3PYPA

Photoactive yellow protein, cryotrapped early light cycle intermediate
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Structure at 0.85 A resolution of an early protein photocycle intermediate.
pubmed doi rcsb
molecule tags Photoreceptor
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1998-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3pypA00
1S67L 5HDCA 4PKYA 2PDRA 2M1CA 2PD8A 1EW0A 4HJ6A 3A0VA 3ZQ5A 3ICYA 3NOTC 2R78A 3VE4A 5F69A 4I3IA 3D72A 3CAXA 5HZHA 2QKPA 3K3CA 3PHYA 4DJ3A 2PR6A 3E4QA 2QJ5A 4LPZA 4R6LA 5AVEA 5EFWA 2VV7A 5DJTA 3HJIA 3EEHA 1OTBA 4HJ3A 4GS9A 1XJ3A 3MJQA 5DKKA 1GSWA 2VLGA 2V1BA 1KOUA 4LRZE 4EEPA 1S66L 4F3LB 4HNBA 1F9IA 2OOLA 4L9EA 5A8BA 3E4OA 1XJ6A 5HD5A 2VV6A 3H82B 4HHDA 3A0SA 2JHEA 4I3JA 1LL8A 4EESA 1UWNX 1XJ4A 2CMNA 5DKLA 1NWZA 4H6JA 2QWSA 1S4RA 2ZOHA 5HWVA 4LLOB 1UWPX 1T1CA 3HJKA 2QJ7A 3BY8A 1OTIA 1OTEA 2Z6DA 2D01A 2QHKA 3UE6A 3LIAA 5TBMA 2D02A 4L9GA 2GJ3A 3B33A 5IS1A 5IU1A 4GS9B 4BBUA 4BBTA 5DJUA 2BASA 2J80A 5AVFA 4EXOA 1OJ5A 1XFNA 4NXFA 1F98A 2A24A 1P97A 3SW1A 1GSVA 2HV1A 3MR0A 4EEUA 4HI4A 4MN6A 4LRYC 3H9WA 3UMEA 2V9AA 4HOIA 4H6JB 1BYWA 2PD7A 5F68A 3RH8B 5J7EA 3CLOA 3K3DA 4HY8A 4NXBA 1T1BA 5TBMB 4I38A 2VV8A 4EQ1A 3C2WA 2W0NA 4JGQA 5I5LA 1LSVA 1DP9A 2H28A 4NXEA 5HWWA 3RTYA 3EWKA 2A24B 1LSWA 3MQQA 1N9NA 3LI9A 4HH2A 4HP9A 3LICA 1TS7A 3F1PA 3LIEA 1DRMA 2V1AA 3F1NA 5HWTA 3BWLA 3UB6A 4WF0A 2L4RA 5J4EA 2VEAA 2YKFA 3UB9A 4KUOA 3FG8A 1TS6A 4YWZA 2OWHA 1DP6A 2INWA 1S1ZA 5G4YA 1OJGA 3MFXA 1WA9A 2Z6CA 1OT9A 4JGOA 2L1MA 3CWFA 1T19A 4I39A 1N9OA 1T18A 3VOLA 1UGUA 1N9LA 5HDDA 4WLAA 1VB6A 2V0UA 3F1OB 4L9FA 4HQAA 2I9VA 1OTAA 1GSXA 1MZUA 2WKQA 2B02A 3LI8A 2W27A 4B9OA 1X0OA 1Y28A 1ODVA 2PYPA 3C8CA 2ZOIA 4KQDA 2OWJA 4M4XA 2PHYA 2YKHA 3IS2A 3H7WA 3F1PB 4GHIA 3F1NB 4EERA 3VE3A 3BY9A 4WN5A 1OTDA 5F6AA 1TS0A 3MXQA 1TS8A 4WL9A 5HSQA 3MQOA 2WKPA 4R38A 4I5SA 5KIZA 3P7NA 3T50A 2L0WA 1P0ZA 1DP8A 3UB8A 3NHQA 3F1OA 4I3AA 4BBVA 1LSXA 4HH3A 4WUJA 2PR5A 2K7SA 5HD3A 2JN7A 4XT2A 5J3WA 4LRXC 2P7JA 3LYXA 1V9YA 5HDSA 4GW9A 1S4SA 1LT0A 3LIBA 1JNUA 4DJ2A 3UB7A 4HP4A 3NOPC 3ULFA 3KX0X 3IBRA 3FC7A 3NJAA 3NOUC 3IS2B 3H7WB 3PYPA 4EW7A 2WKRA 5F5YA 3OLOA 4GHIB 3LIDA 4HIAA 3G6OA 4JGPA 4JGRA 4RQ9A 4K08A 3GDIA 2V0WA 4PKYG 3LUQA 4HJ4A 2KX6A 5G4ZA 1XJ2A 4NXGA 2PYRA 2KDKA 1T1AA 4KUKA 1V9ZA 1XFQA 4XT2B 4MN5A 3LIFA 4EETB 3A0RA 1D06A 2ZBBA 3E4PA 4R3AA 1S1YA 4E04A 1OT6A 1D7EA 1G28A 4F3LA 2EA9A 4R70A 4GCZA 3UMDA 3H82A 3GECA
chains in the Genus database with same CATH superfamily
1SZVA 2M1CA 3JVVA 2J3TC 4R4SA 3UDXA 4I3IA 5FA7A 1K6RA 2QKPA 2Y2NA 3IXDA 5F83A 3A3FA 2PRFA 1KVLA 4PAUA 3N7WA 2J9OA 3UO9A 2BTFP 2PR6A 4DKIA 4R6LA 1PWGA 4CJNA 1YQSA 5DJTA 2FH5A 3SS4A 1L3LA 3BYDA 2RCXA 1OTBA 2H5SA 3ZG5A 3EQUA 5E2GA 4DF6A 2W1TA 4JBFA 3WS0A 3HLBA 2PU4A 4XUZA 4EEPA 1TVFA 1S66L 1Q2QA 4X55A 1F9IA 2OOLA 4YFMA 5HD5A 2XR0A 2K2NA 4BJPA 3GV9A 2CMNA 1NY0A 4X69A 3ZFZA 1W63Q 1S4RA 4WEKA 3PBSA 5HWVA 4OOMA 5K5BA 1ONGA 4LLOB 1EROA 3HJKA 2ZC3B 4WMCA 5HW3A 4OQGA 3BY8A 2ZM2A 1K25A 5A90A 3PR6A 2D01A 4OQIA 4DE1A 1YLZA 2ZQ8A 3LIAA 2WAFA 4WM9A 3KSGA 4BLMA 5HX9A 3IX3A 3E0YA 4R3BA 2XSSA 5IS1A 5FEFA 2Y2GA 2QZ6A 4GS9B 4BBUA 3ZHHA 1LL5A 2XFSA 4O0PA 5DTKA 1XFNA 2H10A 1K38A 4E6XA 4IBXA 2IWBA 1PW8A 4OPRA 3SW1A 2Q9MA 5I94A 2O99A 3M2KA 4ZRRA 4S2IA 3CJMA 3P98A 2HGVA 2PAVP 3EGDC 5CHUA 2HV1A 4U3TA 4P6ZM 3TSGA 2HJEA 3CITA 4LRYC 3WS5A 3W8KA 1O07A 1XXMA 1KGGA 5M1AA 4HOIA 1SDEA 3VV4A 2PD7A 3ZG8B 3Q07A 2E8JA 2A3UA 1DJBA 1VHMA 3RH8B 4ARZB 4RX2A 3V50A 3CLOA 3JVUA 4MBKA 2JBFA 5FQJA 1ZHHB 4NXBA 5EECA 1HTZA 4QY5A 4F94A 2VV8A 4EQ1A 2W3GA 3BFGA 3C2WA 2XLNA 2OSUA 1LSVA 1DP9A 2OLVA 3BFDA 3VP4A 3BW6A 3BLMA 3T1SA 1MWSA 1CK3A 3C4PA 1GA9A 1C3BA 1L0FA 5CXWA 5FEGA 4KZ4A 5GLAA 1BLCA 3VP3A 3VOZA 2NUTC 3LICA 5DF9A 4KZ5A 5EM0A 1CQAA 4MLLA 3T12B 3QP1A 3UB6A 2EX8A 1H5XA 3PBQA 3TW8A 1P9RA 2VEAA 5E2HA 2X71A 4KZ6A 4CQHA 1TS6A 4YWZA 2ZC6B 1DP6A 4Y3IA 3C38A 1OJGA 4KZBA 4HESA 3G31A 3VOLA 5HDDA 1XPBA 1WE4A 3DTIA 1Y54A 5EE8A 1Z6FA 2I9VA 1Q2PA 4DE2A 4U0TA 3UDIA 3LI8A 2ZC5B 4FH4A 3KSFA 2W27A 3HL9A 3GQZA 3UNWA 4KQDA 2JKRI 2R9XA 4Q0JA 2B5RA 4DE3A 2WKHA 2QYBA 2XQZA 3UPNA 4K91A 5EOOA 1MKMA 4DRTA 4MN7A 4GHIA 4S2MA 4WN5A 5JYOA 1MBLA 1OTDA 2Y2LA 5F6AA 5IT5A 3CI6A 2ZQ9A 2V8FA 3ITAA 4I5SA 4FUWA 2JKTM 1XA1A 2OLUA 4LV3A 1BLPA 3NHQA 4I3AA 4BBVA 3MZEA 1LSXA 4EWFA 2HDUA 3LY4A 4DMZA 5HD3A 2JN7A 4B93A 1VEUB 3FZCA 3IHAA 2W3DA 4PM7A 5CEDA 1CI8A 1V9YA 2XD5A 5F82A 4EBPA 5FAPA 4GW9A 1K55C 4ZBEA 1KGFA 4PM6A 4DJ2A 3B42A 4HP4A 1AXBA 4MMNA 3OOVA 2XA7S 3CPTA 4BL2A 5CTNA 1MWRA 1JVJA 3LEZA 2H0TA 2W3EA 4QD4A 1K54A 1LI9A 3IBRA 4CLCC 4C75A 3HLCA 1PWDA 4R23A 4DN0A 1FQGA 4EW7A 5CHMA 4E3IA 5U47A 2WKRA 4OP8A 5DTSA 5GHYA 3D9YA 4HIAA 3G6OA 3M2JA 1FCNA 4C3QA 1SKFA 4JGRA 1IEMA 3RJUA 1E4DA 5EVLA 4BWIA 3GDIA 4PKYG 3LUQA 4HJ4A 2KX6A 4NXGA 2WAEA 1N4OA 5TGFA 4OPYA 4EUZA 4KG6A 4WZ4A 1T1AA 5EVIA 3LIFA 3D3OA 3T4QA 4FTXA 3HUMA 4R3AA 3VFHA 3BJNA 1S1YA 1TDLA 3NC8A 4KQQA 3SS3A 4QWOA 1G28A 2EA9A 1YM1A 3O86A 4GCZA 2P08A 3H82A 3GECA 1H8ZA 1ALQA 1YSQA 5HDCA 4X1LA 1I5QA 3CMZA 2JKFA 2Y2KA 4P85A 5A91A 2PD8A 1EW0A 4HJ6A 3A0VA 3ICYA 4IUKA 2WZZA 2VGLM 1KGEA 1YMSA 3AGDA 1QMFA 3CAXA 3G2YA 4E3MA 1K56A 4N9LA 2M7UA 4PM5A 5DF7A 5IHVA 1SKOA 2OAP1 3EQVA 4N9KA 3MQ0A 4PM9A 2VV7A 3IXBA 3ZG7B 3QP8A 3HJIA 1DY6A 4JKTA 3FV7A 1K0KA 4GD6A 4HJ3A 1K57C 4ETZA 2X02A 1XJ3A 3KYQA 3MJQA 5DKKA 4WZ5A 1GSWA 4NETA 2VJWA 4GDBA 2V1BA 1LHYA 3BQAA 2ZQ7A 3DAVA 4GJ4A 4Q0HA 5A8BA 3VP0A 3MKEA 1XJ6A 3IF5A 4EESA 1FSYA 3T4OA 4LENA 1XJ4A 2O9CA 3LGOA 4H6JA 3G35A 3BFEA 4ME4A 1XGJA 1UWPX 1T1CA 4Q0IA 2KOIA 2WKEA 3V5MA 2PT7A 3PBRA 1FIKA 4E6WA 2ACGA 1G5UA 5G18A 3ZVWA 1BZAA 1LL9A 2EX6A 3IBJA 5FASA 5AJGA 2XRNA 3BM6A 1NXYA 2GZAA 3ZG9B 4L9GA 1XX2A 2GJ3A 2XFTA 3OPHA 3B33A 4M3KA 3KSIA 4MBFA 4S2KA 5IU1A 5F1FA 2BASA 4P6BA 2VZWA 2J80A 1F5MA 3G32A 1KE0A 2A24A 3GR2A 3CZDA 3UPPA 2Y8HA 5GL9A 2Z2MB 1GCEA 1BLHA 1PRQA 3U4LP 1KE4A 1GSVA 4P6ZS 3MR0A 1U60A 3S4XA 1FSWA 2C6WB 2HP9A 1HLUP 4S2NA 4ZJ1A 3FKWA 3UMEA 2Y59A 1BYWA 3MZDA 2M7VA 2IA2A 4OOLA 3SZTA 3SH7A 4QPRA 2JCHA 5EUAA 4KZ9A 4N1HA 2Y2MA 5F68A 3DWZA 2OV5A 3EOIA 3EEAA 3WS4A 3K3DA 3OZHA 1TDGA 4QHCA 3UPOA 4IHQA 3IF6A 3FWLA 1ZKJA 1L0DA 5I5LA 4FCFA 3QNBA 4JF5A 3V3RA 3NIAA 3L9KA 1O7EA 2GX5A 1LSWA 4UEYA 4LV0A 4LFUA 1IKGA 1LI0A 1ONHA 4LV1A 4UA9A 1N9NA 4HP9A 1TEMA 2Y2IA 4Y15A 4OKPA 3EGXC 1NLYA 3LEQA 3LIEA 3F1NA 5HWTA 1FILA 3S7NA 4WF0A 3V3SA 3R7WA 3R4KA 5J4EA 3TE8A 5A92A 3Q7VA 2YKFA 3LR3A 2OWHA 4JXSA 3HREA 4QU3A 4N1XA 3BLSA 1WA9A 2E8IA 4UA7A 1T19A 4I39A 1N9OA 4WELA 1UGUA 3OC2A 4DE0A 1F2KA 1YMXA 1VB6A 1CI9A 1HD8A 3P09A 1OTAA 2WKQA 4YNRA 1IYOA 3KYZA 3RFBA 1Y28A 2P9VA 2PYPA 2OWJA 2XD1A 4M4XA 4OP5A 3QP2A 3BRMA 1IYQA 4IEDA 2PHYA 3S1YA 2WKIA 3ZGAB 3G4PA 2ZMFA 3TJZC 5GLCA 3UE0A 3T4TA 3LY3A 5FL3A 3FPWA 1FOFA 4GLQA 1LLBA 3HUNA 3LR0A 3VSLA 3IWOA 3DTMA 2GNXA 1H8YA 1G6AA 4FOFA 4WL9A 2V2FF 3QP6A 4KQOA 3AGFA 2Y79A 2WKPA 4JPMA 4R38A 1A0KA 1M40A 3P7NA 2L0WA 3T50A 1P0ZA 3UB8A 2Y4AA 2K7SA 2VA0A 4Z1WA 4PPRA 1ES5A 1W5DA 3V67A 3N4IA 4MEZA 1YKDA 2R9WA 3A3DA 1GHPA 3HLEA 4QY6A 4LRXC 3OCNA 2P7JA 4WBGA 1FCMA 4OLGA 1JWZA 2B18A 4IBRA 1LT0A 5KMWA 2DRWA 3NCKA 4WMCD 3LIBA 1JNUA 1PW1A 4KG5A 1NYYA 5TFQA 1G68A 4Y13A 5CX7A 2GDNA 4DXCA 3IHBA 1YT4A 4OVDA 3KX0X 3HBRA 3S7OA 1M6KA 4L0LA 1Y4OA 2WADA 3NOUC 1GHIA 5MC7A 3NECA 3PYPA 4YOFA 5DVAA 2FFFB 5F5YA 4GHIB 4IVKA 5EV0A 3CUEA 3UE1A 1BULA 4JGPA 1WYBA 2XDMA 3T4LA 3DBAA 4K08A 2V0WA 5HL6A 4KZ8A 1PI5A 4UAAA 2J8YA 3KO6A 1XJ2A 5FI2A 4X6TA 5FQIA 3KSHA 4R4RA 3IT9A 4EU0A 2W3HA 2QMIA 4LV2A 2H0YA 1IOUA 2WK0A 3T4SA 2EXAA 1D06A 1BLSA 4LCLA 1JWVA 2ZQCA 4E04A 1OT6A 1IYPA 5D3OA 4F3LA 5C5KA 4R70A 2Q0OA 1J3WA 2HDQA 4NK3A 1J9MA 3E98A 4D2OA 3CPTB 4ETXA 4FSFA 4Y5FA 4PKYA 4CLCE 2X01A 2BLSA 2PDRA 3WS2A 4GKUA 1IELA 2VGLS 3ZQ5A 2R78A 3A3EA 3GTCA 5HPFA 4OLDA 4ZAMA 4BD0A 2EFXA 1BT5A 5HZHA 4B4XA 4XUXA 3D4FA 1QMEA 3PHYA 2IWDA 4DJ3A 3QNCA 4N92A 1NJ4A 3E4QA 2DNSA 3B47A 5LBRA 4H8RA 5AVEA 3IXHA 5HAIA 5L07A 1L2SA 1I2SA 5L2FA 4X68A 3ZNYA 4JF4A 1NRJA 5CEBA 3O87A 2Y2QA 1SCWA 5EVIB 3GSGA 5HL1A 2HF6A 2VLGA 1W8QA 3LO7A 2Y2HA 4UQIM 4IVIA 4LRZE 3GRJA 1W63M 3IWQA 4Y7PA 4RX3A 2XEPA 1EI5A 3A3JA 4BENA 2VV6A 3H82B 3ZG0A 4HHDA 1XP4A 1MY8A 2VGKA 1LL8A 3G34A 5EVEA 4DDSA 1AWIA 1YLJA 1UWNX 3O3VA 5DKLA 3SH9A 3W4OA 1NWZA 1FR6A 2QWSA 1GHMA 1HVBA 2ZOHA 3HLFA 2EX2A 3MFDA 3GVBA 3C30A 1HZOA 1SKOB 4KG2A 1OMEA 5DFYA 2G2UA 3WRZA 1VETA 2QHKA 3Q82A 5TBMA 2XH9A 1PNEA 5KSCA 3NY4A 2O9BA 2HPBA 4ZTKA 4CPKA 1K55A 4BBTA 1MKIA 5CHJA 5AVFA 4EXOA 4GZBA 4QJGA 2LB9A 1OJ5A 3BQ8A 1NYMA 3VOYA 4RYEA 2WYXA 1YLWA 4CLCA 4O7DA 3BFCA 1P97A 3DW0A 4LGWA 1D1JA 4ESPA 4EEUA 2ZC7A 4HI4A 3SS5A 3TG9A 3PBOA 2HDRA 2V9AA 3FKVA 2JKRM 4H6JB 5E2FA 1H8MA 5EOEA 1CEGA 2EWWA 4PMAA 3HVFA 5J7EA 4HEFA 4HY8A 5L8MA 3VSKA 2ZJ9A 4HBTA 3N6IA 4O01A 4GNUA 4JXWA 2MJ6A 2FFYA 3TRCA 1SDNA 4LCMA 2H28A 1E3UD 4NXEA 3UDFA 5HWWA 3IWIA 3RTYA 1GA0A 1YAXA 2XGNA 5FQQA 2A24B 2WGVA 3QP5A 1ESIA 4JF6A 3DTKA 5DTTA 4FD8A 1PZPA 3ZYTA 3C7UA 2EWVA 3M6HA 1ZTUA 2OAQ1 4HH2A 2JE5A 5GHZA 3LR4A 1TS7A 4EV4A 4Y0UA 3F1PA 3HUOA 2UWXA 4PM8A 4S2PA 4JLFA 2EX9A 1DRMA 5EVID 2V1AA 4KZ7A 1ZG4A 3BWLA 4KQRA 2RL3A 3C4OA 4KUOA 3FG8A 1KDWA 5M19A 1DJCA 1PFLA 1ES3A 3DTEA 2WGWA 3IX8A 1K57A 2VKSA 1S1ZA 2W1RA 5G4YA 2P04A 2Z6CA 4OOYA 3HCYA 4JGOA 2ZMAA 3CWFA 2ZL1A 1YPRA 2O9AA 2ZQAA 2LB5A 5L10A 1N9LA 4WLAA 4Y0TA 5FAQA 3F1OB 4L9FA 1ERMA 5A93A 4HQAA 4IUHA 3IF6B 4S2LA 3NDGA 3MSHA 1GSXA 1MZUA 3BEBA 2B02A 1BUEA 3OBFA 2ZQDA 1K56D 1K6SA 4BQMA 5FI7A 5KSHA 1P9WA 1NZOA 1X0OA 4B9OA 1JTDA 2V1ZA 3S22A 2P74A 2ZMVA 2V8CA 3PBTA 2ZOIA 3QP4A 2QPNA 3OCLA 1RGYA 4R1GA 3MZFA 4OPZA 1MWTA 2YKHA 3IS2A 3H7WA 4NKPA 4BL3A 2Z2LB 3F1NB 4EERA 4R3JA 3VE3A 3BY9A 3R7WB 3IX4A 5AQ9A 1TS8A 3Q7VB 4GOGA 1W7FA 3ZNTA 5E2EA 3UY6A 2KLIA 3F1OA 2ZLYA 2Q9NA 3PTEA 4KENB 4XT2A 5FQ9A 3MS6A 5J3WA 2HJ9C 3LYXA 2JC7A 5HDSA 1TD5A 3LR5A 4XXRA 1YLTA 1WYCA 2P9VB 3C5AA 3G2ZA 3NOPC 1XKZA 3MBZA 1K4EA 4MDZA 5GHXA 3N8LA 3SH8A 1IFQA 3AGEA 3VP2A 3FC7A 1NZUA 2BG1A 5CGSA 4U0XA 2C5WB 4II7A 4PHTA 4RQ9A 2ZC4B 5M18A 4BD1A 3PBNA 5CGWA 3Q81A 4E3OA 3GMWA 2JKGA 4B88A 2IWCA 2NUPC 2K31A 4E3LA 2PYRA 1H0MA 1ACFA 3S7PA 3Q7ZA 4MN5A 1YSPA 4EETB 3A0RA 5AQ7A 4UHUA 1OPXA 3ITBA 4E3NA 5HPIA 5L09A 1D7EA 3FPVA 3WRTA 4IJGA 3I7JA 3NBLA 1S67L 1L0GA 3IH9A 2XK1A 2VX8A 1NLZA 3Q1FA 3T1XA 3NOTC 3VE4A 5F69A 3NI9A 3D72A 2JKTI 1CF0A 3K3CA 1KDSA 2A49A 3PXPA 1Z09A 3QHYA 4S2OA 3SOIA 3JPUA 1EWZA 3LFVA 3UB5P 2J3TD 2QJ5A 4LPZA 4Y2FA 5EFWA 3VFFA 2Y2OA 3CUEC 3W2ZA 3EEHA 4GS9A 1KE3A 3NDEA 1FCOA 2PBDP 2EFUA 3IXGA 4GDNA 4UQIS 4GD8A 1KOUA 3IH8A 3N8SA 3S7QA 4A5RA 1K4FA 1ERQA 4G3WA 4F3LB 4HNBA 3IQAA 5J8XA 4L9EA 2AVXA 1KVMA 3E4OA 4UA6A 5GLDA 3A0SA 3T4JA 2JHEA 4I3JA 5FI6A 1YLYA 3UE3A 3K2NA 4MNRA 1BTLA 4NEED 1TF1A 2I72A 2Y2JA 4YINA 3KYEA 1JTGA 5FSRA 4G3KA 5FQKA 4R0QA 1ES4A 2QJ7A 4ARZA 1OTIA 1DJAA 1MXOA 1OTEA 2Z6DA 4P87A 5HAPA 3UE6A 5E43A 2ZM8A 5EM1A 4OPQA 5CERA 3O5YA 2D02A 4Y0OA 3PAGA 3T1QB 4DDYA 4KZ3A 5DF8A 4S2JA 5DJUA 2HDSA 1MC0A 1PWCA 1PIOA 3HLGA 1RCJA 2EXBA 1XA7A 2WGIA 4NXFA 1F98A 4ZJ3A 3T4KA 1RP5A 3C7VA 1ZG6A 3G30A 5FQMA 3JYIA 4K0XA 3UN7A 3CG5A 3RXWA 4MN6A 5HAQA 1CJFA 3H9WA 5AQAA 3OPRA 2G7UA 5CRFA 1K54C 1PI4A 3MXSA 1MWUA 3WS1A 4FH2A 3OPPA 1CEFA 2PBYA 1VETB 2J9PA 1T1BA 5TBMB 4RA7A 3P01A 1VM1A 5DFXA 1PZOA 4I38A 2ZD8A 1VQQA 2UV0E 3ZVTA 2W0NA 3E2LA 4X25A 3U2AA 4JGQA 2W3FA 1RGZA 5EVIC 2DCFA 3W4QA 4CLCB 2J7VA 3EWKA 3PAEA 2CC1A 4C6YA 3M6BA 3MQQA 4KZAA 4ZDXA 3A3IA 5TR7A 4MCWA 1YLPA 3WWXA 1NRFA 2WUQA 4EUVA 3LI9A 4AFIA 1IYSA 4OQ0A 4E3JA 2HZ5A 2XROA 2G2WA 2ZM0A 2L4RA 5GLBA 4JXVA 3UB9A 3NULA 4X56A 1E3UA 1MPLA 2INWA 4X1MA 5EPHA 3MFXA 1OT9A 2L1MA 1N9BA 1T18A 4HBUA 1VEUA 1ESUA 1S0WA 2V0UA 4B4ZA 4DXBA 2V20A 1JWPA 4NG2A 1E25A 2HP6A 4OONA 2PU2A 4OH0A 3BECA 4O8GA 5AQBA 4MBHA 1ODVA 4WZ5C 1PYYA 3C8CA 3VMAA 5FDHA 4WEJA 5FAOA 4G3VA 5TJJA 2O0YA 4P0MA 5JYPA 3ZDJA 2DMWA 4ZJ2A 3F1PB 4E3KA 2VK3A 4WYYA 2WZXA 1TS0A 3MXQA 1I2WA 3RXXA 1XGIA 4ID4A 5HSQA 3MQOA 1FR1A 5CTMA 1G6OA 2Y55A 5F1GA 5KIZA 2WGWB 3V39A 4GB7A 3MF0A 3LCEA 1DP8A 4D60A 4HH3A 4WUJA 2PR5A 2ZL1B 1H3QA 3E2KA 4JXGA 2VGJA 3N8RA 1L0EA 2Y91A 4EBLA 3OPLA 3MXRA 1S4SA 1W8YA 3W4PA 1W79A 1SHVA 3O88A 3DWKA 3UB7A 3BFFA 3TOIA 3T1RA 3MKFA 3FYZA 2XA7M 3ULFA 1BSGA 2B95A 2J3WA 5CGXA 1ES2A 3NJAA 5CECA 3L7HA 4EQIA 3IS2B 3H7WB 1IKIA 2HP5A 3OLOA 3LIDA 5HFOA 3B3XA 4RVAA 3HLWA 3CHWP 4S2NC 3MMHA 3HLDA 4CLCD 4Y17A 5G4ZA 4GN2A 5BOHA 5HARA 2Y2PA 2A2LA 5FDSA 1ZC2A 2KDKA 4KUKA 1S6RA 1V9ZA 1XFQA 2FZ0A 4K0WA 4BMWA 4Z9QA 4XT2B 4Q8IA 2ZBBA 3ZCZA 3ISGA 3E4PA 4X53A 1STZA 2XF3A 3VP1A 2W1TB 3IF6C 5KZHA 4EBNA 4QB8A 4OQHA 3UMDA 5FATA
chains in the Genus database with same CATH topology
1YSQA 1S67L 5HDCA 4ETXA 4FSFA 4Y5FA 4PKYA 4CLCE 2PDRA 2M1CA 3JVVA 2PD8A 1EW0A 2J3TC 2VX8A 1NLZA 4HJ6A 2VGLS 3A0VA 3ZQ5A 3ICYA 3NOTC 4IUKA 2R78A 3VE4A 2VGLM 5F69A 5HPFA 4I3IA 3D72A 3CAXA 2JKTI 5HZHA 2QKPA 3K3CA 3PHYA 4DJ3A 4PAUA 2M7UA 3PXPA 2PR6A 3LFVA 2OAP1 3EQVA 3E4QA 2J3TD 2QJ5A 3B47A 5LBRA 4LPZA 4R6LA 3MQ0A 5AVEA 4Y2FA 5EFWA 2VV7A 3CUEC 5DJTA 3W2ZA 2FH5A 3HJIA 3EEHA 1OTBA 4HJ3A 1NRJA 4GS9A 3EQUA 4ETZA 3KYQA 1XJ3A 3MJQA 5DKKA 4UQIS 1GSWA 2HF6A 2VJWA 2VLGA 2W1TA 4UQIM 2V1BA 1KOUA 4LRZE 3S7QA 3BQAA 1W63M 4EEPA 4G3WA 1S66L 4GJ4A 4F3LB 4HNBA 1F9IA 2OOLA 4L9EA 4Q0HA 5A8BA 3E4OA 1XJ6A 5HD5A 2VV6A 3H82B 4HHDA 3A0SA 2K2NA 3T4JA 4BJPA 2JHEA 4I3JA 1LL8A 4EESA 3T4OA 3UE3A 3K2NA 1UWNX 1XJ4A 2CMNA 5DKLA 2O9CA 1NWZA 4NEED 1TF1A 4H6JA 2QWSA 1W63Q 1S4RA 4WEKA 2ZOHA 3PBSA 5HWVA 4OOMA 4G3KA 5K5BA 4ME4A 4LLOB 1UWPX 1T1CA 4Q0IA 3HJKA 2KOIA 2PT7A 2QJ7A 3BY8A 3PBRA 4ARZA 3C30A 1OTIA 1OTEA 2Z6DA 3PR6A 2D01A 5DFYA 2QHKA 3UE6A 3IBJA 5AJGA 3LIAA 2XRNA 5TBMA 3KSGA 3O5YA 2D02A 2GZAA 4L9GA 2O9BA 2GJ3A 3E0YA 2XSSA 3B33A 5IS1A 3KSIA 5IU1A 4GS9B 4BBUA 4BBTA 5DJUA 1MC0A 2BASA 4O0PA 2VZWA 2J80A 1F5MA 5AVFA 4EXOA 2LB9A 1OJ5A 1XFNA 3BQ8A 4NXFA 4CLCA 1F98A 2A24A 3T4KA 1P97A 3SW1A 2O99A 4ZRRA 2Y8HA 2HGVA 1GSVA 3EGDC 4P6ZS 2HV1A 3MR0A 4EEUA 4P6ZM 2HJEA 3CITA 4HI4A 4MN6A 4LRYC 3H9WA 3PBOA 2G7UA 3UMEA 2V9AA 4HOIA 2JKRM 4H6JB 1BYWA 2M7VA 3VV4A 2PD7A 2IA2A 4OOLA 4QPRA 1H8MA 2EWWA 5F68A 1VHMA 4ARZB 3RH8B 5J7EA 3CLOA 3EOIA 3JVUA 3EEAA 3E98A 1ZHHB 3K3DA 4HY8A 4NXBA 5L8MA 1T1BA 5TBMB 3P01A 5DFXA 4O01A 4I38A 2VV8A 4EQ1A 2W3GA 3C2WA 4IHQA 2MJ6A 2W0NA 3U2AA 3TRCA 4JGQA 5I5LA 1LSVA 1DP9A 2H28A 2W3FA 3BW6A 4NXEA 5HWWA 3RTYA 1YAXA 4CLCB 3EWKA 2A24B 2GX5A 1LSWA 3MQQA 4UEYA 4MCWA 3ZYTA 2EWVA 1ZTUA 2OAQ1 1N9NA 3LI9A 4HH2A 2NUTC 3LICA 3LR4A 4HP9A 1TS7A 4AFIA 4EUVA 5DF9A 3F1PA 3EGXC 1NLYA 3LIEA 1DRMA 2V1AA 3F1NA 5HWTA 2XROA 3BWLA 3UB6A 3S7NA 4WF0A 3R7WA 3R4KA 2L4RA 3PBQA 3TW8A 5J4EA 3TE8A 1P9RA 2VEAA 2YKFA 3UB9A 4KUOA 3FG8A 4CQHA 3LR3A 1TS6A 4YWZA 2OWHA 1DP6A 2INWA 4Y3IA 2VKSA 1S1ZA 2W1RA 5G4YA 3C38A 2P04A 1OJGA 3MFXA 1WA9A 2Z6CA 1OT9A 3HCYA 4JGOA 2L1MA 3CWFA 1T19A 4I39A 1N9OA 2O9AA 1T18A 4WELA 3VOLA 2LB5A 1UGUA 1N9LA 3OC2A 4WLAA 5HDDA 1VB6A 2V0UA 3F1OB 4L9FA 4HQAA 4IUHA 2I9VA 1OTAA 1GSXA 1MZUA 2WKQA 2B02A 3OBFA 4YNRA 5KSHA 3KYZA 3LI8A 3RFBA 3KSFA 2W27A 1P9WA 4O8GA 1X0OA 4B9OA 1Y28A 1ODVA 2PYPA 2ZMVA 3C8CA 3PBTA 2ZOIA 3OCLA 4KQDA 2JKRI 2OWJA 4WEJA 4G3VA 5TJJA 4M4XA 2O0YA 4Q0JA 2PHYA 2QYBA 2DMWA 2YKHA 3IS2A 2ZMFA 3H7WA 4NKPA 1MKMA 3TJZC 3T4TA 3F1PB 4MN7A 3FPWA 5FL3A 4GLQA 4GHIA 3F1NB 4EERA 3VE3A 3BY9A 4WN5A 1OTDA 3LR0A 5F6AA 5IT5A 1TS0A 3R7WB 3MXQA 2GNXA 1TS8A 4FOFA 3CI6A 4WL9A 4KQOA 5HSQA 2Y79A 1G6OA 2WKPA 3MQOA 4R38A 4I5SA 5KIZA 3P7NA 2L0WA 3T50A 1P0ZA 3MF0A 2JKTM 2KLIA 1DP8A 3UB8A 3NHQA 3F1OA 4I3AA 4BBVA 1LSXA 4HH3A 4WUJA 2PR5A 4DMZA 2K7SA 5HD3A 2JN7A 4B93A 2VA0A 1H3QA 4Z1WA 4XT2A 5J3WA 2HJ9C 2W3DA 3V67A 1YKDA 4LRXC 3OCNA 2P7JA 3LYXA 1V9YA 5HDSA 4GW9A 2B18A 1S4SA 1LT0A 1TD5A 3LIBA 3LR5A 1JNUA 4DJ2A 5CX7A 3UB7A 3B42A 4HP4A 4MMNA 3OOVA 2XA7S 3NOPC 2XA7M 3ULFA 3KX0X 4MDZA 3S7OA 2W3EA 3IBRA 4CLCC 2J3WA 4L0LA 1IFQA 3FC7A 3NJAA 4DN0A 3NOUC 3IS2B 3H7WB 5MC7A 3PYPA 4YOFA 4EW7A 2WKRA 5F5YA 3OLOA 4GHIB 3LIDA 3CUEA 4HIAA 3G6OA 4JGPA 4PHTA 4II7A 4JGRA 4RQ9A 3T4LA 3MMHA 4BWIA 4CLCD 3DBAA 3GDIA 4K08A 2V0WA 3PBNA 5HL6A 4PKYG 3LUQA 4HJ4A 2KX6A 3KO6A 5G4ZA 1XJ2A 4NXGA 2NUPC 2K31A 2A2LA 3KSHA 2PYRA 2KDKA 1T1AA 4EU0A 2W3HA 4KUKA 1V9ZA 1XFQA 2FZ0A 3S7PA 4BMWA 1IOUA 4XT2B 4MN5A 3LIFA 1YSPA 3D3OA 3T4SA 4EETB 3A0RA 1D06A 2ZBBA 1OPXA 3T4QA 3E4PA 4R3AA 1STZA 3BJNA 1S1YA 5HPIA 4E04A 2W1TB 1OT6A 1D7EA 1G28A 3FPVA 2EA9A 4F3LA 5C5KA 4R70A 4IJGA 4GCZA 2P08A 3UMDA 3H82A 3GECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S67 L;  5HDC A;  4PKY A;  2PDR A;  2M1C A;  2PD8 A;  1EW0 A;  4HJ6 A;  3A0V A;  3ZQ5 A;  3ICY A;  3NOT C;  2R78 A;  3VE4 A;  5F69 A;  4I3I A;  3D72 A;  3CAX A;  5HZH A;  2QKP A;  3K3C A;  3PHY A;  4DJ3 A;  2PR6 A;  3E4Q A;  2QJ5 A;  4LPZ A;  4R6L A;  5AVE A;  5EFW A;  2VV7 A;  5DJT A;  3HJI A;  3EEH A;  1OTB A;  4HJ3 A;  4GS9 A;  1XJ3 A;  3MJQ A;  5DKK A;  1GSW A;  2VLG A;  2V1B A;  1KOU A;  4LRZ E;  4EEP A;  1S66 L;  4F3L B;  4HNB A;  1F9I A;  2OOL A;  4L9E A;  5A8B A;  3E4O A;  1XJ6 A;  5HD5 A;  2VV6 A;  3H82 B;  4HHD A;  3A0S A;  2JHE A;  4I3J A;  1LL8 A;  4EES A;  1UWN X;  1XJ4 A;  2CMN A;  5DKL A;  1NWZ A;  4H6J A;  2QWS A;  1S4R A;  2ZOH A;  5HWV A;  4LLO B;  1UWP X;  1T1C A;  3HJK A;  2QJ7 A;  3BY8 A;  1OTI A;  1OTE A;  2Z6D A;  2D01 A;  2QHK A;  3UE6 A;  3LIA A;  5TBM A;  2D02 A;  4L9G A;  2GJ3 A;  3B33 A;  5IS1 A;  5IU1 A;  4GS9 B;  4BBU A;  4BBT A;  5DJU A;  2BAS A;  2J80 A;  5AVF A;  4EXO A;  1OJ5 A;  1XFN A;  4NXF A;  1F98 A;  2A24 A;  1P97 A;  3SW1 A;  1GSV A;  2HV1 A;  3MR0 A;  4EEU A;  4HI4 A;  4MN6 A;  4LRY C;  3H9W A;  3UME A;  2V9A A;  4HOI A;  4H6J B;  1BYW A;  2PD7 A;  5F68 A;  3RH8 B;  5J7E A;  3CLO A;  3K3D A;  4HY8 A;  4NXB A;  1T1B A;  5TBM B;  4I38 A;  2VV8 A;  4EQ1 A;  3C2W A;  2W0N A;  4JGQ A;  5I5L A;  1LSV A;  1DP9 A;  2H28 A;  4NXE A;  5HWW A;  3RTY A;  3EWK A;  2A24 B;  1LSW A;  3MQQ A;  1N9N A;  3LI9 A;  4HH2 A;  4HP9 A;  3LIC A;  1TS7 A;  3F1P A;  3LIE A;  1DRM A;  2V1A A;  3F1N A;  5HWT A;  3BWL A;  3UB6 A;  4WF0 A;  2L4R A;  5J4E A;  2VEA A;  2YKF A;  3UB9 A;  4KUO A;  3FG8 A;  1TS6 A;  4YWZ A;  2OWH A;  1DP6 A;  2INW A;  1S1Z A;  5G4Y A;  1OJG A;  3MFX A;  1WA9 A;  2Z6C A;  1OT9 A;  4JGO A;  2L1M A;  3CWF A;  1T19 A;  4I39 A;  1N9O A;  1T18 A;  3VOL A;  1UGU A;  1N9L A;  5HDD A;  4WLA A;  1VB6 A;  2V0U A;  3F1O B;  4L9F A;  4HQA A;  2I9V A;  1OTA A;  1GSX A;  1MZU A;  2WKQ A;  2B02 A;  3LI8 A;  2W27 A;  4B9O A;  1X0O A;  1Y28 A;  1ODV A;  2PYP A;  3C8C A;  2ZOI A;  4KQD A;  2OWJ A;  4M4X A;  2PHY A;  2YKH A;  3IS2 A;  3H7W A;  3F1P B;  4GHI A;  3F1N B;  4EER A;  3VE3 A;  3BY9 A;  4WN5 A;  1OTD A;  5F6A A;  1TS0 A;  3MXQ A;  1TS8 A;  4WL9 A;  5HSQ A;  3MQO A;  2WKP A;  4R38 A;  4I5S A;  5KIZ A;  3P7N A;  3T50 A;  2L0W A;  1P0Z A;  1DP8 A;  3UB8 A;  3NHQ A;  3F1O A;  4I3A A;  4BBV A;  1LSX A;  4HH3 A;  4WUJ A;  2PR5 A;  2K7S A;  5HD3 A;  2JN7 A;  4XT2 A;  5J3W A;  4LRX C;  2P7J A;  3LYX A;  1V9Y A;  5HDS A;  4GW9 A;  1S4S A;  1LT0 A;  3LIB A;  1JNU A;  4DJ2 A;  3UB7 A;  4HP4 A;  3NOP C;  3ULF A;  3KX0 X;  3IBR A;  3FC7 A;  3NJA A;  3NOU C;  3IS2 B;  3H7W B;  3PYP A;  4EW7 A;  2WKR A;  5F5Y A;  3OLO A;  4GHI B;  3LID A;  4HIA A;  3G6O A;  4JGP A;  4JGR A;  4RQ9 A;  4K08 A;  3GDI A;  2V0W A;  4PKY G;  3LUQ A;  4HJ4 A;  2KX6 A;  5G4Z A;  1XJ2 A;  4NXG A;  2PYR A;  2KDK A;  1T1A A;  4KUK A;  1V9Z A;  1XFQ A;  4XT2 B;  4MN5 A;  3LIF A;  4EET B;  3A0R A;  1D06 A;  2ZBB A;  3E4P A;  4R3A A;  1S1Y A;  4E04 A;  1OT6 A;  1D7E A;  1G28 A;  4F3L A;  2EA9 A;  4R70 A;  4GCZ A;  3UMD A;  3H82 A;  3GEC A; 
#chains in the Genus database with same CATH topology
 1SZV A;  2M1C A;  3JVV A;  2J3T C;  4R4S A;  3UDX A;  4I3I A;  5FA7 A;  1K6R A;  2QKP A;  2Y2N A;  3IXD A;  5F83 A;  3A3F A;  2PRF A;  1KVL A;  4PAU A;  3N7W A;  2J9O A;  3UO9 A;  2BTF P;  2PR6 A;  4DKI A;  4R6L A;  1PWG A;  4CJN A;  1YQS A;  5DJT A;  2FH5 A;  3SS4 A;  1L3L A;  3BYD A;  2RCX A;  1OTB A;  2H5S A;  3ZG5 A;  3EQU A;  5E2G A;  4DF6 A;  2W1T A;  4JBF A;  3WS0 A;  3HLB A;  2PU4 A;  4XUZ A;  4EEP A;  1TVF A;  1S66 L;  1Q2Q A;  4X55 A;  1F9I A;  2OOL A;  4YFM A;  5HD5 A;  2XR0 A;  2K2N A;  4BJP A;  3GV9 A;  2CMN A;  1NY0 A;  4X69 A;  3ZFZ A;  1W63 Q;  1S4R A;  4WEK A;  3PBS A;  5HWV A;  4OOM A;  5K5B A;  1ONG A;  4LLO B;  1ERO A;  3HJK A;  2ZC3 B;  4WMC A;  5HW3 A;  4OQG A;  3BY8 A;  2ZM2 A;  1K25 A;  5A90 A;  3PR6 A;  2D01 A;  4OQI A;  4DE1 A;  1YLZ A;  2ZQ8 A;  3LIA A;  2WAF A;  4WM9 A;  3KSG A;  4BLM A;  5HX9 A;  3IX3 A;  3E0Y A;  4R3B A;  2XSS A;  5IS1 A;  5FEF A;  2Y2G A;  2QZ6 A;  4GS9 B;  4BBU A;  3ZHH A;  1LL5 A;  2XFS A;  4O0P A;  5DTK A;  1XFN A;  2H10 A;  1K38 A;  4E6X A;  4IBX A;  2IWB A;  1PW8 A;  4OPR A;  3SW1 A;  2Q9M A;  5I94 A;  2O99 A;  3M2K A;  4ZRR A;  4S2I A;  3CJM A;  3P98 A;  2HGV A;  2PAV P;  3EGD C;  5CHU A;  2HV1 A;  4U3T A;  4P6Z M;  3TSG A;  2HJE A;  3CIT A;  4LRY C;  3WS5 A;  3W8K A;  1O07 A;  1XXM A;  1KGG A;  5M1A A;  4HOI A;  1SDE A;  3VV4 A;  2PD7 A;  3ZG8 B;  3Q07 A;  2E8J A;  2A3U A;  1DJB A;  1VHM A;  3RH8 B;  4ARZ B;  4RX2 A;  3V50 A;  3CLO A;  3JVU A;  4MBK A;  2JBF A;  5FQJ A;  1ZHH B;  4NXB A;  5EEC A;  1HTZ A;  4QY5 A;  4F94 A;  2VV8 A;  4EQ1 A;  2W3G A;  3BFG A;  3C2W A;  2XLN A;  2OSU A;  1LSV A;  1DP9 A;  2OLV A;  3BFD A;  3VP4 A;  3BW6 A;  3BLM A;  3T1S A;  1MWS A;  1CK3 A;  3C4P A;  1GA9 A;  1C3B A;  1L0F A;  5CXW A;  5FEG A;  4KZ4 A;  5GLA A;  1BLC A;  3VP3 A;  3VOZ A;  2NUT C;  3LIC A;  5DF9 A;  4KZ5 A;  5EM0 A;  1CQA A;  4MLL A;  3T12 B;  3QP1 A;  3UB6 A;  2EX8 A;  1H5X A;  3PBQ A;  3TW8 A;  1P9R A;  2VEA A;  5E2H A;  2X71 A;  4KZ6 A;  4CQH A;  1TS6 A;  4YWZ A;  2ZC6 B;  1DP6 A;  4Y3I A;  3C38 A;  1OJG A;  4KZB A;  4HES A;  3G31 A;  3VOL A;  5HDD A;  1XPB A;  1WE4 A;  3DTI A;  1Y54 A;  5EE8 A;  1Z6F A;  2I9V A;  1Q2P A;  4DE2 A;  4U0T A;  3UDI A;  3LI8 A;  2ZC5 B;  4FH4 A;  3KSF A;  2W27 A;  3HL9 A;  3GQZ A;  3UNW A;  4KQD A;  2JKR I;  2R9X A;  4Q0J A;  2B5R A;  4DE3 A;  2WKH A;  2QYB A;  2XQZ A;  3UPN A;  4K91 A;  5EOO A;  1MKM A;  4DRT A;  4MN7 A;  4GHI A;  4S2M A;  4WN5 A;  5JYO A;  1MBL A;  1OTD A;  2Y2L A;  5F6A A;  5IT5 A;  3CI6 A;  2ZQ9 A;  2V8F A;  3ITA A;  4I5S A;  4FUW A;  2JKT M;  1XA1 A;  2OLU A;  4LV3 A;  1BLP A;  3NHQ A;  4I3A A;  4BBV A;  3MZE A;  1LSX A;  4EWF A;  2HDU A;  3LY4 A;  4DMZ A;  5HD3 A;  2JN7 A;  4B93 A;  1VEU B;  3FZC A;  3IHA A;  2W3D A;  4PM7 A;  5CED A;  1CI8 A;  1V9Y A;  2XD5 A;  5F82 A;  4EBP A;  5FAP A;  4GW9 A;  1K55 C;  4ZBE A;  1KGF A;  4PM6 A;  4DJ2 A;  3B42 A;  4HP4 A;  1AXB A;  4MMN A;  3OOV A;  2XA7 S;  3CPT A;  4BL2 A;  5CTN A;  1MWR A;  1JVJ A;  3LEZ A;  2H0T A;  2W3E A;  4QD4 A;  1K54 A;  1LI9 A;  3IBR A;  4CLC C;  4C75 A;  3HLC A;  1PWD A;  4R23 A;  4DN0 A;  1FQG A;  4EW7 A;  5CHM A;  4E3I A;  5U47 A;  2WKR A;  4OP8 A;  5DTS A;  5GHY A;  3D9Y A;  4HIA A;  3G6O A;  3M2J A;  1FCN A;  4C3Q A;  1SKF A;  4JGR A;  1IEM A;  3RJU A;  1E4D A;  5EVL A;  4BWI A;  3GDI A;  4PKY G;  3LUQ A;  4HJ4 A;  2KX6 A;  4NXG A;  2WAE A;  1N4O A;  5TGF A;  4OPY A;  4EUZ A;  4KG6 A;  4WZ4 A;  1T1A A;  5EVI A;  3LIF A;  3D3O A;  3T4Q A;  4FTX A;  3HUM A;  4R3A A;  3VFH A;  3BJN A;  1S1Y A;  1TDL A;  3NC8 A;  4KQQ A;  3SS3 A;  4QWO A;  1G28 A;  2EA9 A;  1YM1 A;  3O86 A;  4GCZ A;  2P08 A;  3H82 A;  3GEC A;  1H8Z A;  1ALQ A;  1YSQ A;  5HDC A;  4X1L A;  1I5Q A;  3CMZ A;  2JKF A;  2Y2K A;  4P85 A;  5A91 A;  2PD8 A;  1EW0 A;  4HJ6 A;  3A0V A;  3ICY A;  4IUK A;  2WZZ A;  2VGL M;  1KGE A;  1YMS A;  3AGD A;  1QMF A;  3CAX A;  3G2Y A;  4E3M A;  1K56 A;  4N9L A;  2M7U A;  4PM5 A;  5DF7 A;  5IHV A;  1SKO A;  2OAP 1;  3EQV A;  4N9K A;  3MQ0 A;  4PM9 A;  2VV7 A;  3IXB A;  3ZG7 B;  3QP8 A;  3HJI A;  1DY6 A;  4JKT A;  3FV7 A;  1K0K A;  4GD6 A;  4HJ3 A;  1K57 C;  4ETZ A;  2X02 A;  1XJ3 A;  3KYQ A;  3MJQ A;  5DKK A;  4WZ5 A;  1GSW A;  4NET A;  2VJW A;  4GDB A;  2V1B A;  1LHY A;  3BQA A;  2ZQ7 A;  3DAV A;  4GJ4 A;  4Q0H A;  5A8B A;  3VP0 A;  3MKE A;  1XJ6 A;  3IF5 A;  4EES A;  1FSY A;  3T4O A;  4LEN A;  1XJ4 A;  2O9C A;  3LGO A;  4H6J A;  3G35 A;  3BFE A;  4ME4 A;  1XGJ A;  1UWP X;  1T1C A;  4Q0I A;  2KOI A;  2WKE A;  3V5M A;  2PT7 A;  3PBR A;  1FIK A;  4E6W A;  2ACG A;  1G5U A;  5G18 A;  3ZVW A;  1BZA A;  1LL9 A;  2EX6 A;  3IBJ A;  5FAS A;  5AJG A;  2XRN A;  3BM6 A;  1NXY A;  2GZA A;  3ZG9 B;  4L9G A;  1XX2 A;  2GJ3 A;  2XFT A;  3OPH A;  3B33 A;  4M3K A;  3KSI A;  4MBF A;  4S2K A;  5IU1 A;  5F1F A;  2BAS A;  4P6B A;  2VZW A;  2J80 A;  1F5M A;  3G32 A;  1KE0 A;  2A24 A;  3GR2 A;  3CZD A;  3UPP A;  2Y8H A;  5GL9 A;  2Z2M B;  1GCE A;  1BLH A;  1PRQ A;  3U4L P;  1KE4 A;  1GSV A;  4P6Z S;  3MR0 A;  1U60 A;  3S4X A;  1FSW A;  2C6W B;  2HP9 A;  1HLU P;  4S2N A;  4ZJ1 A;  3FKW A;  3UME A;  2Y59 A;  1BYW A;  3MZD A;  2M7V A;  2IA2 A;  4OOL A;  3SZT A;  3SH7 A;  4QPR A;  2JCH A;  5EUA A;  4KZ9 A;  4N1H A;  2Y2M A;  5F68 A;  3DWZ A;  2OV5 A;  3EOI A;  3EEA A;  3WS4 A;  3K3D A;  3OZH A;  1TDG A;  4QHC A;  3UPO A;  4IHQ A;  3IF6 A;  3FWL A;  1ZKJ A;  1L0D A;  5I5L A;  4FCF A;  3QNB A;  4JF5 A;  3V3R A;  3NIA A;  3L9K A;  1O7E A;  2GX5 A;  1LSW A;  4UEY A;  4LV0 A;  4LFU A;  1IKG A;  1LI0 A;  1ONH A;  4LV1 A;  4UA9 A;  1N9N A;  4HP9 A;  1TEM A;  2Y2I A;  4Y15 A;  4OKP A;  3EGX C;  1NLY A;  3LEQ A;  3LIE A;  3F1N A;  5HWT A;  1FIL A;  3S7N A;  4WF0 A;  3V3S A;  3R7W A;  3R4K A;  5J4E A;  3TE8 A;  5A92 A;  3Q7V A;  2YKF A;  3LR3 A;  2OWH A;  4JXS A;  3HRE A;  4QU3 A;  4N1X A;  3BLS A;  1WA9 A;  2E8I A;  4UA7 A;  1T19 A;  4I39 A;  1N9O A;  4WEL A;  1UGU A;  3OC2 A;  4DE0 A;  1F2K A;  1YMX A;  1VB6 A;  1CI9 A;  1HD8 A;  3P09 A;  1OTA A;  2WKQ A;  4YNR A;  1IYO A;  3KYZ A;  3RFB A;  1Y28 A;  2P9V A;  2PYP A;  2OWJ A;  2XD1 A;  4M4X A;  4OP5 A;  3QP2 A;  3BRM A;  1IYQ A;  4IED A;  2PHY A;  3S1Y A;  2WKI A;  3ZGA B;  3G4P A;  2ZMF A;  3TJZ C;  5GLC A;  3UE0 A;  3T4T A;  3LY3 A;  5FL3 A;  3FPW A;  1FOF A;  4GLQ A;  1LLB A;  3HUN A;  3LR0 A;  3VSL A;  3IWO A;  3DTM A;  2GNX A;  1H8Y A;  1G6A A;  4FOF A;  4WL9 A;  2V2F F;  3QP6 A;  4KQO A;  3AGF A;  2Y79 A;  2WKP A;  4JPM A;  4R38 A;  1A0K A;  1M40 A;  3P7N A;  2L0W A;  3T50 A;  1P0Z A;  3UB8 A;  2Y4A A;  2K7S A;  2VA0 A;  4Z1W A;  4PPR A;  1ES5 A;  1W5D A;  3V67 A;  3N4I A;  4MEZ A;  1YKD A;  2R9W A;  3A3D A;  1GHP A;  3HLE A;  4QY6 A;  4LRX C;  3OCN A;  2P7J A;  4WBG A;  1FCM A;  4OLG A;  1JWZ A;  2B18 A;  4IBR A;  1LT0 A;  5KMW A;  2DRW A;  3NCK A;  4WMC D;  3LIB A;  1JNU A;  1PW1 A;  4KG5 A;  1NYY A;  5TFQ A;  1G68 A;  4Y13 A;  5CX7 A;  2GDN A;  4DXC A;  3IHB A;  1YT4 A;  4OVD A;  3KX0 X;  3HBR A;  3S7O A;  1M6K A;  4L0L A;  1Y4O A;  2WAD A;  3NOU C;  1GHI A;  5MC7 A;  3NEC A;  3PYP A;  4YOF A;  5DVA A;  2FFF B;  5F5Y A;  4GHI B;  4IVK A;  5EV0 A;  3CUE A;  3UE1 A;  1BUL A;  4JGP A;  1WYB A;  2XDM A;  3T4L A;  3DBA A;  4K08 A;  2V0W A;  5HL6 A;  4KZ8 A;  1PI5 A;  4UAA A;  2J8Y A;  3KO6 A;  1XJ2 A;  5FI2 A;  4X6T A;  5FQI A;  3KSH A;  4R4R A;  3IT9 A;  4EU0 A;  2W3H A;  2QMI A;  4LV2 A;  2H0Y A;  1IOU A;  2WK0 A;  3T4S A;  2EXA A;  1D06 A;  1BLS A;  4LCL A;  1JWV A;  2ZQC A;  4E04 A;  1OT6 A;  1IYP A;  5D3O A;  4F3L A;  5C5K A;  4R70 A;  2Q0O A;  1J3W A;  2HDQ A;  4NK3 A;  1J9M A;  3E98 A;  4D2O A;  3CPT B;  4ETX A;  4FSF A;  4Y5F A;  4PKY A;  4CLC E;  2X01 A;  2BLS A;  2PDR A;  3WS2 A;  4GKU A;  1IEL A;  2VGL S;  3ZQ5 A;  2R78 A;  3A3E A;  3GTC A;  5HPF A;  4OLD A;  4ZAM A;  4BD0 A;  2EFX A;  1BT5 A;  5HZH A;  4B4X A;  4XUX A;  3D4F A;  1QME A;  3PHY A;  2IWD A;  4DJ3 A;  3QNC A;  4N92 A;  1NJ4 A;  3E4Q A;  2DNS A;  3B47 A;  5LBR A;  4H8R A;  5AVE A;  3IXH A;  5HAI A;  5L07 A;  1L2S A;  1I2S A;  5L2F A;  4X68 A;  3ZNY A;  4JF4 A;  1NRJ A;  5CEB A;  3O87 A;  2Y2Q A;  1SCW A;  5EVI B;  3GSG A;  5HL1 A;  2HF6 A;  2VLG A;  1W8Q A;  3LO7 A;  2Y2H A;  4UQI M;  4IVI A;  4LRZ E;  3GRJ A;  1W63 M;  3IWQ A;  4Y7P A;  4RX3 A;  2XEP A;  1EI5 A;  3A3J A;  4BEN A;  2VV6 A;  3H82 B;  3ZG0 A;  4HHD A;  1XP4 A;  1MY8 A;  2VGK A;  1LL8 A;  3G34 A;  5EVE A;  4DDS A;  1AWI A;  1YLJ A;  1UWN X;  3O3V A;  5DKL A;  3SH9 A;  3W4O A;  1NWZ A;  1FR6 A;  2QWS A;  1GHM A;  1HVB A;  2ZOH A;  3HLF A;  2EX2 A;  3MFD A;  3GVB A;  3C30 A;  1HZO A;  1SKO B;  4KG2 A;  1OME A;  5DFY A;  2G2U A;  3WRZ A;  1VET A;  2QHK A;  3Q82 A;  5TBM A;  2XH9 A;  1PNE A;  5KSC A;  3NY4 A;  2O9B A;  2HPB A;  4ZTK A;  4CPK A;  1K55 A;  4BBT A;  1MKI A;  5CHJ A;  5AVF A;  4EXO A;  4GZB A;  4QJG A;  2LB9 A;  1OJ5 A;  3BQ8 A;  1NYM A;  3VOY A;  4RYE A;  2WYX A;  1YLW A;  4CLC A;  4O7D A;  3BFC A;  1P97 A;  3DW0 A;  4LGW A;  1D1J A;  4ESP A;  4EEU A;  2ZC7 A;  4HI4 A;  3SS5 A;  3TG9 A;  3PBO A;  2HDR A;  2V9A A;  3FKV A;  2JKR M;  4H6J B;  5E2F A;  1H8M A;  5EOE A;  1CEG A;  2EWW A;  4PMA A;  3HVF A;  5J7E A;  4HEF A;  4HY8 A;  5L8M A;  3VSK A;  2ZJ9 A;  4HBT A;  3N6I A;  4O01 A;  4GNU A;  4JXW A;  2MJ6 A;  2FFY A;  3TRC A;  1SDN A;  4LCM A;  2H28 A;  1E3U D;  4NXE A;  3UDF A;  5HWW A;  3IWI A;  3RTY A;  1GA0 A;  1YAX A;  2XGN A;  5FQQ A;  2A24 B;  2WGV A;  3QP5 A;  1ESI A;  4JF6 A;  3DTK A;  5DTT A;  4FD8 A;  1PZP A;  3ZYT A;  3C7U A;  2EWV A;  3M6H A;  1ZTU A;  2OAQ 1;  4HH2 A;  2JE5 A;  5GHZ A;  3LR4 A;  1TS7 A;  4EV4 A;  4Y0U A;  3F1P A;  3HUO A;  2UWX A;  4PM8 A;  4S2P A;  4JLF A;  2EX9 A;  1DRM A;  5EVI D;  2V1A A;  4KZ7 A;  1ZG4 A;  3BWL A;  4KQR A;  2RL3 A;  3C4O A;  4KUO A;  3FG8 A;  1KDW A;  5M19 A;  1DJC A;  1PFL A;  1ES3 A;  3DTE A;  2WGW A;  3IX8 A;  1K57 A;  2VKS A;  1S1Z A;  2W1R A;  5G4Y A;  2P04 A;  2Z6C A;  4OOY A;  3HCY A;  4JGO A;  2ZMA A;  3CWF A;  2ZL1 A;  1YPR A;  2O9A A;  2ZQA A;  2LB5 A;  5L10 A;  1N9L A;  4WLA A;  4Y0T A;  5FAQ A;  3F1O B;  4L9F A;  1ERM A;  5A93 A;  4HQA A;  4IUH A;  3IF6 B;  4S2L A;  3NDG A;  3MSH A;  1GSX A;  1MZU A;  3BEB A;  2B02 A;  1BUE A;  3OBF A;  2ZQD A;  1K56 D;  1K6S A;  4BQM A;  5FI7 A;  5KSH A;  1P9W A;  1NZO A;  1X0O A;  4B9O A;  1JTD A;  2V1Z A;  3S22 A;  2P74 A;  2ZMV A;  2V8C A;  3PBT A;  2ZOI A;  3QP4 A;  2QPN A;  3OCL A;  1RGY A;  4R1G A;  3MZF A;  4OPZ A;  1MWT A;  2YKH A;  3IS2 A;  3H7W A;  4NKP A;  4BL3 A;  2Z2L B;  3F1N B;  4EER A;  4R3J A;  3VE3 A;  3BY9 A;  3R7W B;  3IX4 A;  5AQ9 A;  1TS8 A;  3Q7V B;  4GOG A;  1W7F A;  3ZNT A;  5E2E A;  3UY6 A;  2KLI A;  3F1O A;  2ZLY A;  2Q9N A;  3PTE A;  4KEN B;  4XT2 A;  5FQ9 A;  3MS6 A;  5J3W A;  2HJ9 C;  3LYX A;  2JC7 A;  5HDS A;  1TD5 A;  3LR5 A;  4XXR A;  1YLT A;  1WYC A;  2P9V B;  3C5A A;  3G2Z A;  3NOP C;  1XKZ A;  3MBZ A;  1K4E A;  4MDZ A;  5GHX A;  3N8L A;  3SH8 A;  1IFQ A;  3AGE A;  3VP2 A;  3FC7 A;  1NZU A;  2BG1 A;  5CGS A;  4U0X A;  2C5W B;  4II7 A;  4PHT A;  4RQ9 A;  2ZC4 B;  5M18 A;  4BD1 A;  3PBN A;  5CGW A;  3Q81 A;  4E3O A;  3GMW A;  2JKG A;  4B88 A;  2IWC A;  2NUP C;  2K31 A;  4E3L A;  2PYR A;  1H0M A;  1ACF A;  3S7P A;  3Q7Z A;  4MN5 A;  1YSP A;  4EET B;  3A0R A;  5AQ7 A;  4UHU A;  1OPX A;  3ITB A;  4E3N A;  5HPI A;  5L09 A;  1D7E A;  3FPV A;  3WRT A;  4IJG A;  3I7J A;  3NBL A;  1S67 L;  1L0G A;  3IH9 A;  2XK1 A;  2VX8 A;  1NLZ A;  3Q1F A;  3T1X A;  3NOT C;  3VE4 A;  5F69 A;  3NI9 A;  3D72 A;  2JKT I;  1CF0 A;  3K3C A;  1KDS A;  2A49 A;  3PXP A;  1Z09 A;  3QHY A;  4S2O A;  3SOI A;  3JPU A;  1EWZ A;  3LFV A;  3UB5 P;  2J3T D;  2QJ5 A;  4LPZ A;  4Y2F A;  5EFW A;  3VFF A;  2Y2O A;  3CUE C;  3W2Z A;  3EEH A;  4GS9 A;  1KE3 A;  3NDE A;  1FCO A;  2PBD P;  2EFU A;  3IXG A;  4GDN A;  4UQI S;  4GD8 A;  1KOU A;  3IH8 A;  3N8S A;  3S7Q A;  4A5R A;  1K4F A;  1ERQ A;  4G3W A;  4F3L B;  4HNB A;  3IQA A;  5J8X A;  4L9E A;  2AVX A;  1KVM A;  3E4O A;  4UA6 A;  5GLD A;  3A0S A;  3T4J A;  2JHE A;  4I3J A;  5FI6 A;  1YLY A;  3UE3 A;  3K2N A;  4MNR A;  1BTL A;  4NEE D;  1TF1 A;  2I72 A;  2Y2J A;  4YIN A;  3KYE A;  1JTG A;  5FSR A;  4G3K A;  5FQK A;  4R0Q A;  1ES4 A;  2QJ7 A;  4ARZ A;  1OTI A;  1DJA A;  1MXO A;  1OTE A;  2Z6D A;  4P87 A;  5HAP A;  3UE6 A;  5E43 A;  2ZM8 A;  5EM1 A;  4OPQ A;  5CER A;  3O5Y A;  2D02 A;  4Y0O A;  3PAG A;  3T1Q B;  4DDY A;  4KZ3 A;  5DF8 A;  4S2J A;  5DJU A;  2HDS A;  1MC0 A;  1PWC A;  1PIO A;  3HLG A;  1RCJ A;  2EXB A;  1XA7 A;  2WGI A;  4NXF A;  1F98 A;  4ZJ3 A;  3T4K A;  1RP5 A;  3C7V A;  1ZG6 A;  3G30 A;  5FQM A;  3JYI A;  4K0X A;  3UN7 A;  3CG5 A;  3RXW A;  4MN6 A;  5HAQ A;  1CJF A;  3H9W A;  5AQA A;  3OPR A;  2G7U A;  5CRF A;  1K54 C;  1PI4 A;  3MXS A;  1MWU A;  3WS1 A;  4FH2 A;  3OPP A;  1CEF A;  2PBY A;  1VET B;  2J9P A;  1T1B A;  5TBM B;  4RA7 A;  3P01 A;  1VM1 A;  5DFX A;  1PZO A;  4I38 A;  2ZD8 A;  1VQQ A;  2UV0 E;  3ZVT A;  2W0N A;  3E2L A;  4X25 A;  3U2A A;  4JGQ A;  2W3F A;  1RGZ A;  5EVI C;  2DCF A;  3W4Q A;  4CLC B;  2J7V A;  3EWK A;  3PAE A;  2CC1 A;  4C6Y A;  3M6B A;  3MQQ A;  4KZA A;  4ZDX A;  3A3I A;  5TR7 A;  4MCW A;  1YLP A;  3WWX A;  1NRF A;  2WUQ A;  4EUV A;  3LI9 A;  4AFI A;  1IYS A;  4OQ0 A;  4E3J A;  2HZ5 A;  2XRO A;  2G2W A;  2ZM0 A;  2L4R A;  5GLB A;  4JXV A;  3UB9 A;  3NUL A;  4X56 A;  1E3U A;  1MPL A;  2INW A;  4X1M A;  5EPH A;  3MFX A;  1OT9 A;  2L1M A;  1N9B A;  1T18 A;  4HBU A;  1VEU A;  1ESU A;  1S0W A;  2V0U A;  4B4Z A;  4DXB A;  2V20 A;  1JWP A;  4NG2 A;  1E25 A;  2HP6 A;  4OON A;  2PU2 A;  4OH0 A;  3BEC A;  4O8G A;  5AQB A;  4MBH A;  1ODV A;  4WZ5 C;  1PYY A;  3C8C A;  3VMA A;  5FDH A;  4WEJ A;  5FAO A;  4G3V A;  5TJJ A;  2O0Y A;  4P0M A;  5JYP A;  3ZDJ A;  2DMW A;  4ZJ2 A;  3F1P B;  4E3K A;  2VK3 A;  4WYY A;  2WZX A;  1TS0 A;  3MXQ A;  1I2W A;  3RXX A;  1XGI A;  4ID4 A;  5HSQ A;  3MQO A;  1FR1 A;  5CTM A;  1G6O A;  2Y55 A;  5F1G A;  5KIZ A;  2WGW B;  3V39 A;  4GB7 A;  3MF0 A;  3LCE A;  1DP8 A;  4D60 A;  4HH3 A;  4WUJ A;  2PR5 A;  2ZL1 B;  1H3Q A;  3E2K A;  4JXG A;  2VGJ A;  3N8R A;  1L0E A;  2Y91 A;  4EBL A;  3OPL A;  3MXR A;  1S4S A;  1W8Y A;  3W4P A;  1W79 A;  1SHV A;  3O88 A;  3DWK A;  3UB7 A;  3BFF A;  3TOI A;  3T1R A;  3MKF A;  3FYZ A;  2XA7 M;  3ULF A;  1BSG A;  2B95 A;  2J3W A;  5CGX A;  1ES2 A;  3NJA A;  5CEC A;  3L7H A;  4EQI A;  3IS2 B;  3H7W B;  1IKI A;  2HP5 A;  3OLO A;  3LID A;  5HFO A;  3B3X A;  4RVA A;  3HLW A;  3CHW P;  4S2N C;  3MMH A;  3HLD A;  4CLC D;  4Y17 A;  5G4Z A;  4GN2 A;  5BOH A;  5HAR A;  2Y2P A;  2A2L A;  5FDS A;  1ZC2 A;  2KDK A;  4KUK A;  1S6R A;  1V9Z A;  1XFQ A;  2FZ0 A;  4K0W A;  4BMW A;  4Z9Q A;  4XT2 B;  4Q8I A;  2ZBB A;  3ZCZ A;  3ISG A;  3E4P A;  4X53 A;  1STZ A;  2XF3 A;  3VP1 A;  2W1T B;  3IF6 C;  5KZH A;  4EBN A;  4QB8 A;  4OQH A;  3UMD A;  5FAT A; 
#chains in the Genus database with same CATH homology
 1YSQ A;  1S67 L;  5HDC A;  4ETX A;  4FSF A;  4Y5F A;  4PKY A;  4CLC E;  2PDR A;  2M1C A;  3JVV A;  2PD8 A;  1EW0 A;  2J3T C;  2VX8 A;  1NLZ A;  4HJ6 A;  2VGL S;  3A0V A;  3ZQ5 A;  3ICY A;  3NOT C;  4IUK A;  2R78 A;  3VE4 A;  2VGL M;  5F69 A;  5HPF A;  4I3I A;  3D72 A;  3CAX A;  2JKT I;  5HZH A;  2QKP A;  3K3C A;  3PHY A;  4DJ3 A;  4PAU A;  2M7U A;  3PXP A;  2PR6 A;  3LFV A;  2OAP 1;  3EQV A;  3E4Q A;  2J3T D;  2QJ5 A;  3B47 A;  5LBR A;  4LPZ A;  4R6L A;  3MQ0 A;  5AVE A;  4Y2F A;  5EFW A;  2VV7 A;  3CUE C;  5DJT A;  3W2Z A;  2FH5 A;  3HJI A;  3EEH A;  1OTB A;  4HJ3 A;  1NRJ A;  4GS9 A;  3EQU A;  4ETZ A;  3KYQ A;  1XJ3 A;  3MJQ A;  5DKK A;  4UQI S;  1GSW A;  2HF6 A;  2VJW A;  2VLG A;  2W1T A;  4UQI M;  2V1B A;  1KOU A;  4LRZ E;  3S7Q A;  3BQA A;  1W63 M;  4EEP A;  4G3W A;  1S66 L;  4GJ4 A;  4F3L B;  4HNB A;  1F9I A;  2OOL A;  4L9E A;  4Q0H A;  5A8B A;  3E4O A;  1XJ6 A;  5HD5 A;  2VV6 A;  3H82 B;  4HHD A;  3A0S A;  2K2N A;  3T4J A;  4BJP A;  2JHE A;  4I3J A;  1LL8 A;  4EES A;  3T4O A;  3UE3 A;  3K2N A;  1UWN X;  1XJ4 A;  2CMN A;  5DKL A;  2O9C A;  1NWZ A;  4NEE D;  1TF1 A;  4H6J A;  2QWS A;  1W63 Q;  1S4R A;  4WEK A;  2ZOH A;  3PBS A;  5HWV A;  4OOM A;  4G3K A;  5K5B A;  4ME4 A;  4LLO B;  1UWP X;  1T1C A;  4Q0I A;  3HJK A;  2KOI A;  2PT7 A;  2QJ7 A;  3BY8 A;  3PBR A;  4ARZ A;  3C30 A;  1OTI A;  1OTE A;  2Z6D A;  3PR6 A;  2D01 A;  5DFY A;  2QHK A;  3UE6 A;  3IBJ A;  5AJG A;  3LIA A;  2XRN A;  5TBM A;  3KSG A;  3O5Y A;  2D02 A;  2GZA A;  4L9G A;  2O9B A;  2GJ3 A;  3E0Y A;  2XSS A;  3B33 A;  5IS1 A;  3KSI A;  5IU1 A;  4GS9 B;  4BBU A;  4BBT A;  5DJU A;  1MC0 A;  2BAS A;  4O0P A;  2VZW A;  2J80 A;  1F5M A;  5AVF A;  4EXO A;  2LB9 A;  1OJ5 A;  1XFN A;  3BQ8 A;  4NXF A;  4CLC A;  1F98 A;  2A24 A;  3T4K A;  1P97 A;  3SW1 A;  2O99 A;  4ZRR A;  2Y8H A;  2HGV A;  1GSV A;  3EGD C;  4P6Z S;  2HV1 A;  3MR0 A;  4EEU A;  4P6Z M;  2HJE A;  3CIT A;  4HI4 A;  4MN6 A;  4LRY C;  3H9W A;  3PBO A;  2G7U A;  3UME A;  2V9A A;  4HOI A;  2JKR M;  4H6J B;  1BYW A;  2M7V A;  3VV4 A;  2PD7 A;  2IA2 A;  4OOL A;  4QPR A;  1H8M A;  2EWW A;  5F68 A;  1VHM A;  4ARZ B;  3RH8 B;  5J7E A;  3CLO A;  3EOI A;  3JVU A;  3EEA A;  3E98 A;  1ZHH B;  3K3D A;  4HY8 A;  4NXB A;  5L8M A;  1T1B A;  5TBM B;  3P01 A;  5DFX A;  4O01 A;  4I38 A;  2VV8 A;  4EQ1 A;  2W3G A;  3C2W A;  4IHQ A;  2MJ6 A;  2W0N A;  3U2A A;  3TRC A;  4JGQ A;  5I5L A;  1LSV A;  1DP9 A;  2H28 A;  2W3F A;  3BW6 A;  4NXE A;  5HWW A;  3RTY A;  1YAX A;  4CLC B;  3EWK A;  2A24 B;  2GX5 A;  1LSW A;  3MQQ A;  4UEY A;  4MCW A;  3ZYT A;  2EWV A;  1ZTU A;  2OAQ 1;  1N9N A;  3LI9 A;  4HH2 A;  2NUT C;  3LIC A;  3LR4 A;  4HP9 A;  1TS7 A;  4AFI A;  4EUV A;  5DF9 A;  3F1P A;  3EGX C;  1NLY A;  3LIE A;  1DRM A;  2V1A A;  3F1N A;  5HWT A;  2XRO A;  3BWL A;  3UB6 A;  3S7N A;  4WF0 A;  3R7W A;  3R4K A;  2L4R A;  3PBQ A;  3TW8 A;  5J4E A;  3TE8 A;  1P9R A;  2VEA A;  2YKF A;  3UB9 A;  4KUO A;  3FG8 A;  4CQH A;  3LR3 A;  1TS6 A;  4YWZ A;  2OWH A;  1DP6 A;  2INW A;  4Y3I A;  2VKS A;  1S1Z A;  2W1R A;  5G4Y A;  3C38 A;  2P04 A;  1OJG A;  3MFX A;  1WA9 A;  2Z6C A;  1OT9 A;  3HCY A;  4JGO A;  2L1M A;  3CWF A;  1T19 A;  4I39 A;  1N9O A;  2O9A A;  1T18 A;  4WEL A;  3VOL A;  2LB5 A;  1UGU A;  1N9L A;  3OC2 A;  4WLA A;  5HDD A;  1VB6 A;  2V0U A;  3F1O B;  4L9F A;  4HQA A;  4IUH A;  2I9V A;  1OTA A;  1GSX A;  1MZU A;  2WKQ A;  2B02 A;  3OBF A;  4YNR A;  5KSH A;  3KYZ A;  3LI8 A;  3RFB A;  3KSF A;  2W27 A;  1P9W A;  4O8G A;  1X0O A;  4B9O A;  1Y28 A;  1ODV A;  2PYP A;  2ZMV A;  3C8C A;  3PBT A;  2ZOI A;  3OCL A;  4KQD A;  2JKR I;  2OWJ A;  4WEJ A;  4G3V A;  5TJJ A;  4M4X A;  2O0Y A;  4Q0J A;  2PHY A;  2QYB A;  2DMW A;  2YKH A;  3IS2 A;  2ZMF A;  3H7W A;  4NKP A;  1MKM A;  3TJZ C;  3T4T A;  3F1P B;  4MN7 A;  3FPW A;  5FL3 A;  4GLQ A;  4GHI A;  3F1N B;  4EER A;  3VE3 A;  3BY9 A;  4WN5 A;  1OTD A;  3LR0 A;  5F6A A;  5IT5 A;  1TS0 A;  3R7W B;  3MXQ A;  2GNX A;  1TS8 A;  4FOF A;  3CI6 A;  4WL9 A;  4KQO A;  5HSQ A;  2Y79 A;  1G6O A;  2WKP A;  3MQO A;  4R38 A;  4I5S A;  5KIZ A;  3P7N A;  2L0W A;  3T50 A;  1P0Z A;  3MF0 A;  2JKT M;  2KLI A;  1DP8 A;  3UB8 A;  3NHQ A;  3F1O A;  4I3A A;  4BBV A;  1LSX A;  4HH3 A;  4WUJ A;  2PR5 A;  4DMZ A;  2K7S A;  5HD3 A;  2JN7 A;  4B93 A;  2VA0 A;  1H3Q A;  4Z1W A;  4XT2 A;  5J3W A;  2HJ9 C;  2W3D A;  3V67 A;  1YKD A;  4LRX C;  3OCN A;  2P7J A;  3LYX A;  1V9Y A;  5HDS A;  4GW9 A;  2B18 A;  1S4S A;  1LT0 A;  1TD5 A;  3LIB A;  3LR5 A;  1JNU A;  4DJ2 A;  5CX7 A;  3UB7 A;  3B42 A;  4HP4 A;  4MMN A;  3OOV A;  2XA7 S;  3NOP C;  2XA7 M;  3ULF A;  3KX0 X;  4MDZ A;  3S7O A;  2W3E A;  3IBR A;  4CLC C;  2J3W A;  4L0L A;  1IFQ A;  3FC7 A;  3NJA A;  4DN0 A;  3NOU C;  3IS2 B;  3H7W B;  5MC7 A;  3PYP A;  4YOF A;  4EW7 A;  2WKR A;  5F5Y A;  3OLO A;  4GHI B;  3LID A;  3CUE A;  4HIA A;  3G6O A;  4JGP A;  4PHT A;  4II7 A;  4JGR A;  4RQ9 A;  3T4L A;  3MMH A;  4BWI A;  4CLC D;  3DBA A;  3GDI A;  4K08 A;  2V0W A;  3PBN A;  5HL6 A;  4PKY G;  3LUQ A;  4HJ4 A;  2KX6 A;  3KO6 A;  5G4Z A;  1XJ2 A;  4NXG A;  2NUP C;  2K31 A;  2A2L A;  3KSH A;  2PYR A;  2KDK A;  1T1A A;  4EU0 A;  2W3H A;  4KUK A;  1V9Z A;  1XFQ A;  2FZ0 A;  3S7P A;  4BMW A;  1IOU A;  4XT2 B;  4MN5 A;  3LIF A;  1YSP A;  3D3O A;  3T4S A;  4EET B;  3A0R A;  1D06 A;  2ZBB A;  1OPX A;  3T4Q A;  3E4P A;  4R3A A;  1STZ A;  3BJN A;  1S1Y A;  5HPI A;  4E04 A;  2W1T B;  1OT6 A;  1D7E A;  1G28 A;  3FPV A;  2EA9 A;  4F3L A;  5C5K A;  4R70 A;  4IJG A;  4GCZ A;  2P08 A;  3UMD A;  3H82 A;  3GEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...