1L0GA

X-ray crystal structure of ampc s64g mutant beta-lactamase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
355
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGGVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase
publication title Structural bases of stability-function tradeoffs in enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 113
structure length 355
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1l0gA00
4WBGA 4E3NA 3BFDA 3BFGA 3Q7ZA 1KDWA 3ISGA 1ES3A 1RGZA 2JE5A 2XK1A 5FI7A 5M18A 3S22A 3BLMA 2WAFA 2R9WA 4MBKA 1ZG6A 1CK3A 4EBNA 3UPNA 3NC8A 5E2FA 1ZG4A 3PBNA 2ZLYA 4DDYA 3G30A 5EVIC 4S2LA 4R0QA 1YLWA 3I7JA 4JF6A 4KG2A 2WZZA 1YT4A 3EQVA 3ZDJA 1Q2QA 3G31A 4BENA 3PBTA 3WRZA 2X71A 3MFDA 1XGIA 1G6AA 1HVBA 1PWCA 4MNRA 1BZAA 3M2KA 4OOMA 3UDIA 1IEMA 1KGEA 2PU4A 4GD6A 4PM9A 1WE4A 4QB8A 5J8XA 3AGEA 4XXRA 1YM1A 4GOGA 2ZC5B 4UAAA 3IXDA 5DVAA 5TFQA 3S4XA 4X56A 1BLSA 3WS0A 4FH2A 1TEMA 1IYSA 3RXWA 3MKFA 4KZ6A 4UA9A 1N9BA 2ZC6B 3HLDA 3B3XA 1IYOA 1K57C 5DF8A 5F1FA 3M2JA 3FKVA 3UDXA 2Y2QA 4OKPA 3OPPA 3Q07A 1N4OA 3IT9A 3MZEA 4KZ8A 1L2SA 3VP1A 4WZ5A 2FFFB 2PU2A 4N9LA 2XR0A 4KQOA 1AXBA 3W4OA 3IWIA 5KSHA 4R23A 1H5XA 4X55A 5U47A 3MXRA 5HAPA 1YMSA 4R3JA 4Y0UA 4PM6A 1H8YA 2ZC3B 4CJNA 1K25A 1BTLA 1XA1A 1K55C 4OPYA 2Y2IA 4Z9QA 1H8ZA 2JCHA 4R4RA 4OLDA 1M6KA 4K0XA 1GHPA 2R9XA 2HDRA 2ZQDA 4C75A 4KZAA 1K4EA 1K56D 3GR2A 2H0YA 1O07A 2WKEA 3N6IA 1IYPA 4JF4A 1YQSA 4MBFA 5EVIA 3LO7A 1K54C 1XP4A 4WEKA 2Y2JA 2DCFA 3CG5A 4HEFA 1NZUA 3VP2A 2I72A 3UDFA 1MXOA 3G34A 3M6BA 2Z2MB 3IF6B 1MWUA 1Q2PA 2JBFA 1LI9A 5EOOA 2Q9MA 1ES5A 3WS2A 1ZKJA 4DE1A 4JKTA 5DTKA 1XGJA 5DF9A 5A93A 1YLYA 3OCLA 4S2PA 1MBLA 5DF7A 2J7VA 2BG1A 5IHVA 1BULA 4IBRA 5CGSA 4P0MA 5G18A 1XX2A 2XD5A 3Q1FA 4N9KA 5AQAA 4LCMA 3HLWA 5KZHA 4OVDA 3IXGA 1YLTA 3PAEA 2EX9A 2Y2OA 4GN2A 3GVBA 4OQIA 3P98A 2WZXA 2HP9A 3FKWA 4EQIA 1LL9A 1K57A 4K0WA 2GDNA 2XD1A 4CPKA 1MWTA 1NXYA 3N8RA 1SDNA 5GLAA 5FASA 3O88A 1EWZA 1PW1A 3AGDA 3Q7VA 4UA6A 4KZ4A 5FQKA 2WGWB 4X68A 1PW8A 1PZOA 2OLUA 2EFXA 4OOYA 1TDLA 5TR7A 1KE0A 2V2FF 1KE4A 3HLGA 5DTTA 3GRJA 1LL5A 3VSLA 3UO9A 4OQHA 2Y55A 4WZ4A 3CJMA 3C4PA 1LI0A 4QY6A 5EE8A 5DTSA 1K55A 4WM9A 1SDEA 1CI8A 2C5WB 1DJAA 4LV3A 4S2JA 5EECA 4E6WA 1MWRA 3LY3A 3TOIA 1HD8A 3WRTA 4E3JA 3C4OA 4QJGA 1GA9A 3N8SA 4S2NC 1ESIA 2Y91A 1GCEA 5FQMA 5KSCA 4P87A 4XUZA 1MPLA 2JC7A 4DXCA 2HP5A 3MZDA 3WWXA 2Q9NA 3LCEA 3SH8A 2WKHA 1K54A 2Y2HA 1XKZA 3ZFZA 3A3FA 3BECA 2XF3A 4RX2A 2QMIA 4C3QA 3M6HA 4DF6A 1NY0A 5HAQA 5GLBA 1BLPA 2A3UA 4NK3A 2RCXA 5F1GA 3UY6A 1L0EA 1KVLA 1PWGA 4OPQA 3IWOA 4XUXA 4BD0A 1MWSA 4DE2A 5CTMA 1DY6A 2RL3A 1HZOA 3OPRA 3BFEA 4JXWA 3FWLA 3GV9A 4X53A 4KZ7A 4S2KA 5E2EA 2EXAA 3PBSA 3V39A 4DE0A 4PMAA 4BJPA 3LEZA 5GL9A 4RYEA 4JF5A 2ZQAA 2Y2GA 5CECA 2P9VB 5I94A 3ZHHA 3A3EA 3HREA 3ITAA 3IXBA 5FAQA 1IKGA 1BT5A 3A3DA 4UA7A 4QHCA 4HBUA 5CRFA 1KGFA 3G4PA 5M19A 1HTZA 1YLZA 3UPOA 3PBRA 4OOLA 5CERA 5FQIA 4WMCD 4GNUA 2WADA 5EUAA 3S1YA 1ALQA 4Y0OA 4KZBA 4PM5A 1PWDA 1BLCA 3OPLA 3C7UA 3RJUA 3SS5A 5HFOA 4R1GA 3O87A 4YINA 3HLCA 1NRFA 4M3KA 5AQBA 1QMFA 4DRTA 5A90A 4BL2A 3HL9A 1YMXA 3C5AA 1K4FA 5CEBA 5JYPA 4FH4A 4ZJ1A 1WYBA 1ES2A 2XEPA 1XA7A 5GHZA 4S2NA 3W8KA 4X6TA 2WKIA 5E2HA 1JVJA 2HDQA 1FOFA 2XFTA 4S2MA 5AQ9A 1IELA 3IQAA 3MXSA 1E3UA 3G2YA 3N7WA 2ZMAA 3IHBA 3UPPA 1PI5A 2IWDA 3C7VA 4B88A 4BD1A 4BLMA 4OP5A 5CHJA 4E3MA 1NYYA 2EX6A 2Y2LA 3UN7A 1YLJA 3D4FA 1TDGA 4KZ3A 4PM8A 2WGIA 1DJBA 1ZC2A 1KVMA 2DRWA 4QU3A 5HAIA 3ZNTA 3NCKA 4QY5A 1W5DA 1CEGA 4E3IA 1JTGA 1FSYA 2PBYA 2ZJ9A 4L0LA 4U3TA 4DE3A 5JYOA 1ERMA 4OP8A 3IF6C 5M1AA 4GB7A 5GHXA 3E2KA 3WS5A 1NJ4A 5A91A 2UWXA 4BL3A 5E43A 3UE1A 4K91A 4OONA 3HLFA 5CEDA 1TVFA 4ID4A 1LHYA 3QNCA 1M40A 2J9OA 4GDNA 1ESUA 2XLNA 3NY4A 3Q81A 5HW3A 2WUQA 4HBTA 5CHUA 4B4ZA 3GMWA 3N4IA 3G2ZA 4DXBA 5F83A 5EVLA 2XGNA 3UE3A 3NIAA 5F82A 2J8YA 3VP4A 5FQJA 3PTEA 4RVAA 3OZHA 4S2IA 3CMZA 5FQQA 2ZC4B 4QD4A 4BQMA 1MKIA 1O7EA 1FQGA 4IEDA 4E3LA 2CC1A 2EX2A 4JXVA 2Y2NA 3ZCZA 5EPHA 2A49A 5A92A 2J9PA 3OCNA 2G2WA 2P74A 1JWZA 1SCWA 1XPBA 3VOYA 2BLSA 4S2OA 4EBPA 1S6RA 4F94A 4RX3A 1GHMA 2Y2KA 2HDSA 3HLBA 4OPZA 5FI6A 1ONGA 4Y0TA 2OLVA 2B5RA 1ONHA 3A3JA 4GKUA 4WZ5C 3VOZA 1JWPA 3OC2A 3IXHA 2ZQ8A 1FCOA 2XFSA 3SH7A 3RXXA 2OV5A 1ERQA 3ITBA 3HUOA 4IBXA 4IVKA 5CHMA 4ZDXA 3NDGA 3VP3A 3NDEA 3HUNA 1RCJA 2E8IA 1RP5A 4PPRA 3CZDA 4Y7PA 5KMWA 1LLBA 3BYDA 5EVID 1E4DA 3DW0A 4LCLA 4P85A 4JBFA 5EVIB 3P09A 2IWBA 4H8RA 4KQRA 1L0GA 4DKIA 3W4PA 1OMEA 2Z2LB 5FQ9A 3V5MA 2QPNA 4N1XA 3E2LA 5FAPA 4JXSA 1FSWA 2ZM8A 4ZJ3A 3BM6A 3HLEA 3IF6A 4WELA 2EX8A 1FR6A 1CI9A 3SS4A 3N8LA 3VMAA 4B4XA 4C6YA 4R4SA 4KQQA 3NBLA 4EBLA 1PYYA 2ZC7A 1G68A 5FDHA 1JWVA 4DDSA 4IVIA 1K38A 3VP0A 3G35A 3ZNYA 3PBQA 4U0TA 2X02A 3ZVWA 1WYCA 3GSGA 4WYYA 4EV4A 1Z6FA 1PIOA 1I2WA 3DWKA 3SH9A 4ZAMA 1W8QA 2VGKA 1KDSA 4X69A 1JTDA 4JXGA 5FI2A 2ZQ9A 4GDBA 2HP6A 4OPRA 2Y59A 2ZQCA 3BEBA 3IWQA 3PBOA 3MZFA 1IKIA 3Q82A 3QNBA 3WS1A 3G32A 4ZBEA 2H10A 4E6XA 1I5QA 3BLSA 3Q7VB 5GHYA 4NETA 1GA0A 2EFUA 3BFCA 1VQQA 3GQZA 2WK0A 5HX9A 1ES4A 2WGWA 2ZD8A 4OH0A 1QMEA 4LV0A 1SKFA 3V3RA 4FSFA 4JPMA 3SOIA 2WAEA 2X01A 5FATA 4GD8A 4YFMA 3HBRA 1IYQA 2HPBA 2XH9A 4LENA 3IF5A 4KG6A 5GLCA 5EOEA 4EWFA 3NI9A 4FD8A 4ZJ2A 3UE0A 4O7DA 1EROA 3IHAA 3O3VA 3DTMA 5TGFA 1U60A 3TSGA 2OSUA 3MBZA 1W79A 3PAGA 3UNWA 3ZG5A 1NYMA 3O86A 2Y2PA 3FZCA 5HARA 3IH8A 4A5RA 1K6RA 1PI4A 2IWCA 1BSGA 4KG5A 2V1ZA 3VFHA 1L0DA 3EQUA 3ZG8B 1KGGA 4WEJA 5CGWA 4KZ5A 1DJCA 1S0WA 3AGFA 1EI5A 1NZOA 2ZQ7A 3ZVTA 4MEZA 2XQZA 2WGVA 4U0XA 2DNSA 2H0TA 2HDUA 5FA7A 1J9MA 1W7FA 2WYXA 1I2SA 1FCNA 1XXMA 3DWZA 3FV7A 3JYIA 1KE3A 1W8YA 1MY8A 2G2UA 2VGJA 4MLLA 5E2GA 1CEFA 4RA7A 1PZPA 3A3IA 4KENB 1C3BA 3WS4A 2XDMA 4UHUA 4OQ0A 3QHYA 5BOHA 4OLGA 1BLHA 2ZM2A 2ZM0A 5FSRA 5HL1A 2P9VA 3ZG9B 4PM7A 3ZGAB 3MKEA 2Y2MA 5CGXA 5CXWA 3VFFA 4Q8IA 4E3OA 1YLPA 4FCFA 4JLFA 5L2FA 3V3SA 3GTCA 3W4QA 1E25A 5D3OA 4E3KA 4GZBA 4LV1A 5AQ7A 1RGYA 2V20A 4WMCA 3V50A 4D2OA 1FR1A 3BFFA 4HESA 1VM1A 3TG9A 5FAOA 3SS3A 3ZG7B 1L0FA 3BRMA 3ZG0A 2Y4AA 4MBHA 4OQGA 4R3BA 2QZ6A 1FCMA 5CTNA 2EXBA 1GHIA 4N1HA 3FYZA 3HUMA 5GLDA 2C6WB 3LY4A 4ZTKA 3VSKA 1SHVA 4P6BA 2FFYA 3OPHA 4LV2A 1Y54A 1K6SA 4EUZA 4KZ9A 2H5SA 1E3UD 4N92A 1K56A 1BUEA 3HVFA 3IH9A
chains in the Genus database with same CATH superfamily
3Q7ZA 4NXGA 1RGZA 2JE5A 1NLZA 1F98A 1TS8A 3MSHA 3S22A 3BLMA 1EW0A 4EETB 4EERA 1H0MA 2GZAA 4MBKA 4EBNA 4GS9A 4EESA 3CWFA 2ZLYA 4S2LA 4XT2B 4LLOB 3EQVA 3ZDJA 1Q2QA 3NHQA 3G31A 2XSSA 3M2KA 4HJ6A 3UDIA 2PU4A 4Y15A 5TFQA 1YM1A 2ZC5B 4X56A 1S66L 2B18A 2PRFA 3F1NB 3B3XA 1K57C 3LGOA 3CPTA 2Y2QA 3OPPA 4R70A 1YKDA 2PU2A 4HOIA 5DKLA 5I5LA 1H5XA 2GX5A 5TJJA 5U47A 1W63Q 4PM6A 2ZC3B 1K55C 4OPYA 4Z9QA 4R4RA 2JCHA 1G5UA 4K0XA 2ZQDA 3A0VA 3N6IA 2WKEA 2Q0OA 3LO7A 1K54C 1XP4A 4NEED 2EWVA 2DCFA 3KSFA 3UDFA 1MXOA 3IF6B 1LI9A 1ES5A 1XGJA 2VX8A 3OCLA 3JVVA 1BULA 4IBRA 1V9YA 4HI4A 2J3TC 1XX2A 3P7NA 2VLGA 2LB5A 4M4XA 3IX4A 4OQIA 4EQIA 1LL9A 2QJ7A 4CPKA 1MWTA 3G6OA 2ZBBA 1PW1A 3Q7VA 3L7HA 2ZOIA 4X68A 1PW8A 2V9AA 2EFXA 5TR7A 5DTTA 3QP1A 2Y55A 1VEUB 3CJMA 5EE8A 3LY3A 2XA7M 2R78A 4S2NC 5FQMA 4DXCA 2HP5A 2Q9NA 2WKHA 2PDRA 3ZFZA 3K3DA 5FDSA 4MN7A 1CJFA 4BD0A 4DE2A 3ULFA 4X53A 4L9FA 3V39A 5GL9A 5I94A 2P9VB 1BT5A 3A3DA 4UA7A 3E4QA 3W2ZA 4ARZA 1KGFA 5AJGA 5M19A 1HTZA 5AVEA 3PXPA 4LRXC 5FQIA 3VE3A 4PHTA 3S1YA 1ALQA 4PM5A 1BLCA 3OPLA 2JKTI 3RJUA 3BWLA 4I5SA 4R1GA 4YINA 3HLCA 3H82A 2W3HA 2PBDP 4DRTA 5A90A 3C5AA 1D7EA 4FH4A 1P9WA 3UB5P 3W8KA 1LT0A 4YNRA 1JVJA 1FOFA 3ZYTA 5AQ9A 3CHWP 3IQAA 3MXSA 3IHBA 3C7VA 2JN7A 4BD1A 2Z6CA 2V8FA 5CHJA 2EX6A 3HJIA 3D4FA 4LRYC 1UWNX 2OOLA 3JVUA 4QY5A 1CEGA 4E3IA 1FSYA 5JYOA 5M1AA 1LSVA 4K91A 3HLFA 2J9OA 4GDNA 5HW3A 2WUQA 1Y28A 4B4ZA 3GMWA 3G2ZA 5TBMA 4DXBA 3NIAA 5EV0A 3VP4A 2LB9A 2ZL1B 3PTEA 1F5MA 5FQQA 2ZC4B 4Q0HA 1TS7A 2CC1A 5DJTA 3ZCZA 2J80A 2J9PA 4NXFA 1JWZA 3VOYA 4EBPA 5DKKA 4OPZA 2VV8A 1SKOB 5FI6A 3BY9A 4WZ5C 1T1AA 4CLCB 3FPWA 3OC2A 3IXHA 2ZQ8A 1FCOA 3UMDA 3TRCA 1ERQA 3KO6A 4ZDXA 1ODVA 1LSWA 3HUNA 1Y4OA 2EWWA 3DW0A 4KQRA 4DJ3A 1LL8A 1OMEA 2XRNA 2FH5A 3V5MA 4N1XA 3E2LA 1FSWA 1T19A 4ZJ3A 1CI9A 2JKTM 4QWOA 4I3IA 5EFWA 4R38A 4C6YA 1ZHHB 2HV1A 5FDHA 4FOFA 4DDSA 1Z6FA 1I2WA 3DWKA 1KDSA 1V9ZA 2PYPA 5L07A 2ZQ9A 3Q82A 3RTYA 4E3LA 3MZFA 1IKIA 3QP4A 4ZBEA 2L4RA 1LSXA 1GA0A 4KQDA 1VQQA 2WK0A 2WGWA 3MXQA 1QMEA 3O5YA 2V8CA 2WAEA 3ZQ5A 3HBRA 1IYQA 3SZTA 4LENA 2EA9A 3U4LP 4ZJ2A 1EROA 3TSGA 3UNWA 1G28A 5HARA 5MC7A 1K6RA 2IWCA 4JGRA 4KG5A 2PAVP 4O01A 1XJ3A 1S0WA 3AGFA 5F69A 2WGVA 2H0TA 5FA7A 1J9MA 2W0NA 2VGJA 4HNBA 4MLLA 2J3TD 4RA7A 4UHUA 4OLGA 2ZM2A 5FSRA 5HZHA 5HL1A 3ZG9B 3MKEA 4E3OA 1YLPA 4JLFA 5L2FA 4L9GA 3E0YA 3V3SA 3GTCA 4DJ2A 1E25A 5D3OA 2V20A 3VV4A 4WMCA 3V50A 3SS3A 4HY8A 4MBHA 1VHMA 3CAXA 5F5YA 3MQ0A 2QZ6A 5HWWA 1STZA 5GLDA 4ZTKA 2GNXA 2FFYA 4LV2A 4MCWA 3LIBA 1BUEA 3IH9A 4WBGA 3LR3A 3UPNA 5L09A 4R0QA 3I7JA 5DJUA 2H28A 1XJ4A 1YT4A 3OOVA 4BENA 1FIKA 2B02A 1BZAA 1KGEA 2FZ0A 4GD6A 5J8XA 3AGEA 4XXRA 4UAAA 3BW6A 1IYSA 4LGWA 3RXWA 3MKFA 3CUEA 4H6JA 4KZ6A 1N9BA 3HLDA 4D60A 1X0OA 5DF8A 3IS2B 4WZ5A 2FFFB 1D06A 2XA7S 3NULA 4X55A 1UGUA 1YMSA 4G3WA 3D9YA 2VJWA 1H8YA 3PHYA 3LI9A 1H8ZA 3VOLA 2HDRA 3DTIA 3T4LA 3NOUC 3LIDA 5HWVA 1YQSA 5EVIA 3G34A 2HJEA 2Z2MB 3S7PA 5DTKA 1YLYA 2OWHA 1MBLA 4XT2A 2J7VA 2BG1A 4P0MA 3Q1FA 3HLWA 4EUVA 1YLTA 3PAEA 2Y2OA 1P9RA 4B9OA 2ACGA 1EWZA 2OWJA 4UA6A 5J3WA 4BWIA 3LEQA 4CLCE 2OLUA 1TDLA 1S4RA 3HLGA 3GRJA 3UO9A 3MFXA 4OQHA 4UEYA 3UMEA 1VETB 1MWRA 3LIAA 4BBVA 1HD8A 3C4OA 4ETXA 1MKMA 2Y91A 4P87A 3MZDA 3GDIA 3SH8A 4HJ3A 1IOUA 2Y2HA 3B47A 2VZWA 1NY0A 3F1OA 5GLBA 5HAQA 4EQ1A 3S7QA 2CMNA 3UY6A 4ESPA 3LYXA 4QPRA 1KVLA 4XUXA 3IWOA 4GW9A 1DY6A 1HZOA 2I9VA 3OPRA 4KZ7A 4S2KA 5E2EA 5CX7A 4PMAA 3LEZA 4JF5A 2ZQAA 2Y2GA 3ZHHA 2KLIA 5FAQA 4PKYA 1IKGA 4GLQA 5L10A 4OOLA 5CERA 2WADA 4ZRRA 5HL6A 3CI6A 4ZJ1A 5HDDA 2A24A 5GHZA 3L9KA 5E2HA 2XFTA 2P08A 1IELA 3T4KA 1E3UA 4B88A 4BLMA 2Y2LA 4GS9B 5HSQA 1DJBA 2DRWA 3ZNTA 3NCKA 3LIFA 1W5DA 1YAXA 2ZOHA 3DTKA 2PBYA 2ZJ9A 4DE3A 3CITA 1ERMA 5GHXA 3E2KA 3WS5A 3FC7A 4OONA 4NKPA 1ESUA 2PR6A 3Q81A 3T4JA 2P7JA 5CHUA 3C30A 2WKQA 2L0WA 3TJZC 2XGNA 3UE3A 5F82A 3NOTC 3IX8A 4S2IA 4HP4A 2QJ5A 3CMZA 4QD4A 3KSHA 1FQGA 4JGQA 3UB7A 4IHQA 4I3JA 3JPUA 5EPHA 5A92A 4YWZA 2L1MA 1S67L 2P74A 1PNEA 4NXEA 2PYRA 2Y2KA 3HLBA 3TW8A 4Y5FA 4Y0TA 1JWPA 2O0YA 2M1CA 3NOPC 2OV5A 4IBXA 3QP2A 3NDGA 3MQQA 1F2KA 4PPRA 2ZMVA 5KMWA 4UQIM 1LLBA 3BYDA 4ME4A 4LCLA 3P09A 2WKRA 1L0GA 2IWBA 5FQ9A 4X25A 3BM6A 4WELA 1FR6A 3SS4A 4R4SA 1PYYA 1IFQA 4HIAA 4IVIA 2XROA 4LPZA 1K38A 3PBQA 4WYYA 1PIOA 5IU1A 3BQ8A 2VGKA 4X69A 1JTDA 4I39A 5FI2A 4WF0A 4GDBA 2ZQCA 3IWQA 3QNBA 4EEUA 2VA0A 4E6XA 3G32A 1I5QA 3Q7VB 3GQZA 4LFUA 5HX9A 1ES4A 3V3RA 4FSFA 3SOIA 2X01A 3T4SA 2DMWA 4EEPA 2JKGA 5GLCA 3NI9A 4FD8A 4O7DA 5TGFA 3DTMA 1W79A 3O86A 4A5RA 3UB8A 3MS6A 1T18A 1L0DA 4WEJA 5HPIA 1DJCA 1EI5A 4MEZA 3DWZA 1XXMA 3FV7A 1TF1A 3JYIA 1W8YA 1XFQA 1PZPA 5BOHA 1JNUA 4DMZA 2AVXA 2Y2MA 4Q8IA 3CUEC 5AQ7A 1RGYA 3OBFA 2W3EA 4D2OA 1NLYA 3BFFA 5F68A 2Y79A 3ZG7B 2Y4AA 3ICYA 4OQGA 2EXBA 3FYZA 3C8CA 2C6WB 1SHVA 4P6BA 1Y54A 3D72A 2H5SA 3T50A 2W3GA 1K56A 4E3NA 3BFDA 3BFGA 3ISGA 2XK1A 5M18A 2WAFA 3RH8B 1GSXA 1ZG6A 1CK3A 3NC8A 5E2FA 3PBNA 4DDYA 5EVIC 1YLWA 1SZVA 4HHDA 4HH3A 4FTXA 2X71A 3MFDA 1PWCA 4MNRA 1YSQA 4OOMA 4HP9A 1IEMA 4PM9A 4QB8A 4WN5A 5DVAA 4GOGA 3IXDA 1BLSA 4FH2A 5DFXA 4I38A 2ZC6B 4HQAA 1IYOA 3KX0X 5F1FA 4OKPA 3KSGA 3Q07A 1OT6A 3NECA 2E8JA 4HH2A 2KOIA 1L2SA 2KX6A 5EVEA 1A0KA 5EM1A 5AVFA 4N9LA 4KQOA 5KSHA 3W4OA 3IWIA 4R23A 3MXRA 4R3JA 1MC0A 4CJNA 1K25A 2Y2IA 3DTEA 1TS0A 2R9XA 2VV7A 1K56D 1HLUP 1O07A 1N9NA 4WEKA 4HEFA 2I72A 4MDZA 4NG2A 3M6BA 4MN5A 1MWUA 1P97A 1ZKJA 4DE1A 4JKTA 4S2PA 3H7WA 5DF7A 5IT5A 1ACFA 5CGSA 5G18A 4LCMA 1T1CA 4Q0IA 5KZHA 3T4OA 4GN2A 3GVBA 5G4YA 3P98A 2HP9A 1L3LA 3RFBA 4K0WA 2GDNA 2XD1A 5GLAA 5FASA 3O88A 2B95A 2WGWB 1PZOA 4OOYA 3IS2A 1KE0A 2GJ3A 1LL5A 3F1PA 3C4PA 1LI0A 4QY6A 4WM9A 1SDEA 2C5WB 1DJAA 5EECA 3WRTA 4E3JA 4QJGA 3IBRA 1GCEA 2J3WA 1OTIA 3LR4A 4XUZA 5FEGA 2JC7A 1FILA 3B33A 3WWXA 3LCEA 2K31A 1XKZA 3DAVA 2XF3A 4RX2A 3M6HA 4DF6A 4DN0A 2A3UA 4NK3A 2HJ9C 3UE6A 1D1JA 1L0EA 2A2LA 4OPQA 5CTMA 3FWLA 3GV9A 2EXAA 2W3FA 3PBSA 3IX3A 4BJPA 4RYEA 3SW1A 3HREA 3IXBA 4QHCA 5LBRA 5HDCA 3UPOA 3FG8A 3OLOA 3R7WA 4WMCD 1OJGA 4GNUA 4Y0OA 4KZBA 2W1TB 5HFOA 3O87A 4GHIA 3CLOA 4GCZA 5L8MA 3A0RA 4M3KA 5AQBA 2M7UA 1YMXA 2VKSA 1K4FA 5JYPA 2XEPA 1XA7A 4UQIS 2HDQA 1PI5A 1TS6A 4OP5A 4E3MA 3UN7A 4PM8A 2WGIA 2HZ5A 4QU3A 5HD5A 1JTGA 3H9WA 5A8BA 4GB7A 1NJ4A 5HWTA 5A91A 4BL3A 4Q0JA 3UE1A 5CEDA 3QNCA 1M40A 4RQ9A 3E4OA 2XLNA 1AWIA 3NY4A 5HD3A 4HBTA 3GECA 3N4IA 5KIZA 5EVLA 2O9AA 3E4PA 4H6JB 5FQJA 4RVAA 3F1NA 3R4KA 1MKIA 1O7EA 3EEAA 2EX2A 2Y2NA 3QP5A 2A49A 2M7VA 1UWPX 4P6ZM 3OCNA 3NJAA 2G2WA 2VGLM 3E98A 1GSWA 4S2OA 1S6RA 4F94A 2HF6A 2OLVA 2JHEA 1ONHA 3VOZA 3QP8A 2XFSA 3UB6A 3RXXA 3ITBA 3HUOA 4IVKA 5CHMA 4MMNA 3VP3A 1RCJA 4CLCC 1RP5A 3CZDA 1W63M 5EVID 1E4DA 4P85A 4JBFA 5EVIB 1G6OA 4H8RA 4WL9A 4R3AA 4JXSA 3HLEA 3IF6A 2EX8A 3VMAA 1N9LA 4KQQA 3V67A 4EBLA 2ZC7A 1G68A 4WLAA 5G4ZA 2VK3A 3G35A 4EV4A 4U0TA 2X02A 4IUKA 1WYCA 2K7SA 1W8QA 1S4SA 3UB9A 4JXGA 2NUPC 4OPRA 2Y59A 3PBOA 3BEBA 3WS1A 2H10A 5GHYA 3BLSA 4NETA 2EFUA 2ZD8A 4IUHA 4OH0A 3LR0A 1OTEA 2QHKA 1OTDA 5FATA 4GD8A 4E04A 1VEUA 4F3LB 3IF5A 1GSVA 4KG6A 5EOEA 5EM0A 1U60A 1Z09A 2OSUA 3PAGA 2UV0E 1NYMA 4FUWA 2Y2PA 3FZCA 1KOUA 1PI4A 1BSGA 3VFHA 3EQUA 3ZG8B 4CQHA 1KGGA 3QP6A 5CGWA 3F1OB 2V0WA 2ZQ7A 2XQZA 4U0XA 4PAUA 1W7FA 2WYXA 1I2SA 4Y17A 5E2GA 3A3IA 4KENB 4OQ0A 1BLHA 1OPXA 2P9VA 3ZGAB 4JGOA 4I3AA 5CGXA 1PFLA 3CPTB 2JKRM 3W4QA 4LV1A 1VB6A 3D3OA 5DFYA 1F9IA 5HPFA 3TG9A 1L0FA 4R3BA 2YKFA 5CTNA 3HUMA 2IA2A 3OPHA 2A24B 1K6SA 4EUZA 1E3UD 4N92A 1OT9A 3HVFA 2PT7A 2G7UA 1TD5A 2V1BA 1KDWA 3LR5A 2Y8HA 1ES3A 5FI7A 2R9WA 3DBAA 1ZG4A 4JGPA 1S1YA 3G30A 3KSIA 4AFIA 1CQAA 4JF6A 4KG2A 2WZZA 2W1RA 3MF0A 1MZUA 1XFNA 3PBTA 3WRZA 1XGIA 4ETZA 1G6AA 1HVBA 3BQAA 4Y3IA 5FEFA 1P0ZA 4BBTA 1WE4A 3S4XA 3C2WA 3WS0A 1TEMA 4UA9A 2ZL1A 3B42A 3EGXC 3VE4A 3M2JA 3FKVA 3UDXA 3S7NA 5J7EA 1N4OA 4B93A 3IT9A 3MZEA 4KZ8A 1T1BA 3S7OA 3VP1A 1H3QA 2V0UA 2XR0A 1AXBA 2HGVA 5HAPA 4Y0UA 1SKOA 2D01A 2Z6DA 1BTLA 1XA1A 2PR5A 4CLCA 1DP9A 4OLDA 2QKPA 1M6KA 1GHPA 5FL3A 4C75A 4KZAA 1K4EA 2OAQ1 3GR2A 2H0YA 1IYPA 4JF4A 1DRMA 1H8MA 4MBFA 3VP2A 2Y2JA 3CG5A 1NZUA 1Q2PA 2JBFA 4PKYG 4X1LA 5EOOA 2Q9MA 4R6LA 3WS2A 5DF9A 5A93A 5IHVA 1DP8A 4ARZB 2XD5A 4N9KA 5AQAA 4OVDA 3IXGA 2EX9A 2WZXA 3FKWA 3T4TA 1K57A 2PHYA 1NXYA 3N8RA 1SDNA 3AGDA 3H82B 3LFVA 3EWKA 4KZ4A 5FQKA 2V2FF 3C38A 1KE4A 3VSLA 4WZ4A 5DTSA 1K55A 1CI8A 4EU0A 4S2JA 4LV3A 4E6WA 3TOIA 3T1SA 1GA9A 4CLCD 3N8SA 1ESIA 5KSCA 2VV6A 1MPLA 3T1RA 1K54A 2JKFA 3A3FA 3BECA 2QMIA 4C3QA 1BLPA 4MN6A 2RCXA 5F1GA 3T12B 1PWGA 1MWSA 1OJ5A 2RL3A 3BFEA 4JXWA 1XJ2A 5TBMB 4DE0A 5CECA 3A3EA 3ITAA 5J4EA 3LI8A 4IJGA 4HBUA 5CRFA 3A0SA 3G4PA 1YLZA 3PBRA 4KUOA 3MQOA 4P6ZS 5EUAA 2VGLS 1OTAA 1PWDA 3C7UA 2W3DA 3BY8A 3SS5A 5K5BA 1NRFA 1QMFA 3LICA 4BL2A 3HL9A 4G3KA 5CEBA 1WYBA 1DP6A 1ES2A 3HCYA 4S2NA 4X6TA 2WKIA 3U2AA 4Y2FA 3HJKA 4S2MA 3N7WA 1ZTUA 3G2YA 3UPPA 2ZMAA 2IWDA 2V1AA 4BMWA 1NYYA 3LIEA 3BJNA 1YLJA 4KZ3A 1TDGA 4EW7A 1K0KA 1KVMA 1BYWA 1ZC2A 5HAIA 3EGDC 4KUKA 3LUQA 2NUTC 1XJ6A 4L0LA 4U3TA 4OP8A 3IF6C 2UWXA 5E43A 1TVFA 2YKHA 4ID4A 1LHYA 4NXBA 3K3CA 3EEHA 5F83A 3TE8A 2J8YA 3KYEA 3OZHA 3PR6A 4BQMA 2W27A 2P04A 4IEDA 3PYPA 4JXVA 4LRZE 4Z1WA 1SCWA 1XPBA 2BLSA 1N9OA 2W1TA 2O99A 4RX3A 1GHMA 2HDSA 5F6AA 1ONGA 2O9CA 2OAP1 2B5RA 1J3WA 3A3JA 4GKUA 3SH7A 3KYZA 5HDSA 3NDEA 2E8IA 4Y7PA 3FPVA 1WA9A 4DKIA 3W4PA 2Z2LB 2KDKA 2QPNA 5FAPA 2ZM8A 4WUJA 3N8LA 4B4XA 4EXOA 3NBLA 3H7WB 1JWVA 2VEAA 3VP0A 3ZNYA 3ZVWA 3GSGA 3KYQA 2INWA 3SH9A 4ZAMA 4GJ4A 3MR0A 2PD8A 3T4QA 2HP6A 4BBUA 4HJ4A 1NWZA 3BFCA 1PRQA 1YPRA 4LV0A 1SKFA 3MMHA 1CF0A 3F1PB 4JPMA 2PD7A 4YFMA 4K08A 1NRJA 2BTFP 1S1ZA 3K2NA 2HPBA 2XH9A 4EWFA 1VETA 3UE0A 3IHAA 3O3VA 3MBZA 3ZG5A 2QYBA 3IH8A 2V1ZA 4G3VA 2BASA 4II7A 4KZ5A 2O9BA 5C5KA 1NZOA 2MJ6A 3ZVTA 2DNSA 2HDUA 1FCNA 1KE3A 1MY8A 2G2UA 3EOIA 2K2NA 2WKPA 1CEFA 4L9EA 3T1QB 1C3BA 3WS4A 2XDMA 3QHYA 2ZM0A 2QWSA 4PM7A 5CXWA 3VFFA 4FCFA 3T1XA 3MJQA 4O0PA 3R7WB 4E3KA 4GZBA 2ZMFA 1OTBA 3P01A 1FR1A 4HESA 1VM1A 5FAOA 3BRMA 3ZG0A 4GHIB 4Y13A 2D02A 1FCMA 1GHIA 2JKRI 4N1HA 5IS1A 3LY4A 3VSKA 4X1MA 4O8GA 4YOFA 4KZ9A 4F3LA 3IBJA 1YSPA
chains in the Genus database with same CATH topology
4WBGA 4E3NA 3BFDA 3BFGA 3Q7ZA 1KDWA 3ISGA 1ES3A 1RGZA 2JE5A 2XK1A 5FI7A 5M18A 3S22A 3BLMA 2WAFA 2R9WA 4MBKA 1ZG6A 1CK3A 4EBNA 3UPNA 3NC8A 5E2FA 1ZG4A 3PBNA 2ZLYA 4DDYA 3G30A 5EVIC 4S2LA 4R0QA 1YLWA 3I7JA 4JF6A 4KG2A 2WZZA 1YT4A 3EQVA 3ZDJA 1Q2QA 3G31A 4BENA 3PBTA 3WRZA 2X71A 3MFDA 1XGIA 1G6AA 1HVBA 1PWCA 4MNRA 1BZAA 3M2KA 4OOMA 3UDIA 1IEMA 1KGEA 2PU4A 4GD6A 4PM9A 1WE4A 4QB8A 5J8XA 3AGEA 4XXRA 1YM1A 4GOGA 2ZC5B 4UAAA 3IXDA 5DVAA 5TFQA 3S4XA 4X56A 1BLSA 3WS0A 4FH2A 1TEMA 1IYSA 3RXWA 3MKFA 4KZ6A 4UA9A 1N9BA 2ZC6B 3HLDA 3B3XA 1IYOA 1K57C 5DF8A 5F1FA 3M2JA 3FKVA 3UDXA 2Y2QA 4OKPA 3OPPA 3Q07A 1N4OA 3IT9A 3MZEA 4KZ8A 1L2SA 3VP1A 4WZ5A 2FFFB 2PU2A 4N9LA 2XR0A 4KQOA 1AXBA 3W4OA 3IWIA 5KSHA 4R23A 1H5XA 4X55A 5U47A 3MXRA 5HAPA 1YMSA 4R3JA 4Y0UA 4PM6A 1H8YA 2ZC3B 4CJNA 1K25A 1BTLA 1XA1A 1K55C 4OPYA 2Y2IA 4Z9QA 1H8ZA 2JCHA 4R4RA 4OLDA 1M6KA 4K0XA 1GHPA 2R9XA 2HDRA 2ZQDA 4C75A 4KZAA 1K4EA 1K56D 3GR2A 2H0YA 1O07A 2WKEA 3N6IA 1IYPA 4JF4A 1YQSA 4MBFA 5EVIA 3LO7A 1K54C 1XP4A 4WEKA 2Y2JA 2DCFA 3CG5A 4HEFA 1NZUA 3VP2A 2I72A 3UDFA 1MXOA 3G34A 3M6BA 2Z2MB 3IF6B 1MWUA 1Q2PA 2JBFA 1LI9A 5EOOA 2Q9MA 1ES5A 3WS2A 1ZKJA 4DE1A 4JKTA 5DTKA 1XGJA 5DF9A 5A93A 1YLYA 3OCLA 4S2PA 1MBLA 5DF7A 2J7VA 2BG1A 5IHVA 1BULA 4IBRA 5CGSA 4P0MA 5G18A 1XX2A 2XD5A 3Q1FA 4N9KA 5AQAA 4LCMA 3HLWA 5KZHA 4OVDA 3IXGA 1YLTA 3PAEA 2EX9A 2Y2OA 4GN2A 3GVBA 4OQIA 3P98A 2WZXA 2HP9A 3FKWA 4EQIA 1LL9A 1K57A 4K0WA 2GDNA 2XD1A 4CPKA 1MWTA 1NXYA 3N8RA 1SDNA 5GLAA 5FASA 3O88A 1EWZA 1PW1A 3AGDA 3Q7VA 4UA6A 4KZ4A 5FQKA 2WGWB 4X68A 1PW8A 1PZOA 2OLUA 2EFXA 4OOYA 1TDLA 5TR7A 1KE0A 2V2FF 1KE4A 3HLGA 5DTTA 3GRJA 1LL5A 3VSLA 3UO9A 4OQHA 2Y55A 4WZ4A 3CJMA 3C4PA 1LI0A 4QY6A 5EE8A 5DTSA 1K55A 4WM9A 1SDEA 1CI8A 2C5WB 1DJAA 4LV3A 4S2JA 5EECA 4E6WA 1MWRA 3LY3A 3TOIA 1HD8A 3WRTA 4E3JA 3C4OA 4QJGA 1GA9A 3N8SA 4S2NC 1ESIA 2Y91A 1GCEA 5FQMA 5KSCA 4P87A 4XUZA 1MPLA 2JC7A 4DXCA 2HP5A 3MZDA 3WWXA 2Q9NA 3LCEA 3SH8A 2WKHA 1K54A 2Y2HA 1XKZA 3ZFZA 3A3FA 3BECA 2XF3A 4RX2A 2QMIA 4C3QA 3M6HA 4DF6A 1NY0A 5HAQA 5GLBA 1BLPA 2A3UA 4NK3A 2RCXA 5F1GA 3UY6A 1L0EA 1KVLA 1PWGA 4OPQA 3IWOA 4XUXA 4BD0A 1MWSA 4DE2A 5CTMA 1DY6A 2RL3A 1HZOA 3OPRA 3BFEA 4JXWA 3FWLA 3GV9A 4X53A 4KZ7A 4S2KA 5E2EA 2EXAA 3PBSA 3V39A 4DE0A 4PMAA 4BJPA 3LEZA 5GL9A 4RYEA 4JF5A 2ZQAA 2Y2GA 5CECA 2P9VB 5I94A 3ZHHA 3A3EA 3HREA 3ITAA 3IXBA 5FAQA 1IKGA 1BT5A 3A3DA 4UA7A 4QHCA 4HBUA 5CRFA 1KGFA 3G4PA 5M19A 1HTZA 1YLZA 3UPOA 3PBRA 4OOLA 5CERA 5FQIA 4WMCD 4GNUA 2WADA 5EUAA 3S1YA 1ALQA 4Y0OA 4KZBA 4PM5A 1PWDA 1BLCA 3OPLA 3C7UA 3RJUA 3SS5A 5HFOA 4R1GA 3O87A 4YINA 3HLCA 1NRFA 4M3KA 5AQBA 1QMFA 4DRTA 5A90A 4BL2A 3HL9A 1YMXA 3C5AA 1K4FA 5CEBA 5JYPA 4FH4A 4ZJ1A 1WYBA 1ES2A 2XEPA 1XA7A 5GHZA 4S2NA 3W8KA 4X6TA 2WKIA 5E2HA 1JVJA 2HDQA 1FOFA 2XFTA 4S2MA 5AQ9A 1IELA 3IQAA 3MXSA 1E3UA 3G2YA 3N7WA 2ZMAA 3IHBA 3UPPA 1PI5A 2IWDA 3C7VA 4B88A 4BD1A 4BLMA 4OP5A 5CHJA 4E3MA 1NYYA 2EX6A 2Y2LA 3UN7A 1YLJA 3D4FA 1TDGA 4KZ3A 4PM8A 2WGIA 1DJBA 1ZC2A 1KVMA 2DRWA 4QU3A 5HAIA 3ZNTA 3NCKA 4QY5A 1W5DA 1CEGA 4E3IA 1JTGA 1FSYA 2PBYA 2ZJ9A 4L0LA 4U3TA 4DE3A 5JYOA 1ERMA 4OP8A 3IF6C 5M1AA 4GB7A 5GHXA 3E2KA 3WS5A 1NJ4A 5A91A 2UWXA 4BL3A 5E43A 3UE1A 4K91A 4OONA 3HLFA 5CEDA 1TVFA 4ID4A 1LHYA 3QNCA 1M40A 2J9OA 4GDNA 1ESUA 2XLNA 3NY4A 3Q81A 5HW3A 2WUQA 4HBTA 5CHUA 4B4ZA 3GMWA 3N4IA 3G2ZA 4DXBA 5F83A 5EVLA 2XGNA 3UE3A 3NIAA 5F82A 2J8YA 3VP4A 5FQJA 3PTEA 4RVAA 3OZHA 4S2IA 3CMZA 5FQQA 2ZC4B 4QD4A 4BQMA 1MKIA 1O7EA 1FQGA 4IEDA 4E3LA 2CC1A 2EX2A 4JXVA 2Y2NA 3ZCZA 5EPHA 2A49A 5A92A 2J9PA 3OCNA 2G2WA 2P74A 1JWZA 1SCWA 1XPBA 3VOYA 2BLSA 4S2OA 4EBPA 1S6RA 4F94A 4RX3A 1GHMA 2Y2KA 2HDSA 3HLBA 4OPZA 5FI6A 1ONGA 4Y0TA 2OLVA 2B5RA 1ONHA 3A3JA 4GKUA 4WZ5C 3VOZA 1JWPA 3OC2A 3IXHA 2ZQ8A 1FCOA 2XFSA 3SH7A 3RXXA 2OV5A 1ERQA 3ITBA 3HUOA 4IBXA 4IVKA 5CHMA 4ZDXA 3NDGA 3VP3A 3NDEA 3HUNA 1RCJA 2E8IA 1RP5A 4PPRA 3CZDA 4Y7PA 5KMWA 1LLBA 3BYDA 5EVID 1E4DA 3DW0A 4LCLA 4P85A 4JBFA 5EVIB 3P09A 2IWBA 4H8RA 4KQRA 1L0GA 4DKIA 3W4PA 1OMEA 2Z2LB 5FQ9A 3V5MA 2QPNA 4N1XA 3E2LA 5FAPA 4JXSA 1FSWA 2ZM8A 4ZJ3A 3BM6A 3HLEA 3IF6A 4WELA 2EX8A 1FR6A 1CI9A 3SS4A 3N8LA 3VMAA 4B4XA 4C6YA 4R4SA 4KQQA 3NBLA 4EBLA 1PYYA 2ZC7A 1G68A 5FDHA 1JWVA 4DDSA 4IVIA 1K38A 3VP0A 3G35A 3ZNYA 3PBQA 4U0TA 2X02A 3ZVWA 1WYCA 3GSGA 4WYYA 4EV4A 1Z6FA 1PIOA 1I2WA 3DWKA 3SH9A 4ZAMA 1W8QA 2VGKA 1KDSA 4X69A 1JTDA 4JXGA 5FI2A 2ZQ9A 4GDBA 2HP6A 4OPRA 2Y59A 2ZQCA 3BEBA 3IWQA 3PBOA 3MZFA 1IKIA 3Q82A 3QNBA 3WS1A 3G32A 4ZBEA 2H10A 4E6XA 1I5QA 3BLSA 3Q7VB 5GHYA 4NETA 1GA0A 2EFUA 3BFCA 1VQQA 3GQZA 2WK0A 5HX9A 1ES4A 2WGWA 2ZD8A 4OH0A 1QMEA 4LV0A 1SKFA 3V3RA 4FSFA 4JPMA 3SOIA 2WAEA 2X01A 5FATA 4GD8A 4YFMA 3HBRA 1IYQA 2HPBA 2XH9A 4LENA 3IF5A 4KG6A 5GLCA 5EOEA 4EWFA 3NI9A 4FD8A 4ZJ2A 3UE0A 4O7DA 1EROA 3IHAA 3O3VA 3DTMA 5TGFA 1U60A 3TSGA 2OSUA 3MBZA 1W79A 3PAGA 3UNWA 3ZG5A 1NYMA 3O86A 2Y2PA 3FZCA 5HARA 3IH8A 4A5RA 1K6RA 1PI4A 2IWCA 1BSGA 4KG5A 2V1ZA 3VFHA 1L0DA 3EQUA 3ZG8B 1KGGA 4WEJA 5CGWA 4KZ5A 1DJCA 1S0WA 3AGFA 1EI5A 1NZOA 2ZQ7A 3ZVTA 4MEZA 2XQZA 2WGVA 4U0XA 2DNSA 2H0TA 2HDUA 5FA7A 1J9MA 1W7FA 2WYXA 1I2SA 1FCNA 1XXMA 3DWZA 3FV7A 3JYIA 1KE3A 1W8YA 1MY8A 2G2UA 2VGJA 4MLLA 5E2GA 1CEFA 4RA7A 1PZPA 3A3IA 4KENB 1C3BA 3WS4A 2XDMA 4UHUA 4OQ0A 3QHYA 5BOHA 4OLGA 1BLHA 2ZM2A 2ZM0A 5FSRA 5HL1A 2P9VA 3ZG9B 4PM7A 3ZGAB 3MKEA 2Y2MA 5CGXA 5CXWA 3VFFA 4Q8IA 4E3OA 1YLPA 4FCFA 4JLFA 5L2FA 3V3SA 3GTCA 3W4QA 1E25A 5D3OA 4E3KA 4GZBA 4LV1A 5AQ7A 1RGYA 2V20A 4WMCA 3V50A 4D2OA 1FR1A 3BFFA 4HESA 1VM1A 3TG9A 5FAOA 3SS3A 3ZG7B 1L0FA 3BRMA 3ZG0A 2Y4AA 4MBHA 4OQGA 4R3BA 2QZ6A 1FCMA 5CTNA 2EXBA 1GHIA 4N1HA 3FYZA 3HUMA 5GLDA 2C6WB 3LY4A 4ZTKA 3VSKA 1SHVA 4P6BA 2FFYA 3OPHA 4LV2A 1Y54A 1K6SA 4EUZA 4KZ9A 2H5SA 1E3UD 4N92A 1K56A 1BUEA 3HVFA 3IH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WBG A;  4E3N A;  3BFD A;  3BFG A;  3Q7Z A;  1KDW A;  3ISG A;  1ES3 A;  1RGZ A;  2JE5 A;  2XK1 A;  5FI7 A;  5M18 A;  3S22 A;  3BLM A;  2WAF A;  2R9W A;  4MBK A;  1ZG6 A;  1CK3 A;  4EBN A;  3UPN A;  3NC8 A;  5E2F A;  1ZG4 A;  3PBN A;  2ZLY A;  4DDY A;  3G30 A;  5EVI C;  4S2L A;  4R0Q A;  1YLW A;  3I7J A;  4JF6 A;  4KG2 A;  2WZZ A;  1YT4 A;  3EQV A;  3ZDJ A;  1Q2Q A;  3G31 A;  4BEN A;  3PBT A;  3WRZ A;  2X71 A;  3MFD A;  1XGI A;  1G6A A;  1HVB A;  1PWC A;  4MNR A;  1BZA A;  3M2K A;  4OOM A;  3UDI A;  1IEM A;  1KGE A;  2PU4 A;  4GD6 A;  4PM9 A;  1WE4 A;  4QB8 A;  5J8X A;  3AGE A;  4XXR A;  1YM1 A;  4GOG A;  2ZC5 B;  4UAA A;  3IXD A;  5DVA A;  5TFQ A;  3S4X A;  4X56 A;  1BLS A;  3WS0 A;  4FH2 A;  1TEM A;  1IYS A;  3RXW A;  3MKF A;  4KZ6 A;  4UA9 A;  1N9B A;  2ZC6 B;  3HLD A;  3B3X A;  1IYO A;  1K57 C;  5DF8 A;  5F1F A;  3M2J A;  3FKV A;  3UDX A;  2Y2Q A;  4OKP A;  3OPP A;  3Q07 A;  1N4O A;  3IT9 A;  3MZE A;  4KZ8 A;  1L2S A;  3VP1 A;  4WZ5 A;  2FFF B;  2PU2 A;  4N9L A;  2XR0 A;  4KQO A;  1AXB A;  3W4O A;  3IWI A;  5KSH A;  4R23 A;  1H5X A;  4X55 A;  5U47 A;  3MXR A;  5HAP A;  1YMS A;  4R3J A;  4Y0U A;  4PM6 A;  1H8Y A;  2ZC3 B;  4CJN A;  1K25 A;  1BTL A;  1XA1 A;  1K55 C;  4OPY A;  2Y2I A;  4Z9Q A;  1H8Z A;  2JCH A;  4R4R A;  4OLD A;  1M6K A;  4K0X A;  1GHP A;  2R9X A;  2HDR A;  2ZQD A;  4C75 A;  4KZA A;  1K4E A;  1K56 D;  3GR2 A;  2H0Y A;  1O07 A;  2WKE A;  3N6I A;  1IYP A;  4JF4 A;  1YQS A;  4MBF A;  5EVI A;  3LO7 A;  1K54 C;  1XP4 A;  4WEK A;  2Y2J A;  2DCF A;  3CG5 A;  4HEF A;  1NZU A;  3VP2 A;  2I72 A;  3UDF A;  1MXO A;  3G34 A;  3M6B A;  2Z2M B;  3IF6 B;  1MWU A;  1Q2P A;  2JBF A;  1LI9 A;  5EOO A;  2Q9M A;  1ES5 A;  3WS2 A;  1ZKJ A;  4DE1 A;  4JKT A;  5DTK A;  1XGJ A;  5DF9 A;  5A93 A;  1YLY A;  3OCL A;  4S2P A;  1MBL A;  5DF7 A;  2J7V A;  2BG1 A;  5IHV A;  1BUL A;  4IBR A;  5CGS A;  4P0M A;  5G18 A;  1XX2 A;  2XD5 A;  3Q1F A;  4N9K A;  5AQA A;  4LCM A;  3HLW A;  5KZH A;  4OVD A;  3IXG A;  1YLT A;  3PAE A;  2EX9 A;  2Y2O A;  4GN2 A;  3GVB A;  4OQI A;  3P98 A;  2WZX A;  2HP9 A;  3FKW A;  4EQI A;  1LL9 A;  1K57 A;  4K0W A;  2GDN A;  2XD1 A;  4CPK A;  1MWT A;  1NXY A;  3N8R A;  1SDN A;  5GLA A;  5FAS A;  3O88 A;  1EWZ A;  1PW1 A;  3AGD A;  3Q7V A;  4UA6 A;  4KZ4 A;  5FQK A;  2WGW B;  4X68 A;  1PW8 A;  1PZO A;  2OLU A;  2EFX A;  4OOY A;  1TDL A;  5TR7 A;  1KE0 A;  2V2F F;  1KE4 A;  3HLG A;  5DTT A;  3GRJ A;  1LL5 A;  3VSL A;  3UO9 A;  4OQH A;  2Y55 A;  4WZ4 A;  3CJM A;  3C4P A;  1LI0 A;  4QY6 A;  5EE8 A;  5DTS A;  1K55 A;  4WM9 A;  1SDE A;  1CI8 A;  2C5W B;  1DJA A;  4LV3 A;  4S2J A;  5EEC A;  4E6W A;  1MWR A;  3LY3 A;  3TOI A;  1HD8 A;  3WRT A;  4E3J A;  3C4O A;  4QJG A;  1GA9 A;  3N8S A;  4S2N C;  1ESI A;  2Y91 A;  1GCE A;  5FQM A;  5KSC A;  4P87 A;  4XUZ A;  1MPL A;  2JC7 A;  4DXC A;  2HP5 A;  3MZD A;  3WWX A;  2Q9N A;  3LCE A;  3SH8 A;  2WKH A;  1K54 A;  2Y2H A;  1XKZ A;  3ZFZ A;  3A3F A;  3BEC A;  2XF3 A;  4RX2 A;  2QMI A;  4C3Q A;  3M6H A;  4DF6 A;  1NY0 A;  5HAQ A;  5GLB A;  1BLP A;  2A3U A;  4NK3 A;  2RCX A;  5F1G A;  3UY6 A;  1L0E A;  1KVL A;  1PWG A;  4OPQ A;  3IWO A;  4XUX A;  4BD0 A;  1MWS A;  4DE2 A;  5CTM A;  1DY6 A;  2RL3 A;  1HZO A;  3OPR A;  3BFE A;  4JXW A;  3FWL A;  3GV9 A;  4X53 A;  4KZ7 A;  4S2K A;  5E2E A;  2EXA A;  3PBS A;  3V39 A;  4DE0 A;  4PMA A;  4BJP A;  3LEZ A;  5GL9 A;  4RYE A;  4JF5 A;  2ZQA A;  2Y2G A;  5CEC A;  2P9V B;  5I94 A;  3ZHH A;  3A3E A;  3HRE A;  3ITA A;  3IXB A;  5FAQ A;  1IKG A;  1BT5 A;  3A3D A;  4UA7 A;  4QHC A;  4HBU A;  5CRF A;  1KGF A;  3G4P A;  5M19 A;  1HTZ A;  1YLZ A;  3UPO A;  3PBR A;  4OOL A;  5CER A;  5FQI A;  4WMC D;  4GNU A;  2WAD A;  5EUA A;  3S1Y A;  1ALQ A;  4Y0O A;  4KZB A;  4PM5 A;  1PWD A;  1BLC A;  3OPL A;  3C7U A;  3RJU A;  3SS5 A;  5HFO A;  4R1G A;  3O87 A;  4YIN A;  3HLC A;  1NRF A;  4M3K A;  5AQB A;  1QMF A;  4DRT A;  5A90 A;  4BL2 A;  3HL9 A;  1YMX A;  3C5A A;  1K4F A;  5CEB A;  5JYP A;  4FH4 A;  4ZJ1 A;  1WYB A;  1ES2 A;  2XEP A;  1XA7 A;  5GHZ A;  4S2N A;  3W8K A;  4X6T A;  2WKI A;  5E2H A;  1JVJ A;  2HDQ A;  1FOF A;  2XFT A;  4S2M A;  5AQ9 A;  1IEL A;  3IQA A;  3MXS A;  1E3U A;  3G2Y A;  3N7W A;  2ZMA A;  3IHB A;  3UPP A;  1PI5 A;  2IWD A;  3C7V A;  4B88 A;  4BD1 A;  4BLM A;  4OP5 A;  5CHJ A;  4E3M A;  1NYY A;  2EX6 A;  2Y2L A;  3UN7 A;  1YLJ A;  3D4F A;  1TDG A;  4KZ3 A;  4PM8 A;  2WGI A;  1DJB A;  1ZC2 A;  1KVM A;  2DRW A;  4QU3 A;  5HAI A;  3ZNT A;  3NCK A;  4QY5 A;  1W5D A;  1CEG A;  4E3I A;  1JTG A;  1FSY A;  2PBY A;  2ZJ9 A;  4L0L A;  4U3T A;  4DE3 A;  5JYO A;  1ERM A;  4OP8 A;  3IF6 C;  5M1A A;  4GB7 A;  5GHX A;  3E2K A;  3WS5 A;  1NJ4 A;  5A91 A;  2UWX A;  4BL3 A;  5E43 A;  3UE1 A;  4K91 A;  4OON A;  3HLF A;  5CED A;  1TVF A;  4ID4 A;  1LHY A;  3QNC A;  1M40 A;  2J9O A;  4GDN A;  1ESU A;  2XLN A;  3NY4 A;  3Q81 A;  5HW3 A;  2WUQ A;  4HBT A;  5CHU A;  4B4Z A;  3GMW A;  3N4I A;  3G2Z A;  4DXB A;  5F83 A;  5EVL A;  2XGN A;  3UE3 A;  3NIA A;  5F82 A;  2J8Y A;  3VP4 A;  5FQJ A;  3PTE A;  4RVA A;  3OZH A;  4S2I A;  3CMZ A;  5FQQ A;  2ZC4 B;  4QD4 A;  4BQM A;  1MKI A;  1O7E A;  1FQG A;  4IED A;  4E3L A;  2CC1 A;  2EX2 A;  4JXV A;  2Y2N A;  3ZCZ A;  5EPH A;  2A49 A;  5A92 A;  2J9P A;  3OCN A;  2G2W A;  2P74 A;  1JWZ A;  1SCW A;  1XPB A;  3VOY A;  2BLS A;  4S2O A;  4EBP A;  1S6R A;  4F94 A;  4RX3 A;  1GHM A;  2Y2K A;  2HDS A;  3HLB A;  4OPZ A;  5FI6 A;  1ONG A;  4Y0T A;  2OLV A;  2B5R A;  1ONH A;  3A3J A;  4GKU A;  4WZ5 C;  3VOZ A;  1JWP A;  3OC2 A;  3IXH A;  2ZQ8 A;  1FCO A;  2XFS A;  3SH7 A;  3RXX A;  2OV5 A;  1ERQ A;  3ITB A;  3HUO A;  4IBX A;  4IVK A;  5CHM A;  4ZDX A;  3NDG A;  3VP3 A;  3NDE A;  3HUN A;  1RCJ A;  2E8I A;  1RP5 A;  4PPR A;  3CZD A;  4Y7P A;  5KMW A;  1LLB A;  3BYD A;  5EVI D;  1E4D A;  3DW0 A;  4LCL A;  4P85 A;  4JBF A;  5EVI B;  3P09 A;  2IWB A;  4H8R A;  4KQR A;  1L0G A;  4DKI A;  3W4P A;  1OME A;  2Z2L B;  5FQ9 A;  3V5M A;  2QPN A;  4N1X A;  3E2L A;  5FAP A;  4JXS A;  1FSW A;  2ZM8 A;  4ZJ3 A;  3BM6 A;  3HLE A;  3IF6 A;  4WEL A;  2EX8 A;  1FR6 A;  1CI9 A;  3SS4 A;  3N8L A;  3VMA A;  4B4X A;  4C6Y A;  4R4S A;  4KQQ A;  3NBL A;  4EBL A;  1PYY A;  2ZC7 A;  1G68 A;  5FDH A;  1JWV A;  4DDS A;  4IVI A;  1K38 A;  3VP0 A;  3G35 A;  3ZNY A;  3PBQ A;  4U0T A;  2X02 A;  3ZVW A;  1WYC A;  3GSG A;  4WYY A;  4EV4 A;  1Z6F A;  1PIO A;  1I2W A;  3DWK A;  3SH9 A;  4ZAM A;  1W8Q A;  2VGK A;  1KDS A;  4X69 A;  1JTD A;  4JXG A;  5FI2 A;  2ZQ9 A;  4GDB A;  2HP6 A;  4OPR A;  2Y59 A;  2ZQC A;  3BEB A;  3IWQ A;  3PBO A;  3MZF A;  1IKI A;  3Q82 A;  3QNB A;  3WS1 A;  3G32 A;  4ZBE A;  2H10 A;  4E6X A;  1I5Q A;  3BLS A;  3Q7V B;  5GHY A;  4NET A;  1GA0 A;  2EFU A;  3BFC A;  1VQQ A;  3GQZ A;  2WK0 A;  5HX9 A;  1ES4 A;  2WGW A;  2ZD8 A;  4OH0 A;  1QME A;  4LV0 A;  1SKF A;  3V3R A;  4FSF A;  4JPM A;  3SOI A;  2WAE A;  2X01 A;  5FAT A;  4GD8 A;  4YFM A;  3HBR A;  1IYQ A;  2HPB A;  2XH9 A;  4LEN A;  3IF5 A;  4KG6 A;  5GLC A;  5EOE A;  4EWF A;  3NI9 A;  4FD8 A;  4ZJ2 A;  3UE0 A;  4O7D A;  1ERO A;  3IHA A;  3O3V A;  3DTM A;  5TGF A;  1U60 A;  3TSG A;  2OSU A;  3MBZ A;  1W79 A;  3PAG A;  3UNW A;  3ZG5 A;  1NYM A;  3O86 A;  2Y2P A;  3FZC A;  5HAR A;  3IH8 A;  4A5R A;  1K6R A;  1PI4 A;  2IWC A;  1BSG A;  4KG5 A;  2V1Z A;  3VFH A;  1L0D A;  3EQU A;  3ZG8 B;  1KGG A;  4WEJ A;  5CGW A;  4KZ5 A;  1DJC A;  1S0W A;  3AGF A;  1EI5 A;  1NZO A;  2ZQ7 A;  3ZVT A;  4MEZ A;  2XQZ A;  2WGV A;  4U0X A;  2DNS A;  2H0T A;  2HDU A;  5FA7 A;  1J9M A;  1W7F A;  2WYX A;  1I2S A;  1FCN A;  1XXM A;  3DWZ A;  3FV7 A;  3JYI A;  1KE3 A;  1W8Y A;  1MY8 A;  2G2U A;  2VGJ A;  4MLL A;  5E2G A;  1CEF A;  4RA7 A;  1PZP A;  3A3I A;  4KEN B;  1C3B A;  3WS4 A;  2XDM A;  4UHU A;  4OQ0 A;  3QHY A;  5BOH A;  4OLG A;  1BLH A;  2ZM2 A;  2ZM0 A;  5FSR A;  5HL1 A;  2P9V A;  3ZG9 B;  4PM7 A;  3ZGA B;  3MKE A;  2Y2M A;  5CGX A;  5CXW A;  3VFF A;  4Q8I A;  4E3O A;  1YLP A;  4FCF A;  4JLF A;  5L2F A;  3V3S A;  3GTC A;  3W4Q A;  1E25 A;  5D3O A;  4E3K A;  4GZB A;  4LV1 A;  5AQ7 A;  1RGY A;  2V20 A;  4WMC A;  3V50 A;  4D2O A;  1FR1 A;  3BFF A;  4HES A;  1VM1 A;  3TG9 A;  5FAO A;  3SS3 A;  3ZG7 B;  1L0F A;  3BRM A;  3ZG0 A;  2Y4A A;  4MBH A;  4OQG A;  4R3B A;  2QZ6 A;  1FCM A;  5CTN A;  2EXB A;  1GHI A;  4N1H A;  3FYZ A;  3HUM A;  5GLD A;  2C6W B;  3LY4 A;  4ZTK A;  3VSK A;  1SHV A;  4P6B A;  2FFY A;  3OPH A;  4LV2 A;  1Y54 A;  1K6S A;  4EUZ A;  4KZ9 A;  2H5S A;  1E3U D;  4N92 A;  1K56 A;  1BUE A;  3HVF A;  3IH9 A; 
#chains in the Genus database with same CATH topology
 3Q7Z A;  4NXG A;  1RGZ A;  2JE5 A;  1NLZ A;  1F98 A;  1TS8 A;  3MSH A;  3S22 A;  3BLM A;  1EW0 A;  4EET B;  4EER A;  1H0M A;  2GZA A;  4MBK A;  4EBN A;  4GS9 A;  4EES A;  3CWF A;  2ZLY A;  4S2L A;  4XT2 B;  4LLO B;  3EQV A;  3ZDJ A;  1Q2Q A;  3NHQ A;  3G31 A;  2XSS A;  3M2K A;  4HJ6 A;  3UDI A;  2PU4 A;  4Y15 A;  5TFQ A;  1YM1 A;  2ZC5 B;  4X56 A;  1S66 L;  2B18 A;  2PRF A;  3F1N B;  3B3X A;  1K57 C;  3LGO A;  3CPT A;  2Y2Q A;  3OPP A;  4R70 A;  1YKD A;  2PU2 A;  4HOI A;  5DKL A;  5I5L A;  1H5X A;  2GX5 A;  5TJJ A;  5U47 A;  1W63 Q;  4PM6 A;  2ZC3 B;  1K55 C;  4OPY A;  4Z9Q A;  4R4R A;  2JCH A;  1G5U A;  4K0X A;  2ZQD A;  3A0V A;  3N6I A;  2WKE A;  2Q0O A;  3LO7 A;  1K54 C;  1XP4 A;  4NEE D;  2EWV A;  2DCF A;  3KSF A;  3UDF A;  1MXO A;  3IF6 B;  1LI9 A;  1ES5 A;  1XGJ A;  2VX8 A;  3OCL A;  3JVV A;  1BUL A;  4IBR A;  1V9Y A;  4HI4 A;  2J3T C;  1XX2 A;  3P7N A;  2VLG A;  2LB5 A;  4M4X A;  3IX4 A;  4OQI A;  4EQI A;  1LL9 A;  2QJ7 A;  4CPK A;  1MWT A;  3G6O A;  2ZBB A;  1PW1 A;  3Q7V A;  3L7H A;  2ZOI A;  4X68 A;  1PW8 A;  2V9A A;  2EFX A;  5TR7 A;  5DTT A;  3QP1 A;  2Y55 A;  1VEU B;  3CJM A;  5EE8 A;  3LY3 A;  2XA7 M;  2R78 A;  4S2N C;  5FQM A;  4DXC A;  2HP5 A;  2Q9N A;  2WKH A;  2PDR A;  3ZFZ A;  3K3D A;  5FDS A;  4MN7 A;  1CJF A;  4BD0 A;  4DE2 A;  3ULF A;  4X53 A;  4L9F A;  3V39 A;  5GL9 A;  5I94 A;  2P9V B;  1BT5 A;  3A3D A;  4UA7 A;  3E4Q A;  3W2Z A;  4ARZ A;  1KGF A;  5AJG A;  5M19 A;  1HTZ A;  5AVE A;  3PXP A;  4LRX C;  5FQI A;  3VE3 A;  4PHT A;  3S1Y A;  1ALQ A;  4PM5 A;  1BLC A;  3OPL A;  2JKT I;  3RJU A;  3BWL A;  4I5S A;  4R1G A;  4YIN A;  3HLC A;  3H82 A;  2W3H A;  2PBD P;  4DRT A;  5A90 A;  3C5A A;  1D7E A;  4FH4 A;  1P9W A;  3UB5 P;  3W8K A;  1LT0 A;  4YNR A;  1JVJ A;  1FOF A;  3ZYT A;  5AQ9 A;  3CHW P;  3IQA A;  3MXS A;  3IHB A;  3C7V A;  2JN7 A;  4BD1 A;  2Z6C A;  2V8F A;  5CHJ A;  2EX6 A;  3HJI A;  3D4F A;  4LRY C;  1UWN X;  2OOL A;  3JVU A;  4QY5 A;  1CEG A;  4E3I A;  1FSY A;  5JYO A;  5M1A A;  1LSV A;  4K91 A;  3HLF A;  2J9O A;  4GDN A;  5HW3 A;  2WUQ A;  1Y28 A;  4B4Z A;  3GMW A;  3G2Z A;  5TBM A;  4DXB A;  3NIA A;  5EV0 A;  3VP4 A;  2LB9 A;  2ZL1 B;  3PTE A;  1F5M A;  5FQQ A;  2ZC4 B;  4Q0H A;  1TS7 A;  2CC1 A;  5DJT A;  3ZCZ A;  2J80 A;  2J9P A;  4NXF A;  1JWZ A;  3VOY A;  4EBP A;  5DKK A;  4OPZ A;  2VV8 A;  1SKO B;  5FI6 A;  3BY9 A;  4WZ5 C;  1T1A A;  4CLC B;  3FPW A;  3OC2 A;  3IXH A;  2ZQ8 A;  1FCO A;  3UMD A;  3TRC A;  1ERQ A;  3KO6 A;  4ZDX A;  1ODV A;  1LSW A;  3HUN A;  1Y4O A;  2EWW A;  3DW0 A;  4KQR A;  4DJ3 A;  1LL8 A;  1OME A;  2XRN A;  2FH5 A;  3V5M A;  4N1X A;  3E2L A;  1FSW A;  1T19 A;  4ZJ3 A;  1CI9 A;  2JKT M;  4QWO A;  4I3I A;  5EFW A;  4R38 A;  4C6Y A;  1ZHH B;  2HV1 A;  5FDH A;  4FOF A;  4DDS A;  1Z6F A;  1I2W A;  3DWK A;  1KDS A;  1V9Z A;  2PYP A;  5L07 A;  2ZQ9 A;  3Q82 A;  3RTY A;  4E3L A;  3MZF A;  1IKI A;  3QP4 A;  4ZBE A;  2L4R A;  1LSX A;  1GA0 A;  4KQD A;  1VQQ A;  2WK0 A;  2WGW A;  3MXQ A;  1QME A;  3O5Y A;  2V8C A;  2WAE A;  3ZQ5 A;  3HBR A;  1IYQ A;  3SZT A;  4LEN A;  2EA9 A;  3U4L P;  4ZJ2 A;  1ERO A;  3TSG A;  3UNW A;  1G28 A;  5HAR A;  5MC7 A;  1K6R A;  2IWC A;  4JGR A;  4KG5 A;  2PAV P;  4O01 A;  1XJ3 A;  1S0W A;  3AGF A;  5F69 A;  2WGV A;  2H0T A;  5FA7 A;  1J9M A;  2W0N A;  2VGJ A;  4HNB A;  4MLL A;  2J3T D;  4RA7 A;  4UHU A;  4OLG A;  2ZM2 A;  5FSR A;  5HZH A;  5HL1 A;  3ZG9 B;  3MKE A;  4E3O A;  1YLP A;  4JLF A;  5L2F A;  4L9G A;  3E0Y A;  3V3S A;  3GTC A;  4DJ2 A;  1E25 A;  5D3O A;  2V20 A;  3VV4 A;  4WMC A;  3V50 A;  3SS3 A;  4HY8 A;  4MBH A;  1VHM A;  3CAX A;  5F5Y A;  3MQ0 A;  2QZ6 A;  5HWW A;  1STZ A;  5GLD A;  4ZTK A;  2GNX A;  2FFY A;  4LV2 A;  4MCW A;  3LIB A;  1BUE A;  3IH9 A;  4WBG A;  3LR3 A;  3UPN A;  5L09 A;  4R0Q A;  3I7J A;  5DJU A;  2H28 A;  1XJ4 A;  1YT4 A;  3OOV A;  4BEN A;  1FIK A;  2B02 A;  1BZA A;  1KGE A;  2FZ0 A;  4GD6 A;  5J8X A;  3AGE A;  4XXR A;  4UAA A;  3BW6 A;  1IYS A;  4LGW A;  3RXW A;  3MKF A;  3CUE A;  4H6J A;  4KZ6 A;  1N9B A;  3HLD A;  4D60 A;  1X0O A;  5DF8 A;  3IS2 B;  4WZ5 A;  2FFF B;  1D06 A;  2XA7 S;  3NUL A;  4X55 A;  1UGU A;  1YMS A;  4G3W A;  3D9Y A;  2VJW A;  1H8Y A;  3PHY A;  3LI9 A;  1H8Z A;  3VOL A;  2HDR A;  3DTI A;  3T4L A;  3NOU C;  3LID A;  5HWV A;  1YQS A;  5EVI A;  3G34 A;  2HJE A;  2Z2M B;  3S7P A;  5DTK A;  1YLY A;  2OWH A;  1MBL A;  4XT2 A;  2J7V A;  2BG1 A;  4P0M A;  3Q1F A;  3HLW A;  4EUV A;  1YLT A;  3PAE A;  2Y2O A;  1P9R A;  4B9O A;  2ACG A;  1EWZ A;  2OWJ A;  4UA6 A;  5J3W A;  4BWI A;  3LEQ A;  4CLC E;  2OLU A;  1TDL A;  1S4R A;  3HLG A;  3GRJ A;  3UO9 A;  3MFX A;  4OQH A;  4UEY A;  3UME A;  1VET B;  1MWR A;  3LIA A;  4BBV A;  1HD8 A;  3C4O A;  4ETX A;  1MKM A;  2Y91 A;  4P87 A;  3MZD A;  3GDI A;  3SH8 A;  4HJ3 A;  1IOU A;  2Y2H A;  3B47 A;  2VZW A;  1NY0 A;  3F1O A;  5GLB A;  5HAQ A;  4EQ1 A;  3S7Q A;  2CMN A;  3UY6 A;  4ESP A;  3LYX A;  4QPR A;  1KVL A;  4XUX A;  3IWO A;  4GW9 A;  1DY6 A;  1HZO A;  2I9V A;  3OPR A;  4KZ7 A;  4S2K A;  5E2E A;  5CX7 A;  4PMA A;  3LEZ A;  4JF5 A;  2ZQA A;  2Y2G A;  3ZHH A;  2KLI A;  5FAQ A;  4PKY A;  1IKG A;  4GLQ A;  5L10 A;  4OOL A;  5CER A;  2WAD A;  4ZRR A;  5HL6 A;  3CI6 A;  4ZJ1 A;  5HDD A;  2A24 A;  5GHZ A;  3L9K A;  5E2H A;  2XFT A;  2P08 A;  1IEL A;  3T4K A;  1E3U A;  4B88 A;  4BLM A;  2Y2L A;  4GS9 B;  5HSQ A;  1DJB A;  2DRW A;  3ZNT A;  3NCK A;  3LIF A;  1W5D A;  1YAX A;  2ZOH A;  3DTK A;  2PBY A;  2ZJ9 A;  4DE3 A;  3CIT A;  1ERM A;  5GHX A;  3E2K A;  3WS5 A;  3FC7 A;  4OON A;  4NKP A;  1ESU A;  2PR6 A;  3Q81 A;  3T4J A;  2P7J A;  5CHU A;  3C30 A;  2WKQ A;  2L0W A;  3TJZ C;  2XGN A;  3UE3 A;  5F82 A;  3NOT C;  3IX8 A;  4S2I A;  4HP4 A;  2QJ5 A;  3CMZ A;  4QD4 A;  3KSH A;  1FQG A;  4JGQ A;  3UB7 A;  4IHQ A;  4I3J A;  3JPU A;  5EPH A;  5A92 A;  4YWZ A;  2L1M A;  1S67 L;  2P74 A;  1PNE A;  4NXE A;  2PYR A;  2Y2K A;  3HLB A;  3TW8 A;  4Y5F A;  4Y0T A;  1JWP A;  2O0Y A;  2M1C A;  3NOP C;  2OV5 A;  4IBX A;  3QP2 A;  3NDG A;  3MQQ A;  1F2K A;  4PPR A;  2ZMV A;  5KMW A;  4UQI M;  1LLB A;  3BYD A;  4ME4 A;  4LCL A;  3P09 A;  2WKR A;  1L0G A;  2IWB A;  5FQ9 A;  4X25 A;  3BM6 A;  4WEL A;  1FR6 A;  3SS4 A;  4R4S A;  1PYY A;  1IFQ A;  4HIA A;  4IVI A;  2XRO A;  4LPZ A;  1K38 A;  3PBQ A;  4WYY A;  1PIO A;  5IU1 A;  3BQ8 A;  2VGK A;  4X69 A;  1JTD A;  4I39 A;  5FI2 A;  4WF0 A;  4GDB A;  2ZQC A;  3IWQ A;  3QNB A;  4EEU A;  2VA0 A;  4E6X A;  3G32 A;  1I5Q A;  3Q7V B;  3GQZ A;  4LFU A;  5HX9 A;  1ES4 A;  3V3R A;  4FSF A;  3SOI A;  2X01 A;  3T4S A;  2DMW A;  4EEP A;  2JKG A;  5GLC A;  3NI9 A;  4FD8 A;  4O7D A;  5TGF A;  3DTM A;  1W79 A;  3O86 A;  4A5R A;  3UB8 A;  3MS6 A;  1T18 A;  1L0D A;  4WEJ A;  5HPI A;  1DJC A;  1EI5 A;  4MEZ A;  3DWZ A;  1XXM A;  3FV7 A;  1TF1 A;  3JYI A;  1W8Y A;  1XFQ A;  1PZP A;  5BOH A;  1JNU A;  4DMZ A;  2AVX A;  2Y2M A;  4Q8I A;  3CUE C;  5AQ7 A;  1RGY A;  3OBF A;  2W3E A;  4D2O A;  1NLY A;  3BFF A;  5F68 A;  2Y79 A;  3ZG7 B;  2Y4A A;  3ICY A;  4OQG A;  2EXB A;  3FYZ A;  3C8C A;  2C6W B;  1SHV A;  4P6B A;  1Y54 A;  3D72 A;  2H5S A;  3T50 A;  2W3G A;  1K56 A;  4E3N A;  3BFD A;  3BFG A;  3ISG A;  2XK1 A;  5M18 A;  2WAF A;  3RH8 B;  1GSX A;  1ZG6 A;  1CK3 A;  3NC8 A;  5E2F A;  3PBN A;  4DDY A;  5EVI C;  1YLW A;  1SZV A;  4HHD A;  4HH3 A;  4FTX A;  2X71 A;  3MFD A;  1PWC A;  4MNR A;  1YSQ A;  4OOM A;  4HP9 A;  1IEM A;  4PM9 A;  4QB8 A;  4WN5 A;  5DVA A;  4GOG A;  3IXD A;  1BLS A;  4FH2 A;  5DFX A;  4I38 A;  2ZC6 B;  4HQA A;  1IYO A;  3KX0 X;  5F1F A;  4OKP A;  3KSG A;  3Q07 A;  1OT6 A;  3NEC A;  2E8J A;  4HH2 A;  2KOI A;  1L2S A;  2KX6 A;  5EVE A;  1A0K A;  5EM1 A;  5AVF A;  4N9L A;  4KQO A;  5KSH A;  3W4O A;  3IWI A;  4R23 A;  3MXR A;  4R3J A;  1MC0 A;  4CJN A;  1K25 A;  2Y2I A;  3DTE A;  1TS0 A;  2R9X A;  2VV7 A;  1K56 D;  1HLU P;  1O07 A;  1N9N A;  4WEK A;  4HEF A;  2I72 A;  4MDZ A;  4NG2 A;  3M6B A;  4MN5 A;  1MWU A;  1P97 A;  1ZKJ A;  4DE1 A;  4JKT A;  4S2P A;  3H7W A;  5DF7 A;  5IT5 A;  1ACF A;  5CGS A;  5G18 A;  4LCM A;  1T1C A;  4Q0I A;  5KZH A;  3T4O A;  4GN2 A;  3GVB A;  5G4Y A;  3P98 A;  2HP9 A;  1L3L A;  3RFB A;  4K0W A;  2GDN A;  2XD1 A;  5GLA A;  5FAS A;  3O88 A;  2B95 A;  2WGW B;  1PZO A;  4OOY A;  3IS2 A;  1KE0 A;  2GJ3 A;  1LL5 A;  3F1P A;  3C4P A;  1LI0 A;  4QY6 A;  4WM9 A;  1SDE A;  2C5W B;  1DJA A;  5EEC A;  3WRT A;  4E3J A;  4QJG A;  3IBR A;  1GCE A;  2J3W A;  1OTI A;  3LR4 A;  4XUZ A;  5FEG A;  2JC7 A;  1FIL A;  3B33 A;  3WWX A;  3LCE A;  2K31 A;  1XKZ A;  3DAV A;  2XF3 A;  4RX2 A;  3M6H A;  4DF6 A;  4DN0 A;  2A3U A;  4NK3 A;  2HJ9 C;  3UE6 A;  1D1J A;  1L0E A;  2A2L A;  4OPQ A;  5CTM A;  3FWL A;  3GV9 A;  2EXA A;  2W3F A;  3PBS A;  3IX3 A;  4BJP A;  4RYE A;  3SW1 A;  3HRE A;  3IXB A;  4QHC A;  5LBR A;  5HDC A;  3UPO A;  3FG8 A;  3OLO A;  3R7W A;  4WMC D;  1OJG A;  4GNU A;  4Y0O A;  4KZB A;  2W1T B;  5HFO A;  3O87 A;  4GHI A;  3CLO A;  4GCZ A;  5L8M A;  3A0R A;  4M3K A;  5AQB A;  2M7U A;  1YMX A;  2VKS A;  1K4F A;  5JYP A;  2XEP A;  1XA7 A;  4UQI S;  2HDQ A;  1PI5 A;  1TS6 A;  4OP5 A;  4E3M A;  3UN7 A;  4PM8 A;  2WGI A;  2HZ5 A;  4QU3 A;  5HD5 A;  1JTG A;  3H9W A;  5A8B A;  4GB7 A;  1NJ4 A;  5HWT A;  5A91 A;  4BL3 A;  4Q0J A;  3UE1 A;  5CED A;  3QNC A;  1M40 A;  4RQ9 A;  3E4O A;  2XLN A;  1AWI A;  3NY4 A;  5HD3 A;  4HBT A;  3GEC A;  3N4I A;  5KIZ A;  5EVL A;  2O9A A;  3E4P A;  4H6J B;  5FQJ A;  4RVA A;  3F1N A;  3R4K A;  1MKI A;  1O7E A;  3EEA A;  2EX2 A;  2Y2N A;  3QP5 A;  2A49 A;  2M7V A;  1UWP X;  4P6Z M;  3OCN A;  3NJA A;  2G2W A;  2VGL M;  3E98 A;  1GSW A;  4S2O A;  1S6R A;  4F94 A;  2HF6 A;  2OLV A;  2JHE A;  1ONH A;  3VOZ A;  3QP8 A;  2XFS A;  3UB6 A;  3RXX A;  3ITB A;  3HUO A;  4IVK A;  5CHM A;  4MMN A;  3VP3 A;  1RCJ A;  4CLC C;  1RP5 A;  3CZD A;  1W63 M;  5EVI D;  1E4D A;  4P85 A;  4JBF A;  5EVI B;  1G6O A;  4H8R A;  4WL9 A;  4R3A A;  4JXS A;  3HLE A;  3IF6 A;  2EX8 A;  3VMA A;  1N9L A;  4KQQ A;  3V67 A;  4EBL A;  2ZC7 A;  1G68 A;  4WLA A;  5G4Z A;  2VK3 A;  3G35 A;  4EV4 A;  4U0T A;  2X02 A;  4IUK A;  1WYC A;  2K7S A;  1W8Q A;  1S4S A;  3UB9 A;  4JXG A;  2NUP C;  4OPR A;  2Y59 A;  3PBO A;  3BEB A;  3WS1 A;  2H10 A;  5GHY A;  3BLS A;  4NET A;  2EFU A;  2ZD8 A;  4IUH A;  4OH0 A;  3LR0 A;  1OTE A;  2QHK A;  1OTD A;  5FAT A;  4GD8 A;  4E04 A;  1VEU A;  4F3L B;  3IF5 A;  1GSV A;  4KG6 A;  5EOE A;  5EM0 A;  1U60 A;  1Z09 A;  2OSU A;  3PAG A;  2UV0 E;  1NYM A;  4FUW A;  2Y2P A;  3FZC A;  1KOU A;  1PI4 A;  1BSG A;  3VFH A;  3EQU A;  3ZG8 B;  4CQH A;  1KGG A;  3QP6 A;  5CGW A;  3F1O B;  2V0W A;  2ZQ7 A;  2XQZ A;  4U0X A;  4PAU A;  1W7F A;  2WYX A;  1I2S A;  4Y17 A;  5E2G A;  3A3I A;  4KEN B;  4OQ0 A;  1BLH A;  1OPX A;  2P9V A;  3ZGA B;  4JGO A;  4I3A A;  5CGX A;  1PFL A;  3CPT B;  2JKR M;  3W4Q A;  4LV1 A;  1VB6 A;  3D3O A;  5DFY A;  1F9I A;  5HPF A;  3TG9 A;  1L0F A;  4R3B A;  2YKF A;  5CTN A;  3HUM A;  2IA2 A;  3OPH A;  2A24 B;  1K6S A;  4EUZ A;  1E3U D;  4N92 A;  1OT9 A;  3HVF A;  2PT7 A;  2G7U A;  1TD5 A;  2V1B A;  1KDW A;  3LR5 A;  2Y8H A;  1ES3 A;  5FI7 A;  2R9W A;  3DBA A;  1ZG4 A;  4JGP A;  1S1Y A;  3G30 A;  3KSI A;  4AFI A;  1CQA A;  4JF6 A;  4KG2 A;  2WZZ A;  2W1R A;  3MF0 A;  1MZU A;  1XFN A;  3PBT A;  3WRZ A;  1XGI A;  4ETZ A;  1G6A A;  1HVB A;  3BQA A;  4Y3I A;  5FEF A;  1P0Z A;  4BBT A;  1WE4 A;  3S4X A;  3C2W A;  3WS0 A;  1TEM A;  4UA9 A;  2ZL1 A;  3B42 A;  3EGX C;  3VE4 A;  3M2J A;  3FKV A;  3UDX A;  3S7N A;  5J7E A;  1N4O A;  4B93 A;  3IT9 A;  3MZE A;  4KZ8 A;  1T1B A;  3S7O A;  3VP1 A;  1H3Q A;  2V0U A;  2XR0 A;  1AXB A;  2HGV A;  5HAP A;  4Y0U A;  1SKO A;  2D01 A;  2Z6D A;  1BTL A;  1XA1 A;  2PR5 A;  4CLC A;  1DP9 A;  4OLD A;  2QKP A;  1M6K A;  1GHP A;  5FL3 A;  4C75 A;  4KZA A;  1K4E A;  2OAQ 1;  3GR2 A;  2H0Y A;  1IYP A;  4JF4 A;  1DRM A;  1H8M A;  4MBF A;  3VP2 A;  2Y2J A;  3CG5 A;  1NZU A;  1Q2P A;  2JBF A;  4PKY G;  4X1L A;  5EOO A;  2Q9M A;  4R6L A;  3WS2 A;  5DF9 A;  5A93 A;  5IHV A;  1DP8 A;  4ARZ B;  2XD5 A;  4N9K A;  5AQA A;  4OVD A;  3IXG A;  2EX9 A;  2WZX A;  3FKW A;  3T4T A;  1K57 A;  2PHY A;  1NXY A;  3N8R A;  1SDN A;  3AGD A;  3H82 B;  3LFV A;  3EWK A;  4KZ4 A;  5FQK A;  2V2F F;  3C38 A;  1KE4 A;  3VSL A;  4WZ4 A;  5DTS A;  1K55 A;  1CI8 A;  4EU0 A;  4S2J A;  4LV3 A;  4E6W A;  3TOI A;  3T1S A;  1GA9 A;  4CLC D;  3N8S A;  1ESI A;  5KSC A;  2VV6 A;  1MPL A;  3T1R A;  1K54 A;  2JKF A;  3A3F A;  3BEC A;  2QMI A;  4C3Q A;  1BLP A;  4MN6 A;  2RCX A;  5F1G A;  3T12 B;  1PWG A;  1MWS A;  1OJ5 A;  2RL3 A;  3BFE A;  4JXW A;  1XJ2 A;  5TBM B;  4DE0 A;  5CEC A;  3A3E A;  3ITA A;  5J4E A;  3LI8 A;  4IJG A;  4HBU A;  5CRF A;  3A0S A;  3G4P A;  1YLZ A;  3PBR A;  4KUO A;  3MQO A;  4P6Z S;  5EUA A;  2VGL S;  1OTA A;  1PWD A;  3C7U A;  2W3D A;  3BY8 A;  3SS5 A;  5K5B A;  1NRF A;  1QMF A;  3LIC A;  4BL2 A;  3HL9 A;  4G3K A;  5CEB A;  1WYB A;  1DP6 A;  1ES2 A;  3HCY A;  4S2N A;  4X6T A;  2WKI A;  3U2A A;  4Y2F A;  3HJK A;  4S2M A;  3N7W A;  1ZTU A;  3G2Y A;  3UPP A;  2ZMA A;  2IWD A;  2V1A A;  4BMW A;  1NYY A;  3LIE A;  3BJN A;  1YLJ A;  4KZ3 A;  1TDG A;  4EW7 A;  1K0K A;  1KVM A;  1BYW A;  1ZC2 A;  5HAI A;  3EGD C;  4KUK A;  3LUQ A;  2NUT C;  1XJ6 A;  4L0L A;  4U3T A;  4OP8 A;  3IF6 C;  2UWX A;  5E43 A;  1TVF A;  2YKH A;  4ID4 A;  1LHY A;  4NXB A;  3K3C A;  3EEH A;  5F83 A;  3TE8 A;  2J8Y A;  3KYE A;  3OZH A;  3PR6 A;  4BQM A;  2W27 A;  2P04 A;  4IED A;  3PYP A;  4JXV A;  4LRZ E;  4Z1W A;  1SCW A;  1XPB A;  2BLS A;  1N9O A;  2W1T A;  2O99 A;  4RX3 A;  1GHM A;  2HDS A;  5F6A A;  1ONG A;  2O9C A;  2OAP 1;  2B5R A;  1J3W A;  3A3J A;  4GKU A;  3SH7 A;  3KYZ A;  5HDS A;  3NDE A;  2E8I A;  4Y7P A;  3FPV A;  1WA9 A;  4DKI A;  3W4P A;  2Z2L B;  2KDK A;  2QPN A;  5FAP A;  2ZM8 A;  4WUJ A;  3N8L A;  4B4X A;  4EXO A;  3NBL A;  3H7W B;  1JWV A;  2VEA A;  3VP0 A;  3ZNY A;  3ZVW A;  3GSG A;  3KYQ A;  2INW A;  3SH9 A;  4ZAM A;  4GJ4 A;  3MR0 A;  2PD8 A;  3T4Q A;  2HP6 A;  4BBU A;  4HJ4 A;  1NWZ A;  3BFC A;  1PRQ A;  1YPR A;  4LV0 A;  1SKF A;  3MMH A;  1CF0 A;  3F1P B;  4JPM A;  2PD7 A;  4YFM A;  4K08 A;  1NRJ A;  2BTF P;  1S1Z A;  3K2N A;  2HPB A;  2XH9 A;  4EWF A;  1VET A;  3UE0 A;  3IHA A;  3O3V A;  3MBZ A;  3ZG5 A;  2QYB A;  3IH8 A;  2V1Z A;  4G3V A;  2BAS A;  4II7 A;  4KZ5 A;  2O9B A;  5C5K A;  1NZO A;  2MJ6 A;  3ZVT A;  2DNS A;  2HDU A;  1FCN A;  1KE3 A;  1MY8 A;  2G2U A;  3EOI A;  2K2N A;  2WKP A;  1CEF A;  4L9E A;  3T1Q B;  1C3B A;  3WS4 A;  2XDM A;  3QHY A;  2ZM0 A;  2QWS A;  4PM7 A;  5CXW A;  3VFF A;  4FCF A;  3T1X A;  3MJQ A;  4O0P A;  3R7W B;  4E3K A;  4GZB A;  2ZMF A;  1OTB A;  3P01 A;  1FR1 A;  4HES A;  1VM1 A;  5FAO A;  3BRM A;  3ZG0 A;  4GHI B;  4Y13 A;  2D02 A;  1FCM A;  1GHI A;  2JKR I;  4N1H A;  5IS1 A;  3LY4 A;  3VSK A;  4X1M A;  4O8G A;  4YOF A;  4KZ9 A;  4F3L A;  3IBJ A;  1YSP A; 
#chains in the Genus database with same CATH homology
 4WBG A;  4E3N A;  3BFD A;  3BFG A;  3Q7Z A;  1KDW A;  3ISG A;  1ES3 A;  1RGZ A;  2JE5 A;  2XK1 A;  5FI7 A;  5M18 A;  3S22 A;  3BLM A;  2WAF A;  2R9W A;  4MBK A;  1ZG6 A;  1CK3 A;  4EBN A;  3UPN A;  3NC8 A;  5E2F A;  1ZG4 A;  3PBN A;  2ZLY A;  4DDY A;  3G30 A;  5EVI C;  4S2L A;  4R0Q A;  1YLW A;  3I7J A;  4JF6 A;  4KG2 A;  2WZZ A;  1YT4 A;  3EQV A;  3ZDJ A;  1Q2Q A;  3G31 A;  4BEN A;  3PBT A;  3WRZ A;  2X71 A;  3MFD A;  1XGI A;  1G6A A;  1HVB A;  1PWC A;  4MNR A;  1BZA A;  3M2K A;  4OOM A;  3UDI A;  1IEM A;  1KGE A;  2PU4 A;  4GD6 A;  4PM9 A;  1WE4 A;  4QB8 A;  5J8X A;  3AGE A;  4XXR A;  1YM1 A;  4GOG A;  2ZC5 B;  4UAA A;  3IXD A;  5DVA A;  5TFQ A;  3S4X A;  4X56 A;  1BLS A;  3WS0 A;  4FH2 A;  1TEM A;  1IYS A;  3RXW A;  3MKF A;  4KZ6 A;  4UA9 A;  1N9B A;  2ZC6 B;  3HLD A;  3B3X A;  1IYO A;  1K57 C;  5DF8 A;  5F1F A;  3M2J A;  3FKV A;  3UDX A;  2Y2Q A;  4OKP A;  3OPP A;  3Q07 A;  1N4O A;  3IT9 A;  3MZE A;  4KZ8 A;  1L2S A;  3VP1 A;  4WZ5 A;  2FFF B;  2PU2 A;  4N9L A;  2XR0 A;  4KQO A;  1AXB A;  3W4O A;  3IWI A;  5KSH A;  4R23 A;  1H5X A;  4X55 A;  5U47 A;  3MXR A;  5HAP A;  1YMS A;  4R3J A;  4Y0U A;  4PM6 A;  1H8Y A;  2ZC3 B;  4CJN A;  1K25 A;  1BTL A;  1XA1 A;  1K55 C;  4OPY A;  2Y2I A;  4Z9Q A;  1H8Z A;  2JCH A;  4R4R A;  4OLD A;  1M6K A;  4K0X A;  1GHP A;  2R9X A;  2HDR A;  2ZQD A;  4C75 A;  4KZA A;  1K4E A;  1K56 D;  3GR2 A;  2H0Y A;  1O07 A;  2WKE A;  3N6I A;  1IYP A;  4JF4 A;  1YQS A;  4MBF A;  5EVI A;  3LO7 A;  1K54 C;  1XP4 A;  4WEK A;  2Y2J A;  2DCF A;  3CG5 A;  4HEF A;  1NZU A;  3VP2 A;  2I72 A;  3UDF A;  1MXO A;  3G34 A;  3M6B A;  2Z2M B;  3IF6 B;  1MWU A;  1Q2P A;  2JBF A;  1LI9 A;  5EOO A;  2Q9M A;  1ES5 A;  3WS2 A;  1ZKJ A;  4DE1 A;  4JKT A;  5DTK A;  1XGJ A;  5DF9 A;  5A93 A;  1YLY A;  3OCL A;  4S2P A;  1MBL A;  5DF7 A;  2J7V A;  2BG1 A;  5IHV A;  1BUL A;  4IBR A;  5CGS A;  4P0M A;  5G18 A;  1XX2 A;  2XD5 A;  3Q1F A;  4N9K A;  5AQA A;  4LCM A;  3HLW A;  5KZH A;  4OVD A;  3IXG A;  1YLT A;  3PAE A;  2EX9 A;  2Y2O A;  4GN2 A;  3GVB A;  4OQI A;  3P98 A;  2WZX A;  2HP9 A;  3FKW A;  4EQI A;  1LL9 A;  1K57 A;  4K0W A;  2GDN A;  2XD1 A;  4CPK A;  1MWT A;  1NXY A;  3N8R A;  1SDN A;  5GLA A;  5FAS A;  3O88 A;  1EWZ A;  1PW1 A;  3AGD A;  3Q7V A;  4UA6 A;  4KZ4 A;  5FQK A;  2WGW B;  4X68 A;  1PW8 A;  1PZO A;  2OLU A;  2EFX A;  4OOY A;  1TDL A;  5TR7 A;  1KE0 A;  2V2F F;  1KE4 A;  3HLG A;  5DTT A;  3GRJ A;  1LL5 A;  3VSL A;  3UO9 A;  4OQH A;  2Y55 A;  4WZ4 A;  3CJM A;  3C4P A;  1LI0 A;  4QY6 A;  5EE8 A;  5DTS A;  1K55 A;  4WM9 A;  1SDE A;  1CI8 A;  2C5W B;  1DJA A;  4LV3 A;  4S2J A;  5EEC A;  4E6W A;  1MWR A;  3LY3 A;  3TOI A;  1HD8 A;  3WRT A;  4E3J A;  3C4O A;  4QJG A;  1GA9 A;  3N8S A;  4S2N C;  1ESI A;  2Y91 A;  1GCE A;  5FQM A;  5KSC A;  4P87 A;  4XUZ A;  1MPL A;  2JC7 A;  4DXC A;  2HP5 A;  3MZD A;  3WWX A;  2Q9N A;  3LCE A;  3SH8 A;  2WKH A;  1K54 A;  2Y2H A;  1XKZ A;  3ZFZ A;  3A3F A;  3BEC A;  2XF3 A;  4RX2 A;  2QMI A;  4C3Q A;  3M6H A;  4DF6 A;  1NY0 A;  5HAQ A;  5GLB A;  1BLP A;  2A3U A;  4NK3 A;  2RCX A;  5F1G A;  3UY6 A;  1L0E A;  1KVL A;  1PWG A;  4OPQ A;  3IWO A;  4XUX A;  4BD0 A;  1MWS A;  4DE2 A;  5CTM A;  1DY6 A;  2RL3 A;  1HZO A;  3OPR A;  3BFE A;  4JXW A;  3FWL A;  3GV9 A;  4X53 A;  4KZ7 A;  4S2K A;  5E2E A;  2EXA A;  3PBS A;  3V39 A;  4DE0 A;  4PMA A;  4BJP A;  3LEZ A;  5GL9 A;  4RYE A;  4JF5 A;  2ZQA A;  2Y2G A;  5CEC A;  2P9V B;  5I94 A;  3ZHH A;  3A3E A;  3HRE A;  3ITA A;  3IXB A;  5FAQ A;  1IKG A;  1BT5 A;  3A3D A;  4UA7 A;  4QHC A;  4HBU A;  5CRF A;  1KGF A;  3G4P A;  5M19 A;  1HTZ A;  1YLZ A;  3UPO A;  3PBR A;  4OOL A;  5CER A;  5FQI A;  4WMC D;  4GNU A;  2WAD A;  5EUA A;  3S1Y A;  1ALQ A;  4Y0O A;  4KZB A;  4PM5 A;  1PWD A;  1BLC A;  3OPL A;  3C7U A;  3RJU A;  3SS5 A;  5HFO A;  4R1G A;  3O87 A;  4YIN A;  3HLC A;  1NRF A;  4M3K A;  5AQB A;  1QMF A;  4DRT A;  5A90 A;  4BL2 A;  3HL9 A;  1YMX A;  3C5A A;  1K4F A;  5CEB A;  5JYP A;  4FH4 A;  4ZJ1 A;  1WYB A;  1ES2 A;  2XEP A;  1XA7 A;  5GHZ A;  4S2N A;  3W8K A;  4X6T A;  2WKI A;  5E2H A;  1JVJ A;  2HDQ A;  1FOF A;  2XFT A;  4S2M A;  5AQ9 A;  1IEL A;  3IQA A;  3MXS A;  1E3U A;  3G2Y A;  3N7W A;  2ZMA A;  3IHB A;  3UPP A;  1PI5 A;  2IWD A;  3C7V A;  4B88 A;  4BD1 A;  4BLM A;  4OP5 A;  5CHJ A;  4E3M A;  1NYY A;  2EX6 A;  2Y2L A;  3UN7 A;  1YLJ A;  3D4F A;  1TDG A;  4KZ3 A;  4PM8 A;  2WGI A;  1DJB A;  1ZC2 A;  1KVM A;  2DRW A;  4QU3 A;  5HAI A;  3ZNT A;  3NCK A;  4QY5 A;  1W5D A;  1CEG A;  4E3I A;  1JTG A;  1FSY A;  2PBY A;  2ZJ9 A;  4L0L A;  4U3T A;  4DE3 A;  5JYO A;  1ERM A;  4OP8 A;  3IF6 C;  5M1A A;  4GB7 A;  5GHX A;  3E2K A;  3WS5 A;  1NJ4 A;  5A91 A;  2UWX A;  4BL3 A;  5E43 A;  3UE1 A;  4K91 A;  4OON A;  3HLF A;  5CED A;  1TVF A;  4ID4 A;  1LHY A;  3QNC A;  1M40 A;  2J9O A;  4GDN A;  1ESU A;  2XLN A;  3NY4 A;  3Q81 A;  5HW3 A;  2WUQ A;  4HBT A;  5CHU A;  4B4Z A;  3GMW A;  3N4I A;  3G2Z A;  4DXB A;  5F83 A;  5EVL A;  2XGN A;  3UE3 A;  3NIA A;  5F82 A;  2J8Y A;  3VP4 A;  5FQJ A;  3PTE A;  4RVA A;  3OZH A;  4S2I A;  3CMZ A;  5FQQ A;  2ZC4 B;  4QD4 A;  4BQM A;  1MKI A;  1O7E A;  1FQG A;  4IED A;  4E3L A;  2CC1 A;  2EX2 A;  4JXV A;  2Y2N A;  3ZCZ A;  5EPH A;  2A49 A;  5A92 A;  2J9P A;  3OCN A;  2G2W A;  2P74 A;  1JWZ A;  1SCW A;  1XPB A;  3VOY A;  2BLS A;  4S2O A;  4EBP A;  1S6R A;  4F94 A;  4RX3 A;  1GHM A;  2Y2K A;  2HDS A;  3HLB A;  4OPZ A;  5FI6 A;  1ONG A;  4Y0T A;  2OLV A;  2B5R A;  1ONH A;  3A3J A;  4GKU A;  4WZ5 C;  3VOZ A;  1JWP A;  3OC2 A;  3IXH A;  2ZQ8 A;  1FCO A;  2XFS A;  3SH7 A;  3RXX A;  2OV5 A;  1ERQ A;  3ITB A;  3HUO A;  4IBX A;  4IVK A;  5CHM A;  4ZDX A;  3NDG A;  3VP3 A;  3NDE A;  3HUN A;  1RCJ A;  2E8I A;  1RP5 A;  4PPR A;  3CZD A;  4Y7P A;  5KMW A;  1LLB A;  3BYD A;  5EVI D;  1E4D A;  3DW0 A;  4LCL A;  4P85 A;  4JBF A;  5EVI B;  3P09 A;  2IWB A;  4H8R A;  4KQR A;  1L0G A;  4DKI A;  3W4P A;  1OME A;  2Z2L B;  5FQ9 A;  3V5M A;  2QPN A;  4N1X A;  3E2L A;  5FAP A;  4JXS A;  1FSW A;  2ZM8 A;  4ZJ3 A;  3BM6 A;  3HLE A;  3IF6 A;  4WEL A;  2EX8 A;  1FR6 A;  1CI9 A;  3SS4 A;  3N8L A;  3VMA A;  4B4X A;  4C6Y A;  4R4S A;  4KQQ A;  3NBL A;  4EBL A;  1PYY A;  2ZC7 A;  1G68 A;  5FDH A;  1JWV A;  4DDS A;  4IVI A;  1K38 A;  3VP0 A;  3G35 A;  3ZNY A;  3PBQ A;  4U0T A;  2X02 A;  3ZVW A;  1WYC A;  3GSG A;  4WYY A;  4EV4 A;  1Z6F A;  1PIO A;  1I2W A;  3DWK A;  3SH9 A;  4ZAM A;  1W8Q A;  2VGK A;  1KDS A;  4X69 A;  1JTD A;  4JXG A;  5FI2 A;  2ZQ9 A;  4GDB A;  2HP6 A;  4OPR A;  2Y59 A;  2ZQC A;  3BEB A;  3IWQ A;  3PBO A;  3MZF A;  1IKI A;  3Q82 A;  3QNB A;  3WS1 A;  3G32 A;  4ZBE A;  2H10 A;  4E6X A;  1I5Q A;  3BLS A;  3Q7V B;  5GHY A;  4NET A;  1GA0 A;  2EFU A;  3BFC A;  1VQQ A;  3GQZ A;  2WK0 A;  5HX9 A;  1ES4 A;  2WGW A;  2ZD8 A;  4OH0 A;  1QME A;  4LV0 A;  1SKF A;  3V3R A;  4FSF A;  4JPM A;  3SOI A;  2WAE A;  2X01 A;  5FAT A;  4GD8 A;  4YFM A;  3HBR A;  1IYQ A;  2HPB A;  2XH9 A;  4LEN A;  3IF5 A;  4KG6 A;  5GLC A;  5EOE A;  4EWF A;  3NI9 A;  4FD8 A;  4ZJ2 A;  3UE0 A;  4O7D A;  1ERO A;  3IHA A;  3O3V A;  3DTM A;  5TGF A;  1U60 A;  3TSG A;  2OSU A;  3MBZ A;  1W79 A;  3PAG A;  3UNW A;  3ZG5 A;  1NYM A;  3O86 A;  2Y2P A;  3FZC A;  5HAR A;  3IH8 A;  4A5R A;  1K6R A;  1PI4 A;  2IWC A;  1BSG A;  4KG5 A;  2V1Z A;  3VFH A;  1L0D A;  3EQU A;  3ZG8 B;  1KGG A;  4WEJ A;  5CGW A;  4KZ5 A;  1DJC A;  1S0W A;  3AGF A;  1EI5 A;  1NZO A;  2ZQ7 A;  3ZVT A;  4MEZ A;  2XQZ A;  2WGV A;  4U0X A;  2DNS A;  2H0T A;  2HDU A;  5FA7 A;  1J9M A;  1W7F A;  2WYX A;  1I2S A;  1FCN A;  1XXM A;  3DWZ A;  3FV7 A;  3JYI A;  1KE3 A;  1W8Y A;  1MY8 A;  2G2U A;  2VGJ A;  4MLL A;  5E2G A;  1CEF A;  4RA7 A;  1PZP A;  3A3I A;  4KEN B;  1C3B A;  3WS4 A;  2XDM A;  4UHU A;  4OQ0 A;  3QHY A;  5BOH A;  4OLG A;  1BLH A;  2ZM2 A;  2ZM0 A;  5FSR A;  5HL1 A;  2P9V A;  3ZG9 B;  4PM7 A;  3ZGA B;  3MKE A;  2Y2M A;  5CGX A;  5CXW A;  3VFF A;  4Q8I A;  4E3O A;  1YLP A;  4FCF A;  4JLF A;  5L2F A;  3V3S A;  3GTC A;  3W4Q A;  1E25 A;  5D3O A;  4E3K A;  4GZB A;  4LV1 A;  5AQ7 A;  1RGY A;  2V20 A;  4WMC A;  3V50 A;  4D2O A;  1FR1 A;  3BFF A;  4HES A;  1VM1 A;  3TG9 A;  5FAO A;  3SS3 A;  3ZG7 B;  1L0F A;  3BRM A;  3ZG0 A;  2Y4A A;  4MBH A;  4OQG A;  4R3B A;  2QZ6 A;  1FCM A;  5CTN A;  2EXB A;  1GHI A;  4N1H A;  3FYZ A;  3HUM A;  5GLD A;  2C6W B;  3LY4 A;  4ZTK A;  3VSK A;  1SHV A;  4P6B A;  2FFY A;  3OPH A;  4LV2 A;  1Y54 A;  1K6S A;  4EUZ A;  4KZ9 A;  2H5S A;  1E3U D;  4N92 A;  1K56 A;  1BUE A;  3HVF A;  3IH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...