4LV3A

Ampc beta-lactamase in complex with (3,5-di-tert-butylphenyl) boronic acid
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Beta-lactamase
publication title Covalent docking of large libraries for the discovery of chemical probes.
pubmed doi rcsb
source organism Escherichia coli
total genus 112
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4lv3A00
3ZG0A 3ZVTA 4BL2A 4DRTA 1ZG6A 1DJCA 4R3JA 1FOFA 1SDEA 1N9BA 3MKFA 4BL3A 4DE2A 1YMSA 3ITBA 2WAFA 2R9XA 3PBQA 2XDMA 1N4OA 2ZQ9A 5CHUA 3V5MA 4HEFA 4ZDXA 4K91A 3BM6A 4HBUA 5EVID 1BLSA 5FATA 5HW3A 3V3RA 3HLFA 5EE8A 2V2FF 5HAPA 3MXRA 3UDXA 1IEMA 5CGWA 2EXBA 4S2KA 2RCXA 2WGWB 3Q7VB 5KSCA 3IXHA 3NI9A 1GCEA 3PTEA 5L2FA 3UPNA 3CZDA 4GDNA 3A3IA 3HL9A 1CI9A 1XKZA 5CERA 1G6AA 1FSYA 1PI5A 4S2NA 3VMAA 1ERMA 5F1GA 1RCJA 3IXBA 4X69A 2ZQAA 1ZC2A 3OCNA 5D3OA 4BENA 5CGSA 5F83A 3SS5A 4S2NC 1XX2A 3VOYA 3UE3A 3LY3A 2VGJA 1PIOA 4KZ9A 2XLNA 1HD8A 3O87A 4WEJA 4ZJ3A 1RGYA 4JLFA 4LV2A 3S4XA 2P9VA 4QJGA 2EX6A 4WZ5A 4EBNA 4O7DA 1BSGA 4WELA 1MWTA 1DY6A 3Q81A 2EFUA 3PBNA 1Y54A 3Q07A 1ES4A 2R9WA 5CHJA 3VP0A 1I2WA 2ZC6B 2Y2HA 3OPHA 1QMEA 4OVDA 2ZJ9A 2Q9NA 1K57C 4ID4A 3PAGA 3RJUA 4NETA 1FCMA 4R23A 1XXMA 4KZAA 1LI9A 2ZM0A 1O07A 5FQMA 4FH2A 4MLLA 5DVAA 4BJPA 5FDHA 1FR1A 2EX9A 5CTNA 5DTSA 3AGFA 2PBYA 2ZC7A 1XA1A 2Y2NA 4X6TA 5CHMA 4S2JA 4DXBA 2Y2MA 2A3UA 3UO9A 5E2GA 1K6SA 4K0WA 3AGDA 1CEFA 4E3NA 2H10A 1JWZA 4KG5A 5J8XA 1YMXA 3BEBA 1ES2A 5FSRA 5FI7A 3TG9A 1GA9A 4JF6A 1BUEA 5EPHA 3HLGA 2WZXA 3EQUA 3N8LA 2E8IA 1EWZA 5HL1A 2JCHA 3BFCA 3EQVA 3PBOA 4JKTA 2ZD8A 3M2JA 1NZOA 4KZ6A 4X53A 5M18A 4RYEA 5GHYA 1PI4A 2HDUA 2WKHA 4E6WA 4QB8A 2JC7A 1JTDA 1KVMA 5AQBA 5CECA 1GHPA 1L2SA 3ZG8B 1RGZA 4A5RA 2G2WA 4MEZA 2H0YA 2WYXA 3BFFA 4OQGA 4GDBA 3SH9A 3HVFA 1K56A 1BULA 1E4DA 1JVJA 2Y4AA 3UN7A 5M19A 2V1ZA 5DTTA 3MXSA 4HBTA 5FI6A 5A91A 3WRTA 1WYCA 4GD8A 2J9OA 5EUAA 2P74A 1GA0A 4IVKA 3G34A 4RX2A 4WMCA 1G68A 5BOHA 4R4SA 2Z2LB 1SHVA 3LY4A 3N4IA 4MBFA 2Y2GA 3S22A 4KZ7A 4DE0A 5DF8A 3JYIA 2ZQ7A 4N92A 1J9MA 2Y59A 4FD8A 3RXXA 2QZ6A 3W4QA 1K54A 1GHMA 1LLBA 2WZZA 1NRFA 1JWPA 4RA7A 5GLAA 5TR7A 1CEGA 1TDGA 5GHZA 4N1XA 4QHCA 3E2KA 2DRWA 3MBZA 1KGFA 2PU2A 4JBFA 3BFEA 2BG1A 4EBPA 4RVAA 1ES3A 1IKGA 4BD1A 4RX3A 5FAOA 3WS0A 1K55A 2Z2MB 3FWLA 4U0XA 2WAEA 4C3QA 5CEBA 5TGFA 3LO7A 2QPNA 5EVIC 3W4PA 2XR0A 4GZBA 2H5SA 2FFYA 3GV9A 4B4ZA 3HLDA 3PAEA 1PWGA 5U47A 2ZM8A 5EVIA 5EVLA 1ZG4A 2XK1A 1Q2QA 4F94A 2ZM2A 3FKVA 4OKPA 4QU3A 3ZG7B 4P0MA 4JXGA 3ZVWA 4DDYA 1W5DA 2IWDA 3UPPA 5KMWA 4GN2A 1XA7A 3GQZA 1HVBA 2VGKA 3MZFA 3M6HA 1FQGA 2Q9MA 1K4EA 1PWCA 4NK3A 3W8KA 2XEPA 5FQQA 5HAIA 3QHYA 3N6IA 5HX9A 2HDRA 1MBLA 4UHUA 4E3IA 3Q7ZA 4WZ5C 1MWUA 3C4PA 3NC8A 5EECA 3UY6A 3V50A 3G31A 4PM6A 1IYQA 4DKIA 2A49A 4XXRA 3UE1A 1ERQA 3HLBA 5A90A 4E3JA 1BTLA 4UAAA 4OPRA 3NY4A 4DF6A 5HAQA 3DTMA 5CEDA 1K6RA 3HLWA 3UDIA 1EI5A 3C7VA 5JYPA 1E3UD 5FQJA 4E3LA 3GMWA 1MXOA 1YLZA 4OOMA 4DE1A 3A3JA 2OV5A 5FA7A 1OMEA 2OLUA 5A93A 2HP5A 1K38A 3BLMA 2Y2QA 1YLWA 3VFFA 4E3KA 3FYZA 4QY5A 4S2PA 4ZJ1A 4Z9QA 4OH0A 1JWVA 3D4FA 4OPQA 1LL5A 3B3XA 4S2OA 3V39A 2XD1A 3CMZA 2HP9A 2V20A 1PZOA 1NXYA 1CK3A 1XPBA 1ESIA 3IF6C 3IXDA 5GLCA 3IF5A 3IHAA 4PMAA 4XUZA 2WGIA 4X68A 1SCWA 2Y2LA 3M2KA 5EOOA 3IF6A 1M40A 2B5RA 3IXGA 4IBRA 2JBFA 4L0LA 4OP8A 3MZDA 5FAPA 1IELA 2DNSA 1JTGA 3SOIA 3IT9A 3ZNYA 2ZMAA 3ZDJA 2WADA 4Y7PA 3NDEA 4ZTKA 5EVIB 3GRJA 5KSHA 1WE4A 1IKIA 1BLHA 3P09A 2HDSA 4WM9A 3OPRA 3PBRA 2EXAA 1L0FA 2Y2KA 4HESA 1H8ZA 4KG6A 2WGWA 4OPZA 4UA7A 1NZUA 2Y55A 2ZC4B 3VSKA 3OCLA 4S2IA 3LCEA 2BLSA 4EV4A 1I2SA 1PYYA 3SH7A 2ZQ8A 1XGIA 4R0QA 3A3DA 1SDNA 1W8QA 1MKIA 4X55A 3PBTA 2EX2A 2QMIA 4OP5A 3S1YA 3BLSA 1K54C 4CJNA 3ITAA 1IYOA 2H0TA 2P9VB 1SKFA 1KE3A 4ZAMA 3UNWA 4DE3A 5CGXA 1KVLA 3IWIA 3C7UA 3NCKA 1BLPA 3IWQA 1YLJA 4P85A 3ZGAB 2ZLYA 1PWDA 1GHIA 1TDLA 2ZC5B 3HUOA 4JXVA 3WS5A 4C6YA 1K55C 1L0EA 1VM1A 2XF3A 4Y0OA 4YFMA 4KG2A 5FAQA 2Y2JA 3RXWA 2XFTA 3VOZA 3G35A 4WBGA 2FFFB 5DTKA 3WS4A 4EQIA 4WEKA 3UDFA 2IWBA 5DF7A 1O7EA 1TVFA 2X02A 3Q82A 3HUMA 3O3VA 3WWXA 4MNRA 3E2LA 3AGEA 2C6WB 4Q8IA 4WYYA 5AQAA 4KQQA 3BFDA 2Y91A 5AQ7A 1L0DA 1BT5A 1BZAA 1IYSA 3BRMA 4OQ0A 3PBSA 4IVIA 1XGJA 5FQIA 1KE0A 3ZNTA 1M6KA 5GL9A 4OOLA 4JXWA 5A92A 1I5QA 1NYMA 3GTCA 4FCFA 5HARA 1YM1A 3HBRA 4KENB 4IBXA 2G2UA 1ZKJA 5CXWA 1L0GA 2XQZA 2Y2OA 3IF6B 3MFDA 2X01A 3VP1A 4EWFA 3ZG9B 4GD6A 4MBHA 3OPLA 5E2EA 1MWRA 1S0WA 5AQ9A 4N9LA 5FQKA 4BD0A 1W7FA 2UWXA 3OPPA 3C4OA 4N9KA 1ALQA 1NJ4A 2WKIA 5G18A 2EX8A 4MBKA 5HFOA 5GLDA 1ESUA 2HPBA 4DDSA 1ONHA 1YQSA 4KQRA 4KZ4A 5E43A 4E3OA 2EFXA 4ZJ2A 3GVBA 1XP4A 3VFHA 5KZHA 4C75A 5F82A 4KQOA 3ZCZA 3LEZA 4U3TA 5TFQA 3WS1A 2HP6A 1E3UA 2J7VA 2ZQDA 3CJMA 1CI8A 3WRZA 2ZQCA 3HUNA 1H8YA 1W8YA 1WYBA 2C5WB 1MWSA 1EROA 4X56A 3VSLA 4E6XA 3TSGA 3N8RA 4LV3A 1Z6FA 2JE5A 4E3MA 4K0XA 2Y2IA 4Y0TA 5E2FA 1U60A 1H5XA 3BFGA 1TEMA 2X71A 3GSGA 2ZC3B 3MZEA 3QNBA 4JF5A 4OQIA 3HREA 5FI2A 4LENA 4LCMA 3ZHHA 5CTMA 3I7JA 5JYOA 5FASA 3G30A 4OPYA 4GOGA 4CPKA 4S2LA 5GLBA 4BLMA 3CG5A 5I94A 3HLEA 3O86A 3GR2A 3UE0A 4QD4A 4FH4A 1K57A 5FQ9A 2PU4A 1NYYA 3IQAA 3VP4A 4B4XA 4KZBA 1IYPA 2CC1A 4GB7A 3MKEA 4B88A 1KGEA 4LV1A 3OC2A 4P6BA 1FR6A 1KDWA 4H8RA 4JXSA 4KZ5A 4XUXA 5CRFA 5E2HA 1VQQA 4M3KA 3SS3A 1LL9A 4S2MA 1KDSA 3O88A 2I72A 1S6RA 3G4PA 5EOEA 1PW8A 2XH9A 4FSFA 3Q7VA 2DCFA 1W79A 3N8SA 1LHYA 1YLYA 3ISGA 2RL3A 4Y0UA 3NBLA 4YINA 1ES5A 4GKUA 3M6BA 1HZOA 3ZFZA 4JF4A 3C5AA 3TOIA 3SH8A 5F1FA 3BYDA 2OLVA 4PM9A 2WK0A 4OQHA 2HDQA 1E25A 3P98A 3N7WA 2WUQA 1FCOA 2WKEA 1BLCA 2Y2PA 3BECA 3DWZA 3IH8A 3HLCA 4GNUA 5M1AA 1NY0A 3G2ZA 3VP2A 1K4FA 3A3EA 2XFSA 4WZ4A 3UPOA 1QMFA 2XD5A 3G2YA 3V3SA 4ZBEA 1FCNA 2WGVA 4PPRA 1YLPA 2J9PA 1KE4A 1YT4A 3IH9A 2XGNA 3FV7A 1MY8A 4OOYA 4R3BA 1RP5A 1K56D 2GDNA 3A3FA 3NIAA 4KZ8A 1AXBA 4KZ3A 4PM7A 3FKWA 4UA9A 4JPMA 3ZG5A 1KGGA 1YLTA 3DW0A 1LI0A 4U0TA 4WMCD 4EBLA 3Q1FA 4OONA 3OZHA 4R1GA 4LCLA 1C3BA 1PZPA 5DF9A 4D2OA 4LV0A 3SS4A 4QY6A 1PW1A 3DWKA 1DJAA 2IWCA 4UA6A 1K25A 1MPLA 3NDGA 1FSWA 5IHVA 4EUZA 4BQMA 4PM5A 3QNCA 4OLDA 3WS2A 3IHBA 2OSUA 1DJBA 4IEDA 4DXCA 3VP3A 1HTZA 3IWOA 3W4OA 2J8YA 4PM8A 4N1HA 5GHXA 1Q2PA 1ONGA 3FZCA 4OLGA 4R4RA 3G32A 4P87A
chains in the Genus database with same CATH superfamily
4BL2A 4DRTA 3D9YA 3VE3A 1DJCA 1FOFA 4BL3A 1N9BA 3PBQA 2XDMA 2ZQ9A 3FPWA 4L9FA 1BYWA 2ACGA 4EW7A 2HZ5A 3HCYA 3BM6A 4IJGA 5EVID 3EGDC 3HLFA 5EE8A 4HIAA 5KSCA 3IXHA 3UPNA 3VMAA 1XKZA 5CERA 1G6AA 2V0WA 3H7WB 3T4LA 1OT6A 2J3WA 1ZC2A 3OCNA 5D3OA 5CGSA 3BQ8A 1XX2A 3UE3A 3MFXA 4CQHA 4KZ9A 3O87A 1N9OA 4JLFA 4QJGA 4HH2A 3VP0A 3Q07A 1Y54A 5CHJA 2R9WA 3U4LP 2ZC6B 2Y2HA 3OPHA 4OVDA 3PAGA 4R23A 3IX4A 4MLLA 3BY9A 2VA0A 5FDHA 1EW0A 1XA1A 2Y2NA 3K3DA 1OTBA 5CHMA 5L10A 4S2JA 4DXBA 2W27A 3KSGA 5E2GA 5HZHA 1OJGA 2H10A 5J8XA 3BEBA 2W3EA 4PHTA 3PXPA 3HLGA 3N8LA 1EWZA 2HF6A 2JCHA 3P7NA 3PBOA 2UV0E 3OBFA 1NZOA 3MXQA 5M18A 4RYEA 5HWTA 1PI4A 5DKLA 2W3HA 2JC7A 3LFVA 1KVMA 5CECA 1GHPA 4NG2A 3C2WA 4MEZA 4I39A 1DP9A 2K7SA 1BULA 4PAUA 3JVUA 2J9OA 4HOIA 3LGOA 1GA0A 4Y15A 1G68A 4R4SA 1SHVA 2Y2GA 2Y59A 4CLCC 4FD8A 1K54A 5GHZA 4N1XA 4JBFA 2W1TA 4D60A 2PU2A 3BFEA 4EBPA 2PYPA 4RX3A 1N9NA 2Q0OA 3WS0A 2Z2MB 3FWLA 2WAEA 5AVEA 5CEBA 5EVIC 3GV9A 5DJUA 3PAEA 1X0OA 3JVVA 5EVIA 3S7OA 2VV7A 3GQZA 3MZFA 3NOUC 4G3VA 3ZYTA 4NK3A 3W8KA 3N6IA 4UHUA 4QWOA 1T1AA 2PT7A 4WZ5C 4I3AA 1S4RA 4PM6A 4DKIA 2A49A 3UE1A 1UWNX 5HDDA 4QPRA 5HAQA 2GX5A 5FQJA 1YSQA 1OTAA 3UB6A 4L9EA 4E3LA 5J7EA 4OOMA 1G5UA 2V8FA 2OV5A 1ODVA 5A93A 3BLMA 1K38A 2HGVA 2Y2QA 4QY5A 4ZJ1A 3V39A 3LI8A 2XD1A 2O0YA 3V67A 1IFQA 1XPBA 2W1TB 4XUZA 2VX8A 1SCWA 4MCWA 3UB5P 2ZOIA 4IBRA 4L0LA 3F1NA 4NXFA 5EVIB 2QYBA 5KSHA 2VGLS 4HESA 1H8ZA 4Y2FA 2ZC4B 3OCLA 4S2IA 2BLSA 3SH7A 4I38A 3QP2A 2EX2A 2QMIA 3MJQA 3BLSA 4F3LA 4CJNA 1KOUA 2KX6A 2P9VB 1SKFA 5CGXA 1H8MA 5TJJA 1TDLA 2ZMFA 5HD3A 2XF3A 4Y0OA 4KG2A 3VOZA 4WBGA 4EQIA 4WEKA 1O7EA 1TVFA 5FDSA 2ZBBA 3WWXA 4MNRA 3DBAA 1N9LA 2PBDP 2VK3A 2Y91A 1BZAA 3CHWP 4OQ0A 2OOLA 1XGJA 2JHEA 4OOLA 5F5YA 2LB9A 1I5QA 1NYMA 4FCFA 3B33A 5HARA 4KENB 1CQAA 4IBXA 1ZKJA 4IHQA 4ETZA 3OPLA 5E2EA 1S0WA 5FQKA 2UWXA 3F1NB 1NJ4A 2PHYA 2WKIA 5G18A 4MBKA 1OTDA 5HFOA 2FH5A 1ESUA 1ONHA 4KQRA 5E43A 4E3OA 2XRNA 4C75A 1D7EA 5F82A 4U3TA 2HP6A 3CJMA 1CI8A 2ZQCA 2JN7A 3R4KA 3VSLA 4F3LB 3TSGA 3KYQA 1OT9A 4KUKA 4E3MA 1Y4OA 2JKGA 4S2NA 3QNBA 3MQOA 4JF5A 4LENA 4LCMA 5CTMA 1P0ZA 1LSVA 4OPYA 5I94A 4YOFA 2P08A 4GLQA 1D1JA 5FQ9A 1NYYA 4G3WA 1IYPA 1KGEA 3VOLA 4P6BA 4H8RA 4KZ5A 1P9WA 3SS3A 5A8BA 1V9YA 4S2MA 1KDSA 3O88A 2I72A 1S6RA 2XH9A 1LSXA 2DCFA 5HPIA 3N8SA 1YLYA 4LLOB 3KYEA 3QP5A 4GKUA 3M6BA 3LR0A 4P6ZM 4PM9A 1XJ4A 2HDQA 2MJ6A 3P98A 3N7WA 2WUQA 3DWZA 1A0KA 1NY0A 4EETB 4HJ3A 4PKYG 1K4FA 5IU1A 1FILA 1S1ZA 4PPRA 1KE4A 1RP5A 2P7JA 1KGGA 4DMZA 4U0TA 3SZTA 4EERA 4E04A 3O5YA 4EBLA 5HSQA 3KSFA 3NECA 5EFWA 3DWKA 4OLDA 3IHBA 3W4OA 4PM8A 5GHXA 4OLGA 4P87A 3ZG0A 4R3JA 1SDEA 2WAFA 2WKQA 5AJGA 4I3IA 1GSWA 4MN6A 5FATA 4NXEA 5K5BA 3MXRA 1IEMA 3T4JA 3LIEA 1NLYA 2RCXA 2KDKA 2WGWB 1GCEA 2AVXA 3CZDA 3A3IA 1FSYA 1PI5A 2P04A 1RCJA 4X69A 3LIDA 3SS5A 3LICA 3CPTA 1PIOA 3LIAA 4WEJA 4ZJ3A 4X1MA 3S4XA 3E4PA 1DY6A 3PBNA 2Y8HA 4HH3A 3CITA 2ZM0A 3R7WA 4BJPA 1FR1A 2PBYA 2ZC7A 2PD8A 4M4XA 3T4SA 2EWVA 2YKHA 3F1PA 1JWZA 5FI7A 1W63M 5GHYA 3LR4A 2HDUA 2INWA 5AQBA 3ZG8B 2JKTM 3BFFA 1SKOA 3EOIA 2Y4AA 3UN7A 1JVJA 5DJTA 5M19A 2XROA 2V1ZA 3WRTA 4GD8A 2J3TD 4RX2A 5BOHA 2Z2LB 2V9AA 3LY4A 3N4IA 3CPTB 4GW9A 4JGPA 5EM0A 4N92A 4Z1WA 2QZ6A 3W4QA 5GLAA 1NRFA 3E2KA 2DRWA 4Q0IA 3ULFA 3A0SA 3B47A 3T1RA 5FAOA 2W0NA 4U0XA 2IA2A 3LO7A 3IBJA 1PRQA 4GZBA 4HP9A 3HLDA 1PNEA 1PWGA 2Z6CA 1Q2QA 3ZQ5A 3EWKA 1W63Q 4GHIA 4QU3A 4P0MA 4JXGA 4UQIM 3ZVWA 1W5DA 2IWDA 3TW8A 4GN2A 1XA7A 2Q9MA 3KSHA 1K4EA 2XEPA 2L0WA 1DP8A 5FQQA 1Z09A 1F9IA 3QHYA 2HDRA 4E3IA 4EU0A 3H82A 1IYQA 4XXRA 4O0PA 4LRZE 1BTLA 4UAAA 4OPRA 3UB8A 3NY4A 5CEDA 1K6RA 5LBRA 3UDIA 4ESPA 1EI5A 3C7VA 1E3UD 3GMWA 4O8GA 1OMEA 2OLUA 5FA7A 4JGOA 2O9CA 3VFFA 1D06A 4S2PA 1JWVA 3D4FA 1LL5A 4S2OA 3CMZA 2HP9A 1GSXA 3PR6A 3E4QA 2V20A 3T12B 1NXYA 4WUJA 3IXDA 1DRMA 2WGIA 4X68A 3JPUA 3T4OA 1M40A 3IXGA 2JBFA 4YNRA 2V8CA 3MZDA 5FAPA 3SOIA 2WADA 4Y7PA 3NDEA 5EVEA 3C8CA 1WE4A 1IKIA 4WM9A 2D01A 3OPRA 3PBRA 3NHQA 4GHIB 2EXAA 1L0FA 4KG6A 2JKTI 1OPXA 2J3TC 2Y2KA 4UA7A 1NZUA 3CI6A 4FTXA 1I2SA 1PYYA 1XGIA 3A3DA 3LR5A 1SDNA 2DMWA 4X55A 4OP5A 3OOVA 4IUKA 1K54C 4HHDA 2H0TA 3UNWA 3IWIA 3C7UA 3IWQA 4P85A 4C6YA 3RXWA 2BTFP 1MC0A 2XFTA 2FFFB 3UDFA 2IWBA 5DF7A 3Q82A 1VB6A 3O3VA 1S67L 3E2LA 3AGEA 4WYYA 3BFDA 3CUEA 1ZHHB 5FQIA 4EEPA 5GL9A 5A92A 3GTCA 1G28A 4Y13A 5HWWA 1YM1A 2G2UA 2X01A 2XQZA 2Y2OA 3VP1A 4EWFA 1JNUA 4LRYC 4GD6A 5AQ9A 4N9LA 4BD0A 2VZWA 3C4OA 4N9KA 3HJKA 3GDIA 2EX8A 4DDSA 1YQSA 4ZJ2A 3GVBA 4HJ6A 5CX7A 3ZCZA 3LEZA 3LI9A 4WLAA 1E3UA 2J7VA 2ZQDA 3HUNA 5DFYA 1H8YA 2C5WB 3HJIA 4X56A 2W1RA 4E6XA 3N8RA 1Z6FA 3T4QA 4Y0TA 2YKFA 1ACFA 5FASA 3G30A 4GOGA 4CPKA 5GLBA 3CG5A 1XJ2A 3BWLA 3HLEA 3O86A 1XFQA 3UE0A 1K57A 4BWIA 2PU4A 3IQAA 3DAVA 2L4RA 1VETA 1XFNA 4GB7A 3MKEA 3OC2A 1KDWA 4JXSA 2QJ5A 4Y5FA 1LL9A 3K3CA 2W3DA 1PW8A 4FSFA 3UB7A 3NOPC 4P6ZS 1W79A 1LHYA 2RL3A 1P97A 1ES5A 1HZOA 4JF4A 1YPRA 3SH8A 2OLVA 4OQHA 1NRJA 1S66L 2Y2PA 3IH8A 3MSHA 4WZ4A 1QMFA 2XD5A 3T4KA 3G2YA 2KOIA 4ZBEA 2EA9A 1FCNA 2WGVA 3B42A 4K08A 2JKFA 2J9PA 4HP4A 2K2NA 4OOYA 2NUPC 3A3FA 4KZ8A 3ZG5A 1YAXA 4PM7A 2QWSA 4JPMA 4RQ9A 3S7PA 3DW0A 1TD5A 4AFIA 3Q1FA 3OZHA 4D2OA 1PW1A 2IWCA 2V0UA 3NDGA 4EUZA 4BQMA 3LIBA 3WS2A 1S4SA 4DXCA 3VP3A 1HTZA 3IWOA 4N1HA 3FZCA 3LEQA 3IX8A 3ZVTA 1VETB 3MKFA 1P9RA 1YMSA 3ITBA 5CHUA 4EESA 4ZDXA 4HEFA 4JGRA 4K91A 5FL3A 4HBUA 1BLSA 4GJ4A 5J3WA 3V3RA 5HAPA 3UDXA 4S2KA 2ZMVA 2HV1A 3PTEA 4NXGA 3HL9A 5KZHA 1CI9A 2ZQAA 4S2NC 3TRCA 1T19A 2VGJA 2XLNA 2ZL1A 1RGYA 4LV2A 4EBNA 4O7DA 4WELA 3Q81A 1ES4A 1QMEA 2E8JA 1FCMA 3VE4A 4KZAA 2W3FA 3PHYA 5DVAA 5EM1A 2EX9A 3AGFA 3PYPA 1OTEA 4II7A 2XA7S 2A24A 4IUHA 3IS2A 2Y2MA 1TS0A 1K6SA 3AGDA 4E3NA 3NOTC 4KG5A 1ES2A 5FSRA 3TG9A 1GA9A 4FUWA 4JF6A 5EPHA 2WZXA 4MN5A 3MS6A 5HL1A 3BFCA 2HJ9C 3OLOA 3EQVA 3RFBA 2R78A 4KZ6A 1H3QA 1SZVA 2WKHA 4E6WA 4QB8A 1L2SA 2G2WA 4EXOA 2WYXA 3MR0A 4OQGA 3SH9A 3QP1A 5DTTA 3MXSA 4G3KA 5EUAA 3G34A 5G4ZA 4R70A 2VJWA 5EV0A 5TBMA 4MBFA 2ZL1B 4EUVA 4B93A 3JYIA 1J9MA 1GHMA 1LLBA 2WZZA 1JWPA 5TR7A 1CEGA 1TDGA 4QHCA 1ES3A 3RTYA 2OAP1 4DJ3A 4BD1A 1K55A 2B02A 5TGFA 2QPNA 3W4PA 4Y17A 2H5SA 5L07A 4B4ZA 3S7QA 5U47A 2A24B 3H9WA 3IS2B 3QP4A 1ZG4A 5EVLA 4F94A 3FKVA 5MC7A 3ZG7B 3UPPA 4R3AA 2O9AA 1NWZA 1MBLA 2O9BA 5DFXA 3Q7ZA 1MWUA 3C4PA 3NC8A 3F1OA 3FPVA 5J4EA 5HL6A 1ERQA 4E3JA 2V1BA 2O99A 1ZTUA 3A3JA 4R38A 1TF1A 5TBMB 1YLWA 4E3KA 3FYZA 4OH0A 4OPQA 3LR3A 5L09A 1PZOA 1IOUA 3A0VA 4Q0JA 3IF5A 3IHAA 4PMAA 4I3JA 3M2KA 5IS1A 4KUOA 3MF0A 2W3GA 5F69A 2DNSA 1JTGA 5HDCA 2ZMAA 3GRJA 1BLHA 3P09A 4XT2A 1PFLA 4HQAA 3LCEA 4EV4A 2ZQ8A 1LSWA 4R0QA 4WF0A 1T1BA 3PBTA 3S1YA 3F1OB 3ITAA 2BASA 5I5LA 3G6OA 1KE3A 3ZGAB 2ZLYA 1PWDA 3HUOA 4YFMA 1VM1A 3G35A 5DTKA 3WS4A 1VEUA 3R7WB 3CWFA 3KSIA 2C6WB 4Q8IA 3CAXA 4NXBA 5G4YA 5AQ7A 1BT5A 1H0MA 3MMHA 3ZNTA 1KE0A 3RH8B 1YKDA 1M6KA 3T1QB 3F1PB 4CLCD 3HBRA 4GS9A 1L0GA 5FEGA 4HI4A 4MBHA 3T4TA 3OPPA 3ICYA 3LIFA 4MDZA 2HPBA 1Y28A 2PR6A 4XT2B 3BW6A 1J3WA 2VEAA 1SKOB 3A0RA 3WRZA 1W8YA 3BJNA 4LV3A 1DP6A 5E2FA 1H5XA 2ZC3B 3MZEA 4OQIA 3ZHHA 2M1CA 5HWVA 1YSPA 3EGXC 1CJFA 1F98A 4WL9A 5HDSA 1VEUB 1G6OA 4B4XA 2CC1A 3U2AA 4Y3IA 2OWJA 5CRFA 5E2HA 1VQQA 2QKPA 4GS9B 3EEHA 3Q7VA 1NLZA 4DN0A 3ISGA 3NBLA 3ZFZA 3C5AA 3TOIA 5C5KA 3IBRA 2WK0A 1E25A 2WKEA 5M1AA 4GNUA 3G2ZA 3VP2A 2XFSA 3H82B 3UPOA 1TS6A 4JGQA 1YLPA 1YT4A 4R3BA 2XGNA 1MY8A 1K56D 3NIAA 3KYZA 1AXBA 4KZ3A 4UA9A 3FKWA 4BBUA 4NKPA 4WMCD 3CUEC 3FC7A 4O01A 4ARZA 2HJEA 1PZPA 2VV8A 5F68A 3SS4A 1DJAA 4UA6A 1MPLA 5IHVA 1FSWA 4PM5A 3QNCA 5AVFA 5FEFA 4IEDA 4CLCA 2PAVP 4B9OA 4R6LA 3C38A 3E0YA 4R4RA 4EEUA 4ETXA 1ZG6A 4DE2A 2R9XA 1TS8A 1N4OA 3V5MA 4L9GA 5HW3A 2V2FF 1XJ3A 5CGWA 2EXBA 3Q7VB 4Q0HA 3NI9A 5L2FA 4GDNA 2PR5A 3S7NA 3E98A 3T1SA 1ERMA 5F1GA 3IXBA 1TS7A 4BENA 5F83A 2FZ0A 2GZAA 3UB9A 3LYXA 3VOYA 3LY3A 1HD8A 1MZUA 2P9VA 2EX6A 4WZ5A 2JKRM 1BSGA 1MWTA 2EFUA 3DTEA 1I2WA 2ZJ9A 2Q9NA 1K57C 4ID4A 1OJ5A 4YWZA 3RJUA 4NETA 1XXMA 1LI9A 1O07A 5FQMA 4FH2A 4ARZB 4LPZA 5CTNA 5DTSA 2K31A 4X6TA 1L3LA 2A2LA 2A3UA 3UO9A 4CLCB 2KLIA 4K0WA 1XJ6A 1CEFA 1VHMA 3SW1A 4ME4A 3BQAA 1YMXA 2VV6A 1BUEA 1LT0A 3EQUA 2E8IA 4MMNA 4JKTA 2ZD8A 3M2JA 4X53A 4GCZA 3P01A 1JTDA 1RGZA 1V9ZA 5HPFA 4A5RA 3D72A 2H0YA 4GDBA 3HVFA 1K56A 1E4DA 3CLOA 4HBTA 5FI6A 5A91A 2GNXA 1WYCA 1MKMA 2P74A 4IVKA 4WMCA 2VKSA 1T18A 3S22A 4KZ7A 4DE0A 2CMNA 4LFUA 5DF8A 3GECA 4BBTA 2ZQ7A 2B95A 3RXXA 4RA7A 1AWIA 3MBZA 1KGFA 2BG1A 4RVAA 5IT5A 3MQQA 4HNBA 1IKGA 2D02A 1UWPX 2J80A 4ZRRA 4C3QA 2XR0A 2FFYA 1STZA 2ZM8A 2PYRA 3K2NA 2XK1A 2ZM2A 4NEED 4DJ2A 4OKPA 3FG8A 1WA9A 4DDYA 3DTKA 5KMWA 1HVBA 2VGKA 3IX3A 3M6HA 1FQGA 1PWCA 2V1AA 1LL8A 5HAIA 5HX9A 5HD5A 3BY8A 3C30A 4X25A 5EECA 3UY6A 3NJAA 3V50A 3G31A 2GJ3A 5A90A 3HLBA 2JKRI 4DF6A 3DTMA 3HLWA 5JYPA 1MXOA 1YLZA 4DE1A 4PKYA 2Z6DA 4BMWA 4FOFA 1OTIA 2HP5A 4Z9QA 3B3XA 3MQ0A 3KX0X 3E4OA 4KQDA 1CK3A 1ESIA 3IF6C 5KIZA 5GLCA 3VV4A 4HY8A 2Y2LA 5EOOA 2XSSA 3IF6A 2B5RA 4OP8A 1IELA 3IT9A 3ZNYA 3ZDJA 4ZTKA 2WKPA 1T1CA 2EWWA 2HDSA 3QP8A 2WGWA 4OPZA 2VGLM 4HJ4A 2Y55A 3VSKA 2OAQ1 2LB5A 3TJZC 4LGWA 1W8QA 1MKIA 2M7UA 3UMDA 2Y79A 1IYOA 2ZOHA 4ZAMA 4DE3A 1KVLA 3NCKA 1BLPA 1YLJA 2PRFA 1GHIA 2ZC5B 4JXVA 3WS5A 1K55C 1L0EA 5FAQA 2Y2JA 2X02A 3HUMA 3EEAA 5AQAA 4KQQA 4I5SA 1GSVA 1L0DA 1IYSA 3BRMA 3PBSA 4IVIA 4UQIS 2WKRA 4JXWA 1UGUA 5CXWA 3IF6B 3MFDA 1FIKA 5L8MA 3ZG9B 1MWRA 2H28A 1W7FA 3UE6A 2VLGA 1ALQA 5GLDA 1HLUP 1S1YA 4KZ4A 2EFXA 1XP4A 3VFHA 5F6AA 3LUQA 4KQOA 5TFQA 2PD7A 3WS1A 4BBVA 1F5MA 3QP6A 2B18A 2NUTC 1WYBA 1MWSA 1EROA 4H6JA 2JE5A 4K0XA 2G7UA 2Y2IA 1U60A 3BFGA 1TEMA 2X71A 3GSGA 5FI2A 3HREA 3I7JA 5JYOA 4X1LA 3DTIA 4WN5A 3UMEA 4S2LA 4BLMA 5DKKA 3D3OA 2PDRA 3KO6A 3GR2A 4QD4A 4FH4A 3VP4A 4KZBA 1CF0A 4B88A 4LV1A 1FR6A 4XUXA 4M3KA 2XA7M 2I9VA 1F2KA 3G4PA 5EOEA 3T1XA 2OWHA 4LRXC 4Y0UA 4YINA 5F1FA 3BYDA 4EQ1A 3H7WA 4MN7A 1FCOA 1BLCA 3BECA 3HLCA 2L1MA 3A3EA 3TE8A 3V3SA 4UEYA 3IH9A 3NULA 3FV7A 2GDNA 1YLTA 1LI0A 2QHKA 4OONA 3L7HA 5DF9A 4H6JB 4LCLA 1C3BA 4R1GA 3T50A 4LV0A 4QY6A 1K25A 2QJ7A 1K0KA 2OSUA 1DJBA 2M7VA 2J8YA 4CLCE 1Q2PA 1ONGA 3L9KA 3G32A 3W2ZA
chains in the Genus database with same CATH topology
3ZG0A 3ZVTA 4BL2A 4DRTA 1ZG6A 1DJCA 4R3JA 1FOFA 1SDEA 1N9BA 3MKFA 4BL3A 4DE2A 1YMSA 3ITBA 2WAFA 2R9XA 3PBQA 2XDMA 1N4OA 2ZQ9A 5CHUA 3V5MA 4HEFA 4ZDXA 4K91A 3BM6A 4HBUA 5EVID 1BLSA 5FATA 5HW3A 3V3RA 3HLFA 5EE8A 2V2FF 5HAPA 3MXRA 3UDXA 1IEMA 5CGWA 2EXBA 4S2KA 2RCXA 2WGWB 3Q7VB 5KSCA 3IXHA 3NI9A 1GCEA 3PTEA 5L2FA 3UPNA 3CZDA 4GDNA 3A3IA 3HL9A 1CI9A 1XKZA 5CERA 1G6AA 1FSYA 1PI5A 4S2NA 3VMAA 1ERMA 5F1GA 1RCJA 3IXBA 4X69A 2ZQAA 1ZC2A 3OCNA 5D3OA 4BENA 5CGSA 5F83A 3SS5A 4S2NC 1XX2A 3VOYA 3UE3A 3LY3A 2VGJA 1PIOA 4KZ9A 2XLNA 1HD8A 3O87A 4WEJA 4ZJ3A 1RGYA 4JLFA 4LV2A 3S4XA 2P9VA 4QJGA 2EX6A 4WZ5A 4EBNA 4O7DA 1BSGA 4WELA 1MWTA 1DY6A 3Q81A 2EFUA 3PBNA 1Y54A 3Q07A 1ES4A 2R9WA 5CHJA 3VP0A 1I2WA 2ZC6B 2Y2HA 3OPHA 1QMEA 4OVDA 2ZJ9A 2Q9NA 1K57C 4ID4A 3PAGA 3RJUA 4NETA 1FCMA 4R23A 1XXMA 4KZAA 1LI9A 2ZM0A 1O07A 5FQMA 4FH2A 4MLLA 5DVAA 4BJPA 5FDHA 1FR1A 2EX9A 5CTNA 5DTSA 3AGFA 2PBYA 2ZC7A 1XA1A 2Y2NA 4X6TA 5CHMA 4S2JA 4DXBA 2Y2MA 2A3UA 3UO9A 5E2GA 1K6SA 4K0WA 3AGDA 1CEFA 4E3NA 2H10A 1JWZA 4KG5A 5J8XA 1YMXA 3BEBA 1ES2A 5FSRA 5FI7A 3TG9A 1GA9A 4JF6A 1BUEA 5EPHA 3HLGA 2WZXA 3EQUA 3N8LA 2E8IA 1EWZA 5HL1A 2JCHA 3BFCA 3EQVA 3PBOA 4JKTA 2ZD8A 3M2JA 1NZOA 4KZ6A 4X53A 5M18A 4RYEA 5GHYA 1PI4A 2HDUA 2WKHA 4E6WA 4QB8A 2JC7A 1JTDA 1KVMA 5AQBA 5CECA 1GHPA 1L2SA 3ZG8B 1RGZA 4A5RA 2G2WA 4MEZA 2H0YA 2WYXA 3BFFA 4OQGA 4GDBA 3SH9A 3HVFA 1K56A 1BULA 1E4DA 1JVJA 2Y4AA 3UN7A 5M19A 2V1ZA 5DTTA 3MXSA 4HBTA 5FI6A 5A91A 3WRTA 1WYCA 4GD8A 2J9OA 5EUAA 2P74A 1GA0A 4IVKA 3G34A 4RX2A 4WMCA 1G68A 5BOHA 4R4SA 2Z2LB 1SHVA 3LY4A 3N4IA 4MBFA 2Y2GA 3S22A 4KZ7A 4DE0A 5DF8A 3JYIA 2ZQ7A 4N92A 1J9MA 2Y59A 4FD8A 3RXXA 2QZ6A 3W4QA 1K54A 1GHMA 1LLBA 2WZZA 1NRFA 1JWPA 4RA7A 5GLAA 5TR7A 1CEGA 1TDGA 5GHZA 4N1XA 4QHCA 3E2KA 2DRWA 3MBZA 1KGFA 2PU2A 4JBFA 3BFEA 2BG1A 4EBPA 4RVAA 1ES3A 1IKGA 4BD1A 4RX3A 5FAOA 3WS0A 1K55A 2Z2MB 3FWLA 4U0XA 2WAEA 4C3QA 5CEBA 5TGFA 3LO7A 2QPNA 5EVIC 3W4PA 2XR0A 4GZBA 2H5SA 2FFYA 3GV9A 4B4ZA 3HLDA 3PAEA 1PWGA 5U47A 2ZM8A 5EVIA 5EVLA 1ZG4A 2XK1A 1Q2QA 4F94A 2ZM2A 3FKVA 4OKPA 4QU3A 3ZG7B 4P0MA 4JXGA 3ZVWA 4DDYA 1W5DA 2IWDA 3UPPA 5KMWA 4GN2A 1XA7A 3GQZA 1HVBA 2VGKA 3MZFA 3M6HA 1FQGA 2Q9MA 1K4EA 1PWCA 4NK3A 3W8KA 2XEPA 5FQQA 5HAIA 3QHYA 3N6IA 5HX9A 2HDRA 1MBLA 4UHUA 4E3IA 3Q7ZA 4WZ5C 1MWUA 3C4PA 3NC8A 5EECA 3UY6A 3V50A 3G31A 4PM6A 1IYQA 4DKIA 2A49A 4XXRA 3UE1A 1ERQA 3HLBA 5A90A 4E3JA 1BTLA 4UAAA 4OPRA 3NY4A 4DF6A 5HAQA 3DTMA 5CEDA 1K6RA 3HLWA 3UDIA 1EI5A 3C7VA 5JYPA 1E3UD 5FQJA 4E3LA 3GMWA 1MXOA 1YLZA 4OOMA 4DE1A 3A3JA 2OV5A 5FA7A 1OMEA 2OLUA 5A93A 2HP5A 1K38A 3BLMA 2Y2QA 1YLWA 3VFFA 4E3KA 3FYZA 4QY5A 4S2PA 4ZJ1A 4Z9QA 4OH0A 1JWVA 3D4FA 4OPQA 1LL5A 3B3XA 4S2OA 3V39A 2XD1A 3CMZA 2HP9A 2V20A 1PZOA 1NXYA 1CK3A 1XPBA 1ESIA 3IF6C 3IXDA 5GLCA 3IF5A 3IHAA 4PMAA 4XUZA 2WGIA 4X68A 1SCWA 2Y2LA 3M2KA 5EOOA 3IF6A 1M40A 2B5RA 3IXGA 4IBRA 2JBFA 4L0LA 4OP8A 3MZDA 5FAPA 1IELA 2DNSA 1JTGA 3SOIA 3IT9A 3ZNYA 2ZMAA 3ZDJA 2WADA 4Y7PA 3NDEA 4ZTKA 5EVIB 3GRJA 5KSHA 1WE4A 1IKIA 1BLHA 3P09A 2HDSA 4WM9A 3OPRA 3PBRA 2EXAA 1L0FA 2Y2KA 4HESA 1H8ZA 4KG6A 2WGWA 4OPZA 4UA7A 1NZUA 2Y55A 2ZC4B 3VSKA 3OCLA 4S2IA 3LCEA 2BLSA 4EV4A 1I2SA 1PYYA 3SH7A 2ZQ8A 1XGIA 4R0QA 3A3DA 1SDNA 1W8QA 1MKIA 4X55A 3PBTA 2EX2A 2QMIA 4OP5A 3S1YA 3BLSA 1K54C 4CJNA 3ITAA 1IYOA 2H0TA 2P9VB 1SKFA 1KE3A 4ZAMA 3UNWA 4DE3A 5CGXA 1KVLA 3IWIA 3C7UA 3NCKA 1BLPA 3IWQA 1YLJA 4P85A 3ZGAB 2ZLYA 1PWDA 1GHIA 1TDLA 2ZC5B 3HUOA 4JXVA 3WS5A 4C6YA 1K55C 1L0EA 1VM1A 2XF3A 4Y0OA 4YFMA 4KG2A 5FAQA 2Y2JA 3RXWA 2XFTA 3VOZA 3G35A 4WBGA 2FFFB 5DTKA 3WS4A 4EQIA 4WEKA 3UDFA 2IWBA 5DF7A 1O7EA 1TVFA 2X02A 3Q82A 3HUMA 3O3VA 3WWXA 4MNRA 3E2LA 3AGEA 2C6WB 4Q8IA 4WYYA 5AQAA 4KQQA 3BFDA 2Y91A 5AQ7A 1L0DA 1BT5A 1BZAA 1IYSA 3BRMA 4OQ0A 3PBSA 4IVIA 1XGJA 5FQIA 1KE0A 3ZNTA 1M6KA 5GL9A 4OOLA 4JXWA 5A92A 1I5QA 1NYMA 3GTCA 4FCFA 5HARA 1YM1A 3HBRA 4KENB 4IBXA 2G2UA 1ZKJA 5CXWA 1L0GA 2XQZA 2Y2OA 3IF6B 3MFDA 2X01A 3VP1A 4EWFA 3ZG9B 4GD6A 4MBHA 3OPLA 5E2EA 1MWRA 1S0WA 5AQ9A 4N9LA 5FQKA 4BD0A 1W7FA 2UWXA 3OPPA 3C4OA 4N9KA 1ALQA 1NJ4A 2WKIA 5G18A 2EX8A 4MBKA 5HFOA 5GLDA 1ESUA 2HPBA 4DDSA 1ONHA 1YQSA 4KQRA 4KZ4A 5E43A 4E3OA 2EFXA 4ZJ2A 3GVBA 1XP4A 3VFHA 5KZHA 4C75A 5F82A 4KQOA 3ZCZA 3LEZA 4U3TA 5TFQA 3WS1A 2HP6A 1E3UA 2J7VA 2ZQDA 3CJMA 1CI8A 3WRZA 2ZQCA 3HUNA 1H8YA 1W8YA 1WYBA 2C5WB 1MWSA 1EROA 4X56A 3VSLA 4E6XA 3TSGA 3N8RA 4LV3A 1Z6FA 2JE5A 4E3MA 4K0XA 2Y2IA 4Y0TA 5E2FA 1U60A 1H5XA 3BFGA 1TEMA 2X71A 3GSGA 2ZC3B 3MZEA 3QNBA 4JF5A 4OQIA 3HREA 5FI2A 4LENA 4LCMA 3ZHHA 5CTMA 3I7JA 5JYOA 5FASA 3G30A 4OPYA 4GOGA 4CPKA 4S2LA 5GLBA 4BLMA 3CG5A 5I94A 3HLEA 3O86A 3GR2A 3UE0A 4QD4A 4FH4A 1K57A 5FQ9A 2PU4A 1NYYA 3IQAA 3VP4A 4B4XA 4KZBA 1IYPA 2CC1A 4GB7A 3MKEA 4B88A 1KGEA 4LV1A 3OC2A 4P6BA 1FR6A 1KDWA 4H8RA 4JXSA 4KZ5A 4XUXA 5CRFA 5E2HA 1VQQA 4M3KA 3SS3A 1LL9A 4S2MA 1KDSA 3O88A 2I72A 1S6RA 3G4PA 5EOEA 1PW8A 2XH9A 4FSFA 3Q7VA 2DCFA 1W79A 3N8SA 1LHYA 1YLYA 3ISGA 2RL3A 4Y0UA 3NBLA 4YINA 1ES5A 4GKUA 3M6BA 1HZOA 3ZFZA 4JF4A 3C5AA 3TOIA 3SH8A 5F1FA 3BYDA 2OLVA 4PM9A 2WK0A 4OQHA 2HDQA 1E25A 3P98A 3N7WA 2WUQA 1FCOA 2WKEA 1BLCA 2Y2PA 3BECA 3DWZA 3IH8A 3HLCA 4GNUA 5M1AA 1NY0A 3G2ZA 3VP2A 1K4FA 3A3EA 2XFSA 4WZ4A 3UPOA 1QMFA 2XD5A 3G2YA 3V3SA 4ZBEA 1FCNA 2WGVA 4PPRA 1YLPA 2J9PA 1KE4A 1YT4A 3IH9A 2XGNA 3FV7A 1MY8A 4OOYA 4R3BA 1RP5A 1K56D 2GDNA 3A3FA 3NIAA 4KZ8A 1AXBA 4KZ3A 4PM7A 3FKWA 4UA9A 4JPMA 3ZG5A 1KGGA 1YLTA 3DW0A 1LI0A 4U0TA 4WMCD 4EBLA 3Q1FA 4OONA 3OZHA 4R1GA 4LCLA 1C3BA 1PZPA 5DF9A 4D2OA 4LV0A 3SS4A 4QY6A 1PW1A 3DWKA 1DJAA 2IWCA 4UA6A 1K25A 1MPLA 3NDGA 1FSWA 5IHVA 4EUZA 4BQMA 4PM5A 3QNCA 4OLDA 3WS2A 3IHBA 2OSUA 1DJBA 4IEDA 4DXCA 3VP3A 1HTZA 3IWOA 3W4OA 2J8YA 4PM8A 4N1HA 5GHXA 1Q2PA 1ONGA 3FZCA 4OLGA 4R4RA 3G32A 4P87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZG0 A;  3ZVT A;  4BL2 A;  4DRT A;  1ZG6 A;  1DJC A;  4R3J A;  1FOF A;  1SDE A;  1N9B A;  3MKF A;  4BL3 A;  4DE2 A;  1YMS A;  3ITB A;  2WAF A;  2R9X A;  3PBQ A;  2XDM A;  1N4O A;  2ZQ9 A;  5CHU A;  3V5M A;  4HEF A;  4ZDX A;  4K91 A;  3BM6 A;  4HBU A;  5EVI D;  1BLS A;  5FAT A;  5HW3 A;  3V3R A;  3HLF A;  5EE8 A;  2V2F F;  5HAP A;  3MXR A;  3UDX A;  1IEM A;  5CGW A;  2EXB A;  4S2K A;  2RCX A;  2WGW B;  3Q7V B;  5KSC A;  3IXH A;  3NI9 A;  1GCE A;  3PTE A;  5L2F A;  3UPN A;  3CZD A;  4GDN A;  3A3I A;  3HL9 A;  1CI9 A;  1XKZ A;  5CER A;  1G6A A;  1FSY A;  1PI5 A;  4S2N A;  3VMA A;  1ERM A;  5F1G A;  1RCJ A;  3IXB A;  4X69 A;  2ZQA A;  1ZC2 A;  3OCN A;  5D3O A;  4BEN A;  5CGS A;  5F83 A;  3SS5 A;  4S2N C;  1XX2 A;  3VOY A;  3UE3 A;  3LY3 A;  2VGJ A;  1PIO A;  4KZ9 A;  2XLN A;  1HD8 A;  3O87 A;  4WEJ A;  4ZJ3 A;  1RGY A;  4JLF A;  4LV2 A;  3S4X A;  2P9V A;  4QJG A;  2EX6 A;  4WZ5 A;  4EBN A;  4O7D A;  1BSG A;  4WEL A;  1MWT A;  1DY6 A;  3Q81 A;  2EFU A;  3PBN A;  1Y54 A;  3Q07 A;  1ES4 A;  2R9W A;  5CHJ A;  3VP0 A;  1I2W A;  2ZC6 B;  2Y2H A;  3OPH A;  1QME A;  4OVD A;  2ZJ9 A;  2Q9N A;  1K57 C;  4ID4 A;  3PAG A;  3RJU A;  4NET A;  1FCM A;  4R23 A;  1XXM A;  4KZA A;  1LI9 A;  2ZM0 A;  1O07 A;  5FQM A;  4FH2 A;  4MLL A;  5DVA A;  4BJP A;  5FDH A;  1FR1 A;  2EX9 A;  5CTN A;  5DTS A;  3AGF A;  2PBY A;  2ZC7 A;  1XA1 A;  2Y2N A;  4X6T A;  5CHM A;  4S2J A;  4DXB A;  2Y2M A;  2A3U A;  3UO9 A;  5E2G A;  1K6S A;  4K0W A;  3AGD A;  1CEF A;  4E3N A;  2H10 A;  1JWZ A;  4KG5 A;  5J8X A;  1YMX A;  3BEB A;  1ES2 A;  5FSR A;  5FI7 A;  3TG9 A;  1GA9 A;  4JF6 A;  1BUE A;  5EPH A;  3HLG A;  2WZX A;  3EQU A;  3N8L A;  2E8I A;  1EWZ A;  5HL1 A;  2JCH A;  3BFC A;  3EQV A;  3PBO A;  4JKT A;  2ZD8 A;  3M2J A;  1NZO A;  4KZ6 A;  4X53 A;  5M18 A;  4RYE A;  5GHY A;  1PI4 A;  2HDU A;  2WKH A;  4E6W A;  4QB8 A;  2JC7 A;  1JTD A;  1KVM A;  5AQB A;  5CEC A;  1GHP A;  1L2S A;  3ZG8 B;  1RGZ A;  4A5R A;  2G2W A;  4MEZ A;  2H0Y A;  2WYX A;  3BFF A;  4OQG A;  4GDB A;  3SH9 A;  3HVF A;  1K56 A;  1BUL A;  1E4D A;  1JVJ A;  2Y4A A;  3UN7 A;  5M19 A;  2V1Z A;  5DTT A;  3MXS A;  4HBT A;  5FI6 A;  5A91 A;  3WRT A;  1WYC A;  4GD8 A;  2J9O A;  5EUA A;  2P74 A;  1GA0 A;  4IVK A;  3G34 A;  4RX2 A;  4WMC A;  1G68 A;  5BOH A;  4R4S A;  2Z2L B;  1SHV A;  3LY4 A;  3N4I A;  4MBF A;  2Y2G A;  3S22 A;  4KZ7 A;  4DE0 A;  5DF8 A;  3JYI A;  2ZQ7 A;  4N92 A;  1J9M A;  2Y59 A;  4FD8 A;  3RXX A;  2QZ6 A;  3W4Q A;  1K54 A;  1GHM A;  1LLB A;  2WZZ A;  1NRF A;  1JWP A;  4RA7 A;  5GLA A;  5TR7 A;  1CEG A;  1TDG A;  5GHZ A;  4N1X A;  4QHC A;  3E2K A;  2DRW A;  3MBZ A;  1KGF A;  2PU2 A;  4JBF A;  3BFE A;  2BG1 A;  4EBP A;  4RVA A;  1ES3 A;  1IKG A;  4BD1 A;  4RX3 A;  5FAO A;  3WS0 A;  1K55 A;  2Z2M B;  3FWL A;  4U0X A;  2WAE A;  4C3Q A;  5CEB A;  5TGF A;  3LO7 A;  2QPN A;  5EVI C;  3W4P A;  2XR0 A;  4GZB A;  2H5S A;  2FFY A;  3GV9 A;  4B4Z A;  3HLD A;  3PAE A;  1PWG A;  5U47 A;  2ZM8 A;  5EVI A;  5EVL A;  1ZG4 A;  2XK1 A;  1Q2Q A;  4F94 A;  2ZM2 A;  3FKV A;  4OKP A;  4QU3 A;  3ZG7 B;  4P0M A;  4JXG A;  3ZVW A;  4DDY A;  1W5D A;  2IWD A;  3UPP A;  5KMW A;  4GN2 A;  1XA7 A;  3GQZ A;  1HVB A;  2VGK A;  3MZF A;  3M6H A;  1FQG A;  2Q9M A;  1K4E A;  1PWC A;  4NK3 A;  3W8K A;  2XEP A;  5FQQ A;  5HAI A;  3QHY A;  3N6I A;  5HX9 A;  2HDR A;  1MBL A;  4UHU A;  4E3I A;  3Q7Z A;  4WZ5 C;  1MWU A;  3C4P A;  3NC8 A;  5EEC A;  3UY6 A;  3V50 A;  3G31 A;  4PM6 A;  1IYQ A;  4DKI A;  2A49 A;  4XXR A;  3UE1 A;  1ERQ A;  3HLB A;  5A90 A;  4E3J A;  1BTL A;  4UAA A;  4OPR A;  3NY4 A;  4DF6 A;  5HAQ A;  3DTM A;  5CED A;  1K6R A;  3HLW A;  3UDI A;  1EI5 A;  3C7V A;  5JYP A;  1E3U D;  5FQJ A;  4E3L A;  3GMW A;  1MXO A;  1YLZ A;  4OOM A;  4DE1 A;  3A3J A;  2OV5 A;  5FA7 A;  1OME A;  2OLU A;  5A93 A;  2HP5 A;  1K38 A;  3BLM A;  2Y2Q A;  1YLW A;  3VFF A;  4E3K A;  3FYZ A;  4QY5 A;  4S2P A;  4ZJ1 A;  4Z9Q A;  4OH0 A;  1JWV A;  3D4F A;  4OPQ A;  1LL5 A;  3B3X A;  4S2O A;  3V39 A;  2XD1 A;  3CMZ A;  2HP9 A;  2V20 A;  1PZO A;  1NXY A;  1CK3 A;  1XPB A;  1ESI A;  3IF6 C;  3IXD A;  5GLC A;  3IF5 A;  3IHA A;  4PMA A;  4XUZ A;  2WGI A;  4X68 A;  1SCW A;  2Y2L A;  3M2K A;  5EOO A;  3IF6 A;  1M40 A;  2B5R A;  3IXG A;  4IBR A;  2JBF A;  4L0L A;  4OP8 A;  3MZD A;  5FAP A;  1IEL A;  2DNS A;  1JTG A;  3SOI A;  3IT9 A;  3ZNY A;  2ZMA A;  3ZDJ A;  2WAD A;  4Y7P A;  3NDE A;  4ZTK A;  5EVI B;  3GRJ A;  5KSH A;  1WE4 A;  1IKI A;  1BLH A;  3P09 A;  2HDS A;  4WM9 A;  3OPR A;  3PBR A;  2EXA A;  1L0F A;  2Y2K A;  4HES A;  1H8Z A;  4KG6 A;  2WGW A;  4OPZ A;  4UA7 A;  1NZU A;  2Y55 A;  2ZC4 B;  3VSK A;  3OCL A;  4S2I A;  3LCE A;  2BLS A;  4EV4 A;  1I2S A;  1PYY A;  3SH7 A;  2ZQ8 A;  1XGI A;  4R0Q A;  3A3D A;  1SDN A;  1W8Q A;  1MKI A;  4X55 A;  3PBT A;  2EX2 A;  2QMI A;  4OP5 A;  3S1Y A;  3BLS A;  1K54 C;  4CJN A;  3ITA A;  1IYO A;  2H0T A;  2P9V B;  1SKF A;  1KE3 A;  4ZAM A;  3UNW A;  4DE3 A;  5CGX A;  1KVL A;  3IWI A;  3C7U A;  3NCK A;  1BLP A;  3IWQ A;  1YLJ A;  4P85 A;  3ZGA B;  2ZLY A;  1PWD A;  1GHI A;  1TDL A;  2ZC5 B;  3HUO A;  4JXV A;  3WS5 A;  4C6Y A;  1K55 C;  1L0E A;  1VM1 A;  2XF3 A;  4Y0O A;  4YFM A;  4KG2 A;  5FAQ A;  2Y2J A;  3RXW A;  2XFT A;  3VOZ A;  3G35 A;  4WBG A;  2FFF B;  5DTK A;  3WS4 A;  4EQI A;  4WEK A;  3UDF A;  2IWB A;  5DF7 A;  1O7E A;  1TVF A;  2X02 A;  3Q82 A;  3HUM A;  3O3V A;  3WWX A;  4MNR A;  3E2L A;  3AGE A;  2C6W B;  4Q8I A;  4WYY A;  5AQA A;  4KQQ A;  3BFD A;  2Y91 A;  5AQ7 A;  1L0D A;  1BT5 A;  1BZA A;  1IYS A;  3BRM A;  4OQ0 A;  3PBS A;  4IVI A;  1XGJ A;  5FQI A;  1KE0 A;  3ZNT A;  1M6K A;  5GL9 A;  4OOL A;  4JXW A;  5A92 A;  1I5Q A;  1NYM A;  3GTC A;  4FCF A;  5HAR A;  1YM1 A;  3HBR A;  4KEN B;  4IBX A;  2G2U A;  1ZKJ A;  5CXW A;  1L0G A;  2XQZ A;  2Y2O A;  3IF6 B;  3MFD A;  2X01 A;  3VP1 A;  4EWF A;  3ZG9 B;  4GD6 A;  4MBH A;  3OPL A;  5E2E A;  1MWR A;  1S0W A;  5AQ9 A;  4N9L A;  5FQK A;  4BD0 A;  1W7F A;  2UWX A;  3OPP A;  3C4O A;  4N9K A;  1ALQ A;  1NJ4 A;  2WKI A;  5G18 A;  2EX8 A;  4MBK A;  5HFO A;  5GLD A;  1ESU A;  2HPB A;  4DDS A;  1ONH A;  1YQS A;  4KQR A;  4KZ4 A;  5E43 A;  4E3O A;  2EFX A;  4ZJ2 A;  3GVB A;  1XP4 A;  3VFH A;  5KZH A;  4C75 A;  5F82 A;  4KQO A;  3ZCZ A;  3LEZ A;  4U3T A;  5TFQ A;  3WS1 A;  2HP6 A;  1E3U A;  2J7V A;  2ZQD A;  3CJM A;  1CI8 A;  3WRZ A;  2ZQC A;  3HUN A;  1H8Y A;  1W8Y A;  1WYB A;  2C5W B;  1MWS A;  1ERO A;  4X56 A;  3VSL A;  4E6X A;  3TSG A;  3N8R A;  4LV3 A;  1Z6F A;  2JE5 A;  4E3M A;  4K0X A;  2Y2I A;  4Y0T A;  5E2F A;  1U60 A;  1H5X A;  3BFG A;  1TEM A;  2X71 A;  3GSG A;  2ZC3 B;  3MZE A;  3QNB A;  4JF5 A;  4OQI A;  3HRE A;  5FI2 A;  4LEN A;  4LCM A;  3ZHH A;  5CTM A;  3I7J A;  5JYO A;  5FAS A;  3G30 A;  4OPY A;  4GOG A;  4CPK A;  4S2L A;  5GLB A;  4BLM A;  3CG5 A;  5I94 A;  3HLE A;  3O86 A;  3GR2 A;  3UE0 A;  4QD4 A;  4FH4 A;  1K57 A;  5FQ9 A;  2PU4 A;  1NYY A;  3IQA A;  3VP4 A;  4B4X A;  4KZB A;  1IYP A;  2CC1 A;  4GB7 A;  3MKE A;  4B88 A;  1KGE A;  4LV1 A;  3OC2 A;  4P6B A;  1FR6 A;  1KDW A;  4H8R A;  4JXS A;  4KZ5 A;  4XUX A;  5CRF A;  5E2H A;  1VQQ A;  4M3K A;  3SS3 A;  1LL9 A;  4S2M A;  1KDS A;  3O88 A;  2I72 A;  1S6R A;  3G4P A;  5EOE A;  1PW8 A;  2XH9 A;  4FSF A;  3Q7V A;  2DCF A;  1W79 A;  3N8S A;  1LHY A;  1YLY A;  3ISG A;  2RL3 A;  4Y0U A;  3NBL A;  4YIN A;  1ES5 A;  4GKU A;  3M6B A;  1HZO A;  3ZFZ A;  4JF4 A;  3C5A A;  3TOI A;  3SH8 A;  5F1F A;  3BYD A;  2OLV A;  4PM9 A;  2WK0 A;  4OQH A;  2HDQ A;  1E25 A;  3P98 A;  3N7W A;  2WUQ A;  1FCO A;  2WKE A;  1BLC A;  2Y2P A;  3BEC A;  3DWZ A;  3IH8 A;  3HLC A;  4GNU A;  5M1A A;  1NY0 A;  3G2Z A;  3VP2 A;  1K4F A;  3A3E A;  2XFS A;  4WZ4 A;  3UPO A;  1QMF A;  2XD5 A;  3G2Y A;  3V3S A;  4ZBE A;  1FCN A;  2WGV A;  4PPR A;  1YLP A;  2J9P A;  1KE4 A;  1YT4 A;  3IH9 A;  2XGN A;  3FV7 A;  1MY8 A;  4OOY A;  4R3B A;  1RP5 A;  1K56 D;  2GDN A;  3A3F A;  3NIA A;  4KZ8 A;  1AXB A;  4KZ3 A;  4PM7 A;  3FKW A;  4UA9 A;  4JPM A;  3ZG5 A;  1KGG A;  1YLT A;  3DW0 A;  1LI0 A;  4U0T A;  4WMC D;  4EBL A;  3Q1F A;  4OON A;  3OZH A;  4R1G A;  4LCL A;  1C3B A;  1PZP A;  5DF9 A;  4D2O A;  4LV0 A;  3SS4 A;  4QY6 A;  1PW1 A;  3DWK A;  1DJA A;  2IWC A;  4UA6 A;  1K25 A;  1MPL A;  3NDG A;  1FSW A;  5IHV A;  4EUZ A;  4BQM A;  4PM5 A;  3QNC A;  4OLD A;  3WS2 A;  3IHB A;  2OSU A;  1DJB A;  4IED A;  4DXC A;  3VP3 A;  1HTZ A;  3IWO A;  3W4O A;  2J8Y A;  4PM8 A;  4N1H A;  5GHX A;  1Q2P A;  1ONG A;  3FZC A;  4OLG A;  4R4R A;  3G32 A;  4P87 A; 
#chains in the Genus database with same CATH topology
 4BL2 A;  4DRT A;  3D9Y A;  3VE3 A;  1DJC A;  1FOF A;  4BL3 A;  1N9B A;  3PBQ A;  2XDM A;  2ZQ9 A;  3FPW A;  4L9F A;  1BYW A;  2ACG A;  4EW7 A;  2HZ5 A;  3HCY A;  3BM6 A;  4IJG A;  5EVI D;  3EGD C;  3HLF A;  5EE8 A;  4HIA A;  5KSC A;  3IXH A;  3UPN A;  3VMA A;  1XKZ A;  5CER A;  1G6A A;  2V0W A;  3H7W B;  3T4L A;  1OT6 A;  2J3W A;  1ZC2 A;  3OCN A;  5D3O A;  5CGS A;  3BQ8 A;  1XX2 A;  3UE3 A;  3MFX A;  4CQH A;  4KZ9 A;  3O87 A;  1N9O A;  4JLF A;  4QJG A;  4HH2 A;  3VP0 A;  3Q07 A;  1Y54 A;  5CHJ A;  2R9W A;  3U4L P;  2ZC6 B;  2Y2H A;  3OPH A;  4OVD A;  3PAG A;  4R23 A;  3IX4 A;  4MLL A;  3BY9 A;  2VA0 A;  5FDH A;  1EW0 A;  1XA1 A;  2Y2N A;  3K3D A;  1OTB A;  5CHM A;  5L10 A;  4S2J A;  4DXB A;  2W27 A;  3KSG A;  5E2G A;  5HZH A;  1OJG A;  2H10 A;  5J8X A;  3BEB A;  2W3E A;  4PHT A;  3PXP A;  3HLG A;  3N8L A;  1EWZ A;  2HF6 A;  2JCH A;  3P7N A;  3PBO A;  2UV0 E;  3OBF A;  1NZO A;  3MXQ A;  5M18 A;  4RYE A;  5HWT A;  1PI4 A;  5DKL A;  2W3H A;  2JC7 A;  3LFV A;  1KVM A;  5CEC A;  1GHP A;  4NG2 A;  3C2W A;  4MEZ A;  4I39 A;  1DP9 A;  2K7S A;  1BUL A;  4PAU A;  3JVU A;  2J9O A;  4HOI A;  3LGO A;  1GA0 A;  4Y15 A;  1G68 A;  4R4S A;  1SHV A;  2Y2G A;  2Y59 A;  4CLC C;  4FD8 A;  1K54 A;  5GHZ A;  4N1X A;  4JBF A;  2W1T A;  4D60 A;  2PU2 A;  3BFE A;  4EBP A;  2PYP A;  4RX3 A;  1N9N A;  2Q0O A;  3WS0 A;  2Z2M B;  3FWL A;  2WAE A;  5AVE A;  5CEB A;  5EVI C;  3GV9 A;  5DJU A;  3PAE A;  1X0O A;  3JVV A;  5EVI A;  3S7O A;  2VV7 A;  3GQZ A;  3MZF A;  3NOU C;  4G3V A;  3ZYT A;  4NK3 A;  3W8K A;  3N6I A;  4UHU A;  4QWO A;  1T1A A;  2PT7 A;  4WZ5 C;  4I3A A;  1S4R A;  4PM6 A;  4DKI A;  2A49 A;  3UE1 A;  1UWN X;  5HDD A;  4QPR A;  5HAQ A;  2GX5 A;  5FQJ A;  1YSQ A;  1OTA A;  3UB6 A;  4L9E A;  4E3L A;  5J7E A;  4OOM A;  1G5U A;  2V8F A;  2OV5 A;  1ODV A;  5A93 A;  3BLM A;  1K38 A;  2HGV A;  2Y2Q A;  4QY5 A;  4ZJ1 A;  3V39 A;  3LI8 A;  2XD1 A;  2O0Y A;  3V67 A;  1IFQ A;  1XPB A;  2W1T B;  4XUZ A;  2VX8 A;  1SCW A;  4MCW A;  3UB5 P;  2ZOI A;  4IBR A;  4L0L A;  3F1N A;  4NXF A;  5EVI B;  2QYB A;  5KSH A;  2VGL S;  4HES A;  1H8Z A;  4Y2F A;  2ZC4 B;  3OCL A;  4S2I A;  2BLS A;  3SH7 A;  4I38 A;  3QP2 A;  2EX2 A;  2QMI A;  3MJQ A;  3BLS A;  4F3L A;  4CJN A;  1KOU A;  2KX6 A;  2P9V B;  1SKF A;  5CGX A;  1H8M A;  5TJJ A;  1TDL A;  2ZMF A;  5HD3 A;  2XF3 A;  4Y0O A;  4KG2 A;  3VOZ A;  4WBG A;  4EQI A;  4WEK A;  1O7E A;  1TVF A;  5FDS A;  2ZBB A;  3WWX A;  4MNR A;  3DBA A;  1N9L A;  2PBD P;  2VK3 A;  2Y91 A;  1BZA A;  3CHW P;  4OQ0 A;  2OOL A;  1XGJ A;  2JHE A;  4OOL A;  5F5Y A;  2LB9 A;  1I5Q A;  1NYM A;  4FCF A;  3B33 A;  5HAR A;  4KEN B;  1CQA A;  4IBX A;  1ZKJ A;  4IHQ A;  4ETZ A;  3OPL A;  5E2E A;  1S0W A;  5FQK A;  2UWX A;  3F1N B;  1NJ4 A;  2PHY A;  2WKI A;  5G18 A;  4MBK A;  1OTD A;  5HFO A;  2FH5 A;  1ESU A;  1ONH A;  4KQR A;  5E43 A;  4E3O A;  2XRN A;  4C75 A;  1D7E A;  5F82 A;  4U3T A;  2HP6 A;  3CJM A;  1CI8 A;  2ZQC A;  2JN7 A;  3R4K A;  3VSL A;  4F3L B;  3TSG A;  3KYQ A;  1OT9 A;  4KUK A;  4E3M A;  1Y4O A;  2JKG A;  4S2N A;  3QNB A;  3MQO A;  4JF5 A;  4LEN A;  4LCM A;  5CTM A;  1P0Z A;  1LSV A;  4OPY A;  5I94 A;  4YOF A;  2P08 A;  4GLQ A;  1D1J A;  5FQ9 A;  1NYY A;  4G3W A;  1IYP A;  1KGE A;  3VOL A;  4P6B A;  4H8R A;  4KZ5 A;  1P9W A;  3SS3 A;  5A8B A;  1V9Y A;  4S2M A;  1KDS A;  3O88 A;  2I72 A;  1S6R A;  2XH9 A;  1LSX A;  2DCF A;  5HPI A;  3N8S A;  1YLY A;  4LLO B;  3KYE A;  3QP5 A;  4GKU A;  3M6B A;  3LR0 A;  4P6Z M;  4PM9 A;  1XJ4 A;  2HDQ A;  2MJ6 A;  3P98 A;  3N7W A;  2WUQ A;  3DWZ A;  1A0K A;  1NY0 A;  4EET B;  4HJ3 A;  4PKY G;  1K4F A;  5IU1 A;  1FIL A;  1S1Z A;  4PPR A;  1KE4 A;  1RP5 A;  2P7J A;  1KGG A;  4DMZ A;  4U0T A;  3SZT A;  4EER A;  4E04 A;  3O5Y A;  4EBL A;  5HSQ A;  3KSF A;  3NEC A;  5EFW A;  3DWK A;  4OLD A;  3IHB A;  3W4O A;  4PM8 A;  5GHX A;  4OLG A;  4P87 A;  3ZG0 A;  4R3J A;  1SDE A;  2WAF A;  2WKQ A;  5AJG A;  4I3I A;  1GSW A;  4MN6 A;  5FAT A;  4NXE A;  5K5B A;  3MXR A;  1IEM A;  3T4J A;  3LIE A;  1NLY A;  2RCX A;  2KDK A;  2WGW B;  1GCE A;  2AVX A;  3CZD A;  3A3I A;  1FSY A;  1PI5 A;  2P04 A;  1RCJ A;  4X69 A;  3LID A;  3SS5 A;  3LIC A;  3CPT A;  1PIO A;  3LIA A;  4WEJ A;  4ZJ3 A;  4X1M A;  3S4X A;  3E4P A;  1DY6 A;  3PBN A;  2Y8H A;  4HH3 A;  3CIT A;  2ZM0 A;  3R7W A;  4BJP A;  1FR1 A;  2PBY A;  2ZC7 A;  2PD8 A;  4M4X A;  3T4S A;  2EWV A;  2YKH A;  3F1P A;  1JWZ A;  5FI7 A;  1W63 M;  5GHY A;  3LR4 A;  2HDU A;  2INW A;  5AQB A;  3ZG8 B;  2JKT M;  3BFF A;  1SKO A;  3EOI A;  2Y4A A;  3UN7 A;  1JVJ A;  5DJT A;  5M19 A;  2XRO A;  2V1Z A;  3WRT A;  4GD8 A;  2J3T D;  4RX2 A;  5BOH A;  2Z2L B;  2V9A A;  3LY4 A;  3N4I A;  3CPT B;  4GW9 A;  4JGP A;  5EM0 A;  4N92 A;  4Z1W A;  2QZ6 A;  3W4Q A;  5GLA A;  1NRF A;  3E2K A;  2DRW A;  4Q0I A;  3ULF A;  3A0S A;  3B47 A;  3T1R A;  5FAO A;  2W0N A;  4U0X A;  2IA2 A;  3LO7 A;  3IBJ A;  1PRQ A;  4GZB A;  4HP9 A;  3HLD A;  1PNE A;  1PWG A;  2Z6C A;  1Q2Q A;  3ZQ5 A;  3EWK A;  1W63 Q;  4GHI A;  4QU3 A;  4P0M A;  4JXG A;  4UQI M;  3ZVW A;  1W5D A;  2IWD A;  3TW8 A;  4GN2 A;  1XA7 A;  2Q9M A;  3KSH A;  1K4E A;  2XEP A;  2L0W A;  1DP8 A;  5FQQ A;  1Z09 A;  1F9I A;  3QHY A;  2HDR A;  4E3I A;  4EU0 A;  3H82 A;  1IYQ A;  4XXR A;  4O0P A;  4LRZ E;  1BTL A;  4UAA A;  4OPR A;  3UB8 A;  3NY4 A;  5CED A;  1K6R A;  5LBR A;  3UDI A;  4ESP A;  1EI5 A;  3C7V A;  1E3U D;  3GMW A;  4O8G A;  1OME A;  2OLU A;  5FA7 A;  4JGO A;  2O9C A;  3VFF A;  1D06 A;  4S2P A;  1JWV A;  3D4F A;  1LL5 A;  4S2O A;  3CMZ A;  2HP9 A;  1GSX A;  3PR6 A;  3E4Q A;  2V20 A;  3T12 B;  1NXY A;  4WUJ A;  3IXD A;  1DRM A;  2WGI A;  4X68 A;  3JPU A;  3T4O A;  1M40 A;  3IXG A;  2JBF A;  4YNR A;  2V8C A;  3MZD A;  5FAP A;  3SOI A;  2WAD A;  4Y7P A;  3NDE A;  5EVE A;  3C8C A;  1WE4 A;  1IKI A;  4WM9 A;  2D01 A;  3OPR A;  3PBR A;  3NHQ A;  4GHI B;  2EXA A;  1L0F A;  4KG6 A;  2JKT I;  1OPX A;  2J3T C;  2Y2K A;  4UA7 A;  1NZU A;  3CI6 A;  4FTX A;  1I2S A;  1PYY A;  1XGI A;  3A3D A;  3LR5 A;  1SDN A;  2DMW A;  4X55 A;  4OP5 A;  3OOV A;  4IUK A;  1K54 C;  4HHD A;  2H0T A;  3UNW A;  3IWI A;  3C7U A;  3IWQ A;  4P85 A;  4C6Y A;  3RXW A;  2BTF P;  1MC0 A;  2XFT A;  2FFF B;  3UDF A;  2IWB A;  5DF7 A;  3Q82 A;  1VB6 A;  3O3V A;  1S67 L;  3E2L A;  3AGE A;  4WYY A;  3BFD A;  3CUE A;  1ZHH B;  5FQI A;  4EEP A;  5GL9 A;  5A92 A;  3GTC A;  1G28 A;  4Y13 A;  5HWW A;  1YM1 A;  2G2U A;  2X01 A;  2XQZ A;  2Y2O A;  3VP1 A;  4EWF A;  1JNU A;  4LRY C;  4GD6 A;  5AQ9 A;  4N9L A;  4BD0 A;  2VZW A;  3C4O A;  4N9K A;  3HJK A;  3GDI A;  2EX8 A;  4DDS A;  1YQS A;  4ZJ2 A;  3GVB A;  4HJ6 A;  5CX7 A;  3ZCZ A;  3LEZ A;  3LI9 A;  4WLA A;  1E3U A;  2J7V A;  2ZQD A;  3HUN A;  5DFY A;  1H8Y A;  2C5W B;  3HJI A;  4X56 A;  2W1R A;  4E6X A;  3N8R A;  1Z6F A;  3T4Q A;  4Y0T A;  2YKF A;  1ACF A;  5FAS A;  3G30 A;  4GOG A;  4CPK A;  5GLB A;  3CG5 A;  1XJ2 A;  3BWL A;  3HLE A;  3O86 A;  1XFQ A;  3UE0 A;  1K57 A;  4BWI A;  2PU4 A;  3IQA A;  3DAV A;  2L4R A;  1VET A;  1XFN A;  4GB7 A;  3MKE A;  3OC2 A;  1KDW A;  4JXS A;  2QJ5 A;  4Y5F A;  1LL9 A;  3K3C A;  2W3D A;  1PW8 A;  4FSF A;  3UB7 A;  3NOP C;  4P6Z S;  1W79 A;  1LHY A;  2RL3 A;  1P97 A;  1ES5 A;  1HZO A;  4JF4 A;  1YPR A;  3SH8 A;  2OLV A;  4OQH A;  1NRJ A;  1S66 L;  2Y2P A;  3IH8 A;  3MSH A;  4WZ4 A;  1QMF A;  2XD5 A;  3T4K A;  3G2Y A;  2KOI A;  4ZBE A;  2EA9 A;  1FCN A;  2WGV A;  3B42 A;  4K08 A;  2JKF A;  2J9P A;  4HP4 A;  2K2N A;  4OOY A;  2NUP C;  3A3F A;  4KZ8 A;  3ZG5 A;  1YAX A;  4PM7 A;  2QWS A;  4JPM A;  4RQ9 A;  3S7P A;  3DW0 A;  1TD5 A;  4AFI A;  3Q1F A;  3OZH A;  4D2O A;  1PW1 A;  2IWC A;  2V0U A;  3NDG A;  4EUZ A;  4BQM A;  3LIB A;  3WS2 A;  1S4S A;  4DXC A;  3VP3 A;  1HTZ A;  3IWO A;  4N1H A;  3FZC A;  3LEQ A;  3IX8 A;  3ZVT A;  1VET B;  3MKF A;  1P9R A;  1YMS A;  3ITB A;  5CHU A;  4EES A;  4ZDX A;  4HEF A;  4JGR A;  4K91 A;  5FL3 A;  4HBU A;  1BLS A;  4GJ4 A;  5J3W A;  3V3R A;  5HAP A;  3UDX A;  4S2K A;  2ZMV A;  2HV1 A;  3PTE A;  4NXG A;  3HL9 A;  5KZH A;  1CI9 A;  2ZQA A;  4S2N C;  3TRC A;  1T19 A;  2VGJ A;  2XLN A;  2ZL1 A;  1RGY A;  4LV2 A;  4EBN A;  4O7D A;  4WEL A;  3Q81 A;  1ES4 A;  1QME A;  2E8J A;  1FCM A;  3VE4 A;  4KZA A;  2W3F A;  3PHY A;  5DVA A;  5EM1 A;  2EX9 A;  3AGF A;  3PYP A;  1OTE A;  4II7 A;  2XA7 S;  2A24 A;  4IUH A;  3IS2 A;  2Y2M A;  1TS0 A;  1K6S A;  3AGD A;  4E3N A;  3NOT C;  4KG5 A;  1ES2 A;  5FSR A;  3TG9 A;  1GA9 A;  4FUW A;  4JF6 A;  5EPH A;  2WZX A;  4MN5 A;  3MS6 A;  5HL1 A;  3BFC A;  2HJ9 C;  3OLO A;  3EQV A;  3RFB A;  2R78 A;  4KZ6 A;  1H3Q A;  1SZV A;  2WKH A;  4E6W A;  4QB8 A;  1L2S A;  2G2W A;  4EXO A;  2WYX A;  3MR0 A;  4OQG A;  3SH9 A;  3QP1 A;  5DTT A;  3MXS A;  4G3K A;  5EUA A;  3G34 A;  5G4Z A;  4R70 A;  2VJW A;  5EV0 A;  5TBM A;  4MBF A;  2ZL1 B;  4EUV A;  4B93 A;  3JYI A;  1J9M A;  1GHM A;  1LLB A;  2WZZ A;  1JWP A;  5TR7 A;  1CEG A;  1TDG A;  4QHC A;  1ES3 A;  3RTY A;  2OAP 1;  4DJ3 A;  4BD1 A;  1K55 A;  2B02 A;  5TGF A;  2QPN A;  3W4P A;  4Y17 A;  2H5S A;  5L07 A;  4B4Z A;  3S7Q A;  5U47 A;  2A24 B;  3H9W A;  3IS2 B;  3QP4 A;  1ZG4 A;  5EVL A;  4F94 A;  3FKV A;  5MC7 A;  3ZG7 B;  3UPP A;  4R3A A;  2O9A A;  1NWZ A;  1MBL A;  2O9B A;  5DFX A;  3Q7Z A;  1MWU A;  3C4P A;  3NC8 A;  3F1O A;  3FPV A;  5J4E A;  5HL6 A;  1ERQ A;  4E3J A;  2V1B A;  2O99 A;  1ZTU A;  3A3J A;  4R38 A;  1TF1 A;  5TBM B;  1YLW A;  4E3K A;  3FYZ A;  4OH0 A;  4OPQ A;  3LR3 A;  5L09 A;  1PZO A;  1IOU A;  3A0V A;  4Q0J A;  3IF5 A;  3IHA A;  4PMA A;  4I3J A;  3M2K A;  5IS1 A;  4KUO A;  3MF0 A;  2W3G A;  5F69 A;  2DNS A;  1JTG A;  5HDC A;  2ZMA A;  3GRJ A;  1BLH A;  3P09 A;  4XT2 A;  1PFL A;  4HQA A;  3LCE A;  4EV4 A;  2ZQ8 A;  1LSW A;  4R0Q A;  4WF0 A;  1T1B A;  3PBT A;  3S1Y A;  3F1O B;  3ITA A;  2BAS A;  5I5L A;  3G6O A;  1KE3 A;  3ZGA B;  2ZLY A;  1PWD A;  3HUO A;  4YFM A;  1VM1 A;  3G35 A;  5DTK A;  3WS4 A;  1VEU A;  3R7W B;  3CWF A;  3KSI A;  2C6W B;  4Q8I A;  3CAX A;  4NXB A;  5G4Y A;  5AQ7 A;  1BT5 A;  1H0M A;  3MMH A;  3ZNT A;  1KE0 A;  3RH8 B;  1YKD A;  1M6K A;  3T1Q B;  3F1P B;  4CLC D;  3HBR A;  4GS9 A;  1L0G A;  5FEG A;  4HI4 A;  4MBH A;  3T4T A;  3OPP A;  3ICY A;  3LIF A;  4MDZ A;  2HPB A;  1Y28 A;  2PR6 A;  4XT2 B;  3BW6 A;  1J3W A;  2VEA A;  1SKO B;  3A0R A;  3WRZ A;  1W8Y A;  3BJN A;  4LV3 A;  1DP6 A;  5E2F A;  1H5X A;  2ZC3 B;  3MZE A;  4OQI A;  3ZHH A;  2M1C A;  5HWV A;  1YSP A;  3EGX C;  1CJF A;  1F98 A;  4WL9 A;  5HDS A;  1VEU B;  1G6O A;  4B4X A;  2CC1 A;  3U2A A;  4Y3I A;  2OWJ A;  5CRF A;  5E2H A;  1VQQ A;  2QKP A;  4GS9 B;  3EEH A;  3Q7V A;  1NLZ A;  4DN0 A;  3ISG A;  3NBL A;  3ZFZ A;  3C5A A;  3TOI A;  5C5K A;  3IBR A;  2WK0 A;  1E25 A;  2WKE A;  5M1A A;  4GNU A;  3G2Z A;  3VP2 A;  2XFS A;  3H82 B;  3UPO A;  1TS6 A;  4JGQ A;  1YLP A;  1YT4 A;  4R3B A;  2XGN A;  1MY8 A;  1K56 D;  3NIA A;  3KYZ A;  1AXB A;  4KZ3 A;  4UA9 A;  3FKW A;  4BBU A;  4NKP A;  4WMC D;  3CUE C;  3FC7 A;  4O01 A;  4ARZ A;  2HJE A;  1PZP A;  2VV8 A;  5F68 A;  3SS4 A;  1DJA A;  4UA6 A;  1MPL A;  5IHV A;  1FSW A;  4PM5 A;  3QNC A;  5AVF A;  5FEF A;  4IED A;  4CLC A;  2PAV P;  4B9O A;  4R6L A;  3C38 A;  3E0Y A;  4R4R A;  4EEU A;  4ETX A;  1ZG6 A;  4DE2 A;  2R9X A;  1TS8 A;  1N4O A;  3V5M A;  4L9G A;  5HW3 A;  2V2F F;  1XJ3 A;  5CGW A;  2EXB A;  3Q7V B;  4Q0H A;  3NI9 A;  5L2F A;  4GDN A;  2PR5 A;  3S7N A;  3E98 A;  3T1S A;  1ERM A;  5F1G A;  3IXB A;  1TS7 A;  4BEN A;  5F83 A;  2FZ0 A;  2GZA A;  3UB9 A;  3LYX A;  3VOY A;  3LY3 A;  1HD8 A;  1MZU A;  2P9V A;  2EX6 A;  4WZ5 A;  2JKR M;  1BSG A;  1MWT A;  2EFU A;  3DTE A;  1I2W A;  2ZJ9 A;  2Q9N A;  1K57 C;  4ID4 A;  1OJ5 A;  4YWZ A;  3RJU A;  4NET A;  1XXM A;  1LI9 A;  1O07 A;  5FQM A;  4FH2 A;  4ARZ B;  4LPZ A;  5CTN A;  5DTS A;  2K31 A;  4X6T A;  1L3L A;  2A2L A;  2A3U A;  3UO9 A;  4CLC B;  2KLI A;  4K0W A;  1XJ6 A;  1CEF A;  1VHM A;  3SW1 A;  4ME4 A;  3BQA A;  1YMX A;  2VV6 A;  1BUE A;  1LT0 A;  3EQU A;  2E8I A;  4MMN A;  4JKT A;  2ZD8 A;  3M2J A;  4X53 A;  4GCZ A;  3P01 A;  1JTD A;  1RGZ A;  1V9Z A;  5HPF A;  4A5R A;  3D72 A;  2H0Y A;  4GDB A;  3HVF A;  1K56 A;  1E4D A;  3CLO A;  4HBT A;  5FI6 A;  5A91 A;  2GNX A;  1WYC A;  1MKM A;  2P74 A;  4IVK A;  4WMC A;  2VKS A;  1T18 A;  3S22 A;  4KZ7 A;  4DE0 A;  2CMN A;  4LFU A;  5DF8 A;  3GEC A;  4BBT A;  2ZQ7 A;  2B95 A;  3RXX A;  4RA7 A;  1AWI A;  3MBZ A;  1KGF A;  2BG1 A;  4RVA A;  5IT5 A;  3MQQ A;  4HNB A;  1IKG A;  2D02 A;  1UWP X;  2J80 A;  4ZRR A;  4C3Q A;  2XR0 A;  2FFY A;  1STZ A;  2ZM8 A;  2PYR A;  3K2N A;  2XK1 A;  2ZM2 A;  4NEE D;  4DJ2 A;  4OKP A;  3FG8 A;  1WA9 A;  4DDY A;  3DTK A;  5KMW A;  1HVB A;  2VGK A;  3IX3 A;  3M6H A;  1FQG A;  1PWC A;  2V1A A;  1LL8 A;  5HAI A;  5HX9 A;  5HD5 A;  3BY8 A;  3C30 A;  4X25 A;  5EEC A;  3UY6 A;  3NJA A;  3V50 A;  3G31 A;  2GJ3 A;  5A90 A;  3HLB A;  2JKR I;  4DF6 A;  3DTM A;  3HLW A;  5JYP A;  1MXO A;  1YLZ A;  4DE1 A;  4PKY A;  2Z6D A;  4BMW A;  4FOF A;  1OTI A;  2HP5 A;  4Z9Q A;  3B3X A;  3MQ0 A;  3KX0 X;  3E4O A;  4KQD A;  1CK3 A;  1ESI A;  3IF6 C;  5KIZ A;  5GLC A;  3VV4 A;  4HY8 A;  2Y2L A;  5EOO A;  2XSS A;  3IF6 A;  2B5R A;  4OP8 A;  1IEL A;  3IT9 A;  3ZNY A;  3ZDJ A;  4ZTK A;  2WKP A;  1T1C A;  2EWW A;  2HDS A;  3QP8 A;  2WGW A;  4OPZ A;  2VGL M;  4HJ4 A;  2Y55 A;  3VSK A;  2OAQ 1;  2LB5 A;  3TJZ C;  4LGW A;  1W8Q A;  1MKI A;  2M7U A;  3UMD A;  2Y79 A;  1IYO A;  2ZOH A;  4ZAM A;  4DE3 A;  1KVL A;  3NCK A;  1BLP A;  1YLJ A;  2PRF A;  1GHI A;  2ZC5 B;  4JXV A;  3WS5 A;  1K55 C;  1L0E A;  5FAQ A;  2Y2J A;  2X02 A;  3HUM A;  3EEA A;  5AQA A;  4KQQ A;  4I5S A;  1GSV A;  1L0D A;  1IYS A;  3BRM A;  3PBS A;  4IVI A;  4UQI S;  2WKR A;  4JXW A;  1UGU A;  5CXW A;  3IF6 B;  3MFD A;  1FIK A;  5L8M A;  3ZG9 B;  1MWR A;  2H28 A;  1W7F A;  3UE6 A;  2VLG A;  1ALQ A;  5GLD A;  1HLU P;  1S1Y A;  4KZ4 A;  2EFX A;  1XP4 A;  3VFH A;  5F6A A;  3LUQ A;  4KQO A;  5TFQ A;  2PD7 A;  3WS1 A;  4BBV A;  1F5M A;  3QP6 A;  2B18 A;  2NUT C;  1WYB A;  1MWS A;  1ERO A;  4H6J A;  2JE5 A;  4K0X A;  2G7U A;  2Y2I A;  1U60 A;  3BFG A;  1TEM A;  2X71 A;  3GSG A;  5FI2 A;  3HRE A;  3I7J A;  5JYO A;  4X1L A;  3DTI A;  4WN5 A;  3UME A;  4S2L A;  4BLM A;  5DKK A;  3D3O A;  2PDR A;  3KO6 A;  3GR2 A;  4QD4 A;  4FH4 A;  3VP4 A;  4KZB A;  1CF0 A;  4B88 A;  4LV1 A;  1FR6 A;  4XUX A;  4M3K A;  2XA7 M;  2I9V A;  1F2K A;  3G4P A;  5EOE A;  3T1X A;  2OWH A;  4LRX C;  4Y0U A;  4YIN A;  5F1F A;  3BYD A;  4EQ1 A;  3H7W A;  4MN7 A;  1FCO A;  1BLC A;  3BEC A;  3HLC A;  2L1M A;  3A3E A;  3TE8 A;  3V3S A;  4UEY A;  3IH9 A;  3NUL A;  3FV7 A;  2GDN A;  1YLT A;  1LI0 A;  2QHK A;  4OON A;  3L7H A;  5DF9 A;  4H6J B;  4LCL A;  1C3B A;  4R1G A;  3T50 A;  4LV0 A;  4QY6 A;  1K25 A;  2QJ7 A;  1K0K A;  2OSU A;  1DJB A;  2M7V A;  2J8Y A;  4CLC E;  1Q2P A;  1ONG A;  3L9K A;  3G32 A;  3W2Z A; 
#chains in the Genus database with same CATH homology
 3ZG0 A;  3ZVT A;  4BL2 A;  4DRT A;  1ZG6 A;  1DJC A;  4R3J A;  1FOF A;  1SDE A;  1N9B A;  3MKF A;  4BL3 A;  4DE2 A;  1YMS A;  3ITB A;  2WAF A;  2R9X A;  3PBQ A;  2XDM A;  1N4O A;  2ZQ9 A;  5CHU A;  3V5M A;  4HEF A;  4ZDX A;  4K91 A;  3BM6 A;  4HBU A;  5EVI D;  1BLS A;  5FAT A;  5HW3 A;  3V3R A;  3HLF A;  5EE8 A;  2V2F F;  5HAP A;  3MXR A;  3UDX A;  1IEM A;  5CGW A;  2EXB A;  4S2K A;  2RCX A;  2WGW B;  3Q7V B;  5KSC A;  3IXH A;  3NI9 A;  1GCE A;  3PTE A;  5L2F A;  3UPN A;  3CZD A;  4GDN A;  3A3I A;  3HL9 A;  1CI9 A;  1XKZ A;  5CER A;  1G6A A;  1FSY A;  1PI5 A;  4S2N A;  3VMA A;  1ERM A;  5F1G A;  1RCJ A;  3IXB A;  4X69 A;  2ZQA A;  1ZC2 A;  3OCN A;  5D3O A;  4BEN A;  5CGS A;  5F83 A;  3SS5 A;  4S2N C;  1XX2 A;  3VOY A;  3UE3 A;  3LY3 A;  2VGJ A;  1PIO A;  4KZ9 A;  2XLN A;  1HD8 A;  3O87 A;  4WEJ A;  4ZJ3 A;  1RGY A;  4JLF A;  4LV2 A;  3S4X A;  2P9V A;  4QJG A;  2EX6 A;  4WZ5 A;  4EBN A;  4O7D A;  1BSG A;  4WEL A;  1MWT A;  1DY6 A;  3Q81 A;  2EFU A;  3PBN A;  1Y54 A;  3Q07 A;  1ES4 A;  2R9W A;  5CHJ A;  3VP0 A;  1I2W A;  2ZC6 B;  2Y2H A;  3OPH A;  1QME A;  4OVD A;  2ZJ9 A;  2Q9N A;  1K57 C;  4ID4 A;  3PAG A;  3RJU A;  4NET A;  1FCM A;  4R23 A;  1XXM A;  4KZA A;  1LI9 A;  2ZM0 A;  1O07 A;  5FQM A;  4FH2 A;  4MLL A;  5DVA A;  4BJP A;  5FDH A;  1FR1 A;  2EX9 A;  5CTN A;  5DTS A;  3AGF A;  2PBY A;  2ZC7 A;  1XA1 A;  2Y2N A;  4X6T A;  5CHM A;  4S2J A;  4DXB A;  2Y2M A;  2A3U A;  3UO9 A;  5E2G A;  1K6S A;  4K0W A;  3AGD A;  1CEF A;  4E3N A;  2H10 A;  1JWZ A;  4KG5 A;  5J8X A;  1YMX A;  3BEB A;  1ES2 A;  5FSR A;  5FI7 A;  3TG9 A;  1GA9 A;  4JF6 A;  1BUE A;  5EPH A;  3HLG A;  2WZX A;  3EQU A;  3N8L A;  2E8I A;  1EWZ A;  5HL1 A;  2JCH A;  3BFC A;  3EQV A;  3PBO A;  4JKT A;  2ZD8 A;  3M2J A;  1NZO A;  4KZ6 A;  4X53 A;  5M18 A;  4RYE A;  5GHY A;  1PI4 A;  2HDU A;  2WKH A;  4E6W A;  4QB8 A;  2JC7 A;  1JTD A;  1KVM A;  5AQB A;  5CEC A;  1GHP A;  1L2S A;  3ZG8 B;  1RGZ A;  4A5R A;  2G2W A;  4MEZ A;  2H0Y A;  2WYX A;  3BFF A;  4OQG A;  4GDB A;  3SH9 A;  3HVF A;  1K56 A;  1BUL A;  1E4D A;  1JVJ A;  2Y4A A;  3UN7 A;  5M19 A;  2V1Z A;  5DTT A;  3MXS A;  4HBT A;  5FI6 A;  5A91 A;  3WRT A;  1WYC A;  4GD8 A;  2J9O A;  5EUA A;  2P74 A;  1GA0 A;  4IVK A;  3G34 A;  4RX2 A;  4WMC A;  1G68 A;  5BOH A;  4R4S A;  2Z2L B;  1SHV A;  3LY4 A;  3N4I A;  4MBF A;  2Y2G A;  3S22 A;  4KZ7 A;  4DE0 A;  5DF8 A;  3JYI A;  2ZQ7 A;  4N92 A;  1J9M A;  2Y59 A;  4FD8 A;  3RXX A;  2QZ6 A;  3W4Q A;  1K54 A;  1GHM A;  1LLB A;  2WZZ A;  1NRF A;  1JWP A;  4RA7 A;  5GLA A;  5TR7 A;  1CEG A;  1TDG A;  5GHZ A;  4N1X A;  4QHC A;  3E2K A;  2DRW A;  3MBZ A;  1KGF A;  2PU2 A;  4JBF A;  3BFE A;  2BG1 A;  4EBP A;  4RVA A;  1ES3 A;  1IKG A;  4BD1 A;  4RX3 A;  5FAO A;  3WS0 A;  1K55 A;  2Z2M B;  3FWL A;  4U0X A;  2WAE A;  4C3Q A;  5CEB A;  5TGF A;  3LO7 A;  2QPN A;  5EVI C;  3W4P A;  2XR0 A;  4GZB A;  2H5S A;  2FFY A;  3GV9 A;  4B4Z A;  3HLD A;  3PAE A;  1PWG A;  5U47 A;  2ZM8 A;  5EVI A;  5EVL A;  1ZG4 A;  2XK1 A;  1Q2Q A;  4F94 A;  2ZM2 A;  3FKV A;  4OKP A;  4QU3 A;  3ZG7 B;  4P0M A;  4JXG A;  3ZVW A;  4DDY A;  1W5D A;  2IWD A;  3UPP A;  5KMW A;  4GN2 A;  1XA7 A;  3GQZ A;  1HVB A;  2VGK A;  3MZF A;  3M6H A;  1FQG A;  2Q9M A;  1K4E A;  1PWC A;  4NK3 A;  3W8K A;  2XEP A;  5FQQ A;  5HAI A;  3QHY A;  3N6I A;  5HX9 A;  2HDR A;  1MBL A;  4UHU A;  4E3I A;  3Q7Z A;  4WZ5 C;  1MWU A;  3C4P A;  3NC8 A;  5EEC A;  3UY6 A;  3V50 A;  3G31 A;  4PM6 A;  1IYQ A;  4DKI A;  2A49 A;  4XXR A;  3UE1 A;  1ERQ A;  3HLB A;  5A90 A;  4E3J A;  1BTL A;  4UAA A;  4OPR A;  3NY4 A;  4DF6 A;  5HAQ A;  3DTM A;  5CED A;  1K6R A;  3HLW A;  3UDI A;  1EI5 A;  3C7V A;  5JYP A;  1E3U D;  5FQJ A;  4E3L A;  3GMW A;  1MXO A;  1YLZ A;  4OOM A;  4DE1 A;  3A3J A;  2OV5 A;  5FA7 A;  1OME A;  2OLU A;  5A93 A;  2HP5 A;  1K38 A;  3BLM A;  2Y2Q A;  1YLW A;  3VFF A;  4E3K A;  3FYZ A;  4QY5 A;  4S2P A;  4ZJ1 A;  4Z9Q A;  4OH0 A;  1JWV A;  3D4F A;  4OPQ A;  1LL5 A;  3B3X A;  4S2O A;  3V39 A;  2XD1 A;  3CMZ A;  2HP9 A;  2V20 A;  1PZO A;  1NXY A;  1CK3 A;  1XPB A;  1ESI A;  3IF6 C;  3IXD A;  5GLC A;  3IF5 A;  3IHA A;  4PMA A;  4XUZ A;  2WGI A;  4X68 A;  1SCW A;  2Y2L A;  3M2K A;  5EOO A;  3IF6 A;  1M40 A;  2B5R A;  3IXG A;  4IBR A;  2JBF A;  4L0L A;  4OP8 A;  3MZD A;  5FAP A;  1IEL A;  2DNS A;  1JTG A;  3SOI A;  3IT9 A;  3ZNY A;  2ZMA A;  3ZDJ A;  2WAD A;  4Y7P A;  3NDE A;  4ZTK A;  5EVI B;  3GRJ A;  5KSH A;  1WE4 A;  1IKI A;  1BLH A;  3P09 A;  2HDS A;  4WM9 A;  3OPR A;  3PBR A;  2EXA A;  1L0F A;  2Y2K A;  4HES A;  1H8Z A;  4KG6 A;  2WGW A;  4OPZ A;  4UA7 A;  1NZU A;  2Y55 A;  2ZC4 B;  3VSK A;  3OCL A;  4S2I A;  3LCE A;  2BLS A;  4EV4 A;  1I2S A;  1PYY A;  3SH7 A;  2ZQ8 A;  1XGI A;  4R0Q A;  3A3D A;  1SDN A;  1W8Q A;  1MKI A;  4X55 A;  3PBT A;  2EX2 A;  2QMI A;  4OP5 A;  3S1Y A;  3BLS A;  1K54 C;  4CJN A;  3ITA A;  1IYO A;  2H0T A;  2P9V B;  1SKF A;  1KE3 A;  4ZAM A;  3UNW A;  4DE3 A;  5CGX A;  1KVL A;  3IWI A;  3C7U A;  3NCK A;  1BLP A;  3IWQ A;  1YLJ A;  4P85 A;  3ZGA B;  2ZLY A;  1PWD A;  1GHI A;  1TDL A;  2ZC5 B;  3HUO A;  4JXV A;  3WS5 A;  4C6Y A;  1K55 C;  1L0E A;  1VM1 A;  2XF3 A;  4Y0O A;  4YFM A;  4KG2 A;  5FAQ A;  2Y2J A;  3RXW A;  2XFT A;  3VOZ A;  3G35 A;  4WBG A;  2FFF B;  5DTK A;  3WS4 A;  4EQI A;  4WEK A;  3UDF A;  2IWB A;  5DF7 A;  1O7E A;  1TVF A;  2X02 A;  3Q82 A;  3HUM A;  3O3V A;  3WWX A;  4MNR A;  3E2L A;  3AGE A;  2C6W B;  4Q8I A;  4WYY A;  5AQA A;  4KQQ A;  3BFD A;  2Y91 A;  5AQ7 A;  1L0D A;  1BT5 A;  1BZA A;  1IYS A;  3BRM A;  4OQ0 A;  3PBS A;  4IVI A;  1XGJ A;  5FQI A;  1KE0 A;  3ZNT A;  1M6K A;  5GL9 A;  4OOL A;  4JXW A;  5A92 A;  1I5Q A;  1NYM A;  3GTC A;  4FCF A;  5HAR A;  1YM1 A;  3HBR A;  4KEN B;  4IBX A;  2G2U A;  1ZKJ A;  5CXW A;  1L0G A;  2XQZ A;  2Y2O A;  3IF6 B;  3MFD A;  2X01 A;  3VP1 A;  4EWF A;  3ZG9 B;  4GD6 A;  4MBH A;  3OPL A;  5E2E A;  1MWR A;  1S0W A;  5AQ9 A;  4N9L A;  5FQK A;  4BD0 A;  1W7F A;  2UWX A;  3OPP A;  3C4O A;  4N9K A;  1ALQ A;  1NJ4 A;  2WKI A;  5G18 A;  2EX8 A;  4MBK A;  5HFO A;  5GLD A;  1ESU A;  2HPB A;  4DDS A;  1ONH A;  1YQS A;  4KQR A;  4KZ4 A;  5E43 A;  4E3O A;  2EFX A;  4ZJ2 A;  3GVB A;  1XP4 A;  3VFH A;  5KZH A;  4C75 A;  5F82 A;  4KQO A;  3ZCZ A;  3LEZ A;  4U3T A;  5TFQ A;  3WS1 A;  2HP6 A;  1E3U A;  2J7V A;  2ZQD A;  3CJM A;  1CI8 A;  3WRZ A;  2ZQC A;  3HUN A;  1H8Y A;  1W8Y A;  1WYB A;  2C5W B;  1MWS A;  1ERO A;  4X56 A;  3VSL A;  4E6X A;  3TSG A;  3N8R A;  4LV3 A;  1Z6F A;  2JE5 A;  4E3M A;  4K0X A;  2Y2I A;  4Y0T A;  5E2F A;  1U60 A;  1H5X A;  3BFG A;  1TEM A;  2X71 A;  3GSG A;  2ZC3 B;  3MZE A;  3QNB A;  4JF5 A;  4OQI A;  3HRE A;  5FI2 A;  4LEN A;  4LCM A;  3ZHH A;  5CTM A;  3I7J A;  5JYO A;  5FAS A;  3G30 A;  4OPY A;  4GOG A;  4CPK A;  4S2L A;  5GLB A;  4BLM A;  3CG5 A;  5I94 A;  3HLE A;  3O86 A;  3GR2 A;  3UE0 A;  4QD4 A;  4FH4 A;  1K57 A;  5FQ9 A;  2PU4 A;  1NYY A;  3IQA A;  3VP4 A;  4B4X A;  4KZB A;  1IYP A;  2CC1 A;  4GB7 A;  3MKE A;  4B88 A;  1KGE A;  4LV1 A;  3OC2 A;  4P6B A;  1FR6 A;  1KDW A;  4H8R A;  4JXS A;  4KZ5 A;  4XUX A;  5CRF A;  5E2H A;  1VQQ A;  4M3K A;  3SS3 A;  1LL9 A;  4S2M A;  1KDS A;  3O88 A;  2I72 A;  1S6R A;  3G4P A;  5EOE A;  1PW8 A;  2XH9 A;  4FSF A;  3Q7V A;  2DCF A;  1W79 A;  3N8S A;  1LHY A;  1YLY A;  3ISG A;  2RL3 A;  4Y0U A;  3NBL A;  4YIN A;  1ES5 A;  4GKU A;  3M6B A;  1HZO A;  3ZFZ A;  4JF4 A;  3C5A A;  3TOI A;  3SH8 A;  5F1F A;  3BYD A;  2OLV A;  4PM9 A;  2WK0 A;  4OQH A;  2HDQ A;  1E25 A;  3P98 A;  3N7W A;  2WUQ A;  1FCO A;  2WKE A;  1BLC A;  2Y2P A;  3BEC A;  3DWZ A;  3IH8 A;  3HLC A;  4GNU A;  5M1A A;  1NY0 A;  3G2Z A;  3VP2 A;  1K4F A;  3A3E A;  2XFS A;  4WZ4 A;  3UPO A;  1QMF A;  2XD5 A;  3G2Y A;  3V3S A;  4ZBE A;  1FCN A;  2WGV A;  4PPR A;  1YLP A;  2J9P A;  1KE4 A;  1YT4 A;  3IH9 A;  2XGN A;  3FV7 A;  1MY8 A;  4OOY A;  4R3B A;  1RP5 A;  1K56 D;  2GDN A;  3A3F A;  3NIA A;  4KZ8 A;  1AXB A;  4KZ3 A;  4PM7 A;  3FKW A;  4UA9 A;  4JPM A;  3ZG5 A;  1KGG A;  1YLT A;  3DW0 A;  1LI0 A;  4U0T A;  4WMC D;  4EBL A;  3Q1F A;  4OON A;  3OZH A;  4R1G A;  4LCL A;  1C3B A;  1PZP A;  5DF9 A;  4D2O A;  4LV0 A;  3SS4 A;  4QY6 A;  1PW1 A;  3DWK A;  1DJA A;  2IWC A;  4UA6 A;  1K25 A;  1MPL A;  3NDG A;  1FSW A;  5IHV A;  4EUZ A;  4BQM A;  4PM5 A;  3QNC A;  4OLD A;  3WS2 A;  3IHB A;  2OSU A;  1DJB A;  4IED A;  4DXC A;  3VP3 A;  1HTZ A;  3IWO A;  3W4O A;  2J8Y A;  4PM8 A;  4N1H A;  5GHX A;  1Q2P A;  1ONG A;  3FZC A;  4OLG A;  4R4R A;  3G32 A;  4P87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...