4IBRA

Crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying g238s/e104k mutations
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVKYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title What Makes a Protein Fold Amenable to Functional Innovation? Fold Polarity and Stability Trade-offs.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4ibrA00
1N9BA 3ITAA 2BLSA 4U3TA 4RA7A 2OV5A 4PM7A 5CGSA 3HUNA 3BRMA 4IVIA 3UDIA 3G30A 2V20A 1YLZA 3A3JA 2A49A 4E3LA 3Q7ZA 2WGWB 3HLWA 4OH0A 1K6SA 3ZNYA 3LO7A 1JVJA 2WAFA 2ZQ8A 3QNCA 4ZJ3A 4EUZA 3IXDA 3WS5A 1K4FA 5E2HA 5HAQA 1Z6FA 5DF7A 3GVBA 3O88A 4K0XA 4Y0UA 2Y91A 3FWLA 1PWGA 5IHVA 2JC7A 3P09A 1PI4A 1K55C 1LL9A 3BEBA 4ZJ1A 5FQQA 5CTNA 5FQJA 2PBYA 4MNRA 4DKIA 5TGFA 1XPBA 5FI6A 3ZVTA 2ZM0A 1SDNA 5KZHA 4KZ6A 3E2LA 2ZM8A 4K91A 5AQ9A 1MKIA 2P74A 5A93A 3A3IA 3BFFA 3FKWA 3GV9A 5FI7A 3ZCZA 1M6KA 4KZ8A 4YINA 1K56A 2UWXA 4FSFA 1WYCA 3HUMA 1WYBA 1N4OA 3MKFA 1CI9A 1KGGA 4R1GA 4MBHA 3NIAA 2DCFA 4PPRA 1FCMA 3HVFA 1YMSA 4EV4A 4MEZA 3BLMA 1L0FA 4RVAA 1K56D 4LCMA 3IXHA 2XDMA 3N7WA 4ID4A 4R23A 3ZG5A 1MXOA 1YLPA 5M18A 1GA0A 3B3XA 2XQZA 4RX2A 4EBPA 1NRFA 3VP0A 4BL2A 4Z9QA 4WBGA 1XA1A 3VFHA 4P87A 4E3JA 1XKZA 3UE1A 3IH8A 2Y2QA 4CPKA 4KZ5A 5CHJA 4PMAA 5F1FA 4GOGA 1ALQA 3PAEA 5E43A 4E6XA 1YT4A 1Q2PA 1MWSA 3IWIA 2EX2A 3NI9A 1Y54A 3OC2A 1GA9A 1WE4A 4KG6A 4R4SA 2J9OA 2OLUA 4ZAMA 3Q82A 3SOIA 5A91A 3TSGA 1JTGA 2Y2KA 2XLNA 1RCJA 4DRTA 4E3NA 2C5WB 3PAGA 3FKVA 3FZCA 1L0GA 1MBLA 4XUXA 3BM6A 2ZQDA 4OOYA 1BT5A 1BLSA 4JF6A 5DTKA 1NJ4A 3S22A 1HVBA 2WKEA 4X55A 2ZJ9A 4B4XA 1EROA 3CJMA 5KSCA 1FQGA 2JBFA 3VFFA 1NZOA 4QD4A 1ONHA 1W79A 3PBOA 2ZMAA 1CK3A 3NDGA 4R3BA 3ZNTA 3UPNA 4Y0OA 2E8IA 1ESUA 4JBFA 4KG5A 4OONA 2ZQCA 3G2ZA 4S2NC 5AQBA 5FATA 3LCEA 3M6HA 2EX6A 2XEPA 4UA9A 1JWVA 1O07A 4CJNA 2G2UA 3O3VA 4OOLA 4NK3A 3PBTA 4WZ5C 3RXWA 4WEKA 4BL3A 3UPOA 5FQMA 2ZC6B 1ESIA 3SS3A 2R9XA 4R3JA 2OLVA 4FCFA 1GHMA 1IKGA 1BTLA 3IWQA 3W4OA 2WKHA 3MXRA 1K38A 1VQQA 1L0DA 3NY4A 1IYSA 1I2SA 3EQUA 3WS2A 1PW1A 4OP5A 5FASA 3E2KA 2WADA 5GLCA 2R9WA 3HLGA 4QY6A 1BUEA 4LENA 1IYQA 4ZDXA 2V2FF 3IXBA 3W4PA 5FSRA 2A3UA 1KE3A 4IVKA 1LL5A 3G2YA 5TR7A 4EQIA 3AGDA 1GHPA 3Q07A 4BD0A 4WMCA 4UA7A 3Q7VA 1MWRA 5EVIB 1IKIA 3M2JA 4OPZA 4A5RA 5A90A 4PM6A 1W8QA 4BD1A 3MXSA 1XGJA 4IEDA 4QY5A 1SHVA 2EX9A 2I72A 1SDEA 1Q2QA 3VOZA 3IHAA 3SH8A 5F1GA 1TDGA 1K55A 4WMCD 4OQGA 2XD1A 2Q9NA 4KQQA 3VMAA 1FR6A 5FAPA 1W5DA 1W8YA 1ZC2A 4E3OA 1KE4A 2QPNA 4ZBEA 3V5MA 2ZC7A 3BYDA 1KVMA 3D4FA 4X53A 2XK1A 5AQ7A 1NYYA 1K54C 3V50A 4N92A 3ZG9B 3IXGA 3IF6B 4GD6A 3WS1A 2VGKA 2EFUA 2WGWA 4MLLA 5EECA 3TG9A 4QHCA 5E2EA 5FDHA 3NBLA 4GNUA 2Y4AA 3W8KA 5EVIC 4BJPA 5FQ9A 4N1HA 5JYPA 2HPBA 1AXBA 3GMWA 5F82A 4DDSA 3DWKA 3RJUA 1IELA 5BOHA 1CEFA 3C5AA 4QU3A 3SH7A 4BENA 1ZG6A 5CHMA 3S1YA 4Y0TA 4S2PA 4C6YA 1G6AA 4GDNA 4P0MA 4U0XA 1SCWA 1PWDA 1U60A 4MBFA 1PYYA 4S2JA 1KGEA 2XD5A 1MWTA 4KZ7A 4P6BA 3OZHA 3O87A 3UY6A 1I2WA 5FI2A 3ZG0A 3IF6C 5CECA 2XF3A 3TOIA 3VP1A 4DF6A 4DE2A 5L2FA 3OPPA 1EWZA 3AGEA 3MZEA 1K57A 3A3FA 2FFYA 4IBRA 2RL3A 2Y2OA 3FYZA 4YFMA 1YMXA 5HW3A 3VSLA 1BLHA 2WYXA 3QNBA 4M3KA 4OLDA 3SS5A 2P9VB 4EBLA 4JKTA 3N8SA 1K4EA 3G31A 4ZTKA 5TFQA 4DE0A 3ISGA 4N1XA 1IYOA 5J8XA 3VP4A 4GDBA 5CTMA 2J8YA 5DF9A 2ZC4B 5CGXA 4N9KA 3MBZA 3G35A 4E3MA 2VGJA 3PBQA 5GHXA 2H0YA 4WELA 5I94A 1L2SA 1ZKJA 4LV0A 5FQIA 1DY6A 4HEFA 4R0QA 4D2OA 2QMIA 1I5QA 1GHIA 2ZC5B 5KSHA 1MPLA 1YLWA 1ES5A 3W4QA 2FFFB 4NETA 1FR1A 3PBNA 2Y2LA 4OP8A 3WS4A 4DXBA 4XXRA 3MKEA 2Y2MA 4JXWA 4UAAA 2HDQA 4P85A 3HLBA 5GHYA 1IEMA 3Q1FA 3EQVA 1ES2A 1RGYA 1BLPA 3OPRA 3UNWA 3MZFA 1H8YA 3HLFA 2ZQAA 1KVLA 1ERQA 3JYIA 1NYMA 2Y2JA 1C3BA 1HZOA 1JWPA 1KGFA 1NZUA 3CMZA 4JXVA 1GCEA 4RX3A 5GLAA 2WUQA 1YLYA 3MFDA 5HX9A 5HFOA 4X56A 2J7VA 3GQZA 4U0TA 2OSUA 3LY3A 4QB8A 5HARA 2Y2GA 5KMWA 3DTMA 2XH9A 3PBRA 4RYEA 1S6RA 1E25A 2WAEA 3ITBA 4Y7PA 3C7UA 2PU4A 4GKUA 4B4ZA 5EPHA 1DJBA 3GTCA 1M40A 3HL9A 5CERA 4B88A 4HESA 5EOEA 4DE3A 2ZQ9A 1G68A 3PTEA 3LY4A 3Q7VB 2IWCA 3UDFA 1K54A 1IYPA 2H10A 2HDRA 3Q81A 1PZPA 3WRTA 4E3IA 4Q8IA 4JPMA 5E2FA 1OMEA 1LHYA 1PWCA 3C7VA 1DJCA 5G18A 1SKFA 3GR2A 1KDWA 3MZDA 5DVAA 3VOYA 5EVIA 1PI5A 4OQ0A 4ZJ2A 1W7FA 5DTTA 4OPYA 1RGZA 2GDNA 3ZHHA 1JWZA 1ERMA 4OKPA 3WS0A 5D3OA 1K6RA 1LI0A 3VP2A 3VP3A 1E4DA 2ZM2A 4X68A 2G2WA 1XP4A 2HDUA 2V1ZA 3V3SA 1XGIA 2XGNA 2XR0A 1CEGA 5EVID 2Y2PA 3I7JA 1BULA 1O7EA 2EFXA 2J9PA 5CHUA 3A3DA 1CI8A 3ZGAB 1ZG4A 3BFGA 4WM9A 3ZG7B 4EBNA 5HAIA 1LLBA 2Y55A 3IF6A 5GLDA 4DE1A 3N6IA 1DJAA 1ES3A 2Z2MB 3C4OA 2WZXA 2XFSA 4FH2A 5CGWA 1PIOA 1TVFA 2Z2LB 4KZ3A 4S2KA 2H0TA 4UHUA 4BLMA 5JYOA 3IH9A 4GZBA 1FSYA 1FCOA 4OPRA 1XX2A 2QZ6A 2X71A 2Y2HA 1NY0A 5CEDA 4OQIA 4S2LA 3CZDA 3G32A 2CC1A 3WRZA 1K25A 1H8ZA 4N9LA 4X6TA 3OCNA 3BFCA 5GLBA 3OCLA 3CG5A 5FQKA 4F94A 1YLTA 3FV7A 1KE0A 4KQRA 4E6WA 2H5SA 2C6WB 3A3EA 4WYYA 5CEBA 4H8RA 1EI5A 3OPLA 2EXBA 1PZOA 1JTDA 2DRWA 2ZD8A 4OOMA 3OPHA 2IWDA 2RCXA 3C4PA 3P98A 4R4RA 5EVLA 1VM1A 4JF5A 4LV2A 1MWUA 4PM9A 1BZAA 3DW0A 3HLCA 4FD8A 3UN7A 5M19A 4KG2A 1KDSA 3UO9A 3N8LA 4KZ4A 2EX8A 4GD8A 3QHYA 4KZ9A 2Q9MA 2Y2NA 4IBXA 5GHZA 1TDLA 1NXYA 5DTSA 4JF4A 2BG1A 5M1AA 3V3RA 3VSKA 4GB7A 3IHBA 2P9VA 2ZC3B 4JLFA 2X02A 4PM5A 4S2NA 4OVDA 4UA6A 1QMEA 1J9MA 1HD8A 3IWOA 3NDEA 4E3KA 1YLJA 3N4IA 1TEMA 2ZLYA 2XFTA 2HP6A 2Y59A 1MY8A 4S2OA 1H5XA 3PBSA 4WZ4A 1K57C 3O86A 4O7DA 4QJGA 2JE5A 2Y2IA 3BECA 4LV1A 4PM8A 4WZ5A 3UDXA 1PW8A 2EXAA 1L0EA 2B5RA 3GRJA 1XA7A 5HL1A 2ZQ7A 3HBRA 4HBTA 2WGIA 3N8RA 4HBUA 4X69A 3RXXA 3SS4A 1FSWA 3ZG8B 4C75A 2WGVA 5F83A 1HTZA 4LCLA 1BSGA 3V39A 3IQAA 2WZZA 4BQMA 4K0WA 2DNSA 3M2KA 4GN2A 4MBKA 2WK0A 1FOFA 5FAQA 1YQSA 4JXSA 5E2GA 4L0LA 4OLGA 3UE0A 4S2IA 2PU2A 3AGFA 4OPQA 5DF8A 3ZVWA 2HDSA 1YM1A 4DDYA 1ES4A 1XXMA 4C3QA 2WKIA 4WEJA 5FAOA 3ZFZA 3UPPA 3HLDA 4EWFA 1FCNA 1ONGA 3ZDJA 2HP5A 1QMFA 5HAPA 4FH4A 5EOOA 3S4XA 4JXGA 5CRFA 5EUAA 4KZAA 3IT9A 4KENB 4OQHA 3NC8A 2HP9A 5CXWA 3SH9A 3HREA 3M6BA 4LV3A 5U47A 1S0WA 3BLSA 4KQOA 3BFDA 1E3UA 3WWXA 3G34A 1RP5A 2IWBA 5EE8A 4S2MA 1LI9A 4KZBA 4XUZA 5AQAA 3HLEA 5A92A 3DWZA 3BFEA 1BLCA 5GL9A 3LEZA 3GSGA 3G4PA 1E3UD 2JCHA 3NCKA 3IF5A 4DXCA 5FA7A 2X01A 3UE3A 3HUOA
chains in the Genus database with same CATH superfamily
3ITAA 1S67L 4RA7A 5CGSA 3HUNA 4ZRRA 3UDIA 1BYWA 3G30A 3IX4A 1YLZA 3E0YA 2HV1A 2A49A 3LIDA 3S7QA 4EUZA 3LO7A 1F9IA 3EEHA 3WS5A 1K4FA 5E2HA 3GVBA 2VKSA 4K0XA 4Y0UA 2VJWA 1T1BA 5IHVA 2VV6A 1TF1A 1LSVA 3F1NA 1YPRA 5TGFA 5DJTA 3ZVTA 1XJ3A 2ZM8A 5A93A 3BFFA 1D06A 3P01A 2EWVA 3R7WB 3HUMA 3S7OA 1N4OA 3MKFA 2JKRI 3NIAA 2DCFA 3NULA 1FCMA 4PPRA 4LCMA 2VV7A 1LT0A 2B95A 2J3WA 2XQZA 1S4SA 4Z9QA 1WA9A 1XA1A 4P87A 5AVEA 2Y2QA 5EM1A 2EX2A 5L10A 1Y54A 1GA9A 4R4SA 2J9OA 2OLUA 4ZAMA 1JTGA 2Y2KA 4E3NA 2C5WB 1L0GA 1MBLA 3UB5P 1BLSA 4JF6A 1A0KA 3NECA 5DTKA 2ZJ9A 3O5YA 1EROA 5KSCA 3VFFA 2JKTI 4DJ2A 3ZNTA 2E8IA 2EX6A 2XEPA 1JWVA 3O3VA 3PBTA 5HPIA 2R9XA 3T1RA 2OLVA 1GHMA 4NXEA 1BTLA 3EEAA 4BMWA 3MXRA 1L0DA 4QPRA 4F3LA 3EQUA 4OP5A 3HLGA 4I3AA 4ZDXA 5HZHA 5FSRA 2A3UA 2L1MA 2M1CA 3AGDA 4BD0A 4UA7A 2WKPA 3Q7VA 3C8CA 5A90A 4CLCC 2JHEA 1XGJA 4IEDA 1SHVA 4G3KA 3VOZA 3QP5A 1Y28A 4JGPA 4LRZE 5FAPA 1ZC2A 1KE4A 3H9WA 3BYDA 3EWKA 1KVMA 3H7WB 2WGWA 4MLLA 3TG9A 2Y4AA 5FQ9A 1ACFA 3BQAA 4N1HA 5LBRA 5JYPA 1AXBA 3GMWA 4DDSA 3RJUA 3A0VA 1N9LA 3C5AA 4QU3A 3SH7A 2ZL1B 2W1TB 3EGXC 4S2PA 4P0MA 4S2JA 1MWTA 4K08A 4LPZA 3D9YA 4P6BA 3UY6A 1I2WA 3IF6C 4DF6A 2J3TD 4DE2A 1P97A 3OPPA 1OPXA 2RL3A 5DKKA 3F1OB 5MC7A 2WYXA 3QNBA 2PYPA 2E8JA 3SS5A 4EBLA 4EU0A 3ZQ5A 3ISGA 3IX3A 1W63Q 5L8MA 5CTMA 1OJGA 3G35A 2HJEA 4WELA 5DFYA 4EETB 5FL3A 5FQIA 1DY6A 5TJJA 2ZC5B 1YLWA 1G28A 5DKLA 4EERA 4P85A 2OAQ1 2ZMVA 3Q1FA 3EQVA 1BLPA 3OPRA 3F1PA 2Y2JA 4JXVA 2WUQA 4ARZA 5KMWA 2XH9A 1E25A 4Y7PA 2PU4A 3QP1A 5EPHA 4GS9A 4EUVA 3DTIA 4HESA 3LY4A 2IWCA 3UDFA 1IYPA 5E2FA 1LHYA 4L9FA 4QWOA 2PAVP 3VOYA 2UV0E 2DMWA 3IX8A 3LICA 1ERMA 3WS0A 5D3OA 3BWLA 3LYXA 2HDUA 5CX7A 5EVID 3I7JA 3CITA 1O7EA 2J9PA 5CHUA 2XROA 3A3DA 3F1NB 4Q0IA 1ZG4A 4WM9A 3ZG7B 5HAIA 3KYQA 3IF6A 1K0KA 3N6IA 4WUJA 2A24B 2Z2MB 2BASA 2XA7M 2WZXA 2XFSA 1T1AA 4GLQA 4S2KA 5JYOA 3LI8A 4IJGA 3UB6A 3NOUC 2CC1A 1KOUA 4N9LA 3P7NA 5FQKA 1YLTA 3FV7A 2H5SA 2VA0A 3BY9A 3KSHA 2EXBA 5TBMA 3QP4A 4R4RA 5EVLA 2LB9A 1T19A 4JF5A 1MWUA 4PM9A 1FIKA 5M19A 1T1CA 4KZ4A 3KSFA 3QHYA 2Y2NA 1TDLA 2QJ5A 1NXYA 2BG1A 4R38A 4GB7A 3HCYA 2P9VA 2ZC3B 1J9MA 1TEMA 2XFTA 1MY8A 1H5XA 3PBSA 4M4XA 3UDXA 1PW8A 3U4LP 3HBRA 4HBUA 4C75A 5F83A 1HTZA 4LCLA 5L09A 2FH5A 2DNSA 3M2KA 4GN2A 1FOFA 1YQSA 5E2GA 4L0LA 2GZAA 1ES4A 2K31A 3S7NA 2HP5A 5F68A 4F3LB 1YAXA 5EUAA 4Y5FA 3T1XA 3NC8A 4CLCD 2PDRA 4LV3A 2AVXA 3TJZC 3BFDA 4L9EA 4EQ1A 5A92A 3BFEA 5GL9A 4Y17A 3LEZA 3GSGA 3G4PA 3LR5A 2YKFA 1P9WA 4DXCA 3UE3A 1N9OA 3B33A 4IVIA 4I5SA 3DAVA 1HLUP 3Q7ZA 2WGWB 4PHTA 3ZNYA 2WAFA 3IXDA 3U2AA 5HAQA 1L3LA 5HD5A 5DF7A 1Z09A 2Y91A 2P7JA 4ZJ1A 1T18A 3BEBA 5FQQA 2PBYA 5FI6A 3LR4A 4LLOB 3MS6A 4KZ6A 4K91A 3A3IA 5FI7A 3RFBA 3ZCZA 1M6KA 2O99A 4KZ8A 4YINA 4Y13A 2UWXA 2HGVA 1WYCA 1CI9A 1KGGA 4MBHA 3HVFA 4EV4A 4MEZA 3BLMA 4RVAA 1K56D 5G4ZA 3IXHA 3C30A 3N7WA 5M18A 2OAP1 3A0SA 4I3IA 1GA0A 2P04A 4KUKA 3LGOA 2Y8HA 4RX2A 4EBPA 1NRFA 4BL2A 4WBGA 4E3JA 3UE1A 4CPKA 5CHJA 3LIAA 4PMAA 4GOGA 1Q2PA 3NI9A 3LIBA 3L7HA 1RCJA 3FZCA 2ZQDA 3EOIA 1BT5A 4HP4A 1NJ4A 1HVBA 4B4XA 1FQGA 1GSWA 2JBFA 1ONHA 1W79A 4LRXC 4R3BA 3EGDC 4KG5A 4OONA 3F1PB 3UB9A 4ARZB 2G2UA 4DJ3A 4OOLA 4WZ5C 1IFQA 2HZ5A 4D60A 3TE8A 3UB7A 1IKGA 3W4OA 4YOFA 1VQQA 4GS9B 3PXPA 5HDCA 3WS2A 3E2KA 2WADA 2R9WA 3IXBA 1Y4OA 2W3FA 1KE3A 3G2YA 1GHPA 1IKIA 4PM6A 3MQQA 3BW6A 2OWJA 1Q2QA 3IHAA 1IOUA 4OQGA 2XD1A 3VMAA 1FR6A 1W8YA 3V5MA 2ZC7A 5J3WA 2Y79A 3E4PA 3V50A 3IF6B 2M7VA 5EECA 4QHCA 1J3WA 5E2EA 3NBLA 3W8KA 2PD8A 5EVIC 5F82A 3DTKA 1CEFA 1D7EA 1LL8A 3FPVA 2A24A 3S1YA 5CHMA 5HDDA 4CLCE 1G6AA 3LI9A 4GDNA 1EW0A 3R4KA 4R3AA 4I3JA 1PYYA 1KGEA 2XD5A 4KZ7A 3KYEA 3OZHA 3O87A 5TBMB 5DJUA 2V1AA 4UQIS 4Z1WA 3T50A 3TOIA 3T4LA 3AGEA 1K57A 2Y2OA 3FYZA 5HW3A 4HQAA 2P9VB 4JKTA 4JGOA 4GHIB 3G31A 4ZTKA 4N1XA 1IYOA 4GDBA 2VEAA 4CQHA 2ZC4B 2EWWA 4E3MA 2VGJA 5A8BA 5HSQA 2EA9A 5I94A 1ZKJA 4R0QA 1GHIA 3OLOA 5KSHA 3QP2A 1ES5A 2FFFB 2IA2A 2PRFA 1FR1A 3K2NA 3PBNA 2V9AA 4DN0A 2Y2MA 3MJQA 2HDQA 5GHYA 1DP8A 1IEMA 1ES2A 2W1RA 2ZQAA 2V8FA 4GW9A 3JYIA 3KSGA 4IUKA 3CMZA 1KGFA 3D72A 1GCEA 1YLYA 3MFDA 3TRCA 4X56A 2J7VA 1STZA 3GQZA 3LY3A 1TD5A 3UMDA 3PBRA 4BBVA 4RYEA 3ITBA 3C7UA 4G3WA 1FILA 4MDZA 3GTCA 2W3EA 2MJ6A 2Q0OA 4FTXA 3OOVA 2HDRA 3Q81A 4JPMA 1OMEA 1VETB 1DJCA 3PR6A 5EVIA 4NKPA 4ZJ2A 5DTTA 4OPYA 1RGZA 3ZHHA 1JWZA 2W3HA 2ZM2A 3T4SA 4HY8A 2G2WA 2V1ZA 2VV8A 1XGIA 2XR0A 1CEGA 5FEGA 2B02A 2QKPA 2HJ9C 4DE1A 3T12B 2W3GA 1XFQA 1H3QA 1PIOA 1TVFA 2Z2LB 1X0OA 1FSYA 1XX2A 2QZ6A 2Y2HA 1NY0A 5CEDA 4OQIA 4EESA 3CZDA 1PNEA 3G32A 1K25A 3ULFA 3OCNA 3BFCA 4F94A 4KQDA 2C6WB 4WYYA 3UMEA 3HJKA 3OPHA 1NLZA 1VM1A 4LFUA 1XJ6A 4LV2A 1BZAA 3DW0A 3HLCA 1OT6A 4P6ZS 3JPUA 3N8LA 4GD8A 1OTDA 3T1QB 3C2WA 4IBXA 5GHZA 4JF4A 5M1AA 2K2NA 2PR6A 3UB8A 4PM5A 1QMEA 4G3VA 2JKFA 3N4IA 4O0PA 3VOLA 3O86A 3T4KA 4QJGA 3BECA 2KOIA 4PM8A 2EXAA 2B5RA 3GRJA 3N8RA 4X69A 3RXXA 3VE3A 1FSWA 5K5BA 2WGVA 2WZZA 1GSXA 4MBKA 4JXSA 3UE0A 2PU2A 4OPQA 3GDIA 3ZVWA 2WKIA 2V8CA 3ZFZA 4HP9A 3ZDJA 5HPFA 4CLCA 5EOOA 2PBDP 3IT9A 4OQHA 3CUEC 3SH9A 3LIFA 3IBJA 3MMHA 1ZTUA 4S2MA 4XUZA 3HLEA 4HH3A 1E3UD 3NCKA 4O8GA 2X01A 1N9BA 4PM7A 3BRMA 2V20A 3E4QA 2PHYA 4OH0A 1K6SA 2ZBBA 3QNCA 4WLAA 1Z6FA 3O88A 3FWLA 1PWGA 5IT5A 2PT7A 2FZ0A 1PI4A 3QP8A 4MNRA 4DKIA 3LFVA 2ZM0A 2HF6A 2J80A 5AQ9A 3FKWA 1K56A 4FSFA 1WYBA 4R1GA 3G6OA 5F6AA 2VZWA 3LR0A 1L0FA 1D1JA 1ODVA 2XDMA 4R23A 4ID4A 1YLPA 4YNRA 1H8MA 1TS8A 2H28A 3VFHA 4GHIA 1XKZA 3IH8A 4KZ5A 2JKRM 4E6XA 1MWSA 3IWIA 3OC2A 1WE4A 3BY8A 4I39A 3SOIA 3T4TA 5A91A 3IBRA 3SZTA 3TSGA 2B18A 2KLIA 3PAGA 1S66L 3FKVA 4XUXA 3BM6A 3W2ZA 1TS0A 3S22A 2V0UA 2R78A 3PBOA 4B93A 2ZMAA 1CK3A 3UPNA 1ESUA 4JBFA 4PAUA 4S2NC 2GNXA 3VV4A 5FATA 4E04A 3LCEA 3M6HA 4UA9A 2XA7S 3MXQA 4CJNA 4NXBA 1MC0A 5HWVA 4BL3A 4NK3A 3RXWA 3UPOA 2ZC6B 5C5KA 3SS3A 4R3JA 4ETXA 4FCFA 2QJ7A 3IWQA 2JKTM 1IYSA 1I2SA 5FDSA 1PW1A 4LENA 3W4PA 1F2KA 5HWWA 1LL5A 2D02A 2YKHA 4HJ6A 2VX8A 1MWRA 5EVIB 4A5RA 1W8QA 3CAXA 4BD1A 3PHYA 3ICYA 1SDEA 1VETA 1JNUA 2XRNA 4ESPA 3SH8A 5F1GA 4WMCD 1OTAA 3FPWA 4KQQA 1W5DA 2QPNA 3L9KA 3D4FA 4X53A 5AQ7A 3TW8A 4N92A 3ZG9B 4HOIA 2EFUA 4NXFA 3B47A 2HPBA 4Y3IA 3DWKA 1IELA 4Y0TA 3D3OA 4C6YA 4U0XA 5FI2A 3NHQA 1DP9A 4EXOA 2G7UA 2FFYA 4IBRA 3CWFA 4YFMA 1YMXA 3VSLA 1BLHA 4OLDA 3N8SA 3KX0X 5J8XA 3S7PA 2J8YA 5DF9A 5EVEA 4YWZA 3MBZA 5GHXA 5DFXA 4LV0A 4HEFA 1I5QA 1MPLA 2JKGA 3W4QA 3WS4A 3SW1A 4DXBA 2KDKA 3MKEA 4MMNA 4KUOA 3HLBA 4CLCB 1RGYA 3BJNA 2JN7A 4Y15A 4HIAA 1NYMA 2I9VA 4RX3A 1C3BA 1HZOA 1NZUA 5GLAA 1OTIA 2ZOHA 4UQIM 2OSUA 3KO6A 2Y2GA 3DTMA 1S6RA 3MR0A 4Y2FA 2BTFP 1DJBA 1DP6A 3V67A 1AWIA 4B88A 5EOEA 4DE3A 3PTEA 1G68A 1V9YA 1PZPA 4E3IA 4Q8IA 5IS1A 1S4RA 2KX6A 1TS7A 1SKFA 3GR2A 3NOPC 4OQ0A 1W7FA 1G6OA 2GDNA 4X1LA 4OKPA 1K6RA 4O01A 1LI0A 3VP3A 1E4DA 1OTEA 4X68A 1XP4A 3V3SA 4NG2A 2Y2PA 2EFXA 1CI8A 4MN7A 4EBNA 4Q0HA 1LLBA 2OWHA 2P08A 4IUHA 5GLDA 2OOLA 3C4OA 5CGWA 1PFLA 4BLMA 4KZ3A 4UHUA 2VGLS 3IH9A 1FCOA 1CQAA 3RTYA 1NRJA 4S2LA 5FEFA 1GSVA 1YSQA 4X6TA 5HWTA 3OCLA 4KQRA 4E6WA 3A3EA 4H8RA 1EI5A 1JTDA 2DRWA 2ZD8A 2IWDA 2RCXA 3C4PA 3P98A 2WKQA 1H0MA 3DBAA 3UN7A 2QHKA 4KG2A 1KDSA 3UO9A 4B9OA 2Q9MA 4PKYA 5EM0A 3CPTA 2INWA 5L07A 2V0WA 1SZVA 3VSKA 2Z6CA 4DMZA 2X02A 5I5LA 4OVDA 3IWOA 1YLJA 2ZLYA 2HP6A 2Y59A 3K3CA 2O9AA 4WZ4A 2JE5A 2Y2IA 4LV1A 4WZ5A 5HL6A 5HL1A 4HBTA 2WGIA 1OT9A 3SS4A 1VEUA 3V39A 3UE6A 4PKYG 4BQMA 4K0WA 4S2IA 2HDSA 4DDYA 2WKRA 1ONGA 1UGUA 3KYZA 5HAPA 3OBFA 4H6JA 3CHWP 3JVVA 5CRFA 2HP9A 4XT2B 5CXWA 3H82A 5U47A 1S0WA 1E3UA 5F5YA 1VB6A 2IWBA 5EE8A 5AQAA 1S1ZA 4P6ZM 3DWZA 4HJ4A 2JCHA 1LSWA 4R70A 5FA7A 2BLSA 4U3TA 2OV5A 3KSIA 4LRYC 3A3JA 4E3LA 2W27A 3HLWA 1JVJA 2ZQ8A 3MFXA 4ZJ3A 1OTBA 2JC7A 3P09A 1K55C 1LL9A 5CTNA 5FQJA 4EW7A 1XPBA 1CJFA 3VE4A 2L0WA 1SDNA 5KZHA 3E2LA 5HDSA 1F98A 1MKIA 2P74A 3GV9A 1PRQA 3MF0A 1V9ZA 4HH2A 4HI4A 1YMSA 3ZG5A 1MXOA 3JVUA 1OJ5A 3B3XA 5F69A 3VP0A 2PD7A 3E4OA 2Z6DA 5F1FA 1ALQA 2VLGA 3DTEA 3PAEA 2ZMFA 5E43A 1YT4A 1MKMA 1MZUA 4KG6A 3Q82A 2CMNA 2XLNA 4DRTA 1SKOA 3CLOA 4OOYA 2WKEA 4X55A 3CJMA 1NZOA 4QD4A 3NDGA 4Y0OA 2ZQCA 3G2ZA 5AQBA 1O07A 4WEKA 4X25A 4ETZA 5FQMA 1DRMA 1ESIA 1UWPX 4GCZA 5EFWA 2WKHA 1K38A 1XJ2A 1CF0A 3NY4A 1NLYA 5FASA 5GLCA 4QY6A 1BUEA 1IYQA 2V2FF 1XJ4A 4IVKA 1N9NA 5TR7A 1TS6A 4EQIA 5G4YA 3Q07A 4WMCA 2O9BA 4GJ4A 3M2JA 4OPZA 3MXSA 3IS2A 4QY5A 2EX9A 2I72A 1TDGA 1K55A 2GJ3A 2Q9NA 2A2LA 4E3OA 4LGWA 4AFIA 4ZBEA 2XK1A 1NYYA 1K54C 3IXGA 4GD6A 3WS1A 2VGKA 3LIEA 5FDHA 4GNUA 4BJPA 4WF0A 5BOHA 1YSPA 3A0RA 4BENA 3LUQA 1ZG6A 1VHMA 1SCWA 1PWDA 1U60A 4MBFA 2GX5A 4NXGA 2QYBA 2V1BA 4UEYA 3T4JA 3ZG0A 5CECA 2XF3A 2O9CA 2K7SA 3VP1A 3R7WA 5L2FA 1EWZA 3MZEA 3A3FA 4II7A 3NOTC 3BQ8A 3CPTB 3HJIA 2LB5A 4M3KA 3MQ0A 3PYPA 1K4EA 5TFQA 4BBTA 4DE0A 3VP4A 4RQ9A 4HHDA 5CGXA 4N9KA 3PBQA 2H0YA 3T4OA 4ME4A 1L2SA 1VEUB 3MSHA 4D2OA 1F5MA 2QMIA 4FOFA 2NUPC 3NJAA 3RH8B 4Q0JA 3ZYTA 3CUEA 4JGQA 4NETA 4OP8A 2Y2LA 4XXRA 4JXWA 4UAAA 2W0NA 4L9GA 4NEED 4H6JB 3UNWA 3MZFA 1H8YA 3HLFA 1KVLA 1ERQA 1UWNX 1JWPA 4WL9A 3H82B 5HX9A 5HFOA 4U0TA 5HARA 4QB8A 4FUWA 1XFNA 2L4RA 4XT2A 3CI6A 5EV0A 2WAEA 1W63M 2W3DA 4GKUA 4B4ZA 1M40A 3HL9A 5CERA 3GECA 5IU1A 2ZQ9A 4IHQA 3Q7VB 1K54A 2H10A 3WRTA 3FG8A 1P9RA 4MN5A 1PWCA 3C7VA 5G18A 1KDWA 3MZDA 5DVAA 1PI5A 3T4QA 3VP2A 2PYRA 4WN5A 2VK3A 2XGNA 2D01A 1BULA 3ZGAB 3BFGA 2Y55A 1S1YA 3H7WA 3LEQA 1DJAA 1ES3A 4FH2A 2H0TA 4GZBA 1LSXA 4OPRA 2X71A 1NWZA 2XSSA 2ZL1A 2W1TA 3WRZA 1H8ZA 5HD3A 5GLBA 3CG5A 4I38A 1KE0A 5CEBA 3OPLA 1PZOA 4X1MA 3K3DA 4OOMA 2NUTC 2ZOIA 2M7UA 2O0YA 4FD8A 2EX8A 4KZ9A 4BBUA 3F1OA 5AVFA 2J3TC 5DTSA 3V3RA 4MCWA 3IHBA 1P0ZA 4JLFA 1SKOB 4S2NA 4UA6A 1HD8A 3NDEA 4E3KA 5J4EA 4MN6A 3LR3A 4S2OA 3QP6A 5KIZA 1K57C 4O7DA 3FC7A 1L0EA 4EEUA 4HJ3A 5J7EA 1XA7A 2ZQ7A 3ZG8B 1G5UA 1BSGA 3IQAA 4JGRA 5AJGA 2WK0A 3C38A 5FAQA 4OLGA 3AGFA 5DF8A 1YM1A 2VGLM 1YKDA 3MQOA 1XXMA 4C3QA 4WEJA 5FAOA 3E98A 3UPPA 3HLDA 4EWFA 1FCNA 1QMFA 4FH4A 4R6LA 3S4XA 2PR5A 4JXGA 4KZAA 4KENB 4EEPA 3T1SA 3HREA 3M6BA 3BLSA 2ACGA 4KQOA 2QWSA 3WWXA 3G34A 1RP5A 3B42A 3IS2B 1LI9A 4KZBA 1ZHHB 1BLCA 4BWIA 4HNBA 3IF5A 3HUOA
chains in the Genus database with same CATH topology
1N9BA 3ITAA 2BLSA 4U3TA 4RA7A 2OV5A 4PM7A 5CGSA 3HUNA 3BRMA 4IVIA 3UDIA 3G30A 2V20A 1YLZA 3A3JA 2A49A 4E3LA 3Q7ZA 2WGWB 3HLWA 4OH0A 1K6SA 3ZNYA 3LO7A 1JVJA 2WAFA 2ZQ8A 3QNCA 4ZJ3A 4EUZA 3IXDA 3WS5A 1K4FA 5E2HA 5HAQA 1Z6FA 5DF7A 3GVBA 3O88A 4K0XA 4Y0UA 2Y91A 3FWLA 1PWGA 5IHVA 2JC7A 3P09A 1PI4A 1K55C 1LL9A 3BEBA 4ZJ1A 5FQQA 5CTNA 5FQJA 2PBYA 4MNRA 4DKIA 5TGFA 1XPBA 5FI6A 3ZVTA 2ZM0A 1SDNA 5KZHA 4KZ6A 3E2LA 2ZM8A 4K91A 5AQ9A 1MKIA 2P74A 5A93A 3A3IA 3BFFA 3FKWA 3GV9A 5FI7A 3ZCZA 1M6KA 4KZ8A 4YINA 1K56A 2UWXA 4FSFA 1WYCA 3HUMA 1WYBA 1N4OA 3MKFA 1CI9A 1KGGA 4R1GA 4MBHA 3NIAA 2DCFA 4PPRA 1FCMA 3HVFA 1YMSA 4EV4A 4MEZA 3BLMA 1L0FA 4RVAA 1K56D 4LCMA 3IXHA 2XDMA 3N7WA 4ID4A 4R23A 3ZG5A 1MXOA 1YLPA 5M18A 1GA0A 3B3XA 2XQZA 4RX2A 4EBPA 1NRFA 3VP0A 4BL2A 4Z9QA 4WBGA 1XA1A 3VFHA 4P87A 4E3JA 1XKZA 3UE1A 3IH8A 2Y2QA 4CPKA 4KZ5A 5CHJA 4PMAA 5F1FA 4GOGA 1ALQA 3PAEA 5E43A 4E6XA 1YT4A 1Q2PA 1MWSA 3IWIA 2EX2A 3NI9A 1Y54A 3OC2A 1GA9A 1WE4A 4KG6A 4R4SA 2J9OA 2OLUA 4ZAMA 3Q82A 3SOIA 5A91A 3TSGA 1JTGA 2Y2KA 2XLNA 1RCJA 4DRTA 4E3NA 2C5WB 3PAGA 3FKVA 3FZCA 1L0GA 1MBLA 4XUXA 3BM6A 2ZQDA 4OOYA 1BT5A 1BLSA 4JF6A 5DTKA 1NJ4A 3S22A 1HVBA 2WKEA 4X55A 2ZJ9A 4B4XA 1EROA 3CJMA 5KSCA 1FQGA 2JBFA 3VFFA 1NZOA 4QD4A 1ONHA 1W79A 3PBOA 2ZMAA 1CK3A 3NDGA 4R3BA 3ZNTA 3UPNA 4Y0OA 2E8IA 1ESUA 4JBFA 4KG5A 4OONA 2ZQCA 3G2ZA 4S2NC 5AQBA 5FATA 3LCEA 3M6HA 2EX6A 2XEPA 4UA9A 1JWVA 1O07A 4CJNA 2G2UA 3O3VA 4OOLA 4NK3A 3PBTA 4WZ5C 3RXWA 4WEKA 4BL3A 3UPOA 5FQMA 2ZC6B 1ESIA 3SS3A 2R9XA 4R3JA 2OLVA 4FCFA 1GHMA 1IKGA 1BTLA 3IWQA 3W4OA 2WKHA 3MXRA 1K38A 1VQQA 1L0DA 3NY4A 1IYSA 1I2SA 3EQUA 3WS2A 1PW1A 4OP5A 5FASA 3E2KA 2WADA 5GLCA 2R9WA 3HLGA 4QY6A 1BUEA 4LENA 1IYQA 4ZDXA 2V2FF 3IXBA 3W4PA 5FSRA 2A3UA 1KE3A 4IVKA 1LL5A 3G2YA 5TR7A 4EQIA 3AGDA 1GHPA 3Q07A 4BD0A 4WMCA 4UA7A 3Q7VA 1MWRA 5EVIB 1IKIA 3M2JA 4OPZA 4A5RA 5A90A 4PM6A 1W8QA 4BD1A 3MXSA 1XGJA 4IEDA 4QY5A 1SHVA 2EX9A 2I72A 1SDEA 1Q2QA 3VOZA 3IHAA 3SH8A 5F1GA 1TDGA 1K55A 4WMCD 4OQGA 2XD1A 2Q9NA 4KQQA 3VMAA 1FR6A 5FAPA 1W5DA 1W8YA 1ZC2A 4E3OA 1KE4A 2QPNA 4ZBEA 3V5MA 2ZC7A 3BYDA 1KVMA 3D4FA 4X53A 2XK1A 5AQ7A 1NYYA 1K54C 3V50A 4N92A 3ZG9B 3IXGA 3IF6B 4GD6A 3WS1A 2VGKA 2EFUA 2WGWA 4MLLA 5EECA 3TG9A 4QHCA 5E2EA 5FDHA 3NBLA 4GNUA 2Y4AA 3W8KA 5EVIC 4BJPA 5FQ9A 4N1HA 5JYPA 2HPBA 1AXBA 3GMWA 5F82A 4DDSA 3DWKA 3RJUA 1IELA 5BOHA 1CEFA 3C5AA 4QU3A 3SH7A 4BENA 1ZG6A 5CHMA 3S1YA 4Y0TA 4S2PA 4C6YA 1G6AA 4GDNA 4P0MA 4U0XA 1SCWA 1PWDA 1U60A 4MBFA 1PYYA 4S2JA 1KGEA 2XD5A 1MWTA 4KZ7A 4P6BA 3OZHA 3O87A 3UY6A 1I2WA 5FI2A 3ZG0A 3IF6C 5CECA 2XF3A 3TOIA 3VP1A 4DF6A 4DE2A 5L2FA 3OPPA 1EWZA 3AGEA 3MZEA 1K57A 3A3FA 2FFYA 4IBRA 2RL3A 2Y2OA 3FYZA 4YFMA 1YMXA 5HW3A 3VSLA 1BLHA 2WYXA 3QNBA 4M3KA 4OLDA 3SS5A 2P9VB 4EBLA 4JKTA 3N8SA 1K4EA 3G31A 4ZTKA 5TFQA 4DE0A 3ISGA 4N1XA 1IYOA 5J8XA 3VP4A 4GDBA 5CTMA 2J8YA 5DF9A 2ZC4B 5CGXA 4N9KA 3MBZA 3G35A 4E3MA 2VGJA 3PBQA 5GHXA 2H0YA 4WELA 5I94A 1L2SA 1ZKJA 4LV0A 5FQIA 1DY6A 4HEFA 4R0QA 4D2OA 2QMIA 1I5QA 1GHIA 2ZC5B 5KSHA 1MPLA 1YLWA 1ES5A 3W4QA 2FFFB 4NETA 1FR1A 3PBNA 2Y2LA 4OP8A 3WS4A 4DXBA 4XXRA 3MKEA 2Y2MA 4JXWA 4UAAA 2HDQA 4P85A 3HLBA 5GHYA 1IEMA 3Q1FA 3EQVA 1ES2A 1RGYA 1BLPA 3OPRA 3UNWA 3MZFA 1H8YA 3HLFA 2ZQAA 1KVLA 1ERQA 3JYIA 1NYMA 2Y2JA 1C3BA 1HZOA 1JWPA 1KGFA 1NZUA 3CMZA 4JXVA 1GCEA 4RX3A 5GLAA 2WUQA 1YLYA 3MFDA 5HX9A 5HFOA 4X56A 2J7VA 3GQZA 4U0TA 2OSUA 3LY3A 4QB8A 5HARA 2Y2GA 5KMWA 3DTMA 2XH9A 3PBRA 4RYEA 1S6RA 1E25A 2WAEA 3ITBA 4Y7PA 3C7UA 2PU4A 4GKUA 4B4ZA 5EPHA 1DJBA 3GTCA 1M40A 3HL9A 5CERA 4B88A 4HESA 5EOEA 4DE3A 2ZQ9A 1G68A 3PTEA 3LY4A 3Q7VB 2IWCA 3UDFA 1K54A 1IYPA 2H10A 2HDRA 3Q81A 1PZPA 3WRTA 4E3IA 4Q8IA 4JPMA 5E2FA 1OMEA 1LHYA 1PWCA 3C7VA 1DJCA 5G18A 1SKFA 3GR2A 1KDWA 3MZDA 5DVAA 3VOYA 5EVIA 1PI5A 4OQ0A 4ZJ2A 1W7FA 5DTTA 4OPYA 1RGZA 2GDNA 3ZHHA 1JWZA 1ERMA 4OKPA 3WS0A 5D3OA 1K6RA 1LI0A 3VP2A 3VP3A 1E4DA 2ZM2A 4X68A 2G2WA 1XP4A 2HDUA 2V1ZA 3V3SA 1XGIA 2XGNA 2XR0A 1CEGA 5EVID 2Y2PA 3I7JA 1BULA 1O7EA 2EFXA 2J9PA 5CHUA 3A3DA 1CI8A 3ZGAB 1ZG4A 3BFGA 4WM9A 3ZG7B 4EBNA 5HAIA 1LLBA 2Y55A 3IF6A 5GLDA 4DE1A 3N6IA 1DJAA 1ES3A 2Z2MB 3C4OA 2WZXA 2XFSA 4FH2A 5CGWA 1PIOA 1TVFA 2Z2LB 4KZ3A 4S2KA 2H0TA 4UHUA 4BLMA 5JYOA 3IH9A 4GZBA 1FSYA 1FCOA 4OPRA 1XX2A 2QZ6A 2X71A 2Y2HA 1NY0A 5CEDA 4OQIA 4S2LA 3CZDA 3G32A 2CC1A 3WRZA 1K25A 1H8ZA 4N9LA 4X6TA 3OCNA 3BFCA 5GLBA 3OCLA 3CG5A 5FQKA 4F94A 1YLTA 3FV7A 1KE0A 4KQRA 4E6WA 2H5SA 2C6WB 3A3EA 4WYYA 5CEBA 4H8RA 1EI5A 3OPLA 2EXBA 1PZOA 1JTDA 2DRWA 2ZD8A 4OOMA 3OPHA 2IWDA 2RCXA 3C4PA 3P98A 4R4RA 5EVLA 1VM1A 4JF5A 4LV2A 1MWUA 4PM9A 1BZAA 3DW0A 3HLCA 4FD8A 3UN7A 5M19A 4KG2A 1KDSA 3UO9A 3N8LA 4KZ4A 2EX8A 4GD8A 3QHYA 4KZ9A 2Q9MA 2Y2NA 4IBXA 5GHZA 1TDLA 1NXYA 5DTSA 4JF4A 2BG1A 5M1AA 3V3RA 3VSKA 4GB7A 3IHBA 2P9VA 2ZC3B 4JLFA 2X02A 4PM5A 4S2NA 4OVDA 4UA6A 1QMEA 1J9MA 1HD8A 3IWOA 3NDEA 4E3KA 1YLJA 3N4IA 1TEMA 2ZLYA 2XFTA 2HP6A 2Y59A 1MY8A 4S2OA 1H5XA 3PBSA 4WZ4A 1K57C 3O86A 4O7DA 4QJGA 2JE5A 2Y2IA 3BECA 4LV1A 4PM8A 4WZ5A 3UDXA 1PW8A 2EXAA 1L0EA 2B5RA 3GRJA 1XA7A 5HL1A 2ZQ7A 3HBRA 4HBTA 2WGIA 3N8RA 4HBUA 4X69A 3RXXA 3SS4A 1FSWA 3ZG8B 4C75A 2WGVA 5F83A 1HTZA 4LCLA 1BSGA 3V39A 3IQAA 2WZZA 4BQMA 4K0WA 2DNSA 3M2KA 4GN2A 4MBKA 2WK0A 1FOFA 5FAQA 1YQSA 4JXSA 5E2GA 4L0LA 4OLGA 3UE0A 4S2IA 2PU2A 3AGFA 4OPQA 5DF8A 3ZVWA 2HDSA 1YM1A 4DDYA 1ES4A 1XXMA 4C3QA 2WKIA 4WEJA 5FAOA 3ZFZA 3UPPA 3HLDA 4EWFA 1FCNA 1ONGA 3ZDJA 2HP5A 1QMFA 5HAPA 4FH4A 5EOOA 3S4XA 4JXGA 5CRFA 5EUAA 4KZAA 3IT9A 4KENB 4OQHA 3NC8A 2HP9A 5CXWA 3SH9A 3HREA 3M6BA 4LV3A 5U47A 1S0WA 3BLSA 4KQOA 3BFDA 1E3UA 3WWXA 3G34A 1RP5A 2IWBA 5EE8A 4S2MA 1LI9A 4KZBA 4XUZA 5AQAA 3HLEA 5A92A 3DWZA 3BFEA 1BLCA 5GL9A 3LEZA 3GSGA 3G4PA 1E3UD 2JCHA 3NCKA 3IF5A 4DXCA 5FA7A 2X01A 3UE3A 3HUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N9B A;  3ITA A;  2BLS A;  4U3T A;  4RA7 A;  2OV5 A;  4PM7 A;  5CGS A;  3HUN A;  3BRM A;  4IVI A;  3UDI A;  3G30 A;  2V20 A;  1YLZ A;  3A3J A;  2A49 A;  4E3L A;  3Q7Z A;  2WGW B;  3HLW A;  4OH0 A;  1K6S A;  3ZNY A;  3LO7 A;  1JVJ A;  2WAF A;  2ZQ8 A;  3QNC A;  4ZJ3 A;  4EUZ A;  3IXD A;  3WS5 A;  1K4F A;  5E2H A;  5HAQ A;  1Z6F A;  5DF7 A;  3GVB A;  3O88 A;  4K0X A;  4Y0U A;  2Y91 A;  3FWL A;  1PWG A;  5IHV A;  2JC7 A;  3P09 A;  1PI4 A;  1K55 C;  1LL9 A;  3BEB A;  4ZJ1 A;  5FQQ A;  5CTN A;  5FQJ A;  2PBY A;  4MNR A;  4DKI A;  5TGF A;  1XPB A;  5FI6 A;  3ZVT A;  2ZM0 A;  1SDN A;  5KZH A;  4KZ6 A;  3E2L A;  2ZM8 A;  4K91 A;  5AQ9 A;  1MKI A;  2P74 A;  5A93 A;  3A3I A;  3BFF A;  3FKW A;  3GV9 A;  5FI7 A;  3ZCZ A;  1M6K A;  4KZ8 A;  4YIN A;  1K56 A;  2UWX A;  4FSF A;  1WYC A;  3HUM A;  1WYB A;  1N4O A;  3MKF A;  1CI9 A;  1KGG A;  4R1G A;  4MBH A;  3NIA A;  2DCF A;  4PPR A;  1FCM A;  3HVF A;  1YMS A;  4EV4 A;  4MEZ A;  3BLM A;  1L0F A;  4RVA A;  1K56 D;  4LCM A;  3IXH A;  2XDM A;  3N7W A;  4ID4 A;  4R23 A;  3ZG5 A;  1MXO A;  1YLP A;  5M18 A;  1GA0 A;  3B3X A;  2XQZ A;  4RX2 A;  4EBP A;  1NRF A;  3VP0 A;  4BL2 A;  4Z9Q A;  4WBG A;  1XA1 A;  3VFH A;  4P87 A;  4E3J A;  1XKZ A;  3UE1 A;  3IH8 A;  2Y2Q A;  4CPK A;  4KZ5 A;  5CHJ A;  4PMA A;  5F1F A;  4GOG A;  1ALQ A;  3PAE A;  5E43 A;  4E6X A;  1YT4 A;  1Q2P A;  1MWS A;  3IWI A;  2EX2 A;  3NI9 A;  1Y54 A;  3OC2 A;  1GA9 A;  1WE4 A;  4KG6 A;  4R4S A;  2J9O A;  2OLU A;  4ZAM A;  3Q82 A;  3SOI A;  5A91 A;  3TSG A;  1JTG A;  2Y2K A;  2XLN A;  1RCJ A;  4DRT A;  4E3N A;  2C5W B;  3PAG A;  3FKV A;  3FZC A;  1L0G A;  1MBL A;  4XUX A;  3BM6 A;  2ZQD A;  4OOY A;  1BT5 A;  1BLS A;  4JF6 A;  5DTK A;  1NJ4 A;  3S22 A;  1HVB A;  2WKE A;  4X55 A;  2ZJ9 A;  4B4X A;  1ERO A;  3CJM A;  5KSC A;  1FQG A;  2JBF A;  3VFF A;  1NZO A;  4QD4 A;  1ONH A;  1W79 A;  3PBO A;  2ZMA A;  1CK3 A;  3NDG A;  4R3B A;  3ZNT A;  3UPN A;  4Y0O A;  2E8I A;  1ESU A;  4JBF A;  4KG5 A;  4OON A;  2ZQC A;  3G2Z A;  4S2N C;  5AQB A;  5FAT A;  3LCE A;  3M6H A;  2EX6 A;  2XEP A;  4UA9 A;  1JWV A;  1O07 A;  4CJN A;  2G2U A;  3O3V A;  4OOL A;  4NK3 A;  3PBT A;  4WZ5 C;  3RXW A;  4WEK A;  4BL3 A;  3UPO A;  5FQM A;  2ZC6 B;  1ESI A;  3SS3 A;  2R9X A;  4R3J A;  2OLV A;  4FCF A;  1GHM A;  1IKG A;  1BTL A;  3IWQ A;  3W4O A;  2WKH A;  3MXR A;  1K38 A;  1VQQ A;  1L0D A;  3NY4 A;  1IYS A;  1I2S A;  3EQU A;  3WS2 A;  1PW1 A;  4OP5 A;  5FAS A;  3E2K A;  2WAD A;  5GLC A;  2R9W A;  3HLG A;  4QY6 A;  1BUE A;  4LEN A;  1IYQ A;  4ZDX A;  2V2F F;  3IXB A;  3W4P A;  5FSR A;  2A3U A;  1KE3 A;  4IVK A;  1LL5 A;  3G2Y A;  5TR7 A;  4EQI A;  3AGD A;  1GHP A;  3Q07 A;  4BD0 A;  4WMC A;  4UA7 A;  3Q7V A;  1MWR A;  5EVI B;  1IKI A;  3M2J A;  4OPZ A;  4A5R A;  5A90 A;  4PM6 A;  1W8Q A;  4BD1 A;  3MXS A;  1XGJ A;  4IED A;  4QY5 A;  1SHV A;  2EX9 A;  2I72 A;  1SDE A;  1Q2Q A;  3VOZ A;  3IHA A;  3SH8 A;  5F1G A;  1TDG A;  1K55 A;  4WMC D;  4OQG A;  2XD1 A;  2Q9N A;  4KQQ A;  3VMA A;  1FR6 A;  5FAP A;  1W5D A;  1W8Y A;  1ZC2 A;  4E3O A;  1KE4 A;  2QPN A;  4ZBE A;  3V5M A;  2ZC7 A;  3BYD A;  1KVM A;  3D4F A;  4X53 A;  2XK1 A;  5AQ7 A;  1NYY A;  1K54 C;  3V50 A;  4N92 A;  3ZG9 B;  3IXG A;  3IF6 B;  4GD6 A;  3WS1 A;  2VGK A;  2EFU A;  2WGW A;  4MLL A;  5EEC A;  3TG9 A;  4QHC A;  5E2E A;  5FDH A;  3NBL A;  4GNU A;  2Y4A A;  3W8K A;  5EVI C;  4BJP A;  5FQ9 A;  4N1H A;  5JYP A;  2HPB A;  1AXB A;  3GMW A;  5F82 A;  4DDS A;  3DWK A;  3RJU A;  1IEL A;  5BOH A;  1CEF A;  3C5A A;  4QU3 A;  3SH7 A;  4BEN A;  1ZG6 A;  5CHM A;  3S1Y A;  4Y0T A;  4S2P A;  4C6Y A;  1G6A A;  4GDN A;  4P0M A;  4U0X A;  1SCW A;  1PWD A;  1U60 A;  4MBF A;  1PYY A;  4S2J A;  1KGE A;  2XD5 A;  1MWT A;  4KZ7 A;  4P6B A;  3OZH A;  3O87 A;  3UY6 A;  1I2W A;  5FI2 A;  3ZG0 A;  3IF6 C;  5CEC A;  2XF3 A;  3TOI A;  3VP1 A;  4DF6 A;  4DE2 A;  5L2F A;  3OPP A;  1EWZ A;  3AGE A;  3MZE A;  1K57 A;  3A3F A;  2FFY A;  4IBR A;  2RL3 A;  2Y2O A;  3FYZ A;  4YFM A;  1YMX A;  5HW3 A;  3VSL A;  1BLH A;  2WYX A;  3QNB A;  4M3K A;  4OLD A;  3SS5 A;  2P9V B;  4EBL A;  4JKT A;  3N8S A;  1K4E A;  3G31 A;  4ZTK A;  5TFQ A;  4DE0 A;  3ISG A;  4N1X A;  1IYO A;  5J8X A;  3VP4 A;  4GDB A;  5CTM A;  2J8Y A;  5DF9 A;  2ZC4 B;  5CGX A;  4N9K A;  3MBZ A;  3G35 A;  4E3M A;  2VGJ A;  3PBQ A;  5GHX A;  2H0Y A;  4WEL A;  5I94 A;  1L2S A;  1ZKJ A;  4LV0 A;  5FQI A;  1DY6 A;  4HEF A;  4R0Q A;  4D2O A;  2QMI A;  1I5Q A;  1GHI A;  2ZC5 B;  5KSH A;  1MPL A;  1YLW A;  1ES5 A;  3W4Q A;  2FFF B;  4NET A;  1FR1 A;  3PBN A;  2Y2L A;  4OP8 A;  3WS4 A;  4DXB A;  4XXR A;  3MKE A;  2Y2M A;  4JXW A;  4UAA A;  2HDQ A;  4P85 A;  3HLB A;  5GHY A;  1IEM A;  3Q1F A;  3EQV A;  1ES2 A;  1RGY A;  1BLP A;  3OPR A;  3UNW A;  3MZF A;  1H8Y A;  3HLF A;  2ZQA A;  1KVL A;  1ERQ A;  3JYI A;  1NYM A;  2Y2J A;  1C3B A;  1HZO A;  1JWP A;  1KGF A;  1NZU A;  3CMZ A;  4JXV A;  1GCE A;  4RX3 A;  5GLA A;  2WUQ A;  1YLY A;  3MFD A;  5HX9 A;  5HFO A;  4X56 A;  2J7V A;  3GQZ A;  4U0T A;  2OSU A;  3LY3 A;  4QB8 A;  5HAR A;  2Y2G A;  5KMW A;  3DTM A;  2XH9 A;  3PBR A;  4RYE A;  1S6R A;  1E25 A;  2WAE A;  3ITB A;  4Y7P A;  3C7U A;  2PU4 A;  4GKU A;  4B4Z A;  5EPH A;  1DJB A;  3GTC A;  1M40 A;  3HL9 A;  5CER A;  4B88 A;  4HES A;  5EOE A;  4DE3 A;  2ZQ9 A;  1G68 A;  3PTE A;  3LY4 A;  3Q7V B;  2IWC A;  3UDF A;  1K54 A;  1IYP A;  2H10 A;  2HDR A;  3Q81 A;  1PZP A;  3WRT A;  4E3I A;  4Q8I A;  4JPM A;  5E2F A;  1OME A;  1LHY A;  1PWC A;  3C7V A;  1DJC A;  5G18 A;  1SKF A;  3GR2 A;  1KDW A;  3MZD A;  5DVA A;  3VOY A;  5EVI A;  1PI5 A;  4OQ0 A;  4ZJ2 A;  1W7F A;  5DTT A;  4OPY A;  1RGZ A;  2GDN A;  3ZHH A;  1JWZ A;  1ERM A;  4OKP A;  3WS0 A;  5D3O A;  1K6R A;  1LI0 A;  3VP2 A;  3VP3 A;  1E4D A;  2ZM2 A;  4X68 A;  2G2W A;  1XP4 A;  2HDU A;  2V1Z A;  3V3S A;  1XGI A;  2XGN A;  2XR0 A;  1CEG A;  5EVI D;  2Y2P A;  3I7J A;  1BUL A;  1O7E A;  2EFX A;  2J9P A;  5CHU A;  3A3D A;  1CI8 A;  3ZGA B;  1ZG4 A;  3BFG A;  4WM9 A;  3ZG7 B;  4EBN A;  5HAI A;  1LLB A;  2Y55 A;  3IF6 A;  5GLD A;  4DE1 A;  3N6I A;  1DJA A;  1ES3 A;  2Z2M B;  3C4O A;  2WZX A;  2XFS A;  4FH2 A;  5CGW A;  1PIO A;  1TVF A;  2Z2L B;  4KZ3 A;  4S2K A;  2H0T A;  4UHU A;  4BLM A;  5JYO A;  3IH9 A;  4GZB A;  1FSY A;  1FCO A;  4OPR A;  1XX2 A;  2QZ6 A;  2X71 A;  2Y2H A;  1NY0 A;  5CED A;  4OQI A;  4S2L A;  3CZD A;  3G32 A;  2CC1 A;  3WRZ A;  1K25 A;  1H8Z A;  4N9L A;  4X6T A;  3OCN A;  3BFC A;  5GLB A;  3OCL A;  3CG5 A;  5FQK A;  4F94 A;  1YLT A;  3FV7 A;  1KE0 A;  4KQR A;  4E6W A;  2H5S A;  2C6W B;  3A3E A;  4WYY A;  5CEB A;  4H8R A;  1EI5 A;  3OPL A;  2EXB A;  1PZO A;  1JTD A;  2DRW A;  2ZD8 A;  4OOM A;  3OPH A;  2IWD A;  2RCX A;  3C4P A;  3P98 A;  4R4R A;  5EVL A;  1VM1 A;  4JF5 A;  4LV2 A;  1MWU A;  4PM9 A;  1BZA A;  3DW0 A;  3HLC A;  4FD8 A;  3UN7 A;  5M19 A;  4KG2 A;  1KDS A;  3UO9 A;  3N8L A;  4KZ4 A;  2EX8 A;  4GD8 A;  3QHY A;  4KZ9 A;  2Q9M A;  2Y2N A;  4IBX A;  5GHZ A;  1TDL A;  1NXY A;  5DTS A;  4JF4 A;  2BG1 A;  5M1A A;  3V3R A;  3VSK A;  4GB7 A;  3IHB A;  2P9V A;  2ZC3 B;  4JLF A;  2X02 A;  4PM5 A;  4S2N A;  4OVD A;  4UA6 A;  1QME A;  1J9M A;  1HD8 A;  3IWO A;  3NDE A;  4E3K A;  1YLJ A;  3N4I A;  1TEM A;  2ZLY A;  2XFT A;  2HP6 A;  2Y59 A;  1MY8 A;  4S2O A;  1H5X A;  3PBS A;  4WZ4 A;  1K57 C;  3O86 A;  4O7D A;  4QJG A;  2JE5 A;  2Y2I A;  3BEC A;  4LV1 A;  4PM8 A;  4WZ5 A;  3UDX A;  1PW8 A;  2EXA A;  1L0E A;  2B5R A;  3GRJ A;  1XA7 A;  5HL1 A;  2ZQ7 A;  3HBR A;  4HBT A;  2WGI A;  3N8R A;  4HBU A;  4X69 A;  3RXX A;  3SS4 A;  1FSW A;  3ZG8 B;  4C75 A;  2WGV A;  5F83 A;  1HTZ A;  4LCL A;  1BSG A;  3V39 A;  3IQA A;  2WZZ A;  4BQM A;  4K0W A;  2DNS A;  3M2K A;  4GN2 A;  4MBK A;  2WK0 A;  1FOF A;  5FAQ A;  1YQS A;  4JXS A;  5E2G A;  4L0L A;  4OLG A;  3UE0 A;  4S2I A;  2PU2 A;  3AGF A;  4OPQ A;  5DF8 A;  3ZVW A;  2HDS A;  1YM1 A;  4DDY A;  1ES4 A;  1XXM A;  4C3Q A;  2WKI A;  4WEJ A;  5FAO A;  3ZFZ A;  3UPP A;  3HLD A;  4EWF A;  1FCN A;  1ONG A;  3ZDJ A;  2HP5 A;  1QMF A;  5HAP A;  4FH4 A;  5EOO A;  3S4X A;  4JXG A;  5CRF A;  5EUA A;  4KZA A;  3IT9 A;  4KEN B;  4OQH A;  3NC8 A;  2HP9 A;  5CXW A;  3SH9 A;  3HRE A;  3M6B A;  4LV3 A;  5U47 A;  1S0W A;  3BLS A;  4KQO A;  3BFD A;  1E3U A;  3WWX A;  3G34 A;  1RP5 A;  2IWB A;  5EE8 A;  4S2M A;  1LI9 A;  4KZB A;  4XUZ A;  5AQA A;  3HLE A;  5A92 A;  3DWZ A;  3BFE A;  1BLC A;  5GL9 A;  3LEZ A;  3GSG A;  3G4P A;  1E3U D;  2JCH A;  3NCK A;  3IF5 A;  4DXC A;  5FA7 A;  2X01 A;  3UE3 A;  3HUO A; 
#chains in the Genus database with same CATH topology
 3ITA A;  1S67 L;  4RA7 A;  5CGS A;  3HUN A;  4ZRR A;  3UDI A;  1BYW A;  3G30 A;  3IX4 A;  1YLZ A;  3E0Y A;  2HV1 A;  2A49 A;  3LID A;  3S7Q A;  4EUZ A;  3LO7 A;  1F9I A;  3EEH A;  3WS5 A;  1K4F A;  5E2H A;  3GVB A;  2VKS A;  4K0X A;  4Y0U A;  2VJW A;  1T1B A;  5IHV A;  2VV6 A;  1TF1 A;  1LSV A;  3F1N A;  1YPR A;  5TGF A;  5DJT A;  3ZVT A;  1XJ3 A;  2ZM8 A;  5A93 A;  3BFF A;  1D06 A;  3P01 A;  2EWV A;  3R7W B;  3HUM A;  3S7O A;  1N4O A;  3MKF A;  2JKR I;  3NIA A;  2DCF A;  3NUL A;  1FCM A;  4PPR A;  4LCM A;  2VV7 A;  1LT0 A;  2B95 A;  2J3W A;  2XQZ A;  1S4S A;  4Z9Q A;  1WA9 A;  1XA1 A;  4P87 A;  5AVE A;  2Y2Q A;  5EM1 A;  2EX2 A;  5L10 A;  1Y54 A;  1GA9 A;  4R4S A;  2J9O A;  2OLU A;  4ZAM A;  1JTG A;  2Y2K A;  4E3N A;  2C5W B;  1L0G A;  1MBL A;  3UB5 P;  1BLS A;  4JF6 A;  1A0K A;  3NEC A;  5DTK A;  2ZJ9 A;  3O5Y A;  1ERO A;  5KSC A;  3VFF A;  2JKT I;  4DJ2 A;  3ZNT A;  2E8I A;  2EX6 A;  2XEP A;  1JWV A;  3O3V A;  3PBT A;  5HPI A;  2R9X A;  3T1R A;  2OLV A;  1GHM A;  4NXE A;  1BTL A;  3EEA A;  4BMW A;  3MXR A;  1L0D A;  4QPR A;  4F3L A;  3EQU A;  4OP5 A;  3HLG A;  4I3A A;  4ZDX A;  5HZH A;  5FSR A;  2A3U A;  2L1M A;  2M1C A;  3AGD A;  4BD0 A;  4UA7 A;  2WKP A;  3Q7V A;  3C8C A;  5A90 A;  4CLC C;  2JHE A;  1XGJ A;  4IED A;  1SHV A;  4G3K A;  3VOZ A;  3QP5 A;  1Y28 A;  4JGP A;  4LRZ E;  5FAP A;  1ZC2 A;  1KE4 A;  3H9W A;  3BYD A;  3EWK A;  1KVM A;  3H7W B;  2WGW A;  4MLL A;  3TG9 A;  2Y4A A;  5FQ9 A;  1ACF A;  3BQA A;  4N1H A;  5LBR A;  5JYP A;  1AXB A;  3GMW A;  4DDS A;  3RJU A;  3A0V A;  1N9L A;  3C5A A;  4QU3 A;  3SH7 A;  2ZL1 B;  2W1T B;  3EGX C;  4S2P A;  4P0M A;  4S2J A;  1MWT A;  4K08 A;  4LPZ A;  3D9Y A;  4P6B A;  3UY6 A;  1I2W A;  3IF6 C;  4DF6 A;  2J3T D;  4DE2 A;  1P97 A;  3OPP A;  1OPX A;  2RL3 A;  5DKK A;  3F1O B;  5MC7 A;  2WYX A;  3QNB A;  2PYP A;  2E8J A;  3SS5 A;  4EBL A;  4EU0 A;  3ZQ5 A;  3ISG A;  3IX3 A;  1W63 Q;  5L8M A;  5CTM A;  1OJG A;  3G35 A;  2HJE A;  4WEL A;  5DFY A;  4EET B;  5FL3 A;  5FQI A;  1DY6 A;  5TJJ A;  2ZC5 B;  1YLW A;  1G28 A;  5DKL A;  4EER A;  4P85 A;  2OAQ 1;  2ZMV A;  3Q1F A;  3EQV A;  1BLP A;  3OPR A;  3F1P A;  2Y2J A;  4JXV A;  2WUQ A;  4ARZ A;  5KMW A;  2XH9 A;  1E25 A;  4Y7P A;  2PU4 A;  3QP1 A;  5EPH A;  4GS9 A;  4EUV A;  3DTI A;  4HES A;  3LY4 A;  2IWC A;  3UDF A;  1IYP A;  5E2F A;  1LHY A;  4L9F A;  4QWO A;  2PAV P;  3VOY A;  2UV0 E;  2DMW A;  3IX8 A;  3LIC A;  1ERM A;  3WS0 A;  5D3O A;  3BWL A;  3LYX A;  2HDU A;  5CX7 A;  5EVI D;  3I7J A;  3CIT A;  1O7E A;  2J9P A;  5CHU A;  2XRO A;  3A3D A;  3F1N B;  4Q0I A;  1ZG4 A;  4WM9 A;  3ZG7 B;  5HAI A;  3KYQ A;  3IF6 A;  1K0K A;  3N6I A;  4WUJ A;  2A24 B;  2Z2M B;  2BAS A;  2XA7 M;  2WZX A;  2XFS A;  1T1A A;  4GLQ A;  4S2K A;  5JYO A;  3LI8 A;  4IJG A;  3UB6 A;  3NOU C;  2CC1 A;  1KOU A;  4N9L A;  3P7N A;  5FQK A;  1YLT A;  3FV7 A;  2H5S A;  2VA0 A;  3BY9 A;  3KSH A;  2EXB A;  5TBM A;  3QP4 A;  4R4R A;  5EVL A;  2LB9 A;  1T19 A;  4JF5 A;  1MWU A;  4PM9 A;  1FIK A;  5M19 A;  1T1C A;  4KZ4 A;  3KSF A;  3QHY A;  2Y2N A;  1TDL A;  2QJ5 A;  1NXY A;  2BG1 A;  4R38 A;  4GB7 A;  3HCY A;  2P9V A;  2ZC3 B;  1J9M A;  1TEM A;  2XFT A;  1MY8 A;  1H5X A;  3PBS A;  4M4X A;  3UDX A;  1PW8 A;  3U4L P;  3HBR A;  4HBU A;  4C75 A;  5F83 A;  1HTZ A;  4LCL A;  5L09 A;  2FH5 A;  2DNS A;  3M2K A;  4GN2 A;  1FOF A;  1YQS A;  5E2G A;  4L0L A;  2GZA A;  1ES4 A;  2K31 A;  3S7N A;  2HP5 A;  5F68 A;  4F3L B;  1YAX A;  5EUA A;  4Y5F A;  3T1X A;  3NC8 A;  4CLC D;  2PDR A;  4LV3 A;  2AVX A;  3TJZ C;  3BFD A;  4L9E A;  4EQ1 A;  5A92 A;  3BFE A;  5GL9 A;  4Y17 A;  3LEZ A;  3GSG A;  3G4P A;  3LR5 A;  2YKF A;  1P9W A;  4DXC A;  3UE3 A;  1N9O A;  3B33 A;  4IVI A;  4I5S A;  3DAV A;  1HLU P;  3Q7Z A;  2WGW B;  4PHT A;  3ZNY A;  2WAF A;  3IXD A;  3U2A A;  5HAQ A;  1L3L A;  5HD5 A;  5DF7 A;  1Z09 A;  2Y91 A;  2P7J A;  4ZJ1 A;  1T18 A;  3BEB A;  5FQQ A;  2PBY A;  5FI6 A;  3LR4 A;  4LLO B;  3MS6 A;  4KZ6 A;  4K91 A;  3A3I A;  5FI7 A;  3RFB A;  3ZCZ A;  1M6K A;  2O99 A;  4KZ8 A;  4YIN A;  4Y13 A;  2UWX A;  2HGV A;  1WYC A;  1CI9 A;  1KGG A;  4MBH A;  3HVF A;  4EV4 A;  4MEZ A;  3BLM A;  4RVA A;  1K56 D;  5G4Z A;  3IXH A;  3C30 A;  3N7W A;  5M18 A;  2OAP 1;  3A0S A;  4I3I A;  1GA0 A;  2P04 A;  4KUK A;  3LGO A;  2Y8H A;  4RX2 A;  4EBP A;  1NRF A;  4BL2 A;  4WBG A;  4E3J A;  3UE1 A;  4CPK A;  5CHJ A;  3LIA A;  4PMA A;  4GOG A;  1Q2P A;  3NI9 A;  3LIB A;  3L7H A;  1RCJ A;  3FZC A;  2ZQD A;  3EOI A;  1BT5 A;  4HP4 A;  1NJ4 A;  1HVB A;  4B4X A;  1FQG A;  1GSW A;  2JBF A;  1ONH A;  1W79 A;  4LRX C;  4R3B A;  3EGD C;  4KG5 A;  4OON A;  3F1P B;  3UB9 A;  4ARZ B;  2G2U A;  4DJ3 A;  4OOL A;  4WZ5 C;  1IFQ A;  2HZ5 A;  4D60 A;  3TE8 A;  3UB7 A;  1IKG A;  3W4O A;  4YOF A;  1VQQ A;  4GS9 B;  3PXP A;  5HDC A;  3WS2 A;  3E2K A;  2WAD A;  2R9W A;  3IXB A;  1Y4O A;  2W3F A;  1KE3 A;  3G2Y A;  1GHP A;  1IKI A;  4PM6 A;  3MQQ A;  3BW6 A;  2OWJ A;  1Q2Q A;  3IHA A;  1IOU A;  4OQG A;  2XD1 A;  3VMA A;  1FR6 A;  1W8Y A;  3V5M A;  2ZC7 A;  5J3W A;  2Y79 A;  3E4P A;  3V50 A;  3IF6 B;  2M7V A;  5EEC A;  4QHC A;  1J3W A;  5E2E A;  3NBL A;  3W8K A;  2PD8 A;  5EVI C;  5F82 A;  3DTK A;  1CEF A;  1D7E A;  1LL8 A;  3FPV A;  2A24 A;  3S1Y A;  5CHM A;  5HDD A;  4CLC E;  1G6A A;  3LI9 A;  4GDN A;  1EW0 A;  3R4K A;  4R3A A;  4I3J A;  1PYY A;  1KGE A;  2XD5 A;  4KZ7 A;  3KYE A;  3OZH A;  3O87 A;  5TBM B;  5DJU A;  2V1A A;  4UQI S;  4Z1W A;  3T50 A;  3TOI A;  3T4L A;  3AGE A;  1K57 A;  2Y2O A;  3FYZ A;  5HW3 A;  4HQA A;  2P9V B;  4JKT A;  4JGO A;  4GHI B;  3G31 A;  4ZTK A;  4N1X A;  1IYO A;  4GDB A;  2VEA A;  4CQH A;  2ZC4 B;  2EWW A;  4E3M A;  2VGJ A;  5A8B A;  5HSQ A;  2EA9 A;  5I94 A;  1ZKJ A;  4R0Q A;  1GHI A;  3OLO A;  5KSH A;  3QP2 A;  1ES5 A;  2FFF B;  2IA2 A;  2PRF A;  1FR1 A;  3K2N A;  3PBN A;  2V9A A;  4DN0 A;  2Y2M A;  3MJQ A;  2HDQ A;  5GHY A;  1DP8 A;  1IEM A;  1ES2 A;  2W1R A;  2ZQA A;  2V8F A;  4GW9 A;  3JYI A;  3KSG A;  4IUK A;  3CMZ A;  1KGF A;  3D72 A;  1GCE A;  1YLY A;  3MFD A;  3TRC A;  4X56 A;  2J7V A;  1STZ A;  3GQZ A;  3LY3 A;  1TD5 A;  3UMD A;  3PBR A;  4BBV A;  4RYE A;  3ITB A;  3C7U A;  4G3W A;  1FIL A;  4MDZ A;  3GTC A;  2W3E A;  2MJ6 A;  2Q0O A;  4FTX A;  3OOV A;  2HDR A;  3Q81 A;  4JPM A;  1OME A;  1VET B;  1DJC A;  3PR6 A;  5EVI A;  4NKP A;  4ZJ2 A;  5DTT A;  4OPY A;  1RGZ A;  3ZHH A;  1JWZ A;  2W3H A;  2ZM2 A;  3T4S A;  4HY8 A;  2G2W A;  2V1Z A;  2VV8 A;  1XGI A;  2XR0 A;  1CEG A;  5FEG A;  2B02 A;  2QKP A;  2HJ9 C;  4DE1 A;  3T12 B;  2W3G A;  1XFQ A;  1H3Q A;  1PIO A;  1TVF A;  2Z2L B;  1X0O A;  1FSY A;  1XX2 A;  2QZ6 A;  2Y2H A;  1NY0 A;  5CED A;  4OQI A;  4EES A;  3CZD A;  1PNE A;  3G32 A;  1K25 A;  3ULF A;  3OCN A;  3BFC A;  4F94 A;  4KQD A;  2C6W B;  4WYY A;  3UME A;  3HJK A;  3OPH A;  1NLZ A;  1VM1 A;  4LFU A;  1XJ6 A;  4LV2 A;  1BZA A;  3DW0 A;  3HLC A;  1OT6 A;  4P6Z S;  3JPU A;  3N8L A;  4GD8 A;  1OTD A;  3T1Q B;  3C2W A;  4IBX A;  5GHZ A;  4JF4 A;  5M1A A;  2K2N A;  2PR6 A;  3UB8 A;  4PM5 A;  1QME A;  4G3V A;  2JKF A;  3N4I A;  4O0P A;  3VOL A;  3O86 A;  3T4K A;  4QJG A;  3BEC A;  2KOI A;  4PM8 A;  2EXA A;  2B5R A;  3GRJ A;  3N8R A;  4X69 A;  3RXX A;  3VE3 A;  1FSW A;  5K5B A;  2WGV A;  2WZZ A;  1GSX A;  4MBK A;  4JXS A;  3UE0 A;  2PU2 A;  4OPQ A;  3GDI A;  3ZVW A;  2WKI A;  2V8C A;  3ZFZ A;  4HP9 A;  3ZDJ A;  5HPF A;  4CLC A;  5EOO A;  2PBD P;  3IT9 A;  4OQH A;  3CUE C;  3SH9 A;  3LIF A;  3IBJ A;  3MMH A;  1ZTU A;  4S2M A;  4XUZ A;  3HLE A;  4HH3 A;  1E3U D;  3NCK A;  4O8G A;  2X01 A;  1N9B A;  4PM7 A;  3BRM A;  2V20 A;  3E4Q A;  2PHY A;  4OH0 A;  1K6S A;  2ZBB A;  3QNC A;  4WLA A;  1Z6F A;  3O88 A;  3FWL A;  1PWG A;  5IT5 A;  2PT7 A;  2FZ0 A;  1PI4 A;  3QP8 A;  4MNR A;  4DKI A;  3LFV A;  2ZM0 A;  2HF6 A;  2J80 A;  5AQ9 A;  3FKW A;  1K56 A;  4FSF A;  1WYB A;  4R1G A;  3G6O A;  5F6A A;  2VZW A;  3LR0 A;  1L0F A;  1D1J A;  1ODV A;  2XDM A;  4R23 A;  4ID4 A;  1YLP A;  4YNR A;  1H8M A;  1TS8 A;  2H28 A;  3VFH A;  4GHI A;  1XKZ A;  3IH8 A;  4KZ5 A;  2JKR M;  4E6X A;  1MWS A;  3IWI A;  3OC2 A;  1WE4 A;  3BY8 A;  4I39 A;  3SOI A;  3T4T A;  5A91 A;  3IBR A;  3SZT A;  3TSG A;  2B18 A;  2KLI A;  3PAG A;  1S66 L;  3FKV A;  4XUX A;  3BM6 A;  3W2Z A;  1TS0 A;  3S22 A;  2V0U A;  2R78 A;  3PBO A;  4B93 A;  2ZMA A;  1CK3 A;  3UPN A;  1ESU A;  4JBF A;  4PAU A;  4S2N C;  2GNX A;  3VV4 A;  5FAT A;  4E04 A;  3LCE A;  3M6H A;  4UA9 A;  2XA7 S;  3MXQ A;  4CJN A;  4NXB A;  1MC0 A;  5HWV A;  4BL3 A;  4NK3 A;  3RXW A;  3UPO A;  2ZC6 B;  5C5K A;  3SS3 A;  4R3J A;  4ETX A;  4FCF A;  2QJ7 A;  3IWQ A;  2JKT M;  1IYS A;  1I2S A;  5FDS A;  1PW1 A;  4LEN A;  3W4P A;  1F2K A;  5HWW A;  1LL5 A;  2D02 A;  2YKH A;  4HJ6 A;  2VX8 A;  1MWR A;  5EVI B;  4A5R A;  1W8Q A;  3CAX A;  4BD1 A;  3PHY A;  3ICY A;  1SDE A;  1VET A;  1JNU A;  2XRN A;  4ESP A;  3SH8 A;  5F1G A;  4WMC D;  1OTA A;  3FPW A;  4KQQ A;  1W5D A;  2QPN A;  3L9K A;  3D4F A;  4X53 A;  5AQ7 A;  3TW8 A;  4N92 A;  3ZG9 B;  4HOI A;  2EFU A;  4NXF A;  3B47 A;  2HPB A;  4Y3I A;  3DWK A;  1IEL A;  4Y0T A;  3D3O A;  4C6Y A;  4U0X A;  5FI2 A;  3NHQ A;  1DP9 A;  4EXO A;  2G7U A;  2FFY A;  4IBR A;  3CWF A;  4YFM A;  1YMX A;  3VSL A;  1BLH A;  4OLD A;  3N8S A;  3KX0 X;  5J8X A;  3S7P A;  2J8Y A;  5DF9 A;  5EVE A;  4YWZ A;  3MBZ A;  5GHX A;  5DFX A;  4LV0 A;  4HEF A;  1I5Q A;  1MPL A;  2JKG A;  3W4Q A;  3WS4 A;  3SW1 A;  4DXB A;  2KDK A;  3MKE A;  4MMN A;  4KUO A;  3HLB A;  4CLC B;  1RGY A;  3BJN A;  2JN7 A;  4Y15 A;  4HIA A;  1NYM A;  2I9V A;  4RX3 A;  1C3B A;  1HZO A;  1NZU A;  5GLA A;  1OTI A;  2ZOH A;  4UQI M;  2OSU A;  3KO6 A;  2Y2G A;  3DTM A;  1S6R A;  3MR0 A;  4Y2F A;  2BTF P;  1DJB A;  1DP6 A;  3V67 A;  1AWI A;  4B88 A;  5EOE A;  4DE3 A;  3PTE A;  1G68 A;  1V9Y A;  1PZP A;  4E3I A;  4Q8I A;  5IS1 A;  1S4R A;  2KX6 A;  1TS7 A;  1SKF A;  3GR2 A;  3NOP C;  4OQ0 A;  1W7F A;  1G6O A;  2GDN A;  4X1L A;  4OKP A;  1K6R A;  4O01 A;  1LI0 A;  3VP3 A;  1E4D A;  1OTE A;  4X68 A;  1XP4 A;  3V3S A;  4NG2 A;  2Y2P A;  2EFX A;  1CI8 A;  4MN7 A;  4EBN A;  4Q0H A;  1LLB A;  2OWH A;  2P08 A;  4IUH A;  5GLD A;  2OOL A;  3C4O A;  5CGW A;  1PFL A;  4BLM A;  4KZ3 A;  4UHU A;  2VGL S;  3IH9 A;  1FCO A;  1CQA A;  3RTY A;  1NRJ A;  4S2L A;  5FEF A;  1GSV A;  1YSQ A;  4X6T A;  5HWT A;  3OCL A;  4KQR A;  4E6W A;  3A3E A;  4H8R A;  1EI5 A;  1JTD A;  2DRW A;  2ZD8 A;  2IWD A;  2RCX A;  3C4P A;  3P98 A;  2WKQ A;  1H0M A;  3DBA A;  3UN7 A;  2QHK A;  4KG2 A;  1KDS A;  3UO9 A;  4B9O A;  2Q9M A;  4PKY A;  5EM0 A;  3CPT A;  2INW A;  5L07 A;  2V0W A;  1SZV A;  3VSK A;  2Z6C A;  4DMZ A;  2X02 A;  5I5L A;  4OVD A;  3IWO A;  1YLJ A;  2ZLY A;  2HP6 A;  2Y59 A;  3K3C A;  2O9A A;  4WZ4 A;  2JE5 A;  2Y2I A;  4LV1 A;  4WZ5 A;  5HL6 A;  5HL1 A;  4HBT A;  2WGI A;  1OT9 A;  3SS4 A;  1VEU A;  3V39 A;  3UE6 A;  4PKY G;  4BQM A;  4K0W A;  4S2I A;  2HDS A;  4DDY A;  2WKR A;  1ONG A;  1UGU A;  3KYZ A;  5HAP A;  3OBF A;  4H6J A;  3CHW P;  3JVV A;  5CRF A;  2HP9 A;  4XT2 B;  5CXW A;  3H82 A;  5U47 A;  1S0W A;  1E3U A;  5F5Y A;  1VB6 A;  2IWB A;  5EE8 A;  5AQA A;  1S1Z A;  4P6Z M;  3DWZ A;  4HJ4 A;  2JCH A;  1LSW A;  4R70 A;  5FA7 A;  2BLS A;  4U3T A;  2OV5 A;  3KSI A;  4LRY C;  3A3J A;  4E3L A;  2W27 A;  3HLW A;  1JVJ A;  2ZQ8 A;  3MFX A;  4ZJ3 A;  1OTB A;  2JC7 A;  3P09 A;  1K55 C;  1LL9 A;  5CTN A;  5FQJ A;  4EW7 A;  1XPB A;  1CJF A;  3VE4 A;  2L0W A;  1SDN A;  5KZH A;  3E2L A;  5HDS A;  1F98 A;  1MKI A;  2P74 A;  3GV9 A;  1PRQ A;  3MF0 A;  1V9Z A;  4HH2 A;  4HI4 A;  1YMS A;  3ZG5 A;  1MXO A;  3JVU A;  1OJ5 A;  3B3X A;  5F69 A;  3VP0 A;  2PD7 A;  3E4O A;  2Z6D A;  5F1F A;  1ALQ A;  2VLG A;  3DTE A;  3PAE A;  2ZMF A;  5E43 A;  1YT4 A;  1MKM A;  1MZU A;  4KG6 A;  3Q82 A;  2CMN A;  2XLN A;  4DRT A;  1SKO A;  3CLO A;  4OOY A;  2WKE A;  4X55 A;  3CJM A;  1NZO A;  4QD4 A;  3NDG A;  4Y0O A;  2ZQC A;  3G2Z A;  5AQB A;  1O07 A;  4WEK A;  4X25 A;  4ETZ A;  5FQM A;  1DRM A;  1ESI A;  1UWP X;  4GCZ A;  5EFW A;  2WKH A;  1K38 A;  1XJ2 A;  1CF0 A;  3NY4 A;  1NLY A;  5FAS A;  5GLC A;  4QY6 A;  1BUE A;  1IYQ A;  2V2F F;  1XJ4 A;  4IVK A;  1N9N A;  5TR7 A;  1TS6 A;  4EQI A;  5G4Y A;  3Q07 A;  4WMC A;  2O9B A;  4GJ4 A;  3M2J A;  4OPZ A;  3MXS A;  3IS2 A;  4QY5 A;  2EX9 A;  2I72 A;  1TDG A;  1K55 A;  2GJ3 A;  2Q9N A;  2A2L A;  4E3O A;  4LGW A;  4AFI A;  4ZBE A;  2XK1 A;  1NYY A;  1K54 C;  3IXG A;  4GD6 A;  3WS1 A;  2VGK A;  3LIE A;  5FDH A;  4GNU A;  4BJP A;  4WF0 A;  5BOH A;  1YSP A;  3A0R A;  4BEN A;  3LUQ A;  1ZG6 A;  1VHM A;  1SCW A;  1PWD A;  1U60 A;  4MBF A;  2GX5 A;  4NXG A;  2QYB A;  2V1B A;  4UEY A;  3T4J A;  3ZG0 A;  5CEC A;  2XF3 A;  2O9C A;  2K7S A;  3VP1 A;  3R7W A;  5L2F A;  1EWZ A;  3MZE A;  3A3F A;  4II7 A;  3NOT C;  3BQ8 A;  3CPT B;  3HJI A;  2LB5 A;  4M3K A;  3MQ0 A;  3PYP A;  1K4E A;  5TFQ A;  4BBT A;  4DE0 A;  3VP4 A;  4RQ9 A;  4HHD A;  5CGX A;  4N9K A;  3PBQ A;  2H0Y A;  3T4O A;  4ME4 A;  1L2S A;  1VEU B;  3MSH A;  4D2O A;  1F5M A;  2QMI A;  4FOF A;  2NUP C;  3NJA A;  3RH8 B;  4Q0J A;  3ZYT A;  3CUE A;  4JGQ A;  4NET A;  4OP8 A;  2Y2L A;  4XXR A;  4JXW A;  4UAA A;  2W0N A;  4L9G A;  4NEE D;  4H6J B;  3UNW A;  3MZF A;  1H8Y A;  3HLF A;  1KVL A;  1ERQ A;  1UWN X;  1JWP A;  4WL9 A;  3H82 B;  5HX9 A;  5HFO A;  4U0T A;  5HAR A;  4QB8 A;  4FUW A;  1XFN A;  2L4R A;  4XT2 A;  3CI6 A;  5EV0 A;  2WAE A;  1W63 M;  2W3D A;  4GKU A;  4B4Z A;  1M40 A;  3HL9 A;  5CER A;  3GEC A;  5IU1 A;  2ZQ9 A;  4IHQ A;  3Q7V B;  1K54 A;  2H10 A;  3WRT A;  3FG8 A;  1P9R A;  4MN5 A;  1PWC A;  3C7V A;  5G18 A;  1KDW A;  3MZD A;  5DVA A;  1PI5 A;  3T4Q A;  3VP2 A;  2PYR A;  4WN5 A;  2VK3 A;  2XGN A;  2D01 A;  1BUL A;  3ZGA B;  3BFG A;  2Y55 A;  1S1Y A;  3H7W A;  3LEQ A;  1DJA A;  1ES3 A;  4FH2 A;  2H0T A;  4GZB A;  1LSX A;  4OPR A;  2X71 A;  1NWZ A;  2XSS A;  2ZL1 A;  2W1T A;  3WRZ A;  1H8Z A;  5HD3 A;  5GLB A;  3CG5 A;  4I38 A;  1KE0 A;  5CEB A;  3OPL A;  1PZO A;  4X1M A;  3K3D A;  4OOM A;  2NUT C;  2ZOI A;  2M7U A;  2O0Y A;  4FD8 A;  2EX8 A;  4KZ9 A;  4BBU A;  3F1O A;  5AVF A;  2J3T C;  5DTS A;  3V3R A;  4MCW A;  3IHB A;  1P0Z A;  4JLF A;  1SKO B;  4S2N A;  4UA6 A;  1HD8 A;  3NDE A;  4E3K A;  5J4E A;  4MN6 A;  3LR3 A;  4S2O A;  3QP6 A;  5KIZ A;  1K57 C;  4O7D A;  3FC7 A;  1L0E A;  4EEU A;  4HJ3 A;  5J7E A;  1XA7 A;  2ZQ7 A;  3ZG8 B;  1G5U A;  1BSG A;  3IQA A;  4JGR A;  5AJG A;  2WK0 A;  3C38 A;  5FAQ A;  4OLG A;  3AGF A;  5DF8 A;  1YM1 A;  2VGL M;  1YKD A;  3MQO A;  1XXM A;  4C3Q A;  4WEJ A;  5FAO A;  3E98 A;  3UPP A;  3HLD A;  4EWF A;  1FCN A;  1QMF A;  4FH4 A;  4R6L A;  3S4X A;  2PR5 A;  4JXG A;  4KZA A;  4KEN B;  4EEP A;  3T1S A;  3HRE A;  3M6B A;  3BLS A;  2ACG A;  4KQO A;  2QWS A;  3WWX A;  3G34 A;  1RP5 A;  3B42 A;  3IS2 B;  1LI9 A;  4KZB A;  1ZHH B;  1BLC A;  4BWI A;  4HNB A;  3IF5 A;  3HUO A; 
#chains in the Genus database with same CATH homology
 1N9B A;  3ITA A;  2BLS A;  4U3T A;  4RA7 A;  2OV5 A;  4PM7 A;  5CGS A;  3HUN A;  3BRM A;  4IVI A;  3UDI A;  3G30 A;  2V20 A;  1YLZ A;  3A3J A;  2A49 A;  4E3L A;  3Q7Z A;  2WGW B;  3HLW A;  4OH0 A;  1K6S A;  3ZNY A;  3LO7 A;  1JVJ A;  2WAF A;  2ZQ8 A;  3QNC A;  4ZJ3 A;  4EUZ A;  3IXD A;  3WS5 A;  1K4F A;  5E2H A;  5HAQ A;  1Z6F A;  5DF7 A;  3GVB A;  3O88 A;  4K0X A;  4Y0U A;  2Y91 A;  3FWL A;  1PWG A;  5IHV A;  2JC7 A;  3P09 A;  1PI4 A;  1K55 C;  1LL9 A;  3BEB A;  4ZJ1 A;  5FQQ A;  5CTN A;  5FQJ A;  2PBY A;  4MNR A;  4DKI A;  5TGF A;  1XPB A;  5FI6 A;  3ZVT A;  2ZM0 A;  1SDN A;  5KZH A;  4KZ6 A;  3E2L A;  2ZM8 A;  4K91 A;  5AQ9 A;  1MKI A;  2P74 A;  5A93 A;  3A3I A;  3BFF A;  3FKW A;  3GV9 A;  5FI7 A;  3ZCZ A;  1M6K A;  4KZ8 A;  4YIN A;  1K56 A;  2UWX A;  4FSF A;  1WYC A;  3HUM A;  1WYB A;  1N4O A;  3MKF A;  1CI9 A;  1KGG A;  4R1G A;  4MBH A;  3NIA A;  2DCF A;  4PPR A;  1FCM A;  3HVF A;  1YMS A;  4EV4 A;  4MEZ A;  3BLM A;  1L0F A;  4RVA A;  1K56 D;  4LCM A;  3IXH A;  2XDM A;  3N7W A;  4ID4 A;  4R23 A;  3ZG5 A;  1MXO A;  1YLP A;  5M18 A;  1GA0 A;  3B3X A;  2XQZ A;  4RX2 A;  4EBP A;  1NRF A;  3VP0 A;  4BL2 A;  4Z9Q A;  4WBG A;  1XA1 A;  3VFH A;  4P87 A;  4E3J A;  1XKZ A;  3UE1 A;  3IH8 A;  2Y2Q A;  4CPK A;  4KZ5 A;  5CHJ A;  4PMA A;  5F1F A;  4GOG A;  1ALQ A;  3PAE A;  5E43 A;  4E6X A;  1YT4 A;  1Q2P A;  1MWS A;  3IWI A;  2EX2 A;  3NI9 A;  1Y54 A;  3OC2 A;  1GA9 A;  1WE4 A;  4KG6 A;  4R4S A;  2J9O A;  2OLU A;  4ZAM A;  3Q82 A;  3SOI A;  5A91 A;  3TSG A;  1JTG A;  2Y2K A;  2XLN A;  1RCJ A;  4DRT A;  4E3N A;  2C5W B;  3PAG A;  3FKV A;  3FZC A;  1L0G A;  1MBL A;  4XUX A;  3BM6 A;  2ZQD A;  4OOY A;  1BT5 A;  1BLS A;  4JF6 A;  5DTK A;  1NJ4 A;  3S22 A;  1HVB A;  2WKE A;  4X55 A;  2ZJ9 A;  4B4X A;  1ERO A;  3CJM A;  5KSC A;  1FQG A;  2JBF A;  3VFF A;  1NZO A;  4QD4 A;  1ONH A;  1W79 A;  3PBO A;  2ZMA A;  1CK3 A;  3NDG A;  4R3B A;  3ZNT A;  3UPN A;  4Y0O A;  2E8I A;  1ESU A;  4JBF A;  4KG5 A;  4OON A;  2ZQC A;  3G2Z A;  4S2N C;  5AQB A;  5FAT A;  3LCE A;  3M6H A;  2EX6 A;  2XEP A;  4UA9 A;  1JWV A;  1O07 A;  4CJN A;  2G2U A;  3O3V A;  4OOL A;  4NK3 A;  3PBT A;  4WZ5 C;  3RXW A;  4WEK A;  4BL3 A;  3UPO A;  5FQM A;  2ZC6 B;  1ESI A;  3SS3 A;  2R9X A;  4R3J A;  2OLV A;  4FCF A;  1GHM A;  1IKG A;  1BTL A;  3IWQ A;  3W4O A;  2WKH A;  3MXR A;  1K38 A;  1VQQ A;  1L0D A;  3NY4 A;  1IYS A;  1I2S A;  3EQU A;  3WS2 A;  1PW1 A;  4OP5 A;  5FAS A;  3E2K A;  2WAD A;  5GLC A;  2R9W A;  3HLG A;  4QY6 A;  1BUE A;  4LEN A;  1IYQ A;  4ZDX A;  2V2F F;  3IXB A;  3W4P A;  5FSR A;  2A3U A;  1KE3 A;  4IVK A;  1LL5 A;  3G2Y A;  5TR7 A;  4EQI A;  3AGD A;  1GHP A;  3Q07 A;  4BD0 A;  4WMC A;  4UA7 A;  3Q7V A;  1MWR A;  5EVI B;  1IKI A;  3M2J A;  4OPZ A;  4A5R A;  5A90 A;  4PM6 A;  1W8Q A;  4BD1 A;  3MXS A;  1XGJ A;  4IED A;  4QY5 A;  1SHV A;  2EX9 A;  2I72 A;  1SDE A;  1Q2Q A;  3VOZ A;  3IHA A;  3SH8 A;  5F1G A;  1TDG A;  1K55 A;  4WMC D;  4OQG A;  2XD1 A;  2Q9N A;  4KQQ A;  3VMA A;  1FR6 A;  5FAP A;  1W5D A;  1W8Y A;  1ZC2 A;  4E3O A;  1KE4 A;  2QPN A;  4ZBE A;  3V5M A;  2ZC7 A;  3BYD A;  1KVM A;  3D4F A;  4X53 A;  2XK1 A;  5AQ7 A;  1NYY A;  1K54 C;  3V50 A;  4N92 A;  3ZG9 B;  3IXG A;  3IF6 B;  4GD6 A;  3WS1 A;  2VGK A;  2EFU A;  2WGW A;  4MLL A;  5EEC A;  3TG9 A;  4QHC A;  5E2E A;  5FDH A;  3NBL A;  4GNU A;  2Y4A A;  3W8K A;  5EVI C;  4BJP A;  5FQ9 A;  4N1H A;  5JYP A;  2HPB A;  1AXB A;  3GMW A;  5F82 A;  4DDS A;  3DWK A;  3RJU A;  1IEL A;  5BOH A;  1CEF A;  3C5A A;  4QU3 A;  3SH7 A;  4BEN A;  1ZG6 A;  5CHM A;  3S1Y A;  4Y0T A;  4S2P A;  4C6Y A;  1G6A A;  4GDN A;  4P0M A;  4U0X A;  1SCW A;  1PWD A;  1U60 A;  4MBF A;  1PYY A;  4S2J A;  1KGE A;  2XD5 A;  1MWT A;  4KZ7 A;  4P6B A;  3OZH A;  3O87 A;  3UY6 A;  1I2W A;  5FI2 A;  3ZG0 A;  3IF6 C;  5CEC A;  2XF3 A;  3TOI A;  3VP1 A;  4DF6 A;  4DE2 A;  5L2F A;  3OPP A;  1EWZ A;  3AGE A;  3MZE A;  1K57 A;  3A3F A;  2FFY A;  4IBR A;  2RL3 A;  2Y2O A;  3FYZ A;  4YFM A;  1YMX A;  5HW3 A;  3VSL A;  1BLH A;  2WYX A;  3QNB A;  4M3K A;  4OLD A;  3SS5 A;  2P9V B;  4EBL A;  4JKT A;  3N8S A;  1K4E A;  3G31 A;  4ZTK A;  5TFQ A;  4DE0 A;  3ISG A;  4N1X A;  1IYO A;  5J8X A;  3VP4 A;  4GDB A;  5CTM A;  2J8Y A;  5DF9 A;  2ZC4 B;  5CGX A;  4N9K A;  3MBZ A;  3G35 A;  4E3M A;  2VGJ A;  3PBQ A;  5GHX A;  2H0Y A;  4WEL A;  5I94 A;  1L2S A;  1ZKJ A;  4LV0 A;  5FQI A;  1DY6 A;  4HEF A;  4R0Q A;  4D2O A;  2QMI A;  1I5Q A;  1GHI A;  2ZC5 B;  5KSH A;  1MPL A;  1YLW A;  1ES5 A;  3W4Q A;  2FFF B;  4NET A;  1FR1 A;  3PBN A;  2Y2L A;  4OP8 A;  3WS4 A;  4DXB A;  4XXR A;  3MKE A;  2Y2M A;  4JXW A;  4UAA A;  2HDQ A;  4P85 A;  3HLB A;  5GHY A;  1IEM A;  3Q1F A;  3EQV A;  1ES2 A;  1RGY A;  1BLP A;  3OPR A;  3UNW A;  3MZF A;  1H8Y A;  3HLF A;  2ZQA A;  1KVL A;  1ERQ A;  3JYI A;  1NYM A;  2Y2J A;  1C3B A;  1HZO A;  1JWP A;  1KGF A;  1NZU A;  3CMZ A;  4JXV A;  1GCE A;  4RX3 A;  5GLA A;  2WUQ A;  1YLY A;  3MFD A;  5HX9 A;  5HFO A;  4X56 A;  2J7V A;  3GQZ A;  4U0T A;  2OSU A;  3LY3 A;  4QB8 A;  5HAR A;  2Y2G A;  5KMW A;  3DTM A;  2XH9 A;  3PBR A;  4RYE A;  1S6R A;  1E25 A;  2WAE A;  3ITB A;  4Y7P A;  3C7U A;  2PU4 A;  4GKU A;  4B4Z A;  5EPH A;  1DJB A;  3GTC A;  1M40 A;  3HL9 A;  5CER A;  4B88 A;  4HES A;  5EOE A;  4DE3 A;  2ZQ9 A;  1G68 A;  3PTE A;  3LY4 A;  3Q7V B;  2IWC A;  3UDF A;  1K54 A;  1IYP A;  2H10 A;  2HDR A;  3Q81 A;  1PZP A;  3WRT A;  4E3I A;  4Q8I A;  4JPM A;  5E2F A;  1OME A;  1LHY A;  1PWC A;  3C7V A;  1DJC A;  5G18 A;  1SKF A;  3GR2 A;  1KDW A;  3MZD A;  5DVA A;  3VOY A;  5EVI A;  1PI5 A;  4OQ0 A;  4ZJ2 A;  1W7F A;  5DTT A;  4OPY A;  1RGZ A;  2GDN A;  3ZHH A;  1JWZ A;  1ERM A;  4OKP A;  3WS0 A;  5D3O A;  1K6R A;  1LI0 A;  3VP2 A;  3VP3 A;  1E4D A;  2ZM2 A;  4X68 A;  2G2W A;  1XP4 A;  2HDU A;  2V1Z A;  3V3S A;  1XGI A;  2XGN A;  2XR0 A;  1CEG A;  5EVI D;  2Y2P A;  3I7J A;  1BUL A;  1O7E A;  2EFX A;  2J9P A;  5CHU A;  3A3D A;  1CI8 A;  3ZGA B;  1ZG4 A;  3BFG A;  4WM9 A;  3ZG7 B;  4EBN A;  5HAI A;  1LLB A;  2Y55 A;  3IF6 A;  5GLD A;  4DE1 A;  3N6I A;  1DJA A;  1ES3 A;  2Z2M B;  3C4O A;  2WZX A;  2XFS A;  4FH2 A;  5CGW A;  1PIO A;  1TVF A;  2Z2L B;  4KZ3 A;  4S2K A;  2H0T A;  4UHU A;  4BLM A;  5JYO A;  3IH9 A;  4GZB A;  1FSY A;  1FCO A;  4OPR A;  1XX2 A;  2QZ6 A;  2X71 A;  2Y2H A;  1NY0 A;  5CED A;  4OQI A;  4S2L A;  3CZD A;  3G32 A;  2CC1 A;  3WRZ A;  1K25 A;  1H8Z A;  4N9L A;  4X6T A;  3OCN A;  3BFC A;  5GLB A;  3OCL A;  3CG5 A;  5FQK A;  4F94 A;  1YLT A;  3FV7 A;  1KE0 A;  4KQR A;  4E6W A;  2H5S A;  2C6W B;  3A3E A;  4WYY A;  5CEB A;  4H8R A;  1EI5 A;  3OPL A;  2EXB A;  1PZO A;  1JTD A;  2DRW A;  2ZD8 A;  4OOM A;  3OPH A;  2IWD A;  2RCX A;  3C4P A;  3P98 A;  4R4R A;  5EVL A;  1VM1 A;  4JF5 A;  4LV2 A;  1MWU A;  4PM9 A;  1BZA A;  3DW0 A;  3HLC A;  4FD8 A;  3UN7 A;  5M19 A;  4KG2 A;  1KDS A;  3UO9 A;  3N8L A;  4KZ4 A;  2EX8 A;  4GD8 A;  3QHY A;  4KZ9 A;  2Q9M A;  2Y2N A;  4IBX A;  5GHZ A;  1TDL A;  1NXY A;  5DTS A;  4JF4 A;  2BG1 A;  5M1A A;  3V3R A;  3VSK A;  4GB7 A;  3IHB A;  2P9V A;  2ZC3 B;  4JLF A;  2X02 A;  4PM5 A;  4S2N A;  4OVD A;  4UA6 A;  1QME A;  1J9M A;  1HD8 A;  3IWO A;  3NDE A;  4E3K A;  1YLJ A;  3N4I A;  1TEM A;  2ZLY A;  2XFT A;  2HP6 A;  2Y59 A;  1MY8 A;  4S2O A;  1H5X A;  3PBS A;  4WZ4 A;  1K57 C;  3O86 A;  4O7D A;  4QJG A;  2JE5 A;  2Y2I A;  3BEC A;  4LV1 A;  4PM8 A;  4WZ5 A;  3UDX A;  1PW8 A;  2EXA A;  1L0E A;  2B5R A;  3GRJ A;  1XA7 A;  5HL1 A;  2ZQ7 A;  3HBR A;  4HBT A;  2WGI A;  3N8R A;  4HBU A;  4X69 A;  3RXX A;  3SS4 A;  1FSW A;  3ZG8 B;  4C75 A;  2WGV A;  5F83 A;  1HTZ A;  4LCL A;  1BSG A;  3V39 A;  3IQA A;  2WZZ A;  4BQM A;  4K0W A;  2DNS A;  3M2K A;  4GN2 A;  4MBK A;  2WK0 A;  1FOF A;  5FAQ A;  1YQS A;  4JXS A;  5E2G A;  4L0L A;  4OLG A;  3UE0 A;  4S2I A;  2PU2 A;  3AGF A;  4OPQ A;  5DF8 A;  3ZVW A;  2HDS A;  1YM1 A;  4DDY A;  1ES4 A;  1XXM A;  4C3Q A;  2WKI A;  4WEJ A;  5FAO A;  3ZFZ A;  3UPP A;  3HLD A;  4EWF A;  1FCN A;  1ONG A;  3ZDJ A;  2HP5 A;  1QMF A;  5HAP A;  4FH4 A;  5EOO A;  3S4X A;  4JXG A;  5CRF A;  5EUA A;  4KZA A;  3IT9 A;  4KEN B;  4OQH A;  3NC8 A;  2HP9 A;  5CXW A;  3SH9 A;  3HRE A;  3M6B A;  4LV3 A;  5U47 A;  1S0W A;  3BLS A;  4KQO A;  3BFD A;  1E3U A;  3WWX A;  3G34 A;  1RP5 A;  2IWB A;  5EE8 A;  4S2M A;  1LI9 A;  4KZB A;  4XUZ A;  5AQA A;  3HLE A;  5A92 A;  3DWZ A;  3BFE A;  1BLC A;  5GL9 A;  3LEZ A;  3GSG A;  3G4P A;  1E3U D;  2JCH A;  3NCK A;  3IF5 A;  4DXC A;  5FA7 A;  2X01 A;  3UE3 A;  3HUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...