;  3MZE A;  3UPP A;  4A5R A;  3VOY A;  4DXC A;  5M1A A;  3OZH A;  3Q7Z A;  1PZP A;  4ZBE A;  4PMA A;  1E25 A;  1H8Y A;  1K56 A;  2HPB A;  4GN2 A;  3S1Y A;  5L2F A;  1IYQ A;  1O07 A;  1E3U A;  4BD1 A;  4Y0U A;  3HBR A;  5J8X A;  1J9M A;  2XD5 A;  4N9K A;  1MWS A;  2QPN A;  3G35 A;  5FQM A;  4OVD A;  4KZ3 A;  3O3V A;  3TOI A;  1BT5 A;  1NYM A;  2V2F F;  4KQO A;  4RYE A;  3P98 A;  1VM1 A;  3V50 A;  1KGE A;  2H0T A;  3IWO A;  1Z6F A;  4P87 A;  5TR7 A;  2OV5 A;  4JPM A;  3Q7V A;  3G30 A;  2JCH A;  1G68 A;  3GQZ A;  3HLB A;  1BLP A;  4JLF A;  5HAR A;  4R0Q A;  4E3K A;  3RXW A;  4XUZ A;  2EXA A;  5FSR A;  3G2Z A;  2J8Y A;  5FAT A;  3MZF A;  3LY3 A;  4UHU A;  5EEC A;  2VGJ A;  5FA7 A;  2WGW A;  2ZQ9 A;  1ONG A;  1SHV A;  1XXM A;  3QNC A;  5E2E A;  4XXR A;  2JE5 A;  4KZ6 A;  4KZ8 A;  4N1H A;  4S2P A;  4HBT A;  1Q2Q A;  1TEM A;  3HLW A;  1YLZ A;  1WYB A;  4KG5 A;  1W7F A;  4M3K A;  3QNB A;  4EUZ A;  1LLB A;  3LCE A;  4U0T A;  3IQA A;  3MKF A;  5I94 A;  2P74 A;  5DTK A;  1K56 D;  3EQV A;  4X55 A;  3AGF A;  4KEN B;  1E3U D;  1IEM A;  5GLD A;  2G2W A;  3BRM A;  1FCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...