3PYPA

Photoactive yellow protein, cryotrapped early light cycle intermediate
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords PHOTOACTIVE YELLOW PROTEIN
publication title Structure at 0.85 A resolution of an early protein photocycle intermediate.
pubmed doi rcsb
total genus 37
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 1998-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3pypA00
3C8CA 2R78A 2V1AA 4LLOB 5DKKA 4I5SA 1UWPX 2Z6CA 4MN5A 1LSVA 4HJ4A 4R38A 3GECA 4KUKA 4I39A 3T50A 1ODVA 2VLGA 1S67L 1D06A 4I38A 1MZUA 3UB8A 4L9FA 5HDDA 3FC7A 3A0VA 4NXGA 4HOIA 3CWFA 1OT9A 1JNUA 1XFNA 4KUOA 3LIFA 4H6JA 2V0UA 1G28A 2Z6DA 4PKYG 4GCZA 2WKRA 2HV1A 1DRMA 2EA9A 4I3IA 4RQ9A 4YWZA 4DJ3A 3RTYA 3BY8A 3NOPC 4KQDA 3E4OA 4GHIA 5AVEA 1F98A 3VE3A 1T1CA 3K3DA 4HJ6A 4XT2B 4WUJA 4WLAA 1LT0A 5IS1A 1N9NA 4BBVA 3LIDA 4F3LB 5HZHA 2L4RA 3UMEA 3LYXA 3H7WB 4E04A 3VE4A 2GJ3A 2ZBBA 3A0SA 3VOLA 1OTAA 3F1NB 2PYRA 2J80A 3E4QA 4R70A 2CMNA 3RH8B 4EW7A 4R3AA 3F1PB 3UB9A 1N9LA 4K08A 3UMDA 1GSVA 2KX6A 1OTEA 1TS6A 3C2WA 4EXOA 2BASA 2L0WA 1OTDA 4EERA 1BYWA 3H82A 4NXEA 2ZOHA 2QKPA 4HNBA 3LI9A 3MJQA 5HD3A 1XJ2A 5TBMA 5G4ZA 3UE6A 2PR6A 4WF0A 4HP4A 4H6JB 1V9ZA 3PHYA 3SW1A 2I9VA 3HJIA 2B02A 2D01A 3EWKA 3IS2A 3UB6A 1Y28A 5J3WA 2WKQA 4GS9B 3MQOA 4NXBA 1OJGA 1GSWA 1TS0A 4EEPA 4EETB 4GHIB 2PD7A 5F5YA 3F1OA 2W27A 5J7EA 3GDIA 4JGPA 2QJ5A 1D7EA 2V9AA 2YKHA 4HHDA 3NOUC 4DJ2A 3OLOA 2OOLA 4EQ1A 5HDSA 3IBRA 3LIEA 4HQAA 1S66L 1OJ5A 2PYPA 2YKFA 1WA9A 2PDRA 3D72A 1T1AA 1LSWA 1XJ3A 3LUQA 3LIBA 2OWHA 1XJ6A 5F6AA 1S1ZA 1EW0A 5DJTA 3CLOA 1UWNX 5HSQA 5IU1A 3NHQA 5DKLA 3K3CA 3ZQ5A 3H82B 2V0WA 1P97A 1GSXA 2W0NA 4HP9A 2QHKA 5HD5A 3MQQA 3NJAA 3KX0X 4JGOA 3NOTC 3A0RA 1DP6A 5TBMB 2A24A 2PHYA 2D02A 2ZOIA 2VV8A 4HI4A 3B33A 3F1PA 5HWWA 5DJUA 4HY8A 3BWLA 3LIAA 1TS8A 2VEAA 4I3AA 1LSXA 4LRXC 3MFXA 4HH2A 2VV7A 1V9YA 5HWVA 1X0OA 5F69A 5A8BA 2H28A 3IS2B 1N9OA 2L1MA 3H9WA 3P7NA 2PD8A 1S4SA 1XFQA 3FG8A 4WN5A 1T1BA 2QJ7A 4M4XA 1XJ4A 2JHEA 2JN7A 1UGUA 3LICA 3F1OB 1OT6A 5AVFA 4LRZE 4WL9A 4B9OA 1TS7A 4MN6A 3MR0A 4HIAA 4EESA 3EEHA 3MXQA 5J4EA 5EFWA 4R6LA 3BY9A 1P0ZA 4LRYC 4JGQA 3LI8A 4GS9A 4HJ3A 5I5LA 2VV6A 1T19A 4BBTA 2V1BA 2INWA 1F9IA 2PR5A 1T18A 4BBUA 4PKYA 4JGRA 2WKPA 1NWZA 4I3JA 1KOUA 5HWTA 3PYPA 4L9GA 4XT2A 1LL8A 2K7SA 1OTIA 4LPZA 1OTBA 5KIZA 4EEUA 3UB7A 3E4PA 1S1YA 5G4YA 1DP9A 2P7JA 4GW9A 1VB6A 4NXFA 5F68A 4F3LA 2KDKA 3H7WA 3ULFA 3CAXA 1S4RA 2OWJA 2A24B 1DP8A 2QWSA 2M1CA 3G6OA 4L9EA 3HJKA 3F1NA 5HDCA 4HH3A 3ICYA
chains in the Genus database with same CATH superfamily
1YLPA 1CQAA 4GNUA 3B3XA 4BENA 1M40A 3P98A 2ZMVA 3GQZA 5DKKA 1TDGA 3BEBA 4E3LA 2Z2MB 3C4OA 1LSVA 4JLFA 3A3FA 5HAQA 2PRFA 3GECA 4QJGA 3T4QA 4KUKA 5AQBA 3KYQA 3ITAA 5DVAA 3T4KA 3A3EA 2M7VA 1KVLA 2O99A 3T50A 1ODVA 2ZC5B 5AQAA 5CHMA 4OPYA 4G3KA 2WZXA 3ZGAB 4I38A 5AQ9A 4KQOA 5GHXA 1MZUA 3UB8A 2P74A 4XUXA 4L9FA 1JTGA 4UA6A 1PW8A 3A0VA 3CWFA 5DFXA 1I5QA 1VEUA 3HBRA 1HD8A 1FIKA 5HL1A 3QHYA 4Q0HA 2OAP1 2Q9NA 4E3KA 3T4LA 4PPRA 4KZAA 3PTEA 3M2JA 3ISGA 4IVIA 2J9PA 2AVXA 4Y0UA 3LO7A 1S6RA 4OVDA 3OPPA 4KQDA 2HPBA 5CXWA 3IF6C 3OCNA 4WM9A 2J7VA 3PAGA 1DJBA 3K3DA 4HJ6A 3FV7A 3R7WA 4WLAA 2UV0E 3G4PA 3BM6A 4DE0A 2WGWA 4P6ZS 4ME4A 3O88A 3PAEA 2ZLYA 2KOIA 3H7WB 3MZFA 1JWVA 3A0SA 3VOLA 4QU3A 1BLCA 1NY0A 1RCJA 2PYRA 4B4XA 2J80A 4Y0TA 4G3WA 2JC7A 1CJFA 5TGFA 5GLDA 1NZUA 3PBQA 4R3AA 4QWOA 3F1PB 2VKSA 3MXSA 4IUHA 1GSVA 2KX6A 5EVIB 4MMNA 5GLCA 3C7UA 2G7UA 1LL9A 1SKOA 2WADA 4EXOA 5IT5A 5HAPA 1ES4A 4Z1WA 4EERA 4R3JA 5L8MA 1I2WA 3BLMA 1BYWA 4NXEA 1IYOA 2ZOHA 2Y2KA 4HNBA 3LEZA 2LB5A 4WZ4A 3ITBA 3SH9A 1HVBA 1W8QA 3IH9A 4EUZA 2VGLS 3NC8A 5G4ZA 3UE6A 4OPQA 1E3UD 3G32A 1TD5A 3TG9A 1GA0A 2PR6A 2V20A 2VGJA 4N92A 4C3QA 4MCWA 4OKPA 4H6JB 2K31A 3V39A 4AFIA 3W2ZA 5GLBA 1EROA 2D01A 3EWKA 2VZWA 2WKQA 2G2UA 1W7FA 1G68A 2ZQCA 1L0GA 4QHCA 3MKEA 4R4SA 4UQIM 4OH0A 2DRWA 1YT4A 3MKFA 5E2FA 5J7EA 3GDIA 4JGPA 5TR7A 1CF0A 5JYPA 4QPRA 3BFFA 3IXHA 4X69A 3OLOA 2OOLA 3UPOA 2WYXA 4MLLA 1K38A 1IYQA 5D3OA 5F83A 2MJ6A 4HQAA 1S66L 5FI2A 4D60A 2YKFA 5L09A 2OLUA 1KGEA 4KZ6A 5FAPA 5GL9A 1FILA 2A2LA 5FATA 1H8ZA 1K55C 1XJ6A 4UA9A 3T1QB 3CMZA 5DJTA 4K0WA 4EBPA 4X6TA 1SCWA 5HSQA 4LGWA 1GHPA 5EV0A 4BD1A 3LR5A 1SDNA 2BG1A 4LV2A 4ARZA 4U0TA 1G6AA 3O87A 1ERQA 3H82B 3FWLA 4R4RA 3ZNTA 1GSXA 3UE1A 1YLJA 3T1XA 2J8YA 2QHKA 5DF8A 4II7A 1PNEA 4S2KA 2W1RA 3NOTC 3A0RA 4DDYA 3GMWA 5FASA 4BL3A 3MS6A 1K6RA 2A24A 4KZ8A 2A49A 4ZJ1A 3LIAA 2EX2A 4I3AA 1MWTA 3MFXA 4EUVA 3LR3A 4LV3A 3V3SA 4ZJ2A 1V9YA 4N1XA 4CLCC 2PU2A 3NULA 5FQ9A 1DJCA 2ZM8A 3LFVA 1S4SA 2K2NA 3FG8A 3C30A 4WN5A 3A3DA 4DE3A 3UO9A 1AWIA 1N9BA 3Q1FA 3Q7ZA 2Y91A 4JXSA 4Y17A 2W3EA 3S7NA 1XJ4A 5GHZA 5EM1A 5EM0A 3VP2A 4ZBEA 1EWZA 4GJ4A 1ERMA 4LRZE 3IXBA 1Z09A 1PWGA 5FQQA 2Y55A 4B9OA 4MN6A 1J9MA 3NDEA 4HIAA 5JYOA 1K4EA 4UA7A 1MBLA 5HPIA 4GKUA 5J4EA 4OQ0A 2WGWB 4R6LA 1JWPA 3VFHA 2PBYA 1P0ZA 4LRYC 4KG6A 5I5LA 3WWXA 1FCMA 4QB8A 3GRJA 2FFFB 2XA7M 3HREA 2JKTM 4WZ5C 1CEFA 3DTKA 2ZC6B 4R3BA 1MWUA 5M18A 1TF1A 4OQIA 3IHAA 3M2KA 5FDHA 3TJZC 4P6ZM 2JKRM 2K7SA 3JYIA 3ZFZA 4EEUA 3UE3A 1BUEA 3E4PA 3E2LA 2DMWA 1DP9A 5GLAA 3H7WA 2ZL1A 3D3OA 1XP4A 3DBAA 5EOEA 1DP8A 2QWSA 3M6HA 2M1CA 4LV1A 1QMEA 1ES2A 3CZDA 1KGFA 3AGEA 5CECA 3ICYA 3N8RA 2ZM2A 3NBLA 2EXAA 3C8CA 1O7EA 2IWCA 2R78A 3B47A 2V1AA 3W4OA 3IWIA 4LLOB 3E98A 4B88A 4YFMA 4WBGA 4KENB 1Q2PA 4HJ4A 2C6WB 3CI6A 1Z6FA 3UN7A 5GHYA 4E6XA 1XGIA 2XFTA 1YLYA 4OLGA 3ZG9B 3S22A 4KQQA 1FSWA 3PBRA 3QP4A 4O7DA 3C5AA 4N9KA 2HF6A 3HUMA 1IFQA 1XA7A 3HLDA 4P6BA 1H3QA 2OLVA 2WUQA 2IWDA 5FQMA 2Q0OA 3HUNA 1XFNA 2ZQAA 3N7WA 2OV5A 1PZPA 3LIFA 3VV4A 1DJAA 4H6JA 5HX9A 2V0UA 1G28A 2Z6DA 4GCZA 3SOIA 2B5RA 4CPKA 2WKRA 4Y0OA 3EOIA 1DRMA 1FSYA 4IJGA 2EA9A 4WEKA 2Y2QA 4OQGA 4DJ3A 3RTYA 4JXGA 4EU0A 1YLZA 2J3TC 2V2FF 3BY8A 1F98A 1YQSA 3G35A 3VE3A 1RGYA 3OPHA 1T1CA 2EXBA 5A93A 4WUJA 3BJNA 3TW8A 3QP8A 3QP6A 3IXDA 5IS1A 3DTMA 1K56A 4OPZA 1N9NA 4ARZB 4RYEA 4MNRA 5HFOA 1FOFA 2L4RA 2VX8A 5E2GA 3QNBA 2VJWA 3UNWA 3P09A 3VE4A 2W3GA 4S2PA 2X02A 4JPMA 3UE0A 4Y5FA 4MBKA 5FDSA 3CPTB 4EW7A 1JVJA 3SS5A 3HLFA 3UPNA 4UHUA 1N9LA 4K08A 1BZAA 1TS6A 1K54C 3C2WA 2BASA 3T4TA 4U3TA 5CX7A 1LL5A 3GTCA 1RP5A 3H82A 3RXXA 4NEED 3IWQA 4EBNA 2GNXA 2HP9A 4H8RA 4DKIA 5M19A 4CJNA 4E3OA 3T1SA 3IH8A 5HD3A 1JWZA 3S7PA 2QYBA 1KVMA 3FKWA 4PM8A 1JTDA 3T12B 2EWVA 2JKTI 4NK3A 3UDIA 3UDXA 3HJIA 3UPPA 3GR2A 4GZBA 4F94A 4EBLA 2IA2A 2NUTC 3SH7A 3V67A 4NXBA 2NUPC 2ZM0A 4DE1A 1STZA 2JKRI 1SDEA 4IHQA 4EEPA 4EETB 4GHIB 2Q9MA 1KDWA 4UAAA 2XA7S 5K5BA 5HL6A 3NY4A 1F5MA 3JPUA 1NZOA 3HCYA 3WS4A 4YOFA 4OOYA 3PBOA 3N8SA 5L2FA 1YMSA 2E8JA 4Z9QA 3FPWA 5J8XA 3ZHHA 1TVFA 1TDLA 1Y54A 2PYPA 4RX3A 2PDRA 3D72A 4JF4A 3OZHA 5LBRA 2ZL1B 4DE2A 3LIBA 3TRCA 4P87A 3MXRA 1YMXA 1S1ZA 1EW0A 1UWNX 2Y4AA 3ZVWA 3BFEA 4S2JA 3ZQ5A 2ZMAA 2HP5A 5EOOA 1PW1A 3O5YA 2QPNA 1DP6A 2OAQ1 4HBUA 3HVFA 1W8YA 2ZOIA 3HLWA 2H0YA 3HUOA 5KSCA 5HWWA 2XQZA 3ZG8B 4PM6A 1ESIA 1LSXA 4LRXC 4PMAA 5CGXA 2VV7A 1X0OA 2RCXA 3VP0A 3ZCZA 2Y2MA 4Q0JA 4Q0IA 3IF6A 2LB9A 4Y3IA 4P0MA 4M4XA 3IX8A 3ZVTA 4LCMA 2EX8A 4XXRA 2JHEA 3F1OB 4C6YA 1OT6A 4WMCD 3IWOA 3BFCA 4IBRA 4WL9A 5L10A 1VQQA 4MDZA 1YSPA 3MR0A 4IEDA 3NCKA 4EQIA 3EEHA 1J3WA 1HZOA 3MXQA 3VSLA 3MQ0A 4E6WA 1H8MA 5EVEA 1Q2QA 5F1FA 3BY9A 1GHMA 4LENA 4JGQA 2XSSA 3QP5A 4L0LA 4BBTA 3KO6A 3T1RA 3LR0A 1F2KA 2INWA 3OBFA 4GD6A 4PKYA 2ZD8A 1L0DA 4MEZA 4I3JA 1KOUA 5HWTA 4JKTA 1W5DA 3PYPA 1OTIA 5KIZA 2JCHA 3UB7A 1S1YA 5G4YA 2XLNA 1CI8A 3A3IA 4ZDXA 1VB6A 1YSQA 4NXFA 1H5XA 4KZ3A 1E3UA 1MKMA 1IYSA 4BD0A 3CAXA 2H0TA 4S2NA 3ZG0A 2JE5A 2OWJA 3VSKA 4PM7A 4CQHA 3DTEA 1K57C 3MBZA 3V5MA 3CPTA 3P01A 3MZDA 3VOZA 2WZZA 4ZRRA 1QMFA 2O9BA 3KSGA 4Y15A 2H10A 1S0WA 5CTNA 2Y2JA 1UWPX 2I72A 1BT5A 3CUEA 2Z6CA 3OPRA 3PBSA 4CLCD 3VP1A 4I39A 3SH8A 4GLQA 5FA7A 1NXYA 3EQUA 5HW3A 2XEPA 1D06A 4IVKA 3IXGA 2Y79A 2XR0A 4E3MA 1KE4A 4KQRA 3CG5A 2HDRA 5FSRA 3FC7A 2XGNA 2ZQDA 4R1GA 4NXGA 4HOIA 3A3JA 4DRTA 1JNUA 4D2OA 4KZ5A 1W79A 1K25A 2OSUA 3LY3A 4QY5A 1LI0A 4S2MA 4YINA 1W63M 3WS5A 1ONHA 5G18A 4PM5A 5EVIC 3CJMA 2GX5A 3VP4A 5EVID 4I3IA 5FEGA 2V1ZA 1YPRA 4NETA 1PI5A 4Y7PA 3NOPC 3E4OA 5CRFA 2FH5A 4GHIA 3MF0A 2C5WB 4FH2A 1P9RA 2O9AA 1FR6A 4XT2B 3KSHA 5DTSA 4ZAMA 1XGJA 4BBVA 2Y2IA 4S2OA 3B42A 4PM9A 2HP6A 1H8YA 1W63Q 2GJ3A 3RFBA 3TE8A 2ZBBA 3E0YA 3F1NB 5M1AA 3E4QA 2WGVA 3S1YA 2CMNA 5IHVA 1HLUP 3UB9A 3W4PA 4X53A 4KG5A 2QZ6A 4BQMA 2Y2LA 3BW6A 4PHTA 1XKZA 3S7OA 2L0WA 1OTDA 4JF5A 2GDNA 2G2WA 3GVBA 3ZNYA 3IF6B 3DWZA 2XK1A 2XD1A 2WGIA 2HDQA 1D1JA 1FCOA 3CHWP 1GCEA 3VFFA 3W8KA 2R9WA 3Q81A 5CERA 2J3WA 3OC2A 2X01A 3Q07A 4MBHA 1SZVA 1ZHHB 3NIAA 5FQJA 3HLEA 3PHYA 3SW1A 5C5KA 2B02A 4WZ5A 2ZQ8A 3MZEA 1Y28A 5J3WA 3ZDJA 1IEMA 3MQOA 4X1LA 1GSWA 4BL2A 5FAOA 3FPVA 3L9KA 1VETB 1ZC2A 2PD7A 5F5YA 5AJGA 3BFGA 2ZQ7A 3F1OA 3WS1A 2EX6A 3CITA 2EX9A 1D7EA 2X71A 2V9AA 2J3TD 3NOUC 1ACFA 2DNSA 3RJUA 4BJPA 3EQVA 4EQ1A 1PYYA 1WE4A 4ZTKA 1NLYA 3LIEA 2V8FA 1OJ5A 3HLCA 1YLWA 1WA9A 3SS3A 1OMEA 2DCFA 1KE3A 3VOYA 5E2HA 1LSWA 4NG2A 4IUKA 2Y2NA 4E3IA 2OWHA 2XROA 3Q7VB 2JBFA 2XRNA 3JVVA 5FL3A 1SHVA 2EWWA 5CGSA 3CLOA 5FEFA 1K0KA 5IU1A 4X56A 4XUZA 5DKLA 3G2YA 1BLSA 3K3CA 2CC1A 2KLIA 3EEAA 1P97A 2W0NA 5L07A 4HP9A 2P9VA 2HGVA 4Y13A 4K0XA 5HD5A 4KZBA 4BLMA 3NJAA 3UY6A 3KX0X 2Y2GA 4E3NA 5F1GA 4JGOA 5TFQA 1NJ4A 5TBMB 1YAXA 2D02A 2VV8A 4X68A 3B33A 4FOFA 3V50A 5DJUA 1MWRA 5A92A 1K6SA 2VEAA 1FQGA 2E8IA 5HWVA 3SS4A 5A8BA 3IX4A 2H28A 3IS2B 3L7HA 1N9OA 2L1MA 3H9WA 1PZOA 3P7NA 2PD8A 1CEGA 5FI6A 1XFQA 2ZMFA 3WRTA 3WS2A 4GOGA 1LHYA 4HEFA 4HBTA 1UGUA 3LICA 1PRQA 1O07A 1IELA 5AVFA 1VM1A 5A90A 2Y2PA 4O8GA 4DN0A 1TS7A 1VHMA 4Y2FA 4UEYA 5CTMA 3BECA 5EFWA 3T4OA 1DY6A 2BLSA 3GSGA 2P08A 3EGDC 3LI8A 4GS9A 1H0MA 2VV6A 3PBTA 2UWXA 5DFYA 2V1BA 4KZ4A 4DDSA 1G6OA 1GA9A 1K54A 2PR5A 4OP8A 1BLPA 3NECA 4GN2A 4JXWA 4CLCB 3LR4A 3LCEA 1K4FA 3LY4A 3FKVA 4Q8IA 3VP3A 4QD4A 1HTZA 2B18A 4XT2A 1LL8A 1NRFA 4QY6A 3KYZA 4LPZA 1OTBA 1U60A 4U0XA 3OOVA 4RA7A 3N4IA 3G31A 2Y8HA 1L0FA 1ZKJA 2J9OA 2Z2LB 4GW9A 2KDKA 2HDUA 1L3LA 2QMIA 5DF7A 4NKPA 3G6OA 4L9EA 2W3DA 2WKIA 3HJKA 3F1NA 1YM1A 5FQIA 4FTXA 2FZ0A 1IKIA 5MC7A 3PXPA 1KDSA 1LI9A 4N9LA 1BSGA 3D9YA 3DTIA 1GHIA 4OOLA 4I5SA 3UDFA 1EI5A 4FUWA 4LV0A 4MN5A 1ALQA 4R38A 1IKGA 5FQKA 1C3BA 1XXMA 4X1MA 2VLGA 1S67L 3C38A 3HLBA 4RVAA 5FAQA 3TOIA 3G2ZA 5TJJA 2B95A 4S2NC 3DAVA 2HJ9C 1N4OA 1ES3A 5HDDA 3DWKA 1OT9A 3IX3A 2R9XA 4G3VA 3S7QA 4ETZA 3TSGA 4KUOA 4JF6A 2RL3A 3D4FA 4GDBA 5CEDA 2A3UA 4FD8A 2WAFA 4WEJA 4PKYG 1ONGA 1YKDA 3IHBA 3CUEC 2HV1A 3Q82A 3O3VA 4RQ9A 4YWZA 4O01A 3HL9A 1VETA 2ACGA 5AVEA 2WAEA 4X25A 5CEBA 1BTLA 1LT0A 1CK3A 2WKHA 1RGZA 3LIDA 4F3LB 5HZHA 3G30A 5KZHA 3HLGA 3UMEA 3LYXA 2WK0A 4B93A 4E04A 1L2SA 2P9VB 1OTAA 3IT9A 1E25A 1AXBA 1ES5A 4S2LA 4R70A 3DW0A 4KG2A 4ZJ3A 3RH8B 3Q7VA 3S4XA 3ZG5A 3WRZA 3NI9A 3UMDA 4BWIA 1OTEA 1YLTA 2ZC3B 1MY8A 1MC0A 2HZ5A 3C7VA 3BYDA 2XF3A 5HARA 1P9WA 2FFYA 1NLZA 4WMCA 3PR6A 1ZTUA 1OPXA 1PFLA 1PI4A 4OQHA 5U47A 3SZTA 2QKPA 2O0YA 4GDNA 1IOUA 1PWCA 1FR1A 5KMWA 1WYCA 4A5RA 1XPBA 3LI9A 1XX2A 3MJQA 1XJ2A 3KSFA 5TBMA 2W1TA 2VA0A 4X55A 1CI9A 3I7JA 5EECA 2BTFP 1VEUB 2M7UA 3QP1A 4WF0A 2ZC7A 3BRMA 4R0QA 4YNRA 4HP4A 1MPLA 4ID4A 3MFDA 3M6BA 1V9ZA 2XH9A 2I9VA 4OONA 3IS2A 3KSIA 3ZG7B 2EFUA 3UB6A 1TEMA 4E3JA 4GS9B 3LGOA 1K55A 5DF9A 1L0EA 1OJGA 2Y2OA 1TS0A 3EGXC 4GB7A 3WS0A 3O86A 5EVLA 1G5UA 2PBDP 2PU4A 3FZCA 2W27A 3BQ8A 3IBJA 3IQAA 4HESA 2QJ5A 3R7WB 3K2NA 2PT7A 4MBFA 4EV4A 2YKHA 4HHDA 3QP2A 5EE8A 4DJ2A 4MN7A 5DTTA 2JKGA 5I94A 2HJEA 2HDSA 3VMAA 3T4JA 5HDSA 4EWFA 3IBRA 4GD8A 5HPFA 2ZJ9A 1K57A 3RXWA 2IWBA 2XFSA 4BMWA 2PAVP 2V8CA 2VGKA 1A0KA 1ZG4A 2EFXA 5CHUA 2W3HA 3GV9A 1T1AA 4PAUA 1XJ3A 3LUQA 2ZQ9A 4ETXA 4KZ9A 4OLDA 4LCLA 3ZYTA 5BOHA 5F6AA 2ZC4B 3T4SA 4B4ZA 3PBNA 5A91A 4O0PA 4CLCA 3G34A 1SKOB 3NHQA 5CHJA 2WKEA 1BLHA 2V0WA 2JKFA 2W3FA 4ESPA 3N6IA 3AGDA 3MQQA 4CLCE 4DXBA 4JXVA 4FH4A 1ZG6A 3LEQA 1K56D 3R4KA 2PHYA 1PIOA 3QNCA 4P85A 1NYMA 4HI4A 5AQ7A 3BLSA 3F1PA 1I2SA 4HY8A 3BWLA 4OP5A 1TS8A 5EVIA 5F82A 4HH2A 1MWSA 3W4QA 4WELA 2O9CA 3NDGA 4WYYA 2GZAA 4OOMA 1ESUA 4FSFA 4OPRA 5F69A 1Y4OA 5FI7A 5EUAA 3E2KA 1NRJA 3KYEA 3MSHA 1T1BA 2QJ7A 1LLBA 2VGLM 1MKIA 4IBXA 2JN7A 4LFUA 1IYPA 3OPLA 4UQIS 3UB5P 4M3KA 4RX2A 2VK3A 5DTKA 1KE0A 1FCNA 1NYYA 1M6KA 3BQAA 3N8LA 4DXCA 5KSHA 5E43A 2P04A 1BULA 4N1HA 4EESA 1SKFA 1KGGA 4K91A 1PWDA 4DF6A 3OCLA 4KZ7A 4HJ3A 1MXOA 3IF5A 1T19A 4JBFA 4FCFA 3U2AA 3MMHA 2XD5A 5HAIA 1F9IA 3FYZA 4DMZA 3C4PA 3JVUA 5CGWA 1T18A 3V3RA 4BBUA 4JGRA 5E2EA 2WKPA 1NWZA 5EPHA 2XDMA 4L9GA 1E4DA 3BFDA 1XA1A 2H5SA 3AGFA 2P7JA 5F68A 1WYBA 4F3LA 4S2IA 3ULFA 2Y59A 1S4RA 2A24B 4C75A 5HDCA 4HH3A 3U4LP 2Y2HA 4R23A 2W1TB
chains in the Genus database with same CATH topology
3PXPA 3C8CA 4ZRRA 2R78A 2O9BA 3B47A 3KSGA 2V1AA 2ZMVA 4LLOB 5DKKA 4OOLA 3E98A 4I5SA 1UWPX 3CUEA 2Z6CA 3PBSA 4MN5A 1LSVA 4HJ4A 4R38A 3CI6A 3GECA 3T4QA 4KUKA 4CLCD 3KYQA 3T4KA 2M7VA 4I39A 2O99A 4GLQA 3T50A 1ODVA 2VLGA 1S67L 3C38A 4G3KA 3EQUA 1D06A 4I38A 5TJJA 2Y79A 3PBRA 4KQOA 1MZUA 3UB8A 2HJ9C 2HF6A 4L9FA 5HDDA 3FC7A 1IFQA 3A0VA 4NXGA 1H3QA 4HOIA 3CWFA 1OT9A 5DFXA 1JNUA 4G3VA 3S7QA 4ETZA 1XFNA 4KUOA 4Q0HA 2OAP1 3LIFA 3VV4A 1W63M 4H6JA 2V0UA 1G28A 2Z6DA 4WEJA 4PKYG 4GCZA 1YKDA 3T4LA 2GX5A 2WKRA 3EOIA 3CUEC 2HV1A 1DRMA 4IJGA 2EA9A 4I3IA 4WEKA 4RQ9A 4YWZA 4O01A 3RTYA 4DJ3A 4EU0A 2J3TC 3BY8A 3NOPC 4KQDA 3E4OA 2FH5A 4GHIA 5AVEA 3MF0A 1F98A 3OCNA 3VE3A 1T1CA 1P9RA 2O9AA 3K3DA 4HJ6A 4XT2B 3KSHA 4WUJA 3R7WA 3BJNA 4WLAA 3TW8A 1LT0A 5IS1A 4P6ZS 4ME4A 1N9NA 4ARZB 4BBVA 3LIDA 4F3LB 3B42A 2L4RA 5HZHA 2VX8A 3UMEA 3LYXA 2KOIA 4B93A 3H7WB 4E04A 2VJWA 1W63Q 3VE4A 2GJ3A 3RFBA 3TE8A 2ZBBA 3A0SA 2W3GA 3VOLA 1OTAA 3E0YA 3F1NB 4Y5FA 2PYRA 2J80A 4G3WA 3E4QA 4R70A 3PBQA 2CMNA 3RH8B 4EW7A 4R3AA 3F1PB 2VKSA 3UB9A 4IUHA 1N9LA 4K08A 3UMDA 1GSVA 2KX6A 4BWIA 1OTEA 1TS6A 3BW6A 4PHTA 1MC0A 4MMNA 2G7UA 3S7OA 3C2WA 4EXOA 2BASA 3T4TA 2L0WA 1P9WA 5IT5A 5CX7A 4Z1WA 1OTDA 1NLZA 4EERA 3PR6A 5L8MA 1ZTUA 1OPXA 1BYWA 3H82A 4NXEA 2ZOHA 2QKPA 4NEED 2GNXA 2O0YA 1IOUA 4HNBA 3LI9A 2LB5A 3MJQA 5HD3A 1XJ2A 3KSFA 5TBMA 2W1TA 2VA0A 2VGLS 5G4ZA 3UE6A 2J3WA 3S7PA 3OC2A 2QYBA 2M7UA 1TD5A 2PR6A 4WF0A 2EWVA 4YNRA 4HP4A 4MCWA 1ZHHB 2JKTI 2K31A 4H6JB 1V9ZA 3PHYA 3SW1A 5C5KA 2I9VA 3HJIA 2B02A 4AFIA 3W2ZA 2D01A 3EWKA 3IS2A 3KSIA 1Y28A 3UB6A 2IA2A 5J3WA 2VZWA 2NUTC 2WKQA 4GS9B 5DF9A 3MQOA 3V67A 4NXBA 2NUPC 1OJGA 1GSWA 1TS0A 1STZA 2JKRI 3EGXC 4IHQA 3FPVA 4UQIM 4EEPA 4EETB 4GHIB 2PD7A 5F5YA 5AJGA 2XA7S 3F1OA 2W27A 3BQ8A 5K5BA 5J7EA 3GDIA 3IBJA 4JGPA 2QJ5A 3R7WB 3K2NA 2PT7A 3CITA 1D7EA 4QPRA 5HL6A 2V9AA 2YKHA 4HHDA 2J3TD 3NOUC 4DJ2A 4MN7A 1F5MA 3OLOA 2OOLA 2HJEA 4BJPA 3EQVA 3HCYA 4EQ1A 4YOFA 3T4JA 5HDSA 3PBOA 1NLYA 3IBRA 3LIEA 3FPWA 2MJ6A 4HQAA 5HPFA 1S66L 1OJ5A 4BMWA 2PYPA 2YKFA 1WA9A 2PDRA 3D72A 2W3HA 1T1AA 5LBRA 1LSWA 4IUKA 4PAUA 1XJ3A 3LUQA 3LIBA 4ETXA 2OWHA 2XROA 3TRCA 2A2LA 3ZYTA 2XRNA 1XJ6A 3JVVA 5F6AA 5FL3A 3T4SA 1S1ZA 1EW0A 5DJTA 3PBNA 2EWWA 3CLOA 1UWNX 5HSQA 4O0PA 4CLCA 5IU1A 3LR5A 3NHQA 5DKLA 4ARZA 3K3CA 3ZQ5A 3H82B 2KLIA 2V0WA 3EEAA 1P97A 2W3FA 1GSXA 2W0NA 4HP9A 2QHKA 4II7A 2HGVA 5HD5A 3MQQA 4CLCE 3NJAA 3KX0X 2W1RA 3O5YA 4JGOA 3NOTC 3A0RA 1DP6A 2OAQ1 5TBMB 3R4KA 2A24A 1YAXA 2PHYA 2D02A 2ZOIA 2VV8A 4HI4A 3B33A 4FOFA 3F1PA 5HWWA 5DJUA 4HY8A 3BWLA 3LIAA 1TS8A 2VEAA 4I3AA 1LSXA 4LRXC 3MFXA 4HH2A 4EUVA 3LR3A 2VV7A 4WELA 2O9CA 1V9YA 2GZAA 4OOMA 4FSFA 5HWVA 1X0OA 5F69A 5A8BA 2H28A 3IS2B 4CLCC 1N9OA 2L1MA 3H9WA 3P7NA 2PD8A 3LFVA 4Q0JA 1S4SA 1XFQA 2K2NA 2ZMFA 4Q0IA 1NRJA 3FG8A 3C30A 4WN5A 2LB9A 1T1BA 4Y3IA 2QJ7A 2VGLM 4M4XA 2W3EA 3S7NA 1XJ4A 2JHEA 2JN7A 1UGUA 3LICA 4UQIS 3F1OB 1OT6A 4GJ4A 5AVFA 4LRZE 4WL9A 4MDZA 4O8GA 3BQAA 4B9OA 4DN0A 1TS7A 5KSHA 1YSPA 3MR0A 2P04A 4MN6A 4HIAA 1VHMA 4EESA 3EEHA 4Y2FA 5HPIA 4UEYA 3MXQA 5J4EA 3MQ0A 5EFWA 1H8MA 3T4OA 4R6LA 3BY9A 2P08A 1P0ZA 3EGDC 4LRYC 3OCLA 4JGQA 3LI8A 4GS9A 2XSSA 4HJ3A 5I5LA 2VV6A 4L0LA 3PBTA 1T19A 4BBTA 5DFYA 2XA7M 3KO6A 3U2AA 2V1BA 3MMHA 3LR0A 1G6OA 2JKTM 2INWA 4DMZA 1F9IA 2PR5A 3OBFA 3JVUA 1T18A 4BBUA 4PKYA 4CLCB 3LR4A 4JGRA 1TF1A 2WKPA 1NWZA 4I3JA 1KOUA 5HWTA 3PYPA 4L9GA 2B18A 4XT2A 4P6ZM 3TJZC 1LL8A 2JKRM 3KYZA 2K7SA 1OTIA 4LPZA 1OTBA 5KIZA 4EEUA 3UE3A 3UB7A 3OOVA 3E4PA 1S1YA 5G4YA 2Y8HA 2DMWA 1DP9A 2P7JA 4GW9A 1VB6A 1YSQA 4NXFA 5F68A 4F3LA 2KDKA 1MKMA 3H7WA 3ULFA 3CAXA 1S4RA 3D3OA 3DBAA 2OWJA 2A24B 1DP8A 4NKPA 2QWSA 2M1CA 3G6OA 4L9EA 2W3DA 3HJKA 3F1NA 5HDCA 4CQHA 4HH3A 3ICYA 2FZ0A 2W1TB 5MC7A 3P01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C8C A;  2R78 A;  2V1A A;  4LLO B;  5DKK A;  4I5S A;  1UWP X;  2Z6C A;  4MN5 A;  1LSV A;  4HJ4 A;  4R38 A;  3GEC A;  4KUK A;  4I39 A;  3T50 A;  1ODV A;  2VLG A;  1S67 L;  1D06 A;  4I38 A;  1MZU A;  3UB8 A;  4L9F A;  5HDD A;  3FC7 A;  3A0V A;  4NXG A;  4HOI A;  3CWF A;  1OT9 A;  1JNU A;  1XFN A;  4KUO A;  3LIF A;  4H6J A;  2V0U A;  1G28 A;  2Z6D A;  4PKY G;  4GCZ A;  2WKR A;  2HV1 A;  1DRM A;  2EA9 A;  4I3I A;  4RQ9 A;  4YWZ A;  4DJ3 A;  3RTY A;  3BY8 A;  3NOP C;  4KQD A;  3E4O A;  4GHI A;  5AVE A;  1F98 A;  3VE3 A;  1T1C A;  3K3D A;  4HJ6 A;  4XT2 B;  4WUJ A;  4WLA A;  1LT0 A;  5IS1 A;  1N9N A;  4BBV A;  3LID A;  4F3L B;  5HZH A;  2L4R A;  3UME A;  3LYX A;  3H7W B;  4E04 A;  3VE4 A;  2GJ3 A;  2ZBB A;  3A0S A;  3VOL A;  1OTA A;  3F1N B;  2PYR A;  2J80 A;  3E4Q A;  4R70 A;  2CMN A;  3RH8 B;  4EW7 A;  4R3A A;  3F1P B;  3UB9 A;  1N9L A;  4K08 A;  3UMD A;  1GSV A;  2KX6 A;  1OTE A;  1TS6 A;  3C2W A;  4EXO A;  2BAS A;  2L0W A;  1OTD A;  4EER A;  1BYW A;  3H82 A;  4NXE A;  2ZOH A;  2QKP A;  4HNB A;  3LI9 A;  3MJQ A;  5HD3 A;  1XJ2 A;  5TBM A;  5G4Z A;  3UE6 A;  2PR6 A;  4WF0 A;  4HP4 A;  4H6J B;  1V9Z A;  3PHY A;  3SW1 A;  2I9V A;  3HJI A;  2B02 A;  2D01 A;  3EWK A;  3IS2 A;  3UB6 A;  1Y28 A;  5J3W A;  2WKQ A;  4GS9 B;  3MQO A;  4NXB A;  1OJG A;  1GSW A;  1TS0 A;  4EEP A;  4EET B;  4GHI B;  2PD7 A;  5F5Y A;  3F1O A;  2W27 A;  5J7E A;  3GDI A;  4JGP A;  2QJ5 A;  1D7E A;  2V9A A;  2YKH A;  4HHD A;  3NOU C;  4DJ2 A;  3OLO A;  2OOL A;  4EQ1 A;  5HDS A;  3IBR A;  3LIE A;  4HQA A;  1S66 L;  1OJ5 A;  2PYP A;  2YKF A;  1WA9 A;  2PDR A;  3D72 A;  1T1A A;  1LSW A;  1XJ3 A;  3LUQ A;  3LIB A;  2OWH A;  1XJ6 A;  5F6A A;  1S1Z A;  1EW0 A;  5DJT A;  3CLO A;  1UWN X;  5HSQ A;  5IU1 A;  3NHQ A;  5DKL A;  3K3C A;  3ZQ5 A;  3H82 B;  2V0W A;  1P97 A;  1GSX A;  2W0N A;  4HP9 A;  2QHK A;  5HD5 A;  3MQQ A;  3NJA A;  3KX0 X;  4JGO A;  3NOT C;  3A0R A;  1DP6 A;  5TBM B;  2A24 A;  2PHY A;  2D02 A;  2ZOI A;  2VV8 A;  4HI4 A;  3B33 A;  3F1P A;  5HWW A;  5DJU A;  4HY8 A;  3BWL A;  3LIA A;  1TS8 A;  2VEA A;  4I3A A;  1LSX A;  4LRX C;  3MFX A;  4HH2 A;  2VV7 A;  1V9Y A;  5HWV A;  1X0O A;  5F69 A;  5A8B A;  2H28 A;  3IS2 B;  1N9O A;  2L1M A;  3H9W A;  3P7N A;  2PD8 A;  1S4S A;  1XFQ A;  3FG8 A;  4WN5 A;  1T1B A;  2QJ7 A;  4M4X A;  1XJ4 A;  2JHE A;  2JN7 A;  1UGU A;  3LIC A;  3F1O B;  1OT6 A;  5AVF A;  4LRZ E;  4WL9 A;  4B9O A;  1TS7 A;  4MN6 A;  3MR0 A;  4HIA A;  4EES A;  3EEH A;  3MXQ A;  5J4E A;  5EFW A;  4R6L A;  3BY9 A;  1P0Z A;  4LRY C;  4JGQ A;  3LI8 A;  4GS9 A;  4HJ3 A;  5I5L A;  2VV6 A;  1T19 A;  4BBT A;  2V1B A;  2INW A;  1F9I A;  2PR5 A;  1T18 A;  4BBU A;  4PKY A;  4JGR A;  2WKP A;  1NWZ A;  4I3J A;  1KOU A;  5HWT A;  3PYP A;  4L9G A;  4XT2 A;  1LL8 A;  2K7S A;  1OTI A;  4LPZ A;  1OTB A;  5KIZ A;  4EEU A;  3UB7 A;  3E4P A;  1S1Y A;  5G4Y A;  1DP9 A;  2P7J A;  4GW9 A;  1VB6 A;  4NXF A;  5F68 A;  4F3L A;  2KDK A;  3H7W A;  3ULF A;  3CAX A;  1S4R A;  2OWJ A;  2A24 B;  1DP8 A;  2QWS A;  2M1C A;  3G6O A;  4L9E A;  3HJK A;  3F1N A;  5HDC A;  4HH3 A;  3ICY A; 
#chains in the Genus database with same CATH topology
 1YLP A;  1CQA A;  4GNU A;  3B3X A;  4BEN A;  1M40 A;  3P98 A;  2ZMV A;  3GQZ A;  5DKK A;  1TDG A;  3BEB A;  4E3L A;  2Z2M B;  3C4O A;  1LSV A;  4JLF A;  3A3F A;  5HAQ A;  2PRF A;  3GEC A;  4QJG A;  3T4Q A;  4KUK A;  5AQB A;  3KYQ A;  3ITA A;  5DVA A;  3T4K A;  3A3E A;  2M7V A;  1KVL A;  2O99 A;  3T50 A;  1ODV A;  2ZC5 B;  5AQA A;  5CHM A;  4OPY A;  4G3K A;  2WZX A;  3ZGA B;  4I38 A;  5AQ9 A;  4KQO A;  5GHX A;  1MZU A;  3UB8 A;  2P74 A;  4XUX A;  4L9F A;  1JTG A;  4UA6 A;  1PW8 A;  3A0V A;  3CWF A;  5DFX A;  1I5Q A;  1VEU A;  3HBR A;  1HD8 A;  1FIK A;  5HL1 A;  3QHY A;  4Q0H A;  2OAP 1;  2Q9N A;  4E3K A;  3T4L A;  4PPR A;  4KZA A;  3PTE A;  3M2J A;  3ISG A;  4IVI A;  2J9P A;  2AVX A;  4Y0U A;  3LO7 A;  1S6R A;  4OVD A;  3OPP A;  4KQD A;  2HPB A;  5CXW A;  3IF6 C;  3OCN A;  4WM9 A;  2J7V A;  3PAG A;  1DJB A;  3K3D A;  4HJ6 A;  3FV7 A;  3R7W A;  4WLA A;  2UV0 E;  3G4P A;  3BM6 A;  4DE0 A;  2WGW A;  4P6Z S;  4ME4 A;  3O88 A;  3PAE A;  2ZLY A;  2KOI A;  3H7W B;  3MZF A;  1JWV A;  3A0S A;  3VOL A;  4QU3 A;  1BLC A;  1NY0 A;  1RCJ A;  2PYR A;  4B4X A;  2J80 A;  4Y0T A;  4G3W A;  2JC7 A;  1CJF A;  5TGF A;  5GLD A;  1NZU A;  3PBQ A;  4R3A A;  4QWO A;  3F1P B;  2VKS A;  3MXS A;  4IUH A;  1GSV A;  2KX6 A;  5EVI B;  4MMN A;  5GLC A;  3C7U A;  2G7U A;  1LL9 A;  1SKO A;  2WAD A;  4EXO A;  5IT5 A;  5HAP A;  1ES4 A;  4Z1W A;  4EER A;  4R3J A;  5L8M A;  1I2W A;  3BLM A;  1BYW A;  4NXE A;  1IYO A;  2ZOH A;  2Y2K A;  4HNB A;  3LEZ A;  2LB5 A;  4WZ4 A;  3ITB A;  3SH9 A;  1HVB A;  1W8Q A;  3IH9 A;  4EUZ A;  2VGL S;  3NC8 A;  5G4Z A;  3UE6 A;  4OPQ A;  1E3U D;  3G32 A;  1TD5 A;  3TG9 A;  1GA0 A;  2PR6 A;  2V20 A;  2VGJ A;  4N92 A;  4C3Q A;  4MCW A;  4OKP A;  4H6J B;  2K31 A;  3V39 A;  4AFI A;  3W2Z A;  5GLB A;  1ERO A;  2D01 A;  3EWK A;  2VZW A;  2WKQ A;  2G2U A;  1W7F A;  1G68 A;  2ZQC A;  1L0G A;  4QHC A;  3MKE A;  4R4S A;  4UQI M;  4OH0 A;  2DRW A;  1YT4 A;  3MKF A;  5E2F A;  5J7E A;  3GDI A;  4JGP A;  5TR7 A;  1CF0 A;  5JYP A;  4QPR A;  3BFF A;  3IXH A;  4X69 A;  3OLO A;  2OOL A;  3UPO A;  2WYX A;  4MLL A;  1K38 A;  1IYQ A;  5D3O A;  5F83 A;  2MJ6 A;  4HQA A;  1S66 L;  5FI2 A;  4D60 A;  2YKF A;  5L09 A;  2OLU A;  1KGE A;  4KZ6 A;  5FAP A;  5GL9 A;  1FIL A;  2A2L A;  5FAT A;  1H8Z A;  1K55 C;  1XJ6 A;  4UA9 A;  3T1Q B;  3CMZ A;  5DJT A;  4K0W A;  4EBP A;  4X6T A;  1SCW A;  5HSQ A;  4LGW A;  1GHP A;  5EV0 A;  4BD1 A;  3LR5 A;  1SDN A;  2BG1 A;  4LV2 A;  4ARZ A;  4U0T A;  1G6A A;  3O87 A;  1ERQ A;  3H82 B;  3FWL A;  4R4R A;  3ZNT A;  1GSX A;  3UE1 A;  1YLJ A;  3T1X A;  2J8Y A;  2QHK A;  5DF8 A;  4II7 A;  1PNE A;  4S2K A;  2W1R A;  3NOT C;  3A0R A;  4DDY A;  3GMW A;  5FAS A;  4BL3 A;  3MS6 A;  1K6R A;  2A24 A;  4KZ8 A;  2A49 A;  4ZJ1 A;  3LIA A;  2EX2 A;  4I3A A;  1MWT A;  3MFX A;  4EUV A;  3LR3 A;  4LV3 A;  3V3S A;  4ZJ2 A;  1V9Y A;  4N1X A;  4CLC C;  2PU2 A;  3NUL A;  5FQ9 A;  1DJC A;  2ZM8 A;  3LFV A;  1S4S A;  2K2N A;  3FG8 A;  3C30 A;  4WN5 A;  3A3D A;  4DE3 A;  3UO9 A;  1AWI A;  1N9B A;  3Q1F A;  3Q7Z A;  2Y91 A;  4JXS A;  4Y17 A;  2W3E A;  3S7N A;  1XJ4 A;  5GHZ A;  5EM1 A;  5EM0 A;  3VP2 A;  4ZBE A;  1EWZ A;  4GJ4 A;  1ERM A;  4LRZ E;  3IXB A;  1Z09 A;  1PWG A;  5FQQ A;  2Y55 A;  4B9O A;  4MN6 A;  1J9M A;  3NDE A;  4HIA A;  5JYO A;  1K4E A;  4UA7 A;  1MBL A;  5HPI A;  4GKU A;  5J4E A;  4OQ0 A;  2WGW B;  4R6L A;  1JWP A;  3VFH A;  2PBY A;  1P0Z A;  4LRY C;  4KG6 A;  5I5L A;  3WWX A;  1FCM A;  4QB8 A;  3GRJ A;  2FFF B;  2XA7 M;  3HRE A;  2JKT M;  4WZ5 C;  1CEF A;  3DTK A;  2ZC6 B;  4R3B A;  1MWU A;  5M18 A;  1TF1 A;  4OQI A;  3IHA A;  3M2K A;  5FDH A;  3TJZ C;  4P6Z M;  2JKR M;  2K7S A;  3JYI A;  3ZFZ A;  4EEU A;  3UE3 A;  1BUE A;  3E4P A;  3E2L A;  2DMW A;  1DP9 A;  5GLA A;  3H7W A;  2ZL1 A;  3D3O A;  1XP4 A;  3DBA A;  5EOE A;  1DP8 A;  2QWS A;  3M6H A;  2M1C A;  4LV1 A;  1QME A;  1ES2 A;  3CZD A;  1KGF A;  3AGE A;  5CEC A;  3ICY A;  3N8R A;  2ZM2 A;  3NBL A;  2EXA A;  3C8C A;  1O7E A;  2IWC A;  2R78 A;  3B47 A;  2V1A A;  3W4O A;  3IWI A;  4LLO B;  3E98 A;  4B88 A;  4YFM A;  4WBG A;  4KEN B;  1Q2P A;  4HJ4 A;  2C6W B;  3CI6 A;  1Z6F A;  3UN7 A;  5GHY A;  4E6X A;  1XGI A;  2XFT A;  1YLY A;  4OLG A;  3ZG9 B;  3S22 A;  4KQQ A;  1FSW A;  3PBR A;  3QP4 A;  4O7D A;  3C5A A;  4N9K A;  2HF6 A;  3HUM A;  1IFQ A;  1XA7 A;  3HLD A;  4P6B A;  1H3Q A;  2OLV A;  2WUQ A;  2IWD A;  5FQM A;  2Q0O A;  3HUN A;  1XFN A;  2ZQA A;  3N7W A;  2OV5 A;  1PZP A;  3LIF A;  3VV4 A;  1DJA A;  4H6J A;  5HX9 A;  2V0U A;  1G28 A;  2Z6D A;  4GCZ A;  3SOI A;  2B5R A;  4CPK A;  2WKR A;  4Y0O A;  3EOI A;  1DRM A;  1FSY A;  4IJG A;  2EA9 A;  4WEK A;  2Y2Q A;  4OQG A;  4DJ3 A;  3RTY A;  4JXG A;  4EU0 A;  1YLZ A;  2J3T C;  2V2F F;  3BY8 A;  1F98 A;  1YQS A;  3G35 A;  3VE3 A;  1RGY A;  3OPH A;  1T1C A;  2EXB A;  5A93 A;  4WUJ A;  3BJN A;  3TW8 A;  3QP8 A;  3QP6 A;  3IXD A;  5IS1 A;  3DTM A;  1K56 A;  4OPZ A;  1N9N A;  4ARZ B;  4RYE A;  4MNR A;  5HFO A;  1FOF A;  2L4R A;  2VX8 A;  5E2G A;  3QNB A;  2VJW A;  3UNW A;  3P09 A;  3VE4 A;  2W3G A;  4S2P A;  2X02 A;  4JPM A;  3UE0 A;  4Y5F A;  4MBK A;  5FDS A;  3CPT B;  4EW7 A;  1JVJ A;  3SS5 A;  3HLF A;  3UPN A;  4UHU A;  1N9L A;  4K08 A;  1BZA A;  1TS6 A;  1K54 C;  3C2W A;  2BAS A;  3T4T A;  4U3T A;  5CX7 A;  1LL5 A;  3GTC A;  1RP5 A;  3H82 A;  3RXX A;  4NEE D;  3IWQ A;  4EBN A;  2GNX A;  2HP9 A;  4H8R A;  4DKI A;  5M19 A;  4CJN A;  4E3O A;  3T1S A;  3IH8 A;  5HD3 A;  1JWZ A;  3S7P A;  2QYB A;  1KVM A;  3FKW A;  4PM8 A;  1JTD A;  3T12 B;  2EWV A;  2JKT I;  4NK3 A;  3UDI A;  3UDX A;  3HJI A;  3UPP A;  3GR2 A;  4GZB A;  4F94 A;  4EBL A;  2IA2 A;  2NUT C;  3SH7 A;  3V67 A;  4NXB A;  2NUP C;  2ZM0 A;  4DE1 A;  1STZ A;  2JKR I;  1SDE A;  4IHQ A;  4EEP A;  4EET B;  4GHI B;  2Q9M A;  1KDW A;  4UAA A;  2XA7 S;  5K5B A;  5HL6 A;  3NY4 A;  1F5M A;  3JPU A;  1NZO A;  3HCY A;  3WS4 A;  4YOF A;  4OOY A;  3PBO A;  3N8S A;  5L2F A;  1YMS A;  2E8J A;  4Z9Q A;  3FPW A;  5J8X A;  3ZHH A;  1TVF A;  1TDL A;  1Y54 A;  2PYP A;  4RX3 A;  2PDR A;  3D72 A;  4JF4 A;  3OZH A;  5LBR A;  2ZL1 B;  4DE2 A;  3LIB A;  3TRC A;  4P87 A;  3MXR A;  1YMX A;  1S1Z A;  1EW0 A;  1UWN X;  2Y4A A;  3ZVW A;  3BFE A;  4S2J A;  3ZQ5 A;  2ZMA A;  2HP5 A;  5EOO A;  1PW1 A;  3O5Y A;  2QPN A;  1DP6 A;  2OAQ 1;  4HBU A;  3HVF A;  1W8Y A;  2ZOI A;  3HLW A;  2H0Y A;  3HUO A;  5KSC A;  5HWW A;  2XQZ A;  3ZG8 B;  4PM6 A;  1ESI A;  1LSX A;  4LRX C;  4PMA A;  5CGX A;  2VV7 A;  1X0O A;  2RCX A;  3VP0 A;  3ZCZ A;  2Y2M A;  4Q0J A;  4Q0I A;  3IF6 A;  2LB9 A;  4Y3I A;  4P0M A;  4M4X A;  3IX8 A;  3ZVT A;  4LCM A;  2EX8 A;  4XXR A;  2JHE A;  3F1O B;  4C6Y A;  1OT6 A;  4WMC D;  3IWO A;  3BFC A;  4IBR A;  4WL9 A;  5L10 A;  1VQQ A;  4MDZ A;  1YSP A;  3MR0 A;  4IED A;  3NCK A;  4EQI A;  3EEH A;  1J3W A;  1HZO A;  3MXQ A;  3VSL A;  3MQ0 A;  4E6W A;  1H8M A;  5EVE A;  1Q2Q A;  5F1F A;  3BY9 A;  1GHM A;  4LEN A;  4JGQ A;  2XSS A;  3QP5 A;  4L0L A;  4BBT A;  3KO6 A;  3T1R A;  3LR0 A;  1F2K A;  2INW A;  3OBF A;  4GD6 A;  4PKY A;  2ZD8 A;  1L0D A;  4MEZ A;  4I3J A;  1KOU A;  5HWT A;  4JKT A;  1W5D A;  3PYP A;  1OTI A;  5KIZ A;  2JCH A;  3UB7 A;  1S1Y A;  5G4Y A;  2XLN A;  1CI8 A;  3A3I A;  4ZDX A;  1VB6 A;  1YSQ A;  4NXF A;  1H5X A;  4KZ3 A;  1E3U A;  1MKM A;  1IYS A;  4BD0 A;  3CAX A;  2H0T A;  4S2N A;  3ZG0 A;  2JE5 A;  2OWJ A;  3VSK A;  4PM7 A;  4CQH A;  3DTE A;  1K57 C;  3MBZ A;  3V5M A;  3CPT A;  3P01 A;  3MZD A;  3VOZ A;  2WZZ A;  4ZRR A;  1QMF A;  2O9B A;  3KSG A;  4Y15 A;  2H10 A;  1S0W A;  5CTN A;  2Y2J A;  1UWP X;  2I72 A;  1BT5 A;  3CUE A;  2Z6C A;  3OPR A;  3PBS A;  4CLC D;  3VP1 A;  4I39 A;  3SH8 A;  4GLQ A;  5FA7 A;  1NXY A;  3EQU A;  5HW3 A;  2XEP A;  1D06 A;  4IVK A;  3IXG A;  2Y79 A;  2XR0 A;  4E3M A;  1KE4 A;  4KQR A;  3CG5 A;  2HDR A;  5FSR A;  3FC7 A;  2XGN A;  2ZQD A;  4R1G A;  4NXG A;  4HOI A;  3A3J A;  4DRT A;  1JNU A;  4D2O A;  4KZ5 A;  1W79 A;  1K25 A;  2OSU A;  3LY3 A;  4QY5 A;  1LI0 A;  4S2M A;  4YIN A;  1W63 M;  3WS5 A;  1ONH A;  5G18 A;  4PM5 A;  5EVI C;  3CJM A;  2GX5 A;  3VP4 A;  5EVI D;  4I3I A;  5FEG A;  2V1Z A;  1YPR A;  4NET A;  1PI5 A;  4Y7P A;  3NOP C;  3E4O A;  5CRF A;  2FH5 A;  4GHI A;  3MF0 A;  2C5W B;  4FH2 A;  1P9R A;  2O9A A;  1FR6 A;  4XT2 B;  3KSH A;  5DTS A;  4ZAM A;  1XGJ A;  4BBV A;  2Y2I A;  4S2O A;  3B42 A;  4PM9 A;  2HP6 A;  1H8Y A;  1W63 Q;  2GJ3 A;  3RFB A;  3TE8 A;  2ZBB A;  3E0Y A;  3F1N B;  5M1A A;  3E4Q A;  2WGV A;  3S1Y A;  2CMN A;  5IHV A;  1HLU P;  3UB9 A;  3W4P A;  4X53 A;  4KG5 A;  2QZ6 A;  4BQM A;  2Y2L A;  3BW6 A;  4PHT A;  1XKZ A;  3S7O A;  2L0W A;  1OTD A;  4JF5 A;  2GDN A;  2G2W A;  3GVB A;  3ZNY A;  3IF6 B;  3DWZ A;  2XK1 A;  2XD1 A;  2WGI A;  2HDQ A;  1D1J A;  1FCO A;  3CHW P;  1GCE A;  3VFF A;  3W8K A;  2R9W A;  3Q81 A;  5CER A;  2J3W A;  3OC2 A;  2X01 A;  3Q07 A;  4MBH A;  1SZV A;  1ZHH B;  3NIA A;  5FQJ A;  3HLE A;  3PHY A;  3SW1 A;  5C5K A;  2B02 A;  4WZ5 A;  2ZQ8 A;  3MZE A;  1Y28 A;  5J3W A;  3ZDJ A;  1IEM A;  3MQO A;  4X1L A;  1GSW A;  4BL2 A;  5FAO A;  3FPV A;  3L9K A;  1VET B;  1ZC2 A;  2PD7 A;  5F5Y A;  5AJG A;  3BFG A;  2ZQ7 A;  3F1O A;  3WS1 A;  2EX6 A;  3CIT A;  2EX9 A;  1D7E A;  2X71 A;  2V9A A;  2J3T D;  3NOU C;  1ACF A;  2DNS A;  3RJU A;  4BJP A;  3EQV A;  4EQ1 A;  1PYY A;  1WE4 A;  4ZTK A;  1NLY A;  3LIE A;  2V8F A;  1OJ5 A;  3HLC A;  1YLW A;  1WA9 A;  3SS3 A;  1OME A;  2DCF A;  1KE3 A;  3VOY A;  5E2H A;  1LSW A;  4NG2 A;  4IUK A;  2Y2N A;  4E3I A;  2OWH A;  2XRO A;  3Q7V B;  2JBF A;  2XRN A;  3JVV A;  5FL3 A;  1SHV A;  2EWW A;  5CGS A;  3CLO A;  5FEF A;  1K0K A;  5IU1 A;  4X56 A;  4XUZ A;  5DKL A;  3G2Y A;  1BLS A;  3K3C A;  2CC1 A;  2KLI A;  3EEA A;  1P97 A;  2W0N A;  5L07 A;  4HP9 A;  2P9V A;  2HGV A;  4Y13 A;  4K0X A;  5HD5 A;  4KZB A;  4BLM A;  3NJA A;  3UY6 A;  3KX0 X;  2Y2G A;  4E3N A;  5F1G A;  4JGO A;  5TFQ A;  1NJ4 A;  5TBM B;  1YAX A;  2D02 A;  2VV8 A;  4X68 A;  3B33 A;  4FOF A;  3V50 A;  5DJU A;  1MWR A;  5A92 A;  1K6S A;  2VEA A;  1FQG A;  2E8I A;  5HWV A;  3SS4 A;  5A8B A;  3IX4 A;  2H28 A;  3IS2 B;  3L7H A;  1N9O A;  2L1M A;  3H9W A;  1PZO A;  3P7N A;  2PD8 A;  1CEG A;  5FI6 A;  1XFQ A;  2ZMF A;  3WRT A;  3WS2 A;  4GOG A;  1LHY A;  4HEF A;  4HBT A;  1UGU A;  3LIC A;  1PRQ A;  1O07 A;  1IEL A;  5AVF A;  1VM1 A;  5A90 A;  2Y2P A;  4O8G A;  4DN0 A;  1TS7 A;  1VHM A;  4Y2F A;  4UEY A;  5CTM A;  3BEC A;  5EFW A;  3T4O A;  1DY6 A;  2BLS A;  3GSG A;  2P08 A;  3EGD C;  3LI8 A;  4GS9 A;  1H0M A;  2VV6 A;  3PBT A;  2UWX A;  5DFY A;  2V1B A;  4KZ4 A;  4DDS A;  1G6O A;  1GA9 A;  1K54 A;  2PR5 A;  4OP8 A;  1BLP A;  3NEC A;  4GN2 A;  4JXW A;  4CLC B;  3LR4 A;  3LCE A;  1K4F A;  3LY4 A;  3FKV A;  4Q8I A;  3VP3 A;  4QD4 A;  1HTZ A;  2B18 A;  4XT2 A;  1LL8 A;  1NRF A;  4QY6 A;  3KYZ A;  4LPZ A;  1OTB A;  1U60 A;  4U0X A;  3OOV A;  4RA7 A;  3N4I A;  3G31 A;  2Y8H A;  1L0F A;  1ZKJ A;  2J9O A;  2Z2L B;  4GW9 A;  2KDK A;  2HDU A;  1L3L A;  2QMI A;  5DF7 A;  4NKP A;  3G6O A;  4L9E A;  2W3D A;  2WKI A;  3HJK A;  3F1N A;  1YM1 A;  5FQI A;  4FTX A;  2FZ0 A;  1IKI A;  5MC7 A;  3PXP A;  1KDS A;  1LI9 A;  4N9L A;  1BSG A;  3D9Y A;  3DTI A;  1GHI A;  4OOL A;  4I5S A;  3UDF A;  1EI5 A;  4FUW A;  4LV0 A;  4MN5 A;  1ALQ A;  4R38 A;  1IKG A;  5FQK A;  1C3B A;  1XXM A;  4X1M A;  2VLG A;  1S67 L;  3C38 A;  3HLB A;  4RVA A;  5FAQ A;  3TOI A;  3G2Z A;  5TJJ A;  2B95 A;  4S2N C;  3DAV A;  2HJ9 C;  1N4O A;  1ES3 A;  5HDD A;  3DWK A;  1OT9 A;  3IX3 A;  2R9X A;  4G3V A;  3S7Q A;  4ETZ A;  3TSG A;  4KUO A;  4JF6 A;  2RL3 A;  3D4F A;  4GDB A;  5CED A;  2A3U A;  4FD8 A;  2WAF A;  4WEJ A;  4PKY G;  1ONG A;  1YKD A;  3IHB A;  3CUE C;  2HV1 A;  3Q82 A;  3O3V A;  4RQ9 A;  4YWZ A;  4O01 A;  3HL9 A;  1VET A;  2ACG A;  5AVE A;  2WAE A;  4X25 A;  5CEB A;  1BTL A;  1LT0 A;  1CK3 A;  2WKH A;  1RGZ A;  3LID A;  4F3L B;  5HZH A;  3G30 A;  5KZH A;  3HLG A;  3UME A;  3LYX A;  2WK0 A;  4B93 A;  4E04 A;  1L2S A;  2P9V B;  1OTA A;  3IT9 A;  1E25 A;  1AXB A;  1ES5 A;  4S2L A;  4R70 A;  3DW0 A;  4KG2 A;  4ZJ3 A;  3RH8 B;  3Q7V A;  3S4X A;  3ZG5 A;  3WRZ A;  3NI9 A;  3UMD A;  4BWI A;  1OTE A;  1YLT A;  2ZC3 B;  1MY8 A;  1MC0 A;  2HZ5 A;  3C7V A;  3BYD A;  2XF3 A;  5HAR A;  1P9W A;  2FFY A;  1NLZ A;  4WMC A;  3PR6 A;  1ZTU A;  1OPX A;  1PFL A;  1PI4 A;  4OQH A;  5U47 A;  3SZT A;  2QKP A;  2O0Y A;  4GDN A;  1IOU A;  1PWC A;  1FR1 A;  5KMW A;  1WYC A;  4A5R A;  1XPB A;  3LI9 A;  1XX2 A;  3MJQ A;  1XJ2 A;  3KSF A;  5TBM A;  2W1T A;  2VA0 A;  4X55 A;  1CI9 A;  3I7J A;  5EEC A;  2BTF P;  1VEU B;  2M7U A;  3QP1 A;  4WF0 A;  2ZC7 A;  3BRM A;  4R0Q A;  4YNR A;  4HP4 A;  1MPL A;  4ID4 A;  3MFD A;  3M6B A;  1V9Z A;  2XH9 A;  2I9V A;  4OON A;  3IS2 A;  3KSI A;  3ZG7 B;  2EFU A;  3UB6 A;  1TEM A;  4E3J A;  4GS9 B;  3LGO A;  1K55 A;  5DF9 A;  1L0E A;  1OJG A;  2Y2O A;  1TS0 A;  3EGX C;  4GB7 A;  3WS0 A;  3O86 A;  5EVL A;  1G5U A;  2PBD P;  2PU4 A;  3FZC A;  2W27 A;  3BQ8 A;  3IBJ A;  3IQA A;  4HES A;  2QJ5 A;  3R7W B;  3K2N A;  2PT7 A;  4MBF A;  4EV4 A;  2YKH A;  4HHD A;  3QP2 A;  5EE8 A;  4DJ2 A;  4MN7 A;  5DTT A;  2JKG A;  5I94 A;  2HJE A;  2HDS A;  3VMA A;  3T4J A;  5HDS A;  4EWF A;  3IBR A;  4GD8 A;  5HPF A;  2ZJ9 A;  1K57 A;  3RXW A;  2IWB A;  2XFS A;  4BMW A;  2PAV P;  2V8C A;  2VGK A;  1A0K A;  1ZG4 A;  2EFX A;  5CHU A;  2W3H A;  3GV9 A;  1T1A A;  4PAU A;  1XJ3 A;  3LUQ A;  2ZQ9 A;  4ETX A;  4KZ9 A;  4OLD A;  4LCL A;  3ZYT A;  5BOH A;  5F6A A;  2ZC4 B;  3T4S A;  4B4Z A;  3PBN A;  5A91 A;  4O0P A;  4CLC A;  3G34 A;  1SKO B;  3NHQ A;  5CHJ A;  2WKE A;  1BLH A;  2V0W A;  2JKF A;  2W3F A;  4ESP A;  3N6I A;  3AGD A;  3MQQ A;  4CLC E;  4DXB A;  4JXV A;  4FH4 A;  1ZG6 A;  3LEQ A;  1K56 D;  3R4K A;  2PHY A;  1PIO A;  3QNC A;  4P85 A;  1NYM A;  4HI4 A;  5AQ7 A;  3BLS A;  3F1P A;  1I2S A;  4HY8 A;  3BWL A;  4OP5 A;  1TS8 A;  5EVI A;  5F82 A;  4HH2 A;  1MWS A;  3W4Q A;  4WEL A;  2O9C A;  3NDG A;  4WYY A;  2GZA A;  4OOM A;  1ESU A;  4FSF A;  4OPR A;  5F69 A;  1Y4O A;  5FI7 A;  5EUA A;  3E2K A;  1NRJ A;  3KYE A;  3MSH A;  1T1B A;  2QJ7 A;  1LLB A;  2VGL M;  1MKI A;  4IBX A;  2JN7 A;  4LFU A;  1IYP A;  3OPL A;  4UQI S;  3UB5 P;  4M3K A;  4RX2 A;  2VK3 A;  5DTK A;  1KE0 A;  1FCN A;  1NYY A;  1M6K A;  3BQA A;  3N8L A;  4DXC A;  5KSH A;  5E43 A;  2P04 A;  1BUL A;  4N1H A;  4EES A;  1SKF A;  1KGG A;  4K91 A;  1PWD A;  4DF6 A;  3OCL A;  4KZ7 A;  4HJ3 A;  1MXO A;  3IF5 A;  1T19 A;  4JBF A;  4FCF A;  3U2A A;  3MMH A;  2XD5 A;  5HAI A;  1F9I A;  3FYZ A;  4DMZ A;  3C4P A;  3JVU A;  5CGW A;  1T18 A;  3V3R A;  4BBU A;  4JGR A;  5E2E A;  2WKP A;  1NWZ A;  5EPH A;  2XDM A;  4L9G A;  1E4D A;  3BFD A;  1XA1 A;  2H5S A;  3AGF A;  2P7J A;  5F68 A;  1WYB A;  4F3L A;  4S2I A;  3ULF A;  2Y59 A;  1S4R A;  2A24 B;  4C75 A;  5HDC A;  4HH3 A;  3U4L P;  2Y2H A;  4R23 A;  2W1T B; 
#chains in the Genus database with same CATH homology
 3PXP A;  3C8C A;  4ZRR A;  2R78 A;  2O9B A;  3B47 A;  3KSG A;  2V1A A;  2ZMV A;  4LLO B;  5DKK A;  4OOL A;  3E98 A;  4I5S A;  1UWP X;  3CUE A;  2Z6C A;  3PBS A;  4MN5 A;  1LSV A;  4HJ4 A;  4R38 A;  3CI6 A;  3GEC A;  3T4Q A;  4KUK A;  4CLC D;  3KYQ A;  3T4K A;  2M7V A;  4I39 A;  2O99 A;  4GLQ A;  3T50 A;  1ODV A;  2VLG A;  1S67 L;  3C38 A;  4G3K A;  3EQU A;  1D06 A;  4I38 A;  5TJJ A;  2Y79 A;  3PBR A;  4KQO A;  1MZU A;  3UB8 A;  2HJ9 C;  2HF6 A;  4L9F A;  5HDD A;  3FC7 A;  1IFQ A;  3A0V A;  4NXG A;  1H3Q A;  4HOI A;  3CWF A;  1OT9 A;  5DFX A;  1JNU A;  4G3V A;  3S7Q A;  4ETZ A;  1XFN A;  4KUO A;  4Q0H A;  2OAP 1;  3LIF A;  3VV4 A;  1W63 M;  4H6J A;  2V0U A;  1G28 A;  2Z6D A;  4WEJ A;  4PKY G;  4GCZ A;  1YKD A;  3T4L A;  2GX5 A;  2WKR A;  3EOI A;  3CUE C;  2HV1 A;  1DRM A;  4IJG A;  2EA9 A;  4I3I A;  4WEK A;  4RQ9 A;  4YWZ A;  4O01 A;  3RTY A;  4DJ3 A;  4EU0 A;  2J3T C;  3BY8 A;  3NOP C;  4KQD A;  3E4O A;  2FH5 A;  4GHI A;  5AVE A;  3MF0 A;  1F98 A;  3OCN A;  3VE3 A;  1T1C A;  1P9R A;  2O9A A;  3K3D A;  4HJ6 A;  4XT2 B;  3KSH A;  4WUJ A;  3R7W A;  3BJN A;  4WLA A;  3TW8 A;  1LT0 A;  5IS1 A;  4P6Z S;  4ME4 A;  1N9N A;  4ARZ B;  4BBV A;  3LID A;  4F3L B;  3B42 A;  2L4R A;  5HZH A;  2VX8 A;  3UME A;  3LYX A;  2KOI A;  4B93 A;  3H7W B;  4E04 A;  2VJW A;  1W63 Q;  3VE4 A;  2GJ3 A;  3RFB A;  3TE8 A;  2ZBB A;  3A0S A;  2W3G A;  3VOL A;  1OTA A;  3E0Y A;  3F1N B;  4Y5F A;  2PYR A;  2J80 A;  4G3W A;  3E4Q A;  4R70 A;  3PBQ A;  2CMN A;  3RH8 B;  4EW7 A;  4R3A A;  3F1P B;  2VKS A;  3UB9 A;  4IUH A;  1N9L A;  4K08 A;  3UMD A;  1GSV A;  2KX6 A;  4BWI A;  1OTE A;  1TS6 A;  3BW6 A;  4PHT A;  1MC0 A;  4MMN A;  2G7U A;  3S7O A;  3C2W A;  4EXO A;  2BAS A;  3T4T A;  2L0W A;  1P9W A;  5IT5 A;  5CX7 A;  4Z1W A;  1OTD A;  1NLZ A;  4EER A;  3PR6 A;  5L8M A;  1ZTU A;  1OPX A;  1BYW A;  3H82 A;  4NXE A;  2ZOH A;  2QKP A;  4NEE D;  2GNX A;  2O0Y A;  1IOU A;  4HNB A;  3LI9 A;  2LB5 A;  3MJQ A;  5HD3 A;  1XJ2 A;  3KSF A;  5TBM A;  2W1T A;  2VA0 A;  2VGL S;  5G4Z A;  3UE6 A;  2J3W A;  3S7P A;  3OC2 A;  2QYB A;  2M7U A;  1TD5 A;  2PR6 A;  4WF0 A;  2EWV A;  4YNR A;  4HP4 A;  4MCW A;  1ZHH B;  2JKT I;  2K31 A;  4H6J B;  1V9Z A;  3PHY A;  3SW1 A;  5C5K A;  2I9V A;  3HJI A;  2B02 A;  4AFI A;  3W2Z A;  2D01 A;  3EWK A;  3IS2 A;  3KSI A;  1Y28 A;  3UB6 A;  2IA2 A;  5J3W A;  2VZW A;  2NUT C;  2WKQ A;  4GS9 B;  5DF9 A;  3MQO A;  3V67 A;  4NXB A;  2NUP C;  1OJG A;  1GSW A;  1TS0 A;  1STZ A;  2JKR I;  3EGX C;  4IHQ A;  3FPV A;  4UQI M;  4EEP A;  4EET B;  4GHI B;  2PD7 A;  5F5Y A;  5AJG A;  2XA7 S;  3F1O A;  2W27 A;  3BQ8 A;  5K5B A;  5J7E A;  3GDI A;  3IBJ A;  4JGP A;  2QJ5 A;  3R7W B;  3K2N A;  2PT7 A;  3CIT A;  1D7E A;  4QPR A;  5HL6 A;  2V9A A;  2YKH A;  4HHD A;  2J3T D;  3NOU C;  4DJ2 A;  4MN7 A;  1F5M A;  3OLO A;  2OOL A;  2HJE A;  4BJP A;  3EQV A;  3HCY A;  4EQ1 A;  4YOF A;  3T4J A;  5HDS A;  3PBO A;  1NLY A;  3IBR A;  3LIE A;  3FPW A;  2MJ6 A;  4HQA A;  5HPF A;  1S66 L;  1OJ5 A;  4BMW A;  2PYP A;  2YKF A;  1WA9 A;  2PDR A;  3D72 A;  2W3H A;  1T1A A;  5LBR A;  1LSW A;  4IUK A;  4PAU A;  1XJ3 A;  3LUQ A;  3LIB A;  4ETX A;  2OWH A;  2XRO A;  3TRC A;  2A2L A;  3ZYT A;  2XRN A;  1XJ6 A;  3JVV A;  5F6A A;  5FL3 A;  3T4S A;  1S1Z A;  1EW0 A;  5DJT A;  3PBN A;  2EWW A;  3CLO A;  1UWN X;  5HSQ A;  4O0P A;  4CLC A;  5IU1 A;  3LR5 A;  3NHQ A;  5DKL A;  4ARZ A;  3K3C A;  3ZQ5 A;  3H82 B;  2KLI A;  2V0W A;  3EEA A;  1P97 A;  2W3F A;  1GSX A;  2W0N A;  4HP9 A;  2QHK A;  4II7 A;  2HGV A;  5HD5 A;  3MQQ A;  4CLC E;  3NJA A;  3KX0 X;  2W1R A;  3O5Y A;  4JGO A;  3NOT C;  3A0R A;  1DP6 A;  2OAQ 1;  5TBM B;  3R4K A;  2A24 A;  1YAX A;  2PHY A;  2D02 A;  2ZOI A;  2VV8 A;  4HI4 A;  3B33 A;  4FOF A;  3F1P A;  5HWW A;  5DJU A;  4HY8 A;  3BWL A;  3LIA A;  1TS8 A;  2VEA A;  4I3A A;  1LSX A;  4LRX C;  3MFX A;  4HH2 A;  4EUV A;  3LR3 A;  2VV7 A;  4WEL A;  2O9C A;  1V9Y A;  2GZA A;  4OOM A;  4FSF A;  5HWV A;  1X0O A;  5F69 A;  5A8B A;  2H28 A;  3IS2 B;  4CLC C;  1N9O A;  2L1M A;  3H9W A;  3P7N A;  2PD8 A;  3LFV A;  4Q0J A;  1S4S A;  1XFQ A;  2K2N A;  2ZMF A;  4Q0I A;  1NRJ A;  3FG8 A;  3C30 A;  4WN5 A;  2LB9 A;  1T1B A;  4Y3I A;  2QJ7 A;  2VGL M;  4M4X A;  2W3E A;  3S7N A;  1XJ4 A;  2JHE A;  2JN7 A;  1UGU A;  3LIC A;  4UQI S;  3F1O B;  1OT6 A;  4GJ4 A;  5AVF A;  4LRZ E;  4WL9 A;  4MDZ A;  4O8G A;  3BQA A;  4B9O A;  4DN0 A;  1TS7 A;  5KSH A;  1YSP A;  3MR0 A;  2P04 A;  4MN6 A;  4HIA A;  1VHM A;  4EES A;  3EEH A;  4Y2F A;  5HPI A;  4UEY A;  3MXQ A;  5J4E A;  3MQ0 A;  5EFW A;  1H8M A;  3T4O A;  4R6L A;  3BY9 A;  2P08 A;  1P0Z A;  3EGD C;  4LRY C;  3OCL A;  4JGQ A;  3LI8 A;  4GS9 A;  2XSS A;  4HJ3 A;  5I5L A;  2VV6 A;  4L0L A;  3PBT A;  1T19 A;  4BBT A;  5DFY A;  2XA7 M;  3KO6 A;  3U2A A;  2V1B A;  3MMH A;  3LR0 A;  1G6O A;  2JKT M;  2INW A;  4DMZ A;  1F9I A;  2PR5 A;  3OBF A;  3JVU A;  1T18 A;  4BBU A;  4PKY A;  4CLC B;  3LR4 A;  4JGR A;  1TF1 A;  2WKP A;  1NWZ A;  4I3J A;  1KOU A;  5HWT A;  3PYP A;  4L9G A;  2B18 A;  4XT2 A;  4P6Z M;  3TJZ C;  1LL8 A;  2JKR M;  3KYZ A;  2K7S A;  1OTI A;  4LPZ A;  1OTB A;  5KIZ A;  4EEU A;  3UE3 A;  3UB7 A;  3OOV A;  3E4P A;  1S1Y A;  5G4Y A;  2Y8H A;  2DMW A;  1DP9 A;  2P7J A;  4GW9 A;  1VB6 A;  1YSQ A;  4NXF A;  5F68 A;  4F3L A;  2KDK A;  1MKM A;  3H7W A;  3ULF A;  3CAX A;  1S4R A;  3D3O A;  3DBA A;  2OWJ A;  2A24 B;  1DP8 A;  4NKP A;  2QWS A;  2M1C A;  3G6O A;  4L9E A;  2W3D A;  3HJK A;  3F1N A;  5HDC A;  4CQH A;  4HH3 A;  3ICY A;  2FZ0 A;  2W1T B;  5MC7 A;  3P01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...