3PYPA

Photoactive yellow protein, cryotrapped early light cycle intermediate
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure at 0.85 A resolution of an early protein photocycle intermediate.
pubmed doi rcsb
molecule tags Photoreceptor
molecule keywords PHOTOACTIVE YELLOW PROTEIN
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1998-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3pypA00
4R38A 1V9YA 1OTEA 2D01A 3C8CA 1OJ5A 3MFXA 5J7EA 1BYWA 1T1CA 2PDRA 1S1ZA 4LRYC 3K3CA 1LT0A 1S4SA 3BY8A 2V0UA 4GS9B 2HV1A 4F3LB 5AVFA 2OOLA 4HNBA 4I3AA 2WKQA 1XFQA 2PYRA 1S66L 4F3LA 4R6LA 2I9VA 1S67L 2OWJA 1LSXA 1S1YA 3CLOA 4NXEA 5DKKA 4M4XA 3HJKA 3NOTC 4LRXC 3RH8B 4NXGA 4EEUA 3F1OA 4WF0A 4MN5A 3H82B 1DP9A 1VB6A 3P7NA 3MXQA 4NXBA 4R70A 3MJQA 3MR0A 4EESA 3LI8A 2B02A 3ICYA 4WUJA 1D7EA 3NJAA 2QJ5A 5DJTA 4EXOA 5HWVA 2V9AA 3G6OA 5A8BA 3LIDA 4HH2A 3PHYA 2M1CA 3SW1A 4GCZA 4I38A 4EERA 4I3JA 2P7JA 5AVEA 5G4YA 2A24B 2EA9A 4LLOB 5HDSA 4B9OA 4E04A 4GHIB 3D72A 3K3DA 5F68A 1GSVA 2PR6A 1LSVA 1T1BA 3A0VA 3FC7A 4K08A 3F1PA 3ZQ5A 1Y28A 5F6AA 3A0SA 3E4OA 4HI4A 1JNUA 5TBMA 2D02A 3KX0X 4JGOA 4KUOA 4HQAA 1MZUA 5I5LA 2V1BA 2PR5A 2R78A 4L9GA 3VE3A 1OT9A 1XJ4A 1TS8A 1DP8A 2PD8A 5IS1A 2QWSA 3E4PA 4HH3A 4XT2A 4WN5A 3OLOA 1F98A 2VV7A 3UB8A 2JN7A 3LUQA 2WKRA 1LSWA 3CAXA 4LPZA 4HJ4A 3PYPA 5HD5A 2YKFA 3F1NA 3GECA 1G28A 4GS9A 4GW9A 2V0WA 1X0OA 2VLGA 1DP6A 3VOLA 3EWKA 4BBTA 5HDDA 1OT6A 1WA9A 3LI9A 3LIFA 1EW0A 2VEAA 4XT2B 4H6JB 1LL8A 2JHEA 2PHYA 4BBVA 3HJIA 3A0RA 4WL9A 2Z6DA 3ULFA 4KUKA 1D06A 3B33A 1V9ZA 2QHKA 5J3WA 1GSXA 4PKYG 4RQ9A 5G4ZA 1P97A 1GSWA 2BASA 3LIEA 4DJ3A 3LIBA 3NOPC 4DJ2A 2ZBBA 3RTYA 4L9FA 4I5SA 2CMNA 3BWLA 2W0NA 1F9IA 5HDCA 2QJ7A 2YKHA 5F69A 2KX6A 4HP4A 1XFNA 3T50A 1TS0A 2A24A 4HY8A 1OTIA 2K7SA 2V1AA 5DKLA 2PYPA 3UB7A 5HZHA 3IS2A 2J80A 2INWA 1OTAA 2PD7A 4KQDA 3BY9A 3MQQA 3F1PB 3MQOA 3LICA 5HWTA 3EEHA 5DJUA 3IS2B 4NXFA 1XJ6A 4HP9A 4HOIA 2VV8A 4HJ3A 5HWWA 2L4RA 3H82A 1XJ3A 1TS6A 3F1OB 3IBRA 1DRMA 3UE6A 4LRZE 4JGQA 5EFWA 3UB9A 4L9EA 3GDIA 4YWZA 5F5YA 5KIZA 1OTDA 3C2WA 3UB6A 4R3AA 1UWPX 4PKYA 2W27A 4H6JA 4HHDA 1KOUA 2ZOIA 3LIAA 1N9LA 1P0ZA 1S4RA 4JGRA 5TBMB 4EEPA 4EETB 1OTBA 1ODVA 3H9WA 2L0WA 4WLAA 4HJ6A 1OJGA 5HD3A 3CWFA 4GHIA 4EW7A 1XJ2A 4JGPA 3UMEA 3NHQA 3NOUC 4I3IA 2KDKA 5IU1A 3VE4A 1T1AA 2ZOHA 1UWNX 3E4QA 2L1MA 1N9NA 4EQ1A 3UMDA 1TS7A 5HSQA 3H7WA 4I39A 2WKPA 2GJ3A 2H28A 1T18A 3F1NB 3FG8A 2VV6A 1NWZA 2OWHA 3H7WB 1UGUA 4MN6A 1T19A 1N9OA 4BBUA 2Z6CA 5J4EA 4HIAA 3LYXA 2QKPA
chains in the Genus database with same CATH superfamily
2FZ0A 1K57A 2Y2MA 3VOZA 1M40A 4HNBA 4LV1A 1JWZA 4X69A 3CLOA 3A3EA 4X56A 3CI6A 3N8SA 5AQAA 3OPHA 2HDRA 1BT5A 3C4PA 5HDSA 2A24B 2EA9A 2Y59A 1GSVA 3VP4A 1XJ4A 2KOIA 3UB8A 4B4XA 3VP2A 5E2EA 4RYEA 2X71A 4LV0A 4MMNA 5FQJA 4OQIA 2FFFB 1WYCA 2PU4A 3LIFA 1OMEA 1W63Q 4RX2A 4JPMA 3OPRA 2QHKA 1GSXA 5F1GA 1L0FA 2XGNA 5FI2A 1NRJA 5HX9A 2CMNA 4JF6A 4MDZA 1GCEA 2J80A 2PT7A 3T1SA 5E2HA 3PBTA 3LR0A 2ZM2A 1P9WA 1XJ3A 3IBRA 4BJPA 4C3QA 1NXYA 2W3DA 1FSYA 4QU3A 1ES3A 1DJCA 5EVIC 1YMXA 3U4LP 1T1AA 3PTEA 3PR6A 1YLWA 3GVBA 3HLFA 1YSQA 3HUMA 4GOGA 4ZAMA 5CGXA 3C4OA 4PM5A 1H8ZA 3Q07A 4BBUA 3PXPA 3LYXA 1ZKJA 1L0GA 5J7EA 3TJZC 3PBQA 4OQ0A 2WZZA 3GSGA 1O7EA 4EQIA 2AVXA 4OPQA 2XDMA 3BFFA 3IXGA 3KYZA 3F1OA 5EFWA 3MXQA 3MF0A 4WUJA 3G30A 3O86A 1FR1A 4ZBEA 5C5KA 3LY3A 3MMHA 2DMWA 3T4LA 4GHIB 2HJ9C 4EQ1A 5F6AA 5FEFA 4IVKA 3KX0X 1H8MA 2Y8HA 5BOHA 2V1BA 2VX8A 1DJBA 3UN7A 3EOIA 3PAGA 1K0KA 3OLOA 4MBFA 3VV4A 1BLPA 4II7A 4WMCD 2X01A 4EV4A 3PAEA 2ACGA 5CGSA 2NUPC 4WL9A 3S7QA 4DJ3A 2GZAA 4ZDXA 1KE3A 5K5BA 5HL1A 2G2WA 3IWOA 5HZHA 3CHWP 3BM6A 2P9VA 4LENA 4JXVA 4DDYA 2P9VB 3B42A 1L0EA 4HP9A 2IWCA 4HBTA 3MKEA 1CI9A 2B5RA 5EV0A 5EPHA 3VSLA 3A3DA 1CK3A 2WKEA 3S7PA 5HAQA 2W3HA 4IUKA 1OTBA 2DNSA 5G18A 3CPTB 3BFCA 2WAFA 5FQIA 5HAIA 4CLCC 3Q7ZA 1TS7A 1NRFA 4Y5FA 2H28A 2V20A 3AGDA 4OP8A 4Y17A 1T19A 2WADA 1K4FA 4ARZB 3WRTA 1PZPA 4N92A 4P0MA 2PDRA 4HEFA 4GS9B 2HV1A 5FASA 1S0WA 1YSPA 5E2GA 4LRXC 1Q2QA 3GTCA 2M7VA 1PFLA 4YINA 3BEBA 2B02A 3NDEA 5HPFA 4Z9QA 3IX3A 1H8YA 4KZ8A 4NETA 3K3DA 3ZQ5A 5E43A 2WUQA 1K55A 1SKOB 1PW1A 4P6BA 4XT2A 3ZG8B 3ZFZA 3D9YA 2EX8A 2ZM8A 2IWDA 4ZTKA 4E6WA 1EROA 5EM1A 5KSCA 2B95A 1EW0A 2E8IA 1H0MA 3ULFA 3B47A 2VK3A 4E3LA 3RTYA 5HDCA 1YM1A 5F69A 4HY8A 4OOLA 3UB7A 2ZMVA 4KZAA 1KGEA 3GV9A 2OLVA 1ACFA 3R7WA 2PD7A 3BYDA 4NXFA 4CLCD 1F5MA 4LFUA 2HP6A 4G3VA 2HPBA 4N9LA 3UB9A 2HGVA 1ZHHB 3O5YA 1QMFA 1GHMA 4JGRA 1QMEA 3H9WA 3NOUC 1PI5A 4E3IA 5CTMA 3T4KA 4IEDA 3W4OA 4Y0OA 4S2KA 4XUXA 3HLBA 1HTZA 3KSHA 2ZMFA 3MFXA 1OTEA 5AQ9A 5L10A 2W3FA 3OPPA 5TJJA 3CJMA 1S66L 3OC2A 4IBRA 4A5RA 3V3RA 2QMIA 1IKIA 1RGYA 4I38A 5E2FA 1PRQA 1P9RA 4HI4A 3T50A 3PBNA 2H0YA 4L9GA 4P6ZS 3TG9A 2KLIA 5IS1A 3AGEA 4FCFA 2BG1A 4LPZA 1XA7A 3N8RA 4O7DA 3ZHHA 4XT2B 2B18A 4U3TA 3GR2A 1K56D 4QD4A 4RQ9A 5FEGA 5F83A 5FDSA 3LEZA 1FIKA 4QJGA 3A3FA 3VSKA 2EFUA 4RA7A 3RJUA 5AQBA 1K6RA 1XFNA 1TS0A 5CEDA 4EUZA 5IT5A 2XD5A 3BY9A 5DF7A 4S2NC 3P09A 2VV8A 3DWKA 1KVLA 3T1RA 1MWSA 1SZVA 3R7WB 3ZGAB 1YLPA 1XXMA 4KQQA 4GHIA 2WGWB 1PIOA 5J8XA 3A3JA 3VE4A 2UV0E 4UQIM 4KQRA 1UWNX 3FG8A 5D3OA 5FAOA 2J9OA 1MKMA 4R3JA 4HIAA 3WRZA 4Y7PA 4LV2A 3BFDA 3K3CA 3NBLA 3VP1A 4F3LA 1G68A 1S1YA 4M4XA 3NOTC 4R70A 2ZC3B 2Y55A 3JPUA 1ESIA 5HW3A 4LLOB 5HL6A 3D72A 1PWCA 4K08A 4BD1A 4WELA 5KMWA 5CECA 2I72A 5I5LA 4PAUA 1TS8A 1E4DA 2ZC4B 3E4PA 4R0QA 1YPRA 1TVFA 1PWGA 1W8YA 1LSWA 2O9AA 2OSUA 1CEFA 3BLSA 3G34A 2HF6A 3F1NA 1G28A 5A90A 3V39A 3O87A 4BBTA 3D3OA 1OT6A 2NUTC 4JLFA 5CGWA 3M2KA 1P97A 3M6BA 2ZC6B 4S2PA 3SS5A 2G2UA 3HUOA 3L9KA 3B3XA 4E3MA 4IBXA 3VOYA 3T1QB 3LR4A 2HDQA 4U0TA 5IHVA 4DE3A 5FQKA 1JTGA 2XRNA 2DRWA 2JKFA 3TRCA 2L4RA 1W79A 5A92A 3JVUA 5CX7A 2XA7S 1K57C 1BLSA 3WS2A 1AXBA 1OJGA 4PMAA 1N9NA 3IWQA 3UDXA 4I39A 1T18A 3H7WB 2P74A 3QHYA 2ZL1B 1V9YA 1GHPA 1BYWA 4LRYC 2V0UA 2OOLA 4NXEA 3LFVA 1L0DA 1IEMA 3HJKA 2JCHA 3HLCA 3MXRA 3UB5P 2MJ6A 3IX4A 5GLBA 3WWXA 2QJ5A 1AWIA 4HH2A 4WBGA 3MXSA 5A91A 1FCMA 3NECA 1NJ4A 1VQQA 4H8RA 5TFQA 3A0VA 4D2OA 3UE3A 4DRTA 2BTFP 1G6AA 2D02A 4HQAA 1GHIA 1W63M 2LB5A 3BQ8A 3LEQA 3ZCZA 1XKZA 3RXWA 4PM8A 1U60A 3IXDA 3G31A 1NY0A 3T4OA 3UE0A 2VEAA 5M19A 5EOEA 1IYPA 2Y2IA 1VM1A 2E8JA 2Y2GA 3HREA 1OTIA 1HZOA 4WMCA 1MY8A 3WS0A 1CI8A 3M2JA 2XR0A 4JKTA 1TS6A 2K2NA 3WS5A 4QPRA 5FI6A 2W27A 4EERA 4IVIA 4C75A 4OPRA 4UAAA 3OCLA 4ETZA 2GNXA 4O0PA 1IOUA 5FQQA 2HDSA 2XK1A 4BWIA 2GJ3A 4X68A 5GHZA 5U47A 4G3WA 1ES2A 4EU0A 4P6ZM 5EOOA 2CC1A 3JVVA 3LR3A 2Y2JA 4KZ3A 3ZG5A 3HLEA 4ME4A 2HP5A 2XQZA 1SKOA 1I2WA 4EBPA 3IH9A 3RFBA 2JBFA 2EWWA 4MN5A 4WZ5A 1YQSA 4WYYA 3QP1A 1NLYA 3VFFA 1NLZA 3BRMA 4I3JA 1VETA 5EVIB 5GLAA 3SS4A 4OP5A 3IHAA 3F1PA 3MS6A 3MBZA 3A0SA 5CTNA 1MZUA 2ZQCA 1F98A 5GLDA 4HJ4A 2Z2LB 5GHYA 4OH0A 1F2KA 3LI9A 3NIAA 1LL8A 1VHMA 1D06A 3B33A 4M3KA 2EWVA 3P98A 2BASA 2ZBBA 3DTEA 1XA1A 4O01A 3DW0A 2PYPA 3IS2A 4CJNA 3LICA 5AQ7A 2XFSA 4EBLA 1MPLA 3GDIA 5TBMB 1FCOA 3SH9A 5TR7A 4HJ6A 4ETXA 3IHBA 2ZOHA 3Q81A 1ZTUA 3IF5A 2Y2KA 4E3NA 5TGFA 2EXAA 2VV6A 1K38A 1BLHA 3HVFA 1N9OA 1KGGA 4UA9A 4R38A 2XA7M 1K55C 1CF0A 1XGIA 4KENB 3LI8A 4RVAA 2P08A 1ONGA 3QNCA 5HARA 4DN0A 5AVEA 4B9OA 5DFXA 1CEGA 4FSFA 1KDWA 2Y2OA 4GNUA 3BFEA 3FV7A 4G3KA 1DP8A 4GLQA 3Q7VB 3LY4A 5FL3A 3BFGA 5FSRA 4DMZA 5DTTA 4PPRA 5CHJA 4MEZA 1DP6A 2O0YA 2RL3A 2ZL1A 2QZ6A 4LCMA 4C6YA 2Q0OA 3D4FA 1JVJA 5G4ZA 1NYMA 2WAEA 4DE2A 1YLJA 4YNRA 2RCXA 1K25A 2A24A 4Y3IA 1VEUA 4KZBA 5HPIA 3HBRA 1YT4A 1PNEA 3DTKA 2Q9NA 2XSSA 2EFXA 2XEPA 3OPLA 4DKIA 1Y54A 4PHTA 4X1LA 2L0WA 1WYBA 4Y13A 3CWFA 3KSIA 5IU1A 4U0XA 3E4QA 4FOFA 3G2ZA 2WK0A 2ZM0A 5HSQA 1NZUA 2WKPA 3HCYA 4QHCA 3WS4A 3QP8A 4HOIA 4K0WA 2D01A 1N4OA 3C8CA 4HBUA 4GKUA 1YMSA 4I3AA 2I9VA 2GX5A 3KO6A 3CMZA 3SH7A 3UPOA 2JKTI 2G7UA 4NXBA 4X25A 3MJQA 3ZNTA 3NJAA 1ZG4A 5DJTA 2M1CA 3BJNA 2IWBA 3V67A 3EQUA 2PR6A 2VZWA 4EEUA 3VMAA 3E4OA 1PWDA 1KE0A 1TF1A 1KVMA 3IQAA 4S2IA 4Q0HA 2A2LA 4CPKA 5M1AA 4IUHA 3FPVA 1HD8A 3HLWA 4KG6A 3VOLA 4H6JB 2DCFA 2Z6DA 1IYOA 4HESA 2OLUA 4FH4A 3CG5A 1XP4A 2ZQAA 4N1HA 2J3TC 4IJGA 2Q9MA 3NDGA 1LI9A 5FDHA 3SZTA 3KSFA 1S6RA 4R3BA 2FFYA 2M7UA 2FH5A 1E3UD 3NC8A 5F1FA 4BD0A 3N4IA 1E25A 1DRMA 2JE5A 4KG2A 3CITA 1IYQA 4BL3A 1UWPX 1BZAA 1BUEA 3JYIA 4JGPA 3UY6A 3O88A 3SS3A 2J8YA 3LO7A 1EWZA 4GDNA 2QKPA 4YWZA 1IYSA 1YKDA 3HLDA 5L2FA 2WZXA 1XFQA 4FUWA 3MZFA 3T4TA 4E6XA 3FZCA 3IBJA 4NXGA 1BTLA 2C6WB 1N9BA 3HL9A 4PM7A 3I7JA 5FATA 2JC7A 3ZYTA 2V9AA 5G4YA 4JXSA 4AFIA 4E04A 5L8MA 5TBMA 4KUOA 4NKPA 1H5XA 1D1JA 2QWSA 3QP4A 4HH3A 2JN7A 2Y2PA 4CQHA 3NCKA 5HD5A 1HLUP 4GS9A 3OCNA 1O07A 5HDDA 4DXCA 4ARZA 2PHYA 5J3WA 3NI9A 3A3IA 3NOPC 4DDSA 3C7VA 2W0NA 1F9IA 5EVLA 4FTXA 2YKHA 4OPYA 2VGKA 1I5QA 1OTAA 3IF6C 1YLZA 3S1YA 2P04A 2XROA 3IT9A 3MQ0A 5CERA 3TW8A 3F1OB 4XUZA 4E3OA 4BLMA 1OTDA 4EUVA 5CEBA 4GN2A 5KSHA 1K54A 4IHQA 5EUAA 3LR5A 3M6HA 2ZD8A 4I3IA 5HAPA 3UMDA 4B88A 3OBFA 3QNBA 4WZ4A 5I94A 4DXBA 2ZQDA 3E2KA 1S1ZA 2LB9A 5DTKA 1E3UA 2WKQA 2ZQ7A 1FQGA 2PAVP 1LSXA 2ZC7A 1ERMA 4BENA 4B4ZA 5GLCA 5A8BA 2ZC5B 3LIDA 4LGWA 3KYQA 4O8GA 2X02A 3FC7A 5HWVA 3W4PA 5DFYA 3CZDA 1PYYA 2EX6A 4WM9A 2WGVA 2VLGA 2PBYA 1WA9A 5F68A 3SOIA 2ZJ9A 5CXWA 1Q2PA 4ZRRA 4DJ2A 4NG2A 2ZMAA 4KZ6A 5GHXA 4HP4A 5DKLA 2V1AA 2V8CA 3ZG7B 5HWTA 3IXHA 2O99A 2O9BA 4X1MA 3S22A 4N9KA 1SDEA 3H82A 2A3UA 4DE1A 5FI7A 4E3JA 3MSHA 4YOFA 4P87A 4HHDA 1FCNA 2ZOIA 3LIAA 4RX3A 1A0KA 3K2NA 4DF6A 4WLAA 3FYZA 3VP3A 1JWVA 5FQ9A 4S2MA 3NHQA 2W3GA 1SHVA 1RGZA 1OPXA 4NEED 4UA7A 2W1TB 5F5YA 5M18A 4R3AA 4H6JA 1Z6FA 1TDLA 2WKHA 4KZ7A 4WEJA 2O9CA 1BLCA 4Q0JA 4FD8A 3BW6A 3ITBA 5DKKA 4WF0A 2PRFA 1DP9A 3UDFA 3MZEA 5DF9A 4UQIS 3MR0A 4X55A 3ICYA 3FPWA 3V50A 3WS1A 3MZDA 1KE4A 3ZG9B 3PBSA 2VA0A 2V1ZA 1JNUA 4JF5A 4EW7A 4JGOA 4R23A 2R78A 3HLGA 2PD8A 2W1RA 3W4QA 4ZJ1A 2WGWA 2Y2QA 2HZ5A 3GQZA 3T1XA 3EGDC 1JTDA 3ZNYA 3BECA 4KG5A 2W3EA 3BLMA 3G2YA 2BLSA 1W8QA 1JWPA 3LIEA 3LIBA 3KSGA 2A49A 5A93A 4OOMA 4B93A 4GD8A 4F94A 3S7OA 3MQOA 3MFDA 4GDBA 4QWOA 1SCWA 1CQAA 5GL9A 4R1GA 3AGFA 4Y0UA 5KIZA 3QP6A 5EM0A 4PKYA 3TOIA 3UDIA 1S4RA 3T4SA 4WZ5C 3VP0A 3G35A 3IF6B 2JKRM 2ZQ9A 3DBAA 3F1NB 1DJAA 4MN6A 2QPNA 1ALQA 4OOYA 2JKGA 2J3WA 1T1CA 1ES4A 4K0XA 5AVFA 3CUEA 2PYRA 1S67L 2Y79A 2QYBA 4OLDA 4PM9A 3RH8B 4PM6A 4EXOA 3G6OA 4EBNA 3PHYA 4GCZA 3ISGA 1K4EA 2Y4AA 4JF4A 1LSVA 2PR5A 2H5SA 2VV7A 5DTSA 2VGLS 3CAXA 3V5MA 1Z09A 4GW9A 2Y2HA 4CLCE 5LBRA 4BBVA 4OQGA 2VGJA 2PU2A 2R9XA 3N6IA 5CRFA 5KZHA 1VEUB 4Z1WA 4BMWA 3PBRA 4LCLA 3T4QA 4D60A 3T4JA 3V3SA 3U2AA 3MQQA 3TSGA 2EX2A 3IS2B 1PI4A 1XJ6A 1ONHA 2EXBA 2C5WB 2JKRI 1K56A 2HJEA 3UE6A 3KYEA 4LRZE 4JGQA 1K54C 1BULA 2J7VA 1N9LA 1P0ZA 2UWXA 1FR6A 5HD3A 1EI5A 4GD6A 5FQMA 2OAQ1 2J3TD 2V8FA 2OWHA 3EGXC 1LI0A 1UGUA 4YFMA 4WN5A 4GZBA 3DAVA 3C7UA 3IWIA 1LT0A 3BY8A 3UNWA 4OVDA 4R6LA 4K91A 4GJ4A 3HUNA 3C5AA 3W8KA 1BSGA 3H82B 1W7FA 4S2OA 2HP9A 1XX2A 4EESA 4EWFA 4ID4A 3IF6A 1L2SA 4Q8IA 3SW1A 5EE8A 3LGOA 3N8LA 5F82A 3O3VA 1Y28A 4QY6A 1RP5A 3P01A 3LUQA 3E2LA 4R4SA 5FAPA 2YKFA 3GECA 1G6OA 1I2SA 4GB7A 3C38A 3FKWA 1TEMA 1X0OA 4EEPA 2J9PA 4MCWA 2XD1A 1GA9A 3A0RA 1V9ZA 4MBKA 1PZOA 2H10A 1SKFA 4P85A 4L9FA 1RCJA 1TD5A 3Q82A 2KX6A 1YLYA 1VETB 5EVIA 3ZDJA 1J3WA 5JYPA 3IXBA 2INWA 1MWUA 3RXXA 3F1PB 2XH9A 4ESPA 4ZJ3A 4HJ3A 2VGLM 4L9EA 1LL9A 5EECA 1HVBA 3E98A 5CHUA 2R9WA 3OOVA 5AJGA 5FA7A 4X6TA 2L1MA 4MLLA 4NK3A 4UA6A 1L3LA 1LLBA 3S7NA 3ZG0A 5MC7A 1TDGA 1LHYA 3G32A 1OJ5A 4UHUA 1FOFA 2H0TA 4F3LB 3QP2A 4X53A 1NZOA 5DF8A 3T12B 3G4PA 2OWJA 1MXOA 3UPNA 4KZ9A 4QB8A 5HFOA 2ZLYA 2XF3A 1D7EA 4Y15A 1GA0A 1IFQA 2OAP1 2P7JA 4JXWA 3ITAA 3ZVWA 4EETB 4WEKA 2Z2MB 2JKTM 2EX9A 1OT9A 3E0YA 3Q1FA 1SDNA 2WKIA 3CUEC 3PBOA 5JYOA 3PYPA 5L07A 4Y2FA 3GMWA 2V0WA 3EWKA 3C30A 3HJIA 2OV5A 4KUKA 1DY6A 1GSWA 3MKFA 4BQMA 3S4XA 2QJ7A 4LV3A 4Y0TA 5EVEA 2K7SA 3UE1A 3ZVTA 4KQDA 3EEAA 1W5DA 1KDSA 3SH8A 1ESUA 1IELA 3DTMA 3UB6A 4L0LA 3W2ZA 4FH2A 5FAQA 1MWRA 2PBDP 1MC0A 1XJ2A 3EQVA 2KDKA 4DE0A 1CJFA 4CLCB 4S2NA 3H7WA 2GDNA 1ZC2A 1YAXA 4CLCA 1ES5A 2Z6CA 5J4EA 1YLTA 4S2JA 4KZ5A 1FILA 1S4SA 3BQAA 1ZG6A 4XXRA 1XGJA 1MKIA 1G5UA 2Y2NA 4OONA 3GRJA 4MBHA 2HDUA 3FKVA 1VB6A 1MWTA 3P7NA 3IH8A 1Y4OA 4JBFA 1IKGA 3FWLA 2Y91A 3DWZA 4OQHA 1MBLA 5DVAA 1T1BA 3TE8A 4QY5A 3VE3A 4ZJ2A 3QP5A 2V2FF 2ZQ8A 1FSWA 1LL5A 1C3BA 4BL2A 3CPTA 4N1XA 2WKRA 4JXGA 5EVID 4OPZA 4UEYA 3R4KA 2XLNA 2IA2A 1ERQA 1PW8A 3NY4A 2K31A 2VKSA 3N7WA 4Q0IA 2JHEA 1M6KA 2WGIA 3NULA 4KZ4A 4PKYG 1WE4A 3DTIA 2WYXA 4I5SA 3BWLA 3IX8A 3LCEA 4OLGA 3L7HA 5CHMA 3EEHA 5DJUA 1NYYA 1J9MA 5HWWA 4OKPA 2Y2LA 4S2LA 1XPBA 1KGFA 3C2WA 3UO9A 2XFTA 1KOUA 3UPPA 1ODVA 1H3QA 3Q7VA 3OZHA 4MN7A 3UMEA 4R4RA 1K6SA 1STZA 5L09A 2W1TA 4MNRA 4E3KA 1NWZA 4KQOA 2VJWA 3VFHA
chains in the Genus database with same CATH topology
2D01A 3C8CA 2FZ0A 2J3WA 1T1CA 3K3CA 5AVFA 4HNBA 4I3AA 3CUEA 4HIAA 2PYRA 4F3LA 2I9VA 1S67L 2GX5A 1S1YA 2QYBA 2Y79A 3CLOA 3KO6A 4M4XA 3RH8B 3NOTC 2JKTI 2G7UA 4R70A 4NXBA 3MJQA 3CI6A 3NJAA 5DJTA 4EXOA 3G6OA 3PHYA 2M1CA 3BJNA 4GCZA 5HDSA 3V67A 2A24B 2EA9A 4LLOB 3EQUA 5HL6A 3D72A 1GSVA 2PR6A 1LSVA 2VZWA 4K08A 4WELA 4EEUA 3E4OA 1TF1A 4PAUA 5I5LA 2PR5A 1XJ4A 2KOIA 1TS8A 3E4PA 3UB8A 2VV7A 4Q0HA 2VGLS 1LSWA 3CAXA 2A2LA 2O9AA 4MMNA 4IUHA 2HF6A 3F1NA 3FPVA 1G28A 4GW9A 3VOLA 4BBTA 3D3OA 4CLCE 1OT6A 3LIFA 2NUTC 1W63Q 4H6JB 5LBRA 4BBVA 2Z6DA 2QHKA 1GSXA 1P97A 1NRJA 2CMNA 4Z1WA 4BMWA 2J3TC 3PBRA 4IJGA 4MDZA 3T4QA 3KSFA 3T4JA 2J80A 2PT7A 3U2AA 3MQQA 3LR4A 3PBTA 3IS2B 2M7UA 3LR0A 1XJ6A 2FH5A 2XRNA 3TRCA 2JKRI 1P9WA 2L4RA 1XJ3A 3IBRA 2HJEA 4BJPA 1DRMA 3UE6A 4LRZE 4JGQA 3CITA 3JVUA 5CX7A 1UWPX 2XA7S 1N9LA 1P0ZA 2W3DA 5HD3A 1OJGA 4JGPA 1T1AA 3PR6A 1N9NA 2OAQ1 2J3TD 4I39A 1T18A 1YSQA 2OWHA 3EGXC 3H7WB 1UGUA 4BBUA 3PXPA 3LYXA 4WN5A 2QKPA 4YWZA 1V9YA 5J7EA 1BYWA 1YKDA 3TJZC 3PBQA 4LRYC 1LT0A 3BY8A 2V0UA 2OOLA 1XFQA 4R6LA 4NXEA 3LFVA 3KYZA 3T4TA 3HJKA 3IBJA 4NXGA 4GJ4A 3F1OA 2MJ6A 5EFWA 3H82B 3MXQA 3MF0A 4EESA 4WUJA 3ZYTA 2QJ5A 2V9AA 4HH2A 3SW1A 5C5KA 5G4YA 4AFIA 3MMHA 4E04A 2DMWA 3T4LA 4GHIB 5L8MA 2HJ9C 3A0VA 4EQ1A 3UE3A 1Y28A 5F6AA 5TBMA 2D02A 3KX0X 1H8MA 2Y8HA 4HQAA 4KUOA 2V1BA 4NKPA 2VX8A 3EOIA 1W63M 2QWSA 3P01A 4HH3A 3OLOA 2JN7A 2LB5A 4CQHA 3LUQA 3VV4A 3BQ8A 4II7A 5HD5A 2YKFA 3GECA 1G6OA 3C38A 4GS9A 3OCNA 1X0OA 4EEPA 4MCWA 5HDDA 3T4OA 2VEAA 2NUPC 2PHYA 4ARZA 3A0RA 4WL9A 3S7QA 1V9ZA 5J3WA 4DJ3A 2GZAA 3NOPC 4L9FA 1TD5A 5K5BA 2W0NA 1F9IA 2YKHA 2KX6A 1OTIA 5HZHA 2INWA 1OTAA 2P04A 3F1PB 3B42A 2XROA 4HP9A 3MQ0A 4HJ3A 2VGLM 1TS6A 3F1OB 2K2NA 3TW8A 4L9EA 4QPRA 1OTDA 4EUVA 3S7PA 2W27A 2W3HA 4EERA 3E98A 4IUKA 5KSHA 1OTBA 4IHQA 3OOVA 3OCLA 4ETZA 2GNXA 4O0PA 1IOUA 3LR5A 4I3IA 5AJGA 2L1MA 4BWIA 4CLCC 3UMDA 1TS7A 4Y5FA 3OBFA 2GJ3A 2H28A 3S7NA 5MC7A 4G3WA 1T19A 4EU0A 4P6ZM 4ARZB 1OJ5A 3JVVA 2PDRA 3LR3A 1S1ZA 2LB9A 4F3LB 4GS9B 4ME4A 2HV1A 1YSPA 2WKQA 2OWJA 1LSXA 4LRXC 2M7VA 3RFBA 2EWWA 4MN5A 2B02A 1D7EA 1NLYA 5A8BA 3LIDA 5HPFA 1NLZA 1IFQA 2OAP1 4I3JA 2P7JA 3KYQA 4O8GA 3K3DA 3ZQ5A 4EETB 3FC7A 5HWVA 3F1PA 4WEKA 3A0SA 1MZUA 2JKTM 1OT9A 3E0YA 4XT2A 1F98A 3CUEC 3PBOA 4HJ4A 5DFYA 3PYPA 4Y2FA 2V0WA 2VLGA 3EWKA 3C30A 3LI9A 1WA9A 5F68A 1EW0A 1LL8A 3HJIA 1VHMA 3ULFA 3B47A 4KUKA 1D06A 3B33A 2EWVA 2BASA 1GSWA 4ZRRA 4DJ2A 2ZBBA 3RTYA 5HDCA 2QJ7A 5F69A 4HP4A 4O01A 4HY8A 4OOLA 5DKLA 2K7SA 2V1AA 2ZMVA 3UB7A 2PYPA 3IS2A 3R7WA 2PD7A 4KQDA 3EEAA 5HWTA 3LICA 4NXFA 2O99A 2O9BA 1F5MA 4CLCD 3H82A 4G3VA 3UB9A 2HGVA 3GDIA 1ZHHB 4YOFA 3UB6A 3O5YA 4L0LA 3W2ZA 5TBMB 4HHDA 2ZOIA 3LIAA 4JGRA 3K2NA 4WLAA 3H9WA 4HJ6A 1MC0A 1XJ2A 3NHQA 3NOUC 3EQVA 2KDKA 4ETXA 2ZOHA 1ZTUA 2W3GA 4CLCB 3H7WA 1YAXA 2VV6A 1OPXA 4CLCA 3T4KA 4NEED 2W1TB 1N9OA 2Z6CA 5F5YA 3KSHA 2ZMFA 4H6JA 4R3AA 5J4EA 4R38A 3MFXA 1OTEA 2W3FA 1S4SA 3BQAA 2XA7M 4WEJA 2O9CA 4Q0JA 5TJJA 3BW6A 1S66L 3OC2A 5DKKA 4WF0A 1DP9A 1VB6A 3P7NA 5DF9A 4UQIS 3MR0A 3LI8A 3ICYA 3FPWA 2P08A 4DN0A 4I38A 5AVEA 4B9OA 5DFXA 3PBSA 4FSFA 2VA0A 1T1BA 3TE8A 1P9RA 4HI4A 1JNUA 4EW7A 3T50A 4JGOA 3PBNA 3VE3A 4L9GA 2R78A 4G3KA 4P6ZS 1DP8A 2KLIA 4GLQA 2PD8A 2W1RA 5IS1A 5FL3A 3EGDC 2WKRA 4DMZA 4LPZA 4UEYA 3R4KA 2IA2A 2W3EA 1DP6A 2K31A 2O0YA 2VKSA 4XT2B 4Q0IA 2B18A 2JHEA 4RQ9A 4PKYG 5G4ZA 3LIEA 3LIBA 3KSGA 4I5SA 3BWLA 4OOMA 4YNRA 1XFNA 1TS0A 2A24A 4Y3IA 4B93A 5IT5A 3S7OA 5HPIA 3BY9A 3MQOA 3EEHA 5DJUA 2VV8A 5HWWA 2XSSA 5KIZA 3C2WA 4PKYA 3R7WB 1KOUA 1S4RA 3T4SA 4PHTA 1ODVA 2L0WA 1H3QA 3CWFA 4GHIA 4MN7A 3UMEA 3KSIA 5IU1A 3VE4A 1STZA 4UQIM 1UWNX 3E4QA 4FOFA 5HSQA 2JKRM 2W1TA 3DBAA 2WKPA 3F1NB 3FG8A 1NWZA 3HCYA 4KQOA 4MN6A 1MKMA 2VJWA 4HOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R38 A;  1V9Y A;  1OTE A;  2D01 A;  3C8C A;  1OJ5 A;  3MFX A;  5J7E A;  1BYW A;  1T1C A;  2PDR A;  1S1Z A;  4LRY C;  3K3C A;  1LT0 A;  1S4S A;  3BY8 A;  2V0U A;  4GS9 B;  2HV1 A;  4F3L B;  5AVF A;  2OOL A;  4HNB A;  4I3A A;  2WKQ A;  1XFQ A;  2PYR A;  1S66 L;  4F3L A;  4R6L A;  2I9V A;  1S67 L;  2OWJ A;  1LSX A;  1S1Y A;  3CLO A;  4NXE A;  5DKK A;  4M4X A;  3HJK A;  3NOT C;  4LRX C;  3RH8 B;  4NXG A;  4EEU A;  3F1O A;  4WF0 A;  4MN5 A;  3H82 B;  1DP9 A;  1VB6 A;  3P7N A;  3MXQ A;  4NXB A;  4R70 A;  3MJQ A;  3MR0 A;  4EES A;  3LI8 A;  2B02 A;  3ICY A;  4WUJ A;  1D7E A;  3NJA A;  2QJ5 A;  5DJT A;  4EXO A;  5HWV A;  2V9A A;  3G6O A;  5A8B A;  3LID A;  4HH2 A;  3PHY A;  2M1C A;  3SW1 A;  4GCZ A;  4I38 A;  4EER A;  4I3J A;  2P7J A;  5AVE A;  5G4Y A;  2A24 B;  2EA9 A;  4LLO B;  5HDS A;  4B9O A;  4E04 A;  4GHI B;  3D72 A;  3K3D A;  5F68 A;  1GSV A;  2PR6 A;  1LSV A;  1T1B A;  3A0V A;  3FC7 A;  4K08 A;  3F1P A;  3ZQ5 A;  1Y28 A;  5F6A A;  3A0S A;  3E4O A;  4HI4 A;  1JNU A;  5TBM A;  2D02 A;  3KX0 X;  4JGO A;  4KUO A;  4HQA A;  1MZU A;  5I5L A;  2V1B A;  2PR5 A;  2R78 A;  4L9G A;  3VE3 A;  1OT9 A;  1XJ4 A;  1TS8 A;  1DP8 A;  2PD8 A;  5IS1 A;  2QWS A;  3E4P A;  4HH3 A;  4XT2 A;  4WN5 A;  3OLO A;  1F98 A;  2VV7 A;  3UB8 A;  2JN7 A;  3LUQ A;  2WKR A;  1LSW A;  3CAX A;  4LPZ A;  4HJ4 A;  3PYP A;  5HD5 A;  2YKF A;  3F1N A;  3GEC A;  1G28 A;  4GS9 A;  4GW9 A;  2V0W A;  1X0O A;  2VLG A;  1DP6 A;  3VOL A;  3EWK A;  4BBT A;  5HDD A;  1OT6 A;  1WA9 A;  3LI9 A;  3LIF A;  1EW0 A;  2VEA A;  4XT2 B;  4H6J B;  1LL8 A;  2JHE A;  2PHY A;  4BBV A;  3HJI A;  3A0R A;  4WL9 A;  2Z6D A;  3ULF A;  4KUK A;  1D06 A;  3B33 A;  1V9Z A;  2QHK A;  5J3W A;  1GSX A;  4PKY G;  4RQ9 A;  5G4Z A;  1P97 A;  1GSW A;  2BAS A;  3LIE A;  4DJ3 A;  3LIB A;  3NOP C;  4DJ2 A;  2ZBB A;  3RTY A;  4L9F A;  4I5S A;  2CMN A;  3BWL A;  2W0N A;  1F9I A;  5HDC A;  2QJ7 A;  2YKH A;  5F69 A;  2KX6 A;  4HP4 A;  1XFN A;  3T50 A;  1TS0 A;  2A24 A;  4HY8 A;  1OTI A;  2K7S A;  2V1A A;  5DKL A;  2PYP A;  3UB7 A;  5HZH A;  3IS2 A;  2J80 A;  2INW A;  1OTA A;  2PD7 A;  4KQD A;  3BY9 A;  3MQQ A;  3F1P B;  3MQO A;  3LIC A;  5HWT A;  3EEH A;  5DJU A;  3IS2 B;  4NXF A;  1XJ6 A;  4HP9 A;  4HOI A;  2VV8 A;  4HJ3 A;  5HWW A;  2L4R A;  3H82 A;  1XJ3 A;  1TS6 A;  3F1O B;  3IBR A;  1DRM A;  3UE6 A;  4LRZ E;  4JGQ A;  5EFW A;  3UB9 A;  4L9E A;  3GDI A;  4YWZ A;  5F5Y A;  5KIZ A;  1OTD A;  3C2W A;  3UB6 A;  4R3A A;  1UWP X;  4PKY A;  2W27 A;  4H6J A;  4HHD A;  1KOU A;  2ZOI A;  3LIA A;  1N9L A;  1P0Z A;  1S4R A;  4JGR A;  5TBM B;  4EEP A;  4EET B;  1OTB A;  1ODV A;  3H9W A;  2L0W A;  4WLA A;  4HJ6 A;  1OJG A;  5HD3 A;  3CWF A;  4GHI A;  4EW7 A;  1XJ2 A;  4JGP A;  3UME A;  3NHQ A;  3NOU C;  4I3I A;  2KDK A;  5IU1 A;  3VE4 A;  1T1A A;  2ZOH A;  1UWN X;  3E4Q A;  2L1M A;  1N9N A;  4EQ1 A;  3UMD A;  1TS7 A;  5HSQ A;  3H7W A;  4I39 A;  2WKP A;  2GJ3 A;  2H28 A;  1T18 A;  3F1N B;  3FG8 A;  2VV6 A;  1NWZ A;  2OWH A;  3H7W B;  1UGU A;  4MN6 A;  1T19 A;  1N9O A;  4BBU A;  2Z6C A;  5J4E A;  4HIA A;  3LYX A;  2QKP A; 
#chains in the Genus database with same CATH topology
 2FZ0 A;  1K57 A;  2Y2M A;  3VOZ A;  1M40 A;  4HNB A;  4LV1 A;  1JWZ A;  4X69 A;  3CLO A;  3A3E A;  4X56 A;  3CI6 A;  3N8S A;  5AQA A;  3OPH A;  2HDR A;  1BT5 A;  3C4P A;  5HDS A;  2A24 B;  2EA9 A;  2Y59 A;  1GSV A;  3VP4 A;  1XJ4 A;  2KOI A;  3UB8 A;  4B4X A;  3VP2 A;  5E2E A;  4RYE A;  2X71 A;  4LV0 A;  4MMN A;  5FQJ A;  4OQI A;  2FFF B;  1WYC A;  2PU4 A;  3LIF A;  1OME A;  1W63 Q;  4RX2 A;  4JPM A;  3OPR A;  2QHK A;  1GSX A;  5F1G A;  1L0F A;  2XGN A;  5FI2 A;  1NRJ A;  5HX9 A;  2CMN A;  4JF6 A;  4MDZ A;  1GCE A;  2J80 A;  2PT7 A;  3T1S A;  5E2H A;  3PBT A;  3LR0 A;  2ZM2 A;  1P9W A;  1XJ3 A;  3IBR A;  4BJP A;  4C3Q A;  1NXY A;  2W3D A;  1FSY A;  4QU3 A;  1ES3 A;  1DJC A;  5EVI C;  1YMX A;  3U4L P;  1T1A A;  3PTE A;  3PR6 A;  1YLW A;  3GVB A;  3HLF A;  1YSQ A;  3HUM A;  4GOG A;  4ZAM A;  5CGX A;  3C4O A;  4PM5 A;  1H8Z A;  3Q07 A;  4BBU A;  3PXP A;  3LYX A;  1ZKJ A;  1L0G A;  5J7E A;  3TJZ C;  3PBQ A;  4OQ0 A;  2WZZ A;  3GSG A;  1O7E A;  4EQI A;  2AVX A;  4OPQ A;  2XDM A;  3BFF A;  3IXG A;  3KYZ A;  3F1O A;  5EFW A;  3MXQ A;  3MF0 A;  4WUJ A;  3G30 A;  3O86 A;  1FR1 A;  4ZBE A;  5C5K A;  3LY3 A;  3MMH A;  2DMW A;  3T4L A;  4GHI B;  2HJ9 C;  4EQ1 A;  5F6A A;  5FEF A;  4IVK A;  3KX0 X;  1H8M A;  2Y8H A;  5BOH A;  2V1B A;  2VX8 A;  1DJB A;  3UN7 A;  3EOI A;  3PAG A;  1K0K A;  3OLO A;  4MBF A;  3VV4 A;  1BLP A;  4II7 A;  4WMC D;  2X01 A;  4EV4 A;  3PAE A;  2ACG A;  5CGS A;  2NUP C;  4WL9 A;  3S7Q A;  4DJ3 A;  2GZA A;  4ZDX A;  1KE3 A;  5K5B A;  5HL1 A;  2G2W A;  3IWO A;  5HZH A;  3CHW P;  3BM6 A;  2P9V A;  4LEN A;  4JXV A;  4DDY A;  2P9V B;  3B42 A;  1L0E A;  4HP9 A;  2IWC A;  4HBT A;  3MKE A;  1CI9 A;  2B5R A;  5EV0 A;  5EPH A;  3VSL A;  3A3D A;  1CK3 A;  2WKE A;  3S7P A;  5HAQ A;  2W3H A;  4IUK A;  1OTB A;  2DNS A;  5G18 A;  3CPT B;  3BFC A;  2WAF A;  5FQI A;  5HAI A;  4CLC C;  3Q7Z A;  1TS7 A;  1NRF A;  4Y5F A;  2H28 A;  2V20 A;  3AGD A;  4OP8 A;  4Y17 A;  1T19 A;  2WAD A;  1K4F A;  4ARZ B;  3WRT A;  1PZP A;  4N92 A;  4P0M A;  2PDR A;  4HEF A;  4GS9 B;  2HV1 A;  5FAS A;  1S0W A;  1YSP A;  5E2G A;  4LRX C;  1Q2Q A;  3GTC A;  2M7V A;  1PFL A;  4YIN A;  3BEB A;  2B02 A;  3NDE A;  5HPF A;  4Z9Q A;  3IX3 A;  1H8Y A;  4KZ8 A;  4NET A;  3K3D A;  3ZQ5 A;  5E43 A;  2WUQ A;  1K55 A;  1SKO B;  1PW1 A;  4P6B A;  4XT2 A;  3ZG8 B;  3ZFZ A;  3D9Y A;  2EX8 A;  2ZM8 A;  2IWD A;  4ZTK A;  4E6W A;  1ERO A;  5EM1 A;  5KSC A;  2B95 A;  1EW0 A;  2E8I A;  1H0M A;  3ULF A;  3B47 A;  2VK3 A;  4E3L A;  3RTY A;  5HDC A;  1YM1 A;  5F69 A;  4HY8 A;  4OOL A;  3UB7 A;  2ZMV A;  4KZA A;  1KGE A;  3GV9 A;  2OLV A;  1ACF A;  3R7W A;  2PD7 A;  3BYD A;  4NXF A;  4CLC D;  1F5M A;  4LFU A;  2HP6 A;  4G3V A;  2HPB A;  4N9L A;  3UB9 A;  2HGV A;  1ZHH B;  3O5Y A;  1QMF A;  1GHM A;  4JGR A;  1QME A;  3H9W A;  3NOU C;  1PI5 A;  4E3I A;  5CTM A;  3T4K A;  4IED A;  3W4O A;  4Y0O A;  4S2K A;  4XUX A;  3HLB A;  1HTZ A;  3KSH A;  2ZMF A;  3MFX A;  1OTE A;  5AQ9 A;  5L10 A;  2W3F A;  3OPP A;  5TJJ A;  3CJM A;  1S66 L;  3OC2 A;  4IBR A;  4A5R A;  3V3R A;  2QMI A;  1IKI A;  1RGY A;  4I38 A;  5E2F A;  1PRQ A;  1P9R A;  4HI4 A;  3T50 A;  3PBN A;  2H0Y A;  4L9G A;  4P6Z S;  3TG9 A;  2KLI A;  5IS1 A;  3AGE A;  4FCF A;  2BG1 A;  4LPZ A;  1XA7 A;  3N8R A;  4O7D A;  3ZHH A;  4XT2 B;  2B18 A;  4U3T A;  3GR2 A;  1K56 D;  4QD4 A;  4RQ9 A;  5FEG A;  5F83 A;  5FDS A;  3LEZ A;  1FIK A;  4QJG A;  3A3F A;  3VSK A;  2EFU A;  4RA7 A;  3RJU A;  5AQB A;  1K6R A;  1XFN A;  1TS0 A;  5CED A;  4EUZ A;  5IT5 A;  2XD5 A;  3BY9 A;  5DF7 A;  4S2N C;  3P09 A;  2VV8 A;  3DWK A;  1KVL A;  3T1R A;  1MWS A;  1SZV A;  3R7W B;  3ZGA B;  1YLP A;  1XXM A;  4KQQ A;  4GHI A;  2WGW B;  1PIO A;  5J8X A;  3A3J A;  3VE4 A;  2UV0 E;  4UQI M;  4KQR A;  1UWN X;  3FG8 A;  5D3O A;  5FAO A;  2J9O A;  1MKM A;  4R3J A;  4HIA A;  3WRZ A;  4Y7P A;  4LV2 A;  3BFD A;  3K3C A;  3NBL A;  3VP1 A;  4F3L A;  1G68 A;  1S1Y A;  4M4X A;  3NOT C;  4R70 A;  2ZC3 B;  2Y55 A;  3JPU A;  1ESI A;  5HW3 A;  4LLO B;  5HL6 A;  3D72 A;  1PWC A;  4K08 A;  4BD1 A;  4WEL A;  5KMW A;  5CEC A;  2I72 A;  5I5L A;  4PAU A;  1TS8 A;  1E4D A;  2ZC4 B;  3E4P A;  4R0Q A;  1YPR A;  1TVF A;  1PWG A;  1W8Y A;  1LSW A;  2O9A A;  2OSU A;  1CEF A;  3BLS A;  3G34 A;  2HF6 A;  3F1N A;  1G28 A;  5A90 A;  3V39 A;  3O87 A;  4BBT A;  3D3O A;  1OT6 A;  2NUT C;  4JLF A;  5CGW A;  3M2K A;  1P97 A;  3M6B A;  2ZC6 B;  4S2P A;  3SS5 A;  2G2U A;  3HUO A;  3L9K A;  3B3X A;  4E3M A;  4IBX A;  3VOY A;  3T1Q B;  3LR4 A;  2HDQ A;  4U0T A;  5IHV A;  4DE3 A;  5FQK A;  1JTG A;  2XRN A;  2DRW A;  2JKF A;  3TRC A;  2L4R A;  1W79 A;  5A92 A;  3JVU A;  5CX7 A;  2XA7 S;  1K57 C;  1BLS A;  3WS2 A;  1AXB A;  1OJG A;  4PMA A;  1N9N A;  3IWQ A;  3UDX A;  4I39 A;  1T18 A;  3H7W B;  2P74 A;  3QHY A;  2ZL1 B;  1V9Y A;  1GHP A;  1BYW A;  4LRY C;  2V0U A;  2OOL A;  4NXE A;  3LFV A;  1L0D A;  1IEM A;  3HJK A;  2JCH A;  3HLC A;  3MXR A;  3UB5 P;  2MJ6 A;  3IX4 A;  5GLB A;  3WWX A;  2QJ5 A;  1AWI A;  4HH2 A;  4WBG A;  3MXS A;  5A91 A;  1FCM A;  3NEC A;  1NJ4 A;  1VQQ A;  4H8R A;  5TFQ A;  3A0V A;  4D2O A;  3UE3 A;  4DRT A;  2BTF P;  1G6A A;  2D02 A;  4HQA A;  1GHI A;  1W63 M;  2LB5 A;  3BQ8 A;  3LEQ A;  3ZCZ A;  1XKZ A;  3RXW A;  4PM8 A;  1U60 A;  3IXD A;  3G31 A;  1NY0 A;  3T4O A;  3UE0 A;  2VEA A;  5M19 A;  5EOE A;  1IYP A;  2Y2I A;  1VM1 A;  2E8J A;  2Y2G A;  3HRE A;  1OTI A;  1HZO A;  4WMC A;  1MY8 A;  3WS0 A;  1CI8 A;  3M2J A;  2XR0 A;  4JKT A;  1TS6 A;  2K2N A;  3WS5 A;  4QPR A;  5FI6 A;  2W27 A;  4EER A;  4IVI A;  4C75 A;  4OPR A;  4UAA A;  3OCL A;  4ETZ A;  2GNX A;  4O0P A;  1IOU A;  5FQQ A;  2HDS A;  2XK1 A;  4BWI A;  2GJ3 A;  4X68 A;  5GHZ A;  5U47 A;  4G3W A;  1ES2 A;  4EU0 A;  4P6Z M;  5EOO A;  2CC1 A;  3JVV A;  3LR3 A;  2Y2J A;  4KZ3 A;  3ZG5 A;  3HLE A;  4ME4 A;  2HP5 A;  2XQZ A;  1SKO A;  1I2W A;  4EBP A;  3IH9 A;  3RFB A;  2JBF A;  2EWW A;  4MN5 A;  4WZ5 A;  1YQS A;  4WYY A;  3QP1 A;  1NLY A;  3VFF A;  1NLZ A;  3BRM A;  4I3J A;  1VET A;  5EVI B;  5GLA A;  3SS4 A;  4OP5 A;  3IHA A;  3F1P A;  3MS6 A;  3MBZ A;  3A0S A;  5CTN A;  1MZU A;  2ZQC A;  1F98 A;  5GLD A;  4HJ4 A;  2Z2L B;  5GHY A;  4OH0 A;  1F2K A;  3LI9 A;  3NIA A;  1LL8 A;  1VHM A;  1D06 A;  3B33 A;  4M3K A;  2EWV A;  3P98 A;  2BAS A;  2ZBB A;  3DTE A;  1XA1 A;  4O01 A;  3DW0 A;  2PYP A;  3IS2 A;  4CJN A;  3LIC A;  5AQ7 A;  2XFS A;  4EBL A;  1MPL A;  3GDI A;  5TBM B;  1FCO A;  3SH9 A;  5TR7 A;  4HJ6 A;  4ETX A;  3IHB A;  2ZOH A;  3Q81 A;  1ZTU A;  3IF5 A;  2Y2K A;  4E3N A;  5TGF A;  2EXA A;  2VV6 A;  1K38 A;  1BLH A;  3HVF A;  1N9O A;  1KGG A;  4UA9 A;  4R38 A;  2XA7 M;  1K55 C;  1CF0 A;  1XGI A;  4KEN B;  3LI8 A;  4RVA A;  2P08 A;  1ONG A;  3QNC A;  5HAR A;  4DN0 A;  5AVE A;  4B9O A;  5DFX A;  1CEG A;  4FSF A;  1KDW A;  2Y2O A;  4GNU A;  3BFE A;  3FV7 A;  4G3K A;  1DP8 A;  4GLQ A;  3Q7V B;  3LY4 A;  5FL3 A;  3BFG A;  5FSR A;  4DMZ A;  5DTT A;  4PPR A;  5CHJ A;  4MEZ A;  1DP6 A;  2O0Y A;  2RL3 A;  2ZL1 A;  2QZ6 A;  4LCM A;  4C6Y A;  2Q0O A;  3D4F A;  1JVJ A;  5G4Z A;  1NYM A;  2WAE A;  4DE2 A;  1YLJ A;  4YNR A;  2RCX A;  1K25 A;  2A24 A;  4Y3I A;  1VEU A;  4KZB A;  5HPI A;  3HBR A;  1YT4 A;  1PNE A;  3DTK A;  2Q9N A;  2XSS A;  2EFX A;  2XEP A;  3OPL A;  4DKI A;  1Y54 A;  4PHT A;  4X1L A;  2L0W A;  1WYB A;  4Y13 A;  3CWF A;  3KSI A;  5IU1 A;  4U0X A;  3E4Q A;  4FOF A;  3G2Z A;  2WK0 A;  2ZM0 A;  5HSQ A;  1NZU A;  2WKP A;  3HCY A;  4QHC A;  3WS4 A;  3QP8 A;  4HOI A;  4K0W A;  2D01 A;  1N4O A;  3C8C A;  4HBU A;  4GKU A;  1YMS A;  4I3A A;  2I9V A;  2GX5 A;  3KO6 A;  3CMZ A;  3SH7 A;  3UPO A;  2JKT I;  2G7U A;  4NXB A;  4X25 A;  3MJQ A;  3ZNT A;  3NJA A;  1ZG4 A;  5DJT A;  2M1C A;  3BJN A;  2IWB A;  3V67 A;  3EQU A;  2PR6 A;  2VZW A;  4EEU A;  3VMA A;  3E4O A;  1PWD A;  1KE0 A;  1TF1 A;  1KVM A;  3IQA A;  4S2I A;  4Q0H A;  2A2L A;  4CPK A;  5M1A A;  4IUH A;  3FPV A;  1HD8 A;  3HLW A;  4KG6 A;  3VOL A;  4H6J B;  2DCF A;  2Z6D A;  1IYO A;  4HES A;  2OLU A;  4FH4 A;  3CG5 A;  1XP4 A;  2ZQA A;  4N1H A;  2J3T C;  4IJG A;  2Q9M A;  3NDG A;  1LI9 A;  5FDH A;  3SZT A;  3KSF A;  1S6R A;  4R3B A;  2FFY A;  2M7U A;  2FH5 A;  1E3U D;  3NC8 A;  5F1F A;  4BD0 A;  3N4I A;  1E25 A;  1DRM A;  2JE5 A;  4KG2 A;  3CIT A;  1IYQ A;  4BL3 A;  1UWP X;  1BZA A;  1BUE A;  3JYI A;  4JGP A;  3UY6 A;  3O88 A;  3SS3 A;  2J8Y A;  3LO7 A;  1EWZ A;  4GDN A;  2QKP A;  4YWZ A;  1IYS A;  1YKD A;  3HLD A;  5L2F A;  2WZX A;  1XFQ A;  4FUW A;  3MZF A;  3T4T A;  4E6X A;  3FZC A;  3IBJ A;  4NXG A;  1BTL A;  2C6W B;  1N9B A;  3HL9 A;  4PM7 A;  3I7J A;  5FAT A;  2JC7 A;  3ZYT A;  2V9A A;  5G4Y A;  4JXS A;  4AFI A;  4E04 A;  5L8M A;  5TBM A;  4KUO A;  4NKP A;  1H5X A;  1D1J A;  2QWS A;  3QP4 A;  4HH3 A;  2JN7 A;  2Y2P A;  4CQH A;  3NCK A;  5HD5 A;  1HLU P;  4GS9 A;  3OCN A;  1O07 A;  5HDD A;  4DXC A;  4ARZ A;  2PHY A;  5J3W A;  3NI9 A;  3A3I A;  3NOP C;  4DDS A;  3C7V A;  2W0N A;  1F9I A;  5EVL A;  4FTX A;  2YKH A;  4OPY A;  2VGK A;  1I5Q A;  1OTA A;  3IF6 C;  1YLZ A;  3S1Y A;  2P04 A;  2XRO A;  3IT9 A;  3MQ0 A;  5CER A;  3TW8 A;  3F1O B;  4XUZ A;  4E3O A;  4BLM A;  1OTD A;  4EUV A;  5CEB A;  4GN2 A;  5KSH A;  1K54 A;  4IHQ A;  5EUA A;  3LR5 A;  3M6H A;  2ZD8 A;  4I3I A;  5HAP A;  3UMD A;  4B88 A;  3OBF A;  3QNB A;  4WZ4 A;  5I94 A;  4DXB A;  2ZQD A;  3E2K A;  1S1Z A;  2LB9 A;  5DTK A;  1E3U A;  2WKQ A;  2ZQ7 A;  1FQG A;  2PAV P;  1LSX A;  2ZC7 A;  1ERM A;  4BEN A;  4B4Z A;  5GLC A;  5A8B A;  2ZC5 B;  3LID A;  4LGW A;  3KYQ A;  4O8G A;  2X02 A;  3FC7 A;  5HWV A;  3W4P A;  5DFY A;  3CZD A;  1PYY A;  2EX6 A;  4WM9 A;  2WGV A;  2VLG A;  2PBY A;  1WA9 A;  5F68 A;  3SOI A;  2ZJ9 A;  5CXW A;  1Q2P A;  4ZRR A;  4DJ2 A;  4NG2 A;  2ZMA A;  4KZ6 A;  5GHX A;  4HP4 A;  5DKL A;  2V1A A;  2V8C A;  3ZG7 B;  5HWT A;  3IXH A;  2O99 A;  2O9B A;  4X1M A;  3S22 A;  4N9K A;  1SDE A;  3H82 A;  2A3U A;  4DE1 A;  5FI7 A;  4E3J A;  3MSH A;  4YOF A;  4P87 A;  4HHD A;  1FCN A;  2ZOI A;  3LIA A;  4RX3 A;  1A0K A;  3K2N A;  4DF6 A;  4WLA A;  3FYZ A;  3VP3 A;  1JWV A;  5FQ9 A;  4S2M A;  3NHQ A;  2W3G A;  1SHV A;  1RGZ A;  1OPX A;  4NEE D;  4UA7 A;  2W1T B;  5F5Y A;  5M18 A;  4R3A A;  4H6J A;  1Z6F A;  1TDL A;  2WKH A;  4KZ7 A;  4WEJ A;  2O9C A;  1BLC A;  4Q0J A;  4FD8 A;  3BW6 A;  3ITB A;  5DKK A;  4WF0 A;  2PRF A;  1DP9 A;  3UDF A;  3MZE A;  5DF9 A;  4UQI S;  3MR0 A;  4X55 A;  3ICY A;  3FPW A;  3V50 A;  3WS1 A;  3MZD A;  1KE4 A;  3ZG9 B;  3PBS A;  2VA0 A;  2V1Z A;  1JNU A;  4JF5 A;  4EW7 A;  4JGO A;  4R23 A;  2R78 A;  3HLG A;  2PD8 A;  2W1R A;  3W4Q A;  4ZJ1 A;  2WGW A;  2Y2Q A;  2HZ5 A;  3GQZ A;  3T1X A;  3EGD C;  1JTD A;  3ZNY A;  3BEC A;  4KG5 A;  2W3E A;  3BLM A;  3G2Y A;  2BLS A;  1W8Q A;  1JWP A;  3LIE A;  3LIB A;  3KSG A;  2A49 A;  5A93 A;  4OOM A;  4B93 A;  4GD8 A;  4F94 A;  3S7O A;  3MQO A;  3MFD A;  4GDB A;  4QWO A;  1SCW A;  1CQA A;  5GL9 A;  4R1G A;  3AGF A;  4Y0U A;  5KIZ A;  3QP6 A;  5EM0 A;  4PKY A;  3TOI A;  3UDI A;  1S4R A;  3T4S A;  4WZ5 C;  3VP0 A;  3G35 A;  3IF6 B;  2JKR M;  2ZQ9 A;  3DBA A;  3F1N B;  1DJA A;  4MN6 A;  2QPN A;  1ALQ A;  4OOY A;  2JKG A;  2J3W A;  1T1C A;  1ES4 A;  4K0X A;  5AVF A;  3CUE A;  2PYR A;  1S67 L;  2Y79 A;  2QYB A;  4OLD A;  4PM9 A;  3RH8 B;  4PM6 A;  4EXO A;  3G6O A;  4EBN A;  3PHY A;  4GCZ A;  3ISG A;  1K4E A;  2Y4A A;  4JF4 A;  1LSV A;  2PR5 A;  2H5S A;  2VV7 A;  5DTS A;  2VGL S;  3CAX A;  3V5M A;  1Z09 A;  4GW9 A;  2Y2H A;  4CLC E;  5LBR A;  4BBV A;  4OQG A;  2VGJ A;  2PU2 A;  2R9X A;  3N6I A;  5CRF A;  5KZH A;  1VEU B;  4Z1W A;  4BMW A;  3PBR A;  4LCL A;  3T4Q A;  4D60 A;  3T4J A;  3V3S A;  3U2A A;  3MQQ A;  3TSG A;  2EX2 A;  3IS2 B;  1PI4 A;  1XJ6 A;  1ONH A;  2EXB A;  2C5W B;  2JKR I;  1K56 A;  2HJE A;  3UE6 A;  3KYE A;  4LRZ E;  4JGQ A;  1K54 C;  1BUL A;  2J7V A;  1N9L A;  1P0Z A;  2UWX A;  1FR6 A;  5HD3 A;  1EI5 A;  4GD6 A;  5FQM A;  2OAQ 1;  2J3T D;  2V8F A;  2OWH A;  3EGX C;  1LI0 A;  1UGU A;  4YFM A;  4WN5 A;  4GZB A;  3DAV A;  3C7U A;  3IWI A;  1LT0 A;  3BY8 A;  3UNW A;  4OVD A;  4R6L A;  4K91 A;  4GJ4 A;  3HUN A;  3C5A A;  3W8K A;  1BSG A;  3H82 B;  1W7F A;  4S2O A;  2HP9 A;  1XX2 A;  4EES A;  4EWF A;  4ID4 A;  3IF6 A;  1L2S A;  4Q8I A;  3SW1 A;  5EE8 A;  3LGO A;  3N8L A;  5F82 A;  3O3V A;  1Y28 A;  4QY6 A;  1RP5 A;  3P01 A;  3LUQ A;  3E2L A;  4R4S A;  5FAP A;  2YKF A;  3GEC A;  1G6O A;  1I2S A;  4GB7 A;  3C38 A;  3FKW A;  1TEM A;  1X0O A;  4EEP A;  2J9P A;  4MCW A;  2XD1 A;  1GA9 A;  3A0R A;  1V9Z A;  4MBK A;  1PZO A;  2H10 A;  1SKF A;  4P85 A;  4L9F A;  1RCJ A;  1TD5 A;  3Q82 A;  2KX6 A;  1YLY A;  1VET B;  5EVI A;  3ZDJ A;  1J3W A;  5JYP A;  3IXB A;  2INW A;  1MWU A;  3RXX A;  3F1P B;  2XH9 A;  4ESP A;  4ZJ3 A;  4HJ3 A;  2VGL M;  4L9E A;  1LL9 A;  5EEC A;  1HVB A;  3E98 A;  5CHU A;  2R9W A;  3OOV A;  5AJG A;  5FA7 A;  4X6T A;  2L1M A;  4MLL A;  4NK3 A;  4UA6 A;  1L3L A;  1LLB A;  3S7N A;  3ZG0 A;  5MC7 A;  1TDG A;  1LHY A;  3G32 A;  1OJ5 A;  4UHU A;  1FOF A;  2H0T A;  4F3L B;  3QP2 A;  4X53 A;  1NZO A;  5DF8 A;  3T12 B;  3G4P A;  2OWJ A;  1MXO A;  3UPN A;  4KZ9 A;  4QB8 A;  5HFO A;  2ZLY A;  2XF3 A;  1D7E A;  4Y15 A;  1GA0 A;  1IFQ A;  2OAP 1;  2P7J A;  4JXW A;  3ITA A;  3ZVW A;  4EET B;  4WEK A;  2Z2M B;  2JKT M;  2EX9 A;  1OT9 A;  3E0Y A;  3Q1F A;  1SDN A;  2WKI A;  3CUE C;  3PBO A;  5JYO A;  3PYP A;  5L07 A;  4Y2F A;  3GMW A;  2V0W A;  3EWK A;  3C30 A;  3HJI A;  2OV5 A;  4KUK A;  1DY6 A;  1GSW A;  3MKF A;  4BQM A;  3S4X A;  2QJ7 A;  4LV3 A;  4Y0T A;  5EVE A;  2K7S A;  3UE1 A;  3ZVT A;  4KQD A;  3EEA A;  1W5D A;  1KDS A;  3SH8 A;  1ESU A;  1IEL A;  3DTM A;  3UB6 A;  4L0L A;  3W2Z A;  4FH2 A;  5FAQ A;  1MWR A;  2PBD P;  1MC0 A;  1XJ2 A;  3EQV A;  2KDK A;  4DE0 A;  1CJF A;  4CLC B;  4S2N A;  3H7W A;  2GDN A;  1ZC2 A;  1YAX A;  4CLC A;  1ES5 A;  2Z6C A;  5J4E A;  1YLT A;  4S2J A;  4KZ5 A;  1FIL A;  1S4S A;  3BQA A;  1ZG6 A;  4XXR A;  1XGJ A;  1MKI A;  1G5U A;  2Y2N A;  4OON A;  3GRJ A;  4MBH A;  2HDU A;  3FKV A;  1VB6 A;  1MWT A;  3P7N A;  3IH8 A;  1Y4O A;  4JBF A;  1IKG A;  3FWL A;  2Y91 A;  3DWZ A;  4OQH A;  1MBL A;  5DVA A;  1T1B A;  3TE8 A;  4QY5 A;  3VE3 A;  4ZJ2 A;  3QP5 A;  2V2F F;  2ZQ8 A;  1FSW A;  1LL5 A;  1C3B A;  4BL2 A;  3CPT A;  4N1X A;  2WKR A;  4JXG A;  5EVI D;  4OPZ A;  4UEY A;  3R4K A;  2XLN A;  2IA2 A;  1ERQ A;  1PW8 A;  3NY4 A;  2K31 A;  2VKS A;  3N7W A;  4Q0I A;  2JHE A;  1M6K A;  2WGI A;  3NUL A;  4KZ4 A;  4PKY G;  1WE4 A;  3DTI A;  2WYX A;  4I5S A;  3BWL A;  3IX8 A;  3LCE A;  4OLG A;  3L7H A;  5CHM A;  3EEH A;  5DJU A;  1NYY A;  1J9M A;  5HWW A;  4OKP A;  2Y2L A;  4S2L A;  1XPB A;  1KGF A;  3C2W A;  3UO9 A;  2XFT A;  1KOU A;  3UPP A;  1ODV A;  1H3Q A;  3Q7V A;  3OZH A;  4MN7 A;  3UME A;  4R4R A;  1K6S A;  1STZ A;  5L09 A;  2W1T A;  4MNR A;  4E3K A;  1NWZ A;  4KQO A;  2VJW A;  3VFH A; 
#chains in the Genus database with same CATH homology
 2D01 A;  3C8C A;  2FZ0 A;  2J3W A;  1T1C A;  3K3C A;  5AVF A;  4HNB A;  4I3A A;  3CUE A;  4HIA A;  2PYR A;  4F3L A;  2I9V A;  1S67 L;  2GX5 A;  1S1Y A;  2QYB A;  2Y79 A;  3CLO A;  3KO6 A;  4M4X A;  3RH8 B;  3NOT C;  2JKT I;  2G7U A;  4R70 A;  4NXB A;  3MJQ A;  3CI6 A;  3NJA A;  5DJT A;  4EXO A;  3G6O A;  3PHY A;  2M1C A;  3BJN A;  4GCZ A;  5HDS A;  3V67 A;  2A24 B;  2EA9 A;  4LLO B;  3EQU A;  5HL6 A;  3D72 A;  1GSV A;  2PR6 A;  1LSV A;  2VZW A;  4K08 A;  4WEL A;  4EEU A;  3E4O A;  1TF1 A;  4PAU A;  5I5L A;  2PR5 A;  1XJ4 A;  2KOI A;  1TS8 A;  3E4P A;  3UB8 A;  2VV7 A;  4Q0H A;  2VGL S;  1LSW A;  3CAX A;  2A2L A;  2O9A A;  4MMN A;  4IUH A;  2HF6 A;  3F1N A;  3FPV A;  1G28 A;  4GW9 A;  3VOL A;  4BBT A;  3D3O A;  4CLC E;  1OT6 A;  3LIF A;  2NUT C;  1W63 Q;  4H6J B;  5LBR A;  4BBV A;  2Z6D A;  2QHK A;  1GSX A;  1P97 A;  1NRJ A;  2CMN A;  4Z1W A;  4BMW A;  2J3T C;  3PBR A;  4IJG A;  4MDZ A;  3T4Q A;  3KSF A;  3T4J A;  2J80 A;  2PT7 A;  3U2A A;  3MQQ A;  3LR4 A;  3PBT A;  3IS2 B;  2M7U A;  3LR0 A;  1XJ6 A;  2FH5 A;  2XRN A;  3TRC A;  2JKR I;  1P9W A;  2L4R A;  1XJ3 A;  3IBR A;  2HJE A;  4BJP A;  1DRM A;  3UE6 A;  4LRZ E;  4JGQ A;  3CIT A;  3JVU A;  5CX7 A;  1UWP X;  2XA7 S;  1N9L A;  1P0Z A;  2W3D A;  5HD3 A;  1OJG A;  4JGP A;  1T1A A;  3PR6 A;  1N9N A;  2OAQ 1;  2J3T D;  4I39 A;  1T18 A;  1YSQ A;  2OWH A;  3EGX C;  3H7W B;  1UGU A;  4BBU A;  3PXP A;  3LYX A;  4WN5 A;  2QKP A;  4YWZ A;  1V9Y A;  5J7E A;  1BYW A;  1YKD A;  3TJZ C;  3PBQ A;  4LRY C;  1LT0 A;  3BY8 A;  2V0U A;  2OOL A;  1XFQ A;  4R6L A;  4NXE A;  3LFV A;  3KYZ A;  3T4T A;  3HJK A;  3IBJ A;  4NXG A;  4GJ4 A;  3F1O A;  2MJ6 A;  5EFW A;  3H82 B;  3MXQ A;  3MF0 A;  4EES A;  4WUJ A;  3ZYT A;  2QJ5 A;  2V9A A;  4HH2 A;  3SW1 A;  5C5K A;  5G4Y A;  4AFI A;  3MMH A;  4E04 A;  2DMW A;  3T4L A;  4GHI B;  5L8M A;  2HJ9 C;  3A0V A;  4EQ1 A;  3UE3 A;  1Y28 A;  5F6A A;  5TBM A;  2D02 A;  3KX0 X;  1H8M A;  2Y8H A;  4HQA A;  4KUO A;  2V1B A;  4NKP A;  2VX8 A;  3EOI A;  1W63 M;  2QWS A;  3P01 A;  4HH3 A;  3OLO A;  2JN7 A;  2LB5 A;  4CQH A;  3LUQ A;  3VV4 A;  3BQ8 A;  4II7 A;  5HD5 A;  2YKF A;  3GEC A;  1G6O A;  3C38 A;  4GS9 A;  3OCN A;  1X0O A;  4EEP A;  4MCW A;  5HDD A;  3T4O A;  2VEA A;  2NUP C;  2PHY A;  4ARZ A;  3A0R A;  4WL9 A;  3S7Q A;  1V9Z A;  5J3W A;  4DJ3 A;  2GZA A;  3NOP C;  4L9F A;  1TD5 A;  5K5B A;  2W0N A;  1F9I A;  2YKH A;  2KX6 A;  1OTI A;  5HZH A;  2INW A;  1OTA A;  2P04 A;  3F1P B;  3B42 A;  2XRO A;  4HP9 A;  3MQ0 A;  4HJ3 A;  2VGL M;  1TS6 A;  3F1O B;  2K2N A;  3TW8 A;  4L9E A;  4QPR A;  1OTD A;  4EUV A;  3S7P A;  2W27 A;  2W3H A;  4EER A;  3E98 A;  4IUK A;  5KSH A;  1OTB A;  4IHQ A;  3OOV A;  3OCL A;  4ETZ A;  2GNX A;  4O0P A;  1IOU A;  3LR5 A;  4I3I A;  5AJG A;  2L1M A;  4BWI A;  4CLC C;  3UMD A;  1TS7 A;  4Y5F A;  3OBF A;  2GJ3 A;  2H28 A;  3S7N A;  5MC7 A;  4G3W A;  1T19 A;  4EU0 A;  4P6Z M;  4ARZ B;  1OJ5 A;  3JVV A;  2PDR A;  3LR3 A;  1S1Z A;  2LB9 A;  4F3L B;  4GS9 B;  4ME4 A;  2HV1 A;  1YSP A;  2WKQ A;  2OWJ A;  1LSX A;  4LRX C;  2M7V A;  3RFB A;  2EWW A;  4MN5 A;  2B02 A;  1D7E A;  1NLY A;  5A8B A;  3LID A;  5HPF A;  1NLZ A;  1IFQ A;  2OAP 1;  4I3J A;  2P7J A;  3KYQ A;  4O8G A;  3K3D A;  3ZQ5 A;  4EET B;  3FC7 A;  5HWV A;  3F1P A;  4WEK A;  3A0S A;  1MZU A;  2JKT M;  1OT9 A;  3E0Y A;  4XT2 A;  1F98 A;  3CUE C;  3PBO A;  4HJ4 A;  5DFY A;  3PYP A;  4Y2F A;  2V0W A;  2VLG A;  3EWK A;  3C30 A;  3LI9 A;  1WA9 A;  5F68 A;  1EW0 A;  1LL8 A;  3HJI A;  1VHM A;  3ULF A;  3B47 A;  4KUK A;  1D06 A;  3B33 A;  2EWV A;  2BAS A;  1GSW A;  4ZRR A;  4DJ2 A;  2ZBB A;  3RTY A;  5HDC A;  2QJ7 A;  5F69 A;  4HP4 A;  4O01 A;  4HY8 A;  4OOL A;  5DKL A;  2K7S A;  2V1A A;  2ZMV A;  3UB7 A;  2PYP A;  3IS2 A;  3R7W A;  2PD7 A;  4KQD A;  3EEA A;  5HWT A;  3LIC A;  4NXF A;  2O99 A;  2O9B A;  1F5M A;  4CLC D;  3H82 A;  4G3V A;  3UB9 A;  2HGV A;  3GDI A;  1ZHH B;  4YOF A;  3UB6 A;  3O5Y A;  4L0L A;  3W2Z A;  5TBM B;  4HHD A;  2ZOI A;  3LIA A;  4JGR A;  3K2N A;  4WLA A;  3H9W A;  4HJ6 A;  1MC0 A;  1XJ2 A;  3NHQ A;  3NOU C;  3EQV A;  2KDK A;  4ETX A;  2ZOH A;  1ZTU A;  2W3G A;  4CLC B;  3H7W A;  1YAX A;  2VV6 A;  1OPX A;  4CLC A;  3T4K A;  4NEE D;  2W1T B;  1N9O A;  2Z6C A;  5F5Y A;  3KSH A;  2ZMF A;  4H6J A;  4R3A A;  5J4E A;  4R38 A;  3MFX A;  1OTE A;  2W3F A;  1S4S A;  3BQA A;  2XA7 M;  4WEJ A;  2O9C A;  4Q0J A;  5TJJ A;  3BW6 A;  1S66 L;  3OC2 A;  5DKK A;  4WF0 A;  1DP9 A;  1VB6 A;  3P7N A;  5DF9 A;  4UQI S;  3MR0 A;  3LI8 A;  3ICY A;  3FPW A;  2P08 A;  4DN0 A;  4I38 A;  5AVE A;  4B9O A;  5DFX A;  3PBS A;  4FSF A;  2VA0 A;  1T1B A;  3TE8 A;  1P9R A;  4HI4 A;  1JNU A;  4EW7 A;  3T50 A;  4JGO A;  3PBN A;  3VE3 A;  4L9G A;  2R78 A;  4G3K A;  4P6Z S;  1DP8 A;  2KLI A;  4GLQ A;  2PD8 A;  2W1R A;  5IS1 A;  5FL3 A;  3EGD C;  2WKR A;  4DMZ A;  4LPZ A;  4UEY A;  3R4K A;  2IA2 A;  2W3E A;  1DP6 A;  2K31 A;  2O0Y A;  2VKS A;  4XT2 B;  4Q0I A;  2B18 A;  2JHE A;  4RQ9 A;  4PKY G;  5G4Z A;  3LIE A;  3LIB A;  3KSG A;  4I5S A;  3BWL A;  4OOM A;  4YNR A;  1XFN A;  1TS0 A;  2A24 A;  4Y3I A;  4B93 A;  5IT5 A;  3S7O A;  5HPI A;  3BY9 A;  3MQO A;  3EEH A;  5DJU A;  2VV8 A;  5HWW A;  2XSS A;  5KIZ A;  3C2W A;  4PKY A;  3R7W B;  1KOU A;  1S4R A;  3T4S A;  4PHT A;  1ODV A;  2L0W A;  1H3Q A;  3CWF A;  4GHI A;  4MN7 A;  3UME A;  3KSI A;  5IU1 A;  3VE4 A;  1STZ A;  4UQI M;  1UWN X;  3E4Q A;  4FOF A;  5HSQ A;  2JKR M;  2W1T A;  3DBA A;  2WKP A;  3F1N B;  3FG8 A;  1NWZ A;  3HCY A;  4KQO A;  4MN6 A;  1MKM A;  2VJW A;  4HOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...