1L0GA

X-ray crystal structure of ampc s64g mutant beta-lactamase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
355
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGGVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-lactamase
publication title Structural bases of stability-function tradeoffs in enzymes.
pubmed doi rcsb
source organism Escherichia coli
total genus 113
structure length 355
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1l0gA00
1W8YA 2Z2MB 4HEFA 2GDNA 1XPBA 2H10A 3GRJA 1FQGA 2QPNA 1PYYA 3VSLA 1MWUA 2C6WB 1I2SA 2ZMAA 3UE1A 5E2FA 1YLTA 2EFUA 4KZ9A 4N9LA 4B4ZA 1OMEA 4OPQA 2QMIA 3SH9A 1ZG4A 3UE0A 4KZBA 1KDSA 1CK3A 2G2WA 2H0YA 2UWXA 2WK0A 3I7JA 5CTNA 4YFMA 5I94A 3V39A 3UN7A 4S2OA 1PW8A 1LI0A 3BLMA 3UO9A 4UHUA 1YLWA 5EVLA 3BFGA 2JBFA 4GZBA 2XGNA 4L0LA 1K54C 1K54A 4R23A 1EI5A 1K25A 3PBTA 1TVFA 5G18A 5FAOA 2B5RA 3VFFA 3ZGAB 4C6YA 1K55C 1K55A 4N92A 4S2IA 1K4FA 2P9VA 2Y2LA 4HESA 4OQIA 1HZOA 5FQKA 4DKIA 1NZUA 4GOGA 3PAEA 3AGFA 1TDGA 1I5QA 2C5WB 5KSCA 3BFCA 1JTDA 3ITBA 4O7DA 1MWRA 1XGIA 3E2KA 4NK3A 1KE3A 1LL9A 2BG1A 2ZM2A 5E2EA 3WS1A 4KZAA 1NXYA 3QHYA 3A3DA 1FCMA 3GV9A 4JF6A 3RJUA 3ZVWA 1VM1A 4ZAMA 2EX2A 3NI9A 5M1AA 1Y54A 4GD6A 4IEDA 1XA1A 4OOLA 1H5XA 5CGWA 1CI8A 3PBNA 2ZJ9A 5F83A 2WZXA 2FFYA 2QZ6A 2EXBA 3E2LA 3PBSA 1L0DA 4BLMA 3C5AA 3A3IA 2V2FF 1PWCA 3LEZA 1YLZA 3Q81A 2RCXA 5EOOA 1RCJA 4H8RA 2WKHA 5BOHA 4YINA 2XF3A 3BRMA 3IXBA 3V3SA 5CXWA 4DDSA 5JYOA 3TG9A 3UDXA 2HDQA 1G68A 3Q7VB 4QB8A 4RA7A 1KE4A 3NCKA 3LO7A 5CERA 3G32A 3NC8A 4OQHA 2Q9MA 5FSRA 3HL9A 4S2KA 1CI9A 4GN2A 3Q07A 5DTTA 3S4XA 2G2UA 1GCEA 3ZDJA 4KZ8A 2DCFA 3ZFZA 3UE3A 3P09A 2JCHA 1IYPA 4JBFA 3ZHHA 3OZHA 4FH4A 2JC7A 1L0FA 1JWVA 4JPMA 4UA7A 5E43A 4RX2A 5FAPA 4BD0A 4F94A 2WAFA 3HLWA 4OONA 3IXDA 1O7EA 3M6HA 2XR0A 1NYYA 2ZM0A 4P0MA 5A90A 1LHYA 5F1GA 4BJPA 3WRZA 3MFDA 1LL5A 3IF6C 3IF6A 4FH2A 4OOMA 1XKZA 2ZC6B 2CC1A 1HVBA 3CJMA 3GVBA 4OLDA 5AQ9A 1FCOA 1K6RA 4S2MA 5HAQA 2WADA 3ZNTA 2HDUA 5FATA 2EXAA 2WAEA 1PZOA 4X55A 4X56A 4OKPA 5GLDA 1Z6FA 2FFFB 1ES2A 4IVIA 1WE4A 3PBRA 3WS2A 1MWSA 2I72A 1KGFA 1LI9A 2Q9NA 3N8SA 1PI4A 4LV0A 2IWCA 3N8RA 1GHMA 4LV2A 3ZVTA 3CZDA 4KZ5A 2ZC7A 1MY8A 4BQMA 5E2HA 1FOFA 3MBZA 4BD1A 1ALQA 1XP4A 5HARA 3GR2A 5A93A 3DW0A 1ERQA 4JF4A 2XFTA 4WBGA 3C4OA 1YMSA 1SKFA 3CG5A 4FCFA 4IVKA 4DE0A 3MKEA 1ZC2A 4OP8A 5AQAA 4A5RA 3EQUA 4LCLA 3AGEA 1E3UD 3IT9A 4JXGA 4DXCA 4P87A 3EQVA 4GDNA 4LENA 1VQQA 3UNWA 4HBTA 3Q7ZA 3SS5A 5HAPA 1K56D 3MZDA 2DRWA 2R9WA 3D4FA 4DF6A 2WGIA 5CEBA 2PU4A 3ZG8B 5KMWA 3NY4A 5HAIA 3FYZA 1EROA 3OCLA 4WZ5A 4WZ5C 4Z9QA 2X01A 4LCMA 1J9MA 5EOEA 4R0QA 2Y2IA 2ZQ7A 3HUMA 2JE5A 4JXSA 4DDYA 2WGWB 5FASA 1C3BA 3DWZA 4ZJ1A 4JF5A 4B4XA 5EPHA 5HL1A 3M2KA 5FQMA 4GNUA 2XFSA 4XXRA 3G35A 1PW1A 4X6TA 2BLSA 2EX8A 4GKUA 4R4SA 4S2NC 4S2NA 5CRFA 5FI2A 4M3KA 1MBLA 3HVFA 4MLLA 4PPRA 4E3JA 5FQIA 5EECA 3SS3A 3IH9A 4IBXA 2XD5A 1EWZA 1JWZA 1ES4A 4RX3A 2OSUA 3W4PA 4MBHA 4R1GA 5FI6A 2Y2MA 3Q1FA 2Y91A 4HBUA 5IHVA 3TSGA 2V1ZA 2A3UA 3W4OA 2XLNA 2Z2LB 1GA9A 4PM5A 4E3OA 1YMXA 3N4IA 4BENA 3UY6A 3W4QA 4ZJ2A 2ZQAA 4MBFA 3UPPA 5A91A 2WYXA 2ZC4B 1PIOA 1K6SA 3GMWA 1K4EA 1S6RA 2WUQA 3G30A 2WKEA 5CGXA 2J7VA 3ZG0A 3MXRA 2ZC3B 4DXBA 3VP0A 5M19A 3PTEA 3QNBA 1JWPA 1DJAA 2Y59A 3N7WA 5TR7A 5GHXA 4EV4A 4LV3A 1IEMA 2XEPA 4OQ0A 1WYCA 1CEGA 1NRFA 2PU2A 4MEZA 3OPLA 3WS4A 3QNCA 4DE3A 3BFFA 4OPZA 5DF8A 3SH8A 1NZOA 1FSYA 1BZAA 3GTCA 4ZBEA 3PAGA 4GB7A 3WS5A 1AXBA 1ES3A 1BT5A 1XGJA 4OH0A 1L2SA 4WEKA 4RYEA 2WGWA 1E3UA 5CGSA 4OOYA 3ITAA 2Y2JA 5FQ9A 1KDWA 1MWTA 4BL2A 3VOZA 3ZCZA 3MXSA 4KQRA 3VP3A 4EUZA 1FR6A 3G2YA 4PM7A 3WWXA 1K56A 3S22A 4EBLA 2VGJA 4QD4A 1XXMA 4U0TA 3DTMA 5HW3A 1YQSA 2Y2KA 2Y2QA 3IF5A 2E8IA 4S2JA 2J9PA 1N9BA 1I2WA 5FDHA 4CJNA 5KSHA 3IWOA 1IYQA 3VP4A 3G4PA 1IKGA 4GD8A 3OCNA 5KZHA 4DE1A 1YLPA 3WS0A 2XQZA 2IWDA 3MZEA 2WKIA 1W7FA 2R9XA 1PI5A 2Y4AA 3FV7A 4S2LA 2P9VB 1SDNA 3IHAA 3IWIA 4WM9A 2X71A 4QY6A 1ZKJA 2ZQCA 3N8LA 1KVMA 2XDMA 1FCNA 4QHCA 1BULA 2H5SA 1PWGA 2Y2GA 1W8QA 2ZQ8A 3HLEA 1E4DA 4KG2A 4PMAA 4UAAA 1JVJA 4E6XA 1KGGA 3BECA 4KQOA 4D2OA 4KZ4A 3A3EA 4EQIA 3AGDA 1RGYA 4UA9A 2OLVA 4OP5A 1GHIA 3BLSA 4K0XA 4Y0OA 1WYBA 5CHMA 5GLAA 1L0GA 2ZLYA 3IH8A 1E25A 3HLBA 4Y0UA 4C3QA 4JLFA 1NY0A 4QJGA 3BEBA 1HTZA 3Q7VA 1LLBA 3NDGA 3OPRA 1BSGA 3M2JA 3O3VA 3FWLA 2Y2PA 3A3JA 1FR1A 3UDIA 3G31A 2WZZA 3C4PA 5CTMA 2HP6A 4X69A 3O88A 1IKIA 4B88A 3ISGA 3M6BA 1IYOA 5FQQA 1RGZA 1W5DA 3NIAA 3UPNA 2A49A 2EFXA 5E2GA 4OVDA 3C7UA 4JKTA 4IBRA 5D3OA 4Q8IA 2H0TA 4WELA 1RP5A 1G6AA 4KZ3A 4ZJ3A 4KG5A 2Y2NA 4OLGA 3FZCA 2J8YA 2X02A 5GLCA 4E3NA 1KGEA 2DNSA 1DY6A 1PZPA 4U3TA 4EWFA 1ONGA 1PWDA 4C75A 4RVAA 1QMEA 4MBKA 3PBQA 1MPLA 2J9OA 3G34A 1SHVA 3P98A 3DWKA 4GDBA 3RXXA 1YT4A 4K0WA 4P85A 4R4RA 4E3MA 3FKWA 5L2FA 4DE2A 2HPBA 4X53A 3IF6B 4OPRA 3TOIA 3IXHA 4ID4A 5GL9A 4WYYA 3MKFA 3HBRA 4WMCD 5GHYA 3VP2A 1BUEA 1MKIA 2EX9A 2OLUA 1ES5A 4DRTA 1H8YA 3BFEA 3GQZA 4PM8A 3N6IA 5M18A 1KE0A 1JTGA 4N1XA 5EVID 3MZFA 4XUXA 2XK1A 2HDRA 3GSGA 1S0WA 5EE8A 5A92A 2WGVA 5J8XA 3A3FA 5AQBA 3HLCA 4XUZA 3ZG7B 2ZQDA 3HLGA 3O86A 2Y2OA 3HUNA 3JYIA 4E3LA 1GHPA 4JXVA 3VFHA 1BLHA 2EX6A 1NYMA 1IELA 4KQQA 3Q82A 2RL3A 2ZQ9A 4OPYA 1ESIA 4EBNA 2HDSA 2VGKA 4KG6A 3G2ZA 3VP1A 3HUOA 5EUAA 1O07A 3V50A 5DVAA 4P6BA 4BL3A 5CEDA 5CHJA 5CHUA 5EVIB 3SS4A 2PBYA 4PM9A 3VSKA 4OQGA 2V20A 2Y55A 3SH7A 1XA7A 1H8ZA 1Q2PA 5TFQA 3NDEA 5FAQA 4N9KA 4E3IA 4Y0TA 1QMFA 3PBOA 1L0EA 5CECA 3FKVA 4PM6A 4UA6A 1BLPA 3V3RA 4R3BA 1YM1A 3OPHA 5JYPA 1DJBA 1GA0A 4WEJA 1ERMA 2ZM8A 4QY5A 4E6WA 3W8KA 1W79A 1YLYA 4QU3A 2HP9A 3VOYA 1ONHA 5DTKA 5U47A 3VMAA 1ZG6A 5GLBA 4NETA 1HD8A 1TEMA 1Q2QA 4X68A 1XX2A 1MXOA 4ZDXA 3BYDA 4Y7PA 1K38A 5DF9A 3ZG9B 5HX9A 3LCEA 1SDEA 1YLJA 1CEFA 2HP5A 2Y2HA 3NBLA 3LY4A 5F82A 4KZ6A 3HLDA 1ESUA 3IQAA 5AQ7A 3HLFA 4U0XA 1M40A 3IWQA 1BLCA 2P74A 3ZNYA 3OPPA 4LV1A 5FA7A 4KENB 4K91A 4FSFA 5F1FA 3UDFA 1M6KA 3OC2A 3IXGA 3B3XA 5DF7A 3ZG5A 2IWBA 3HREA 4EBPA 3C7VA 4JXWA 4R3JA 3LY3A 3SOIA 4KZ7A 3CMZA 5HFOA 3RXWA 2XH9A 1NJ4A 3S1YA 5TGFA 3UPOA 4MNRA 3BM6A 1TDLA 2XD1A 5FI7A 3BFDA 1DJCA 4WZ4A 1BTLA 4E3KA 4WMCA 4ZTKA 1K57C 1K57A 3WRTA 2ZC5B 5FQJA 5GHZA 1IYSA 3IHBA 4FD8A 3O87A 4N1HA 4S2PA 1BLSA 1N4OA 1U60A 2OV5A 4CPKA 1SCWA 5DTSA 3V5MA 1FSWA 1KVLA 5EVIC 5EVIA 2ZD8A
chains in the Genus database with same CATH superfamily
2Z2MB 1XPBA 2QPNA 1HLUP 5TJJA 1H0MA 2C6WB 3K3CA 2ZMAA 2EFUA 2XRNA 2KLIA 3BJNA 3SH9A 3UE0A 2UWXA 2L1MA 1OPXA 4ZRRA 1YPRA 4Q0HA 1F5MA 5FL3A 4UHUA 5EVLA 2XGNA 4QWOA 1K54A 1EI5A 3PBTA 3ZGAB 1K55A 4S2IA 2P9VA 4WL9A 4HESA 2A24A 5FQKA 1NZUA 4DKIA 1XJ3A 3UB6A 1S67L 1TS7A 3PAEA 4R3AA 5L07A 5KSCA 3ITBA 1MWRA 1XGIA 2XSSA 3C8CA 1LSWA 2ZM2A 5E2EA 1F2KA 1XA1A 3T4OA 1CI8A 5AJGA 3LIFA 5F83A 2WZXA 3PBSA 1L0DA 1S1YA 1PWCA 1TF1A 3Q81A 1T1BA 2RCXA 3CI6A 4H8RA 2XF3A 3BRMA 3V3SA 4DDSA 3UB7A 4LGWA 2HDQA 3K3DA 1KE4A 3LO7A 3Q07A 3LR3A 2G2UA 1GCEA 3KSHA 3ZFZA 3UE3A 3P09A 1IYPA 3ZHHA 2JC7A 4RX2A 3VE4A 4BD0A 3HLWA 2PR5A 3M6HA 2PRFA 4DXCA 4E3LA 3IF6C 2LB9A 3GVBA 2WADA 2ZBBA 4F3LB 1S66L 1H3QA 2EXAA 3IX3A 4X56A 1ODVA 1Y4OA 4M4XA 3N8SA 3LFVA 4LV2A 3CZDA 4KZ5A 2ZC7A 1FOFA 1ALQA 3C2WA 5A93A 2B02A 3CUEC 3DTEA 4JXGA 4GHIB 3T4JA 4HBTA 3MF0A 3L9KA 5KMWA 5HSQA 2JE5A 4DDYA 5FQMA 4X6TA 2BLSA 4GKUA 5FI2A 3LIDA 1MBLA 2OAQ1 5FQIA 3LR5A 4IBXA 2XD5A 1OT9A 1JWZA 3IX8A 3W4PA 4IHQA 1KOUA 1PRQA 4BENA 5HL6A 3R7WA 2A2LA 1PIOA 2PD8A 3G30A 2W3DA 4CLCB 3ZG0A 4ETZA 2PHYA 4HJ6A 5HDCA 5TR7A 5GHXA 4EV4A 2XEPA 1NRFA 3WS4A 4OPZA 5DF8A 4ZBEA 1ES3A 4OH0A 4EERA 1EW0A 2WGWA 1E3UA 5CGSA 2L4RA 2OAP1 5DJUA 2Y2JA 2VZWA 2ZMFA 4LRXC 2P08A 3DTIA 3VOZA 3S7NA 3ZCZA 4KQRA 1K56A 1UWPX 1XXMA 1YQSA 2Y2QA 3CPTB 3LR0A 4S2JA 4EQ1A 4DJ2A 1I2WA 3D9YA 3VE3A 2J80A 4DE1A 4G3VA 3WS0A 2LB5A 2XQZA 2IWDA 2V9AA 4S2LA 3T1SA 1SDNA 3IHAA 3BW6A 4B9OA 1W8QA 3PHYA 3BECA 4KQOA 4D2OA 2W1RA 4OP5A 1GHIA 4K0XA 1WYBA 2ZLYA 3HLBA 3BEBA 4HNBA 1T1AA 3KYEA 2B95A 2WKRA 2WZZA 2HP6A 1IKIA 3M6BA 5FQQA 1RGZA 1W5DA 3NIAA 3UPNA 4OVDA 3C7UA 1GSVA 2VEAA 4Q8IA 1G6AA 4Y17A 2Y2NA 2J8YA 1PZPA 1XJ6A 4CLCD 3MFXA 1MPLA 1P97A 4K0WA 4MN6A 3FKWA 3MQ0A 3MQQA 4OPRA 3BWLA 4ID4A 3VP2A 2OLUA 1ES5A 3BFEA 1F9IA 5F6AA 1KE0A 4N1XA 3MZFA 1NLYA 2HDRA 1S0WA 3NOTC 2EWWA 5AQBA 3VFHA 4EUVA 4KQQA 4EEUA 3VP1A 3LI9A 3LUQA 3V50A 5CHJA 3SS4A 4EESA 1XA7A 4N9KA 1QMFA 1L0EA 3VOLA 1BLPA 2OOLA 1YM1A 1DJBA 4QY5A 1YLYA 1ONHA 3F1NB 5U47A 1Q2QA 5J3WA 3BYDA 1K38A 4BBTA 3LCEA 4HQAA 1YLJA 2Y2HA 5J7EA 3LY4A 4CLCC 2M1CA 3HLFA 1BLCA 2P74A 4K91A 3UDFA 5J4EA 3B3XA 2VA0A 4R3JA 4KZ7A 3CMZA 2PD7A 5G4ZA 1D1JA 3P7NA 3UPOA 4MNRA 4WN5A 5FI7A 1DJCA 3G6OA 4WMCA 1K57A 2ZC5B 5FQJA 1P0ZA 5F5YA 4HEFA 2H10A 1XFQA 3GRJA 1FQGA 1PYYA 5AVFA 5HWTA 4OPQA 2QMIA 1ZG4A 3F1OA 1KDSA 2PYRA 2G2WA 5CTNA 4YFMA 5I94A 4S2OA 3UO9A 1YLWA 3KSIA 3BFGA 2JBFA 4GZBA 2JKTI 2HJEA 4L0LA 4R23A 4K08A 1K4FA 2J3WA 4CQHA 1TDGA 4LRZE 1JTDA 1DRMA 1KE3A 4KZAA 1NXYA 3QHYA 3S7OA 5MC7A 3GV9A 4JF6A 3RJUA 2VJWA 1VM1A 2ZMVA 5M1AA 4KQDA 5CGWA 4G3WA 3PBNA 2ZJ9A 4HOIA 4H6JB 2QZ6A 3C5AA 1YSPA 4WF0A 3F1PB 5CXWA 5F69A 3Q7VB 2L0WA 3NCKA 5CERA 4Y5FA 2H28A 2JN7A 1ACFA 2Q9MA 2EWVA 5HD3A 3BQAA 4DJ3A 1JWVA 3A0RA 4JPMA 5FAPA 3QP6A 4F94A 3MXQA 4OONA 3IXDA 2XR0A 1NYYA 4P0MA 1LL5A 1XKZA 2ZC6B 2CC1A 3CJMA 5AQ9A 2Z6CA 1K6RA 3ZNTA 2HDUA 5FATA 2WAEA 2YKFA 4X55A 4IVIA 3WS2A 1WE4A 1K0KA 1LI9A 4LV0A 2IWCA 3IX4A 3ZVTA 3MBZA 1XP4A 2HV1A 3DW0A 4JF4A 3C4OA 4FCFA 4IVKA 4DE0A 4HHDA 4ME4A 3MKEA 4OP8A 4A5RA 4LCLA 3AGEA 3IT9A 3C30A 1VQQA 3Q7ZA 2JKGA 2DRWA 5CEBA 3IS2A 2PU4A 4XT2A 3NY4A 4WZ5C 3OCLA 1J9MA 5EOEA 1TS6A 3UB5P 2Y2IA 3CHWP 2W1TA 5FASA 1C3BA 3CWFA 1GSXA 5EPHA 3TJZC 4S2NA 3UB8A 4Y15A 2Y8HA 5EECA 3IH9A 3GECA 2VLGA 2BTFP 2Y2MA 2J3TD 4HBUA 2V1ZA 4ARZA 3W4OA 2XLNA 2Z2LB 3H82A 1GA9A 4PM5A 4E3OA 3W4QA 4ZJ2A 2Y79A 2WUQA 5L10A 4NXBA 5CGXA 2J7VA 1VETA 2ZC3B 4DXBA 3VP0A 5M19A 3R4KA 3NULA 1DJAA 3N7WA 2GZAA 4OQ0A 1CEGA 2PU2A 4MEZA 3OPLA 2V1BA 3QNCA 2W3GA 4DE3A 2M7UA 3SH8A 1BZAA 3GTCA 3PAGA 4GB7A 4WEKA 1TD5A 3ITAA 5FQ9A 1MWTA 3E4OA 4BL2A 3VP3A 2KOIA 4EUZA 1FR6A 3WWXA 3B47A 3C38A 4QD4A 1Z09A 3IF5A 4BBUA 1G28A 3VP4A 3EOIA 3UMEA 2V8CA 2W27A 1X0OA 2WKIA 4P6ZM 1PI5A 1D7EA 2P9VB 4WM9A 1G6OA 2X71A 2A24B 1ZKJA 2ZQCA 2PT7A 3T1RA 3B33A 3FPVA 3H7WA 2J3TC 2H5SA 3HLEA 1KGGA 1UWNX 2OLVA 3WS1A 3BLSA 5GLAA 4C3QA 1E25A 4JLFA 1NY0A 1NLZA 4QPRA 3M2JA 4Y13A 1FR1A 5TBMA 3L7HA 3O88A 4B88A 1VHMA 3ISGA 3CITA 2A49A 4AFIA 5D3OA 3KO6A 3NOUC 4KG5A 2X02A 2JKRM 4U3TA 1ONGA 2YKHA 3PBQA 3P98A 3RXXA 1YT4A 3H9WA 1ZHHB 4P85A 4X53A 3TOIA 3ICYA 5GL9A 1WA9A 4WYYA 3MKFA 3QP1A 3HBRA 5GHYA 1BUEA 1MKIA 4D60A 1H8YA 3GQZA 4PM8A 1JTGA 3OBFA 4PKYG 5EVID 4XUXA 3GSGA 5EE8A 1V9YA 3ZG7B 4EETB 1IELA 2ZQ9A 1ESIA 4EBNA 1XJ2A 1J3WA 2VGKA 3G2ZA 3HUOA 1L3LA 1OTIA 4P6BA 5CHUA 2W3HA 4PM9A 3VSKA 4OQGA 1LT0A 4UQIM 4FTXA 4MCWA 1OTEA 4X25A 4E3IA 3PBOA 4PM6A 4UA6A 2XA7S 3U4LP 1GA0A 1W79A 4QU3A 3B42A 3VMAA 5DTKA 5GLBA 2QYBA 4GJ4A 1TEMA 2B18A 4X68A 3A0VA 2PR6A 3BY8A 4Y7PA 5HD5A 5DF9A 4EU0A 2K7SA 2HP5A 5F82A 3HLDA 1ESUA 1S1ZA 3JVUA 4U0XA 1M40A 1MKMA 4LV1A 5FA7A 4FSFA 5F1FA 2JKRI 1M6KA 3IXGA 3ZG5A 4EBPA 3C7VA 3SOIA 3R7WB 3S7QA 5HFOA 2XH9A 1NJ4A 1DP8A 4HIAA 5HWVA 3WRTA 4ZTKA 4NXGA 5GHZA 2VGLM 3IHBA 2VKSA 4CPKA 1SCWA 3HJIA 5EVIC 2ZD8A 1W8YA 4BBVA 4I39A 4LLOB 3UE1A 2O9CA 4KZ9A 5E2FA 4N9LA 4JGRA 2V1AA 4HY8A 4B4ZA 1OMEA 1CK3A 2H0YA 2P7JA 2WK0A 3UN7A 1LI0A 3LIAA 1K54C 5G18A 5FAOA 2B5RA 3VFFA 4I3JA 1K55C 4N92A 4LRYC 4UEYA 1SKOA 4GOGA 2C5WB 4R38A 3BFCA 4O7DA 1FILA 3RH8B 1LL9A 2BG1A 3EWKA 3S7PA 3P01A 1Y54A 4GD6A 4IEDA 4OOLA 4BLMA 2EXBA 2JKTM 3T1QB 4E04A 2V2FF 3LEZA 1YLZA 2R78A 4FOFA 2WKHA 4YINA 3IXBA 3TG9A 3UDXA 4QB8A 1G68A 4RA7A 2GX5A 5FSRA 3HL9A 1CI9A 4GN2A 3S4XA 3ZDJA 1OJGA 2HJ9C 4JBFA 3OZHA 1L0FA 3ZQ5A 4ETXA 2WAFA 2ZOHA 2UV0E 1P9RA 3WRZA 4FH2A 4OOMA 3IF6A 1TS8A 4E6WA 1FCOA 4S2MA 4NXEA 2OWJA 3MS6A 2W3EA 1PZOA 2HF6A 4OKPA 3PBRA 1MWSA 3DBAA 2Q9NA 3N8RA 1GHMA 4BQMA 1MY8A 5E2HA 5EV0A 4IJGA 3GR2A 2K2NA 5HARA 1ERQA 4NXFA 2QJ7A 3UB9A 2XFTA 4WLAA 5C5KA 1ZC2A 3EQUA 1E3UD 2E8JA 4YOFA 4LENA 3UNWA 4GS9A 1LSXA 5HAPA 1K56D 3MZDA 3D4FA 2WGIA 3ZG8B 5HAIA 3FYZA 2X01A 1N9OA 4Z9QA 2JHEA 2ZQ7A 3HUMA 4R70A 3DWZA 4NG2A 4B4XA 2Z6DA 4GNUA 4XXRA 1PW1A 2NUTC 2EX8A 4R4SA 1PNEA 4MLLA 4PPRA 4E3JA 1PFLA 3SS3A 4Z1WA 1ES4A 2OSUA 4MBHA 3KX0X 4R1GA 3Q1FA 3V67A 3E0YA 2Y91A 3EEHA 5IHVA 3TSGA 2ZL1A 4LPZA 1UGUA 1YMXA 1CJFA 1MC0A 4BWIA 2ZQAA 2WYXA 2ZC4B 5HPIA 1K6SA 3GMWA 3VV4A 2W3FA 5DJTA 2WKEA 4Y2FA 1OJ5A 3PTEA 3QNBA 1YKDA 1JWPA 2Y59A 3PXPA 4LV3A 1IEMA 5HZHA 4JGQA 3WS5A 1AXBA 1BT5A 1XGJA 1L2SA 3RFBA 4OOYA 3KSGA 4BMWA 3G2YA 3LIEA 1DP9A 4EBLA 2W0NA 4PHTA 4U0TA 3DTMA 2XA7M 4MN7A 2J9PA 5I5LA 3KYQA 3IWOA 3G4PA 1IKGA 3OCNA 4R6LA 5KZHA 2FZ0A 1W7FA 2Y4AA 4Y3IA 2O9BA 3IWIA 3LGOA 3N8LA 2P04A 1KVMA 1FCNA 1MZUA 4QHCA 1BULA 2PDRA 1PWGA 2Y2GA 2ZQ8A 4NEED 1JVJA 4E6XA 1N9LA 4HP9A 3AGDA 5CHMA 4Y0OA 2PAVP 3PR6A 3TW8A 4QJGA 1LLBA 3NDGA 3OPRA 3O3VA 3FWLA 4WUJA 3UDIA 3C4PA 5CTMA 4X69A 2EFXA 5E2GA 2PBDP 4IBRA 4WELA 1RP5A 4KZ3A 3DTKA 4YNRA 1KGEA 2DNSA 3FPWA 4EWFA 1CQAA 1PWDA 4L9GA 1QMEA 4F3LA 3G34A 2O9AA 4R4RA 4E3MA 5L2FA 4DE2A 2INWA 3IBRA 1OT6A 3IXHA 2NUPC 1VEUB 1LL8A 4WMCD 3T4LA 5M18A 3W2ZA 4GHIA 3FG8A 4HI4A 2VX8A 3T12B 5A92A 5J8XA 3A3FA 1ZTUA 4XUZA 2ZQDA 3HLGA 3O86A 3HUNA 1GHPA 4JXVA 1NYMA 1S4RA 2HGVA 2RL3A 4OPYA 2HDSA 3TRCA 2D01A 5EUAA 1O07A 5DVAA 5EVIB 2PBYA 4NKPA 3IS2B 4XT2B 2V20A 3SH7A 5AVEA 1Q2PA 4HH3A 4Y0TA 4X1MA 1OTAA 5CECA 2W1TB 2G7UA 3MQOA 4R3BA 3V3RA 5JYPA 4WEJA 1ERMA 3W8KA 3RTYA 2HP9A 3VOYA 3EEAA 4NETA 1HD8A 1XX2A 1MXOA 4ZDXA 4GCZA 3ZG9B 5HX9A 1SDEA 4KZ6A 3E4PA 4ARZB 3IQAA 4MMNA 4CLCA 4DMZA 3KSFA 3H82B 3GDIA 3K2NA 3ZNYA 3OC2A 5DF7A 2I9VA 2IWBA 2VK3A 3RXWA 2OWHA 2WKQA 3S1YA 1V9ZA 5TGFA 5DKKA 3BM6A 1TDLA 4IUHA 1VETB 4E3KA 1K57C 4ESPA 2VV7A 4FD8A 4N1HA 1BLSA 1N4OA 3EGDC 5IU1A 4HJ4A 5DTSA 3NOPC 1AWIA 2VV6A 2GDNA 4Q0IA 1IOUA 2VV8A 3VSLA 1MWUA 5DFXA 1I2SA 3JVVA 4II7A 1YLTA 3CPTA 1STZA 1S4SA 1P9WA 4KZBA 3I7JA 3V39A 1PW8A 3BLMA 4X1LA 3T4QA 4Q0JA 5HDDA 1K25A 1TVFA 4RQ9A 1YSQA 4C6YA 2Y2LA 4OQIA 1HZOA 3CAXA 3CLOA 2D02A 3AGFA 1I5QA 3DAVA 5EFWA 5A8BA 3E2KA 4NK3A 3A3DA 1FCMA 3LYXA 3LI8A 3QP8A 3ZVWA 2CMNA 4ZAMA 2EX2A 3NI9A 2M7VA 1H5XA 3H7WB 1GSWA 4MN5A 3UE6A 2FFYA 3E2LA 3T50A 3A3IA 3MJQA 2ZOIA 5EOOA 1RCJA 5BOHA 5JYOA 5FEFA 1T1CA 3G32A 3LICA 1G5UA 3NC8A 4OQHA 3QP2A 4O0PA 4S2KA 5DTTA 5TBMB 2HZ5A 4KZ8A 2DCFA 3E98A 2QJ5A 1OTBA 2JCHA 2GNXA 4FH4A 3QP4A 4UA7A 3NHQA 5E43A 3A0SA 4HH2A 4L9FA 1XJ4A 2Q0OA 4O8GA 1O7EA 4CLCE 2ZM0A 4EEPA 5A90A 1LHYA 3OOVA 5F1GA 4BJPA 3MFDA 4DRTA 1HVBA 4OLDA 5HAQA 2GJ3A 5GLDA 1Z6FA 2FFFB 1ES2A 2I72A 1KGFA 1PI4A 5EVEA 4BD1A 1NWZA 1T18A 4WBGA 3EGXC 5F68A 1YMSA 1SKFA 3CG5A 5AQAA 1CF0A 1LSVA 1VB6A 4P87A 3EQVA 4GDNA 2PYPA 3MR0A 3PYPA 3SS5A 1FIKA 2R9WA 4DF6A 1XFNA 1EROA 4WZ5A 4LCMA 2MJ6A 5LBRA 4R0QA 4JXSA 2WGWB 4ZJ1A 4JF5A 5HL1A 3M2KA 4KUKA 5L8MA 2XFSA 3G35A 2JKFA 5EM1A 2BASA 3F1NA 2V0WA 4S2NC 5CRFA 4M3KA 3HVFA 3ULFA 2V8FA 4EXOA 4FUWA 1EWZA 5FEGA 4RX3A 3BY9A 5FI6A 1IFQA 2A3UA 2WKPA 3N4IA 3UY6A 4MBFA 2AVXA 4KUOA 5A91A 3UPPA 3HCYA 1K4EA 1S6RA 3FC7A 2V0UA 3HJKA 3MXRA 3LEQA 2QKPA 4EW7A 4DN0A 5KIZA 5EM0A 1WYCA 1JNUA 3BFFA 3SW1A 3T4TA 1FSYA 1NZOA 3OLOA 3SZTA 4RYEA 1F98A 5HPFA 1KDWA 2EA9A 3MXSA 4PM7A 3S22A 2VGJA 2IA2A 2ACGA 5IT5A 3E4QA 5HW3A 2Y2KA 2E8IA 4I5SA 4JGOA 1YAXA 5FDSA 3O5YA 4L9EA 1N9BA 5FDHA 4CJNA 5KSHA 1IYQA 4GD8A 4I3AA 1NRJA 1YLPA 5CX7A 2O99A 3MZEA 2R9XA 3FV7A 3T1XA 3ZYTA 3D72A 4P6ZS 4QY6A 1SKOB 4GW9A 2XDMA 3CUEA 4PMAA 1E4DA 4UAAA 4KG2A 4H6JA 3NJAA 4KZ4A 1SZVA 3A3EA 4I38A 4EQIA 1RGYA 3LR4A 4UA9A 1L0GA 3IH8A 4Y0UA 1T19A 3F1PA 1HTZA 3Q7VA 5K5BA 1BSGA 4G3KA 2Y2PA 5IS1A 3A3JA 3G31A 3QP5A 3T4KA 2KDKA 1IYOA 2K31A 1A0KA 4JKTA 3KYZA 2H0TA 4ZJ3A 4OLGA 3FZCA 4HP4A 5HWWA 5GLCA 4E3NA 1DY6A 3U2AA 4C75A 4RVAA 4MBKA 3MMHA 2J9OA 1SHVA 3DWKA 4GDBA 1TS0A 1D06A 4HJ3A 2HPBA 1W63Q 2QWSA 3IF6B 3MSHA 1N9NA 3BQ8A 2O0YA 1Y28A 2EX9A 4PKYA 4MDZA 2XROA 3N6IA 2XK1A 4I3IA 2WGVA 3HLCA 1H8MA 1W63M 2DMWA 2Y2OA 3JYIA 5G4YA 1BLHA 2EX6A 5DKLA 3Q82A 4KG6A 4O01A 4BL3A 5CEDA 4GS9B 4IUKA 3D3OA 3NECA 2Y55A 4YWZA 1H8ZA 5TFQA 3NDEA 5FAQA 4JGPA 4UQIS 3FKVA 3F1OB 3OPHA 4LFUA 2ZM8A 1ZG6A 3LIBA 1OTDA 5HDSA 3UMDA 4GLQA 1CEFA 3NBLA 1VEUA 5L09A 2ZL1B 5AQ7A 3JPUA 3IWQA 2KX6A 3OPPA 4KENB 3HREA 4JXWA 5DFYA 3LY3A 2FH5A 4B93A 1BYWA 3T4SA 2QHKA 1DP6A 2XD1A 4PAUA 3BFDA 4WZ4A 1BTLA 3TE8A 1IYSA 3O87A 4S2PA 3IBJA 1U60A 2OV5A 3V5MA 1FSWA 1KVLA 5EVIA 2VGLS
chains in the Genus database with same CATH topology
1W8YA 2Z2MB 4HEFA 2GDNA 1XPBA 2H10A 3GRJA 1FQGA 2QPNA 1PYYA 3VSLA 1MWUA 2C6WB 1I2SA 2ZMAA 3UE1A 5E2FA 1YLTA 2EFUA 4KZ9A 4N9LA 4B4ZA 1OMEA 4OPQA 2QMIA 3SH9A 1ZG4A 3UE0A 4KZBA 1KDSA 1CK3A 2G2WA 2H0YA 2UWXA 2WK0A 3I7JA 5CTNA 4YFMA 5I94A 3V39A 3UN7A 4S2OA 1PW8A 1LI0A 3BLMA 3UO9A 4UHUA 1YLWA 5EVLA 3BFGA 2JBFA 4GZBA 2XGNA 4L0LA 1K54C 1K54A 4R23A 1EI5A 1K25A 3PBTA 1TVFA 5G18A 5FAOA 2B5RA 3VFFA 3ZGAB 4C6YA 1K55C 1K55A 4N92A 4S2IA 1K4FA 2P9VA 2Y2LA 4HESA 4OQIA 1HZOA 5FQKA 4DKIA 1NZUA 4GOGA 3PAEA 3AGFA 1TDGA 1I5QA 2C5WB 5KSCA 3BFCA 1JTDA 3ITBA 4O7DA 1MWRA 1XGIA 3E2KA 4NK3A 1KE3A 1LL9A 2BG1A 2ZM2A 5E2EA 3WS1A 4KZAA 1NXYA 3QHYA 3A3DA 1FCMA 3GV9A 4JF6A 3RJUA 3ZVWA 1VM1A 4ZAMA 2EX2A 3NI9A 5M1AA 1Y54A 4GD6A 4IEDA 1XA1A 4OOLA 1H5XA 5CGWA 1CI8A 3PBNA 2ZJ9A 5F83A 2WZXA 2FFYA 2QZ6A 2EXBA 3E2LA 3PBSA 1L0DA 4BLMA 3C5AA 3A3IA 2V2FF 1PWCA 3LEZA 1YLZA 3Q81A 2RCXA 5EOOA 1RCJA 4H8RA 2WKHA 5BOHA 4YINA 2XF3A 3BRMA 3IXBA 3V3SA 5CXWA 4DDSA 5JYOA 3TG9A 3UDXA 2HDQA 1G68A 3Q7VB 4QB8A 4RA7A 1KE4A 3NCKA 3LO7A 5CERA 3G32A 3NC8A 4OQHA 2Q9MA 5FSRA 3HL9A 4S2KA 1CI9A 4GN2A 3Q07A 5DTTA 3S4XA 2G2UA 1GCEA 3ZDJA 4KZ8A 2DCFA 3ZFZA 3UE3A 3P09A 2JCHA 1IYPA 4JBFA 3ZHHA 3OZHA 4FH4A 2JC7A 1L0FA 1JWVA 4JPMA 4UA7A 5E43A 4RX2A 5FAPA 4BD0A 4F94A 2WAFA 3HLWA 4OONA 3IXDA 1O7EA 3M6HA 2XR0A 1NYYA 2ZM0A 4P0MA 5A90A 1LHYA 5F1GA 4BJPA 3WRZA 3MFDA 1LL5A 3IF6C 3IF6A 4FH2A 4OOMA 1XKZA 2ZC6B 2CC1A 1HVBA 3CJMA 3GVBA 4OLDA 5AQ9A 1FCOA 1K6RA 4S2MA 5HAQA 2WADA 3ZNTA 2HDUA 5FATA 2EXAA 2WAEA 1PZOA 4X55A 4X56A 4OKPA 5GLDA 1Z6FA 2FFFB 1ES2A 4IVIA 1WE4A 3PBRA 3WS2A 1MWSA 2I72A 1KGFA 1LI9A 2Q9NA 3N8SA 1PI4A 4LV0A 2IWCA 3N8RA 1GHMA 4LV2A 3ZVTA 3CZDA 4KZ5A 2ZC7A 1MY8A 4BQMA 5E2HA 1FOFA 3MBZA 4BD1A 1ALQA 1XP4A 5HARA 3GR2A 5A93A 3DW0A 1ERQA 4JF4A 2XFTA 4WBGA 3C4OA 1YMSA 1SKFA 3CG5A 4FCFA 4IVKA 4DE0A 3MKEA 1ZC2A 4OP8A 5AQAA 4A5RA 3EQUA 4LCLA 3AGEA 1E3UD 3IT9A 4JXGA 4DXCA 4P87A 3EQVA 4GDNA 4LENA 1VQQA 3UNWA 4HBTA 3Q7ZA 3SS5A 5HAPA 1K56D 3MZDA 2DRWA 2R9WA 3D4FA 4DF6A 2WGIA 5CEBA 2PU4A 3ZG8B 5KMWA 3NY4A 5HAIA 3FYZA 1EROA 3OCLA 4WZ5A 4WZ5C 4Z9QA 2X01A 4LCMA 1J9MA 5EOEA 4R0QA 2Y2IA 2ZQ7A 3HUMA 2JE5A 4JXSA 4DDYA 2WGWB 5FASA 1C3BA 3DWZA 4ZJ1A 4JF5A 4B4XA 5EPHA 5HL1A 3M2KA 5FQMA 4GNUA 2XFSA 4XXRA 3G35A 1PW1A 4X6TA 2BLSA 2EX8A 4GKUA 4R4SA 4S2NC 4S2NA 5CRFA 5FI2A 4M3KA 1MBLA 3HVFA 4MLLA 4PPRA 4E3JA 5FQIA 5EECA 3SS3A 3IH9A 4IBXA 2XD5A 1EWZA 1JWZA 1ES4A 4RX3A 2OSUA 3W4PA 4MBHA 4R1GA 5FI6A 2Y2MA 3Q1FA 2Y91A 4HBUA 5IHVA 3TSGA 2V1ZA 2A3UA 3W4OA 2XLNA 2Z2LB 1GA9A 4PM5A 4E3OA 1YMXA 3N4IA 4BENA 3UY6A 3W4QA 4ZJ2A 2ZQAA 4MBFA 3UPPA 5A91A 2WYXA 2ZC4B 1PIOA 1K6SA 3GMWA 1K4EA 1S6RA 2WUQA 3G30A 2WKEA 5CGXA 2J7VA 3ZG0A 3MXRA 2ZC3B 4DXBA 3VP0A 5M19A 3PTEA 3QNBA 1JWPA 1DJAA 2Y59A 3N7WA 5TR7A 5GHXA 4EV4A 4LV3A 1IEMA 2XEPA 4OQ0A 1WYCA 1CEGA 1NRFA 2PU2A 4MEZA 3OPLA 3WS4A 3QNCA 4DE3A 3BFFA 4OPZA 5DF8A 3SH8A 1NZOA 1FSYA 1BZAA 3GTCA 4ZBEA 3PAGA 4GB7A 3WS5A 1AXBA 1ES3A 1BT5A 1XGJA 4OH0A 1L2SA 4WEKA 4RYEA 2WGWA 1E3UA 5CGSA 4OOYA 3ITAA 2Y2JA 5FQ9A 1KDWA 1MWTA 4BL2A 3VOZA 3ZCZA 3MXSA 4KQRA 3VP3A 4EUZA 1FR6A 3G2YA 4PM7A 3WWXA 1K56A 3S22A 4EBLA 2VGJA 4QD4A 1XXMA 4U0TA 3DTMA 5HW3A 1YQSA 2Y2KA 2Y2QA 3IF5A 2E8IA 4S2JA 2J9PA 1N9BA 1I2WA 5FDHA 4CJNA 5KSHA 3IWOA 1IYQA 3VP4A 3G4PA 1IKGA 4GD8A 3OCNA 5KZHA 4DE1A 1YLPA 3WS0A 2XQZA 2IWDA 3MZEA 2WKIA 1W7FA 2R9XA 1PI5A 2Y4AA 3FV7A 4S2LA 2P9VB 1SDNA 3IHAA 3IWIA 4WM9A 2X71A 4QY6A 1ZKJA 2ZQCA 3N8LA 1KVMA 2XDMA 1FCNA 4QHCA 1BULA 2H5SA 1PWGA 2Y2GA 1W8QA 2ZQ8A 3HLEA 1E4DA 4KG2A 4PMAA 4UAAA 1JVJA 4E6XA 1KGGA 3BECA 4KQOA 4D2OA 4KZ4A 3A3EA 4EQIA 3AGDA 1RGYA 4UA9A 2OLVA 4OP5A 1GHIA 3BLSA 4K0XA 4Y0OA 1WYBA 5CHMA 5GLAA 1L0GA 2ZLYA 3IH8A 1E25A 3HLBA 4Y0UA 4C3QA 4JLFA 1NY0A 4QJGA 3BEBA 1HTZA 3Q7VA 1LLBA 3NDGA 3OPRA 1BSGA 3M2JA 3O3VA 3FWLA 2Y2PA 3A3JA 1FR1A 3UDIA 3G31A 2WZZA 3C4PA 5CTMA 2HP6A 4X69A 3O88A 1IKIA 4B88A 3ISGA 3M6BA 1IYOA 5FQQA 1RGZA 1W5DA 3NIAA 3UPNA 2A49A 2EFXA 5E2GA 4OVDA 3C7UA 4JKTA 4IBRA 5D3OA 4Q8IA 2H0TA 4WELA 1RP5A 1G6AA 4KZ3A 4ZJ3A 4KG5A 2Y2NA 4OLGA 3FZCA 2J8YA 2X02A 5GLCA 4E3NA 1KGEA 2DNSA 1DY6A 1PZPA 4U3TA 4EWFA 1ONGA 1PWDA 4C75A 4RVAA 1QMEA 4MBKA 3PBQA 1MPLA 2J9OA 3G34A 1SHVA 3P98A 3DWKA 4GDBA 3RXXA 1YT4A 4K0WA 4P85A 4R4RA 4E3MA 3FKWA 5L2FA 4DE2A 2HPBA 4X53A 3IF6B 4OPRA 3TOIA 3IXHA 4ID4A 5GL9A 4WYYA 3MKFA 3HBRA 4WMCD 5GHYA 3VP2A 1BUEA 1MKIA 2EX9A 2OLUA 1ES5A 4DRTA 1H8YA 3BFEA 3GQZA 4PM8A 3N6IA 5M18A 1KE0A 1JTGA 4N1XA 5EVID 3MZFA 4XUXA 2XK1A 2HDRA 3GSGA 1S0WA 5EE8A 5A92A 2WGVA 5J8XA 3A3FA 5AQBA 3HLCA 4XUZA 3ZG7B 2ZQDA 3HLGA 3O86A 2Y2OA 3HUNA 3JYIA 4E3LA 1GHPA 4JXVA 3VFHA 1BLHA 2EX6A 1NYMA 1IELA 4KQQA 3Q82A 2RL3A 2ZQ9A 4OPYA 1ESIA 4EBNA 2HDSA 2VGKA 4KG6A 3G2ZA 3VP1A 3HUOA 5EUAA 1O07A 3V50A 5DVAA 4P6BA 4BL3A 5CEDA 5CHJA 5CHUA 5EVIB 3SS4A 2PBYA 4PM9A 3VSKA 4OQGA 2V20A 2Y55A 3SH7A 1XA7A 1H8ZA 1Q2PA 5TFQA 3NDEA 5FAQA 4N9KA 4E3IA 4Y0TA 1QMFA 3PBOA 1L0EA 5CECA 3FKVA 4PM6A 4UA6A 1BLPA 3V3RA 4R3BA 1YM1A 3OPHA 5JYPA 1DJBA 1GA0A 4WEJA 1ERMA 2ZM8A 4QY5A 4E6WA 3W8KA 1W79A 1YLYA 4QU3A 2HP9A 3VOYA 1ONHA 5DTKA 5U47A 3VMAA 1ZG6A 5GLBA 4NETA 1HD8A 1TEMA 1Q2QA 4X68A 1XX2A 1MXOA 4ZDXA 3BYDA 4Y7PA 1K38A 5DF9A 3ZG9B 5HX9A 3LCEA 1SDEA 1YLJA 1CEFA 2HP5A 2Y2HA 3NBLA 3LY4A 5F82A 4KZ6A 3HLDA 1ESUA 3IQAA 5AQ7A 3HLFA 4U0XA 1M40A 3IWQA 1BLCA 2P74A 3ZNYA 3OPPA 4LV1A 5FA7A 4KENB 4K91A 4FSFA 5F1FA 3UDFA 1M6KA 3OC2A 3IXGA 3B3XA 5DF7A 3ZG5A 2IWBA 3HREA 4EBPA 3C7VA 4JXWA 4R3JA 3LY3A 3SOIA 4KZ7A 3CMZA 5HFOA 3RXWA 2XH9A 1NJ4A 3S1YA 5TGFA 3UPOA 4MNRA 3BM6A 1TDLA 2XD1A 5FI7A 3BFDA 1DJCA 4WZ4A 1BTLA 4E3KA 4WMCA 4ZTKA 1K57C 1K57A 3WRTA 2ZC5B 5FQJA 5GHZA 1IYSA 3IHBA 4FD8A 3O87A 4N1HA 4S2PA 1BLSA 1N4OA 1U60A 2OV5A 4CPKA 1SCWA 5DTSA 3V5MA 1FSWA 1KVLA 5EVIC 5EVIA 2ZD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W8Y A;  2Z2M B;  4HEF A;  2GDN A;  1XPB A;  2H10 A;  3GRJ A;  1FQG A;  2QPN A;  1PYY A;  3VSL A;  1MWU A;  2C6W B;  1I2S A;  2ZMA A;  3UE1 A;  5E2F A;  1YLT A;  2EFU A;  4KZ9 A;  4N9L A;  4B4Z A;  1OME A;  4OPQ A;  2QMI A;  3SH9 A;  1ZG4 A;  3UE0 A;  4KZB A;  1KDS A;  1CK3 A;  2G2W A;  2H0Y A;  2UWX A;  2WK0 A;  3I7J A;  5CTN A;  4YFM A;  5I94 A;  3V39 A;  3UN7 A;  4S2O A;  1PW8 A;  1LI0 A;  3BLM A;  3UO9 A;  4UHU A;  1YLW A;  5EVL A;  3BFG A;  2JBF A;  4GZB A;  2XGN A;  4L0L A;  1K54 C;  1K54 A;  4R23 A;  1EI5 A;  1K25 A;  3PBT A;  1TVF A;  5G18 A;  5FAO A;  2B5R A;  3VFF A;  3ZGA B;  4C6Y A;  1K55 C;  1K55 A;  4N92 A;  4S2I A;  1K4F A;  2P9V A;  2Y2L A;  4HES A;  4OQI A;  1HZO A;  5FQK A;  4DKI A;  1NZU A;  4GOG A;  3PAE A;  3AGF A;  1TDG A;  1I5Q A;  2C5W B;  5KSC A;  3BFC A;  1JTD A;  3ITB A;  4O7D A;  1MWR A;  1XGI A;  3E2K A;  4NK3 A;  1KE3 A;  1LL9 A;  2BG1 A;  2ZM2 A;  5E2E A;  3WS1 A;  4KZA A;  1NXY A;  3QHY A;  3A3D A;  1FCM A;  3GV9 A;  4JF6 A;  3RJU A;  3ZVW A;  1VM1 A;  4ZAM A;  2EX2 A;  3NI9 A;  5M1A A;  1Y54 A;  4GD6 A;  4IED A;  1XA1 A;  4OOL A;  1H5X A;  5CGW A;  1CI8 A;  3PBN A;  2ZJ9 A;  5F83 A;  2WZX A;  2FFY A;  2QZ6 A;  2EXB A;  3E2L A;  3PBS A;  1L0D A;  4BLM A;  3C5A A;  3A3I A;  2V2F F;  1PWC A;  3LEZ A;  1YLZ A;  3Q81 A;  2RCX A;  5EOO A;  1RCJ A;  4H8R A;  2WKH A;  5BOH A;  4YIN A;  2XF3 A;  3BRM A;  3IXB A;  3V3S A;  5CXW A;  4DDS A;  5JYO A;  3TG9 A;  3UDX A;  2HDQ A;  1G68 A;  3Q7V B;  4QB8 A;  4RA7 A;  1KE4 A;  3NCK A;  3LO7 A;  5CER A;  3G32 A;  3NC8 A;  4OQH A;  2Q9M A;  5FSR A;  3HL9 A;  4S2K A;  1CI9 A;  4GN2 A;  3Q07 A;  5DTT A;  3S4X A;  2G2U A;  1GCE A;  3ZDJ A;  4KZ8 A;  2DCF A;  3ZFZ A;  3UE3 A;  3P09 A;  2JCH A;  1IYP A;  4JBF A;  3ZHH A;  3OZH A;  4FH4 A;  2JC7 A;  1L0F A;  1JWV A;  4JPM A;  4UA7 A;  5E43 A;  4RX2 A;  5FAP A;  4BD0 A;  4F94 A;  2WAF A;  3HLW A;  4OON A;  3IXD A;  1O7E A;  3M6H A;  2XR0 A;  1NYY A;  2ZM0 A;  4P0M A;  5A90 A;  1LHY A;  5F1G A;  4BJP A;  3WRZ A;  3MFD A;  1LL5 A;  3IF6 C;  3IF6 A;  4FH2 A;  4OOM A;  1XKZ A;  2ZC6 B;  2CC1 A;  1HVB A;  3CJM A;  3GVB A;  4OLD A;  5AQ9 A;  1FCO A;  1K6R A;  4S2M A;  5HAQ A;  2WAD A;  3ZNT A;  2HDU A;  5FAT A;  2EXA A;  2WAE A;  1PZO A;  4X55 A;  4X56 A;  4OKP A;  5GLD A;  1Z6F A;  2FFF B;  1ES2 A;  4IVI A;  1WE4 A;  3PBR A;  3WS2 A;  1MWS A;  2I72 A;  1KGF A;  1LI9 A;  2Q9N A;  3N8S A;  1PI4 A;  4LV0 A;  2IWC A;  3N8R A;  1GHM A;  4LV2 A;  3ZVT A;  3CZD A;  4KZ5 A;  2ZC7 A;  1MY8 A;  4BQM A;  5E2H A;  1FOF A;  3MBZ A;  4BD1 A;  1ALQ A;  1XP4 A;  5HAR A;  3GR2 A;  5A93 A;  3DW0 A;  1ERQ A;  4JF4 A;  2XFT A;  4WBG A;  3C4O A;  1YMS A;  1SKF A;  3CG5 A;  4FCF A;  4IVK A;  4DE0 A;  3MKE A;  1ZC2 A;  4OP8 A;  5AQA A;  4A5R A;  3EQU A;  4LCL A;  3AGE A;  1E3U D;  3IT9 A;  4JXG A;  4DXC A;  4P87 A;  3EQV A;  4GDN A;  4LEN A;  1VQQ A;  3UNW A;  4HBT A;  3Q7Z A;  3SS5 A;  5HAP A;  1K56 D;  3MZD A;  2DRW A;  2R9W A;  3D4F A;  4DF6 A;  2WGI A;  5CEB A;  2PU4 A;  3ZG8 B;  5KMW A;  3NY4 A;  5HAI A;  3FYZ A;  1ERO A;  3OCL A;  4WZ5 A;  4WZ5 C;  4Z9Q A;  2X01 A;  4LCM A;  1J9M A;  5EOE A;  4R0Q A;  2Y2I A;  2ZQ7 A;  3HUM A;  2JE5 A;  4JXS A;  4DDY A;  2WGW B;  5FAS A;  1C3B A;  3DWZ A;  4ZJ1 A;  4JF5 A;  4B4X A;  5EPH A;  5HL1 A;  3M2K A;  5FQM A;  4GNU A;  2XFS A;  4XXR A;  3G35 A;  1PW1 A;  4X6T A;  2BLS A;  2EX8 A;  4GKU A;  4R4S A;  4S2N C;  4S2N A;  5CRF A;  5FI2 A;  4M3K A;  1MBL A;  3HVF A;  4MLL A;  4PPR A;  4E3J A;  5FQI A;  5EEC A;  3SS3 A;  3IH9 A;  4IBX A;  2XD5 A;  1EWZ A;  1JWZ A;  1ES4 A;  4RX3 A;  2OSU A;  3W4P A;  4MBH A;  4R1G A;  5FI6 A;  2Y2M A;  3Q1F A;  2Y91 A;  4HBU A;  5IHV A;  3TSG A;  2V1Z A;  2A3U A;  3W4O A;  2XLN A;  2Z2L B;  1GA9 A;  4PM5 A;  4E3O A;  1YMX A;  3N4I A;  4BEN A;  3UY6 A;  3W4Q A;  4ZJ2 A;  2ZQA A;  4MBF A;  3UPP A;  5A91 A;  2WYX A;  2ZC4 B;  1PIO A;  1K6S A;  3GMW A;  1K4E A;  1S6R A;  2WUQ A;  3G30 A;  2WKE A;  5CGX A;  2J7V A;  3ZG0 A;  3MXR A;  2ZC3 B;  4DXB A;  3VP0 A;  5M19 A;  3PTE A;  3QNB A;  1JWP A;  1DJA A;  2Y59 A;  3N7W A;  5TR7 A;  5GHX A;  4EV4 A;  4LV3 A;  1IEM A;  2XEP A;  4OQ0 A;  1WYC A;  1CEG A;  1NRF A;  2PU2 A;  4MEZ A;  3OPL A;  3WS4 A;  3QNC A;  4DE3 A;  3BFF A;  4OPZ A;  5DF8 A;  3SH8 A;  1NZO A;  1FSY A;  1BZA A;  3GTC A;  4ZBE A;  3PAG A;  4GB7 A;  3WS5 A;  1AXB A;  1ES3 A;  1BT5 A;  1XGJ A;  4OH0 A;  1L2S A;  4WEK A;  4RYE A;  2WGW A;  1E3U A;  5CGS A;  4OOY A;  3ITA A;  2Y2J A;  5FQ9 A;  1KDW A;  1MWT A;  4BL2 A;  3VOZ A;  3ZCZ A;  3MXS A;  4KQR A;  3VP3 A;  4EUZ A;  1FR6 A;  3G2Y A;  4PM7 A;  3WWX A;  1K56 A;  3S22 A;  4EBL A;  2VGJ A;  4QD4 A;  1XXM A;  4U0T A;  3DTM A;  5HW3 A;  1YQS A;  2Y2K A;  2Y2Q A;  3IF5 A;  2E8I A;  4S2J A;  2J9P A;  1N9B A;  1I2W A;  5FDH A;  4CJN A;  5KSH A;  3IWO A;  1IYQ A;  3VP4 A;  3G4P A;  1IKG A;  4GD8 A;  3OCN A;  5KZH A;  4DE1 A;  1YLP A;  3WS0 A;  2XQZ A;  2IWD A;  3MZE A;  2WKI A;  1W7F A;  2R9X A;  1PI5 A;  2Y4A A;  3FV7 A;  4S2L A;  2P9V B;  1SDN A;  3IHA A;  3IWI A;  4WM9 A;  2X71 A;  4QY6 A;  1ZKJ A;  2ZQC A;  3N8L A;  1KVM A;  2XDM A;  1FCN A;  4QHC A;  1BUL A;  2H5S A;  1PWG A;  2Y2G A;  1W8Q A;  2ZQ8 A;  3HLE A;  1E4D A;  4KG2 A;  4PMA A;  4UAA A;  1JVJ A;  4E6X A;  1KGG A;  3BEC A;  4KQO A;  4D2O A;  4KZ4 A;  3A3E A;  4EQI A;  3AGD A;  1RGY A;  4UA9 A;  2OLV A;  4OP5 A;  1GHI A;  3BLS A;  4K0X A;  4Y0O A;  1WYB A;  5CHM A;  5GLA A;  1L0G A;  2ZLY A;  3IH8 A;  1E25 A;  3HLB A;  4Y0U A;  4C3Q A;  4JLF A;  1NY0 A;  4QJG A;  3BEB A;  1HTZ A;  3Q7V A;  1LLB A;  3NDG A;  3OPR A;  1BSG A;  3M2J A;  3O3V A;  3FWL A;  2Y2P A;  3A3J A;  1FR1 A;  3UDI A;  3G31 A;  2WZZ A;  3C4P A;  5CTM A;  2HP6 A;  4X69 A;  3O88 A;  1IKI A;  4B88 A;  3ISG A;  3M6B A;  1IYO A;  5FQQ A;  1RGZ A;  1W5D A;  3NIA A;  3UPN A;  2A49 A;  2EFX A;  5E2G A;  4OVD A;  3C7U A;  4JKT A;  4IBR A;  5D3O A;  4Q8I A;  2H0T A;  4WEL A;  1RP5 A;  1G6A A;  4KZ3 A;  4ZJ3 A;  4KG5 A;  2Y2N A;  4OLG A;  3FZC A;  2J8Y A;  2X02 A;  5GLC A;  4E3N A;  1KGE A;  2DNS A;  1DY6 A;  1PZP A;  4U3T A;  4EWF A;  1ONG A;  1PWD A;  4C75 A;  4RVA A;  1QME A;  4MBK A;  3PBQ A;  1MPL A;  2J9O A;  3G34 A;  1SHV A;  3P98 A;  3DWK A;  4GDB A;  3RXX A;  1YT4 A;  4K0W A;  4P85 A;  4R4R A;  4E3M A;  3FKW A;  5L2F A;  4DE2 A;  2HPB A;  4X53 A;  3IF6 B;  4OPR A;  3TOI A;  3IXH A;  4ID4 A;  5GL9 A;  4WYY A;  3MKF A;  3HBR A;  4WMC D;  5GHY A;  3VP2 A;  1BUE A;  1MKI A;  2EX9 A;  2OLU A;  1ES5 A;  4DRT A;  1H8Y A;  3BFE A;  3GQZ A;  4PM8 A;  3N6I A;  5M18 A;  1KE0 A;  1JTG A;  4N1X A;  5EVI D;  3MZF A;  4XUX A;  2XK1 A;  2HDR A;  3GSG A;  1S0W A;  5EE8 A;  5A92 A;  2WGV A;  5J8X A;  3A3F A;  5AQB A;  3HLC A;  4XUZ A;  3ZG7 B;  2ZQD A;  3HLG A;  3O86 A;  2Y2O A;  3HUN A;  3JYI A;  4E3L A;  1GHP A;  4JXV A;  3VFH A;  1BLH A;  2EX6 A;  1NYM A;  1IEL A;  4KQQ A;  3Q82 A;  2RL3 A;  2ZQ9 A;  4OPY A;  1ESI A;  4EBN A;  2HDS A;  2VGK A;  4KG6 A;  3G2Z A;  3VP1 A;  3HUO A;  5EUA A;  1O07 A;  3V50 A;  5DVA A;  4P6B A;  4BL3 A;  5CED A;  5CHJ A;  5CHU A;  5EVI B;  3SS4 A;  2PBY A;  4PM9 A;  3VSK A;  4OQG A;  2V20 A;  2Y55 A;  3SH7 A;  1XA7 A;  1H8Z A;  1Q2P A;  5TFQ A;  3NDE A;  5FAQ A;  4N9K A;  4E3I A;  4Y0T A;  1QMF A;  3PBO A;  1L0E A;  5CEC A;  3FKV A;  4PM6 A;  4UA6 A;  1BLP A;  3V3R A;  4R3B A;  1YM1 A;  3OPH A;  5JYP A;  1DJB A;  1GA0 A;  4WEJ A;  1ERM A;  2ZM8 A;  4QY5 A;  4E6W A;  3W8K A;  1W79 A;  1YLY A;  4QU3 A;  2HP9 A;  3VOY A;  1ONH A;  5DTK A;  5U47 A;  3VMA A;  1ZG6 A;  5GLB A;  4NET A;  1HD8 A;  1TEM A;  1Q2Q A;  4X68 A;  1XX2 A;  1MXO A;  4ZDX A;  3BYD A;  4Y7P A;  1K38 A;  5DF9 A;  3ZG9 B;  5HX9 A;  3LCE A;  1SDE A;  1YLJ A;  1CEF A;  2HP5 A;  2Y2H A;  3NBL A;  3LY4 A;  5F82 A;  4KZ6 A;  3HLD A;  1ESU A;  3IQA A;  5AQ7 A;  3HLF A;  4U0X A;  1M40 A;  3IWQ A;  1BLC A;  2P74 A;  3ZNY A;  3OPP A;  4LV1 A;  5FA7 A;  4KEN B;  4K91 A;  4FSF A;  5F1F A;  3UDF A;  1M6K A;  3OC2 A;  3IXG A;  3B3X A;  5DF7 A;  3ZG5 A;  2IWB A;  3HRE A;  4EBP A;  3C7V A;  4JXW A;  4R3J A;  3LY3 A;  3SOI A;  4KZ7 A;  3CMZ A;  5HFO A;  3RXW A;  2XH9 A;  1NJ4 A;  3S1Y A;  5TGF A;  3UPO A;  4MNR A;  3BM6 A;  1TDL A;  2XD1 A;  5FI7 A;  3BFD A;  1DJC A;  4WZ4 A;  1BTL A;  4E3K A;  4WMC A;  4ZTK A;  1K57 C;  1K57 A;  3WRT A;  2ZC5 B;  5FQJ A;  5GHZ A;  1IYS A;  3IHB A;  4FD8 A;  3O87 A;  4N1H A;  4S2P A;  1BLS A;  1N4O A;  1U60 A;  2OV5 A;  4CPK A;  1SCW A;  5DTS A;  3V5M A;  1FSW A;  1KVL A;  5EVI C;  5EVI A;  2ZD8 A; 
#chains in the Genus database with same CATH topology
 2Z2M B;  1XPB A;  2QPN A;  1HLU P;  5TJJ A;  1H0M A;  2C6W B;  3K3C A;  2ZMA A;  2EFU A;  2XRN A;  2KLI A;  3BJN A;  3SH9 A;  3UE0 A;  2UWX A;  2L1M A;  1OPX A;  4ZRR A;  1YPR A;  4Q0H A;  1F5M A;  5FL3 A;  4UHU A;  5EVL A;  2XGN A;  4QWO A;  1K54 A;  1EI5 A;  3PBT A;  3ZGA B;  1K55 A;  4S2I A;  2P9V A;  4WL9 A;  4HES A;  2A24 A;  5FQK A;  1NZU A;  4DKI A;  1XJ3 A;  3UB6 A;  1S67 L;  1TS7 A;  3PAE A;  4R3A A;  5L07 A;  5KSC A;  3ITB A;  1MWR A;  1XGI A;  2XSS A;  3C8C A;  1LSW A;  2ZM2 A;  5E2E A;  1F2K A;  1XA1 A;  3T4O A;  1CI8 A;  5AJG A;  3LIF A;  5F83 A;  2WZX A;  3PBS A;  1L0D A;  1S1Y A;  1PWC A;  1TF1 A;  3Q81 A;  1T1B A;  2RCX A;  3CI6 A;  4H8R A;  2XF3 A;  3BRM A;  3V3S A;  4DDS A;  3UB7 A;  4LGW A;  2HDQ A;  3K3D A;  1KE4 A;  3LO7 A;  3Q07 A;  3LR3 A;  2G2U A;  1GCE A;  3KSH A;  3ZFZ A;  3UE3 A;  3P09 A;  1IYP A;  3ZHH A;  2JC7 A;  4RX2 A;  3VE4 A;  4BD0 A;  3HLW A;  2PR5 A;  3M6H A;  2PRF A;  4DXC A;  4E3L A;  3IF6 C;  2LB9 A;  3GVB A;  2WAD A;  2ZBB A;  4F3L B;  1S66 L;  1H3Q A;  2EXA A;  3IX3 A;  4X56 A;  1ODV A;  1Y4O A;  4M4X A;  3N8S A;  3LFV A;  4LV2 A;  3CZD A;  4KZ5 A;  2ZC7 A;  1FOF A;  1ALQ A;  3C2W A;  5A93 A;  2B02 A;  3CUE C;  3DTE A;  4JXG A;  4GHI B;  3T4J A;  4HBT A;  3MF0 A;  3L9K A;  5KMW A;  5HSQ A;  2JE5 A;  4DDY A;  5FQM A;  4X6T A;  2BLS A;  4GKU A;  5FI2 A;  3LID A;  1MBL A;  2OAQ 1;  5FQI A;  3LR5 A;  4IBX A;  2XD5 A;  1OT9 A;  1JWZ A;  3IX8 A;  3W4P A;  4IHQ A;  1KOU A;  1PRQ A;  4BEN A;  5HL6 A;  3R7W A;  2A2L A;  1PIO A;  2PD8 A;  3G30 A;  2W3D A;  4CLC B;  3ZG0 A;  4ETZ A;  2PHY A;  4HJ6 A;  5HDC A;  5TR7 A;  5GHX A;  4EV4 A;  2XEP A;  1NRF A;  3WS4 A;  4OPZ A;  5DF8 A;  4ZBE A;  1ES3 A;  4OH0 A;  4EER A;  1EW0 A;  2WGW A;  1E3U A;  5CGS A;  2L4R A;  2OAP 1;  5DJU A;  2Y2J A;  2VZW A;  2ZMF A;  4LRX C;  2P08 A;  3DTI A;  3VOZ A;  3S7N A;  3ZCZ A;  4KQR A;  1K56 A;  1UWP X;  1XXM A;  1YQS A;  2Y2Q A;  3CPT B;  3LR0 A;  4S2J A;  4EQ1 A;  4DJ2 A;  1I2W A;  3D9Y A;  3VE3 A;  2J80 A;  4DE1 A;  4G3V A;  3WS0 A;  2LB5 A;  2XQZ A;  2IWD A;  2V9A A;  4S2L A;  3T1S A;  1SDN A;  3IHA A;  3BW6 A;  4B9O A;  1W8Q A;  3PHY A;  3BEC A;  4KQO A;  4D2O A;  2W1R A;  4OP5 A;  1GHI A;  4K0X A;  1WYB A;  2ZLY A;  3HLB A;  3BEB A;  4HNB A;  1T1A A;  3KYE A;  2B95 A;  2WKR A;  2WZZ A;  2HP6 A;  1IKI A;  3M6B A;  5FQQ A;  1RGZ A;  1W5D A;  3NIA A;  3UPN A;  4OVD A;  3C7U A;  1GSV A;  2VEA A;  4Q8I A;  1G6A A;  4Y17 A;  2Y2N A;  2J8Y A;  1PZP A;  1XJ6 A;  4CLC D;  3MFX A;  1MPL A;  1P97 A;  4K0W A;  4MN6 A;  3FKW A;  3MQ0 A;  3MQQ A;  4OPR A;  3BWL A;  4ID4 A;  3VP2 A;  2OLU A;  1ES5 A;  3BFE A;  1F9I A;  5F6A A;  1KE0 A;  4N1X A;  3MZF A;  1NLY A;  2HDR A;  1S0W A;  3NOT C;  2EWW A;  5AQB A;  3VFH A;  4EUV A;  4KQQ A;  4EEU A;  3VP1 A;  3LI9 A;  3LUQ A;  3V50 A;  5CHJ A;  3SS4 A;  4EES A;  1XA7 A;  4N9K A;  1QMF A;  1L0E A;  3VOL A;  1BLP A;  2OOL A;  1YM1 A;  1DJB A;  4QY5 A;  1YLY A;  1ONH A;  3F1N B;  5U47 A;  1Q2Q A;  5J3W A;  3BYD A;  1K38 A;  4BBT A;  3LCE A;  4HQA A;  1YLJ A;  2Y2H A;  5J7E A;  3LY4 A;  4CLC C;  2M1C A;  3HLF A;  1BLC A;  2P74 A;  4K91 A;  3UDF A;  5J4E A;  3B3X A;  2VA0 A;  4R3J A;  4KZ7 A;  3CMZ A;  2PD7 A;  5G4Z A;  1D1J A;  3P7N A;  3UPO A;  4MNR A;  4WN5 A;  5FI7 A;  1DJC A;  3G6O A;  4WMC A;  1K57 A;  2ZC5 B;  5FQJ A;  1P0Z A;  5F5Y A;  4HEF A;  2H10 A;  1XFQ A;  3GRJ A;  1FQG A;  1PYY A;  5AVF A;  5HWT A;  4OPQ A;  2QMI A;  1ZG4 A;  3F1O A;  1KDS A;  2PYR A;  2G2W A;  5CTN A;  4YFM A;  5I94 A;  4S2O A;  3UO9 A;  1YLW A;  3KSI A;  3BFG A;  2JBF A;  4GZB A;  2JKT I;  2HJE A;  4L0L A;  4R23 A;  4K08 A;  1K4F A;  2J3W A;  4CQH A;  1TDG A;  4LRZ E;  1JTD A;  1DRM A;  1KE3 A;  4KZA A;  1NXY A;  3QHY A;  3S7O A;  5MC7 A;  3GV9 A;  4JF6 A;  3RJU A;  2VJW A;  1VM1 A;  2ZMV A;  5M1A A;  4KQD A;  5CGW A;  4G3W A;  3PBN A;  2ZJ9 A;  4HOI A;  4H6J B;  2QZ6 A;  3C5A A;  1YSP A;  4WF0 A;  3F1P B;  5CXW A;  5F69 A;  3Q7V B;  2L0W A;  3NCK A;  5CER A;  4Y5F A;  2H28 A;  2JN7 A;  1ACF A;  2Q9M A;  2EWV A;  5HD3 A;  3BQA A;  4DJ3 A;  1JWV A;  3A0R A;  4JPM A;  5FAP A;  3QP6 A;  4F94 A;  3MXQ A;  4OON A;  3IXD A;  2XR0 A;  1NYY A;  4P0M A;  1LL5 A;  1XKZ A;  2ZC6 B;  2CC1 A;  3CJM A;  5AQ9 A;  2Z6C A;  1K6R A;  3ZNT A;  2HDU A;  5FAT A;  2WAE A;  2YKF A;  4X55 A;  4IVI A;  3WS2 A;  1WE4 A;  1K0K A;  1LI9 A;  4LV0 A;  2IWC A;  3IX4 A;  3ZVT A;  3MBZ A;  1XP4 A;  2HV1 A;  3DW0 A;  4JF4 A;  3C4O A;  4FCF A;  4IVK A;  4DE0 A;  4HHD A;  4ME4 A;  3MKE A;  4OP8 A;  4A5R A;  4LCL A;  3AGE A;  3IT9 A;  3C30 A;  1VQQ A;  3Q7Z A;  2JKG A;  2DRW A;  5CEB A;  3IS2 A;  2PU4 A;  4XT2 A;  3NY4 A;  4WZ5 C;  3OCL A;  1J9M A;  5EOE A;  1TS6 A;  3UB5 P;  2Y2I A;  3CHW P;  2W1T A;  5FAS A;  1C3B A;  3CWF A;  1GSX A;  5EPH A;  3TJZ C;  4S2N A;  3UB8 A;  4Y15 A;  2Y8H A;  5EEC A;  3IH9 A;  3GEC A;  2VLG A;  2BTF P;  2Y2M A;  2J3T D;  4HBU A;  2V1Z A;  4ARZ A;  3W4O A;  2XLN A;  2Z2L B;  3H82 A;  1GA9 A;  4PM5 A;  4E3O A;  3W4Q A;  4ZJ2 A;  2Y79 A;  2WUQ A;  5L10 A;  4NXB A;  5CGX A;  2J7V A;  1VET A;  2ZC3 B;  4DXB A;  3VP0 A;  5M19 A;  3R4K A;  3NUL A;  1DJA A;  3N7W A;  2GZA A;  4OQ0 A;  1CEG A;  2PU2 A;  4MEZ A;  3OPL A;  2V1B A;  3QNC A;  2W3G A;  4DE3 A;  2M7U A;  3SH8 A;  1BZA A;  3GTC A;  3PAG A;  4GB7 A;  4WEK A;  1TD5 A;  3ITA A;  5FQ9 A;  1MWT A;  3E4O A;  4BL2 A;  3VP3 A;  2KOI A;  4EUZ A;  1FR6 A;  3WWX A;  3B47 A;  3C38 A;  4QD4 A;  1Z09 A;  3IF5 A;  4BBU A;  1G28 A;  3VP4 A;  3EOI A;  3UME A;  2V8C A;  2W27 A;  1X0O A;  2WKI A;  4P6Z M;  1PI5 A;  1D7E A;  2P9V B;  4WM9 A;  1G6O A;  2X71 A;  2A24 B;  1ZKJ A;  2ZQC A;  2PT7 A;  3T1R A;  3B33 A;  3FPV A;  3H7W A;  2J3T C;  2H5S A;  3HLE A;  1KGG A;  1UWN X;  2OLV A;  3WS1 A;  3BLS A;  5GLA A;  4C3Q A;  1E25 A;  4JLF A;  1NY0 A;  1NLZ A;  4QPR A;  3M2J A;  4Y13 A;  1FR1 A;  5TBM A;  3L7H A;  3O88 A;  4B88 A;  1VHM A;  3ISG A;  3CIT A;  2A49 A;  4AFI A;  5D3O A;  3KO6 A;  3NOU C;  4KG5 A;  2X02 A;  2JKR M;  4U3T A;  1ONG A;  2YKH A;  3PBQ A;  3P98 A;  3RXX A;  1YT4 A;  3H9W A;  1ZHH B;  4P85 A;  4X53 A;  3TOI A;  3ICY A;  5GL9 A;  1WA9 A;  4WYY A;  3MKF A;  3QP1 A;  3HBR A;  5GHY A;  1BUE A;  1MKI A;  4D60 A;  1H8Y A;  3GQZ A;  4PM8 A;  1JTG A;  3OBF A;  4PKY G;  5EVI D;  4XUX A;  3GSG A;  5EE8 A;  1V9Y A;  3ZG7 B;  4EET B;  1IEL A;  2ZQ9 A;  1ESI A;  4EBN A;  1XJ2 A;  1J3W A;  2VGK A;  3G2Z A;  3HUO A;  1L3L A;  1OTI A;  4P6B A;  5CHU A;  2W3H A;  4PM9 A;  3VSK A;  4OQG A;  1LT0 A;  4UQI M;  4FTX A;  4MCW A;  1OTE A;  4X25 A;  4E3I A;  3PBO A;  4PM6 A;  4UA6 A;  2XA7 S;  3U4L P;  1GA0 A;  1W79 A;  4QU3 A;  3B42 A;  3VMA A;  5DTK A;  5GLB A;  2QYB A;  4GJ4 A;  1TEM A;  2B18 A;  4X68 A;  3A0V A;  2PR6 A;  3BY8 A;  4Y7P A;  5HD5 A;  5DF9 A;  4EU0 A;  2K7S A;  2HP5 A;  5F82 A;  3HLD A;  1ESU A;  1S1Z A;  3JVU A;  4U0X A;  1M40 A;  1MKM A;  4LV1 A;  5FA7 A;  4FSF A;  5F1F A;  2JKR I;  1M6K A;  3IXG A;  3ZG5 A;  4EBP A;  3C7V A;  3SOI A;  3R7W B;  3S7Q A;  5HFO A;  2XH9 A;  1NJ4 A;  1DP8 A;  4HIA A;  5HWV A;  3WRT A;  4ZTK A;  4NXG A;  5GHZ A;  2VGL M;  3IHB A;  2VKS A;  4CPK A;  1SCW A;  3HJI A;  5EVI C;  2ZD8 A;  1W8Y A;  4BBV A;  4I39 A;  4LLO B;  3UE1 A;  2O9C A;  4KZ9 A;  5E2F A;  4N9L A;  4JGR A;  2V1A A;  4HY8 A;  4B4Z A;  1OME A;  1CK3 A;  2H0Y A;  2P7J A;  2WK0 A;  3UN7 A;  1LI0 A;  3LIA A;  1K54 C;  5G18 A;  5FAO A;  2B5R A;  3VFF A;  4I3J A;  1K55 C;  4N92 A;  4LRY C;  4UEY A;  1SKO A;  4GOG A;  2C5W B;  4R38 A;  3BFC A;  4O7D A;  1FIL A;  3RH8 B;  1LL9 A;  2BG1 A;  3EWK A;  3S7P A;  3P01 A;  1Y54 A;  4GD6 A;  4IED A;  4OOL A;  4BLM A;  2EXB A;  2JKT M;  3T1Q B;  4E04 A;  2V2F F;  3LEZ A;  1YLZ A;  2R78 A;  4FOF A;  2WKH A;  4YIN A;  3IXB A;  3TG9 A;  3UDX A;  4QB8 A;  1G68 A;  4RA7 A;  2GX5 A;  5FSR A;  3HL9 A;  1CI9 A;  4GN2 A;  3S4X A;  3ZDJ A;  1OJG A;  2HJ9 C;  4JBF A;  3OZH A;  1L0F A;  3ZQ5 A;  4ETX A;  2WAF A;  2ZOH A;  2UV0 E;  1P9R A;  3WRZ A;  4FH2 A;  4OOM A;  3IF6 A;  1TS8 A;  4E6W A;  1FCO A;  4S2M A;  4NXE A;  2OWJ A;  3MS6 A;  2W3E A;  1PZO A;  2HF6 A;  4OKP A;  3PBR A;  1MWS A;  3DBA A;  2Q9N A;  3N8R A;  1GHM A;  4BQM A;  1MY8 A;  5E2H A;  5EV0 A;  4IJG A;  3GR2 A;  2K2N A;  5HAR A;  1ERQ A;  4NXF A;  2QJ7 A;  3UB9 A;  2XFT A;  4WLA A;  5C5K A;  1ZC2 A;  3EQU A;  1E3U D;  2E8J A;  4YOF A;  4LEN A;  3UNW A;  4GS9 A;  1LSX A;  5HAP A;  1K56 D;  3MZD A;  3D4F A;  2WGI A;  3ZG8 B;  5HAI A;  3FYZ A;  2X01 A;  1N9O A;  4Z9Q A;  2JHE A;  2ZQ7 A;  3HUM A;  4R70 A;  3DWZ A;  4NG2 A;  4B4X A;  2Z6D A;  4GNU A;  4XXR A;  1PW1 A;  2NUT C;  2EX8 A;  4R4S A;  1PNE A;  4MLL A;  4PPR A;  4E3J A;  1PFL A;  3SS3 A;  4Z1W A;  1ES4 A;  2OSU A;  4MBH A;  3KX0 X;  4R1G A;  3Q1F A;  3V67 A;  3E0Y A;  2Y91 A;  3EEH A;  5IHV A;  3TSG A;  2ZL1 A;  4LPZ A;  1UGU A;  1YMX A;  1CJF A;  1MC0 A;  4BWI A;  2ZQA A;  2WYX A;  2ZC4 B;  5HPI A;  1K6S A;  3GMW A;  3VV4 A;  2W3F A;  5DJT A;  2WKE A;  4Y2F A;  1OJ5 A;  3PTE A;  3QNB A;  1YKD A;  1JWP A;  2Y59 A;  3PXP A;  4LV3 A;  1IEM A;  5HZH A;  4JGQ A;  3WS5 A;  1AXB A;  1BT5 A;  1XGJ A;  1L2S A;  3RFB A;  4OOY A;  3KSG A;  4BMW A;  3G2Y A;  3LIE A;  1DP9 A;  4EBL A;  2W0N A;  4PHT A;  4U0T A;  3DTM A;  2XA7 M;  4MN7 A;  2J9P A;  5I5L A;  3KYQ A;  3IWO A;  3G4P A;  1IKG A;  3OCN A;  4R6L A;  5KZH A;  2FZ0 A;  1W7F A;  2Y4A A;  4Y3I A;  2O9B A;  3IWI A;  3LGO A;  3N8L A;  2P04 A;  1KVM A;  1FCN A;  1MZU A;  4QHC A;  1BUL A;  2PDR A;  1PWG A;  2Y2G A;  2ZQ8 A;  4NEE D;  1JVJ A;  4E6X A;  1N9L A;  4HP9 A;  3AGD A;  5CHM A;  4Y0O A;  2PAV P;  3PR6 A;  3TW8 A;  4QJG A;  1LLB A;  3NDG A;  3OPR A;  3O3V A;  3FWL A;  4WUJ A;  3UDI A;  3C4P A;  5CTM A;  4X69 A;  2EFX A;  5E2G A;  2PBD P;  4IBR A;  4WEL A;  1RP5 A;  4KZ3 A;  3DTK A;  4YNR A;  1KGE A;  2DNS A;  3FPW A;  4EWF A;  1CQA A;  1PWD A;  4L9G A;  1QME A;  4F3L A;  3G34 A;  2O9A A;  4R4R A;  4E3M A;  5L2F A;  4DE2 A;  2INW A;  3IBR A;  1OT6 A;  3IXH A;  2NUP C;  1VEU B;  1LL8 A;  4WMC D;  3T4L A;  5M18 A;  3W2Z A;  4GHI A;  3FG8 A;  4HI4 A;  2VX8 A;  3T12 B;  5A92 A;  5J8X A;  3A3F A;  1ZTU A;  4XUZ A;  2ZQD A;  3HLG A;  3O86 A;  3HUN A;  1GHP A;  4JXV A;  1NYM A;  1S4R A;  2HGV A;  2RL3 A;  4OPY A;  2HDS A;  3TRC A;  2D01 A;  5EUA A;  1O07 A;  5DVA A;  5EVI B;  2PBY A;  4NKP A;  3IS2 B;  4XT2 B;  2V20 A;  3SH7 A;  5AVE A;  1Q2P A;  4HH3 A;  4Y0T A;  4X1M A;  1OTA A;  5CEC A;  2W1T B;  2G7U A;  3MQO A;  4R3B A;  3V3R A;  5JYP A;  4WEJ A;  1ERM A;  3W8K A;  3RTY A;  2HP9 A;  3VOY A;  3EEA A;  4NET A;  1HD8 A;  1XX2 A;  1MXO A;  4ZDX A;  4GCZ A;  3ZG9 B;  5HX9 A;  1SDE A;  4KZ6 A;  3E4P A;  4ARZ B;  3IQA A;  4MMN A;  4CLC A;  4DMZ A;  3KSF A;  3H82 B;  3GDI A;  3K2N A;  3ZNY A;  3OC2 A;  5DF7 A;  2I9V A;  2IWB A;  2VK3 A;  3RXW A;  2OWH A;  2WKQ A;  3S1Y A;  1V9Z A;  5TGF A;  5DKK A;  3BM6 A;  1TDL A;  4IUH A;  1VET B;  4E3K A;  1K57 C;  4ESP A;  2VV7 A;  4FD8 A;  4N1H A;  1BLS A;  1N4O A;  3EGD C;  5IU1 A;  4HJ4 A;  5DTS A;  3NOP C;  1AWI A;  2VV6 A;  2GDN A;  4Q0I A;  1IOU A;  2VV8 A;  3VSL A;  1MWU A;  5DFX A;  1I2S A;  3JVV A;  4II7 A;  1YLT A;  3CPT A;  1STZ A;  1S4S A;  1P9W A;  4KZB A;  3I7J A;  3V39 A;  1PW8 A;  3BLM A;  4X1L A;  3T4Q A;  4Q0J A;  5HDD A;  1K25 A;  1TVF A;  4RQ9 A;  1YSQ A;  4C6Y A;  2Y2L A;  4OQI A;  1HZO A;  3CAX A;  3CLO A;  2D02 A;  3AGF A;  1I5Q A;  3DAV A;  5EFW A;  5A8B A;  3E2K A;  4NK3 A;  3A3D A;  1FCM A;  3LYX A;  3LI8 A;  3QP8 A;  3ZVW A;  2CMN A;  4ZAM A;  2EX2 A;  3NI9 A;  2M7V A;  1H5X A;  3H7W B;  1GSW A;  4MN5 A;  3UE6 A;  2FFY A;  3E2L A;  3T50 A;  3A3I A;  3MJQ A;  2ZOI A;  5EOO A;  1RCJ A;  5BOH A;  5JYO A;  5FEF A;  1T1C A;  3G32 A;  3LIC A;  1G5U A;  3NC8 A;  4OQH A;  3QP2 A;  4O0P A;  4S2K A;  5DTT A;  5TBM B;  2HZ5 A;  4KZ8 A;  2DCF A;  3E98 A;  2QJ5 A;  1OTB A;  2JCH A;  2GNX A;  4FH4 A;  3QP4 A;  4UA7 A;  3NHQ A;  5E43 A;  3A0S A;  4HH2 A;  4L9F A;  1XJ4 A;  2Q0O A;  4O8G A;  1O7E A;  4CLC E;  2ZM0 A;  4EEP A;  5A90 A;  1LHY A;  3OOV A;  5F1G A;  4BJP A;  3MFD A;  4DRT A;  1HVB A;  4OLD A;  5HAQ A;  2GJ3 A;  5GLD A;  1Z6F A;  2FFF B;  1ES2 A;  2I72 A;  1KGF A;  1PI4 A;  5EVE A;  4BD1 A;  1NWZ A;  1T18 A;  4WBG A;  3EGX C;  5F68 A;  1YMS A;  1SKF A;  3CG5 A;  5AQA A;  1CF0 A;  1LSV A;  1VB6 A;  4P87 A;  3EQV A;  4GDN A;  2PYP A;  3MR0 A;  3PYP A;  3SS5 A;  1FIK A;  2R9W A;  4DF6 A;  1XFN A;  1ERO A;  4WZ5 A;  4LCM A;  2MJ6 A;  5LBR A;  4R0Q A;  4JXS A;  2WGW B;  4ZJ1 A;  4JF5 A;  5HL1 A;  3M2K A;  4KUK A;  5L8M A;  2XFS A;  3G35 A;  2JKF A;  5EM1 A;  2BAS A;  3F1N A;  2V0W A;  4S2N C;  5CRF A;  4M3K A;  3HVF A;  3ULF A;  2V8F A;  4EXO A;  4FUW A;  1EWZ A;  5FEG A;  4RX3 A;  3BY9 A;  5FI6 A;  1IFQ A;  2A3U A;  2WKP A;  3N4I A;  3UY6 A;  4MBF A;  2AVX A;  4KUO A;  5A91 A;  3UPP A;  3HCY A;  1K4E A;  1S6R A;  3FC7 A;  2V0U A;  3HJK A;  3MXR A;  3LEQ A;  2QKP A;  4EW7 A;  4DN0 A;  5KIZ A;  5EM0 A;  1WYC A;  1JNU A;  3BFF A;  3SW1 A;  3T4T A;  1FSY A;  1NZO A;  3OLO A;  3SZT A;  4RYE A;  1F98 A;  5HPF A;  1KDW A;  2EA9 A;  3MXS A;  4PM7 A;  3S22 A;  2VGJ A;  2IA2 A;  2ACG A;  5IT5 A;  3E4Q A;  5HW3 A;  2Y2K A;  2E8I A;  4I5S A;  4JGO A;  1YAX A;  5FDS A;  3O5Y A;  4L9E A;  1N9B A;  5FDH A;  4CJN A;  5KSH A;  1IYQ A;  4GD8 A;  4I3A A;  1NRJ A;  1YLP A;  5CX7 A;  2O99 A;  3MZE A;  2R9X A;  3FV7 A;  3T1X A;  3ZYT A;  3D72 A;  4P6Z S;  4QY6 A;  1SKO B;  4GW9 A;  2XDM A;  3CUE A;  4PMA A;  1E4D A;  4UAA A;  4KG2 A;  4H6J A;  3NJA A;  4KZ4 A;  1SZV A;  3A3E A;  4I38 A;  4EQI A;  1RGY A;  3LR4 A;  4UA9 A;  1L0G A;  3IH8 A;  4Y0U A;  1T19 A;  3F1P A;  1HTZ A;  3Q7V A;  5K5B A;  1BSG A;  4G3K A;  2Y2P A;  5IS1 A;  3A3J A;  3G31 A;  3QP5 A;  3T4K A;  2KDK A;  1IYO A;  2K31 A;  1A0K A;  4JKT A;  3KYZ A;  2H0T A;  4ZJ3 A;  4OLG A;  3FZC A;  4HP4 A;  5HWW A;  5GLC A;  4E3N A;  1DY6 A;  3U2A A;  4C75 A;  4RVA A;  4MBK A;  3MMH A;  2J9O A;  1SHV A;  3DWK A;  4GDB A;  1TS0 A;  1D06 A;  4HJ3 A;  2HPB A;  1W63 Q;  2QWS A;  3IF6 B;  3MSH A;  1N9N A;  3BQ8 A;  2O0Y A;  1Y28 A;  2EX9 A;  4PKY A;  4MDZ A;  2XRO A;  3N6I A;  2XK1 A;  4I3I A;  2WGV A;  3HLC A;  1H8M A;  1W63 M;  2DMW A;  2Y2O A;  3JYI A;  5G4Y A;  1BLH A;  2EX6 A;  5DKL A;  3Q82 A;  4KG6 A;  4O01 A;  4BL3 A;  5CED A;  4GS9 B;  4IUK A;  3D3O A;  3NEC A;  2Y55 A;  4YWZ A;  1H8Z A;  5TFQ A;  3NDE A;  5FAQ A;  4JGP A;  4UQI S;  3FKV A;  3F1O B;  3OPH A;  4LFU A;  2ZM8 A;  1ZG6 A;  3LIB A;  1OTD A;  5HDS A;  3UMD A;  4GLQ A;  1CEF A;  3NBL A;  1VEU A;  5L09 A;  2ZL1 B;  5AQ7 A;  3JPU A;  3IWQ A;  2KX6 A;  3OPP A;  4KEN B;  3HRE A;  4JXW A;  5DFY A;  3LY3 A;  2FH5 A;  4B93 A;  1BYW A;  3T4S A;  2QHK A;  1DP6 A;  2XD1 A;  4PAU A;  3BFD A;  4WZ4 A;  1BTL A;  3TE8 A;  1IYS A;  3O87 A;  4S2P A;  3IBJ A;  1U60 A;  2OV5 A;  3V5M A;  1FSW A;  1KVL A;  5EVI A;  2VGL S; 
#chains in the Genus database with same CATH homology
 1W8Y A;  2Z2M B;  4HEF A;  2GDN A;  1XPB A;  2H10 A;  3GRJ A;  1FQG A;  2QPN A;  1PYY A;  3VSL A;  1MWU A;  2C6W B;  1I2S A;  2ZMA A;  3UE1 A;  5E2F A;  1YLT A;  2EFU A;  4KZ9 A;  4N9L A;  4B4Z A;  1OME A;  4OPQ A;  2QMI A;  3SH9 A;  1ZG4 A;  3UE0 A;  4KZB A;  1KDS A;  1CK3 A;  2G2W A;  2H0Y A;  2UWX A;  2WK0 A;  3I7J A;  5CTN A;  4YFM A;  5I94 A;  3V39 A;  3UN7 A;  4S2O A;  1PW8 A;  1LI0 A;  3BLM A;  3UO9 A;  4UHU A;  1YLW A;  5EVL A;  3BFG A;  2JBF A;  4GZB A;  2XGN A;  4L0L A;  1K54 C;  1K54 A;  4R23 A;  1EI5 A;  1K25 A;  3PBT A;  1TVF A;  5G18 A;  5FAO A;  2B5R A;  3VFF A;  3ZGA B;  4C6Y A;  1K55 C;  1K55 A;  4N92 A;  4S2I A;  1K4F A;  2P9V A;  2Y2L A;  4HES A;  4OQI A;  1HZO A;  5FQK A;  4DKI A;  1NZU A;  4GOG A;  3PAE A;  3AGF A;  1TDG A;  1I5Q A;  2C5W B;  5KSC A;  3BFC A;  1JTD A;  3ITB A;  4O7D A;  1MWR A;  1XGI A;  3E2K A;  4NK3 A;  1KE3 A;  1LL9 A;  2BG1 A;  2ZM2 A;  5E2E A;  3WS1 A;  4KZA A;  1NXY A;  3QHY A;  3A3D A;  1FCM A;  3GV9 A;  4JF6 A;  3RJU A;  3ZVW A;  1VM1 A;  4ZAM A;  2EX2 A;  3NI9 A;  5M1A A;  1Y54 A;  4GD6 A;  4IED A;  1XA1 A;  4OOL A;  1H5X A;  5CGW A;  1CI8 A;  3PBN A;  2ZJ9 A;  5F83 A;  2WZX A;  2FFY A;  2QZ6 A;  2EXB A;  3E2L A;  3PBS A;  1L0D A;  4BLM A;  3C5A A;  3A3I A;  2V2F F;  1PWC A;  3LEZ A;  1YLZ A;  3Q81 A;  2RCX A;  5EOO A;  1RCJ A;  4H8R A;  2WKH A;  5BOH A;  4YIN A;  2XF3 A;  3BRM A;  3IXB A;  3V3S A;  5CXW A;  4DDS A;  5JYO A;  3TG9 A;  3UDX A;  2HDQ A;  1G68 A;  3Q7V B;  4QB8 A;  4RA7 A;  1KE4 A;  3NCK A;  3LO7 A;  5CER A;  3G32 A;  3NC8 A;  4OQH A;  2Q9M A;  5FSR A;  3HL9 A;  4S2K A;  1CI9 A;  4GN2 A;  3Q07 A;  5DTT A;  3S4X A;  2G2U A;  1GCE A;  3ZDJ A;  4KZ8 A;  2DCF A;  3ZFZ A;  3UE3 A;  3P09 A;  2JCH A;  1IYP A;  4JBF A;  3ZHH A;  3OZH A;  4FH4 A;  2JC7 A;  1L0F A;  1JWV A;  4JPM A;  4UA7 A;  5E43 A;  4RX2 A;  5FAP A;  4BD0 A;  4F94 A;  2WAF A;  3HLW A;  4OON A;  3IXD A;  1O7E A;  3M6H A;  2XR0 A;  1NYY A;  2ZM0 A;  4P0M A;  5A90 A;  1LHY A;  5F1G A;  4BJP A;  3WRZ A;  3MFD A;  1LL5 A;  3IF6 C;  3IF6 A;  4FH2 A;  4OOM A;  1XKZ A;  2ZC6 B;  2CC1 A;  1HVB A;  3CJM A;  3GVB A;  4OLD A;  5AQ9 A;  1FCO A;  1K6R A;  4S2M A;  5HAQ A;  2WAD A;  3ZNT A;  2HDU A;  5FAT A;  2EXA A;  2WAE A;  1PZO A;  4X55 A;  4X56 A;  4OKP A;  5GLD A;  1Z6F A;  2FFF B;  1ES2 A;  4IVI A;  1WE4 A;  3PBR A;  3WS2 A;  1MWS A;  2I72 A;  1KGF A;  1LI9 A;  2Q9N A;  3N8S A;  1PI4 A;  4LV0 A;  2IWC A;  3N8R A;  1GHM A;  4LV2 A;  3ZVT A;  3CZD A;  4KZ5 A;  2ZC7 A;  1MY8 A;  4BQM A;  5E2H A;  1FOF A;  3MBZ A;  4BD1 A;  1ALQ A;  1XP4 A;  5HAR A;  3GR2 A;  5A93 A;  3DW0 A;  1ERQ A;  4JF4 A;  2XFT A;  4WBG A;  3C4O A;  1YMS A;  1SKF A;  3CG5 A;  4FCF A;  4IVK A;  4DE0 A;  3MKE A;  1ZC2 A;  4OP8 A;  5AQA A;  4A5R A;  3EQU A;  4LCL A;  3AGE A;  1E3U D;  3IT9 A;  4JXG A;  4DXC A;  4P87 A;  3EQV A;  4GDN A;  4LEN A;  1VQQ A;  3UNW A;  4HBT A;  3Q7Z A;  3SS5 A;  5HAP A;  1K56 D;  3MZD A;  2DRW A;  2R9W A;  3D4F A;  4DF6 A;  2WGI A;  5CEB A;  2PU4 A;  3ZG8 B;  5KMW A;  3NY4 A;  5HAI A;  3FYZ A;  1ERO A;  3OCL A;  4WZ5 A;  4WZ5 C;  4Z9Q A;  2X01 A;  4LCM A;  1J9M A;  5EOE A;  4R0Q A;  2Y2I A;  2ZQ7 A;  3HUM A;  2JE5 A;  4JXS A;  4DDY A;  2WGW B;  5FAS A;  1C3B A;  3DWZ A;  4ZJ1 A;  4JF5 A;  4B4X A;  5EPH A;  5HL1 A;  3M2K A;  5FQM A;  4GNU A;  2XFS A;  4XXR A;  3G35 A;  1PW1 A;  4X6T A;  2BLS A;  2EX8 A;  4GKU A;  4R4S A;  4S2N C;  4S2N A;  5CRF A;  5FI2 A;  4M3K A;  1MBL A;  3HVF A;  4MLL A;  4PPR A;  4E3J A;  5FQI A;  5EEC A;  3SS3 A;  3IH9 A;  4IBX A;  2XD5 A;  1EWZ A;  1JWZ A;  1ES4 A;  4RX3 A;  2OSU A;  3W4P A;  4MBH A;  4R1G A;  5FI6 A;  2Y2M A;  3Q1F A;  2Y91 A;  4HBU A;  5IHV A;  3TSG A;  2V1Z A;  2A3U A;  3W4O A;  2XLN A;  2Z2L B;  1GA9 A;  4PM5 A;  4E3O A;  1YMX A;  3N4I A;  4BEN A;  3UY6 A;  3W4Q A;  4ZJ2 A;  2ZQA A;  4MBF A;  3UPP A;  5A91 A;  2WYX A;  2ZC4 B;  1PIO A;  1K6S A;  3GMW A;  1K4E A;  1S6R A;  2WUQ A;  3G30 A;  2WKE A;  5CGX A;  2J7V A;  3ZG0 A;  3MXR A;  2ZC3 B;  4DXB A;  3VP0 A;  5M19 A;  3PTE A;  3QNB A;  1JWP A;  1DJA A;  2Y59 A;  3N7W A;  5TR7 A;  5GHX A;  4EV4 A;  4LV3 A;  1IEM A;  2XEP A;  4OQ0 A;  1WYC A;  1CEG A;  1NRF A;  2PU2 A;  4MEZ A;  3OPL A;  3WS4 A;  3QNC A;  4DE3 A;  3BFF A;  4OPZ A;  5DF8 A;  3SH8 A;  1NZO A;  1FSY A;  1BZA A;  3GTC A;  4ZBE A;  3PAG A;  4GB7 A;  3WS5 A;  1AXB A;  1ES3 A;  1BT5 A;  1XGJ A;  4OH0 A;  1L2S A;  4WEK A;  4RYE A;  2WGW A;  1E3U A;  5CGS A;  4OOY A;  3ITA A;  2Y2J A;  5FQ9 A;  1KDW A;  1MWT A;  4BL2 A;  3VOZ A;  3ZCZ A;  3MXS A;  4KQR A;  3VP3 A;  4EUZ A;  1FR6 A;  3G2Y A;  4PM7 A;  3WWX A;  1K56 A;  3S22 A;  4EBL A;  2VGJ A;  4QD4 A;  1XXM A;  4U0T A;  3DTM A;  5HW3 A;  1YQS A;  2Y2K A;  2Y2Q A;  3IF5 A;  2E8I A;  4S2J A;  2J9P A;  1N9B A;  1I2W A;  5FDH A;  4CJN A;  5KSH A;  3IWO A;  1IYQ A;  3VP4 A;  3G4P A;  1IKG A;  4GD8 A;  3OCN A;  5KZH A;  4DE1 A;  1YLP A;  3WS0 A;  2XQZ A;  2IWD A;  3MZE A;  2WKI A;  1W7F A;  2R9X A;  1PI5 A;  2Y4A A;  3FV7 A;  4S2L A;  2P9V B;  1SDN A;  3IHA A;  3IWI A;  4WM9 A;  2X71 A;  4QY6 A;  1ZKJ A;  2ZQC A;  3N8L A;  1KVM A;  2XDM A;  1FCN A;  4QHC A;  1BUL A;  2H5S A;  1PWG A;  2Y2G A;  1W8Q A;  2ZQ8 A;  3HLE A;  1E4D A;  4KG2 A;  4PMA A;  4UAA A;  1JVJ A;  4E6X A;  1KGG A;  3BEC A;  4KQO A;  4D2O A;  4KZ4 A;  3A3E A;  4EQI A;  3AGD A;  1RGY A;  4UA9 A;  2OLV A;  4OP5 A;  1GHI A;  3BLS A;  4K0X A;  4Y0O A;  1WYB A;  5CHM A;  5GLA A;  1L0G A;  2ZLY A;  3IH8 A;  1E25 A;  3HLB A;  4Y0U A;  4C3Q A;  4JLF A;  1NY0 A;  4QJG A;  3BEB A;  1HTZ A;  3Q7V A;  1LLB A;  3NDG A;  3OPR A;  1BSG A;  3M2J A;  3O3V A;  3FWL A;  2Y2P A;  3A3J A;  1FR1 A;  3UDI A;  3G31 A;  2WZZ A;  3C4P A;  5CTM A;  2HP6 A;  4X69 A;  3O88 A;  1IKI A;  4B88 A;  3ISG A;  3M6B A;  1IYO A;  5FQQ A;  1RGZ A;  1W5D A;  3NIA A;  3UPN A;  2A49 A;  2EFX A;  5E2G A;  4OVD A;  3C7U A;  4JKT A;  4IBR A;  5D3O A;  4Q8I A;  2H0T A;  4WEL A;  1RP5 A;  1G6A A;  4KZ3 A;  4ZJ3 A;  4KG5 A;  2Y2N A;  4OLG A;  3FZC A;  2J8Y A;  2X02 A;  5GLC A;  4E3N A;  1KGE A;  2DNS A;  1DY6 A;  1PZP A;  4U3T A;  4EWF A;  1ONG A;  1PWD A;  4C75 A;  4RVA A;  1QME A;  4MBK A;  3PBQ A;  1MPL A;  2J9O A;  3G34 A;  1SHV A;  3P98 A;  3DWK A;  4GDB A;  3RXX A;  1YT4 A;  4K0W A;  4P85 A;  4R4R A;  4E3M A;  3FKW A;  5L2F A;  4DE2 A;  2HPB A;  4X53 A;  3IF6 B;  4OPR A;  3TOI A;  3IXH A;  4ID4 A;  5GL9 A;  4WYY A;  3MKF A;  3HBR A;  4WMC D;  5GHY A;  3VP2 A;  1BUE A;  1MKI A;  2EX9 A;  2OLU A;  1ES5 A;  4DRT A;  1H8Y A;  3BFE A;  3GQZ A;  4PM8 A;  3N6I A;  5M18 A;  1KE0 A;  1JTG A;  4N1X A;  5EVI D;  3MZF A;  4XUX A;  2XK1 A;  2HDR A;  3GSG A;  1S0W A;  5EE8 A;  5A92 A;  2WGV A;  5J8X A;  3A3F A;  5AQB A;  3HLC A;  4XUZ A;  3ZG7 B;  2ZQD A;  3HLG A;  3O86 A;  2Y2O A;  3HUN A;  3JYI A;  4E3L A;  1GHP A;  4JXV A;  3VFH A;  1BLH A;  2EX6 A;  1NYM A;  1IEL A;  4KQQ A;  3Q82 A;  2RL3 A;  2ZQ9 A;  4OPY A;  1ESI A;  4EBN A;  2HDS A;  2VGK A;  4KG6 A;  3G2Z A;  3VP1 A;  3HUO A;  5EUA A;  1O07 A;  3V50 A;  5DVA A;  4P6B A;  4BL3 A;  5CED A;  5CHJ A;  5CHU A;  5EVI B;  3SS4 A;  2PBY A;  4PM9 A;  3VSK A;  4OQG A;  2V20 A;  2Y55 A;  3SH7 A;  1XA7 A;  1H8Z A;  1Q2P A;  5TFQ A;  3NDE A;  5FAQ A;  4N9K A;  4E3I A;  4Y0T A;  1QMF A;  3PBO A;  1L0E A;  5CEC A;  3FKV A;  4PM6 A;  4UA6 A;  1BLP A;  3V3R A;  4R3B A;  1YM1 A;  3OPH A;  5JYP A;  1DJB A;  1GA0 A;  4WEJ A;  1ERM A;  2ZM8 A;  4QY5 A;  4E6W A;  3W8K A;  1W79 A;  1YLY A;  4QU3 A;  2HP9 A;  3VOY A;  1ONH A;  5DTK A;  5U47 A;  3VMA A;  1ZG6 A;  5GLB A;  4NET A;  1HD8 A;  1TEM A;  1Q2Q A;  4X68 A;  1XX2 A;  1MXO A;  4ZDX A;  3BYD A;  4Y7P A;  1K38 A;  5DF9 A;  3ZG9 B;  5HX9 A;  3LCE A;  1SDE A;  1YLJ A;  1CEF A;  2HP5 A;  2Y2H A;  3NBL A;  3LY4 A;  5F82 A;  4KZ6 A;  3HLD A;  1ESU A;  3IQA A;  5AQ7 A;  3HLF A;  4U0X A;  1M40 A;  3IWQ A;  1BLC A;  2P74 A;  3ZNY A;  3OPP A;  4LV1 A;  5FA7 A;  4KEN B;  4K91 A;  4FSF A;  5F1F A;  3UDF A;  1M6K A;  3OC2 A;  3IXG A;  3B3X A;  5DF7 A;  3ZG5 A;  2IWB A;  3HRE A;  4EBP A;  3C7V A;  4JXW A;  4R3J A;  3LY3 A;  3SOI A;  4KZ7 A;  3CMZ A;  5HFO A;  3RXW A;  2XH9 A;  1NJ4 A;  3S1Y A;  5TGF A;  3UPO A;  4MNR A;  3BM6 A;  1TDL A;  2XD1 A;  5FI7 A;  3BFD A;  1DJC A;  4WZ4 A;  1BTL A;  4E3K A;  4WMC A;  4ZTK A;  1K57 C;  1K57 A;  3WRT A;  2ZC5 B;  5FQJ A;  5GHZ A;  1IYS A;  3IHB A;  4FD8 A;  3O87 A;  4N1H A;  4S2P A;  1BLS A;  1N4O A;  1U60 A;  2OV5 A;  4CPK A;  1SCW A;  5DTS A;  3V5M A;  1FSW A;  1KVL A;  5EVI C;  5EVI A;  2ZD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...