4UQIS

Ap2 controls clathrin polymerization with a membrane-activated switch
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
publication title Clathrin Adaptors. Ap2 Controls Clathrin Polymerization with a Membrane-Activated Switch.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 49
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4uqiS00
5MC7A 2JKRM 1W63M 2VGLM 2JKTI 4UQIS 2HF6A 1W63Q 2XA7S 4P6ZS 4UQIM 2JKRI 2XA7M 4P6ZM 2JKTM 3TJZC 4NEED 1NRJA 2FH5A 2VGLS
chains in the Genus database with same CATH superfamily
1DRMA 4UA6A 3LR4A 3BFCA 2QPNA 1ZKJA 3ZG5A 5CEBA 4OQGA 2XFTA 3GSGA 3OBFA 3C7UA 4EBLA 2XD5A 2EFXA 2OAQ1 4X55A 4EBPA 3PAEA 4I38A 3CLOA 2EWWA 1OTAA 4EQIA 5CTNA 2KDKA 1YT4A 4D60A 4ID4A 4NK3A 5FQ9A 1L0FA 1QMEA 2P08A 4L9FA 5EVEA 3TOIA 2B18A 4I3JA 4PAUA 4N9KA 4ETZA 4UEYA 3UO9A 4IVIA 2W1TA 1K55A 5TFQA 2WGVA 2XH9A 1NRFA 1NWZA 3HCYA 1Y54A 2JHEA 5CGXA 5HPFA 3A3FA 3B47A 3F1NB 4R6LA 4UA7A 2Z6CA 4JBFA 5AQ7A 1TDLA 3IQAA 1OTBA 2I72A 4CLCC 2J7VA 4RQ9A 5J7EA 2WKEA 5EVIB 3SH7A 3B33A 4ZAMA 2XA7S 2EX9A 3G30A 3HJIA 3UDFA 1H5XA 3S7OA 1XJ4A 5HAIA 3T4OA 5EUAA 5IT5A 4ESPA 1BZAA 2WK0A 3B42A 1CJFA 4S2NC 3ZHHA 2XF3A 1KDWA 2PU4A 2LB9A 1XGIA 3KX0X 4YINA 3FYZA 1VETA 4LRXC 3CITA 4DJ3A 4DDSA 1UGUA 2JCHA 3MSHA 1SDEA 3C4OA 3AGEA 3UPOA 3MQOA 2EX8A 4O0PA 3BLMA 1YSPA 4Y15A 1JTDA 1NLZA 4RVAA 5J4EA 4RA7A 4E6XA 1ES2A 3LR0A 3PTEA 3BFEA 1IOUA 5KSHA 3UB7A 1E25A 5TJJA 1H8YA 3KO6A 4EQ1A 5AVFA 2PAVP 1ZG6A 3PR6A 4I3IA 4AFIA 4D2OA 4OPZA 1XPBA 2ZMAA 3QP1A 3IXBA 1FIKA 4K0WA 4X53A 1T19A 1ALQA 3QNBA 5FAOA 5CECA 2GDNA 3G34A 4K08A 3MJQA 1PNEA 2J80A 4WLAA 3HBRA 2ZQ9A 2GJ3A 3K3CA 2HDSA 5FI7A 2JKRI 3P01A 4H6JB 4CPKA 3Q81A 5CHUA 1IYOA 3ITAA 2ZL1A 3C8CA 4JGOA 3WRZA 3T1RA 2VJWA 3IXGA 3A3DA 2HP5A 1NXYA 1AWIA 3I7JA 4QJGA 2XFSA 5HARA 5EOEA 2XK1A 3U2AA 2FFYA 5GLCA 3L7HA 1K56D 3E2KA 4HOIA 2VK3A 2ZC3B 2BLSA 3HLBA 4BL3A 1PFLA 2FZ0A 2ZQCA 3CWFA 5KIZA 4EESA 3OPRA 2Q9NA 2V1BA 5CEDA 2Y2KA 3LIFA 3UE1A 1S66L 4UQIS 2WKPA 2Y55A 3E4PA 4JPMA 3E4OA 2B02A 3N8RA 4F3LA 2ZJ9A 3O88A 4RX2A 2Q9MA 3H9WA 1WA9A 1OTDA 1O07A 2Y2OA 5A91A 4N92A 4O8GA 2OLUA 1ZC2A 4E3KA 5FA7A 1XJ2A 5CHMA 1XXMA 4OONA 3VE4A 4CJNA 3LFVA 1VEUB 2AVXA 3VP4A 5TBMB 2JKGA 3NOTC 1VM1A 3OC2A 5AJGA 4BLMA 2PHYA 4R70A 1BT5A 5AQBA 2EX2A 3CJMA 5L07A 4FD8A 3N4IA 5A8BA 5TGFA 1GA9A 1TF1A 1V9YA 4IHQA 3LIDA 2WGIA 4JGPA 3ZNYA 3B3XA 1LHYA 5DJTA 2V0UA 5F1GA 2ZC7A 3G31A 4OLDA 2X71A 4ZJ1A 4U0XA 1NRJA 3GVBA 3CUEC 4HY8A 3O86A 4S2OA 4PM7A 3VE3A 1PZOA 2H0TA 2XSSA 4DXBA 4JGQA 1S4RA 2ZQ7A 4OPQA 1CEFA 4P6ZM 1GA0A 3D3OA 2MJ6A 2Q0OA 3R7WB 1G5UA 4R3JA 4LV0A 3PYPA 1YLWA 4LPZA 3M6BA 1FSWA 2A3UA 3T1QB 4WM9A 5FDHA 2P74A 5DF9A 4MMNA 4OQ0A 3OOVA 3HL9A 5EFWA 4GW9A 3TJZC 2H0YA 4BWIA 2KOIA 3EWKA 3FC7A 3QP5A 1W63M 1BLHA 3ZFZA 2EXAA 4Y7PA 4LV3A 4OVDA 2D02A 1MPLA 3KSHA 3DWKA 3M6HA 5HDCA 2XLNA 2ZOHA 5G18A 4E04A 3KSIA 5EV0A 4S2LA 1MKIA 2ZMFA 4CQHA 3UB6A 4FH2A 3D72A 1CEGA 3VOLA 3V39A 3BFGA 4L0LA 1OT6A 2VA0A 4HESA 3IH9A 4WUJA 2B95A 4N1HA 4HP4A 4MCWA 5E2FA 3NCKA 2ZBBA 3VOZA 3D4FA 1ESUA 3DW0A 3GQZA 3ZDJA 4KZ4A 3ZVTA 4GS9B 4MDZA 1SHVA 4JF5A 4PPRA 2WKQA 3GR2A 1SKOA 2RCXA 5D3OA 1OT9A 3DWZA 4P6BA 4XT2A 3W4QA 3ZG8B 1VHMA 2R9WA 1S1YA 3CPTB 3IX4A 4NXBA 4DF6A 3S7PA 2M7UA 2DNSA 4OQHA 4GZBA 1JVJA 1LSWA 1TDGA 5J8XA 4N9LA 4GDNA 4KG5A 3LCEA 1IKGA 2L4RA 1LI9A 4Z1WA 2WKIA 1S4SA 3MKEA 4LGWA 2W3HA 3Q7VB 4ZBEA 1DY6A 4EWFA 4GKUA 4PM6A 3MF0A 1T1AA 5F82A 2Y8HA 3BWLA 5CXWA 1T18A 3LY3A 3BFDA 3WWXA 5GLBA 1ES3A 4LLOB 2BTFP 3F1PB 1OTEA 4YNRA 4HQAA 1OJGA 2WGWA 4DE3A 1ZTUA 3PBQA 5DKKA 3IWOA 4X69A 3JVUA 2P04A 1TS7A 2HDRA 3ZQ5A 1E3UD 4PM9A 2G2UA 3T4QA 1KOUA 3CZDA 1Y4OA 2C6WB 5CX7A 4KZAA 2R9XA 4LCLA 3CAXA 3P09A 5F83A 2X02A 5HAPA 1N9LA 4DE1A 2IWDA 3BW6A 1YSQA 1JWZA 2CMNA 2HJ9C 3ZVWA 2QJ7A 4DN0A 3LY4A 1SCWA 1PI4A 2XA7M 2VGKA 2UWXA 1KDSA 2PR5A 4E3OA 3NECA 4CLCD 4WYYA 4PM8A 2WADA 1GCEA 3MR0A 1AXBA 4GN2A 5EM0A 4JLFA 4GHIA 1TVFA 2XDMA 5HZHA 2EXBA 5A92A 4ARZA 3NBLA 2QKPA 2W1TB 5K5BA 3T1SA 3G2YA 2EFUA 4QY5A 4FH4A 1VB6A 5F68A 1HTZA 4LV2A 3LEZA 5FQIA 1LT0A 5FSRA 4YWZA 1IYQA 3PHYA 4EEUA 1GHPA 3SOIA 1LL5A 3E4QA 4KUKA 4E3NA 3T4KA 3HUOA 3T12B 4EUVA 5A93A 5L8MA 4HH3A 1G6OA 1K57C 4HNBA 3QP6A 3FKVA 2V9AA 2P9VA 1OPXA 2ZC6B 4Y2FA 4KENB 3RTYA 5KSCA 1MXOA 5CTMA 1K54C 1S6RA 4FTXA 5F6AA 3HLGA 2VGLS 2HP6A 1VETB 2PU2A 2G2WA 3ZG9B 5HDSA 4X1LA 1LSVA 4DJ2A 1F98A 4OKPA 5L10A 3BM6A 3EQUA 1ACFA 3NHQA 1ESIA 2QHKA 3UB5P 4DXCA 3OCLA 3HJKA 2INWA 3NOUC 5FAPA 4JF4A 1H0MA 1OJ5A 3A0RA 1BUEA 1G68A 1OTIA 1W8QA 1X0OA 1A0KA 5E2HA 1I2SA 2XROA 1TS6A 4HHDA 2NUPC 4GD8A 5HWTA 1P9WA 3Q07A 2JE5A 3S7NA 1W5DA 4JF6A 3MZFA 4G3VA 2OOLA 4Y3IA 1Z09A 2QMIA 5DTTA 5KMWA 1PYYA 3NJAA 2XQZA 4OPYA 5HW3A 2ZQAA 1GSXA 4QY6A 4UQIM 4LFUA 4Q0JA 4PMAA 5E2EA 4IUKA 4WF0A 3VP0A 1FCNA 2XD1A 3FV7A 3MXRA 1N4OA 3UE6A 3NDGA 5AQAA 4Y0UA 1DJBA 2Y2NA 5GL9A 3ULFA 4O7DA 2ZL1B 3AGFA 2PDRA 3LO7A 1ODVA 5IU1A 3IX8A 5EVID 2WKRA 2VZWA 2L1MA 3QP8A 3MZDA 3EEHA 3IHBA 3TW8A 4QWOA 1XP4A 3VV4A 1K55C 4R23A 2YKHA 2HP9A 4KZBA 1MWSA 3DBAA 1MWUA 1K56A 3ZNTA 1ERQA 4BBVA 4R3BA 3UNWA 3VP2A 4F3LB 5HDDA 1W8YA 2QYBA 4UAAA 3IF6B 1KE0A 4K0XA 3LI9A 1BLCA 2W3FA 3HLFA 5FL3A 2W0NA 3C38A 2A24A 3TSGA 3HLDA 4FCFA 4WN5A 1TEMA 2NUTC 4BL2A 2XR0A 4GJ4A 3WRTA 4EETB 5FQQA 1MZUA 3E98A 2K2NA 5KZHA 2PT7A 1FCMA 2Y2GA 2Y2HA 4WELA 1W7FA 3IF6A 1FSYA 2P7JA 3RXWA 2FH5A 4I5SA 3G6OA 3H7WA 1STZA 3A0VA 3OLOA 2Z6DA 4FUWA 3H82A 4OOYA 3BQ8A 1D1JA 2E8JA 1YMXA 1L3LA 4NXEA 1D7EA 4HJ4A 4MN6A 4B93A 3OPPA 4ZJ3A 4R38A 3UDIA 1IKIA 4DMZA 3T4TA 3RH8B 2EWVA 3QHYA 4OPRA 2Y4AA 4GD6A 3LIAA 3V50A 1G6AA 5HPIA 2HV1A 3G2ZA 3E0YA 5CERA 5F1FA 1PW1A 4ETXA 2PBDP 1MY8A 1D06A 5E43A 2ZM0A 5HD5A 3KYEA 2PRFA 2ACGA 4S2MA 4MBKA 5BOHA 4EEPA 4DE0A 1XX2A 4R4SA 2DRWA 2VLGA 3KYQA 1ES4A 4KZ7A 2Y2JA 5DF8A 1K4EA 3F1OA 3GV9A 1FCOA 2J9PA 2VEAA 4HH2A 2PBYA 4MNRA 4XUXA 4U3TA 1YM1A 2QWSA 4Y17A 5JYOA 1OMEA 4DRTA 4Q0HA 5GHZA 3VP1A 4WL9A 5DTKA 2J3WA 1BLPA 3UN7A 4LCMA 3EGXC 4KQQA 5DTSA 2Y79A 3C4PA 2JKRM 4Y5FA 1J3WA 2OLVA 2W27A 2WYXA 5FI6A 4CLCE 4MN5A 4P85A 3IT9A 5FQMA 3IF6C 3AGDA 2J3TD 1JWVA 3KSGA 4KG6A 4LRYC 3P7NA 1IYSA 2A2LA 3TRCA 5EVLA 1SKOB 5CRFA 3LGOA 3PAGA 3N8SA 4HI4A 4X6TA 1H3QA 1G28A 1WYCA 5A90A 4XT2B 5L2FA 1NZOA 3PBSA 4L9GA 3CHWP 5EPHA 2EX6A 1PW8A 3WS4A 1MKMA 1YLTA 3EOIA 3UE3A 4KG2A 1Y28A 2ZM8A 4OLGA 5EOOA 3M2KA 3UY6A 1YPRA 3EEAA 1ZG4A 2WKHA 4UA9A 3G35A 4BBUA 2K31A 2HJEA 2DCFA 3HREA 2Y2PA 3IS2A 3LR5A 3UB9A 1EI5A 2O9BA 2HGVA 2ZQ8A 3BQAA 3TE8A 1EWZA 5EECA 1DP6A 4QU3A 1DP9A 5HAQA 3ZG0A 3VSLA 4QD4A 4S2KA 3FPWA 3SH8A 3QNCA 3DTEA 5FQJA 2WGWB 4EXOA 3O87A 4WEKA 3N6IA 2IA2A 4JGRA 3GRJA 5CGSA 3LEQA 4KQOA 2IWBA 2WZZA 4S2PA 1L0GA 3MFDA 4G3KA 1KVMA 3W2ZA 3ISGA 5M18A 1PIOA 1GHMA 1P97A 1RP5A 1T1CA 1K38A 3A3IA 2ZC4B 1GSVA 1CK3A 3N8LA 2WUQA 3PBOA 1NJ4A 1BLSA 1E3UA 4FOFA 5HWVA 1KGEA 1KGGA 1FOFA 3BECA 3S1YA 2Y2LA 4WMCD 4KZ8A 4HBUA 3HUNA 5GLAA 5FI2A 4GCZA 5HFOA 1SZVA 4EV4A 4IEDA 4X68A 1YMSA 4PKYG 1W79A 1W63Q 3IX3A 2V1ZA 4DDYA 1XA7A 5GHXA 1M6KA 4GHIB 3W4OA 5AQ9A 1Z6FA 2VGJA 4BD1A 4ZRRA 4ARZB 2W3GA 4CLCA 2BG1A 4FSFA 4N1XA 4MEZA 2VGLM 2L0WA 1EROA 4HBTA 2ZLYA 1RGZA 1Q2PA 4Y0OA 2PYRA 2ZM2A 3FG8A 4PM5A 1PWDA 1JNUA 2FFFB 1CI9A 5G4YA 3UMDA 4JXWA 4YFMA 3ZYTA 1L2SA 1XJ3A 4NKPA 3G32A 3O3VA 5F69A 1Q2QA 2P9VB 1K4FA 3TG9A 3Q82A 5AVEA 3IF5A 1NYMA 3GDIA 3MXQA 4EBNA 1IYPA 2UV0E 3MQQA 3SS5A 3A0SA 4BD0A 5M19A 4ZJ2A 1C3BA 2HZ5A 1N9OA 1LLBA 2H5SA 4R1GA 1MC0A 4EW7A 5C5KA 3UPPA 3DTKA 4GNUA 4NEED 2W3DA 3WS5A 3FZCA 3BY8A 2O9AA 4KQDA 4OQIA 2PD7A 5HWWA 3FKWA 1YLJA 2WAFA 1K25A 2BASA 2QZ6A 1GHIA 1XKZA 3R4KA 4L9EA 5EM1A 1PWGA 2VKSA 2LB5A 2O99A 3OPHA 4I39A 1VQQA 3K3DA 3MMHA 1F2KA 3UMEA 3JPUA 2IWCA 2ZD8A 4HP9A 4M4XA 4RYEA 4IVKA 3C2WA 4R4RA 4B4ZA 2GX5A 3PBRA 3NY4A 3NIAA 2JBFA 1ERMA 3MKFA 1L0EA 3V5MA 1XGJA 2Z2MB 4HIAA 2ZQDA 1S0WA 2VX8A 4OOMA 4GB7A 1FR6A 4ZTKA 4MBFA 1WYBA 2JKTI 4MBHA 3V67A 4E3MA 5DVAA 2ZMVA 5FASA 5DFYA 4KZ9A 4G3WA 3JYIA 1YQSA 3LIEA 3HVFA 2GNXA 3T4SA 3VSKA 4PKYA 3NC8A 1PI5A 1K6RA 3F1NA 4C6YA 3MBZA 3LUQA 3UE0A 3PXPA 2RL3A 3T50A 2D01A 4NXGA 4E3LA 5EVIA 2HDUA 4JKTA 5FDSA 1JWPA 3HLCA 5MC7A 3VP3A 5CHJA 4LRZE 1PWCA 4KZ6A 1F9IA 4EUZA 3IXDA 3GECA 3VFFA 3LI8A 5TR7A 1PRQA 1LL9A 5LBRA 3NI9A 4K91A 1IEMA 2V2FF 4EU0A 2OV5A 4WZ5A 1T1BA 1YLZA 3S22A 2A24B 3MS6A 5I5LA 2B5RA 3OCNA 5J3WA 3LYXA 3M2JA 3NULA 3DTIA 4GLQA 3PBTA 3Q7ZA 1SDNA 1XFQA 3MQ0A 2R78A 2W3EA 4OP8A 4GOGA 2O9CA 2VV8A 3W8KA 3CUEA 2M1CA 1YAXA 3ZG7B 2X01A 4HJ3A 4WBGA 2KX6A 2YKFA 3H7WB 3N7WA 2J8YA 4B88A 5E2GA 3H82B 3IWQA 4IBXA 2W1RA 2Y91A 4WZ4A 4BQMA 2KLIA 3CG5A 4I3AA 3SW1A 1E4DA 1DJAA 4A5RA 1NZUA 2PYPA 2OWHA 3BEBA 3SS3A 1KE4A 1NY0A 4OP5A 1XJ6A 1O7EA 1K0KA 1JTGA 2V0WA 1L0DA 3NOPC 4HEFA 2Y2MA 3QP4A 3BJNA 2OWJA 1KGFA 3KSFA 5IHVA 3NDEA 4H6JA 1MWTA 4BMWA 2M7VA 1V9ZA 2XGNA 1M40A 5HSQA 4E3IA 5EVIC 3BRMA 3E2LA 3BYDA 3FPVA 3A3JA 5HL1A 2JKTM 2Y59A 1PZPA 3EQVA 4H8RA 4LENA 2E8IA 1LSXA 3OZHA 1EW0A 1HZOA 4WEJA 3F1OB 5DJUA 4P87A 2V8FA 3Q1FA 4C3QA 3BLSA 2GZAA 4QB8A 2XRNA 1RGYA 3K2NA 4QPRA 2VV7A 4WZ5C 3CI6A 2HPBA 1XFNA 4PHTA 4KUOA 3CMZA 2G7UA 5FQKA 5CGWA 5DFXA 1BTLA 5JYPA 3IXHA 3T4JA 2V20A 1S1ZA 1FQGA 1I2WA 4MLLA 3DTMA 2CC1A 1H8ZA 4Q8IA 1VEUA 3LR3A 5TBMA 1YLPA 2A49A 3V3RA 1K6SA 1P9RA 1N9BA 1HLUP 4ME4A 1TS0A 3ZGAB 4R0QA 2V8CA 3IWIA 3RFBA 3DAVA 3ZCZA 1LL8A 3A3EA 5GHYA 4OOLA 1UWPX 2Y2QA 1J9MA 2PD8A 2DMWA 2J9OA 4DKIA 3S7QA 4IUHA 3G4PA 3C5AA 3QP2A 3SZTA 1BYWA 5HL6A 1WE4A 2H28A 3KYZA 4BBTA 4B4XA 1P0ZA 3D9YA 4XXRA 1CI8A 4X25A 4X56A 4Y13A 3IS2B 3IHAA 1RCJA 3BFFA 1QMFA 4BENA 2WZXA 5M1AA 3C7VA 3R7WA 3S4XA 5U47A 1FR1A 1KE3A 3SH9A 3FWLA 1CQAA 2WAEA 4E3JA 4JXGA 3UDXA 3WS1A 1ONGA 4IJGA 3JVVA 2K7SA 5I94A 4MN7A 2OSUA 5EE8A 2V1AA 3HLWA 5G4ZA 4C75A 4RX3A 2HF6A 3SS4A 4Y0TA 1MBLA 3RJUA 2HDQA 4B9OA 2VV6A 3IH8A 5GLDA 1DJCA 2O0YA 1TD5A 3RXXA 3UPNA 1IELA 4E6WA 1MWRA 2ZOIA 3LICA 3UB8A 4IBRA 4U0TA 3V3SA 1I5QA 1ZHHB 2Y2IA 2Z2LB 4P6ZS 4QHCA 1HVBA 4S2JA 1NYYA 4NETA 3IBJA 3L9KA 1ONHA 3HUMA 4O01A 4JXSA 4XUZA 1YLYA 4OH0A 3OPLA 4WMCA 5DKLA 1UWNX 1H8MA 2H10A 5FEGA 3HLEA 4CLCB 2J3TC 2I9VA 4GS9A 4KQRA 3ICYA 1BSGA 3T4LA 4BJPA 4ZDXA 1KVLA 4X1MA 4NXFA 1LI0A 5F5YA 4Z9QA 5HD3A 4P0MA 1K57A 4NG2A 1DP8A 3WS2A 3VFHA 3ITBA 3PBNA 1GSWA 4HJ6A 1IFQA 4KZ5A 3WS0A 1F5MA 4LV1A 3C30A 1NLYA 4II7A 3W4PA 3CPTA 3U4LP 4R3AA 3GMWA 1N9NA 1K54A 3IBRA 4EERA 2XEPA 2JKFA 2OAP1 3P98A 5DF7A 5FEFA 2PR6A 5FAQA 3VOYA 3MFXA 3BY9A 3EGDC 3Q7VA 3LIBA 1S67L 3MZEA 1BULA 1TS8A 5FATA 5IS1A 1HD8A 2JN7A 3F1PA 3VMAA 5L09A 2QJ5A 1U60A 4KZ3A 4S2IA 4Q0IA 3MXSA 1SKFA 4F94A 2JC7A 4S2NA 1FILA 2EA9A 4UHUA 2C5WB 3O5YA 4YOFA 5HX9A 4GDBA 4DE2A 1XA1A 3T1XA 4M3KA 4JXVA 3GTCA 1YKDA 2ZC5B 1CF0A 1ES5A
chains in the Genus database with same CATH topology
1DRMA 5MC7A 4DMZA 4GS9B 3LR4A 4LRZE 4MDZA 3T4TA 3RH8B 2WKQA 2EWVA 3OBFA 1F9IA 3LIAA 3GECA 5HPIA 2HV1A 3LI8A 1OT9A 4XT2A 2OAQ1 3E0YA 5LBRA 4ETXA 1VHMA 1S1YA 3CLOA 4I38A 2EWWA 4EU0A 4NXBA 1D06A 3S7PA 2M7UA 5HD5A 1OTAA 1T1BA 2A24B 5I5LA 5J3WA 1LSWA 3OCNA 2KDKA 4EEPA 3LYXA 2L4RA 4Z1WA 1S4SA 2VLGA 2P08A 3PBTA 4GLQA 4L9FA 3KYQA 1XFQA 3MQ0A 2R78A 2W3HA 2W3EA 2B18A 3F1OA 3MF0A 4I3JA 1T1AA 2O9CA 4PAUA 2VV8A 4ETZA 2Y8HA 4UEYA 2VEAA 3BWLA 3CUEA 2W1TA 2M1CA 1T18A 1YAXA 4HH2A 1NWZA 4LLOB 3HCYA 3F1PB 4HJ3A 2KX6A 1OTEA 2JHEA 2YKFA 2QWSA 4YNRA 3H7WB 5HPFA 4Q0HA 4HQAA 3B47A 3F1NB 4R6LA 3H82B 4WL9A 2J3WA 2Z6CA 2W1RA 1OJGA 1OTBA 2KLIA 4I3AA 3EGXC 3SW1A 2Y79A 1ZTUA 3PBQA 5DKKA 4CLCC 4RQ9A 2JKRM 4Y5FA 5J7EA 2PYPA 2OWHA 2W27A 3B33A 3JVUA 2P04A 4CLCE 1TS7A 4MN5A 1XJ6A 2XA7S 3ZQ5A 3HJIA 2J3TD 3T4QA 3KSGA 4LRYC 3P7NA 3S7OA 1KOUA 2V0WA 2A2LA 1XJ4A 3NOPC 3TRCA 5CX7A 3T4OA 5IT5A 3BJNA 3B42A 3CAXA 2OWJA 4HI4A 3KSFA 1H3QA 1G28A 1N9LA 4XT2B 2LB9A 3KX0X 4H6JA 4BMWA 3BW6A 1YSQA 3PBSA 2M7VA 1V9ZA 2CMNA 4L9GA 2HJ9C 4DN0A 2QJ7A 5HSQA 4LRXC 3CITA 2XA7M 1MKMA 3FPVA 4DJ3A 2JKTM 1UGUA 3EOIA 3EQVA 3UE3A 1Y28A 2PR5A 4CLCD 3MQOA 1LSXA 3EEAA 4O0PA 3MR0A 1EW0A 1YSPA 4GHIA 1NLZA 5J4EA 4BBUA 5HZHA 4WEJA 2K31A 3F1OB 5DJUA 2HJEA 3LR0A 4ARZA 1IOUA 3IS2A 5KSHA 3LR5A 3UB7A 3UB9A 2QKPA 2W1TB 2O9BA 2HGVA 5K5BA 2GZAA 5TJJA 3BQAA 3TE8A 2XRNA 1DP6A 3KO6A 3K2NA 4QPRA 2VV7A 1DP9A 4EQ1A 5AVFA 1VB6A 3CI6A 5F68A 1XFNA 3FPWA 3PR6A 4I3IA 4PHTA 4AFIA 4KUOA 2G7UA 5DFXA 1LT0A 4YWZA 4WEKA 4EXOA 3PHYA 4EEUA 3T4JA 2IA2A 4JGRA 1S1ZA 3E4QA 4KUKA 1T19A 4KQOA 3T4KA 4EUVA 5L8MA 4HH3A 1G6OA 4G3KA 4HNBA 3W2ZA 3LR3A 5TBMA 4K08A 1P97A 2V9AA 3MJQA 1P9RA 1T1CA 2J80A 1OPXA 1GSVA 4WLAA 4Y2FA 4ME4A 3RTYA 1TS0A 2GJ3A 3PBOA 3K3CA 3RFBA 2JKRI 3P01A 4FOFA 5HWVA 4H6JB 1LL8A 5F6AA 3C8CA 4JGOA 4OOLA 2VGLS 1UWPX 2VJWA 5HDSA 2PD8A 2DMWA 4GCZA 3S7QA 1LSVA 4IUHA 4DJ2A 1F98A 1BYWA 4PKYG 5HL6A 3EQUA 1W63Q 3U2AA 2H28A 3KYZA 4BBTA 3NHQA 1P0ZA 2QHKA 4HOIA 4GHIB 3OCLA 3HJKA 2INWA 2FZ0A 3CWFA 4ZRRA 4ARZB 5KIZA 3IS2B 2W3GA 4EESA 3NOUC 2V1BA 1OJ5A 4CLCA 4FSFA 2VGLM 3LIFA 3A0RA 1S66L 1OTIA 1X0OA 2L0WA 4UQIS 2WKPA 3E4PA 3E4OA 2XROA 2B02A 1TS6A 3R7WA 4HHDA 2NUPC 5HWTA 4F3LA 1P9WA 3H9WA 1WA9A 3S7NA 1OTDA 4O8GA 2PYRA 3JVVA 4IJGA 4G3VA 3FG8A 2K7SA 2OOLA 4Y3IA 4MN7A 1JNUA 1XJ2A 2V1AA 3NJAA 5G4ZA 5G4YA 3UMDA 2HF6A 3VE4A 3ZYTA 3LFVA 1XJ3A 1GSXA 4NKPA 5TBMB 4UQIM 4Q0JA 3NOTC 4IUKA 4WF0A 5F69A 3OC2A 5AJGA 5AVEA 4B9OA 2PHYA 4R70A 2VV6A 3UE6A 3GDIA 2O0YA 3MXQA 1TD5A 3MQQA 2ZOIA 3A0SA 5A8BA 3ULFA 3LICA 3UB8A 1TF1A 1V9YA 4IHQA 3LIDA 4JGPA 1ZHHB 1N9OA 2PDRA 1ODVA 5IU1A 4P6ZS 5DJTA 2V0UA 2WKRA 1MC0A 2VZWA 4EW7A 2L1MA 5C5KA 3IBJA 4O01A 4NEED 2W3DA 1NRJA 3EEHA 3TW8A 3VV4A 3BY8A 3CUEC 4HY8A 2O9AA 4KQDA 2PD7A 3VE3A 2YKHA 5HWWA 5DKLA 1UWNX 2XSSA 1H8MA 2BASA 3DBAA 4JGQA 3R4KA 1S4RA 4CLCB 2J3TC 4L9EA 2I9VA 2VKSA 4GS9A 3ICYA 4BJPA 2LB5A 3T4LA 4P6ZM 2O99A 4NXFA 3D3OA 4I39A 4BBVA 2MJ6A 5F5YA 5HD3A 3K3DA 3R7WB 3MMHA 3PYPA 1DP8A 4F3LB 5HDDA 4LPZA 2QYBA 3UMEA 3PBNA 1GSWA 4HJ6A 1IFQA 3LI9A 1F5MA 3C30A 5DF9A 1NLYA 4HP9A 4II7A 4M4XA 4MMNA 3C2WA 3OOVA 2W3FA 4R3AA 2GX5A 5EFWA 3PBRA 5FL3A 4GW9A 2W0NA 1N9NA 3TJZC 3C38A 2A24A 3IBRA 4WN5A 4HIAA 4BWIA 2KOIA 2NUTC 3EWKA 2VX8A 4GJ4A 3FC7A 4OOMA 4EERA 2OAP1 2PR6A 1W63M 4EETB 3MFXA 2JKTI 1MZUA 3BY9A 3EGDC 3E98A 3V67A 2D02A 2K2NA 3LIBA 1S67L 2ZMVA 3KSHA 2PT7A 5HDCA 1TS8A 2ZOHA 4WELA 5DFYA 4E04A 3KSIA 4G3WA 2ZMFA 5IS1A 2P7JA 2JN7A 3LIEA 4CQHA 2GNXA 3F1PA 3UB6A 2FH5A 3T4SA 4I5SA 2QJ5A 3G6OA 3D72A 1STZA 3H7WA 4Q0IA 4PKYA 3A0VA 3OLOA 2Z6DA 3VOLA 3F1NA 3H82A 2EA9A 3LUQA 3O5YA 3BQ8A 4YOFA 4L0LA 1OT6A 2VA0A 4WUJA 3PXPA 4NXEA 4HP4A 4MCWA 1D7EA 4HJ4A 3T50A 2D01A 4NXGA 2ZBBA 4MN6A 4B93A 4R38A 1YKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MC7 A;  2JKR M;  1W63 M;  2VGL M;  2JKT I;  4UQI S;  2HF6 A;  1W63 Q;  2XA7 S;  4P6Z S;  4UQI M;  2JKR I;  2XA7 M;  4P6Z M;  2JKT M;  3TJZ C;  4NEE D;  1NRJ A;  2FH5 A;  2VGL S; 
#chains in the Genus database with same CATH topology
 1DRM A;  4UA6 A;  3LR4 A;  3BFC A;  2QPN A;  1ZKJ A;  3ZG5 A;  5CEB A;  4OQG A;  2XFT A;  3GSG A;  3OBF A;  3C7U A;  4EBL A;  2XD5 A;  2EFX A;  2OAQ 1;  4X55 A;  4EBP A;  3PAE A;  4I38 A;  3CLO A;  2EWW A;  1OTA A;  4EQI A;  5CTN A;  2KDK A;  1YT4 A;  4D60 A;  4ID4 A;  4NK3 A;  5FQ9 A;  1L0F A;  1QME A;  2P08 A;  4L9F A;  5EVE A;  3TOI A;  2B18 A;  4I3J A;  4PAU A;  4N9K A;  4ETZ A;  4UEY A;  3UO9 A;  4IVI A;  2W1T A;  1K55 A;  5TFQ A;  2WGV A;  2XH9 A;  1NRF A;  1NWZ A;  3HCY A;  1Y54 A;  2JHE A;  5CGX A;  5HPF A;  3A3F A;  3B47 A;  3F1N B;  4R6L A;  4UA7 A;  2Z6C A;  4JBF A;  5AQ7 A;  1TDL A;  3IQA A;  1OTB A;  2I72 A;  4CLC C;  2J7V A;  4RQ9 A;  5J7E A;  2WKE A;  5EVI B;  3SH7 A;  3B33 A;  4ZAM A;  2XA7 S;  2EX9 A;  3G30 A;  3HJI A;  3UDF A;  1H5X A;  3S7O A;  1XJ4 A;  5HAI A;  3T4O A;  5EUA A;  5IT5 A;  4ESP A;  1BZA A;  2WK0 A;  3B42 A;  1CJF A;  4S2N C;  3ZHH A;  2XF3 A;  1KDW A;  2PU4 A;  2LB9 A;  1XGI A;  3KX0 X;  4YIN A;  3FYZ A;  1VET A;  4LRX C;  3CIT A;  4DJ3 A;  4DDS A;  1UGU A;  2JCH A;  3MSH A;  1SDE A;  3C4O A;  3AGE A;  3UPO A;  3MQO A;  2EX8 A;  4O0P A;  3BLM A;  1YSP A;  4Y15 A;  1JTD A;  1NLZ A;  4RVA A;  5J4E A;  4RA7 A;  4E6X A;  1ES2 A;  3LR0 A;  3PTE A;  3BFE A;  1IOU A;  5KSH A;  3UB7 A;  1E25 A;  5TJJ A;  1H8Y A;  3KO6 A;  4EQ1 A;  5AVF A;  2PAV P;  1ZG6 A;  3PR6 A;  4I3I A;  4AFI A;  4D2O A;  4OPZ A;  1XPB A;  2ZMA A;  3QP1 A;  3IXB A;  1FIK A;  4K0W A;  4X53 A;  1T19 A;  1ALQ A;  3QNB A;  5FAO A;  5CEC A;  2GDN A;  3G34 A;  4K08 A;  3MJQ A;  1PNE A;  2J80 A;  4WLA A;  3HBR A;  2ZQ9 A;  2GJ3 A;  3K3C A;  2HDS A;  5FI7 A;  2JKR I;  3P01 A;  4H6J B;  4CPK A;  3Q81 A;  5CHU A;  1IYO A;  3ITA A;  2ZL1 A;  3C8C A;  4JGO A;  3WRZ A;  3T1R A;  2VJW A;  3IXG A;  3A3D A;  2HP5 A;  1NXY A;  1AWI A;  3I7J A;  4QJG A;  2XFS A;  5HAR A;  5EOE A;  2XK1 A;  3U2A A;  2FFY A;  5GLC A;  3L7H A;  1K56 D;  3E2K A;  4HOI A;  2VK3 A;  2ZC3 B;  2BLS A;  3HLB A;  4BL3 A;  1PFL A;  2FZ0 A;  2ZQC A;  3CWF A;  5KIZ A;  4EES A;  3OPR A;  2Q9N A;  2V1B A;  5CED A;  2Y2K A;  3LIF A;  3UE1 A;  1S66 L;  4UQI S;  2WKP A;  2Y55 A;  3E4P A;  4JPM A;  3E4O A;  2B02 A;  3N8R A;  4F3L A;  2ZJ9 A;  3O88 A;  4RX2 A;  2Q9M A;  3H9W A;  1WA9 A;  1OTD A;  1O07 A;  2Y2O A;  5A91 A;  4N92 A;  4O8G A;  2OLU A;  1ZC2 A;  4E3K A;  5FA7 A;  1XJ2 A;  5CHM A;  1XXM A;  4OON A;  3VE4 A;  4CJN A;  3LFV A;  1VEU B;  2AVX A;  3VP4 A;  5TBM B;  2JKG A;  3NOT C;  1VM1 A;  3OC2 A;  5AJG A;  4BLM A;  2PHY A;  4R70 A;  1BT5 A;  5AQB A;  2EX2 A;  3CJM A;  5L07 A;  4FD8 A;  3N4I A;  5A8B A;  5TGF A;  1GA9 A;  1TF1 A;  1V9Y A;  4IHQ A;  3LID A;  2WGI A;  4JGP A;  3ZNY A;  3B3X A;  1LHY A;  5DJT A;  2V0U A;  5F1G A;  2ZC7 A;  3G31 A;  4OLD A;  2X71 A;  4ZJ1 A;  4U0X A;  1NRJ A;  3GVB A;  3CUE C;  4HY8 A;  3O86 A;  4S2O A;  4PM7 A;  3VE3 A;  1PZO A;  2H0T A;  2XSS A;  4DXB A;  4JGQ A;  1S4R A;  2ZQ7 A;  4OPQ A;  1CEF A;  4P6Z M;  1GA0 A;  3D3O A;  2MJ6 A;  2Q0O A;  3R7W B;  1G5U A;  4R3J A;  4LV0 A;  3PYP A;  1YLW A;  4LPZ A;  3M6B A;  1FSW A;  2A3U A;  3T1Q B;  4WM9 A;  5FDH A;  2P74 A;  5DF9 A;  4MMN A;  4OQ0 A;  3OOV A;  3HL9 A;  5EFW A;  4GW9 A;  3TJZ C;  2H0Y A;  4BWI A;  2KOI A;  3EWK A;  3FC7 A;  3QP5 A;  1W63 M;  1BLH A;  3ZFZ A;  2EXA A;  4Y7P A;  4LV3 A;  4OVD A;  2D02 A;  1MPL A;  3KSH A;  3DWK A;  3M6H A;  5HDC A;  2XLN A;  2ZOH A;  5G18 A;  4E04 A;  3KSI A;  5EV0 A;  4S2L A;  1MKI A;  2ZMF A;  4CQH A;  3UB6 A;  4FH2 A;  3D72 A;  1CEG A;  3VOL A;  3V39 A;  3BFG A;  4L0L A;  1OT6 A;  2VA0 A;  4HES A;  3IH9 A;  4WUJ A;  2B95 A;  4N1H A;  4HP4 A;  4MCW A;  5E2F A;  3NCK A;  2ZBB A;  3VOZ A;  3D4F A;  1ESU A;  3DW0 A;  3GQZ A;  3ZDJ A;  4KZ4 A;  3ZVT A;  4GS9 B;  4MDZ A;  1SHV A;  4JF5 A;  4PPR A;  2WKQ A;  3GR2 A;  1SKO A;  2RCX A;  5D3O A;  1OT9 A;  3DWZ A;  4P6B A;  4XT2 A;  3W4Q A;  3ZG8 B;  1VHM A;  2R9W A;  1S1Y A;  3CPT B;  3IX4 A;  4NXB A;  4DF6 A;  3S7P A;  2M7U A;  2DNS A;  4OQH A;  4GZB A;  1JVJ A;  1LSW A;  1TDG A;  5J8X A;  4N9L A;  4GDN A;  4KG5 A;  3LCE A;  1IKG A;  2L4R A;  1LI9 A;  4Z1W A;  2WKI A;  1S4S A;  3MKE A;  4LGW A;  2W3H A;  3Q7V B;  4ZBE A;  1DY6 A;  4EWF A;  4GKU A;  4PM6 A;  3MF0 A;  1T1A A;  5F82 A;  2Y8H A;  3BWL A;  5CXW A;  1T18 A;  3LY3 A;  3BFD A;  3WWX A;  5GLB A;  1ES3 A;  4LLO B;  2BTF P;  3F1P B;  1OTE A;  4YNR A;  4HQA A;  1OJG A;  2WGW A;  4DE3 A;  1ZTU A;  3PBQ A;  5DKK A;  3IWO A;  4X69 A;  3JVU A;  2P04 A;  1TS7 A;  2HDR A;  3ZQ5 A;  1E3U D;  4PM9 A;  2G2U A;  3T4Q A;  1KOU A;  3CZD A;  1Y4O A;  2C6W B;  5CX7 A;  4KZA A;  2R9X A;  4LCL A;  3CAX A;  3P09 A;  5F83 A;  2X02 A;  5HAP A;  1N9L A;  4DE1 A;  2IWD A;  3BW6 A;  1YSQ A;  1JWZ A;  2CMN A;  2HJ9 C;  3ZVW A;  2QJ7 A;  4DN0 A;  3LY4 A;  1SCW A;  1PI4 A;  2XA7 M;  2VGK A;  2UWX A;  1KDS A;  2PR5 A;  4E3O A;  3NEC A;  4CLC D;  4WYY A;  4PM8 A;  2WAD A;  1GCE A;  3MR0 A;  1AXB A;  4GN2 A;  5EM0 A;  4JLF A;  4GHI A;  1TVF A;  2XDM A;  5HZH A;  2EXB A;  5A92 A;  4ARZ A;  3NBL A;  2QKP A;  2W1T B;  5K5B A;  3T1S A;  3G2Y A;  2EFU A;  4QY5 A;  4FH4 A;  1VB6 A;  5F68 A;  1HTZ A;  4LV2 A;  3LEZ A;  5FQI A;  1LT0 A;  5FSR A;  4YWZ A;  1IYQ A;  3PHY A;  4EEU A;  1GHP A;  3SOI A;  1LL5 A;  3E4Q A;  4KUK A;  4E3N A;  3T4K A;  3HUO A;  3T12 B;  4EUV A;  5A93 A;  5L8M A;  4HH3 A;  1G6O A;  1K57 C;  4HNB A;  3QP6 A;  3FKV A;  2V9A A;  2P9V A;  1OPX A;  2ZC6 B;  4Y2F A;  4KEN B;  3RTY A;  5KSC A;  1MXO A;  5CTM A;  1K54 C;  1S6R A;  4FTX A;  5F6A A;  3HLG A;  2VGL S;  2HP6 A;  1VET B;  2PU2 A;  2G2W A;  3ZG9 B;  5HDS A;  4X1L A;  1LSV A;  4DJ2 A;  1F98 A;  4OKP A;  5L10 A;  3BM6 A;  3EQU A;  1ACF A;  3NHQ A;  1ESI A;  2QHK A;  3UB5 P;  4DXC A;  3OCL A;  3HJK A;  2INW A;  3NOU C;  5FAP A;  4JF4 A;  1H0M A;  1OJ5 A;  3A0R A;  1BUE A;  1G68 A;  1OTI A;  1W8Q A;  1X0O A;  1A0K A;  5E2H A;  1I2S A;  2XRO A;  1TS6 A;  4HHD A;  2NUP C;  4GD8 A;  5HWT A;  1P9W A;  3Q07 A;  2JE5 A;  3S7N A;  1W5D A;  4JF6 A;  3MZF A;  4G3V A;  2OOL A;  4Y3I A;  1Z09 A;  2QMI A;  5DTT A;  5KMW A;  1PYY A;  3NJA A;  2XQZ A;  4OPY A;  5HW3 A;  2ZQA A;  1GSX A;  4QY6 A;  4UQI M;  4LFU A;  4Q0J A;  4PMA A;  5E2E A;  4IUK A;  4WF0 A;  3VP0 A;  1FCN A;  2XD1 A;  3FV7 A;  3MXR A;  1N4O A;  3UE6 A;  3NDG A;  5AQA A;  4Y0U A;  1DJB A;  2Y2N A;  5GL9 A;  3ULF A;  4O7D A;  2ZL1 B;  3AGF A;  2PDR A;  3LO7 A;  1ODV A;  5IU1 A;  3IX8 A;  5EVI D;  2WKR A;  2VZW A;  2L1M A;  3QP8 A;  3MZD A;  3EEH A;  3IHB A;  3TW8 A;  4QWO A;  1XP4 A;  3VV4 A;  1K55 C;  4R23 A;  2YKH A;  2HP9 A;  4KZB A;  1MWS A;  3DBA A;  1MWU A;  1K56 A;  3ZNT A;  1ERQ A;  4BBV A;  4R3B A;  3UNW A;  3VP2 A;  4F3L B;  5HDD A;  1W8Y A;  2QYB A;  4UAA A;  3IF6 B;  1KE0 A;  4K0X A;  3LI9 A;  1BLC A;  2W3F A;  3HLF A;  5FL3 A;  2W0N A;  3C38 A;  2A24 A;  3TSG A;  3HLD A;  4FCF A;  4WN5 A;  1TEM A;  2NUT C;  4BL2 A;  2XR0 A;  4GJ4 A;  3WRT A;  4EET B;  5FQQ A;  1MZU A;  3E98 A;  2K2N A;  5KZH A;  2PT7 A;  1FCM A;  2Y2G A;  2Y2H A;  4WEL A;  1W7F A;  3IF6 A;  1FSY A;  2P7J A;  3RXW A;  2FH5 A;  4I5S A;  3G6O A;  3H7W A;  1STZ A;  3A0V A;  3OLO A;  2Z6D A;  4FUW A;  3H82 A;  4OOY A;  3BQ8 A;  1D1J A;  2E8J A;  1YMX A;  1L3L A;  4NXE A;  1D7E A;  4HJ4 A;  4MN6 A;  4B93 A;  3OPP A;  4ZJ3 A;  4R38 A;  3UDI A;  1IKI A;  4DMZ A;  3T4T A;  3RH8 B;  2EWV A;  3QHY A;  4OPR A;  2Y4A A;  4GD6 A;  3LIA A;  3V50 A;  1G6A A;  5HPI A;  2HV1 A;  3G2Z A;  3E0Y A;  5CER A;  5F1F A;  1PW1 A;  4ETX A;  2PBD P;  1MY8 A;  1D06 A;  5E43 A;  2ZM0 A;  5HD5 A;  3KYE A;  2PRF A;  2ACG A;  4S2M A;  4MBK A;  5BOH A;  4EEP A;  4DE0 A;  1XX2 A;  4R4S A;  2DRW A;  2VLG A;  3KYQ A;  1ES4 A;  4KZ7 A;  2Y2J A;  5DF8 A;  1K4E A;  3F1O A;  3GV9 A;  1FCO A;  2J9P A;  2VEA A;  4HH2 A;  2PBY A;  4MNR A;  4XUX A;  4U3T A;  1YM1 A;  2QWS A;  4Y17 A;  5JYO A;  1OME A;  4DRT A;  4Q0H A;  5GHZ A;  3VP1 A;  4WL9 A;  5DTK A;  2J3W A;  1BLP A;  3UN7 A;  4LCM A;  3EGX C;  4KQQ A;  5DTS A;  2Y79 A;  3C4P A;  2JKR M;  4Y5F A;  1J3W A;  2OLV A;  2W27 A;  2WYX A;  5FI6 A;  4CLC E;  4MN5 A;  4P85 A;  3IT9 A;  5FQM A;  3IF6 C;  3AGD A;  2J3T D;  1JWV A;  3KSG A;  4KG6 A;  4LRY C;  3P7N A;  1IYS A;  2A2L A;  3TRC A;  5EVL A;  1SKO B;  5CRF A;  3LGO A;  3PAG A;  3N8S A;  4HI4 A;  4X6T A;  1H3Q A;  1G28 A;  1WYC A;  5A90 A;  4XT2 B;  5L2F A;  1NZO A;  3PBS A;  4L9G A;  3CHW P;  5EPH A;  2EX6 A;  1PW8 A;  3WS4 A;  1MKM A;  1YLT A;  3EOI A;  3UE3 A;  4KG2 A;  1Y28 A;  2ZM8 A;  4OLG A;  5EOO A;  3M2K A;  3UY6 A;  1YPR A;  3EEA A;  1ZG4 A;  2WKH A;  4UA9 A;  3G35 A;  4BBU A;  2K31 A;  2HJE A;  2DCF A;  3HRE A;  2Y2P A;  3IS2 A;  3LR5 A;  3UB9 A;  1EI5 A;  2O9B A;  2HGV A;  2ZQ8 A;  3BQA A;  3TE8 A;  1EWZ A;  5EEC A;  1DP6 A;  4QU3 A;  1DP9 A;  5HAQ A;  3ZG0 A;  3VSL A;  4QD4 A;  4S2K A;  3FPW A;  3SH8 A;  3QNC A;  3DTE A;  5FQJ A;  2WGW B;  4EXO A;  3O87 A;  4WEK A;  3N6I A;  2IA2 A;  4JGR A;  3GRJ A;  5CGS A;  3LEQ A;  4KQO A;  2IWB A;  2WZZ A;  4S2P A;  1L0G A;  3MFD A;  4G3K A;  1KVM A;  3W2Z A;  3ISG A;  5M18 A;  1PIO A;  1GHM A;  1P97 A;  1RP5 A;  1T1C A;  1K38 A;  3A3I A;  2ZC4 B;  1GSV A;  1CK3 A;  3N8L A;  2WUQ A;  3PBO A;  1NJ4 A;  1BLS A;  1E3U A;  4FOF A;  5HWV A;  1KGE A;  1KGG A;  1FOF A;  3BEC A;  3S1Y A;  2Y2L A;  4WMC D;  4KZ8 A;  4HBU A;  3HUN A;  5GLA A;  5FI2 A;  4GCZ A;  5HFO A;  1SZV A;  4EV4 A;  4IED A;  4X68 A;  1YMS A;  4PKY G;  1W79 A;  1W63 Q;  3IX3 A;  2V1Z A;  4DDY A;  1XA7 A;  5GHX A;  1M6K A;  4GHI B;  3W4O A;  5AQ9 A;  1Z6F A;  2VGJ A;  4BD1 A;  4ZRR A;  4ARZ B;  2W3G A;  4CLC A;  2BG1 A;  4FSF A;  4N1X A;  4MEZ A;  2VGL M;  2L0W A;  1ERO A;  4HBT A;  2ZLY A;  1RGZ A;  1Q2P A;  4Y0O A;  2PYR A;  2ZM2 A;  3FG8 A;  4PM5 A;  1PWD A;  1JNU A;  2FFF B;  1CI9 A;  5G4Y A;  3UMD A;  4JXW A;  4YFM A;  3ZYT A;  1L2S A;  1XJ3 A;  4NKP A;  3G32 A;  3O3V A;  5F69 A;  1Q2Q A;  2P9V B;  1K4F A;  3TG9 A;  3Q82 A;  5AVE A;  3IF5 A;  1NYM A;  3GDI A;  3MXQ A;  4EBN A;  1IYP A;  2UV0 E;  3MQQ A;  3SS5 A;  3A0S A;  4BD0 A;  5M19 A;  4ZJ2 A;  1C3B A;  2HZ5 A;  1N9O A;  1LLB A;  2H5S A;  4R1G A;  1MC0 A;  4EW7 A;  5C5K A;  3UPP A;  3DTK A;  4GNU A;  4NEE D;  2W3D A;  3WS5 A;  3FZC A;  3BY8 A;  2O9A A;  4KQD A;  4OQI A;  2PD7 A;  5HWW A;  3FKW A;  1YLJ A;  2WAF A;  1K25 A;  2BAS A;  2QZ6 A;  1GHI A;  1XKZ A;  3R4K A;  4L9E A;  5EM1 A;  1PWG A;  2VKS A;  2LB5 A;  2O99 A;  3OPH A;  4I39 A;  1VQQ A;  3K3D A;  3MMH A;  1F2K A;  3UME A;  3JPU A;  2IWC A;  2ZD8 A;  4HP9 A;  4M4X A;  4RYE A;  4IVK A;  3C2W A;  4R4R A;  4B4Z A;  2GX5 A;  3PBR A;  3NY4 A;  3NIA A;  2JBF A;  1ERM A;  3MKF A;  1L0E A;  3V5M A;  1XGJ A;  2Z2M B;  4HIA A;  2ZQD A;  1S0W A;  2VX8 A;  4OOM A;  4GB7 A;  1FR6 A;  4ZTK A;  4MBF A;  1WYB A;  2JKT I;  4MBH A;  3V67 A;  4E3M A;  5DVA A;  2ZMV A;  5FAS A;  5DFY A;  4KZ9 A;  4G3W A;  3JYI A;  1YQS A;  3LIE A;  3HVF A;  2GNX A;  3T4S A;  3VSK A;  4PKY A;  3NC8 A;  1PI5 A;  1K6R A;  3F1N A;  4C6Y A;  3MBZ A;  3LUQ A;  3UE0 A;  3PXP A;  2RL3 A;  3T50 A;  2D01 A;  4NXG A;  4E3L A;  5EVI A;  2HDU A;  4JKT A;  5FDS A;  1JWP A;  3HLC A;  5MC7 A;  3VP3 A;  5CHJ A;  4LRZ E;  1PWC A;  4KZ6 A;  1F9I A;  4EUZ A;  3IXD A;  3GEC A;  3VFF A;  3LI8 A;  5TR7 A;  1PRQ A;  1LL9 A;  5LBR A;  3NI9 A;  4K91 A;  1IEM A;  2V2F F;  4EU0 A;  2OV5 A;  4WZ5 A;  1T1B A;  1YLZ A;  3S22 A;  2A24 B;  3MS6 A;  5I5L A;  2B5R A;  3OCN A;  5J3W A;  3LYX A;  3M2J A;  3NUL A;  3DTI A;  4GLQ A;  3PBT A;  3Q7Z A;  1SDN A;  1XFQ A;  3MQ0 A;  2R78 A;  2W3E A;  4OP8 A;  4GOG A;  2O9C A;  2VV8 A;  3W8K A;  3CUE A;  2M1C A;  1YAX A;  3ZG7 B;  2X01 A;  4HJ3 A;  4WBG A;  2KX6 A;  2YKF A;  3H7W B;  3N7W A;  2J8Y A;  4B88 A;  5E2G A;  3H82 B;  3IWQ A;  4IBX A;  2W1R A;  2Y91 A;  4WZ4 A;  4BQM A;  2KLI A;  3CG5 A;  4I3A A;  3SW1 A;  1E4D A;  1DJA A;  4A5R A;  1NZU A;  2PYP A;  2OWH A;  3BEB A;  3SS3 A;  1KE4 A;  1NY0 A;  4OP5 A;  1XJ6 A;  1O7E A;  1K0K A;  1JTG A;  2V0W A;  1L0D A;  3NOP C;  4HEF A;  2Y2M A;  3QP4 A;  3BJN A;  2OWJ A;  1KGF A;  3KSF A;  5IHV A;  3NDE A;  4H6J A;  1MWT A;  4BMW A;  2M7V A;  1V9Z A;  2XGN A;  1M40 A;  5HSQ A;  4E3I A;  5EVI C;  3BRM A;  3E2L A;  3BYD A;  3FPV A;  3A3J A;  5HL1 A;  2JKT M;  2Y59 A;  1PZP A;  3EQV A;  4H8R A;  4LEN A;  2E8I A;  1LSX A;  3OZH A;  1EW0 A;  1HZO A;  4WEJ A;  3F1O B;  5DJU A;  4P87 A;  2V8F A;  3Q1F A;  4C3Q A;  3BLS A;  2GZA A;  4QB8 A;  2XRN A;  1RGY A;  3K2N A;  4QPR A;  2VV7 A;  4WZ5 C;  3CI6 A;  2HPB A;  1XFN A;  4PHT A;  4KUO A;  3CMZ A;  2G7U A;  5FQK A;  5CGW A;  5DFX A;  1BTL A;  5JYP A;  3IXH A;  3T4J A;  2V20 A;  1S1Z A;  1FQG A;  1I2W A;  4MLL A;  3DTM A;  2CC1 A;  1H8Z A;  4Q8I A;  1VEU A;  3LR3 A;  5TBM A;  1YLP A;  2A49 A;  3V3R A;  1K6S A;  1P9R A;  1N9B A;  1HLU P;  4ME4 A;  1TS0 A;  3ZGA B;  4R0Q A;  2V8C A;  3IWI A;  3RFB A;  3DAV A;  3ZCZ A;  1LL8 A;  3A3E A;  5GHY A;  4OOL A;  1UWP X;  2Y2Q A;  1J9M A;  2PD8 A;  2DMW A;  2J9O A;  4DKI A;  3S7Q A;  4IUH A;  3G4P A;  3C5A A;  3QP2 A;  3SZT A;  1BYW A;  5HL6 A;  1WE4 A;  2H28 A;  3KYZ A;  4BBT A;  4B4X A;  1P0Z A;  3D9Y A;  4XXR A;  1CI8 A;  4X25 A;  4X56 A;  4Y13 A;  3IS2 B;  3IHA A;  1RCJ A;  3BFF A;  1QMF A;  4BEN A;  2WZX A;  5M1A A;  3C7V A;  3R7W A;  3S4X A;  5U47 A;  1FR1 A;  1KE3 A;  3SH9 A;  3FWL A;  1CQA A;  2WAE A;  4E3J A;  4JXG A;  3UDX A;  3WS1 A;  1ONG A;  4IJG A;  3JVV A;  2K7S A;  5I94 A;  4MN7 A;  2OSU A;  5EE8 A;  2V1A A;  3HLW A;  5G4Z A;  4C75 A;  4RX3 A;  2HF6 A;  3SS4 A;  4Y0T A;  1MBL A;  3RJU A;  2HDQ A;  4B9O A;  2VV6 A;  3IH8 A;  5GLD A;  1DJC A;  2O0Y A;  1TD5 A;  3RXX A;  3UPN A;  1IEL A;  4E6W A;  1MWR A;  2ZOI A;  3LIC A;  3UB8 A;  4IBR A;  4U0T A;  3V3S A;  1I5Q A;  1ZHH B;  2Y2I A;  2Z2L B;  4P6Z S;  4QHC A;  1HVB A;  4S2J A;  1NYY A;  4NET A;  3IBJ A;  3L9K A;  1ONH A;  3HUM A;  4O01 A;  4JXS A;  4XUZ A;  1YLY A;  4OH0 A;  3OPL A;  4WMC A;  5DKL A;  1UWN X;  1H8M A;  2H10 A;  5FEG A;  3HLE A;  4CLC B;  2J3T C;  2I9V A;  4GS9 A;  4KQR A;  3ICY A;  1BSG A;  3T4L A;  4BJP A;  4ZDX A;  1KVL A;  4X1M A;  4NXF A;  1LI0 A;  5F5Y A;  4Z9Q A;  5HD3 A;  4P0M A;  1K57 A;  4NG2 A;  1DP8 A;  3WS2 A;  3VFH A;  3ITB A;  3PBN A;  1GSW A;  4HJ6 A;  1IFQ A;  4KZ5 A;  3WS0 A;  1F5M A;  4LV1 A;  3C30 A;  1NLY A;  4II7 A;  3W4P A;  3CPT A;  3U4L P;  4R3A A;  3GMW A;  1N9N A;  1K54 A;  3IBR A;  4EER A;  2XEP A;  2JKF A;  2OAP 1;  3P98 A;  5DF7 A;  5FEF A;  2PR6 A;  5FAQ A;  3VOY A;  3MFX A;  3BY9 A;  3EGD C;  3Q7V A;  3LIB A;  1S67 L;  3MZE A;  1BUL A;  1TS8 A;  5FAT A;  5IS1 A;  1HD8 A;  2JN7 A;  3F1P A;  3VMA A;  5L09 A;  2QJ5 A;  1U60 A;  4KZ3 A;  4S2I A;  4Q0I A;  3MXS A;  1SKF A;  4F94 A;  2JC7 A;  4S2N A;  1FIL A;  2EA9 A;  4UHU A;  2C5W B;  3O5Y A;  4YOF A;  5HX9 A;  4GDB A;  4DE2 A;  1XA1 A;  3T1X A;  4M3K A;  4JXV A;  3GTC A;  1YKD A;  2ZC5 B;  1CF0 A;  1ES5 A; 
#chains in the Genus database with same CATH homology
 1DRM A;  5MC7 A;  4DMZ A;  4GS9 B;  3LR4 A;  4LRZ E;  4MDZ A;  3T4T A;  3RH8 B;  2WKQ A;  2EWV A;  3OBF A;  1F9I A;  3LIA A;  3GEC A;  5HPI A;  2HV1 A;  3LI8 A;  1OT9 A;  4XT2 A;  2OAQ 1;  3E0Y A;  5LBR A;  4ETX A;  1VHM A;  1S1Y A;  3CLO A;  4I38 A;  2EWW A;  4EU0 A;  4NXB A;  1D06 A;  3S7P A;  2M7U A;  5HD5 A;  1OTA A;  1T1B A;  2A24 B;  5I5L A;  5J3W A;  1LSW A;  3OCN A;  2KDK A;  4EEP A;  3LYX A;  2L4R A;  4Z1W A;  1S4S A;  2VLG A;  2P08 A;  3PBT A;  4GLQ A;  4L9F A;  3KYQ A;  1XFQ A;  3MQ0 A;  2R78 A;  2W3H A;  2W3E A;  2B18 A;  3F1O A;  3MF0 A;  4I3J A;  1T1A A;  2O9C A;  4PAU A;  2VV8 A;  4ETZ A;  2Y8H A;  4UEY A;  2VEA A;  3BWL A;  3CUE A;  2W1T A;  2M1C A;  1T18 A;  1YAX A;  4HH2 A;  1NWZ A;  4LLO B;  3HCY A;  3F1P B;  4HJ3 A;  2KX6 A;  1OTE A;  2JHE A;  2YKF A;  2QWS A;  4YNR A;  3H7W B;  5HPF A;  4Q0H A;  4HQA A;  3B47 A;  3F1N B;  4R6L A;  3H82 B;  4WL9 A;  2J3W A;  2Z6C A;  2W1R A;  1OJG A;  1OTB A;  2KLI A;  4I3A A;  3EGX C;  3SW1 A;  2Y79 A;  1ZTU A;  3PBQ A;  5DKK A;  4CLC C;  4RQ9 A;  2JKR M;  4Y5F A;  5J7E A;  2PYP A;  2OWH A;  2W27 A;  3B33 A;  3JVU A;  2P04 A;  4CLC E;  1TS7 A;  4MN5 A;  1XJ6 A;  2XA7 S;  3ZQ5 A;  3HJI A;  2J3T D;  3T4Q A;  3KSG A;  4LRY C;  3P7N A;  3S7O A;  1KOU A;  2V0W A;  2A2L A;  1XJ4 A;  3NOP C;  3TRC A;  5CX7 A;  3T4O A;  5IT5 A;  3BJN A;  3B42 A;  3CAX A;  2OWJ A;  4HI4 A;  3KSF A;  1H3Q A;  1G28 A;  1N9L A;  4XT2 B;  2LB9 A;  3KX0 X;  4H6J A;  4BMW A;  3BW6 A;  1YSQ A;  3PBS A;  2M7V A;  1V9Z A;  2CMN A;  4L9G A;  2HJ9 C;  4DN0 A;  2QJ7 A;  5HSQ A;  4LRX C;  3CIT A;  2XA7 M;  1MKM A;  3FPV A;  4DJ3 A;  2JKT M;  1UGU A;  3EOI A;  3EQV A;  3UE3 A;  1Y28 A;  2PR5 A;  4CLC D;  3MQO A;  1LSX A;  3EEA A;  4O0P A;  3MR0 A;  1EW0 A;  1YSP A;  4GHI A;  1NLZ A;  5J4E A;  4BBU A;  5HZH A;  4WEJ A;  2K31 A;  3F1O B;  5DJU A;  2HJE A;  3LR0 A;  4ARZ A;  1IOU A;  3IS2 A;  5KSH A;  3LR5 A;  3UB7 A;  3UB9 A;  2QKP A;  2W1T B;  2O9B A;  2HGV A;  5K5B A;  2GZA A;  5TJJ A;  3BQA A;  3TE8 A;  2XRN A;  1DP6 A;  3KO6 A;  3K2N A;  4QPR A;  2VV7 A;  1DP9 A;  4EQ1 A;  5AVF A;  1VB6 A;  3CI6 A;  5F68 A;  1XFN A;  3FPW A;  3PR6 A;  4I3I A;  4PHT A;  4AFI A;  4KUO A;  2G7U A;  5DFX A;  1LT0 A;  4YWZ A;  4WEK A;  4EXO A;  3PHY A;  4EEU A;  3T4J A;  2IA2 A;  4JGR A;  1S1Z A;  3E4Q A;  4KUK A;  1T19 A;  4KQO A;  3T4K A;  4EUV A;  5L8M A;  4HH3 A;  1G6O A;  4G3K A;  4HNB A;  3W2Z A;  3LR3 A;  5TBM A;  4K08 A;  1P97 A;  2V9A A;  3MJQ A;  1P9R A;  1T1C A;  2J80 A;  1OPX A;  1GSV A;  4WLA A;  4Y2F A;  4ME4 A;  3RTY A;  1TS0 A;  2GJ3 A;  3PBO A;  3K3C A;  3RFB A;  2JKR I;  3P01 A;  4FOF A;  5HWV A;  4H6J B;  1LL8 A;  5F6A A;  3C8C A;  4JGO A;  4OOL A;  2VGL S;  1UWP X;  2VJW A;  5HDS A;  2PD8 A;  2DMW A;  4GCZ A;  3S7Q A;  1LSV A;  4IUH A;  4DJ2 A;  1F98 A;  1BYW A;  4PKY G;  5HL6 A;  3EQU A;  1W63 Q;  3U2A A;  2H28 A;  3KYZ A;  4BBT A;  3NHQ A;  1P0Z A;  2QHK A;  4HOI A;  4GHI B;  3OCL A;  3HJK A;  2INW A;  2FZ0 A;  3CWF A;  4ZRR A;  4ARZ B;  5KIZ A;  3IS2 B;  2W3G A;  4EES A;  3NOU C;  2V1B A;  1OJ5 A;  4CLC A;  4FSF A;  2VGL M;  3LIF A;  3A0R A;  1S66 L;  1OTI A;  1X0O A;  2L0W A;  4UQI S;  2WKP A;  3E4P A;  3E4O A;  2XRO A;  2B02 A;  1TS6 A;  3R7W A;  4HHD A;  2NUP C;  5HWT A;  4F3L A;  1P9W A;  3H9W A;  1WA9 A;  3S7N A;  1OTD A;  4O8G A;  2PYR A;  3JVV A;  4IJG A;  4G3V A;  3FG8 A;  2K7S A;  2OOL A;  4Y3I A;  4MN7 A;  1JNU A;  1XJ2 A;  2V1A A;  3NJA A;  5G4Z A;  5G4Y A;  3UMD A;  2HF6 A;  3VE4 A;  3ZYT A;  3LFV A;  1XJ3 A;  1GSX A;  4NKP A;  5TBM B;  4UQI M;  4Q0J A;  3NOT C;  4IUK A;  4WF0 A;  5F69 A;  3OC2 A;  5AJG A;  5AVE A;  4B9O A;  2PHY A;  4R70 A;  2VV6 A;  3UE6 A;  3GDI A;  2O0Y A;  3MXQ A;  1TD5 A;  3MQQ A;  2ZOI A;  3A0S A;  5A8B A;  3ULF A;  3LIC A;  3UB8 A;  1TF1 A;  1V9Y A;  4IHQ A;  3LID A;  4JGP A;  1ZHH B;  1N9O A;  2PDR A;  1ODV A;  5IU1 A;  4P6Z S;  5DJT A;  2V0U A;  2WKR A;  1MC0 A;  2VZW A;  4EW7 A;  2L1M A;  5C5K A;  3IBJ A;  4O01 A;  4NEE D;  2W3D A;  1NRJ A;  3EEH A;  3TW8 A;  3VV4 A;  3BY8 A;  3CUE C;  4HY8 A;  2O9A A;  4KQD A;  2PD7 A;  3VE3 A;  2YKH A;  5HWW A;  5DKL A;  1UWN X;  2XSS A;  1H8M A;  2BAS A;  3DBA A;  4JGQ A;  3R4K A;  1S4R A;  4CLC B;  2J3T C;  4L9E A;  2I9V A;  2VKS A;  4GS9 A;  3ICY A;  4BJP A;  2LB5 A;  3T4L A;  4P6Z M;  2O99 A;  4NXF A;  3D3O A;  4I39 A;  4BBV A;  2MJ6 A;  5F5Y A;  5HD3 A;  3K3D A;  3R7W B;  3MMH A;  3PYP A;  1DP8 A;  4F3L B;  5HDD A;  4LPZ A;  2QYB A;  3UME A;  3PBN A;  1GSW A;  4HJ6 A;  1IFQ A;  3LI9 A;  1F5M A;  3C30 A;  5DF9 A;  1NLY A;  4HP9 A;  4II7 A;  4M4X A;  4MMN A;  3C2W A;  3OOV A;  2W3F A;  4R3A A;  2GX5 A;  5EFW A;  3PBR A;  5FL3 A;  4GW9 A;  2W0N A;  1N9N A;  3TJZ C;  3C38 A;  2A24 A;  3IBR A;  4WN5 A;  4HIA A;  4BWI A;  2KOI A;  2NUT C;  3EWK A;  2VX8 A;  4GJ4 A;  3FC7 A;  4OOM A;  4EER A;  2OAP 1;  2PR6 A;  1W63 M;  4EET B;  3MFX A;  2JKT I;  1MZU A;  3BY9 A;  3EGD C;  3E98 A;  3V67 A;  2D02 A;  2K2N A;  3LIB A;  1S67 L;  2ZMV A;  3KSH A;  2PT7 A;  5HDC A;  1TS8 A;  2ZOH A;  4WEL A;  5DFY A;  4E04 A;  3KSI A;  4G3W A;  2ZMF A;  5IS1 A;  2P7J A;  2JN7 A;  3LIE A;  4CQH A;  2GNX A;  3F1P A;  3UB6 A;  2FH5 A;  3T4S A;  4I5S A;  2QJ5 A;  3G6O A;  3D72 A;  1STZ A;  3H7W A;  4Q0I A;  4PKY A;  3A0V A;  3OLO A;  2Z6D A;  3VOL A;  3F1N A;  3H82 A;  2EA9 A;  3LUQ A;  3O5Y A;  3BQ8 A;  4YOF A;  4L0L A;  1OT6 A;  2VA0 A;  4WUJ A;  3PXP A;  4NXE A;  4HP4 A;  4MCW A;  1D7E A;  4HJ4 A;  3T50 A;  2D01 A;  4NXG A;  2ZBB A;  4MN6 A;  4B93 A;  4R38 A;  1YKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...