4IBRA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s/e104k mutations
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title What Makes a Protein Fold Amenable to Functional Innovation? Fold Polarity and Stability Trade-offs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ibrA00
2Y2PA 1GHPA 4OQHA 2Y91A 4R4SA 3QHYA 3FZCA 4P6BA 2WKIA 3RXWA 3CZDA 3VOZA 5AQ9A 3RJUA 5FQIA 3PBRA 4IEDA 3N7WA 3OC2A 1PYYA 4GDBA 5HL1A 2ZJ9A 5GLCA 2VGJA 2XGNA 2IWDA 3G4PA 4JKTA 3AGEA 1E25A 5E43A 4F94A 2Z2LB 3G31A 3ITAA 2OLVA 2P9VB 4P0MA 1Z6FA 1GA9A 4QY6A 5F83A 4OKPA 4K0XA 4CPKA 4N9KA 1KGFA 3NBLA 4E6XA 3W4PA 4E3NA 2XEPA 2Y55A 3MKFA 4S2NC 2J8YA 1MWTA 5CHMA 2QMIA 4FSFA 2Y2OA 1YMSA 3IF6B 4LV0A 1XGJA 2PU2A 3VFFA 1FQGA 1NY0A 5DTKA 4EUZA 1FSYA 1FR6A 3N6IA 2JC7A 4GZBA 3QNBA 1N9BA 2WGVA 1ES5A 1GHMA 1MBLA 4K0WA 2DNSA 2WAEA 3NIAA 4NK3A 3LY4A 1FSWA 4UA9A 1IYOA 3A3FA 5D3OA 3ZG5A 5BOHA 2Y59A 4JF4A 1PIOA 3O87A 2OV5A 3A3EA 5FI6A 4JF5A 1XA7A 1BT5A 3G30A 2XFSA 5FDHA 1O07A 3WS2A 3C7VA 4RVAA 4BLMA 4KQOA 4GB7A 1MWRA 3WS4A 2H10A 1SKFA 2FFYA 3Q1FA 5AQAA 2XD5A 3IH9A 4P85A 3WRTA 5CHUA 3UPPA 3SH8A 1EI5A 1YLYA 5EUAA 2ZC6B 4PM8A 1J9MA 4IBRA 1W5DA 4JXSA 2JE5A 5EVIB 4DKIA 5E2GA 1BSGA 4RX3A 3ZNTA 1PI5A 1LHYA 1YT4A 5FAOA 2HPBA 3G2YA 4R3BA 2BG1A 4LV2A 5GHXA 1KE0A 3HLEA 4WYYA 4KZ9A 5FQJA 4PMAA 5HAIA 1XX2A 3HLFA 5TR7A 2C6WB 3ZVTA 1K25A 1LL9A 4N92A 1PZPA 2E8IA 3Q7ZA 3V50A 5AQ7A 1YLWA 1Q2PA 3NDGA 2RL3A 4MEZA 3UDFA 4UHUA 1RCJA 1CK3A 3IXGA 5EPHA 3UDXA 1H8ZA 1FCNA 3O3VA 5HFOA 1ZG4A 4E3MA 4OLGA 3WWXA 4Y0OA 3AGFA 5E2HA 5F1GA 3V39A 4KZ6A 2P74A 1ZKJA 4ZJ3A 3FYZA 4BJPA 1JTDA 1L2SA 1K57C 2G2UA 4JF6A 3S1YA 3HREA 5CHJA 4C75A 2XD1A 1LLBA 3HLWA 2Q9NA 5CGXA 4GD6A 3NCKA 1FR1A 1QMFA 3HUMA 4R0QA 4KG6A 4LCLA 4LV3A 4S2MA 2WYXA 4DE2A 1U60A 5JYPA 4U0TA 1BLPA 3V3SA 3ZG7B 1WYBA 3HUOA 4JBFA 1VQQA 1PW8A 1ZC2A 4KZ4A 3IHAA 1XP4A 4IBXA 5M1AA 3M2KA 3HLCA 4P87A 2XDMA 2EX6A 3PBOA 5DVAA 3BFFA 5M18A 1MXOA 2ZC5B 3NI9A 1YLJA 4ZAMA 3ZG0A 1K55C 2IWCA 3IXBA 5IHVA 1NXYA 2C5WB 2HDUA 2I72A 1PWDA 3UNWA 4KENB 4PPRA 1W8QA 3G2ZA 4OLDA 3NY4A 4X68A 1KVLA 3IQAA 5CERA 1C3BA 4MNRA 5GLAA 1IYQA 4S2JA 1HVBA 1TEMA 3IF5A 4OVDA 2DRWA 1BTLA 4WZ5A 5HARA 1ONGA 5A90A 3S4XA 2EX9A 3Q7VB 5GLDA 4DRTA 4WEJA 3SOIA 3V5MA 2JCHA 4KQQA 1RGZA 1XGIA 2WKEA 2XF3A 1L0GA 1EWZA 1NJ4A 1DY6A 4EQIA 3RXXA 2G2WA 3A3IA 2BLSA 3BRMA 5CGWA 1ZG6A 1K57A 2V2FF 1K38A 1K4EA 1YLTA 2EFXA 2WAFA 1K6SA 3DTMA 1E3UA 4X55A 4X56A 4Q8IA 4X53A 3OCLA 3UN7A 3CG5A 5KMWA 4KQRA 3BM6A 1PZOA 1K6RA 3IXDA 1ONHA 3ZCZA 4Y0UA 5HW3A 3ZG9B 4BL3A 1ESIA 1W79A 3LO7A 5E2EA 4RX2A 3C5AA 1K55A 3P98A 2R9XA 2EX2A 4UA6A 3VFHA 1CI8A 1I5QA 1NZUA 3IWOA 1M6KA 5CGSA 3G32A 4KZ3A 3SS3A 1QMEA 3UPNA 4E3LA 4HEFA 2QZ6A 3OCNA 5U47A 4WMCD 3UE1A 1KE4A 3MBZA 4X69A 5FAQA 1L0FA 4PM5A 4OPYA 3CMZA 2J9PA 5A92A 2ZC4B 3BFDA 3GV9A 4OP5A 1K56D 1PW1A 4FH2A 2Y2HA 3ZG8B 1BUEA 1H5XA 4U0XA 1W8YA 1JWZA 4LV1A 3UPOA 2ZC7A 4C6YA 1YQSA 1I2SA 4BD1A 4DDSA 3G35A 4JXWA 2EFUA 4WZ4A 4OOYA 4EBPA 3MZDA 5A93A 1K54C 4YINA 3MFDA 1DJCA 5FI7A 1MY8A 3VP1A 4EBNA 2XLNA 4L0LA 2QPNA 2A49A 3PAEA 3OPRA 4OQGA 3C7UA 3FKWA 4EWFA 2XFTA 3A3DA 1HZOA 1NYMA 3MXSA 4QJGA 2Y2KA 2OLUA 1JVJA 2WZZA 2ZQ9A 1CEFA 1MWUA 4QU3A 5FAPA 3ISGA 4S2NA 2X71A 3WS5A 2HDQA 3PAGA 4DF6A 1NRFA 2X01A 4KZ8A 3GVBA 4WEKA 3AGDA 3N8LA 4M3KA 5KZHA 1TDLA 3M6HA 4Z9QA 4ZTKA 5FQMA 2ZM2A 1S6RA 2Z2MB 4WBGA 3G34A 5GHZA 1ESUA 1JWVA 3BLSA 3UE3A 3IWIA 5I94A 1XA1A 1IELA 3BFEA 4CJNA 3VSKA 2ZM0A 3HLGA 1BLHA 1JWPA 2WUQA 2ZQCA 3FKVA 3WS1A 4R1GA 4PM6A 3ZNYA 5EE8A 2Y2MA 3IH8A 3SH7A 4QHCA 3HUNA 2ZMAA 3N8SA 1TVFA 1IYPA 2PBYA 4LCMA 3VP0A 1ES4A 4BD0A 2DCFA 4ZJ2A 4B4ZA 1PI4A 4DE0A 3GSGA 5CXWA 3GMWA 1HD8A 3FV7A 4OPZA 3Q81A 1M40A 4B4XA 1WE4A 5EVLA 1RP5A 3GR2A 2HDRA 5L2FA 2A3UA 5AQBA 3EQUA 1Q2QA 5A91A 2HP5A 4OONA 1K54A 4EBLA 3HLDA 3MZEA 3VMAA 3IWQA 2H5SA 3MZFA 3OPPA 1MWSA 3MKEA 5CTNA 5GLBA 4GNUA 4DXCA 1ERQA 5EVIC 3N8RA 4FD8A 1ES3A 4GOGA 3B3XA 3O86A 4YFMA 1SDNA 4QB8A 4KG2A 5KSHA 4S2OA 4N1HA 4EV4A 4PM9A 2J9OA 1SHVA 3PBSA 5EVID 3ZVWA 3DWKA 5KSCA 3W4QA 4OQ0A 3V3RA 4UA7A 1G68A 4MBKA 3Q07A 3LEZA 3PTEA 3MXRA 3DWZA 3TG9A 3W8KA 3ZFZA 5FATA 4E6WA 2OSUA 4K91A 1KDWA 1WYCA 1Y54A 4KZ5A 2XR0A 2R9WA 2ZC3B 4XUXA 4A5RA 1DJBA 5DTTA 4KZAA 1YLPA 3BFGA 3VSLA 4X6TA 3SS4A 1XXMA 5FI2A 3BLMA 4XUZA 4S2PA 1LI0A 5FASA 1MKIA 5EOOA 1CEGA 1NZOA 5DF7A 5F82A 3TOIA 2H0YA 4ZDXA 4O7DA 4S2IA 5EOEA 5F1FA 1GA0A 1YMXA 4KZ7A 4E3IA 3IXHA 1RGYA 5FSRA 4FH4A 3JYIA 4E3OA 1TDGA 3PBNA 2B5RA 1FOFA 1XPBA 2XQZA 3GQZA 4S2KA 5DF8A 4DDYA 2CC1A 5HX9A 3HBRA 1O7EA 2H0TA 3E2KA 2Y2IA 4C3QA 1DJAA 2V1ZA 2EXAA 5EVIA 4LENA 3WRZA 2ZQ7A 4B88A 4E3KA 2EXBA 4H8RA 5G18A 2WKHA 5EECA 1XKZA 3TSGA 3BYDA 3HLBA 1IKIA 1ALQA 1KDSA 2J7VA 4GN2A 4R3JA 3P09A 5GL9A 4NETA 4ZBEA 2WK0A 1N4OA 3IT9A 3BFCA 2Y2NA 1YLZA 3HL9A 4IVIA 1I2WA 4R23A 5FQKA 2RCXA 3UE0A 3SH9A 4KZBA 3UO9A 1BLCA 3E2LA 1OMEA 5FQ9A 2XH9A 5TFQA 1K4FA 2WZXA 4UAAA 1LL5A 2VGKA 4OOMA 4RA7A 3LCEA 3QNCA 4DXBA 2HP9A 2ZQAA 2WGWA 4RYEA 1AXBA 2IWBA 2Q9MA 3BEBA 3LY3A 2UWXA 3C4OA 3DW0A 4E3JA 5GHYA 4OH0A 4DE3A 4ID4A 3VP4A 4GDNA 2Y2LA 1KE3A 4N9LA 3CJMA 3UDIA 1G6AA 3C4PA 2HDSA 4N1XA 5DF9A 3ZGAB 3NC8A 5CEDA 4JXVA 3BECA 2PU4A 4JPMA 3VP2A 1IKGA 4QY5A 1IEMA 2Y2JA 4WMCA 4GD8A 4PM7A 2JBFA 3IF6C 1FCOA 3OZHA 3NDEA 3ZHHA 3Q82A 4XXRA 1K56A 3GTCA 1ERMA 1MPLA 2V20A 4IVKA 4WM9A 3SS5A 2GDNA 5FQQA 1EROA 1E4DA 2ZQDA 1ES2A 5FA7A 3O88A 4WZ5C 1KGEA 1JTGA 4OQIA 1W7FA 5JYOA 4HBTA 3VP3A 4DE1A 1KGGA 1PWGA 4OPQA 1HTZA 1BZAA 1H8YA 4BL2A 1VM1A 5DTSA 4HESA 4OOLA 3A3JA 4WELA 1YM1A 4JLFA 4BENA 4QD4A 4OPRA 5CRFA 3WS0A 2WGWB 2ZM8A 3Q7VA 1BLSA 3ITBA 2EX8A 2WGIA 5M19A 3ZDJA 2Y2QA 3HVFA 1L0DA 4HBUA 1NYYA 5CEBA 3I7JA 4MLLA 1PWCA 3FWLA 3PBQA 4MBFA 4S2LA 4Y7PA 5HAQA 1L0EA 3GRJA 4FCFA 3M6BA 4ZJ1A 4MBHA 1SCWA 5TGFA 5J8XA 2XK1A 2P9VA 1E3UD 3M2JA 1CI9A 2HP6A 4Y0TA 5HAPA 2Y2GA 3OPHA 3OPLA 1KVMA 4OP8A 3N4IA 3PBTA 4U3TA 3EQVA 1BULA 4JXGA 3VOYA 1IYSA 1S0WA 3IHBA 3S22A 1LI9A 5CTMA 2ZQ8A 1GCEA 2FFFB 2WADA 3D4FA 4KG5A 2ZLYA 2X02A 1FCMA 3IF6A 3W4OA 4BQMA 4D2OA 1SDEA 1GHIA 4GKUA 5E2FA 3UY6A 2Y4AA 2ZD8A 4R4RA 5CECA
chains in the Genus database with same CATH superfamily
1GHPA 3NJAA 1UWNX 1AWIA 4P6BA 1Z09A 5AQ9A 4IEDA 3OC2A 4GDBA 2ZJ9A 3G4PA 3T50A 1E25A 2EWVA 2BTFP 4WL9A 3C38A 4OKPA 3QP5A 4CPKA 4E6XA 3W4PA 2Y55A 2QMIA 4FSFA 1YMSA 5J7EA 3BQ8A 5L09A 1F9IA 2PU2A 5DTKA 4YWZA 1N9BA 1MBLA 4BBUA 1FILA 2DNSA 4E04A 4UA9A 1IYOA 3E4PA 1CF0A 2OV5A 2JKRM 3LFVA 5FI6A 2QJ5A 1BT5A 1TF1A 3QP2A 5HWVA 2J80A 2W3EA 3WS4A 1SKFA 2XD5A 5CHUA 1EI5A 1P9WA 3O5YA 4IBRA 1W5DA 4JXSA 3BW6A 2JE5A 4WN5A 4WLAA 4RX3A 1PI5A 3TW8A 4R3BA 4EEUA 4GJ4A 2W1TA 4KZ9A 4PMAA 5HAIA 2FZ0A 4N92A 1PZPA 4Q0HA 1H8ZA 1ZG4A 2VKSA 4PHTA 1H8MA 5E2HA 3S7PA 4ZJ3A 4BJPA 3S1YA 4Y13A 2W3HA 2XD1A 3HLWA 4O0PA 3UMDA 2V8CA 4D60A 3ZG7B 4XT2B 1ZC2A 3ZQ5A 1XP4A 2KDKA 4P87A 2XDMA 4L9GA 1MXOA 3DAVA 1NXYA 3UMEA 2ZOIA 3UNWA 4KENB 1W8QA 3G2ZA 4HH2A 3A0SA 1IOUA 3MF0A 1BYWA 3IQAA 3BWLA 5GLAA 4CLCA 3T4SA 1HVBA 1L3LA 5HARA 1ONGA 3Q7VB 3SOIA 2WKEA 2KX6A 1L0GA 3QP6A 4X25A 2BLSA 1K38A 4AFIA 3DTMA 3KSFA 4X56A 4X53A 1Y4OA 3UN7A 3LR4A 1OTIA 2W27A 2ZL1A 3LI8A 4PKYA 4KUKA 1K6RA 3HCYA 3IXDA 3GDIA 1S67L 1W79A 5E2EA 3C5AA 5AVFA 1CI8A 1M6KA 5IT5A 4KZ3A 3SS3A 4E3LA 2P08A 5FAQA 2J9PA 2ZC4B 3BY9A 3GV9A 4UQIM 2Y2HA 4Q0IA 1W8YA 2O9CA 3MQ0A 1YQSA 1VB6A 4DDSA 4WZ4A 5FI7A 1H0MA 2YKFA 3OPRA 1H3QA 1HZOA 1NYMA 2OLUA 3SW1A 3B33A 3IX4A 3ISGA 2X71A 3WS5A 2HDQA 3C30A 4DF6A 4KZ8A 3GVBA 3N8LA 1TDLA 3H9WA 3G34A 5GHZA 3BLSA 5DJUA 2ZM0A 5TBMB 2ZQCA 2W1RA 3FKVA 1S1ZA 4R70A 5EE8A 3IH8A 2DCFA 2VV6A 4ZJ2A 4DE0A 3ICYA 3LIAA 3FV7A 3Q81A 1OTBA 1M40A 4B4XA 3GR2A 5L2FA 5AQBA 3LR5A 4OONA 4L9EA 3LR3A 3VMAA 3G6OA 3MZFA 2Y8HA 3MKEA 1ERQA 1ES3A 4GOGA 3B3XA 5KSHA 2K2NA 3HJIA 4O8GA 3VV4A 3ZVWA 5KSCA 3MXRA 3TG9A 1KDWA 3B47A 2O9AA 2ZC3B 4BBVA 2B02A 5DTTA 1YLPA 3BFGA 1XFNA 1NWZA 1XXMA 4S2PA 1LI0A 1NZOA 1ZHHB 3PYPA 2H0YA 2V1BA 4HI4A 5F1FA 1YMXA 5FSRA 2UV0E 4S2KA 1O7EA 2Y2IA 4C3QA 2V1ZA 1TS6A 1LT0A 2QKPA 2JHEA 4H8RA 1SZVA 2WKHA 5EECA 3TSGA 5DFYA 5GL9A 4R3JA 4GN2A 1YSPA 1N4OA 4IUHA 1YLZA 1I2WA 3UE0A 2K31A 1PNEA 2GNXA 1OMEA 1OJGA 2NUTC 2WZXA 4KQDA 4OOMA 4RA7A 4HH3A 4DXBA 1W63M 2ZQAA 4RYEA 3RH8B 2K7SA 2UWXA 3DTKA 5J4EA 5AVEA 2Y2LA 4N1XA 4ETXA 3NC8A 1YPRA 3BECA 2PU4A 4JPMA 3VP2A 1XFQA 4GD8A 4GHIB 4Y3IA 1FCOA 3OZHA 1DP9A 3ZHHA 2P7JA 2PRFA 3CITA 5HDCA 2GZAA 1ES2A 3EGXC 4WZ5C 4DMZA 4OQIA 3VP3A 5DTSA 1VEUB 4BENA 4R38A 1OT9A 2WGWB 2XA7S 3Q7VA 1BLSA 3ZDJA 1L0DA 3I7JA 3FWLA 4MBFA 4S2LA 2Z6DA 4Y7PA 3GRJA 3M6BA 4MBHA 4YOFA 1SCWA 2P9VA 1MZUA 3M2JA 4Y0TA 5HAPA 4OP8A 3N4IA 1T19A 3LR0A 1NLYA 3NOPC 3EQVA 1IYSA 1S0WA 4X1MA 2WADA 2EA9A 2ZLYA 2X02A 3IF6A 3W4OA 4BQMA 4Y2FA 1SDEA 1GHIA 3UY6A 2Y4AA 4M4XA 2ZD8A 3MR0A 1OT6A 2Y2PA 3FZCA 3CZDA 2XRNA 3VOZA 3RJUA 1N9OA 3PBRA 1PYYA 2VGJA 2XGNA 5FEGA 2JKRI 4UEYA 5HPFA 3ITAA 4P0MA 3NBLA 2VLGA 2XEPA 3MKFA 4EUVA 1MWTA 5CHMA 1X0OA 3PXPA 4LV0A 4NEED 4GZBA 4I3JA 4K0WA 4I3IA 3NIAA 4NK3A 4HP4A 5D3OA 4JF4A 1IFQA 1PIOA 4R3AA 4JF5A 4II7A 3WS2A 3F1PB 4BLMA 3Q1FA 3UPPA 1YLYA 1LSXA 4WUJA 1J9MA 2HJ9C 1OTEA 2VV8A 5K5BA 3ZNTA 2JN7A 4Y5FA 2HPBA 3CWFA 4LV2A 5GHXA 1KE0A 2D01A 1VHMA 3HLFA 3V50A 1YLWA 4ME4A 1Q2PA 4MEZA 4UHUA 5HFOA 4OLGA 4IHQA 5F1GA 2ZOHA 2P74A 1ZKJA 2EWWA 4JF6A 2G2UA 5JYPA 5CGXA 4GD6A 3HUMA 3IS2B 4LRYC 4KG6A 4S2MA 2BASA 1GSVA 2HF6A 2OAQ1 1WYBA 1UWPX 1PW8A 2OAP1 3IHAA 4IBXA 1G5UA 2EX6A 3BFFA 3NI9A 1WA9A 3MQQA 5IHVA 2C5WB 2HDUA 2I72A 1PWDA 3NY4A 5AJGA 5F6AA 1P97A 1LL8A 4MNRA 1IYQA 2L1MA 3IF5A 4OVDA 2DRWA 4WZ5A 5A90A 5GLDA 4MN5A 1DY6A 3U2AA 3A3IA 1UGUA 1ZG6A 1K57A 2V2FF 3KO6A 4MN7A 1K4EA 1YLTA 2WAFA 4X55A 3OCLA 5HDDA 5KMWA 5FDSA 1PZOA 1XJ3A 4Y0UA 3LO7A 2PYRA 3DTIA 1G28A 3T4TA 4RX2A 3VFHA 1I5QA 5CGSA 1QMEA 2QZ6A 2W3GA 1N9NA 4BMWA 1KE4A 4PM5A 4OPYA 3KYZA 3BFDA 1PW1A 3ZG8B 4JGQA 3EOIA 5F69A 3CHWP 4NG2A 4CQHA 1T1BA 2ZC7A 1CJFA 3G35A 4JXWA 4EBPA 4YINA 1DJCA 2QPNA 3CPTB 3PAEA 4OQGA 1TS0A 2XFTA 3MXSA 2Y2KA 2ZQ9A 1CEFA 4GCZA 3LIBA 4I38A 3AGDA 3H82B 2Z2MB 3IWIA 3T1XA 1BLHA 2L0WA 4PM6A 3CLOA 2Y2MA 3N8SA 1J3WA 2PBYA 3FPWA 4BD0A 4B4ZA 1PI4A 1TS7A 5CXWA 2MJ6A 3UB7A 1RP5A 2L4RA 2A3UA 5A91A 1Q2QA 2FH5A 2HP5A 4DJ3A 1K54A 4EBLA 3T1RA 4CLCE 3IWQA 1MWSA 4DXCA 4NKPA 2XROA 1TD5A 4NXFA 5I5LA 4FD8A 3O86A 4YFMA 3D9YA 4JGPA 3DTEA 1SHVA 3W4QA 4OQ0A 4UA7A 2PD7A 1G68A 1KOUA 5L07A 3Q07A 1NLZA 4E6WA 1WYCA 2R78A 1Y54A 2R9WA 3R7WB 1XJ4A 3VSLA 4P6ZS 5FASA 1CEGA 1W63Q 5DF7A 4IUKA 3KSHA 1PFLA 4KZ7A 3UE6A 1RGYA 4FH4A 1TDGA 4LFUA 4Y15A 3EEAA 4B88A 4E3KA 2INWA 3BYDA 4FOFA 1IKIA 1KDSA 3P09A 4EW7A 4ZBEA 2WK0A 3E4OA 3CUEC 1T1CA 3HL9A 4R23A 4ETZA 4G3KA 2PDRA 2WKQA 1GSWA 4KZBA 3UB6A 3UO9A 2XA7M 5FQ9A 4PKYG 1K4FA 2V9AA 4UAAA 1LL5A 4EU0A 3OLOA 4NXEA 1F5MA 3NHQA 4JGOA 4B9OA 4OH0A 4ID4A 3IS2A 1LSVA 3MS6A 3RFBA 2HDSA 5DF9A 2XSSA 4PM7A 2JBFA 3IF6C 4LGWA 1S4SA 1T1AA 5FQQA 3E4QA 4DN0A 5FA7A 3U4LP 1KGGA 4OPQA 3V67A 1SKOB 4HESA 4OOLA 4QD4A 1NRJA 2EX8A 5G4ZA 2Y2QA 4HBUA 5CEBA 4HOIA 4MLLA 1PWCA 3CAXA 1LSWA 3KX0X 4NXBA 4KUOA 4R6LA 5TGFA 2XK1A 1E3UD 1GSXA 2HP6A 1MKMA 5J3WA 4GLQA 3BQAA 3EGDC 3PBTA 4JXGA 4DJ2A 3IHBA 1LI9A 2FFFB 1TS8A 3C8CA 3H7WB 5CECA 4OQHA 2Y91A 2WKIA 3RXWA 3N7WA 1VETB 5HL1A 3LUQA 5GLCA 2WKPA 3AGEA 3OBFA 3T12B 5E43A 4F94A 3G31A 2OLVA 1Z6FA 1GA9A 5F83A 4K0XA 4N9KA 4E3NA 4S2NC 2J8YA 2Y2OA 3CPTA 3T4JA 1XGJA 1YAXA 3VFFA 4EUZA 1FSYA 1FR6A 2JC7A 3MJQA 1GHMA 3FPVA 3LY4A 1FSWA 3A3FA 5BOHA 3H82A 2Y59A 1S66L 3A3EA 3D72A 3G30A 2XFSA 1O07A 4O01A 2VJWA 3C7VA 4HNBA 4GB7A 1MWRA 5AQAA 2FFYA 3QP8A 3IH9A 4P85A 4HJ3A 5HSQA 2V1AA 5TJJA 1T18A 5EVIB 4XT2A 1BSGA 5FAOA 3E98A 3G2YA 3ULFA 3HLEA 4WYYA 5FQJA 1XX2A 3ZVTA 4EXOA 2M7VA 2B18A 3Q7ZA 4WF0A 3JVUA 4X1LA 3NDGA 3UDFA 3CUEA 3IXGA 5EPHA 3UDXA 3O3VA 1FCNA 4HY8A 4E3MA 3WWXA 3KYQA 4Y0OA 3P7NA 3D3OA 3V39A 3FYZA 1L2SA 1K57C 2J3WA 3HREA 5CHJA 1LLBA 3NCKA 4I5SA 4LCLA 4R0QA 4LV3A 2WYXA 4DE2A 4ESPA 4U0TA 3R7WA 3MFXA 2PBDP 3HUOA 4JBFA 1VQQA 3EEHA 5DVAA 3K2NA 1YLJA 3ZG0A 4G3WA 3IXBA 2ACGA 4PPRA 4X68A 5CERA 1C3BA 2VZWA 1TEMA 3LIDA 1BTLA 4RQ9A 3S4XA 3CI6A 4WEJA 3V5MA 2JCHA 1RGZA 1XGIA 2XF3A 1EWZA 1NJ4A 2JKFA 4EQIA 3RXXA 3T4OA 4JGRA 3BRMA 5CGWA 3S7OA 1E3UA 5MC7A 2WKRA 3CG5A 3F1NB 3BM6A 3ZCZA 3ZG9B 2GJ3A 1K55A 3FG8A 3P98A 2R9XA 4CLCB 3E0YA 5G4YA 4UA6A 2LB5A 1NZUA 3SZTA 3UPNA 4PAUA 4HEFA 3OCNA 3UB9A 2VGLS 3UE1A 4X69A 1L0FA 5A92A 4Y17A 5TBMA 4OP5A 4FH2A 1OTDA 1BUEA 3T4LA 1H5XA 4U0XA 2PR5A 1JWZA 4LV1A 4MDZA 3UPOA 3F1OB 2AVXA 2EFUA 4I39A 4OOYA 1K54C 2ZBBA 1SKOA 3VP1A 4EBNA 4L0LA 4EEPA 3IBRA 3C7UA 3FKWA 1YKDA 4QJGA 1JVJA 1MWUA 2J3TC 4QU3A 5FAPA 4S2NA 1XJ2A 3PAGA 2X01A 4WEKA 4M3KA 5KZHA 3M6HA 4ZTKA 2A2LA 5FQMA 2J3TD 1ESUA 1JWVA 5I94A 1XA1A 1IELA 3BFEA 3VSKA 1JWPA 2WUQA 3KSIA 2HZ5A 5EM1A 2Z6CA 3SH7A 5FEFA 1TVFA 4P6ZM 3VP0A 4LPZA 1MC0A 4I3AA 3GMWA 1HD8A 4OPZA 3K3CA 4B93A 1VETA 2H5SA 4LRZE 1DP6A 1ACFA 5GLBA 3N8RA 1FIKA 1SDNA 4QB8A 4EV4A 4PM9A 2J9OA 3PBSA 3DWKA 2VV7A 2HJEA 3V3RA 4YNRA 4HJ4A 1PRQA 3LEZA 5HL6A 1JNUA 4A5RA 2HV1A 1P9RA 4KZAA 3SS4A 5FI2A 3BLMA 2B95A 1MKIA 5F82A 3TOIA 4E3IA 4E3OA 3MXQA 3JYIA 1V9YA 2B5RA 2O0YA 2XQZA 4Q0JA 3JPUA 5DF8A 5HX9A 2JKGA 2H0TA 2O9BA 5EVIA 4LENA 3WRZA 2ZQ7A 2EXBA 4GHIA 1XKZA 2V0UA 2KLIA 2J7VA 4IVIA 5HDSA 5FQKA 2RCXA 3SH9A 2HGVA 4HP9A 1BLCA 3IBJA 2P04A 3UB8A 2OWHA 5HWTA 5TFQA 5EM0A 2VGKA 4NXGA 1VEUA 3QNCA 2A24B 2WGWA 3A0VA 3BEBA 5C5KA 4E3JA 3C4OA 5GHYA 3VP4A 4GDNA 1KE3A 3B42A 1ODVA 4F3LB 1A0KA 3C4PA 3ZGAB 2Y2JA 1Y28A 3IX3A 5CX7A 3GTCA 1ERMA 1MPLA 4WM9A 3SS5A 1E4DA 2ZQDA 1OTAA 4FUWA 4HBTA 1PWGA 1VM1A 4WELA 3A3JA 3RTYA 4JLFA 4OPRA 3ITBA 2WGIA 5M19A 1DP8A 3HVFA 1NYYA 5DJTA 1L0EA 3JVVA 3OPHA 3OPLA 2IA2A 1HLUP 5IU1A 3LYXA 3F1NA 1BULA 3VOYA 3PHYA 5CTMA 2ZQ8A 1GCEA 4GKUA 5E2FA 3EWKA 4R4RA 4GS9B 3LI9A 4FTXA 3R4KA 4R4SA 3QHYA 3W2ZA 5FQIA 5A8BA 1N9LA 1EW0A 1P0ZA 2IWDA 3F1PA 4JKTA 3LIFA 1CQAA 2QYBA 3VE4A 2Z2LB 2P9VB 3F1OA 4QY6A 5DKLA 1KGFA 3KSGA 3P01A 1D7EA 3BJNA 2M7UA 3IF6B 1G6OA 2LB9A 1FQGA 1NY0A 3N6IA 3QNBA 2WGVA 1ES5A 2WAEA 4HIAA 3ZG5A 3O87A 1XA7A 5FDHA 1DRMA 4RVAA 4KQOA 4ARZB 2H10A 3WRTA 3MQOA 3SH8A 3TE8A 1D06A 5EUAA 2ZC6B 3NOUC 4PM8A 4DKIA 2ZMVA 3NOTC 5E2GA 3MSHA 1LHYA 1YT4A 2BG1A 3MMHA 5DFXA 2W3DA 4ZRRA 2ZMFA 4QWOA 2C6WB 5TR7A 1K25A 1LL9A 2E8IA 2V0WA 5AQ7A 2RL3A 4LRXC 1RCJA 1CK3A 2PD8A 3AGFA 4Z1WA 2PHYA 4KZ6A 1JTDA 4C75A 4H6JB 2Q9NA 1FR1A 1QMFA 1U60A 3LICA 1BLPA 3V3SA 3NECA 4KZ4A 5HZHA 5M1AA 3M2KA 3QP1A 3HLCA 3PBOA 5M18A 3VE3A 2ZC5B 4ZAMA 1K55C 2IWCA 2YKHA 4OLDA 3HJKA 4EERA 1KVLA 2E8JA 2VGLM 4GW9A 4S2JA 2QWSA 4K08A 2EX9A 1D1JA 4DRTA 3S7QA 4KQQA 1OJ5A 5FL3A 4EETB 2G2WA 2Y79A 3LGOA 4L9FA 5DKKA 5HWWA 2EFXA 1K6SA 4Q8IA 4KQRA 3DBAA 1ONHA 5HD3A 2A24A 5HW3A 4BL3A 1ESIA 4MCWA 1F98A 1V9ZA 1ZTUA 2EX2A 4F3LA 3T4QA 3IWOA 3G32A 2W3FA 2PYPA 5U47A 4WMCD 3MBZA 3CMZA 1K56D 5L8MA 5L10A 3TRCA 4C6YA 1I2SA 4BD1A 3PR6A 3MZDA 5A93A 1YSQA 3MFDA 1MY8A 3OOVA 2XLNA 3LIEA 3T1QB 5EV0A 3TJZC 2A49A 3IX8A 2V8FA 4EWFA 4QPRA 3A3DA 2WZZA 2G7UA 1NRFA 4Z9QA 4MMNA 2ZM2A 1S6RA 4WBGA 4BWIA 3UE3A 4CJNA 3HLGA 3WS1A 4R1GA 2JKTI 3ZNYA 4HJ6A 4EQ1A 4QHCA 3HUNA 2ZMAA 1IYPA 4LCMA 1ES4A 4HQAA 4UQIS 2I9VA 3L7HA 3GSGA 4GS9A 3GECA 1STZA 1WE4A 5EVLA 2VEAA 2HDRA 2QHKA 3EQUA 1S1YA 2W1TB 3HLDA 3MZEA 3NULA 4LLOB 3OPPA 5CTNA 5IS1A 4GNUA 4IJGA 5EVIC 5F68A 4KG2A 2VA0A 4N1HA 4S2OA 5EVID 1K0KA 4MBKA 3BY8A 3PTEA 2OOLA 3DWZA 1F2KA 3W8KA 3ZFZA 5FATA 2OSUA 4K91A 3K3DA 3T4KA 4KZ5A 2XR0A 2M1CA 3C2WA 4XUXA 1DJBA 4X6TA 4XUZA 5HPIA 5EOOA 4MN6A 4ZDXA 4O7DA 4S2IA 5EOEA 1GA0A 5HD5A 1OPXA 3IXHA 4ARZA 2NUPC 3PBNA 1FOFA 1XPBA 3GQZA 4DDYA 2CC1A 3HBRA 2DMWA 3E2KA 1XJ6A 1DJAA 2EXAA 4HHDA 5G18A 3HLBA 1ALQA 4NETA 2QJ7A 3IT9A 3BFCA 2Y2NA 3E2LA 3ZYTA 2XH9A 2ZL1B 5LBRA 3LEQA 3LCEA 2HP9A 3S7NA 5KIZA 1AXBA 2IWBA 2Q9MA 3LY3A 5EVEA 3DW0A 4H6JA 4DE3A 4BBTA 2Q0OA 3KYEA 3L9KA 4N9LA 3CJMA 3UDIA 2KOIA 1G6AA 2CMNA 2D02A 2PAVP 5CEDA 4JXVA 2PT7A 1IKGA 4QY5A 1IEMA 4WMCA 3UB5P 3NDEA 3Q82A 5EFWA 4XXRA 1K56A 2V20A 4IVKA 4CLCC 3T1SA 2GDNA 3QP4A 1EROA 3A0RA 2W0NA 3O88A 1KGEA 1JTGA 2OWJA 1W7FA 5JYOA 4DE1A 3H7WA 4CLCD 1HTZA 1BZAA 1H8YA 4BL2A 3FC7A 1YM1A 2VK3A 5CRFA 4EESA 3WS0A 2ZM8A 2PR6A 2H28A 2GX5A 3PBQA 5F5YA 2VX8A 5HAQA 4FCFA 4ZJ1A 2JKTM 4G3VA 5J8XA 3VOLA 1CI9A 2Y2GA 1KVMA 4U3TA 2O99A 3S22A 3D4FA 4KG5A 1FCMA 4D2OA 1S4RA
chains in the Genus database with same CATH topology
2Y2PA 1GHPA 4OQHA 2Y91A 4R4SA 3QHYA 3FZCA 4P6BA 2WKIA 3RXWA 3CZDA 3VOZA 5AQ9A 3RJUA 5FQIA 3PBRA 4IEDA 3N7WA 3OC2A 1PYYA 4GDBA 5HL1A 2ZJ9A 5GLCA 2VGJA 2XGNA 2IWDA 3G4PA 4JKTA 3AGEA 1E25A 5E43A 4F94A 2Z2LB 3G31A 3ITAA 2OLVA 2P9VB 4P0MA 1Z6FA 1GA9A 4QY6A 5F83A 4OKPA 4K0XA 4CPKA 4N9KA 1KGFA 3NBLA 4E6XA 3W4PA 4E3NA 2XEPA 2Y55A 3MKFA 4S2NC 2J8YA 1MWTA 5CHMA 2QMIA 4FSFA 2Y2OA 1YMSA 3IF6B 4LV0A 1XGJA 2PU2A 3VFFA 1FQGA 1NY0A 5DTKA 4EUZA 1FSYA 1FR6A 3N6IA 2JC7A 4GZBA 3QNBA 1N9BA 2WGVA 1ES5A 1GHMA 1MBLA 4K0WA 2DNSA 2WAEA 3NIAA 4NK3A 3LY4A 1FSWA 4UA9A 1IYOA 3A3FA 5D3OA 3ZG5A 5BOHA 2Y59A 4JF4A 1PIOA 3O87A 2OV5A 3A3EA 5FI6A 4JF5A 1XA7A 1BT5A 3G30A 2XFSA 5FDHA 1O07A 3WS2A 3C7VA 4RVAA 4BLMA 4KQOA 4GB7A 1MWRA 3WS4A 2H10A 1SKFA 2FFYA 3Q1FA 5AQAA 2XD5A 3IH9A 4P85A 3WRTA 5CHUA 3UPPA 3SH8A 1EI5A 1YLYA 5EUAA 2ZC6B 4PM8A 1J9MA 4IBRA 1W5DA 4JXSA 2JE5A 5EVIB 4DKIA 5E2GA 1BSGA 4RX3A 3ZNTA 1PI5A 1LHYA 1YT4A 5FAOA 2HPBA 3G2YA 4R3BA 2BG1A 4LV2A 5GHXA 1KE0A 3HLEA 4WYYA 4KZ9A 5FQJA 4PMAA 5HAIA 1XX2A 3HLFA 5TR7A 2C6WB 3ZVTA 1K25A 1LL9A 4N92A 1PZPA 2E8IA 3Q7ZA 3V50A 5AQ7A 1YLWA 1Q2PA 3NDGA 2RL3A 4MEZA 3UDFA 4UHUA 1RCJA 1CK3A 3IXGA 5EPHA 3UDXA 1H8ZA 1FCNA 3O3VA 5HFOA 1ZG4A 4E3MA 4OLGA 3WWXA 4Y0OA 3AGFA 5E2HA 5F1GA 3V39A 4KZ6A 2P74A 1ZKJA 4ZJ3A 3FYZA 4BJPA 1JTDA 1L2SA 1K57C 2G2UA 4JF6A 3S1YA 3HREA 5CHJA 4C75A 2XD1A 1LLBA 3HLWA 2Q9NA 5CGXA 4GD6A 3NCKA 1FR1A 1QMFA 3HUMA 4R0QA 4KG6A 4LCLA 4LV3A 4S2MA 2WYXA 4DE2A 1U60A 5JYPA 4U0TA 1BLPA 3V3SA 3ZG7B 1WYBA 3HUOA 4JBFA 1VQQA 1PW8A 1ZC2A 4KZ4A 3IHAA 1XP4A 4IBXA 5M1AA 3M2KA 3HLCA 4P87A 2XDMA 2EX6A 3PBOA 5DVAA 3BFFA 5M18A 1MXOA 2ZC5B 3NI9A 1YLJA 4ZAMA 3ZG0A 1K55C 2IWCA 3IXBA 5IHVA 1NXYA 2C5WB 2HDUA 2I72A 1PWDA 3UNWA 4KENB 4PPRA 1W8QA 3G2ZA 4OLDA 3NY4A 4X68A 1KVLA 3IQAA 5CERA 1C3BA 4MNRA 5GLAA 1IYQA 4S2JA 1HVBA 1TEMA 3IF5A 4OVDA 2DRWA 1BTLA 4WZ5A 5HARA 1ONGA 5A90A 3S4XA 2EX9A 3Q7VB 5GLDA 4DRTA 4WEJA 3SOIA 3V5MA 2JCHA 4KQQA 1RGZA 1XGIA 2WKEA 2XF3A 1L0GA 1EWZA 1NJ4A 1DY6A 4EQIA 3RXXA 2G2WA 3A3IA 2BLSA 3BRMA 5CGWA 1ZG6A 1K57A 2V2FF 1K38A 1K4EA 1YLTA 2EFXA 2WAFA 1K6SA 3DTMA 1E3UA 4X55A 4X56A 4Q8IA 4X53A 3OCLA 3UN7A 3CG5A 5KMWA 4KQRA 3BM6A 1PZOA 1K6RA 3IXDA 1ONHA 3ZCZA 4Y0UA 5HW3A 3ZG9B 4BL3A 1ESIA 1W79A 3LO7A 5E2EA 4RX2A 3C5AA 1K55A 3P98A 2R9XA 2EX2A 4UA6A 3VFHA 1CI8A 1I5QA 1NZUA 3IWOA 1M6KA 5CGSA 3G32A 4KZ3A 3SS3A 1QMEA 3UPNA 4E3LA 4HEFA 2QZ6A 3OCNA 5U47A 4WMCD 3UE1A 1KE4A 3MBZA 4X69A 5FAQA 1L0FA 4PM5A 4OPYA 3CMZA 2J9PA 5A92A 2ZC4B 3BFDA 3GV9A 4OP5A 1K56D 1PW1A 4FH2A 2Y2HA 3ZG8B 1BUEA 1H5XA 4U0XA 1W8YA 1JWZA 4LV1A 3UPOA 2ZC7A 4C6YA 1YQSA 1I2SA 4BD1A 4DDSA 3G35A 4JXWA 2EFUA 4WZ4A 4OOYA 4EBPA 3MZDA 5A93A 1K54C 4YINA 3MFDA 1DJCA 5FI7A 1MY8A 3VP1A 4EBNA 2XLNA 4L0LA 2QPNA 2A49A 3PAEA 3OPRA 4OQGA 3C7UA 3FKWA 4EWFA 2XFTA 3A3DA 1HZOA 1NYMA 3MXSA 4QJGA 2Y2KA 2OLUA 1JVJA 2WZZA 2ZQ9A 1CEFA 1MWUA 4QU3A 5FAPA 3ISGA 4S2NA 2X71A 3WS5A 2HDQA 3PAGA 4DF6A 1NRFA 2X01A 4KZ8A 3GVBA 4WEKA 3AGDA 3N8LA 4M3KA 5KZHA 1TDLA 3M6HA 4Z9QA 4ZTKA 5FQMA 2ZM2A 1S6RA 2Z2MB 4WBGA 3G34A 5GHZA 1ESUA 1JWVA 3BLSA 3UE3A 3IWIA 5I94A 1XA1A 1IELA 3BFEA 4CJNA 3VSKA 2ZM0A 3HLGA 1BLHA 1JWPA 2WUQA 2ZQCA 3FKVA 3WS1A 4R1GA 4PM6A 3ZNYA 5EE8A 2Y2MA 3IH8A 3SH7A 4QHCA 3HUNA 2ZMAA 3N8SA 1TVFA 1IYPA 2PBYA 4LCMA 3VP0A 1ES4A 4BD0A 2DCFA 4ZJ2A 4B4ZA 1PI4A 4DE0A 3GSGA 5CXWA 3GMWA 1HD8A 3FV7A 4OPZA 3Q81A 1M40A 4B4XA 1WE4A 5EVLA 1RP5A 3GR2A 2HDRA 5L2FA 2A3UA 5AQBA 3EQUA 1Q2QA 5A91A 2HP5A 4OONA 1K54A 4EBLA 3HLDA 3MZEA 3VMAA 3IWQA 2H5SA 3MZFA 3OPPA 1MWSA 3MKEA 5CTNA 5GLBA 4GNUA 4DXCA 1ERQA 5EVIC 3N8RA 4FD8A 1ES3A 4GOGA 3B3XA 3O86A 4YFMA 1SDNA 4QB8A 4KG2A 5KSHA 4S2OA 4N1HA 4EV4A 4PM9A 2J9OA 1SHVA 3PBSA 5EVID 3ZVWA 3DWKA 5KSCA 3W4QA 4OQ0A 3V3RA 4UA7A 1G68A 4MBKA 3Q07A 3LEZA 3PTEA 3MXRA 3DWZA 3TG9A 3W8KA 3ZFZA 5FATA 4E6WA 2OSUA 4K91A 1KDWA 1WYCA 1Y54A 4KZ5A 2XR0A 2R9WA 2ZC3B 4XUXA 4A5RA 1DJBA 5DTTA 4KZAA 1YLPA 3BFGA 3VSLA 4X6TA 3SS4A 1XXMA 5FI2A 3BLMA 4XUZA 4S2PA 1LI0A 5FASA 1MKIA 5EOOA 1CEGA 1NZOA 5DF7A 5F82A 3TOIA 2H0YA 4ZDXA 4O7DA 4S2IA 5EOEA 5F1FA 1GA0A 1YMXA 4KZ7A 4E3IA 3IXHA 1RGYA 5FSRA 4FH4A 3JYIA 4E3OA 1TDGA 3PBNA 2B5RA 1FOFA 1XPBA 2XQZA 3GQZA 4S2KA 5DF8A 4DDYA 2CC1A 5HX9A 3HBRA 1O7EA 2H0TA 3E2KA 2Y2IA 4C3QA 1DJAA 2V1ZA 2EXAA 5EVIA 4LENA 3WRZA 2ZQ7A 4B88A 4E3KA 2EXBA 4H8RA 5G18A 2WKHA 5EECA 1XKZA 3TSGA 3BYDA 3HLBA 1IKIA 1ALQA 1KDSA 2J7VA 4GN2A 4R3JA 3P09A 5GL9A 4NETA 4ZBEA 2WK0A 1N4OA 3IT9A 3BFCA 2Y2NA 1YLZA 3HL9A 4IVIA 1I2WA 4R23A 5FQKA 2RCXA 3UE0A 3SH9A 4KZBA 3UO9A 1BLCA 3E2LA 1OMEA 5FQ9A 2XH9A 5TFQA 1K4FA 2WZXA 4UAAA 1LL5A 2VGKA 4OOMA 4RA7A 3LCEA 3QNCA 4DXBA 2HP9A 2ZQAA 2WGWA 4RYEA 1AXBA 2IWBA 2Q9MA 3BEBA 3LY3A 2UWXA 3C4OA 3DW0A 4E3JA 5GHYA 4OH0A 4DE3A 4ID4A 3VP4A 4GDNA 2Y2LA 1KE3A 4N9LA 3CJMA 3UDIA 1G6AA 3C4PA 2HDSA 4N1XA 5DF9A 3ZGAB 3NC8A 5CEDA 4JXVA 3BECA 2PU4A 4JPMA 3VP2A 1IKGA 4QY5A 1IEMA 2Y2JA 4WMCA 4GD8A 4PM7A 2JBFA 3IF6C 1FCOA 3OZHA 3NDEA 3ZHHA 3Q82A 4XXRA 1K56A 3GTCA 1ERMA 1MPLA 2V20A 4IVKA 4WM9A 3SS5A 2GDNA 5FQQA 1EROA 1E4DA 2ZQDA 1ES2A 5FA7A 3O88A 4WZ5C 1KGEA 1JTGA 4OQIA 1W7FA 5JYOA 4HBTA 3VP3A 4DE1A 1KGGA 1PWGA 4OPQA 1HTZA 1BZAA 1H8YA 4BL2A 1VM1A 5DTSA 4HESA 4OOLA 3A3JA 4WELA 1YM1A 4JLFA 4BENA 4QD4A 4OPRA 5CRFA 3WS0A 2WGWB 2ZM8A 3Q7VA 1BLSA 3ITBA 2EX8A 2WGIA 5M19A 3ZDJA 2Y2QA 3HVFA 1L0DA 4HBUA 1NYYA 5CEBA 3I7JA 4MLLA 1PWCA 3FWLA 3PBQA 4MBFA 4S2LA 4Y7PA 5HAQA 1L0EA 3GRJA 4FCFA 3M6BA 4ZJ1A 4MBHA 1SCWA 5TGFA 5J8XA 2XK1A 2P9VA 1E3UD 3M2JA 1CI9A 2HP6A 4Y0TA 5HAPA 2Y2GA 3OPHA 3OPLA 1KVMA 4OP8A 3N4IA 3PBTA 4U3TA 3EQVA 1BULA 4JXGA 3VOYA 1IYSA 1S0WA 3IHBA 3S22A 1LI9A 5CTMA 2ZQ8A 1GCEA 2FFFB 2WADA 3D4FA 4KG5A 2ZLYA 2X02A 1FCMA 3IF6A 3W4OA 4BQMA 4D2OA 1SDEA 1GHIA 4GKUA 5E2FA 3UY6A 2Y4AA 2ZD8A 4R4RA 5CECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2P A;  1GHP A;  4OQH A;  2Y91 A;  4R4S A;  3QHY A;  3FZC A;  4P6B A;  2WKI A;  3RXW A;  3CZD A;  3VOZ A;  5AQ9 A;  3RJU A;  5FQI A;  3PBR A;  4IED A;  3N7W A;  3OC2 A;  1PYY A;  4GDB A;  5HL1 A;  2ZJ9 A;  5GLC A;  2VGJ A;  2XGN A;  2IWD A;  3G4P A;  4JKT A;  3AGE A;  1E25 A;  5E43 A;  4F94 A;  2Z2L B;  3G31 A;  3ITA A;  2OLV A;  2P9V B;  4P0M A;  1Z6F A;  1GA9 A;  4QY6 A;  5F83 A;  4OKP A;  4K0X A;  4CPK A;  4N9K A;  1KGF A;  3NBL A;  4E6X A;  3W4P A;  4E3N A;  2XEP A;  2Y55 A;  3MKF A;  4S2N C;  2J8Y A;  1MWT A;  5CHM A;  2QMI A;  4FSF A;  2Y2O A;  1YMS A;  3IF6 B;  4LV0 A;  1XGJ A;  2PU2 A;  3VFF A;  1FQG A;  1NY0 A;  5DTK A;  4EUZ A;  1FSY A;  1FR6 A;  3N6I A;  2JC7 A;  4GZB A;  3QNB A;  1N9B A;  2WGV A;  1ES5 A;  1GHM A;  1MBL A;  4K0W A;  2DNS A;  2WAE A;  3NIA A;  4NK3 A;  3LY4 A;  1FSW A;  4UA9 A;  1IYO A;  3A3F A;  5D3O A;  3ZG5 A;  5BOH A;  2Y59 A;  4JF4 A;  1PIO A;  3O87 A;  2OV5 A;  3A3E A;  5FI6 A;  4JF5 A;  1XA7 A;  1BT5 A;  3G30 A;  2XFS A;  5FDH A;  1O07 A;  3WS2 A;  3C7V A;  4RVA A;  4BLM A;  4KQO A;  4GB7 A;  1MWR A;  3WS4 A;  2H10 A;  1SKF A;  2FFY A;  3Q1F A;  5AQA A;  2XD5 A;  3IH9 A;  4P85 A;  3WRT A;  5CHU A;  3UPP A;  3SH8 A;  1EI5 A;  1YLY A;  5EUA A;  2ZC6 B;  4PM8 A;  1J9M A;  4IBR A;  1W5D A;  4JXS A;  2JE5 A;  5EVI B;  4DKI A;  5E2G A;  1BSG A;  4RX3 A;  3ZNT A;  1PI5 A;  1LHY A;  1YT4 A;  5FAO A;  2HPB A;  3G2Y A;  4R3B A;  2BG1 A;  4LV2 A;  5GHX A;  1KE0 A;  3HLE A;  4WYY A;  4KZ9 A;  5FQJ A;  4PMA A;  5HAI A;  1XX2 A;  3HLF A;  5TR7 A;  2C6W B;  3ZVT A;  1K25 A;  1LL9 A;  4N92 A;  1PZP A;  2E8I A;  3Q7Z A;  3V50 A;  5AQ7 A;  1YLW A;  1Q2P A;  3NDG A;  2RL3 A;  4MEZ A;  3UDF A;  4UHU A;  1RCJ A;  1CK3 A;  3IXG A;  5EPH A;  3UDX A;  1H8Z A;  1FCN A;  3O3V A;  5HFO A;  1ZG4 A;  4E3M A;  4OLG A;  3WWX A;  4Y0O A;  3AGF A;  5E2H A;  5F1G A;  3V39 A;  4KZ6 A;  2P74 A;  1ZKJ A;  4ZJ3 A;  3FYZ A;  4BJP A;  1JTD A;  1L2S A;  1K57 C;  2G2U A;  4JF6 A;  3S1Y A;  3HRE A;  5CHJ A;  4C75 A;  2XD1 A;  1LLB A;  3HLW A;  2Q9N A;  5CGX A;  4GD6 A;  3NCK A;  1FR1 A;  1QMF A;  3HUM A;  4R0Q A;  4KG6 A;  4LCL A;  4LV3 A;  4S2M A;  2WYX A;  4DE2 A;  1U60 A;  5JYP A;  4U0T A;  1BLP A;  3V3S A;  3ZG7 B;  1WYB A;  3HUO A;  4JBF A;  1VQQ A;  1PW8 A;  1ZC2 A;  4KZ4 A;  3IHA A;  1XP4 A;  4IBX A;  5M1A A;  3M2K A;  3HLC A;  4P87 A;  2XDM A;  2EX6 A;  3PBO A;  5DVA A;  3BFF A;  5M18 A;  1MXO A;  2ZC5 B;  3NI9 A;  1YLJ A;  4ZAM A;  3ZG0 A;  1K55 C;  2IWC A;  3IXB A;  5IHV A;  1NXY A;  2C5W B;  2HDU A;  2I72 A;  1PWD A;  3UNW A;  4KEN B;  4PPR A;  1W8Q A;  3G2Z A;  4OLD A;  3NY4 A;  4X68 A;  1KVL A;  3IQA A;  5CER A;  1C3B A;  4MNR A;  5GLA A;  1IYQ A;  4S2J A;  1HVB A;  1TEM A;  3IF5 A;  4OVD A;  2DRW A;  1BTL A;  4WZ5 A;  5HAR A;  1ONG A;  5A90 A;  3S4X A;  2EX9 A;  3Q7V B;  5GLD A;  4DRT A;  4WEJ A;  3SOI A;  3V5M A;  2JCH A;  4KQQ A;  1RGZ A;  1XGI A;  2WKE A;  2XF3 A;  1L0G A;  1EWZ A;  1NJ4 A;  1DY6 A;  4EQI A;  3RXX A;  2G2W A;  3A3I A;  2BLS A;  3BRM A;  5CGW A;  1ZG6 A;  1K57 A;  2V2F F;  1K38 A;  1K4E A;  1YLT A;  2EFX A;  2WAF A;  1K6S A;  3DTM A;  1E3U A;  4X55 A;  4X56 A;  4Q8I A;  4X53 A;  3OCL A;  3UN7 A;  3CG5 A;  5KMW A;  4KQR A;  3BM6 A;  1PZO A;  1K6R A;  3IXD A;  1ONH A;  3ZCZ A;  4Y0U A;  5HW3 A;  3ZG9 B;  4BL3 A;  1ESI A;  1W79 A;  3LO7 A;  5E2E A;  4RX2 A;  3C5A A;  1K55 A;  3P98 A;  2R9X A;  2EX2 A;  4UA6 A;  3VFH A;  1CI8 A;  1I5Q A;  1NZU A;  3IWO A;  1M6K A;  5CGS A;  3G32 A;  4KZ3 A;  3SS3 A;  1QME A;  3UPN A;  4E3L A;  4HEF A;  2QZ6 A;  3OCN A;  5U47 A;  4WMC D;  3UE1 A;  1KE4 A;  3MBZ A;  4X69 A;  5FAQ A;  1L0F A;  4PM5 A;  4OPY A;  3CMZ A;  2J9P A;  5A92 A;  2ZC4 B;  3BFD A;  3GV9 A;  4OP5 A;  1K56 D;  1PW1 A;  4FH2 A;  2Y2H A;  3ZG8 B;  1BUE A;  1H5X A;  4U0X A;  1W8Y A;  1JWZ A;  4LV1 A;  3UPO A;  2ZC7 A;  4C6Y A;  1YQS A;  1I2S A;  4BD1 A;  4DDS A;  3G35 A;  4JXW A;  2EFU A;  4WZ4 A;  4OOY A;  4EBP A;  3MZD A;  5A93 A;  1K54 C;  4YIN A;  3MFD A;  1DJC A;  5FI7 A;  1MY8 A;  3VP1 A;  4EBN A;  2XLN A;  4L0L A;  2QPN A;  2A49 A;  3PAE A;  3OPR A;  4OQG A;  3C7U A;  3FKW A;  4EWF A;  2XFT A;  3A3D A;  1HZO A;  1NYM A;  3MXS A;  4QJG A;  2Y2K A;  2OLU A;  1JVJ A;  2WZZ A;  2ZQ9 A;  1CEF A;  1MWU A;  4QU3 A;  5FAP A;  3ISG A;  4S2N A;  2X71 A;  3WS5 A;  2HDQ A;  3PAG A;  4DF6 A;  1NRF A;  2X01 A;  4KZ8 A;  3GVB A;  4WEK A;  3AGD A;  3N8L A;  4M3K A;  5KZH A;  1TDL A;  3M6H A;  4Z9Q A;  4ZTK A;  5FQM A;  2ZM2 A;  1S6R A;  2Z2M B;  4WBG A;  3G34 A;  5GHZ A;  1ESU A;  1JWV A;  3BLS A;  3UE3 A;  3IWI A;  5I94 A;  1XA1 A;  1IEL A;  3BFE A;  4CJN A;  3VSK A;  2ZM0 A;  3HLG A;  1BLH A;  1JWP A;  2WUQ A;  2ZQC A;  3FKV A;  3WS1 A;  4R1G A;  4PM6 A;  3ZNY A;  5EE8 A;  2Y2M A;  3IH8 A;  3SH7 A;  4QHC A;  3HUN A;  2ZMA A;  3N8S A;  1TVF A;  1IYP A;  2PBY A;  4LCM A;  3VP0 A;  1ES4 A;  4BD0 A;  2DCF A;  4ZJ2 A;  4B4Z A;  1PI4 A;  4DE0 A;  3GSG A;  5CXW A;  3GMW A;  1HD8 A;  3FV7 A;  4OPZ A;  3Q81 A;  1M40 A;  4B4X A;  1WE4 A;  5EVL A;  1RP5 A;  3GR2 A;  2HDR A;  5L2F A;  2A3U A;  5AQB A;  3EQU A;  1Q2Q A;  5A91 A;  2HP5 A;  4OON A;  1K54 A;  4EBL A;  3HLD A;  3MZE A;  3VMA A;  3IWQ A;  2H5S A;  3MZF A;  3OPP A;  1MWS A;  3MKE A;  5CTN A;  5GLB A;  4GNU A;  4DXC A;  1ERQ A;  5EVI C;  3N8R A;  4FD8 A;  1ES3 A;  4GOG A;  3B3X A;  3O86 A;  4YFM A;  1SDN A;  4QB8 A;  4KG2 A;  5KSH A;  4S2O A;  4N1H A;  4EV4 A;  4PM9 A;  2J9O A;  1SHV A;  3PBS A;  5EVI D;  3ZVW A;  3DWK A;  5KSC A;  3W4Q A;  4OQ0 A;  3V3R A;  4UA7 A;  1G68 A;  4MBK A;  3Q07 A;  3LEZ A;  3PTE A;  3MXR A;  3DWZ A;  3TG9 A;  3W8K A;  3ZFZ A;  5FAT A;  4E6W A;  2OSU A;  4K91 A;  1KDW A;  1WYC A;  1Y54 A;  4KZ5 A;  2XR0 A;  2R9W A;  2ZC3 B;  4XUX A;  4A5R A;  1DJB A;  5DTT A;  4KZA A;  1YLP A;  3BFG A;  3VSL A;  4X6T A;  3SS4 A;  1XXM A;  5FI2 A;  3BLM A;  4XUZ A;  4S2P A;  1LI0 A;  5FAS A;  1MKI A;  5EOO A;  1CEG A;  1NZO A;  5DF7 A;  5F82 A;  3TOI A;  2H0Y A;  4ZDX A;  4O7D A;  4S2I A;  5EOE A;  5F1F A;  1GA0 A;  1YMX A;  4KZ7 A;  4E3I A;  3IXH A;  1RGY A;  5FSR A;  4FH4 A;  3JYI A;  4E3O A;  1TDG A;  3PBN A;  2B5R A;  1FOF A;  1XPB A;  2XQZ A;  3GQZ A;  4S2K A;  5DF8 A;  4DDY A;  2CC1 A;  5HX9 A;  3HBR A;  1O7E A;  2H0T A;  3E2K A;  2Y2I A;  4C3Q A;  1DJA A;  2V1Z A;  2EXA A;  5EVI A;  4LEN A;  3WRZ A;  2ZQ7 A;  4B88 A;  4E3K A;  2EXB A;  4H8R A;  5G18 A;  2WKH A;  5EEC A;  1XKZ A;  3TSG A;  3BYD A;  3HLB A;  1IKI A;  1ALQ A;  1KDS A;  2J7V A;  4GN2 A;  4R3J A;  3P09 A;  5GL9 A;  4NET A;  4ZBE A;  2WK0 A;  1N4O A;  3IT9 A;  3BFC A;  2Y2N A;  1YLZ A;  3HL9 A;  4IVI A;  1I2W A;  4R23 A;  5FQK A;  2RCX A;  3UE0 A;  3SH9 A;  4KZB A;  3UO9 A;  1BLC A;  3E2L A;  1OME A;  5FQ9 A;  2XH9 A;  5TFQ A;  1K4F A;  2WZX A;  4UAA A;  1LL5 A;  2VGK A;  4OOM A;  4RA7 A;  3LCE A;  3QNC A;  4DXB A;  2HP9 A;  2ZQA A;  2WGW A;  4RYE A;  1AXB A;  2IWB A;  2Q9M A;  3BEB A;  3LY3 A;  2UWX A;  3C4O A;  3DW0 A;  4E3J A;  5GHY A;  4OH0 A;  4DE3 A;  4ID4 A;  3VP4 A;  4GDN A;  2Y2L A;  1KE3 A;  4N9L A;  3CJM A;  3UDI A;  1G6A A;  3C4P A;  2HDS A;  4N1X A;  5DF9 A;  3ZGA B;  3NC8 A;  5CED A;  4JXV A;  3BEC A;  2PU4 A;  4JPM A;  3VP2 A;  1IKG A;  4QY5 A;  1IEM A;  2Y2J A;  4WMC A;  4GD8 A;  4PM7 A;  2JBF A;  3IF6 C;  1FCO A;  3OZH A;  3NDE A;  3ZHH A;  3Q82 A;  4XXR A;  1K56 A;  3GTC A;  1ERM A;  1MPL A;  2V20 A;  4IVK A;  4WM9 A;  3SS5 A;  2GDN A;  5FQQ A;  1ERO A;  1E4D A;  2ZQD A;  1ES2 A;  5FA7 A;  3O88 A;  4WZ5 C;  1KGE A;  1JTG A;  4OQI A;  1W7F A;  5JYO A;  4HBT A;  3VP3 A;  4DE1 A;  1KGG A;  1PWG A;  4OPQ A;  1HTZ A;  1BZA A;  1H8Y A;  4BL2 A;  1VM1 A;  5DTS A;  4HES A;  4OOL A;  3A3J A;  4WEL A;  1YM1 A;  4JLF A;  4BEN A;  4QD4 A;  4OPR A;  5CRF A;  3WS0 A;  2WGW B;  2ZM8 A;  3Q7V A;  1BLS A;  3ITB A;  2EX8 A;  2WGI A;  5M19 A;  3ZDJ A;  2Y2Q A;  3HVF A;  1L0D A;  4HBU A;  1NYY A;  5CEB A;  3I7J A;  4MLL A;  1PWC A;  3FWL A;  3PBQ A;  4MBF A;  4S2L A;  4Y7P A;  5HAQ A;  1L0E A;  3GRJ A;  4FCF A;  3M6B A;  4ZJ1 A;  4MBH A;  1SCW A;  5TGF A;  5J8X A;  2XK1 A;  2P9V A;  1E3U D;  3M2J A;  1CI9 A;  2HP6 A;  4Y0T A;  5HAP A;  2Y2G A;  3OPH A;  3OPL A;  1KVM A;  4OP8 A;  3N4I A;  3PBT A;  4U3T A;  3EQV A;  1BUL A;  4JXG A;  3VOY A;  1IYS A;  1S0W A;  3IHB A;  3S22 A;  1LI9 A;  5CTM A;  2ZQ8 A;  1GCE A;  2FFF B;  2WAD A;  3D4F A;  4KG5 A;  2ZLY A;  2X02 A;  1FCM A;  3IF6 A;  3W4O A;  4BQM A;  4D2O A;  1SDE A;  1GHI A;  4GKU A;  5E2F A;  3UY6 A;  2Y4A A;  2ZD8 A;  4R4R A;  5CEC A; 
#chains in the Genus database with same CATH topology
 1GHP A;  3NJA A;  1UWN X;  1AWI A;  4P6B A;  1Z09 A;  5AQ9 A;  4IED A;  3OC2 A;  4GDB A;  2ZJ9 A;  3G4P A;  3T50 A;  1E25 A;  2EWV A;  2BTF P;  4WL9 A;  3C38 A;  4OKP A;  3QP5 A;  4CPK A;  4E6X A;  3W4P A;  2Y55 A;  2QMI A;  4FSF A;  1YMS A;  5J7E A;  3BQ8 A;  5L09 A;  1F9I A;  2PU2 A;  5DTK A;  4YWZ A;  1N9B A;  1MBL A;  4BBU A;  1FIL A;  2DNS A;  4E04 A;  4UA9 A;  1IYO A;  3E4P A;  1CF0 A;  2OV5 A;  2JKR M;  3LFV A;  5FI6 A;  2QJ5 A;  1BT5 A;  1TF1 A;  3QP2 A;  5HWV A;  2J80 A;  2W3E A;  3WS4 A;  1SKF A;  2XD5 A;  5CHU A;  1EI5 A;  1P9W A;  3O5Y A;  4IBR A;  1W5D A;  4JXS A;  3BW6 A;  2JE5 A;  4WN5 A;  4WLA A;  4RX3 A;  1PI5 A;  3TW8 A;  4R3B A;  4EEU A;  4GJ4 A;  2W1T A;  4KZ9 A;  4PMA A;  5HAI A;  2FZ0 A;  4N92 A;  1PZP A;  4Q0H A;  1H8Z A;  1ZG4 A;  2VKS A;  4PHT A;  1H8M A;  5E2H A;  3S7P A;  4ZJ3 A;  4BJP A;  3S1Y A;  4Y13 A;  2W3H A;  2XD1 A;  3HLW A;  4O0P A;  3UMD A;  2V8C A;  4D60 A;  3ZG7 B;  4XT2 B;  1ZC2 A;  3ZQ5 A;  1XP4 A;  2KDK A;  4P87 A;  2XDM A;  4L9G A;  1MXO A;  3DAV A;  1NXY A;  3UME A;  2ZOI A;  3UNW A;  4KEN B;  1W8Q A;  3G2Z A;  4HH2 A;  3A0S A;  1IOU A;  3MF0 A;  1BYW A;  3IQA A;  3BWL A;  5GLA A;  4CLC A;  3T4S A;  1HVB A;  1L3L A;  5HAR A;  1ONG A;  3Q7V B;  3SOI A;  2WKE A;  2KX6 A;  1L0G A;  3QP6 A;  4X25 A;  2BLS A;  1K38 A;  4AFI A;  3DTM A;  3KSF A;  4X56 A;  4X53 A;  1Y4O A;  3UN7 A;  3LR4 A;  1OTI A;  2W27 A;  2ZL1 A;  3LI8 A;  4PKY A;  4KUK A;  1K6R A;  3HCY A;  3IXD A;  3GDI A;  1S67 L;  1W79 A;  5E2E A;  3C5A A;  5AVF A;  1CI8 A;  1M6K A;  5IT5 A;  4KZ3 A;  3SS3 A;  4E3L A;  2P08 A;  5FAQ A;  2J9P A;  2ZC4 B;  3BY9 A;  3GV9 A;  4UQI M;  2Y2H A;  4Q0I A;  1W8Y A;  2O9C A;  3MQ0 A;  1YQS A;  1VB6 A;  4DDS A;  4WZ4 A;  5FI7 A;  1H0M A;  2YKF A;  3OPR A;  1H3Q A;  1HZO A;  1NYM A;  2OLU A;  3SW1 A;  3B33 A;  3IX4 A;  3ISG A;  2X71 A;  3WS5 A;  2HDQ A;  3C30 A;  4DF6 A;  4KZ8 A;  3GVB A;  3N8L A;  1TDL A;  3H9W A;  3G34 A;  5GHZ A;  3BLS A;  5DJU A;  2ZM0 A;  5TBM B;  2ZQC A;  2W1R A;  3FKV A;  1S1Z A;  4R70 A;  5EE8 A;  3IH8 A;  2DCF A;  2VV6 A;  4ZJ2 A;  4DE0 A;  3ICY A;  3LIA A;  3FV7 A;  3Q81 A;  1OTB A;  1M40 A;  4B4X A;  3GR2 A;  5L2F A;  5AQB A;  3LR5 A;  4OON A;  4L9E A;  3LR3 A;  3VMA A;  3G6O A;  3MZF A;  2Y8H A;  3MKE A;  1ERQ A;  1ES3 A;  4GOG A;  3B3X A;  5KSH A;  2K2N A;  3HJI A;  4O8G A;  3VV4 A;  3ZVW A;  5KSC A;  3MXR A;  3TG9 A;  1KDW A;  3B47 A;  2O9A A;  2ZC3 B;  4BBV A;  2B02 A;  5DTT A;  1YLP A;  3BFG A;  1XFN A;  1NWZ A;  1XXM A;  4S2P A;  1LI0 A;  1NZO A;  1ZHH B;  3PYP A;  2H0Y A;  2V1B A;  4HI4 A;  5F1F A;  1YMX A;  5FSR A;  2UV0 E;  4S2K A;  1O7E A;  2Y2I A;  4C3Q A;  2V1Z A;  1TS6 A;  1LT0 A;  2QKP A;  2JHE A;  4H8R A;  1SZV A;  2WKH A;  5EEC A;  3TSG A;  5DFY A;  5GL9 A;  4R3J A;  4GN2 A;  1YSP A;  1N4O A;  4IUH A;  1YLZ A;  1I2W A;  3UE0 A;  2K31 A;  1PNE A;  2GNX A;  1OME A;  1OJG A;  2NUT C;  2WZX A;  4KQD A;  4OOM A;  4RA7 A;  4HH3 A;  4DXB A;  1W63 M;  2ZQA A;  4RYE A;  3RH8 B;  2K7S A;  2UWX A;  3DTK A;  5J4E A;  5AVE A;  2Y2L A;  4N1X A;  4ETX A;  3NC8 A;  1YPR A;  3BEC A;  2PU4 A;  4JPM A;  3VP2 A;  1XFQ A;  4GD8 A;  4GHI B;  4Y3I A;  1FCO A;  3OZH A;  1DP9 A;  3ZHH A;  2P7J A;  2PRF A;  3CIT A;  5HDC A;  2GZA A;  1ES2 A;  3EGX C;  4WZ5 C;  4DMZ A;  4OQI A;  3VP3 A;  5DTS A;  1VEU B;  4BEN A;  4R38 A;  1OT9 A;  2WGW B;  2XA7 S;  3Q7V A;  1BLS A;  3ZDJ A;  1L0D A;  3I7J A;  3FWL A;  4MBF A;  4S2L A;  2Z6D A;  4Y7P A;  3GRJ A;  3M6B A;  4MBH A;  4YOF A;  1SCW A;  2P9V A;  1MZU A;  3M2J A;  4Y0T A;  5HAP A;  4OP8 A;  3N4I A;  1T19 A;  3LR0 A;  1NLY A;  3NOP C;  3EQV A;  1IYS A;  1S0W A;  4X1M A;  2WAD A;  2EA9 A;  2ZLY A;  2X02 A;  3IF6 A;  3W4O A;  4BQM A;  4Y2F A;  1SDE A;  1GHI A;  3UY6 A;  2Y4A A;  4M4X A;  2ZD8 A;  3MR0 A;  1OT6 A;  2Y2P A;  3FZC A;  3CZD A;  2XRN A;  3VOZ A;  3RJU A;  1N9O A;  3PBR A;  1PYY A;  2VGJ A;  2XGN A;  5FEG A;  2JKR I;  4UEY A;  5HPF A;  3ITA A;  4P0M A;  3NBL A;  2VLG A;  2XEP A;  3MKF A;  4EUV A;  1MWT A;  5CHM A;  1X0O A;  3PXP A;  4LV0 A;  4NEE D;  4GZB A;  4I3J A;  4K0W A;  4I3I A;  3NIA A;  4NK3 A;  4HP4 A;  5D3O A;  4JF4 A;  1IFQ A;  1PIO A;  4R3A A;  4JF5 A;  4II7 A;  3WS2 A;  3F1P B;  4BLM A;  3Q1F A;  3UPP A;  1YLY A;  1LSX A;  4WUJ A;  1J9M A;  2HJ9 C;  1OTE A;  2VV8 A;  5K5B A;  3ZNT A;  2JN7 A;  4Y5F A;  2HPB A;  3CWF A;  4LV2 A;  5GHX A;  1KE0 A;  2D01 A;  1VHM A;  3HLF A;  3V50 A;  1YLW A;  4ME4 A;  1Q2P A;  4MEZ A;  4UHU A;  5HFO A;  4OLG A;  4IHQ A;  5F1G A;  2ZOH A;  2P74 A;  1ZKJ A;  2EWW A;  4JF6 A;  2G2U A;  5JYP A;  5CGX A;  4GD6 A;  3HUM A;  3IS2 B;  4LRY C;  4KG6 A;  4S2M A;  2BAS A;  1GSV A;  2HF6 A;  2OAQ 1;  1WYB A;  1UWP X;  1PW8 A;  2OAP 1;  3IHA A;  4IBX A;  1G5U A;  2EX6 A;  3BFF A;  3NI9 A;  1WA9 A;  3MQQ A;  5IHV A;  2C5W B;  2HDU A;  2I72 A;  1PWD A;  3NY4 A;  5AJG A;  5F6A A;  1P97 A;  1LL8 A;  4MNR A;  1IYQ A;  2L1M A;  3IF5 A;  4OVD A;  2DRW A;  4WZ5 A;  5A90 A;  5GLD A;  4MN5 A;  1DY6 A;  3U2A A;  3A3I A;  1UGU A;  1ZG6 A;  1K57 A;  2V2F F;  3KO6 A;  4MN7 A;  1K4E A;  1YLT A;  2WAF A;  4X55 A;  3OCL A;  5HDD A;  5KMW A;  5FDS A;  1PZO A;  1XJ3 A;  4Y0U A;  3LO7 A;  2PYR A;  3DTI A;  1G28 A;  3T4T A;  4RX2 A;  3VFH A;  1I5Q A;  5CGS A;  1QME A;  2QZ6 A;  2W3G A;  1N9N A;  4BMW A;  1KE4 A;  4PM5 A;  4OPY A;  3KYZ A;  3BFD A;  1PW1 A;  3ZG8 B;  4JGQ A;  3EOI A;  5F69 A;  3CHW P;  4NG2 A;  4CQH A;  1T1B A;  2ZC7 A;  1CJF A;  3G35 A;  4JXW A;  4EBP A;  4YIN A;  1DJC A;  2QPN A;  3CPT B;  3PAE A;  4OQG A;  1TS0 A;  2XFT A;  3MXS A;  2Y2K A;  2ZQ9 A;  1CEF A;  4GCZ A;  3LIB A;  4I38 A;  3AGD A;  3H82 B;  2Z2M B;  3IWI A;  3T1X A;  1BLH A;  2L0W A;  4PM6 A;  3CLO A;  2Y2M A;  3N8S A;  1J3W A;  2PBY A;  3FPW A;  4BD0 A;  4B4Z A;  1PI4 A;  1TS7 A;  5CXW A;  2MJ6 A;  3UB7 A;  1RP5 A;  2L4R A;  2A3U A;  5A91 A;  1Q2Q A;  2FH5 A;  2HP5 A;  4DJ3 A;  1K54 A;  4EBL A;  3T1R A;  4CLC E;  3IWQ A;  1MWS A;  4DXC A;  4NKP A;  2XRO A;  1TD5 A;  4NXF A;  5I5L A;  4FD8 A;  3O86 A;  4YFM A;  3D9Y A;  4JGP A;  3DTE A;  1SHV A;  3W4Q A;  4OQ0 A;  4UA7 A;  2PD7 A;  1G68 A;  1KOU A;  5L07 A;  3Q07 A;  1NLZ A;  4E6W A;  1WYC A;  2R78 A;  1Y54 A;  2R9W A;  3R7W B;  1XJ4 A;  3VSL A;  4P6Z S;  5FAS A;  1CEG A;  1W63 Q;  5DF7 A;  4IUK A;  3KSH A;  1PFL A;  4KZ7 A;  3UE6 A;  1RGY A;  4FH4 A;  1TDG A;  4LFU A;  4Y15 A;  3EEA A;  4B88 A;  4E3K A;  2INW A;  3BYD A;  4FOF A;  1IKI A;  1KDS A;  3P09 A;  4EW7 A;  4ZBE A;  2WK0 A;  3E4O A;  3CUE C;  1T1C A;  3HL9 A;  4R23 A;  4ETZ A;  4G3K A;  2PDR A;  2WKQ A;  1GSW A;  4KZB A;  3UB6 A;  3UO9 A;  2XA7 M;  5FQ9 A;  4PKY G;  1K4F A;  2V9A A;  4UAA A;  1LL5 A;  4EU0 A;  3OLO A;  4NXE A;  1F5M A;  3NHQ A;  4JGO A;  4B9O A;  4OH0 A;  4ID4 A;  3IS2 A;  1LSV A;  3MS6 A;  3RFB A;  2HDS A;  5DF9 A;  2XSS A;  4PM7 A;  2JBF A;  3IF6 C;  4LGW A;  1S4S A;  1T1A A;  5FQQ A;  3E4Q A;  4DN0 A;  5FA7 A;  3U4L P;  1KGG A;  4OPQ A;  3V67 A;  1SKO B;  4HES A;  4OOL A;  4QD4 A;  1NRJ A;  2EX8 A;  5G4Z A;  2Y2Q A;  4HBU A;  5CEB A;  4HOI A;  4MLL A;  1PWC A;  3CAX A;  1LSW A;  3KX0 X;  4NXB A;  4KUO A;  4R6L A;  5TGF A;  2XK1 A;  1E3U D;  1GSX A;  2HP6 A;  1MKM A;  5J3W A;  4GLQ A;  3BQA A;  3EGD C;  3PBT A;  4JXG A;  4DJ2 A;  3IHB A;  1LI9 A;  2FFF B;  1TS8 A;  3C8C A;  3H7W B;  5CEC A;  4OQH A;  2Y91 A;  2WKI A;  3RXW A;  3N7W A;  1VET B;  5HL1 A;  3LUQ A;  5GLC A;  2WKP A;  3AGE A;  3OBF A;  3T12 B;  5E43 A;  4F94 A;  3G31 A;  2OLV A;  1Z6F A;  1GA9 A;  5F83 A;  4K0X A;  4N9K A;  4E3N A;  4S2N C;  2J8Y A;  2Y2O A;  3CPT A;  3T4J A;  1XGJ A;  1YAX A;  3VFF A;  4EUZ A;  1FSY A;  1FR6 A;  2JC7 A;  3MJQ A;  1GHM A;  3FPV A;  3LY4 A;  1FSW A;  3A3F A;  5BOH A;  3H82 A;  2Y59 A;  1S66 L;  3A3E A;  3D72 A;  3G30 A;  2XFS A;  1O07 A;  4O01 A;  2VJW A;  3C7V A;  4HNB A;  4GB7 A;  1MWR A;  5AQA A;  2FFY A;  3QP8 A;  3IH9 A;  4P85 A;  4HJ3 A;  5HSQ A;  2V1A A;  5TJJ A;  1T18 A;  5EVI B;  4XT2 A;  1BSG A;  5FAO A;  3E98 A;  3G2Y A;  3ULF A;  3HLE A;  4WYY A;  5FQJ A;  1XX2 A;  3ZVT A;  4EXO A;  2M7V A;  2B18 A;  3Q7Z A;  4WF0 A;  3JVU A;  4X1L A;  3NDG A;  3UDF A;  3CUE A;  3IXG A;  5EPH A;  3UDX A;  3O3V A;  1FCN A;  4HY8 A;  4E3M A;  3WWX A;  3KYQ A;  4Y0O A;  3P7N A;  3D3O A;  3V39 A;  3FYZ A;  1L2S A;  1K57 C;  2J3W A;  3HRE A;  5CHJ A;  1LLB A;  3NCK A;  4I5S A;  4LCL A;  4R0Q A;  4LV3 A;  2WYX A;  4DE2 A;  4ESP A;  4U0T A;  3R7W A;  3MFX A;  2PBD P;  3HUO A;  4JBF A;  1VQQ A;  3EEH A;  5DVA A;  3K2N A;  1YLJ A;  3ZG0 A;  4G3W A;  3IXB A;  2ACG A;  4PPR A;  4X68 A;  5CER A;  1C3B A;  2VZW A;  1TEM A;  3LID A;  1BTL A;  4RQ9 A;  3S4X A;  3CI6 A;  4WEJ A;  3V5M A;  2JCH A;  1RGZ A;  1XGI A;  2XF3 A;  1EWZ A;  1NJ4 A;  2JKF A;  4EQI A;  3RXX A;  3T4O A;  4JGR A;  3BRM A;  5CGW A;  3S7O A;  1E3U A;  5MC7 A;  2WKR A;  3CG5 A;  3F1N B;  3BM6 A;  3ZCZ A;  3ZG9 B;  2GJ3 A;  1K55 A;  3FG8 A;  3P98 A;  2R9X A;  4CLC B;  3E0Y A;  5G4Y A;  4UA6 A;  2LB5 A;  1NZU A;  3SZT A;  3UPN A;  4PAU A;  4HEF A;  3OCN A;  3UB9 A;  2VGL S;  3UE1 A;  4X69 A;  1L0F A;  5A92 A;  4Y17 A;  5TBM A;  4OP5 A;  4FH2 A;  1OTD A;  1BUE A;  3T4L A;  1H5X A;  4U0X A;  2PR5 A;  1JWZ A;  4LV1 A;  4MDZ A;  3UPO A;  3F1O B;  2AVX A;  2EFU A;  4I39 A;  4OOY A;  1K54 C;  2ZBB A;  1SKO A;  3VP1 A;  4EBN A;  4L0L A;  4EEP A;  3IBR A;  3C7U A;  3FKW A;  1YKD A;  4QJG A;  1JVJ A;  1MWU A;  2J3T C;  4QU3 A;  5FAP A;  4S2N A;  1XJ2 A;  3PAG A;  2X01 A;  4WEK A;  4M3K A;  5KZH A;  3M6H A;  4ZTK A;  2A2L A;  5FQM A;  2J3T D;  1ESU A;  1JWV A;  5I94 A;  1XA1 A;  1IEL A;  3BFE A;  3VSK A;  1JWP A;  2WUQ A;  3KSI A;  2HZ5 A;  5EM1 A;  2Z6C A;  3SH7 A;  5FEF A;  1TVF A;  4P6Z M;  3VP0 A;  4LPZ A;  1MC0 A;  4I3A A;  3GMW A;  1HD8 A;  4OPZ A;  3K3C A;  4B93 A;  1VET A;  2H5S A;  4LRZ E;  1DP6 A;  1ACF A;  5GLB A;  3N8R A;  1FIK A;  1SDN A;  4QB8 A;  4EV4 A;  4PM9 A;  2J9O A;  3PBS A;  3DWK A;  2VV7 A;  2HJE A;  3V3R A;  4YNR A;  4HJ4 A;  1PRQ A;  3LEZ A;  5HL6 A;  1JNU A;  4A5R A;  2HV1 A;  1P9R A;  4KZA A;  3SS4 A;  5FI2 A;  3BLM A;  2B95 A;  1MKI A;  5F82 A;  3TOI A;  4E3I A;  4E3O A;  3MXQ A;  3JYI A;  1V9Y A;  2B5R A;  2O0Y A;  2XQZ A;  4Q0J A;  3JPU A;  5DF8 A;  5HX9 A;  2JKG A;  2H0T A;  2O9B A;  5EVI A;  4LEN A;  3WRZ A;  2ZQ7 A;  2EXB A;  4GHI A;  1XKZ A;  2V0U A;  2KLI A;  2J7V A;  4IVI A;  5HDS A;  5FQK A;  2RCX A;  3SH9 A;  2HGV A;  4HP9 A;  1BLC A;  3IBJ A;  2P04 A;  3UB8 A;  2OWH A;  5HWT A;  5TFQ A;  5EM0 A;  2VGK A;  4NXG A;  1VEU A;  3QNC A;  2A24 B;  2WGW A;  3A0V A;  3BEB A;  5C5K A;  4E3J A;  3C4O A;  5GHY A;  3VP4 A;  4GDN A;  1KE3 A;  3B42 A;  1ODV A;  4F3L B;  1A0K A;  3C4P A;  3ZGA B;  2Y2J A;  1Y28 A;  3IX3 A;  5CX7 A;  3GTC A;  1ERM A;  1MPL A;  4WM9 A;  3SS5 A;  1E4D A;  2ZQD A;  1OTA A;  4FUW A;  4HBT A;  1PWG A;  1VM1 A;  4WEL A;  3A3J A;  3RTY A;  4JLF A;  4OPR A;  3ITB A;  2WGI A;  5M19 A;  1DP8 A;  3HVF A;  1NYY A;  5DJT A;  1L0E A;  3JVV A;  3OPH A;  3OPL A;  2IA2 A;  1HLU P;  5IU1 A;  3LYX A;  3F1N A;  1BUL A;  3VOY A;  3PHY A;  5CTM A;  2ZQ8 A;  1GCE A;  4GKU A;  5E2F A;  3EWK A;  4R4R A;  4GS9 B;  3LI9 A;  4FTX A;  3R4K A;  4R4S A;  3QHY A;  3W2Z A;  5FQI A;  5A8B A;  1N9L A;  1EW0 A;  1P0Z A;  2IWD A;  3F1P A;  4JKT A;  3LIF A;  1CQA A;  2QYB A;  3VE4 A;  2Z2L B;  2P9V B;  3F1O A;  4QY6 A;  5DKL A;  1KGF A;  3KSG A;  3P01 A;  1D7E A;  3BJN A;  2M7U A;  3IF6 B;  1G6O A;  2LB9 A;  1FQG A;  1NY0 A;  3N6I A;  3QNB A;  2WGV A;  1ES5 A;  2WAE A;  4HIA A;  3ZG5 A;  3O87 A;  1XA7 A;  5FDH A;  1DRM A;  4RVA A;  4KQO A;  4ARZ B;  2H10 A;  3WRT A;  3MQO A;  3SH8 A;  3TE8 A;  1D06 A;  5EUA A;  2ZC6 B;  3NOU C;  4PM8 A;  4DKI A;  2ZMV A;  3NOT C;  5E2G A;  3MSH A;  1LHY A;  1YT4 A;  2BG1 A;  3MMH A;  5DFX A;  2W3D A;  4ZRR A;  2ZMF A;  4QWO A;  2C6W B;  5TR7 A;  1K25 A;  1LL9 A;  2E8I A;  2V0W A;  5AQ7 A;  2RL3 A;  4LRX C;  1RCJ A;  1CK3 A;  2PD8 A;  3AGF A;  4Z1W A;  2PHY A;  4KZ6 A;  1JTD A;  4C75 A;  4H6J B;  2Q9N A;  1FR1 A;  1QMF A;  1U60 A;  3LIC A;  1BLP A;  3V3S A;  3NEC A;  4KZ4 A;  5HZH A;  5M1A A;  3M2K A;  3QP1 A;  3HLC A;  3PBO A;  5M18 A;  3VE3 A;  2ZC5 B;  4ZAM A;  1K55 C;  2IWC A;  2YKH A;  4OLD A;  3HJK A;  4EER A;  1KVL A;  2E8J A;  2VGL M;  4GW9 A;  4S2J A;  2QWS A;  4K08 A;  2EX9 A;  1D1J A;  4DRT A;  3S7Q A;  4KQQ A;  1OJ5 A;  5FL3 A;  4EET B;  2G2W A;  2Y79 A;  3LGO A;  4L9F A;  5DKK A;  5HWW A;  2EFX A;  1K6S A;  4Q8I A;  4KQR A;  3DBA A;  1ONH A;  5HD3 A;  2A24 A;  5HW3 A;  4BL3 A;  1ESI A;  4MCW A;  1F98 A;  1V9Z A;  1ZTU A;  2EX2 A;  4F3L A;  3T4Q A;  3IWO A;  3G32 A;  2W3F A;  2PYP A;  5U47 A;  4WMC D;  3MBZ A;  3CMZ A;  1K56 D;  5L8M A;  5L10 A;  3TRC A;  4C6Y A;  1I2S A;  4BD1 A;  3PR6 A;  3MZD A;  5A93 A;  1YSQ A;  3MFD A;  1MY8 A;  3OOV A;  2XLN A;  3LIE A;  3T1Q B;  5EV0 A;  3TJZ C;  2A49 A;  3IX8 A;  2V8F A;  4EWF A;  4QPR A;  3A3D A;  2WZZ A;  2G7U A;  1NRF A;  4Z9Q A;  4MMN A;  2ZM2 A;  1S6R A;  4WBG A;  4BWI A;  3UE3 A;  4CJN A;  3HLG A;  3WS1 A;  4R1G A;  2JKT I;  3ZNY A;  4HJ6 A;  4EQ1 A;  4QHC A;  3HUN A;  2ZMA A;  1IYP A;  4LCM A;  1ES4 A;  4HQA A;  4UQI S;  2I9V A;  3L7H A;  3GSG A;  4GS9 A;  3GEC A;  1STZ A;  1WE4 A;  5EVL A;  2VEA A;  2HDR A;  2QHK A;  3EQU A;  1S1Y A;  2W1T B;  3HLD A;  3MZE A;  3NUL A;  4LLO B;  3OPP A;  5CTN A;  5IS1 A;  4GNU A;  4IJG A;  5EVI C;  5F68 A;  4KG2 A;  2VA0 A;  4N1H A;  4S2O A;  5EVI D;  1K0K A;  4MBK A;  3BY8 A;  3PTE A;  2OOL A;  3DWZ A;  1F2K A;  3W8K A;  3ZFZ A;  5FAT A;  2OSU A;  4K91 A;  3K3D A;  3T4K A;  4KZ5 A;  2XR0 A;  2M1C A;  3C2W A;  4XUX A;  1DJB A;  4X6T A;  4XUZ A;  5HPI A;  5EOO A;  4MN6 A;  4ZDX A;  4O7D A;  4S2I A;  5EOE A;  1GA0 A;  5HD5 A;  1OPX A;  3IXH A;  4ARZ A;  2NUP C;  3PBN A;  1FOF A;  1XPB A;  3GQZ A;  4DDY A;  2CC1 A;  3HBR A;  2DMW A;  3E2K A;  1XJ6 A;  1DJA A;  2EXA A;  4HHD A;  5G18 A;  3HLB A;  1ALQ A;  4NET A;  2QJ7 A;  3IT9 A;  3BFC A;  2Y2N A;  3E2L A;  3ZYT A;  2XH9 A;  2ZL1 B;  5LBR A;  3LEQ A;  3LCE A;  2HP9 A;  3S7N A;  5KIZ A;  1AXB A;  2IWB A;  2Q9M A;  3LY3 A;  5EVE A;  3DW0 A;  4H6J A;  4DE3 A;  4BBT A;  2Q0O A;  3KYE A;  3L9K A;  4N9L A;  3CJM A;  3UDI A;  2KOI A;  1G6A A;  2CMN A;  2D02 A;  2PAV P;  5CED A;  4JXV A;  2PT7 A;  1IKG A;  4QY5 A;  1IEM A;  4WMC A;  3UB5 P;  3NDE A;  3Q82 A;  5EFW A;  4XXR A;  1K56 A;  2V20 A;  4IVK A;  4CLC C;  3T1S A;  2GDN A;  3QP4 A;  1ERO A;  3A0R A;  2W0N A;  3O88 A;  1KGE A;  1JTG A;  2OWJ A;  1W7F A;  5JYO A;  4DE1 A;  3H7W A;  4CLC D;  1HTZ A;  1BZA A;  1H8Y A;  4BL2 A;  3FC7 A;  1YM1 A;  2VK3 A;  5CRF A;  4EES A;  3WS0 A;  2ZM8 A;  2PR6 A;  2H28 A;  2GX5 A;  3PBQ A;  5F5Y A;  2VX8 A;  5HAQ A;  4FCF A;  4ZJ1 A;  2JKT M;  4G3V A;  5J8X A;  3VOL A;  1CI9 A;  2Y2G A;  1KVM A;  4U3T A;  2O99 A;  3S22 A;  3D4F A;  4KG5 A;  1FCM A;  4D2O A;  1S4R A; 
#chains in the Genus database with same CATH homology
 2Y2P A;  1GHP A;  4OQH A;  2Y91 A;  4R4S A;  3QHY A;  3FZC A;  4P6B A;  2WKI A;  3RXW A;  3CZD A;  3VOZ A;  5AQ9 A;  3RJU A;  5FQI A;  3PBR A;  4IED A;  3N7W A;  3OC2 A;  1PYY A;  4GDB A;  5HL1 A;  2ZJ9 A;  5GLC A;  2VGJ A;  2XGN A;  2IWD A;  3G4P A;  4JKT A;  3AGE A;  1E25 A;  5E43 A;  4F94 A;  2Z2L B;  3G31 A;  3ITA A;  2OLV A;  2P9V B;  4P0M A;  1Z6F A;  1GA9 A;  4QY6 A;  5F83 A;  4OKP A;  4K0X A;  4CPK A;  4N9K A;  1KGF A;  3NBL A;  4E6X A;  3W4P A;  4E3N A;  2XEP A;  2Y55 A;  3MKF A;  4S2N C;  2J8Y A;  1MWT A;  5CHM A;  2QMI A;  4FSF A;  2Y2O A;  1YMS A;  3IF6 B;  4LV0 A;  1XGJ A;  2PU2 A;  3VFF A;  1FQG A;  1NY0 A;  5DTK A;  4EUZ A;  1FSY A;  1FR6 A;  3N6I A;  2JC7 A;  4GZB A;  3QNB A;  1N9B A;  2WGV A;  1ES5 A;  1GHM A;  1MBL A;  4K0W A;  2DNS A;  2WAE A;  3NIA A;  4NK3 A;  3LY4 A;  1FSW A;  4UA9 A;  1IYO A;  3A3F A;  5D3O A;  3ZG5 A;  5BOH A;  2Y59 A;  4JF4 A;  1PIO A;  3O87 A;  2OV5 A;  3A3E A;  5FI6 A;  4JF5 A;  1XA7 A;  1BT5 A;  3G30 A;  2XFS A;  5FDH A;  1O07 A;  3WS2 A;  3C7V A;  4RVA A;  4BLM A;  4KQO A;  4GB7 A;  1MWR A;  3WS4 A;  2H10 A;  1SKF A;  2FFY A;  3Q1F A;  5AQA A;  2XD5 A;  3IH9 A;  4P85 A;  3WRT A;  5CHU A;  3UPP A;  3SH8 A;  1EI5 A;  1YLY A;  5EUA A;  2ZC6 B;  4PM8 A;  1J9M A;  4IBR A;  1W5D A;  4JXS A;  2JE5 A;  5EVI B;  4DKI A;  5E2G A;  1BSG A;  4RX3 A;  3ZNT A;  1PI5 A;  1LHY A;  1YT4 A;  5FAO A;  2HPB A;  3G2Y A;  4R3B A;  2BG1 A;  4LV2 A;  5GHX A;  1KE0 A;  3HLE A;  4WYY A;  4KZ9 A;  5FQJ A;  4PMA A;  5HAI A;  1XX2 A;  3HLF A;  5TR7 A;  2C6W B;  3ZVT A;  1K25 A;  1LL9 A;  4N92 A;  1PZP A;  2E8I A;  3Q7Z A;  3V50 A;  5AQ7 A;  1YLW A;  1Q2P A;  3NDG A;  2RL3 A;  4MEZ A;  3UDF A;  4UHU A;  1RCJ A;  1CK3 A;  3IXG A;  5EPH A;  3UDX A;  1H8Z A;  1FCN A;  3O3V A;  5HFO A;  1ZG4 A;  4E3M A;  4OLG A;  3WWX A;  4Y0O A;  3AGF A;  5E2H A;  5F1G A;  3V39 A;  4KZ6 A;  2P74 A;  1ZKJ A;  4ZJ3 A;  3FYZ A;  4BJP A;  1JTD A;  1L2S A;  1K57 C;  2G2U A;  4JF6 A;  3S1Y A;  3HRE A;  5CHJ A;  4C75 A;  2XD1 A;  1LLB A;  3HLW A;  2Q9N A;  5CGX A;  4GD6 A;  3NCK A;  1FR1 A;  1QMF A;  3HUM A;  4R0Q A;  4KG6 A;  4LCL A;  4LV3 A;  4S2M A;  2WYX A;  4DE2 A;  1U60 A;  5JYP A;  4U0T A;  1BLP A;  3V3S A;  3ZG7 B;  1WYB A;  3HUO A;  4JBF A;  1VQQ A;  1PW8 A;  1ZC2 A;  4KZ4 A;  3IHA A;  1XP4 A;  4IBX A;  5M1A A;  3M2K A;  3HLC A;  4P87 A;  2XDM A;  2EX6 A;  3PBO A;  5DVA A;  3BFF A;  5M18 A;  1MXO A;  2ZC5 B;  3NI9 A;  1YLJ A;  4ZAM A;  3ZG0 A;  1K55 C;  2IWC A;  3IXB A;  5IHV A;  1NXY A;  2C5W B;  2HDU A;  2I72 A;  1PWD A;  3UNW A;  4KEN B;  4PPR A;  1W8Q A;  3G2Z A;  4OLD A;  3NY4 A;  4X68 A;  1KVL A;  3IQA A;  5CER A;  1C3B A;  4MNR A;  5GLA A;  1IYQ A;  4S2J A;  1HVB A;  1TEM A;  3IF5 A;  4OVD A;  2DRW A;  1BTL A;  4WZ5 A;  5HAR A;  1ONG A;  5A90 A;  3S4X A;  2EX9 A;  3Q7V B;  5GLD A;  4DRT A;  4WEJ A;  3SOI A;  3V5M A;  2JCH A;  4KQQ A;  1RGZ A;  1XGI A;  2WKE A;  2XF3 A;  1L0G A;  1EWZ A;  1NJ4 A;  1DY6 A;  4EQI A;  3RXX A;  2G2W A;  3A3I A;  2BLS A;  3BRM A;  5CGW A;  1ZG6 A;  1K57 A;  2V2F F;  1K38 A;  1K4E A;  1YLT A;  2EFX A;  2WAF A;  1K6S A;  3DTM A;  1E3U A;  4X55 A;  4X56 A;  4Q8I A;  4X53 A;  3OCL A;  3UN7 A;  3CG5 A;  5KMW A;  4KQR A;  3BM6 A;  1PZO A;  1K6R A;  3IXD A;  1ONH A;  3ZCZ A;  4Y0U A;  5HW3 A;  3ZG9 B;  4BL3 A;  1ESI A;  1W79 A;  3LO7 A;  5E2E A;  4RX2 A;  3C5A A;  1K55 A;  3P98 A;  2R9X A;  2EX2 A;  4UA6 A;  3VFH A;  1CI8 A;  1I5Q A;  1NZU A;  3IWO A;  1M6K A;  5CGS A;  3G32 A;  4KZ3 A;  3SS3 A;  1QME A;  3UPN A;  4E3L A;  4HEF A;  2QZ6 A;  3OCN A;  5U47 A;  4WMC D;  3UE1 A;  1KE4 A;  3MBZ A;  4X69 A;  5FAQ A;  1L0F A;  4PM5 A;  4OPY A;  3CMZ A;  2J9P A;  5A92 A;  2ZC4 B;  3BFD A;  3GV9 A;  4OP5 A;  1K56 D;  1PW1 A;  4FH2 A;  2Y2H A;  3ZG8 B;  1BUE A;  1H5X A;  4U0X A;  1W8Y A;  1JWZ A;  4LV1 A;  3UPO A;  2ZC7 A;  4C6Y A;  1YQS A;  1I2S A;  4BD1 A;  4DDS A;  3G35 A;  4JXW A;  2EFU A;  4WZ4 A;  4OOY A;  4EBP A;  3MZD A;  5A93 A;  1K54 C;  4YIN A;  3MFD A;  1DJC A;  5FI7 A;  1MY8 A;  3VP1 A;  4EBN A;  2XLN A;  4L0L A;  2QPN A;  2A49 A;  3PAE A;  3OPR A;  4OQG A;  3C7U A;  3FKW A;  4EWF A;  2XFT A;  3A3D A;  1HZO A;  1NYM A;  3MXS A;  4QJG A;  2Y2K A;  2OLU A;  1JVJ A;  2WZZ A;  2ZQ9 A;  1CEF A;  1MWU A;  4QU3 A;  5FAP A;  3ISG A;  4S2N A;  2X71 A;  3WS5 A;  2HDQ A;  3PAG A;  4DF6 A;  1NRF A;  2X01 A;  4KZ8 A;  3GVB A;  4WEK A;  3AGD A;  3N8L A;  4M3K A;  5KZH A;  1TDL A;  3M6H A;  4Z9Q A;  4ZTK A;  5FQM A;  2ZM2 A;  1S6R A;  2Z2M B;  4WBG A;  3G34 A;  5GHZ A;  1ESU A;  1JWV A;  3BLS A;  3UE3 A;  3IWI A;  5I94 A;  1XA1 A;  1IEL A;  3BFE A;  4CJN A;  3VSK A;  2ZM0 A;  3HLG A;  1BLH A;  1JWP A;  2WUQ A;  2ZQC A;  3FKV A;  3WS1 A;  4R1G A;  4PM6 A;  3ZNY A;  5EE8 A;  2Y2M A;  3IH8 A;  3SH7 A;  4QHC A;  3HUN A;  2ZMA A;  3N8S A;  1TVF A;  1IYP A;  2PBY A;  4LCM A;  3VP0 A;  1ES4 A;  4BD0 A;  2DCF A;  4ZJ2 A;  4B4Z A;  1PI4 A;  4DE0 A;  3GSG A;  5CXW A;  3GMW A;  1HD8 A;  3FV7 A;  4OPZ A;  3Q81 A;  1M40 A;  4B4X A;  1WE4 A;  5EVL A;  1RP5 A;  3GR2 A;  2HDR A;  5L2F A;  2A3U A;  5AQB A;  3EQU A;  1Q2Q A;  5A91 A;  2HP5 A;  4OON A;  1K54 A;  4EBL A;  3HLD A;  3MZE A;  3VMA A;  3IWQ A;  2H5S A;  3MZF A;  3OPP A;  1MWS A;  3MKE A;  5CTN A;  5GLB A;  4GNU A;  4DXC A;  1ERQ A;  5EVI C;  3N8R A;  4FD8 A;  1ES3 A;  4GOG A;  3B3X A;  3O86 A;  4YFM A;  1SDN A;  4QB8 A;  4KG2 A;  5KSH A;  4S2O A;  4N1H A;  4EV4 A;  4PM9 A;  2J9O A;  1SHV A;  3PBS A;  5EVI D;  3ZVW A;  3DWK A;  5KSC A;  3W4Q A;  4OQ0 A;  3V3R A;  4UA7 A;  1G68 A;  4MBK A;  3Q07 A;  3LEZ A;  3PTE A;  3MXR A;  3DWZ A;  3TG9 A;  3W8K A;  3ZFZ A;  5FAT A;  4E6W A;  2OSU A;  4K91 A;  1KDW A;  1WYC A;  1Y54 A;  4KZ5 A;  2XR0 A;  2R9W A;  2ZC3 B;  4XUX A;  4A5R A;  1DJB A;  5DTT A;  4KZA A;  1YLP A;  3BFG A;  3VSL A;  4X6T A;  3SS4 A;  1XXM A;  5FI2 A;  3BLM A;  4XUZ A;  4S2P A;  1LI0 A;  5FAS A;  1MKI A;  5EOO A;  1CEG A;  1NZO A;  5DF7 A;  5F82 A;  3TOI A;  2H0Y A;  4ZDX A;  4O7D A;  4S2I A;  5EOE A;  5F1F A;  1GA0 A;  1YMX A;  4KZ7 A;  4E3I A;  3IXH A;  1RGY A;  5FSR A;  4FH4 A;  3JYI A;  4E3O A;  1TDG A;  3PBN A;  2B5R A;  1FOF A;  1XPB A;  2XQZ A;  3GQZ A;  4S2K A;  5DF8 A;  4DDY A;  2CC1 A;  5HX9 A;  3HBR A;  1O7E A;  2H0T A;  3E2K A;  2Y2I A;  4C3Q A;  1DJA A;  2V1Z A;  2EXA A;  5EVI A;  4LEN A;  3WRZ A;  2ZQ7 A;  4B88 A;  4E3K A;  2EXB A;  4H8R A;  5G18 A;  2WKH A;  5EEC A;  1XKZ A;  3TSG A;  3BYD A;  3HLB A;  1IKI A;  1ALQ A;  1KDS A;  2J7V A;  4GN2 A;  4R3J A;  3P09 A;  5GL9 A;  4NET A;  4ZBE A;  2WK0 A;  1N4O A;  3IT9 A;  3BFC A;  2Y2N A;  1YLZ A;  3HL9 A;  4IVI A;  1I2W A;  4R23 A;  5FQK A;  2RCX A;  3UE0 A;  3SH9 A;  4KZB A;  3UO9 A;  1BLC A;  3E2L A;  1OME A;  5FQ9 A;  2XH9 A;  5TFQ A;  1K4F A;  2WZX A;  4UAA A;  1LL5 A;  2VGK A;  4OOM A;  4RA7 A;  3LCE A;  3QNC A;  4DXB A;  2HP9 A;  2ZQA A;  2WGW A;  4RYE A;  1AXB A;  2IWB A;  2Q9M A;  3BEB A;  3LY3 A;  2UWX A;  3C4O A;  3DW0 A;  4E3J A;  5GHY A;  4OH0 A;  4DE3 A;  4ID4 A;  3VP4 A;  4GDN A;  2Y2L A;  1KE3 A;  4N9L A;  3CJM A;  3UDI A;  1G6A A;  3C4P A;  2HDS A;  4N1X A;  5DF9 A;  3ZGA B;  3NC8 A;  5CED A;  4JXV A;  3BEC A;  2PU4 A;  4JPM A;  3VP2 A;  1IKG A;  4QY5 A;  1IEM A;  2Y2J A;  4WMC A;  4GD8 A;  4PM7 A;  2JBF A;  3IF6 C;  1FCO A;  3OZH A;  3NDE A;  3ZHH A;  3Q82 A;  4XXR A;  1K56 A;  3GTC A;  1ERM A;  1MPL A;  2V20 A;  4IVK A;  4WM9 A;  3SS5 A;  2GDN A;  5FQQ A;  1ERO A;  1E4D A;  2ZQD A;  1ES2 A;  5FA7 A;  3O88 A;  4WZ5 C;  1KGE A;  1JTG A;  4OQI A;  1W7F A;  5JYO A;  4HBT A;  3VP3 A;  4DE1 A;  1KGG A;  1PWG A;  4OPQ A;  1HTZ A;  1BZA A;  1H8Y A;  4BL2 A;  1VM1 A;  5DTS A;  4HES A;  4OOL A;  3A3J A;  4WEL A;  1YM1 A;  4JLF A;  4BEN A;  4QD4 A;  4OPR A;  5CRF A;  3WS0 A;  2WGW B;  2ZM8 A;  3Q7V A;  1BLS A;  3ITB A;  2EX8 A;  2WGI A;  5M19 A;  3ZDJ A;  2Y2Q A;  3HVF A;  1L0D A;  4HBU A;  1NYY A;  5CEB A;  3I7J A;  4MLL A;  1PWC A;  3FWL A;  3PBQ A;  4MBF A;  4S2L A;  4Y7P A;  5HAQ A;  1L0E A;  3GRJ A;  4FCF A;  3M6B A;  4ZJ1 A;  4MBH A;  1SCW A;  5TGF A;  5J8X A;  2XK1 A;  2P9V A;  1E3U D;  3M2J A;  1CI9 A;  2HP6 A;  4Y0T A;  5HAP A;  2Y2G A;  3OPH A;  3OPL A;  1KVM A;  4OP8 A;  3N4I A;  3PBT A;  4U3T A;  3EQV A;  1BUL A;  4JXG A;  3VOY A;  1IYS A;  1S0W A;  3IHB A;  3S22 A;  1LI9 A;  5CTM A;  2ZQ8 A;  1GCE A;  2FFF B;  2WAD A;  3D4F A;  4KG5 A;  2ZLY A;  2X02 A;  1FCM A;  3IF6 A;  3W4O A;  4BQM A;  4D2O A;  1SDE A;  1GHI A;  4GKU A;  5E2F A;  3UY6 A;  2Y4A A;  2ZD8 A;  4R4R A;  5CEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...