4IBRA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s/e104k mutations
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TEM-94 ES-beta-lactamase
publication title What Makes a Protein Fold Amenable to Functional Innovation? Fold Polarity and Stability Trade-offs.
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ibrA00
2WAFA 2Y91A 4P87A 4E3JA 3OPRA 4KQOA 2OLUA 4S2KA 4PM5A 4OLGA 1MPLA 1H8ZA 5A93A 1N9BA 3IQAA 4X56A 1O07A 1FOFA 3FYZA 1KDWA 3CMZA 3G35A 1Q2QA 4M3KA 4OOLA 4X55A 2HP6A 3BFFA 3HVFA 2J8YA 3NI9A 1FR6A 4KZ9A 1YQSA 4NK3A 1G6AA 2H0YA 3MFDA 1NJ4A 4LENA 4WBGA 1XGIA 4Y7PA 5EPHA 4S2MA 5HAIA 4S2JA 5FA7A 4ZJ3A 3IWQA 1NY0A 1ZKJA 2R9WA 2XQZA 3W4OA 4IVIA 2XFTA 3OPPA 4PM8A 5FDHA 2XR0A 4ZBEA 4IBXA 5CGWA 1U60A 4KZ7A 4KZ4A 4U0XA 3N7WA 2QPNA 4KG5A 4N9LA 1BLHA 3RXXA 4EWFA 1ESUA 5AQAA 1YLWA 4WEKA 3OCNA 5GL9A 2Y2MA 1WE4A 1L0FA 2ZQ7A 3W4QA 2Z2LB 4C75A 1RP5A 2EXAA 2XH9A 4OVDA 1I2SA 3WS1A 4DDYA 1VM1A 3ZGAB 1SDEA 2ZQDA 3UO9A 2DCFA 3W4PA 4K0WA 1KVMA 1NYYA 3UPNA 4EV4A 3BFDA 4JF5A 4JPMA 4LV0A 1KE4A 2ZJ9A 4FH2A 4BD0A 4E3KA 2Y2JA 5DF8A 3IWIA 1ES4A 3ZG0A 1FSWA 1XA1A 4F94A 4LV2A 1ES2A 1LHYA 1SHVA 1SCWA 1LL9A 2IWDA 3WS2A 1YLPA 3UY6A 1HTZA 2RCXA 4QHCA 4X69A 3NDEA 2HDSA 1YLZA 4OONA 1ES3A 2ZC6B 1XPBA 5M18A 3DWZA 4OQIA 5EVIC 3IH9A 1LL5A 4RX2A 4B4XA 1PZPA 1BT5A 2XD1A 4WEJA 3NC8A 4Y0UA 4DXBA 2ZMAA 3EQUA 3UN7A 3G4PA 3G2ZA 3MZEA 1PW8A 3B3XA 4OP5A 4N92A 4LCLA 4DXCA 3SS5A 1QMEA 1XGJA 3SH7A 1NRFA 1GHMA 2C5WB 2P9VA 2WK0A 4WYYA 4Z9QA 3VSKA 3PAEA 3E2LA 1YT4A 3A3JA 4WZ4A 3HUOA 1XP4A 3ZHHA 4PM7A 3HLCA 1I2WA 1L0DA 2P74A 2Y2LA 4DDSA 1H8YA 2Q9MA 1E3UD 4KZ6A 4HEFA 2HDRA 4BD1A 4RA7A 4S2OA 3BFEA 3UPOA 1K6SA 4RX3A 5JYOA 1J9MA 2IWCA 1M40A 3ZFZA 5BOHA 3UNWA 1HZOA 3EQVA 2H5SA 5EOOA 4JKTA 4R23A 3IT9A 2Y55A 4UHUA 1PWDA 3N4IA 4GZBA 4WMCA 3ITBA 4N9KA 4MNRA 4E3LA 4JF6A 1JVJA 3OPLA 2Y59A 4KG6A 3VFFA 1NYMA 4K91A 3UDFA 1ERMA 5FQMA 2P9VB 1FCOA 3DWKA 2VGKA 3AGEA 2WGWA 2HP9A 1L0GA 3S4XA 3G2YA 3SS4A 2E8IA 4ZAMA 3HBRA 3LO7A 1JTDA 3PBNA 4GOGA 1KGEA 4BJPA 3MZFA 1WYBA 4DRTA 2EX9A 3UDXA 3O87A 3Q7ZA 1L0EA 1LLBA 4GD8A 1K56D 4JF4A 3IXHA 1XXMA 3OC2A 3VOZA 3LCEA 3IXDA 4ZJ2A 3IF6C 4H8RA 1RGYA 3V3RA 3ZG5A 1ES5A 4MEZA 3HUMA 5FQQA 4OPRA 4PMAA 4C3QA 5M19A 2J7VA 1E3UA 2WKHA 3NIAA 1ZG4A 3IWOA 3AGDA 1BULA 1K57C 1TDGA 4LCMA 4FH4A 3IHAA 2PU4A 1S0WA 4NETA 2Y2NA 3ZG7B 1MWRA 2I72A 4N1HA 5HW3A 2B5RA 1MKIA 2C6WB 3Q81A 4KENB 5AQBA 4QU3A 1SDNA 1IEMA 3C7UA 4R3JA 5EVIA 3V5MA 4IVKA 1KDSA 4OPZA 4MBHA 4O7DA 5EOEA 3UPPA 1YM1A 1ZC2A 2X02A 3G31A 4XUZA 4X68A 4HBUA 2WADA 5HAQA 5E43A 5FI2A 4KQQA 3ZG8B 5CXWA 4FSFA 3D4FA 4EUZA 5HL1A 2XGNA 3DW0A 5AQ7A 3S22A 1TEMA 4P6BA 5CECA 3WS5A 2ZD8A 1EROA 3GQZA 1BTLA 2WZZA 3N8RA 4E3MA 2XD5A 2HP5A 5EE8A 3HL9A 1MWTA 1PZOA 3HUNA 2OLVA 3GV9A 5CGSA 5AQ9A 4IEDA 5I94A 4R4RA 5EVIB 3ZG9B 4GN2A 3WWXA 5CTMA 3QNBA 1FCNA 5FI6A 3N8LA 2XDMA 3G32A 4OQGA 2WZXA 3M2KA 3JYIA 3IH8A 4Y0TA 2HDQA 4X53A 3MBZA 3MZDA 4JXVA 1FQGA 5KSHA 3Q7VA 2ZM0A 3BLMA 2XEPA 1PIOA 1W7FA 3C4PA 4RYEA 2ZQCA 3GR2A 1JWPA 3BFCA 5FATA 4UA7A 3NDGA 5L2FA 2ZLYA 4MLLA 5A91A 4FCFA 4ZJ1A 2Y2OA 4WELA 4XXRA 1MBLA 5DTKA 1CI9A 3VP2A 2GDNA 1W8YA 4QY5A 4RVAA 4KZ5A 3VP0A 2WYXA 2G2WA 4JLFA 5E2EA 2EXBA 2PU2A 2Y2HA 4GDBA 2H0TA 4QD4A 3PBSA 1NZUA 1KE0A 4LV1A 3IF6A 3ZCZA 5DTSA 2Y2QA 1YLJA 2QMIA 2VGJA 3NCKA 4GDNA 2OSUA 4S2LA 5GLBA 5A90A 3WRTA 3Q7VB 1K57A 4E3OA 2H10A 1DY6A 3GTCA 2V2FF 4ZTKA 5KZHA 1MY8A 1RCJA 3PAGA 5F1GA 3VP3A 3SH8A 1KE3A 4YINA 4R4SA 4Y0OA 1EWZA 4KZBA 3BM6A 2WAEA 4JXGA 1IYQA 2WGVA 3GRJA 3BFGA 2HPBA 5GLAA 5FSRA 4EQIA 5EUAA 5U47A 4ZDXA 1CEFA 3ZDJA 4QJGA 4E6XA 2ZQ9A 3VSLA 1MWUA 1TVFA 2V20A 3N6IA 4GKUA 3A3FA 3MKFA 4P0MA 1IYPA 2ZC3B 3I7JA 4X6TA 4R1GA 5E2HA 5IHVA 5E2FA 4DE1A 1XKZA 2ZM8A 2V1ZA 1K25A 4HBTA 4OP8A 2JE5A 3IHBA 4JBFA 4WZ5C 3UE0A 3WRZA 2G2UA 1BLSA 4UA6A 5GLDA 1MXOA 3RJUA 3A3DA 3IXGA 1Z6FA 1JWZA 1JWVA 1PWCA 2A3UA 3P09A 3QNCA 1IYSA 5FQKA 5FI7A 1FR1A 5JYPA 1K4FA 2XLNA 1PW1A 2DNSA 1GA9A 4BL3A 1KGGA 5EECA 2ZQAA 2ZC4B 2CC1A 4U0TA 5CGXA 3TOIA 5DF9A 2XK1A 2R9XA 4JXWA 5F1FA 3M2JA 2Z2MB 4BL2A 3WS4A 3A3EA 4GNUA 1K38A 5FASA 2Y4AA 5TR7A 4XUXA 1NXYA 1DJAA 4LV3A 1YLYA 2WGIA 5CEDA 2XFSA 5CTNA 3SH9A 1FCMA 2Q9NA 3A3IA 1K54A 4KZ8A 5KSCA 1BZAA 4N1XA 3G34A 4PPRA 5CRFA 5KMWA 3BLSA 3PBTA 3HREA 5CEBA 2WGWB 3BECA 1AXBA 1PWGA 2PBYA 2OV5A 4QB8A 1CI8A 4Q8IA 2X71A 3NBLA 1E25A 1HD8A 4C6YA 3FKWA 3HLGA 3BEBA 3O88A 5FQJA 3VP1A 5CHUA 4BLMA 4KG2A 3IXBA 2XF3A 1PI4A 5CHMA 4CPKA 3HLWA 5HFOA 4EBLA 2RL3A 3S1YA 1K56A 3IF5A 1BSGA 2EFUA 5DVAA 4E3NA 1XX2A 4B4ZA 5EVLA 3Q82A 5GLCA 2WKIA 4L0LA 4EBPA 1RGZA 1ESIA 3MXSA 4DF6A 2JC7A 1M6KA 4DE3A 1IYOA 3QHYA 3UE3A 4P85A 2WUQA 5GHZA 4GB7A 5FAPA 1S6RA 4ID4A 4GD6A 2QZ6A 1GHPA 2UWXA 3OZHA 1K55C 1K54C 4HESA 3ZNTA 4CJNA 1FSYA 3P98A 3C5AA 5E2GA 1JTGA 1L2SA 4DKIA 3N8SA 3UDIA 2ZC5B 1ALQA 1YLTA 4KQRA 1WYCA 3ZNYA 4WZ5A 4D2OA 1VQQA 1LI9A 2EX8A 3GVBA 2X01A 3GMWA 1W79A 1SKFA 3HLEA 1K4EA 4PM6A 1LI0A 1TDLA 2A49A 4YFMA 2EFXA 1E4DA 4JXSA 1CK3A 1BLCA 3CZDA 3ISGA 3OCLA 1MWSA 2Y2KA 2ZM2A 3VFHA 2JBFA 1NZOA 3FV7A 3VP4A 4BQMA 2IWBA 4DE0A 4WMCD 3SOIA 1W8QA 3E2KA 2JCHA 3C7VA 5FQ9A 3RXWA 3HLDA 1W5DA 5CHJA 2WKEA 4K0XA 3TSGA 4EBNA 5M1AA 4S2NA 5TGFA 4OH0A 5FAQA 4BENA 1O7EA 2BG1A 1HVBA 5DTTA 3ZVWA 5FAOA 1IELA 4A5RA 3O86A 3MKEA 3FZCA 4OLDA 3LEZA 1KVLA 1IKIA 2EX2A 1ONHA 3TG9A 3PTEA 2Y2GA 2Y2IA 5CERA 5TFQA 3LY3A 3Q07A 1ZG6A 4FD8A 4OPYA 3UE1A 3Q1FA 4E3IA 4R0QA 5F82A 1YMSA 3V50A 5FQIA 2FFFB 3M6BA 5GHXA 4OQHA 1PYYA 2HDUA 2ZQ8A 3MXRA 4OOMA 1ONGA 2J9PA 3IF6B 4S2IA 2FFYA 4IBRA 4OKPA 4OQ0A 1QMFA 4KZ3A 1G68A 3LY4A 4MBFA 4PM9A 2BLSA 1ERQA 3BRMA 3DTMA 3G30A 5GHYA 3FWLA 3V39A 2ZC7A 4UAAA 2EX6A 4DE2A 1CEGA 1IKGA 1C3BA 4OPQA 4UA9A 3HLFA 5EVID 4OOYA 5A92A 3FKVA 3V3SA 1PI5A 1DJCA 5DF7A 3VOYA 5F83A 3HLBA 1XA7A 1BLPA 3AGFA 1H5XA 5G18A 4MBKA 1GA0A 3NY4A 4KZAA 3ITAA 5HARA 4WM9A 3O3VA 1I5QA 4QY6A 3SS3A 3WS0A 1K6RA 3PBQA 5HAPA 3ZVTA 2DRWA 4S2NC 1EI5A 3M6HA 4R3BA 5D3OA 5J8XA 1K55A 3C4OA 1YMXA 1DJBA 4U3TA 4B88A 3BYDA 1KGFA 1GCEA 1Y54A 2J9OA 1GHIA 2Y2PA 1N4OA 3OPHA 3VMAA 3CJMA 3GSGA 1OMEA 3PBRA 1BUEA 1Q2PA 3W8KA 5HX9A 3CG5A 3PBOA 4S2PA 4E6WA
chains in the Genus database with same CATH superfamily
5F6AA 2P7JA 4KQOA 1MPLA 5A93A 1N9BA 1T19A 3IQAA 4HJ6A 1FOFA 3G35A 5FDSA 2HP6A 1FR6A 4LENA 5DFXA 3SW1A 4S2MA 3NOTC 3NULA 2YKFA 3W4OA 3P01A 4KG5A 2O9BA 4N9LA 3KSFA 1TS6A 3T4JA 5HZHA 4C75A 1RP5A 4DDYA 4NEED 2O9CA 4E3KA 1XFNA 4KUOA 2Y2JA 3T50A 5DF8A 4O01A 1ES4A 5J7EA 1XA1A 1SHVA 1LL9A 2L1MA 1HTZA 2RCXA 4NXGA 2E8JA 4B4XA 4Q0HA 2V9AA 1CQAA 3HJKA 4HP4A 5AVFA 1PZPA 4WEJA 4X1MA 2JKTI 2ZMAA 5HPFA 4EQ1A 4OP5A 4N92A 4DXCA 2K2NA 3LR4A 3SH7A 2WK0A 3VSKA 4Z9QA 3A3JA 3HUOA 2Z6CA 3HLCA 3KSGA 1H8YA 4G3KA 4KZ6A 4HEFA 2HDRA 3OBFA 4S2OA 2PYPA 2LB5A 5MC7A 2H5SA 4UHUA 4GZBA 4E3LA 4KG6A 1NYMA 5FQMA 2WGWA 3S4XA 3UMDA 2ZOHA 3PBNA 1JTDA 1KGEA 4LPZA 2JKTM 3OC2A 3IXDA 4XT2A 3IF6C 1ZHHB 4H8RA 3V3RA 4OPRA 4PMAA 4C3QA 1L3LA 3T4OA 2QJ7A 1E3UA 1ZG4A 1F98A 1BULA 3AGDA 3DTIA 3MF0A 4JGOA 2PU4A 5DKLA 1MWRA 4KENB 4FUWA 1J3WA 1SDNA 3C7UA 2QWSA 4OPZA 2P04A 2OWHA 3TJZC 1ZC2A 4XUZA 5EM1A 4LRZE 2J3WA 5HAQA 5G4ZA 1SZVA 4EUZA 4PAUA 1TEMA 4P6BA 2ZD8A 4EEUA 2XD5A 2EWWA 1GSWA 5CGSA 4IEDA 4GN2A 3NHQA 1FCNA 5FI6A 3IH8A 3MBZA 4JXVA 5KSHA 3Q7VA 4RYEA 3GR2A 1JWPA 4WN5A 3PR6A 5DJTA 3NDGA 3LUQA 1T18A 5A91A 4XXRA 1W63M 4RVAA 4QY5A 4KZ5A 1YSPA 3KYZA 4GDBA 2H0TA 3MQOA 3PBSA 1UWPX 1KE0A 3IF6A 5DTSA 3GDIA 3NCKA 4S2LA 5GLBA 5A90A 2B95A 3EOIA 1MY8A 1RCJA 3PAGA 3VP3A 2WKRA 4EESA 2OAQ1 3NECA 4EQIA 5EUAA 1CEFA 1TVFA 4GKUA 3MKFA 4P0MA 3I7JA 1TD5A 5E2HA 4CLCE 2V1ZA 3UE0A 3WRZA 1FIKA 5GLDA 3FG8A 1MXOA 5TBMA 3IXGA 2A3UA 5FQKA 5FI7A 1N9OA 2XLNA 4E04A 3K2NA 2GJ3A 3JVVA 3IX4A 4UQIS 4BL2A 3WS4A 4GNUA 2Y4AA 1DJAA 2WGIA 1FCMA 3A3IA 1K54A 2J3TD 2WGWB 1PWGA 2PBYA 4QB8A 1CI8A 2PAVP 4C6YA 3FKWA 3O88A 3VP1A 5DKKA 3ZYTA 2VLGA 3R4KA 1PI4A 4CPKA 4EBLA 2B02A 1T1CA 4B4ZA 3Q82A 1P9WA 4L0LA 4RQ9A 5GLCA 1RGZA 1ESIA 4DF6A 5HDCA 3LR3A 3UE3A 4P85A 4GB7A 4WLAA 1OTDA 2QZ6A 1GHPA 2UWXA 1FSYA 3UDIA 2W1TA 4KQRA 1Y28A 1WYCA 1LI9A 3EGXC 1P0ZA 3BQ8A 3KSIA 4MCWA 3TRCA 4YFMA 3CZDA 4YWZA 4WMCD 2Z6DA 4D60A 2JCHA 5FQ9A 3TE8A 4K0XA 4EBNA 1LSVA 4HH2A 4DJ2A 1IOUA 5DTTA 3QP1A 5HWWA 4R70A 3O86A 4O0PA 1KVLA 2KOIA 3D3OA 2J3TC 2R78A 2PHYA 3Q07A 3CUEC 4FD8A 4E3IA 3W2ZA 1YMSA 4OOMA 4PM5A 3MXRA 1ONGA 3IF6B 4S2IA 2ZL1B 3DTMA 3FWLA 1OPXA 5HDSA 4UA9A 3QP2A 1LSXA 1PI5A 2BTFP 5F83A 3L7HA 1XA7A 1BLPA 3AGFA 2JKGA 4ZRRA 3NY4A 5HARA 1DRMA 2VJWA 1K6RA 3WS0A 1BYWA 1EI5A 2M7VA 1YMXA 1DJBA 4F3LA 1GHIA 3VMAA 3KX0X 1Q2PA 5HX9A 5TBMB 4R3AA 2WAFA 4P87A 3OPRA 4OLGA 4X56A 3FYZA 4M3KA 3CMZA 4OOLA 3HVFA 2J8YA 2H28A 3NI9A 4KZ9A 1YQSA 4CQHA 1G6AA 2H0YA 3MFDA 1XGIA 5FA7A 4ZJ3A 1NY0A 4DJ3A 2XA7S 2VV6A 4Y2FA 4KZ7A 4U0XA 1PRQA 2AVXA 1ESUA 1YLWA 3CUEA 2XRNA 2XH9A 1VM1A 2ZBBA 2DCFA 1NYYA 3V67A 5L09A 3EGDC 4KUKA 4EV4A 3BFDA 4JPMA 1YKDA 1KE4A 2ZJ9A 4FH2A 2PDRA 2ACGA 3RH8B 4LRXC 2VV7A 4F94A 4LV2A 1ES2A 2W3FA 5HDDA 3WS2A 1YLPA 2M1CA 4OONA 1ES3A 4ETXA 3ZQ5A 2A24A 2FH5A 1OTIA 3G4PA 3G2ZA 3MZEA 4LCLA 1XGJA 4YOFA 2C5WB 2I9VA 4UEYA 3PAEA 3E2LA 1YT4A 1XP4A 3ZHHA 5DFYA 1I2WA 5CX7A 2QKPA 2BASA 3LIDA 2Q9MA 1E3UD 2UV0E 2O9AA 1N9NA 3UPOA 5JYOA 1J9MA 1LSWA 5BOHA 1HZOA 1LT0A 3BW6A 4WL9A 1F9IA 4R23A 1PWDA 4WMCA 2J80A 4MNRA 4N9KA 3OPLA 2Y59A 4K91A 3NOUC 1GSXA 3UDFA 2P9VB 2D02A 3SS4A 2E8IA 2VEAA 4GOGA 3LR5A 1WYBA 2HGVA 4DRTA 2EX9A 3UDXA 3E4QA 1L0EA 1LLBA 3MQQA 4QPRA 4GD8A 4JF4A 3UB6A 4ZJ2A 3ZG5A 4MEZA 5M19A 4IJGA 2A2LA 3IWOA 4LCMA 4Z1WA 4EU0A 2VV8A 4Y15A 3IHAA 2HF6A 3LIBA 3E4OA 4NETA 3ZG7B 1V9YA 2EA9A 5HW3A 5AQBA 2W27A 3K3DA 4PKYG 4QU3A 4IVKA 2V1AA 3LICA 4O7DA 5L10A 2PD8A 3S7QA 4F3LB 5KIZA 4X68A 4HBUA 5FI2A 3S7NA 3ZG8B 5CXWA 3UE6A 5HL1A 2XGNA 3DW0A 2K31A 5K5BA 2KDKA 3D9YA 3OLOA 2KLIA 2WZZA 3HL9A 3HUNA 1PZOA 2OLVA 3GV9A 3C8CA 4HI4A 3ZG9B 3WWXA 5CTMA 3QNBA 1OT6A 2FZ0A 3JYIA 5IS1A 2HDQA 3MSHA 2ZM0A 4MDZA 2XEPA 5L8MA 2HJ9C 3C4PA 5HSQA 3T4KA 5I5LA 3BFCA 4I39A 4UA7A 5FATA 4BMWA 5L2FA 3VE4A 2ZLYA 1OTEA 4WELA 2XROA 5DTKA 3VP2A 2GDNA 1W8YA 3VP0A 2G2WA 4QD4A 4L9GA 4ESPA 2CMNA 3LI9A 1D7EA 4I5SA 4PKYA 3GTCA 5TJJA 1KE3A 4NKPA 1EWZA 2A24B 4KZBA 1IYQA 2WGVA 2HPBA 1FILA 4ZDXA 3T1RA 2L4RA 2YKHA 2WKQA 3N6IA 2JKRM 2ZC3B 3BY9A 1JNUA 3KYEA 2VZWA 4R1GA 5C5KA 2ZM8A 3QP8A 4WZ5C 4JBFA 2QHKA 3LGOA 2JHEA 2V1BA 3P09A 1FR1A 1Z09A 1S66L 1PW1A 1GA9A 4CLCB 1KGGA 2ZQAA 4LRYC 5CGXA 3TOIA 2XK1A 2R9XA 3L9KA 2Z2MB 5TR7A 1NXYA 2VA0A 3EWKA 5CEDA 4ARZB 3SH9A 1BZAA 4PPRA 3A0VA 3PBTA 5CEBA 1AXBA 2OV5A 4Q8IA 3R7WB 1E25A 5A8BA 3BEBA 1H0MA 3LIAA 3E0YA 2V8FA 4KG2A 3O5YA 3IXBA 4GJ4A 3HLWA 2IA2A 1BSGA 1CJFA 2EFUA 1YSQA 4JGRA 2JC7A 3F1PA 2VGLS 2EWVA 5GHZA 3FPWA 4ID4A 1XJ2A 1K55C 1K54C 4CJNA 3ZNTA 3P98A 3C5AA 5E2GA 1L2SA 4DKIA 2W0NA 4R38A 4WZ5A 3H7WA 3GMWA 1OJGA 1P97A 3T4TA 3HLEA 4PM6A 2DMWA 3RTYA 4EW7A 3CHWP 1E4DA 4JXSA 3T4SA 1BLCA 3VFHA 3NJAA 4BQMA 2IWBA 2ZL1A 3SOIA 1W8QA 3E2KA 3C7VA 3RXWA 3E4PA 1PNEA 2WKEA 4EERA 4GHIA 4S2NA 4BENA 5FAQA 1O7EA 2BG1A 1IELA 4A5RA 2MJ6A 3MJQA 2VKSA 1V9ZA 2EX2A 3TG9A 3PTEA 5TFQA 3LY3A 3ICYA 5L07A 4HH3A 4OQHA 1PYYA 4G3VA 4L9FA 2V0UA 4KZ3A 5GHYA 2ZC7A 4MN7A 4OPQA 1UGUA 1DJCA 5F69A 1GA0A 4KZAA 3O3VA 4QY6A 5HAPA 2DRWA 5HPIA 1K55A 3C4OA 4U3TA 1EW0A 4DMZA 1Y54A 2J9OA 1D1JA 3CJMA 3GSGA 3PBRA 4GS9A 3W8KA 2Y91A 4NXFA 1HLUP 2OLUA 4HHDA 3V39A 1KDWA 1Q2QA 3BFFA 4WBGA 4Y7PA 1NJ4A 1OT9A 5HAIA 5AJGA 4S2JA 3CITA 3IWQA 1ZKJA 2R9WA 4I3JA 3OPPA 4IVIA 2XR0A 4ZBEA 4GLQA 4IBXA 5CGWA 1TS7A 2QPNA 3RXXA 4BBVA 4I3IA 3OCNA 1WE4A 1L0FA 2ZQ7A 3W4QA 2Z2LB 4Q0JA 3T1XA 4OVDA 3WS1A 3MXQA 1SDEA 2Y79A 3UO9A 2PR6A 4K0WA 1KVMA 3UPNA 3OOVA 4LV0A 4H6JA 5FEFA 2GX5A 1LHYA 4O8GA 4CLCD 1SCWA 2GNXA 3UY6A 3T1SA 3F1PB 2HDSA 1YLZA 2ZC6B 4OQIA 3IH9A 1T1BA 4RX2A 4NXBA 1NLZA 2HZ5A 1BT5A 1VHMA 1K0KA 4Y0UA 4DXBA 2OWJA 4I38A 3B3XA 3H7WB 2P9VA 4WYYA 4WZ4A 1TF1A 4GW9A 3F1NA 2P74A 3UB5P 4BD1A 3BFEA 3B42A 2IWCA 3UNWA 2D01A 3EQVA 4GHIB 5EOOA 2HJEA 2Y55A 3N4IA 2PYRA 3ITBA 3A0SA 4JF6A 1VEUB 3VFFA 3LFVA 1ERMA 3DWKA 3AGEA 4QWOA 1L0GA 3MQ0A 4ZAMA 3LO7A 3MZFA 3O87A 3CWFA 4Y3IA 3IXHA 1XXMA 3VOZA 5HD5A 5LBRA 1RGYA 3KYQA 1F2KA 2Q0OA 2WKHA 3NIAA 1TDGA 4FH4A 1S0WA 4CLCC 2I72A 4N1HA 2B5RA 3V5MA 4HOIA 3G31A 2WADA 5E43A 4GS9B 4FSFA 3KO6A 4MN5A 5AQ7A 2NUTC 3WS5A 1EROA 3N8RA 4BBUA 2HP5A 5EE8A 5EVEA 3ULFA 3HCYA 4R4RA 5EVIB 4OQGA 3G32A 1XFQA 4X53A 3PHYA 1FQGA 1PIOA 5G4YA 2ZQCA 2Y2OA 1MBLA 4BBTA 5E2EA 2EXBA 2PU2A 1NZUA 4LV1A 3IBRA 4H6JB 4IUHA 2Y2QA 4M4XA 3WRTA 4E3OA 2V2FF 4ZTKA 5KZHA 5F1GA 5F68A 3SH8A 4YINA 1XJ6A 4EETB 4CLCA 3BM6A 4JXGA 1DP9A 3GRJA 5GLAA 5U47A 2VK3A 1MZUA 4MMNA 1MWUA 1A0KA 4ARZA 4X6TA 3LIFA 1XKZA 2W3DA 4HBTA 5HWTA 3R7WA 1BLSA 4UA6A 3F1NB 4DE1A 3A3DA 2W3EA 1Z6FA 1JWZA 1PWCA 1IYSA 1GSVA 1K4FA 4BL3A 5EECA 1S4SA 2ZC4B 3H82B 4U0TA 5DF9A 5F1FA 5EFWA 3S7OA 4WF0A 4LV3A 1YLYA 4X1LA 3CAXA 2XFSA 5CTNA 5KSCA 4KZ8A 3LEQA 4N1XA 2G7UA 1D06A 2X71A 3HLGA 5FQJA 1S4RA 2HV1A 1S1ZA 3DTEA 1SKOA 3MR0A 5HFOA 1YAXA 5F5YA 2RL3A 5DVAA 1LL8A 4E3NA 1XX2A 1M6KA 4DE3A 3QHYA 1UWNX 2PT7A 1S6RA 2JKRI 4GD6A 1X0OA 3IX3A 2PBDP 1G5UA 3E98A 3N8SA 3UMEA 4YNRA 1YLTA 2ZMVA 3BY8A 4R6LA 2EX8A 1F5MA 3MFXA 1SKFA 3MMHA 2ZOIA 2EFXA 1CK3A 2NUPC 3OCLA 3ISGA 5IT5A 3K3CA 2Y2KA 2L0WA 2JBFA 1NZOA 1DP6A 3FV7A 3QP4A 2K7SA 4JGQA 3MS6A 3HLDA 3EEAA 3A0RA 5M1AA 4OH0A 5HD3A 3ZVWA 3HJIA 2B18A 3MKEA 4OLDA 3LEZA 4UQIM 4II7A 5CERA 1ZG6A 4OPYA 3UE1A 3Q1FA 4HQAA 5F82A 1WA9A 5FQIA 2LB9A 3M6BA 2HDUA 2J9PA 2FFYA 5J4EA 4IBRA 1QMFA 1G68A 4MBFA 2BLSA 1ERQA 2XSSA 3G30A 4GCZA 2EX6A 4DE2A 1CEGA 5EVID 1OJ5A 3H9WA 4OOYA 5A92A 4I3AA 3V3SA 5DF7A 3VOYA 2W1RA 3HLBA 2GZAA 3IX8A 4LLOB 1H5XA 5G18A 3ITAA 1I5QA 3DTKA 3G6OA 3T1QB 4DN0A 3ZVTA 4S2NC 3B33A 4R3BA 5D3OA 1MC0A 5J8XA 4B88A 3BYDA 3EEHA 3OPHA 2Y2PA 1N4OA 1P9RA 1OMEA 1BUEA 1VB6A 3JVUA 4E3JA 4S2KA 5EM0A 1H8ZA 1O07A 4X55A 3JPUA 4NK3A 1OTBA 4HP9A 5EPHA 5EV0A 3UB9A 3T12B 2XQZA 2XFTA 4PM8A 4B9OA 5FDHA 4MN6A 1U60A 4KZ4A 3N7WA 1BLHA 4EWFA 3U4LP 5AQAA 4FTXA 4WEKA 5GL9A 2Y2MA 4BWIA 2O0YA 2EXAA 1I2SA 2WKPA 3ZGAB 2ZQDA 3W4PA 4NXEA 3F1OA 1SKOB 4JF5A 2VX8A 4BD0A 3IWIA 3ZG0A 1FSWA 3LYXA 1STZA 3IS2A 2IWDA 1S67L 3CPTA 4QHCA 4X69A 3NDEA 3UB8A 4EXOA 1DP8A 1XPBA 5M18A 3DWZA 1NLYA 4EEPA 5EVIC 1LL5A 2XD1A 3NC8A 3EQUA 3UN7A 4Q0IA 5FL3A 5AVEA 1PW8A 3QP6A 3SS5A 1QMEA 1VEUA 1NRFA 1GHMA 1W63Q 1G6OA 1TS0A 1Y4OA 4PM7A 1L0DA 2Y2LA 4DDSA 4RA7A 5HL6A 1K6SA 4RX3A 1M40A 3ZFZA 4PHTA 4JKTA 3IT9A 2V0WA 1JVJA 4HNBA 1FCOA 2VGKA 2O99A 2HP9A 3D72A 3G2YA 1NRJA 3HBRA 4BJPA 3KSHA 1N9LA 3Q7ZA 2XA7M 1H3QA 1K56D 2QJ5A 3LCEA 4Y5FA 1ES5A 3HUMA 5FQQA 1G28A 5FEGA 2J7VA 1K57C 2JN7A 4LFUA 2Y2NA 3UB7A 2C6WB 1MKIA 3P7NA 3Q81A 5EVIA 4R3JA 1IEMA 3C2WA 3VOLA 1KDSA 4MBHA 5EOEA 3UPPA 1YM1A 2X02A 4KQQA 3U2AA 1OTAA 2PD7A 1ACFA 4XT2B 3D4FA 3S22A 5CECA 2PRFA 3NOPC 3GQZA 1BTLA 3FPVA 4E3MA 1MWTA 2OOLA 5AQ9A 5IU1A 3DBAA 3RFBA 5I94A 4FOFA 2JKFA 3N8LA 2XDMA 2WZXA 3M2KA 2OAP1 4Y0TA 3MZDA 3BLMA 1W7FA 4G3WA 3C38A 4WUJA 3T4QA 4MLLA 3BQAA 4FCFA 4ZJ1A 3C30A 1CI9A 2WYXA 4JLFA 2W3GA 2Y2HA 3F1OB 4HY8A 4P6ZM 3ZCZA 2W3HA 1YLJA 2QMIA 2VGJA 3IS2B 4GDNA 2OSUA 3LR0A 1ODVA 3CPTB 1K57A 3Q7VB 2H10A 1DY6A 4R4SA 4HJ3A 4Y0OA 1PFLA 2WAEA 3H82A 3BFGA 5FSRA 3ZDJA 4QJGA 4E6XA 2ZQ9A 3VSLA 2V20A 3A3FA 1IYPA 1VETA 3DAVA 5IHVA 5E2FA 1K25A 4OP8A 2JE5A 3IHBA 2G2UA 4JGPA 3RJUA 5JYPA 3VE3A 3QNCA 1JWVA 4EUVA 2DNSA 4B93A 1NWZA 3LI8A 2CC1A 4JXWA 3M2JA 3A3EA 1K38A 5FASA 4XUXA 4KQDA 3S7PA 3IBJA 2Q9NA 4ME4A 3G34A 5CRFA 5KMWA 3BLSA 3HREA 3T4LA 3BECA 3NBLA 2V8CA 1HD8A 5CHUA 4BLMA 1T1AA 3CI6A 2XF3A 4X25A 5CHMA 1TS8A 3VV4A 3S1YA 1K56A 3IF5A 3B47A 5EVLA 2WKIA 4EBPA 3MXSA 4AFIA 4ETZA 3TW8A 1IYOA 4LGWA 2WUQA 5FAPA 3QP5A 3GECA 4IHQA 3OZHA 3CLOA 5DJUA 4HESA 1KOUA 2ZMFA 1JTGA 3BJNA 2ZC5B 1ALQA 3ZNYA 4D2OA 1VQQA 2M7UA 3GVBA 2X01A 1W79A 1H8MA 1K4EA 4Y13A 1LI0A 1TDLA 2A49A 1MWSA 2ZM2A 4NG2A 1ZTUA 3PYPA 3VP4A 4DE0A 2QYBA 2PR5A 3PXPA 1W5DA 5CHJA 5HWVA 3TSGA 5TGFA 4L9EA 1CF0A 1HVBA 5FAOA 4HIAA 2INWA 2W1TB 3FZCA 1IKIA 4IUKA 1ONHA 2Y2GA 2Y2IA 4R0QA 3V50A 2FFFB 5GHXA 1XJ3A 2ZQ8A 1IFQA 4OKPA 4OQ0A 4K08A 3LY4A 4PM9A 3BRMA 5J3WA 3FC7A 4UAAA 4HJ4A 1IKGA 1C3BA 2Y8HA 3HLFA 3FKVA 3LIEA 1YPRA 1XJ4A 3BWLA 4Y17A 2KX6A 4MBKA 1MKMA 1AWIA 4P6ZS 4WM9A 3SS3A 3SZTA 3PBQA 2P08A 3M6HA 1VETB 1KGFA 2VGLM 1S1YA 1GCEA 3CG5A 3PBOA 4S2PA 4E6WA
chains in the Genus database with same CATH topology
2WAFA 2Y91A 4P87A 4E3JA 3OPRA 4KQOA 2OLUA 4S2KA 4PM5A 4OLGA 1MPLA 1H8ZA 5A93A 1N9BA 3IQAA 4X56A 1O07A 1FOFA 3FYZA 1KDWA 3CMZA 3G35A 1Q2QA 4M3KA 4OOLA 4X55A 2HP6A 3BFFA 3HVFA 2J8YA 3NI9A 1FR6A 4KZ9A 1YQSA 4NK3A 1G6AA 2H0YA 3MFDA 1NJ4A 4LENA 4WBGA 1XGIA 4Y7PA 5EPHA 4S2MA 5HAIA 4S2JA 5FA7A 4ZJ3A 3IWQA 1NY0A 1ZKJA 2R9WA 2XQZA 3W4OA 4IVIA 2XFTA 3OPPA 4PM8A 5FDHA 2XR0A 4ZBEA 4IBXA 5CGWA 1U60A 4KZ7A 4KZ4A 4U0XA 3N7WA 2QPNA 4KG5A 4N9LA 1BLHA 3RXXA 4EWFA 1ESUA 5AQAA 1YLWA 4WEKA 3OCNA 5GL9A 2Y2MA 1WE4A 1L0FA 2ZQ7A 3W4QA 2Z2LB 4C75A 1RP5A 2EXAA 2XH9A 4OVDA 1I2SA 3WS1A 4DDYA 1VM1A 3ZGAB 1SDEA 2ZQDA 3UO9A 2DCFA 3W4PA 4K0WA 1KVMA 1NYYA 3UPNA 4EV4A 3BFDA 4JF5A 4JPMA 4LV0A 1KE4A 2ZJ9A 4FH2A 4BD0A 4E3KA 2Y2JA 5DF8A 3IWIA 1ES4A 3ZG0A 1FSWA 1XA1A 4F94A 4LV2A 1ES2A 1LHYA 1SHVA 1SCWA 1LL9A 2IWDA 3WS2A 1YLPA 3UY6A 1HTZA 2RCXA 4QHCA 4X69A 3NDEA 2HDSA 1YLZA 4OONA 1ES3A 2ZC6B 1XPBA 5M18A 3DWZA 4OQIA 5EVIC 3IH9A 1LL5A 4RX2A 4B4XA 1PZPA 1BT5A 2XD1A 4WEJA 3NC8A 4Y0UA 4DXBA 2ZMAA 3EQUA 3UN7A 3G4PA 3G2ZA 3MZEA 1PW8A 3B3XA 4OP5A 4N92A 4LCLA 4DXCA 3SS5A 1QMEA 1XGJA 3SH7A 1NRFA 1GHMA 2C5WB 2P9VA 2WK0A 4WYYA 4Z9QA 3VSKA 3PAEA 3E2LA 1YT4A 3A3JA 4WZ4A 3HUOA 1XP4A 3ZHHA 4PM7A 3HLCA 1I2WA 1L0DA 2P74A 2Y2LA 4DDSA 1H8YA 2Q9MA 1E3UD 4KZ6A 4HEFA 2HDRA 4BD1A 4RA7A 4S2OA 3BFEA 3UPOA 1K6SA 4RX3A 5JYOA 1J9MA 2IWCA 1M40A 3ZFZA 5BOHA 3UNWA 1HZOA 3EQVA 2H5SA 5EOOA 4JKTA 4R23A 3IT9A 2Y55A 4UHUA 1PWDA 3N4IA 4GZBA 4WMCA 3ITBA 4N9KA 4MNRA 4E3LA 4JF6A 1JVJA 3OPLA 2Y59A 4KG6A 3VFFA 1NYMA 4K91A 3UDFA 1ERMA 5FQMA 2P9VB 1FCOA 3DWKA 2VGKA 3AGEA 2WGWA 2HP9A 1L0GA 3S4XA 3G2YA 3SS4A 2E8IA 4ZAMA 3HBRA 3LO7A 1JTDA 3PBNA 4GOGA 1KGEA 4BJPA 3MZFA 1WYBA 4DRTA 2EX9A 3UDXA 3O87A 3Q7ZA 1L0EA 1LLBA 4GD8A 1K56D 4JF4A 3IXHA 1XXMA 3OC2A 3VOZA 3LCEA 3IXDA 4ZJ2A 3IF6C 4H8RA 1RGYA 3V3RA 3ZG5A 1ES5A 4MEZA 3HUMA 5FQQA 4OPRA 4PMAA 4C3QA 5M19A 2J7VA 1E3UA 2WKHA 3NIAA 1ZG4A 3IWOA 3AGDA 1BULA 1K57C 1TDGA 4LCMA 4FH4A 3IHAA 2PU4A 1S0WA 4NETA 2Y2NA 3ZG7B 1MWRA 2I72A 4N1HA 5HW3A 2B5RA 1MKIA 2C6WB 3Q81A 4KENB 5AQBA 4QU3A 1SDNA 1IEMA 3C7UA 4R3JA 5EVIA 3V5MA 4IVKA 1KDSA 4OPZA 4MBHA 4O7DA 5EOEA 3UPPA 1YM1A 1ZC2A 2X02A 3G31A 4XUZA 4X68A 4HBUA 2WADA 5HAQA 5E43A 5FI2A 4KQQA 3ZG8B 5CXWA 4FSFA 3D4FA 4EUZA 5HL1A 2XGNA 3DW0A 5AQ7A 3S22A 1TEMA 4P6BA 5CECA 3WS5A 2ZD8A 1EROA 3GQZA 1BTLA 2WZZA 3N8RA 4E3MA 2XD5A 2HP5A 5EE8A 3HL9A 1MWTA 1PZOA 3HUNA 2OLVA 3GV9A 5CGSA 5AQ9A 4IEDA 5I94A 4R4RA 5EVIB 3ZG9B 4GN2A 3WWXA 5CTMA 3QNBA 1FCNA 5FI6A 3N8LA 2XDMA 3G32A 4OQGA 2WZXA 3M2KA 3JYIA 3IH8A 4Y0TA 2HDQA 4X53A 3MBZA 3MZDA 4JXVA 1FQGA 5KSHA 3Q7VA 2ZM0A 3BLMA 2XEPA 1PIOA 1W7FA 3C4PA 4RYEA 2ZQCA 3GR2A 1JWPA 3BFCA 5FATA 4UA7A 3NDGA 5L2FA 2ZLYA 4MLLA 5A91A 4FCFA 4ZJ1A 2Y2OA 4WELA 4XXRA 1MBLA 5DTKA 1CI9A 3VP2A 2GDNA 1W8YA 4QY5A 4RVAA 4KZ5A 3VP0A 2WYXA 2G2WA 4JLFA 5E2EA 2EXBA 2PU2A 2Y2HA 4GDBA 2H0TA 4QD4A 3PBSA 1NZUA 1KE0A 4LV1A 3IF6A 3ZCZA 5DTSA 2Y2QA 1YLJA 2QMIA 2VGJA 3NCKA 4GDNA 2OSUA 4S2LA 5GLBA 5A90A 3WRTA 3Q7VB 1K57A 4E3OA 2H10A 1DY6A 3GTCA 2V2FF 4ZTKA 5KZHA 1MY8A 1RCJA 3PAGA 5F1GA 3VP3A 3SH8A 1KE3A 4YINA 4R4SA 4Y0OA 1EWZA 4KZBA 3BM6A 2WAEA 4JXGA 1IYQA 2WGVA 3GRJA 3BFGA 2HPBA 5GLAA 5FSRA 4EQIA 5EUAA 5U47A 4ZDXA 1CEFA 3ZDJA 4QJGA 4E6XA 2ZQ9A 3VSLA 1MWUA 1TVFA 2V20A 3N6IA 4GKUA 3A3FA 3MKFA 4P0MA 1IYPA 2ZC3B 3I7JA 4X6TA 4R1GA 5E2HA 5IHVA 5E2FA 4DE1A 1XKZA 2ZM8A 2V1ZA 1K25A 4HBTA 4OP8A 2JE5A 3IHBA 4JBFA 4WZ5C 3UE0A 3WRZA 2G2UA 1BLSA 4UA6A 5GLDA 1MXOA 3RJUA 3A3DA 3IXGA 1Z6FA 1JWZA 1JWVA 1PWCA 2A3UA 3P09A 3QNCA 1IYSA 5FQKA 5FI7A 1FR1A 5JYPA 1K4FA 2XLNA 1PW1A 2DNSA 1GA9A 4BL3A 1KGGA 5EECA 2ZQAA 2ZC4B 2CC1A 4U0TA 5CGXA 3TOIA 5DF9A 2XK1A 2R9XA 4JXWA 5F1FA 3M2JA 2Z2MB 4BL2A 3WS4A 3A3EA 4GNUA 1K38A 5FASA 2Y4AA 5TR7A 4XUXA 1NXYA 1DJAA 4LV3A 1YLYA 2WGIA 5CEDA 2XFSA 5CTNA 3SH9A 1FCMA 2Q9NA 3A3IA 1K54A 4KZ8A 5KSCA 1BZAA 4N1XA 3G34A 4PPRA 5CRFA 5KMWA 3BLSA 3PBTA 3HREA 5CEBA 2WGWB 3BECA 1AXBA 1PWGA 2PBYA 2OV5A 4QB8A 1CI8A 4Q8IA 2X71A 3NBLA 1E25A 1HD8A 4C6YA 3FKWA 3HLGA 3BEBA 3O88A 5FQJA 3VP1A 5CHUA 4BLMA 4KG2A 3IXBA 2XF3A 1PI4A 5CHMA 4CPKA 3HLWA 5HFOA 4EBLA 2RL3A 3S1YA 1K56A 3IF5A 1BSGA 2EFUA 5DVAA 4E3NA 1XX2A 4B4ZA 5EVLA 3Q82A 5GLCA 2WKIA 4L0LA 4EBPA 1RGZA 1ESIA 3MXSA 4DF6A 2JC7A 1M6KA 4DE3A 1IYOA 3QHYA 3UE3A 4P85A 2WUQA 5GHZA 4GB7A 5FAPA 1S6RA 4ID4A 4GD6A 2QZ6A 1GHPA 2UWXA 3OZHA 1K55C 1K54C 4HESA 3ZNTA 4CJNA 1FSYA 3P98A 3C5AA 5E2GA 1JTGA 1L2SA 4DKIA 3N8SA 3UDIA 2ZC5B 1ALQA 1YLTA 4KQRA 1WYCA 3ZNYA 4WZ5A 4D2OA 1VQQA 1LI9A 2EX8A 3GVBA 2X01A 3GMWA 1W79A 1SKFA 3HLEA 1K4EA 4PM6A 1LI0A 1TDLA 2A49A 4YFMA 2EFXA 1E4DA 4JXSA 1CK3A 1BLCA 3CZDA 3ISGA 3OCLA 1MWSA 2Y2KA 2ZM2A 3VFHA 2JBFA 1NZOA 3FV7A 3VP4A 4BQMA 2IWBA 4DE0A 4WMCD 3SOIA 1W8QA 3E2KA 2JCHA 3C7VA 5FQ9A 3RXWA 3HLDA 1W5DA 5CHJA 2WKEA 4K0XA 3TSGA 4EBNA 5M1AA 4S2NA 5TGFA 4OH0A 5FAQA 4BENA 1O7EA 2BG1A 1HVBA 5DTTA 3ZVWA 5FAOA 1IELA 4A5RA 3O86A 3MKEA 3FZCA 4OLDA 3LEZA 1KVLA 1IKIA 2EX2A 1ONHA 3TG9A 3PTEA 2Y2GA 2Y2IA 5CERA 5TFQA 3LY3A 3Q07A 1ZG6A 4FD8A 4OPYA 3UE1A 3Q1FA 4E3IA 4R0QA 5F82A 1YMSA 3V50A 5FQIA 2FFFB 3M6BA 5GHXA 4OQHA 1PYYA 2HDUA 2ZQ8A 3MXRA 4OOMA 1ONGA 2J9PA 3IF6B 4S2IA 2FFYA 4IBRA 4OKPA 4OQ0A 1QMFA 4KZ3A 1G68A 3LY4A 4MBFA 4PM9A 2BLSA 1ERQA 3BRMA 3DTMA 3G30A 5GHYA 3FWLA 3V39A 2ZC7A 4UAAA 2EX6A 4DE2A 1CEGA 1IKGA 1C3BA 4OPQA 4UA9A 3HLFA 5EVID 4OOYA 5A92A 3FKVA 3V3SA 1PI5A 1DJCA 5DF7A 3VOYA 5F83A 3HLBA 1XA7A 1BLPA 3AGFA 1H5XA 5G18A 4MBKA 1GA0A 3NY4A 4KZAA 3ITAA 5HARA 4WM9A 3O3VA 1I5QA 4QY6A 3SS3A 3WS0A 1K6RA 3PBQA 5HAPA 3ZVTA 2DRWA 4S2NC 1EI5A 3M6HA 4R3BA 5D3OA 5J8XA 1K55A 3C4OA 1YMXA 1DJBA 4U3TA 4B88A 3BYDA 1KGFA 1GCEA 1Y54A 2J9OA 1GHIA 2Y2PA 1N4OA 3OPHA 3VMAA 3CJMA 3GSGA 1OMEA 3PBRA 1BUEA 1Q2PA 3W8KA 5HX9A 3CG5A 3PBOA 4S2PA 4E6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAF A;  2Y91 A;  4P87 A;  4E3J A;  3OPR A;  4KQO A;  2OLU A;  4S2K A;  4PM5 A;  4OLG A;  1MPL A;  1H8Z A;  5A93 A;  1N9B A;  3IQA A;  4X56 A;  1O07 A;  1FOF A;  3FYZ A;  1KDW A;  3CMZ A;  3G35 A;  1Q2Q A;  4M3K A;  4OOL A;  4X55 A;  2HP6 A;  3BFF A;  3HVF A;  2J8Y A;  3NI9 A;  1FR6 A;  4KZ9 A;  1YQS A;  4NK3 A;  1G6A A;  2H0Y A;  3MFD A;  1NJ4 A;  4LEN A;  4WBG A;  1XGI A;  4Y7P A;  5EPH A;  4S2M A;  5HAI A;  4S2J A;  5FA7 A;  4ZJ3 A;  3IWQ A;  1NY0 A;  1ZKJ A;  2R9W A;  2XQZ A;  3W4O A;  4IVI A;  2XFT A;  3OPP A;  4PM8 A;  5FDH A;  2XR0 A;  4ZBE A;  4IBX A;  5CGW A;  1U60 A;  4KZ7 A;  4KZ4 A;  4U0X A;  3N7W A;  2QPN A;  4KG5 A;  4N9L A;  1BLH A;  3RXX A;  4EWF A;  1ESU A;  5AQA A;  1YLW A;  4WEK A;  3OCN A;  5GL9 A;  2Y2M A;  1WE4 A;  1L0F A;  2ZQ7 A;  3W4Q A;  2Z2L B;  4C75 A;  1RP5 A;  2EXA A;  2XH9 A;  4OVD A;  1I2S A;  3WS1 A;  4DDY A;  1VM1 A;  3ZGA B;  1SDE A;  2ZQD A;  3UO9 A;  2DCF A;  3W4P A;  4K0W A;  1KVM A;  1NYY A;  3UPN A;  4EV4 A;  3BFD A;  4JF5 A;  4JPM A;  4LV0 A;  1KE4 A;  2ZJ9 A;  4FH2 A;  4BD0 A;  4E3K A;  2Y2J A;  5DF8 A;  3IWI A;  1ES4 A;  3ZG0 A;  1FSW A;  1XA1 A;  4F94 A;  4LV2 A;  1ES2 A;  1LHY A;  1SHV A;  1SCW A;  1LL9 A;  2IWD A;  3WS2 A;  1YLP A;  3UY6 A;  1HTZ A;  2RCX A;  4QHC A;  4X69 A;  3NDE A;  2HDS A;  1YLZ A;  4OON A;  1ES3 A;  2ZC6 B;  1XPB A;  5M18 A;  3DWZ A;  4OQI A;  5EVI C;  3IH9 A;  1LL5 A;  4RX2 A;  4B4X A;  1PZP A;  1BT5 A;  2XD1 A;  4WEJ A;  3NC8 A;  4Y0U A;  4DXB A;  2ZMA A;  3EQU A;  3UN7 A;  3G4P A;  3G2Z A;  3MZE A;  1PW8 A;  3B3X A;  4OP5 A;  4N92 A;  4LCL A;  4DXC A;  3SS5 A;  1QME A;  1XGJ A;  3SH7 A;  1NRF A;  1GHM A;  2C5W B;  2P9V A;  2WK0 A;  4WYY A;  4Z9Q A;  3VSK A;  3PAE A;  3E2L A;  1YT4 A;  3A3J A;  4WZ4 A;  3HUO A;  1XP4 A;  3ZHH A;  4PM7 A;  3HLC A;  1I2W A;  1L0D A;  2P74 A;  2Y2L A;  4DDS A;  1H8Y A;  2Q9M A;  1E3U D;  4KZ6 A;  4HEF A;  2HDR A;  4BD1 A;  4RA7 A;  4S2O A;  3BFE A;  3UPO A;  1K6S A;  4RX3 A;  5JYO A;  1J9M A;  2IWC A;  1M40 A;  3ZFZ A;  5BOH A;  3UNW A;  1HZO A;  3EQV A;  2H5S A;  5EOO A;  4JKT A;  4R23 A;  3IT9 A;  2Y55 A;  4UHU A;  1PWD A;  3N4I A;  4GZB A;  4WMC A;  3ITB A;  4N9K A;  4MNR A;  4E3L A;  4JF6 A;  1JVJ A;  3OPL A;  2Y59 A;  4KG6 A;  3VFF A;  1NYM A;  4K91 A;  3UDF A;  1ERM A;  5FQM A;  2P9V B;  1FCO A;  3DWK A;  2VGK A;  3AGE A;  2WGW A;  2HP9 A;  1L0G A;  3S4X A;  3G2Y A;  3SS4 A;  2E8I A;  4ZAM A;  3HBR A;  3LO7 A;  1JTD A;  3PBN A;  4GOG A;  1KGE A;  4BJP A;  3MZF A;  1WYB A;  4DRT A;  2EX9 A;  3UDX A;  3O87 A;  3Q7Z A;  1L0E A;  1LLB A;  4GD8 A;  1K56 D;  4JF4 A;  3IXH A;  1XXM A;  3OC2 A;  3VOZ A;  3LCE A;  3IXD A;  4ZJ2 A;  3IF6 C;  4H8R A;  1RGY A;  3V3R A;  3ZG5 A;  1ES5 A;  4MEZ A;  3HUM A;  5FQQ A;  4OPR A;  4PMA A;  4C3Q A;  5M19 A;  2J7V A;  1E3U A;  2WKH A;  3NIA A;  1ZG4 A;  3IWO A;  3AGD A;  1BUL A;  1K57 C;  1TDG A;  4LCM A;  4FH4 A;  3IHA A;  2PU4 A;  1S0W A;  4NET A;  2Y2N A;  3ZG7 B;  1MWR A;  2I72 A;  4N1H A;  5HW3 A;  2B5R A;  1MKI A;  2C6W B;  3Q81 A;  4KEN B;  5AQB A;  4QU3 A;  1SDN A;  1IEM A;  3C7U A;  4R3J A;  5EVI A;  3V5M A;  4IVK A;  1KDS A;  4OPZ A;  4MBH A;  4O7D A;  5EOE A;  3UPP A;  1YM1 A;  1ZC2 A;  2X02 A;  3G31 A;  4XUZ A;  4X68 A;  4HBU A;  2WAD A;  5HAQ A;  5E43 A;  5FI2 A;  4KQQ A;  3ZG8 B;  5CXW A;  4FSF A;  3D4F A;  4EUZ A;  5HL1 A;  2XGN A;  3DW0 A;  5AQ7 A;  3S22 A;  1TEM A;  4P6B A;  5CEC A;  3WS5 A;  2ZD8 A;  1ERO A;  3GQZ A;  1BTL A;  2WZZ A;  3N8R A;  4E3M A;  2XD5 A;  2HP5 A;  5EE8 A;  3HL9 A;  1MWT A;  1PZO A;  3HUN A;  2OLV A;  3GV9 A;  5CGS A;  5AQ9 A;  4IED A;  5I94 A;  4R4R A;  5EVI B;  3ZG9 B;  4GN2 A;  3WWX A;  5CTM A;  3QNB A;  1FCN A;  5FI6 A;  3N8L A;  2XDM A;  3G32 A;  4OQG A;  2WZX A;  3M2K A;  3JYI A;  3IH8 A;  4Y0T A;  2HDQ A;  4X53 A;  3MBZ A;  3MZD A;  4JXV A;  1FQG A;  5KSH A;  3Q7V A;  2ZM0 A;  3BLM A;  2XEP A;  1PIO A;  1W7F A;  3C4P A;  4RYE A;  2ZQC A;  3GR2 A;  1JWP A;  3BFC A;  5FAT A;  4UA7 A;  3NDG A;  5L2F A;  2ZLY A;  4MLL A;  5A91 A;  4FCF A;  4ZJ1 A;  2Y2O A;  4WEL A;  4XXR A;  1MBL A;  5DTK A;  1CI9 A;  3VP2 A;  2GDN A;  1W8Y A;  4QY5 A;  4RVA A;  4KZ5 A;  3VP0 A;  2WYX A;  2G2W A;  4JLF A;  5E2E A;  2EXB A;  2PU2 A;  2Y2H A;  4GDB A;  2H0T A;  4QD4 A;  3PBS A;  1NZU A;  1KE0 A;  4LV1 A;  3IF6 A;  3ZCZ A;  5DTS A;  2Y2Q A;  1YLJ A;  2QMI A;  2VGJ A;  3NCK A;  4GDN A;  2OSU A;  4S2L A;  5GLB A;  5A90 A;  3WRT A;  3Q7V B;  1K57 A;  4E3O A;  2H10 A;  1DY6 A;  3GTC A;  2V2F F;  4ZTK A;  5KZH A;  1MY8 A;  1RCJ A;  3PAG A;  5F1G A;  3VP3 A;  3SH8 A;  1KE3 A;  4YIN A;  4R4S A;  4Y0O A;  1EWZ A;  4KZB A;  3BM6 A;  2WAE A;  4JXG A;  1IYQ A;  2WGV A;  3GRJ A;  3BFG A;  2HPB A;  5GLA A;  5FSR A;  4EQI A;  5EUA A;  5U47 A;  4ZDX A;  1CEF A;  3ZDJ A;  4QJG A;  4E6X A;  2ZQ9 A;  3VSL A;  1MWU A;  1TVF A;  2V20 A;  3N6I A;  4GKU A;  3A3F A;  3MKF A;  4P0M A;  1IYP A;  2ZC3 B;  3I7J A;  4X6T A;  4R1G A;  5E2H A;  5IHV A;  5E2F A;  4DE1 A;  1XKZ A;  2ZM8 A;  2V1Z A;  1K25 A;  4HBT A;  4OP8 A;  2JE5 A;  3IHB A;  4JBF A;  4WZ5 C;  3UE0 A;  3WRZ A;  2G2U A;  1BLS A;  4UA6 A;  5GLD A;  1MXO A;  3RJU A;  3A3D A;  3IXG A;  1Z6F A;  1JWZ A;  1JWV A;  1PWC A;  2A3U A;  3P09 A;  3QNC A;  1IYS A;  5FQK A;  5FI7 A;  1FR1 A;  5JYP A;  1K4F A;  2XLN A;  1PW1 A;  2DNS A;  1GA9 A;  4BL3 A;  1KGG A;  5EEC A;  2ZQA A;  2ZC4 B;  2CC1 A;  4U0T A;  5CGX A;  3TOI A;  5DF9 A;  2XK1 A;  2R9X A;  4JXW A;  5F1F A;  3M2J A;  2Z2M B;  4BL2 A;  3WS4 A;  3A3E A;  4GNU A;  1K38 A;  5FAS A;  2Y4A A;  5TR7 A;  4XUX A;  1NXY A;  1DJA A;  4LV3 A;  1YLY A;  2WGI A;  5CED A;  2XFS A;  5CTN A;  3SH9 A;  1FCM A;  2Q9N A;  3A3I A;  1K54 A;  4KZ8 A;  5KSC A;  1BZA A;  4N1X A;  3G34 A;  4PPR A;  5CRF A;  5KMW A;  3BLS A;  3PBT A;  3HRE A;  5CEB A;  2WGW B;  3BEC A;  1AXB A;  1PWG A;  2PBY A;  2OV5 A;  4QB8 A;  1CI8 A;  4Q8I A;  2X71 A;  3NBL A;  1E25 A;  1HD8 A;  4C6Y A;  3FKW A;  3HLG A;  3BEB A;  3O88 A;  5FQJ A;  3VP1 A;  5CHU A;  4BLM A;  4KG2 A;  3IXB A;  2XF3 A;  1PI4 A;  5CHM A;  4CPK A;  3HLW A;  5HFO A;  4EBL A;  2RL3 A;  3S1Y A;  1K56 A;  3IF5 A;  1BSG A;  2EFU A;  5DVA A;  4E3N A;  1XX2 A;  4B4Z A;  5EVL A;  3Q82 A;  5GLC A;  2WKI A;  4L0L A;  4EBP A;  1RGZ A;  1ESI A;  3MXS A;  4DF6 A;  2JC7 A;  1M6K A;  4DE3 A;  1IYO A;  3QHY A;  3UE3 A;  4P85 A;  2WUQ A;  5GHZ A;  4GB7 A;  5FAP A;  1S6R A;  4ID4 A;  4GD6 A;  2QZ6 A;  1GHP A;  2UWX A;  3OZH A;  1K55 C;  1K54 C;  4HES A;  3ZNT A;  4CJN A;  1FSY A;  3P98 A;  3C5A A;  5E2G A;  1JTG A;  1L2S A;  4DKI A;  3N8S A;  3UDI A;  2ZC5 B;  1ALQ A;  1YLT A;  4KQR A;  1WYC A;  3ZNY A;  4WZ5 A;  4D2O A;  1VQQ A;  1LI9 A;  2EX8 A;  3GVB A;  2X01 A;  3GMW A;  1W79 A;  1SKF A;  3HLE A;  1K4E A;  4PM6 A;  1LI0 A;  1TDL A;  2A49 A;  4YFM A;  2EFX A;  1E4D A;  4JXS A;  1CK3 A;  1BLC A;  3CZD A;  3ISG A;  3OCL A;  1MWS A;  2Y2K A;  2ZM2 A;  3VFH A;  2JBF A;  1NZO A;  3FV7 A;  3VP4 A;  4BQM A;  2IWB A;  4DE0 A;  4WMC D;  3SOI A;  1W8Q A;  3E2K A;  2JCH A;  3C7V A;  5FQ9 A;  3RXW A;  3HLD A;  1W5D A;  5CHJ A;  2WKE A;  4K0X A;  3TSG A;  4EBN A;  5M1A A;  4S2N A;  5TGF A;  4OH0 A;  5FAQ A;  4BEN A;  1O7E A;  2BG1 A;  1HVB A;  5DTT A;  3ZVW A;  5FAO A;  1IEL A;  4A5R A;  3O86 A;  3MKE A;  3FZC A;  4OLD A;  3LEZ A;  1KVL A;  1IKI A;  2EX2 A;  1ONH A;  3TG9 A;  3PTE A;  2Y2G A;  2Y2I A;  5CER A;  5TFQ A;  3LY3 A;  3Q07 A;  1ZG6 A;  4FD8 A;  4OPY A;  3UE1 A;  3Q1F A;  4E3I A;  4R0Q A;  5F82 A;  1YMS A;  3V50 A;  5FQI A;  2FFF B;  3M6B A;  5GHX A;  4OQH A;  1PYY A;  2HDU A;  2ZQ8 A;  3MXR A;  4OOM A;  1ONG A;  2J9P A;  3IF6 B;  4S2I A;  2FFY A;  4IBR A;  4OKP A;  4OQ0 A;  1QMF A;  4KZ3 A;  1G68 A;  3LY4 A;  4MBF A;  4PM9 A;  2BLS A;  1ERQ A;  3BRM A;  3DTM A;  3G30 A;  5GHY A;  3FWL A;  3V39 A;  2ZC7 A;  4UAA A;  2EX6 A;  4DE2 A;  1CEG A;  1IKG A;  1C3B A;  4OPQ A;  4UA9 A;  3HLF A;  5EVI D;  4OOY A;  5A92 A;  3FKV A;  3V3S A;  1PI5 A;  1DJC A;  5DF7 A;  3VOY A;  5F83 A;  3HLB A;  1XA7 A;  1BLP A;  3AGF A;  1H5X A;  5G18 A;  4MBK A;  1GA0 A;  3NY4 A;  4KZA A;  3ITA A;  5HAR A;  4WM9 A;  3O3V A;  1I5Q A;  4QY6 A;  3SS3 A;  3WS0 A;  1K6R A;  3PBQ A;  5HAP A;  3ZVT A;  2DRW A;  4S2N C;  1EI5 A;  3M6H A;  4R3B A;  5D3O A;  5J8X A;  1K55 A;  3C4O A;  1YMX A;  1DJB A;  4U3T A;  4B88 A;  3BYD A;  1KGF A;  1GCE A;  1Y54 A;  2J9O A;  1GHI A;  2Y2P A;  1N4O A;  3OPH A;  3VMA A;  3CJM A;  3GSG A;  1OME A;  3PBR A;  1BUE A;  1Q2P A;  3W8K A;  5HX9 A;  3CG5 A;  3PBO A;  4S2P A;  4E6W A; 
#chains in the Genus database with same CATH topology
 5F6A A;  2P7J A;  4KQO A;  1MPL A;  5A93 A;  1N9B A;  1T19 A;  3IQA A;  4HJ6 A;  1FOF A;  3G35 A;  5FDS A;  2HP6 A;  1FR6 A;  4LEN A;  5DFX A;  3SW1 A;  4S2M A;  3NOT C;  3NUL A;  2YKF A;  3W4O A;  3P01 A;  4KG5 A;  2O9B A;  4N9L A;  3KSF A;  1TS6 A;  3T4J A;  5HZH A;  4C75 A;  1RP5 A;  4DDY A;  4NEE D;  2O9C A;  4E3K A;  1XFN A;  4KUO A;  2Y2J A;  3T50 A;  5DF8 A;  4O01 A;  1ES4 A;  5J7E A;  1XA1 A;  1SHV A;  1LL9 A;  2L1M A;  1HTZ A;  2RCX A;  4NXG A;  2E8J A;  4B4X A;  4Q0H A;  2V9A A;  1CQA A;  3HJK A;  4HP4 A;  5AVF A;  1PZP A;  4WEJ A;  4X1M A;  2JKT I;  2ZMA A;  5HPF A;  4EQ1 A;  4OP5 A;  4N92 A;  4DXC A;  2K2N A;  3LR4 A;  3SH7 A;  2WK0 A;  3VSK A;  4Z9Q A;  3A3J A;  3HUO A;  2Z6C A;  3HLC A;  3KSG A;  1H8Y A;  4G3K A;  4KZ6 A;  4HEF A;  2HDR A;  3OBF A;  4S2O A;  2PYP A;  2LB5 A;  5MC7 A;  2H5S A;  4UHU A;  4GZB A;  4E3L A;  4KG6 A;  1NYM A;  5FQM A;  2WGW A;  3S4X A;  3UMD A;  2ZOH A;  3PBN A;  1JTD A;  1KGE A;  4LPZ A;  2JKT M;  3OC2 A;  3IXD A;  4XT2 A;  3IF6 C;  1ZHH B;  4H8R A;  3V3R A;  4OPR A;  4PMA A;  4C3Q A;  1L3L A;  3T4O A;  2QJ7 A;  1E3U A;  1ZG4 A;  1F98 A;  1BUL A;  3AGD A;  3DTI A;  3MF0 A;  4JGO A;  2PU4 A;  5DKL A;  1MWR A;  4KEN B;  4FUW A;  1J3W A;  1SDN A;  3C7U A;  2QWS A;  4OPZ A;  2P04 A;  2OWH A;  3TJZ C;  1ZC2 A;  4XUZ A;  5EM1 A;  4LRZ E;  2J3W A;  5HAQ A;  5G4Z A;  1SZV A;  4EUZ A;  4PAU A;  1TEM A;  4P6B A;  2ZD8 A;  4EEU A;  2XD5 A;  2EWW A;  1GSW A;  5CGS A;  4IED A;  4GN2 A;  3NHQ A;  1FCN A;  5FI6 A;  3IH8 A;  3MBZ A;  4JXV A;  5KSH A;  3Q7V A;  4RYE A;  3GR2 A;  1JWP A;  4WN5 A;  3PR6 A;  5DJT A;  3NDG A;  3LUQ A;  1T18 A;  5A91 A;  4XXR A;  1W63 M;  4RVA A;  4QY5 A;  4KZ5 A;  1YSP A;  3KYZ A;  4GDB A;  2H0T A;  3MQO A;  3PBS A;  1UWP X;  1KE0 A;  3IF6 A;  5DTS A;  3GDI A;  3NCK A;  4S2L A;  5GLB A;  5A90 A;  2B95 A;  3EOI A;  1MY8 A;  1RCJ A;  3PAG A;  3VP3 A;  2WKR A;  4EES A;  2OAQ 1;  3NEC A;  4EQI A;  5EUA A;  1CEF A;  1TVF A;  4GKU A;  3MKF A;  4P0M A;  3I7J A;  1TD5 A;  5E2H A;  4CLC E;  2V1Z A;  3UE0 A;  3WRZ A;  1FIK A;  5GLD A;  3FG8 A;  1MXO A;  5TBM A;  3IXG A;  2A3U A;  5FQK A;  5FI7 A;  1N9O A;  2XLN A;  4E04 A;  3K2N A;  2GJ3 A;  3JVV A;  3IX4 A;  4UQI S;  4BL2 A;  3WS4 A;  4GNU A;  2Y4A A;  1DJA A;  2WGI A;  1FCM A;  3A3I A;  1K54 A;  2J3T D;  2WGW B;  1PWG A;  2PBY A;  4QB8 A;  1CI8 A;  2PAV P;  4C6Y A;  3FKW A;  3O88 A;  3VP1 A;  5DKK A;  3ZYT A;  2VLG A;  3R4K A;  1PI4 A;  4CPK A;  4EBL A;  2B02 A;  1T1C A;  4B4Z A;  3Q82 A;  1P9W A;  4L0L A;  4RQ9 A;  5GLC A;  1RGZ A;  1ESI A;  4DF6 A;  5HDC A;  3LR3 A;  3UE3 A;  4P85 A;  4GB7 A;  4WLA A;  1OTD A;  2QZ6 A;  1GHP A;  2UWX A;  1FSY A;  3UDI A;  2W1T A;  4KQR A;  1Y28 A;  1WYC A;  1LI9 A;  3EGX C;  1P0Z A;  3BQ8 A;  3KSI A;  4MCW A;  3TRC A;  4YFM A;  3CZD A;  4YWZ A;  4WMC D;  2Z6D A;  4D60 A;  2JCH A;  5FQ9 A;  3TE8 A;  4K0X A;  4EBN A;  1LSV A;  4HH2 A;  4DJ2 A;  1IOU A;  5DTT A;  3QP1 A;  5HWW A;  4R70 A;  3O86 A;  4O0P A;  1KVL A;  2KOI A;  3D3O A;  2J3T C;  2R78 A;  2PHY A;  3Q07 A;  3CUE C;  4FD8 A;  4E3I A;  3W2Z A;  1YMS A;  4OOM A;  4PM5 A;  3MXR A;  1ONG A;  3IF6 B;  4S2I A;  2ZL1 B;  3DTM A;  3FWL A;  1OPX A;  5HDS A;  4UA9 A;  3QP2 A;  1LSX A;  1PI5 A;  2BTF P;  5F83 A;  3L7H A;  1XA7 A;  1BLP A;  3AGF A;  2JKG A;  4ZRR A;  3NY4 A;  5HAR A;  1DRM A;  2VJW A;  1K6R A;  3WS0 A;  1BYW A;  1EI5 A;  2M7V A;  1YMX A;  1DJB A;  4F3L A;  1GHI A;  3VMA A;  3KX0 X;  1Q2P A;  5HX9 A;  5TBM B;  4R3A A;  2WAF A;  4P87 A;  3OPR A;  4OLG A;  4X56 A;  3FYZ A;  4M3K A;  3CMZ A;  4OOL A;  3HVF A;  2J8Y A;  2H28 A;  3NI9 A;  4KZ9 A;  1YQS A;  4CQH A;  1G6A A;  2H0Y A;  3MFD A;  1XGI A;  5FA7 A;  4ZJ3 A;  1NY0 A;  4DJ3 A;  2XA7 S;  2VV6 A;  4Y2F A;  4KZ7 A;  4U0X A;  1PRQ A;  2AVX A;  1ESU A;  1YLW A;  3CUE A;  2XRN A;  2XH9 A;  1VM1 A;  2ZBB A;  2DCF A;  1NYY A;  3V67 A;  5L09 A;  3EGD C;  4KUK A;  4EV4 A;  3BFD A;  4JPM A;  1YKD A;  1KE4 A;  2ZJ9 A;  4FH2 A;  2PDR A;  2ACG A;  3RH8 B;  4LRX C;  2VV7 A;  4F94 A;  4LV2 A;  1ES2 A;  2W3F A;  5HDD A;  3WS2 A;  1YLP A;  2M1C A;  4OON A;  1ES3 A;  4ETX A;  3ZQ5 A;  2A24 A;  2FH5 A;  1OTI A;  3G4P A;  3G2Z A;  3MZE A;  4LCL A;  1XGJ A;  4YOF A;  2C5W B;  2I9V A;  4UEY A;  3PAE A;  3E2L A;  1YT4 A;  1XP4 A;  3ZHH A;  5DFY A;  1I2W A;  5CX7 A;  2QKP A;  2BAS A;  3LID A;  2Q9M A;  1E3U D;  2UV0 E;  2O9A A;  1N9N A;  3UPO A;  5JYO A;  1J9M A;  1LSW A;  5BOH A;  1HZO A;  1LT0 A;  3BW6 A;  4WL9 A;  1F9I A;  4R23 A;  1PWD A;  4WMC A;  2J80 A;  4MNR A;  4N9K A;  3OPL A;  2Y59 A;  4K91 A;  3NOU C;  1GSX A;  3UDF A;  2P9V B;  2D02 A;  3SS4 A;  2E8I A;  2VEA A;  4GOG A;  3LR5 A;  1WYB A;  2HGV A;  4DRT A;  2EX9 A;  3UDX A;  3E4Q A;  1L0E A;  1LLB A;  3MQQ A;  4QPR A;  4GD8 A;  4JF4 A;  3UB6 A;  4ZJ2 A;  3ZG5 A;  4MEZ A;  5M19 A;  4IJG A;  2A2L A;  3IWO A;  4LCM A;  4Z1W A;  4EU0 A;  2VV8 A;  4Y15 A;  3IHA A;  2HF6 A;  3LIB A;  3E4O A;  4NET A;  3ZG7 B;  1V9Y A;  2EA9 A;  5HW3 A;  5AQB A;  2W27 A;  3K3D A;  4PKY G;  4QU3 A;  4IVK A;  2V1A A;  3LIC A;  4O7D A;  5L10 A;  2PD8 A;  3S7Q A;  4F3L B;  5KIZ A;  4X68 A;  4HBU A;  5FI2 A;  3S7N A;  3ZG8 B;  5CXW A;  3UE6 A;  5HL1 A;  2XGN A;  3DW0 A;  2K31 A;  5K5B A;  2KDK A;  3D9Y A;  3OLO A;  2KLI A;  2WZZ A;  3HL9 A;  3HUN A;  1PZO A;  2OLV A;  3GV9 A;  3C8C A;  4HI4 A;  3ZG9 B;  3WWX A;  5CTM A;  3QNB A;  1OT6 A;  2FZ0 A;  3JYI A;  5IS1 A;  2HDQ A;  3MSH A;  2ZM0 A;  4MDZ A;  2XEP A;  5L8M A;  2HJ9 C;  3C4P A;  5HSQ A;  3T4K A;  5I5L A;  3BFC A;  4I39 A;  4UA7 A;  5FAT A;  4BMW A;  5L2F A;  3VE4 A;  2ZLY A;  1OTE A;  4WEL A;  2XRO A;  5DTK A;  3VP2 A;  2GDN A;  1W8Y A;  3VP0 A;  2G2W A;  4QD4 A;  4L9G A;  4ESP A;  2CMN A;  3LI9 A;  1D7E A;  4I5S A;  4PKY A;  3GTC A;  5TJJ A;  1KE3 A;  4NKP A;  1EWZ A;  2A24 B;  4KZB A;  1IYQ A;  2WGV A;  2HPB A;  1FIL A;  4ZDX A;  3T1R A;  2L4R A;  2YKH A;  2WKQ A;  3N6I A;  2JKR M;  2ZC3 B;  3BY9 A;  1JNU A;  3KYE A;  2VZW A;  4R1G A;  5C5K A;  2ZM8 A;  3QP8 A;  4WZ5 C;  4JBF A;  2QHK A;  3LGO A;  2JHE A;  2V1B A;  3P09 A;  1FR1 A;  1Z09 A;  1S66 L;  1PW1 A;  1GA9 A;  4CLC B;  1KGG A;  2ZQA A;  4LRY C;  5CGX A;  3TOI A;  2XK1 A;  2R9X A;  3L9K A;  2Z2M B;  5TR7 A;  1NXY A;  2VA0 A;  3EWK A;  5CED A;  4ARZ B;  3SH9 A;  1BZA A;  4PPR A;  3A0V A;  3PBT A;  5CEB A;  1AXB A;  2OV5 A;  4Q8I A;  3R7W B;  1E25 A;  5A8B A;  3BEB A;  1H0M A;  3LIA A;  3E0Y A;  2V8F A;  4KG2 A;  3O5Y A;  3IXB A;  4GJ4 A;  3HLW A;  2IA2 A;  1BSG A;  1CJF A;  2EFU A;  1YSQ A;  4JGR A;  2JC7 A;  3F1P A;  2VGL S;  2EWV A;  5GHZ A;  3FPW A;  4ID4 A;  1XJ2 A;  1K55 C;  1K54 C;  4CJN A;  3ZNT A;  3P98 A;  3C5A A;  5E2G A;  1L2S A;  4DKI A;  2W0N A;  4R38 A;  4WZ5 A;  3H7W A;  3GMW A;  1OJG A;  1P97 A;  3T4T A;  3HLE A;  4PM6 A;  2DMW A;  3RTY A;  4EW7 A;  3CHW P;  1E4D A;  4JXS A;  3T4S A;  1BLC A;  3VFH A;  3NJA A;  4BQM A;  2IWB A;  2ZL1 A;  3SOI A;  1W8Q A;  3E2K A;  3C7V A;  3RXW A;  3E4P A;  1PNE A;  2WKE A;  4EER A;  4GHI A;  4S2N A;  4BEN A;  5FAQ A;  1O7E A;  2BG1 A;  1IEL A;  4A5R A;  2MJ6 A;  3MJQ A;  2VKS A;  1V9Z A;  2EX2 A;  3TG9 A;  3PTE A;  5TFQ A;  3LY3 A;  3ICY A;  5L07 A;  4HH3 A;  4OQH A;  1PYY A;  4G3V A;  4L9F A;  2V0U A;  4KZ3 A;  5GHY A;  2ZC7 A;  4MN7 A;  4OPQ A;  1UGU A;  1DJC A;  5F69 A;  1GA0 A;  4KZA A;  3O3V A;  4QY6 A;  5HAP A;  2DRW A;  5HPI A;  1K55 A;  3C4O A;  4U3T A;  1EW0 A;  4DMZ A;  1Y54 A;  2J9O A;  1D1J A;  3CJM A;  3GSG A;  3PBR A;  4GS9 A;  3W8K A;  2Y91 A;  4NXF A;  1HLU P;  2OLU A;  4HHD A;  3V39 A;  1KDW A;  1Q2Q A;  3BFF A;  4WBG A;  4Y7P A;  1NJ4 A;  1OT9 A;  5HAI A;  5AJG A;  4S2J A;  3CIT A;  3IWQ A;  1ZKJ A;  2R9W A;  4I3J A;  3OPP A;  4IVI A;  2XR0 A;  4ZBE A;  4GLQ A;  4IBX A;  5CGW A;  1TS7 A;  2QPN A;  3RXX A;  4BBV A;  4I3I A;  3OCN A;  1WE4 A;  1L0F A;  2ZQ7 A;  3W4Q A;  2Z2L B;  4Q0J A;  3T1X A;  4OVD A;  3WS1 A;  3MXQ A;  1SDE A;  2Y79 A;  3UO9 A;  2PR6 A;  4K0W A;  1KVM A;  3UPN A;  3OOV A;  4LV0 A;  4H6J A;  5FEF A;  2GX5 A;  1LHY A;  4O8G A;  4CLC D;  1SCW A;  2GNX A;  3UY6 A;  3T1S A;  3F1P B;  2HDS A;  1YLZ A;  2ZC6 B;  4OQI A;  3IH9 A;  1T1B A;  4RX2 A;  4NXB A;  1NLZ A;  2HZ5 A;  1BT5 A;  1VHM A;  1K0K A;  4Y0U A;  4DXB A;  2OWJ A;  4I38 A;  3B3X A;  3H7W B;  2P9V A;  4WYY A;  4WZ4 A;  1TF1 A;  4GW9 A;  3F1N A;  2P74 A;  3UB5 P;  4BD1 A;  3BFE A;  3B42 A;  2IWC A;  3UNW A;  2D01 A;  3EQV A;  4GHI B;  5EOO A;  2HJE A;  2Y55 A;  3N4I A;  2PYR A;  3ITB A;  3A0S A;  4JF6 A;  1VEU B;  3VFF A;  3LFV A;  1ERM A;  3DWK A;  3AGE A;  4QWO A;  1L0G A;  3MQ0 A;  4ZAM A;  3LO7 A;  3MZF A;  3O87 A;  3CWF A;  4Y3I A;  3IXH A;  1XXM A;  3VOZ A;  5HD5 A;  5LBR A;  1RGY A;  3KYQ A;  1F2K A;  2Q0O A;  2WKH A;  3NIA A;  1TDG A;  4FH4 A;  1S0W A;  4CLC C;  2I72 A;  4N1H A;  2B5R A;  3V5M A;  4HOI A;  3G31 A;  2WAD A;  5E43 A;  4GS9 B;  4FSF A;  3KO6 A;  4MN5 A;  5AQ7 A;  2NUT C;  3WS5 A;  1ERO A;  3N8R A;  4BBU A;  2HP5 A;  5EE8 A;  5EVE A;  3ULF A;  3HCY A;  4R4R A;  5EVI B;  4OQG A;  3G32 A;  1XFQ A;  4X53 A;  3PHY A;  1FQG A;  1PIO A;  5G4Y A;  2ZQC A;  2Y2O A;  1MBL A;  4BBT A;  5E2E A;  2EXB A;  2PU2 A;  1NZU A;  4LV1 A;  3IBR A;  4H6J B;  4IUH A;  2Y2Q A;  4M4X A;  3WRT A;  4E3O A;  2V2F F;  4ZTK A;  5KZH A;  5F1G A;  5F68 A;  3SH8 A;  4YIN A;  1XJ6 A;  4EET B;  4CLC A;  3BM6 A;  4JXG A;  1DP9 A;  3GRJ A;  5GLA A;  5U47 A;  2VK3 A;  1MZU A;  4MMN A;  1MWU A;  1A0K A;  4ARZ A;  4X6T A;  3LIF A;  1XKZ A;  2W3D A;  4HBT A;  5HWT A;  3R7W A;  1BLS A;  4UA6 A;  3F1N B;  4DE1 A;  3A3D A;  2W3E A;  1Z6F A;  1JWZ A;  1PWC A;  1IYS A;  1GSV A;  1K4F A;  4BL3 A;  5EEC A;  1S4S A;  2ZC4 B;  3H82 B;  4U0T A;  5DF9 A;  5F1F A;  5EFW A;  3S7O A;  4WF0 A;  4LV3 A;  1YLY A;  4X1L A;  3CAX A;  2XFS A;  5CTN A;  5KSC A;  4KZ8 A;  3LEQ A;  4N1X A;  2G7U A;  1D06 A;  2X71 A;  3HLG A;  5FQJ A;  1S4R A;  2HV1 A;  1S1Z A;  3DTE A;  1SKO A;  3MR0 A;  5HFO A;  1YAX A;  5F5Y A;  2RL3 A;  5DVA A;  1LL8 A;  4E3N A;  1XX2 A;  1M6K A;  4DE3 A;  3QHY A;  1UWN X;  2PT7 A;  1S6R A;  2JKR I;  4GD6 A;  1X0O A;  3IX3 A;  2PBD P;  1G5U A;  3E98 A;  3N8S A;  3UME A;  4YNR A;  1YLT A;  2ZMV A;  3BY8 A;  4R6L A;  2EX8 A;  1F5M A;  3MFX A;  1SKF A;  3MMH A;  2ZOI A;  2EFX A;  1CK3 A;  2NUP C;  3OCL A;  3ISG A;  5IT5 A;  3K3C A;  2Y2K A;  2L0W A;  2JBF A;  1NZO A;  1DP6 A;  3FV7 A;  3QP4 A;  2K7S A;  4JGQ A;  3MS6 A;  3HLD A;  3EEA A;  3A0R A;  5M1A A;  4OH0 A;  5HD3 A;  3ZVW A;  3HJI A;  2B18 A;  3MKE A;  4OLD A;  3LEZ A;  4UQI M;  4II7 A;  5CER A;  1ZG6 A;  4OPY A;  3UE1 A;  3Q1F A;  4HQA A;  5F82 A;  1WA9 A;  5FQI A;  2LB9 A;  3M6B A;  2HDU A;  2J9P A;  2FFY A;  5J4E A;  4IBR A;  1QMF A;  1G68 A;  4MBF A;  2BLS A;  1ERQ A;  2XSS A;  3G30 A;  4GCZ A;  2EX6 A;  4DE2 A;  1CEG A;  5EVI D;  1OJ5 A;  3H9W A;  4OOY A;  5A92 A;  4I3A A;  3V3S A;  5DF7 A;  3VOY A;  2W1R A;  3HLB A;  2GZA A;  3IX8 A;  4LLO B;  1H5X A;  5G18 A;  3ITA A;  1I5Q A;  3DTK A;  3G6O A;  3T1Q B;  4DN0 A;  3ZVT A;  4S2N C;  3B33 A;  4R3B A;  5D3O A;  1MC0 A;  5J8X A;  4B88 A;  3BYD A;  3EEH A;  3OPH A;  2Y2P A;  1N4O A;  1P9R A;  1OME A;  1BUE A;  1VB6 A;  3JVU A;  4E3J A;  4S2K A;  5EM0 A;  1H8Z A;  1O07 A;  4X55 A;  3JPU A;  4NK3 A;  1OTB A;  4HP9 A;  5EPH A;  5EV0 A;  3UB9 A;  3T12 B;  2XQZ A;  2XFT A;  4PM8 A;  4B9O A;  5FDH A;  4MN6 A;  1U60 A;  4KZ4 A;  3N7W A;  1BLH A;  4EWF A;  3U4L P;  5AQA A;  4FTX A;  4WEK A;  5GL9 A;  2Y2M A;  4BWI A;  2O0Y A;  2EXA A;  1I2S A;  2WKP A;  3ZGA B;  2ZQD A;  3W4P A;  4NXE A;  3F1O A;  1SKO B;  4JF5 A;  2VX8 A;  4BD0 A;  3IWI A;  3ZG0 A;  1FSW A;  3LYX A;  1STZ A;  3IS2 A;  2IWD A;  1S67 L;  3CPT A;  4QHC A;  4X69 A;  3NDE A;  3UB8 A;  4EXO A;  1DP8 A;  1XPB A;  5M18 A;  3DWZ A;  1NLY A;  4EEP A;  5EVI C;  1LL5 A;  2XD1 A;  3NC8 A;  3EQU A;  3UN7 A;  4Q0I A;  5FL3 A;  5AVE A;  1PW8 A;  3QP6 A;  3SS5 A;  1QME A;  1VEU A;  1NRF A;  1GHM A;  1W63 Q;  1G6O A;  1TS0 A;  1Y4O A;  4PM7 A;  1L0D A;  2Y2L A;  4DDS A;  4RA7 A;  5HL6 A;  1K6S A;  4RX3 A;  1M40 A;  3ZFZ A;  4PHT A;  4JKT A;  3IT9 A;  2V0W A;  1JVJ A;  4HNB A;  1FCO A;  2VGK A;  2O99 A;  2HP9 A;  3D72 A;  3G2Y A;  1NRJ A;  3HBR A;  4BJP A;  3KSH A;  1N9L A;  3Q7Z A;  2XA7 M;  1H3Q A;  1K56 D;  2QJ5 A;  3LCE A;  4Y5F A;  1ES5 A;  3HUM A;  5FQQ A;  1G28 A;  5FEG A;  2J7V A;  1K57 C;  2JN7 A;  4LFU A;  2Y2N A;  3UB7 A;  2C6W B;  1MKI A;  3P7N A;  3Q81 A;  5EVI A;  4R3J A;  1IEM A;  3C2W A;  3VOL A;  1KDS A;  4MBH A;  5EOE A;  3UPP A;  1YM1 A;  2X02 A;  4KQQ A;  3U2A A;  1OTA A;  2PD7 A;  1ACF A;  4XT2 B;  3D4F A;  3S22 A;  5CEC A;  2PRF A;  3NOP C;  3GQZ A;  1BTL A;  3FPV A;  4E3M A;  1MWT A;  2OOL A;  5AQ9 A;  5IU1 A;  3DBA A;  3RFB A;  5I94 A;  4FOF A;  2JKF A;  3N8L A;  2XDM A;  2WZX A;  3M2K A;  2OAP 1;  4Y0T A;  3MZD A;  3BLM A;  1W7F A;  4G3W A;  3C38 A;  4WUJ A;  3T4Q A;  4MLL A;  3BQA A;  4FCF A;  4ZJ1 A;  3C30 A;  1CI9 A;  2WYX A;  4JLF A;  2W3G A;  2Y2H A;  3F1O B;  4HY8 A;  4P6Z M;  3ZCZ A;  2W3H A;  1YLJ A;  2QMI A;  2VGJ A;  3IS2 B;  4GDN A;  2OSU A;  3LR0 A;  1ODV A;  3CPT B;  1K57 A;  3Q7V B;  2H10 A;  1DY6 A;  4R4S A;  4HJ3 A;  4Y0O A;  1PFL A;  2WAE A;  3H82 A;  3BFG A;  5FSR A;  3ZDJ A;  4QJG A;  4E6X A;  2ZQ9 A;  3VSL A;  2V20 A;  3A3F A;  1IYP A;  1VET A;  3DAV A;  5IHV A;  5E2F A;  1K25 A;  4OP8 A;  2JE5 A;  3IHB A;  2G2U A;  4JGP A;  3RJU A;  5JYP A;  3VE3 A;  3QNC A;  1JWV A;  4EUV A;  2DNS A;  4B93 A;  1NWZ A;  3LI8 A;  2CC1 A;  4JXW A;  3M2J A;  3A3E A;  1K38 A;  5FAS A;  4XUX A;  4KQD A;  3S7P A;  3IBJ A;  2Q9N A;  4ME4 A;  3G34 A;  5CRF A;  5KMW A;  3BLS A;  3HRE A;  3T4L A;  3BEC A;  3NBL A;  2V8C A;  1HD8 A;  5CHU A;  4BLM A;  1T1A A;  3CI6 A;  2XF3 A;  4X25 A;  5CHM A;  1TS8 A;  3VV4 A;  3S1Y A;  1K56 A;  3IF5 A;  3B47 A;  5EVL A;  2WKI A;  4EBP A;  3MXS A;  4AFI A;  4ETZ A;  3TW8 A;  1IYO A;  4LGW A;  2WUQ A;  5FAP A;  3QP5 A;  3GEC A;  4IHQ A;  3OZH A;  3CLO A;  5DJU A;  4HES A;  1KOU A;  2ZMF A;  1JTG A;  3BJN A;  2ZC5 B;  1ALQ A;  3ZNY A;  4D2O A;  1VQQ A;  2M7U A;  3GVB A;  2X01 A;  1W79 A;  1H8M A;  1K4E A;  4Y13 A;  1LI0 A;  1TDL A;  2A49 A;  1MWS A;  2ZM2 A;  4NG2 A;  1ZTU A;  3PYP A;  3VP4 A;  4DE0 A;  2QYB A;  2PR5 A;  3PXP A;  1W5D A;  5CHJ A;  5HWV A;  3TSG A;  5TGF A;  4L9E A;  1CF0 A;  1HVB A;  5FAO A;  4HIA A;  2INW A;  2W1T B;  3FZC A;  1IKI A;  4IUK A;  1ONH A;  2Y2G A;  2Y2I A;  4R0Q A;  3V50 A;  2FFF B;  5GHX A;  1XJ3 A;  2ZQ8 A;  1IFQ A;  4OKP A;  4OQ0 A;  4K08 A;  3LY4 A;  4PM9 A;  3BRM A;  5J3W A;  3FC7 A;  4UAA A;  4HJ4 A;  1IKG A;  1C3B A;  2Y8H A;  3HLF A;  3FKV A;  3LIE A;  1YPR A;  1XJ4 A;  3BWL A;  4Y17 A;  2KX6 A;  4MBK A;  1MKM A;  1AWI A;  4P6Z S;  4WM9 A;  3SS3 A;  3SZT A;  3PBQ A;  2P08 A;  3M6H A;  1VET B;  1KGF A;  2VGL M;  1S1Y A;  1GCE A;  3CG5 A;  3PBO A;  4S2P A;  4E6W A; 
#chains in the Genus database with same CATH homology
 2WAF A;  2Y91 A;  4P87 A;  4E3J A;  3OPR A;  4KQO A;  2OLU A;  4S2K A;  4PM5 A;  4OLG A;  1MPL A;  1H8Z A;  5A93 A;  1N9B A;  3IQA A;  4X56 A;  1O07 A;  1FOF A;  3FYZ A;  1KDW A;  3CMZ A;  3G35 A;  1Q2Q A;  4M3K A;  4OOL A;  4X55 A;  2HP6 A;  3BFF A;  3HVF A;  2J8Y A;  3NI9 A;  1FR6 A;  4KZ9 A;  1YQS A;  4NK3 A;  1G6A A;  2H0Y A;  3MFD A;  1NJ4 A;  4LEN A;  4WBG A;  1XGI A;  4Y7P A;  5EPH A;  4S2M A;  5HAI A;  4S2J A;  5FA7 A;  4ZJ3 A;  3IWQ A;  1NY0 A;  1ZKJ A;  2R9W A;  2XQZ A;  3W4O A;  4IVI A;  2XFT A;  3OPP A;  4PM8 A;  5FDH A;  2XR0 A;  4ZBE A;  4IBX A;  5CGW A;  1U60 A;  4KZ7 A;  4KZ4 A;  4U0X A;  3N7W A;  2QPN A;  4KG5 A;  4N9L A;  1BLH A;  3RXX A;  4EWF A;  1ESU A;  5AQA A;  1YLW A;  4WEK A;  3OCN A;  5GL9 A;  2Y2M A;  1WE4 A;  1L0F A;  2ZQ7 A;  3W4Q A;  2Z2L B;  4C75 A;  1RP5 A;  2EXA A;  2XH9 A;  4OVD A;  1I2S A;  3WS1 A;  4DDY A;  1VM1 A;  3ZGA B;  1SDE A;  2ZQD A;  3UO9 A;  2DCF A;  3W4P A;  4K0W A;  1KVM A;  1NYY A;  3UPN A;  4EV4 A;  3BFD A;  4JF5 A;  4JPM A;  4LV0 A;  1KE4 A;  2ZJ9 A;  4FH2 A;  4BD0 A;  4E3K A;  2Y2J A;  5DF8 A;  3IWI A;  1ES4 A;  3ZG0 A;  1FSW A;  1XA1 A;  4F94 A;  4LV2 A;  1ES2 A;  1LHY A;  1SHV A;  1SCW A;  1LL9 A;  2IWD A;  3WS2 A;  1YLP A;  3UY6 A;  1HTZ A;  2RCX A;  4QHC A;  4X69 A;  3NDE A;  2HDS A;  1YLZ A;  4OON A;  1ES3 A;  2ZC6 B;  1XPB A;  5M18 A;  3DWZ A;  4OQI A;  5EVI C;  3IH9 A;  1LL5 A;  4RX2 A;  4B4X A;  1PZP A;  1BT5 A;  2XD1 A;  4WEJ A;  3NC8 A;  4Y0U A;  4DXB A;  2ZMA A;  3EQU A;  3UN7 A;  3G4P A;  3G2Z A;  3MZE A;  1PW8 A;  3B3X A;  4OP5 A;  4N92 A;  4LCL A;  4DXC A;  3SS5 A;  1QME A;  1XGJ A;  3SH7 A;  1NRF A;  1GHM A;  2C5W B;  2P9V A;  2WK0 A;  4WYY A;  4Z9Q A;  3VSK A;  3PAE A;  3E2L A;  1YT4 A;  3A3J A;  4WZ4 A;  3HUO A;  1XP4 A;  3ZHH A;  4PM7 A;  3HLC A;  1I2W A;  1L0D A;  2P74 A;  2Y2L A;  4DDS A;  1H8Y A;  2Q9M A;  1E3U D;  4KZ6 A;  4HEF A;  2HDR A;  4BD1 A;  4RA7 A;  4S2O A;  3BFE A;  3UPO A;  1K6S A;  4RX3 A;  5JYO A;  1J9M A;  2IWC A;  1M40 A;  3ZFZ A;  5BOH A;  3UNW A;  1HZO A;  3EQV A;  2H5S A;  5EOO A;  4JKT A;  4R23 A;  3IT9 A;  2Y55 A;  4UHU A;  1PWD A;  3N4I A;  4GZB A;  4WMC A;  3ITB A;  4N9K A;  4MNR A;  4E3L A;  4JF6 A;  1JVJ A;  3OPL A;  2Y59 A;  4KG6 A;  3VFF A;  1NYM A;  4K91 A;  3UDF A;  1ERM A;  5FQM A;  2P9V B;  1FCO A;  3DWK A;  2VGK A;  3AGE A;  2WGW A;  2HP9 A;  1L0G A;  3S4X A;  3G2Y A;  3SS4 A;  2E8I A;  4ZAM A;  3HBR A;  3LO7 A;  1JTD A;  3PBN A;  4GOG A;  1KGE A;  4BJP A;  3MZF A;  1WYB A;  4DRT A;  2EX9 A;  3UDX A;  3O87 A;  3Q7Z A;  1L0E A;  1LLB A;  4GD8 A;  1K56 D;  4JF4 A;  3IXH A;  1XXM A;  3OC2 A;  3VOZ A;  3LCE A;  3IXD A;  4ZJ2 A;  3IF6 C;  4H8R A;  1RGY A;  3V3R A;  3ZG5 A;  1ES5 A;  4MEZ A;  3HUM A;  5FQQ A;  4OPR A;  4PMA A;  4C3Q A;  5M19 A;  2J7V A;  1E3U A;  2WKH A;  3NIA A;  1ZG4 A;  3IWO A;  3AGD A;  1BUL A;  1K57 C;  1TDG A;  4LCM A;  4FH4 A;  3IHA A;  2PU4 A;  1S0W A;  4NET A;  2Y2N A;  3ZG7 B;  1MWR A;  2I72 A;  4N1H A;  5HW3 A;  2B5R A;  1MKI A;  2C6W B;  3Q81 A;  4KEN B;  5AQB A;  4QU3 A;  1SDN A;  1IEM A;  3C7U A;  4R3J A;  5EVI A;  3V5M A;  4IVK A;  1KDS A;  4OPZ A;  4MBH A;  4O7D A;  5EOE A;  3UPP A;  1YM1 A;  1ZC2 A;  2X02 A;  3G31 A;  4XUZ A;  4X68 A;  4HBU A;  2WAD A;  5HAQ A;  5E43 A;  5FI2 A;  4KQQ A;  3ZG8 B;  5CXW A;  4FSF A;  3D4F A;  4EUZ A;  5HL1 A;  2XGN A;  3DW0 A;  5AQ7 A;  3S22 A;  1TEM A;  4P6B A;  5CEC A;  3WS5 A;  2ZD8 A;  1ERO A;  3GQZ A;  1BTL A;  2WZZ A;  3N8R A;  4E3M A;  2XD5 A;  2HP5 A;  5EE8 A;  3HL9 A;  1MWT A;  1PZO A;  3HUN A;  2OLV A;  3GV9 A;  5CGS A;  5AQ9 A;  4IED A;  5I94 A;  4R4R A;  5EVI B;  3ZG9 B;  4GN2 A;  3WWX A;  5CTM A;  3QNB A;  1FCN A;  5FI6 A;  3N8L A;  2XDM A;  3G32 A;  4OQG A;  2WZX A;  3M2K A;  3JYI A;  3IH8 A;  4Y0T A;  2HDQ A;  4X53 A;  3MBZ A;  3MZD A;  4JXV A;  1FQG A;  5KSH A;  3Q7V A;  2ZM0 A;  3BLM A;  2XEP A;  1PIO A;  1W7F A;  3C4P A;  4RYE A;  2ZQC A;  3GR2 A;  1JWP A;  3BFC A;  5FAT A;  4UA7 A;  3NDG A;  5L2F A;  2ZLY A;  4MLL A;  5A91 A;  4FCF A;  4ZJ1 A;  2Y2O A;  4WEL A;  4XXR A;  1MBL A;  5DTK A;  1CI9 A;  3VP2 A;  2GDN A;  1W8Y A;  4QY5 A;  4RVA A;  4KZ5 A;  3VP0 A;  2WYX A;  2G2W A;  4JLF A;  5E2E A;  2EXB A;  2PU2 A;  2Y2H A;  4GDB A;  2H0T A;  4QD4 A;  3PBS A;  1NZU A;  1KE0 A;  4LV1 A;  3IF6 A;  3ZCZ A;  5DTS A;  2Y2Q A;  1YLJ A;  2QMI A;  2VGJ A;  3NCK A;  4GDN A;  2OSU A;  4S2L A;  5GLB A;  5A90 A;  3WRT A;  3Q7V B;  1K57 A;  4E3O A;  2H10 A;  1DY6 A;  3GTC A;  2V2F F;  4ZTK A;  5KZH A;  1MY8 A;  1RCJ A;  3PAG A;  5F1G A;  3VP3 A;  3SH8 A;  1KE3 A;  4YIN A;  4R4S A;  4Y0O A;  1EWZ A;  4KZB A;  3BM6 A;  2WAE A;  4JXG A;  1IYQ A;  2WGV A;  3GRJ A;  3BFG A;  2HPB A;  5GLA A;  5FSR A;  4EQI A;  5EUA A;  5U47 A;  4ZDX A;  1CEF A;  3ZDJ A;  4QJG A;  4E6X A;  2ZQ9 A;  3VSL A;  1MWU A;  1TVF A;  2V20 A;  3N6I A;  4GKU A;  3A3F A;  3MKF A;  4P0M A;  1IYP A;  2ZC3 B;  3I7J A;  4X6T A;  4R1G A;  5E2H A;  5IHV A;  5E2F A;  4DE1 A;  1XKZ A;  2ZM8 A;  2V1Z A;  1K25 A;  4HBT A;  4OP8 A;  2JE5 A;  3IHB A;  4JBF A;  4WZ5 C;  3UE0 A;  3WRZ A;  2G2U A;  1BLS A;  4UA6 A;  5GLD A;  1MXO A;  3RJU A;  3A3D A;  3IXG A;  1Z6F A;  1JWZ A;  1JWV A;  1PWC A;  2A3U A;  3P09 A;  3QNC A;  1IYS A;  5FQK A;  5FI7 A;  1FR1 A;  5JYP A;  1K4F A;  2XLN A;  1PW1 A;  2DNS A;  1GA9 A;  4BL3 A;  1KGG A;  5EEC A;  2ZQA A;  2ZC4 B;  2CC1 A;  4U0T A;  5CGX A;  3TOI A;  5DF9 A;  2XK1 A;  2R9X A;  4JXW A;  5F1F A;  3M2J A;  2Z2M B;  4BL2 A;  3WS4 A;  3A3E A;  4GNU A;  1K38 A;  5FAS A;  2Y4A A;  5TR7 A;  4XUX A;  1NXY A;  1DJA A;  4LV3 A;  1YLY A;  2WGI A;  5CED A;  2XFS A;  5CTN A;  3SH9 A;  1FCM A;  2Q9N A;  3A3I A;  1K54 A;  4KZ8 A;  5KSC A;  1BZA A;  4N1X A;  3G34 A;  4PPR A;  5CRF A;  5KMW A;  3BLS A;  3PBT A;  3HRE A;  5CEB A;  2WGW B;  3BEC A;  1AXB A;  1PWG A;  2PBY A;  2OV5 A;  4QB8 A;  1CI8 A;  4Q8I A;  2X71 A;  3NBL A;  1E25 A;  1HD8 A;  4C6Y A;  3FKW A;  3HLG A;  3BEB A;  3O88 A;  5FQJ A;  3VP1 A;  5CHU A;  4BLM A;  4KG2 A;  3IXB A;  2XF3 A;  1PI4 A;  5CHM A;  4CPK A;  3HLW A;  5HFO A;  4EBL A;  2RL3 A;  3S1Y A;  1K56 A;  3IF5 A;  1BSG A;  2EFU A;  5DVA A;  4E3N A;  1XX2 A;  4B4Z A;  5EVL A;  3Q82 A;  5GLC A;  2WKI A;  4L0L A;  4EBP A;  1RGZ A;  1ESI A;  3MXS A;  4DF6 A;  2JC7 A;  1M6K A;  4DE3 A;  1IYO A;  3QHY A;  3UE3 A;  4P85 A;  2WUQ A;  5GHZ A;  4GB7 A;  5FAP A;  1S6R A;  4ID4 A;  4GD6 A;  2QZ6 A;  1GHP A;  2UWX A;  3OZH A;  1K55 C;  1K54 C;  4HES A;  3ZNT A;  4CJN A;  1FSY A;  3P98 A;  3C5A A;  5E2G A;  1JTG A;  1L2S A;  4DKI A;  3N8S A;  3UDI A;  2ZC5 B;  1ALQ A;  1YLT A;  4KQR A;  1WYC A;  3ZNY A;  4WZ5 A;  4D2O A;  1VQQ A;  1LI9 A;  2EX8 A;  3GVB A;  2X01 A;  3GMW A;  1W79 A;  1SKF A;  3HLE A;  1K4E A;  4PM6 A;  1LI0 A;  1TDL A;  2A49 A;  4YFM A;  2EFX A;  1E4D A;  4JXS A;  1CK3 A;  1BLC A;  3CZD A;  3ISG A;  3OCL A;  1MWS A;  2Y2K A;  2ZM2 A;  3VFH A;  2JBF A;  1NZO A;  3FV7 A;  3VP4 A;  4BQM A;  2IWB A;  4DE0 A;  4WMC D;  3SOI A;  1W8Q A;  3E2K A;  2JCH A;  3C7V A;  5FQ9 A;  3RXW A;  3HLD A;  1W5D A;  5CHJ A;  2WKE A;  4K0X A;  3TSG A;  4EBN A;  5M1A A;  4S2N A;  5TGF A;  4OH0 A;  5FAQ A;  4BEN A;  1O7E A;  2BG1 A;  1HVB A;  5DTT A;  3ZVW A;  5FAO A;  1IEL A;  4A5R A;  3O86 A;  3MKE A;  3FZC A;  4OLD A;  3LEZ A;  1KVL A;  1IKI A;  2EX2 A;  1ONH A;  3TG9 A;  3PTE A;  2Y2G A;  2Y2I A;  5CER A;  5TFQ A;  3LY3 A;  3Q07 A;  1ZG6 A;  4FD8 A;  4OPY A;  3UE1 A;  3Q1F A;  4E3I A;  4R0Q A;  5F82 A;  1YMS A;  3V50 A;  5FQI A;  2FFF B;  3M6B A;  5GHX A;  4OQH A;  1PYY A;  2HDU A;  2ZQ8 A;  3MXR A;  4OOM A;  1ONG A;  2J9P A;  3IF6 B;  4S2I A;  2FFY A;  4IBR A;  4OKP A;  4OQ0 A;  1QMF A;  4KZ3 A;  1G68 A;  3LY4 A;  4MBF A;  4PM9 A;  2BLS A;  1ERQ A;  3BRM A;  3DTM A;  3G30 A;  5GHY A;  3FWL A;  3V39 A;  2ZC7 A;  4UAA A;  2EX6 A;  4DE2 A;  1CEG A;  1IKG A;  1C3B A;  4OPQ A;  4UA9 A;  3HLF A;  5EVI D;  4OOY A;  5A92 A;  3FKV A;  3V3S A;  1PI5 A;  1DJC A;  5DF7 A;  3VOY A;  5F83 A;  3HLB A;  1XA7 A;  1BLP A;  3AGF A;  1H5X A;  5G18 A;  4MBK A;  1GA0 A;  3NY4 A;  4KZA A;  3ITA A;  5HAR A;  4WM9 A;  3O3V A;  1I5Q A;  4QY6 A;  3SS3 A;  3WS0 A;  1K6R A;  3PBQ A;  5HAP A;  3ZVT A;  2DRW A;  4S2N C;  1EI5 A;  3M6H A;  4R3B A;  5D3O A;  5J8X A;  1K55 A;  3C4O A;  1YMX A;  1DJB A;  4U3T A;  4B88 A;  3BYD A;  1KGF A;  1GCE A;  1Y54 A;  2J9O A;  1GHI A;  2Y2P A;  1N4O A;  3OPH A;  3VMA A;  3CJM A;  3GSG A;  1OME A;  3PBR A;  1BUE A;  1Q2P A;  3W8K A;  5HX9 A;  3CG5 A;  3PBO A;  4S2P A;  4E6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...