4UQIS

Ap2 controls clathrin polymerization with a membrane-activated switch
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
142
structure length
142
Chain Sequence
b'MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
molecule tags Endocytosis
source organism Rattus norvegicus
publication title Clathrin Adaptors. Ap2 Controls Clathrin Polymerization with a Membrane-Activated Switch.
pubmed doi rcsb
total genus 49
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4uqiS00
2FH5A 2JKTM 2HF6A 2VGLS 1W63Q 4UQIM 3TJZC 4P6ZS 4NEED 1W63M 2XA7M 2XA7S 2VGLM 4UQIS 2JKRI 4P6ZM 5MC7A 2JKTI 2JKRM 1NRJA
chains in the Genus database with same CATH superfamily
3N8RA 3PYPA 1PW1A 4R6LA 3QP5A 1PI5A 1SKFA 1TS6A 3Q7VA 3UB9A 4R23A 1K55A 1BLSA 2WADA 3C7UA 3D4FA 4KQRA 2V1AA 1YM1A 4RA7A 2A2LA 3SS5A 2PBDP 1VETA 4IVKA 4UHUA 4B4XA 3NBLA 1G6AA 3E4QA 2B5RA 1DRMA 4PM9A 4EEUA 3QNBA 4GCZA 4OH0A 5F68A 2J9PA 3GR2A 4WYYA 1SHVA 4IEDA 3WRZA 4KENB 3UPPA 3BY9A 3NY4A 2XF3A 3B42A 4UQIS 4JGQA 2DNSA 1T1BA 3TW8A 1P97A 3MMHA 4HEFA 1K6RA 3F1NB 5CHJA 4OLDA 1YMXA 4OPZA 1LHYA 3H7WA 2FFYA 4O8GA 3UE1A 1TEMA 1MWSA 5FQMA 2Z6CA 4ZJ2A 2Y59A 2VZWA 2R9XA 4HIAA 2A24B 4DE2A 2WK0A 5J8XA 1SZVA 3G2ZA 1WA9A 3IF6C 4PPRA 3T12B 4I3AA 1S67L 2KX6A 3OLOA 5HAPA 5G18A 5FA7A 4Q0IA 3Q7VB 3G30A 1KDSA 3G32A 1MZUA 4QB8A 1FCMA 4JXWA 2YKFA 3HJIA 5DFXA 3A0RA 1CF0A 4Z1WA 2WAEA 2V2FF 1DP6A 2Y2NA 1VB6A 4OVDA 4R38A 2CC1A 3IF6B 2QHKA 3CMZA 2R78A 1D06A 3IBRA 4KZ9A 5CTNA 2FH5A 2Y79A 4KG2A 4JLFA 3UMEA 1NLYA 4O01A 2EX2A 4H8RA 1K4FA 4EBLA 3MBZA 5TJJA 1F98A 1I2WA 4P0MA 4E04A 2WKPA 3CLOA 3FKVA 5EOOA 4AFIA 2E8JA 2J9OA 2XR0A 1FR1A 4Y15A 2JKTM 1MC0A 4X68A 3GV9A 3ZGAB 1W63Q 5EOEA 3BFFA 4LPZA 4B88A 4E6WA 1PWGA 3PBSA 2O9AA 3R7WA 1YLYA 1K56D 4X56A 1TDLA 1W63M 2Z2LB 3T4LA 1KE3A 4G3KA 1CI9A 1H8MA 4KZ3A 4R70A 5FDSA 1ONHA 1E3UA 3QP2A 1AWIA 2W1TB 1UWNX 3O87A 1HTZA 4NXFA 1S1ZA 4E3LA 5HWTA 1NYYA 3NOPC 2J3TD 1YLTA 4WEJA 1K38A 3KYQA 5HPFA 3A0SA 3EGDC 2MJ6A 1CJFA 3Q7ZA 4PM6A 2JBFA 3NC8A 5A91A 1KVLA 2Y2LA 4IUHA 5J4EA 4WMCD 4B93A 2RCXA 1YLJA 4MCWA 4QY6A 2OAQ1 2DRWA 3UDIA 3SS3A 1BLCA 2HDSA 5JYOA 3OC2A 1XFQA 2A3UA 2WKEA 5AQ9A 4KUKA 5FEFA 3UB6A 5F82A 2G2UA 5HWWA 3RTYA 3IX4A 5KZHA 5FI7A 2GJ3A 1UGUA 1PW8A 3IHAA 3E4OA 4HBTA 4S2MA 1I2SA 3CUEC 1TVFA 1YT4A 1Y4OA 4DXBA 3ZVTA 3HLBA 2B95A 5I5LA 2WKHA 2EFXA 3LI8A 3MQ0A 4QY5A 2BTFP 3N7WA 1G5UA 3LR5A 2VGJA 5CGWA 3WS5A 4CLCD 4GOGA 4KZBA 4EUZA 2XEPA 1N9BA 5DJUA 2JCHA 3V67A 1S66L 2JE5A 2BG1A 3UE3A 3S7OA 4KQDA 5DKKA 2P04A 3VSLA 4ZAMA 1FIKA 3RJUA 4HESA 3CJMA 4LV1A 3FYZA 2ZC5B 4Y5FA 4QHCA 2XD5A 3C38A 1G6OA 1XFNA 1XJ3A 4OOLA 2I72A 2W3EA 1W8YA 3IH8A 3BECA 3K3DA 4EBPA 1M6KA 3KO6A 5M18A 1VM1A 2IWBA 4GN2A 1K4EA 1NJ4A 4U3TA 2D02A 1BUEA 3VP2A 1OT6A 2HDQA 1IELA 1OTDA 3IWIA 4DJ3A 3E0YA 5LBRA 3TG9A 4G3WA 1NRFA 2HF6A 2ZQ9A 3LIDA 3BRMA 3GECA 4CQHA 3HBRA 3UPNA 3F1PB 4ETZA 2V8FA 4BD1A 5EE8A 2ZOHA 2KDKA 3OPRA 4S2NC 1DY6A 1T18A 5DVAA 2QZ6A 3BFGA 2ZBBA 1ESUA 3F1OB 4GDNA 4KZ4A 4KZ8A 1PZOA 1IYSA 3VOYA 3KSGA 4UA9A 1CEFA 4P6ZM 3P7NA 4Y0UA 3OZHA 3ZCZA 5CERA 5M1AA 1J3WA 3VMAA 3MQQA 1L0DA 3T4OA 2VA0A 3AGDA 1ODVA 3C5AA 3HUOA 4LV3A 2XDMA 1GHMA 1ESIA 3EGXC 2A49A 1O7EA 2PAVP 4I38A 2ACGA 4BBTA 1K25A 3FG8A 4IHQA 4II7A 1NWZA 2V0UA 3GVBA 1TS8A 3L9KA 3LUQA 3T4SA 3NCKA 1JVJA 2L0WA 4WZ5A 5FI6A 5L2FA 2Z6DA 3C7VA 5GLAA 2WGWA 3GDIA 5CTMA 4CJNA 3DTMA 2WZZA 4EQIA 5HX9A 3DTKA 4JGRA 4GZBA 4KQQA 4DMZA 1LT0A 4XT2A 5CECA 2HP6A 3IXDA 1LSXA 2WYXA 4N1XA 3C2WA 2OAP1 4EERA 3HLEA 4D60A 2HPBA 5FQIA 1Y28A 2Y91A 3IF5A 1BLHA 2GX5A 1SKOA 2X71A 1OMEA 4ETXA 4CLCB 2I9VA 4R4RA 3NULA 2PR6A 4JGPA 4IBXA 4DF6A 4C6YA 4ID4A 3KSFA 3VV4A 5FI2A 1OT9A 4HP4A 4YINA 3SH8A 1VEUA 1P0ZA 4S2OA 2ZL1A 3A3EA 1IKGA 1L2SA 1T19A 5CRFA 1K56A 2QYBA 2A24A 1IEMA 4OLGA 3TE8A 3H82A 3W4OA 1YPRA 1XA7A 4E6XA 5F1GA 5DF8A 3LFVA 4FH4A 3LR0A 3B3XA 1K57A 2J3TC 4BJPA 1BZAA 3F1NA 3GSGA 1NZUA 4BMWA 4IUKA 3T4TA 4QU3A 4ZBEA 2Y8HA 5HL6A 1YLZA 3B47A 4R4SA 3R4KA 3WWXA 3SW1A 2XA7S 5J3WA 2Q9NA 3T4JA 4WZ5C 3I7JA 1OJ5A 3NJAA 2JC7A 3WS4A 4GW9A 2IA2A 4I3IA 4K0XA 2JKFA 2EX9A 4NG2A 3PAEA 4K0WA 2VKSA 4PM8A 3FPVA 2V0WA 4U0XA 3WS2A 2R9WA 3OPLA 5EM1A 3MZFA 2PT7A 2E8IA 1E4DA 4PM7A 5HSQA 5HL1A 1MWUA 1PRQA 1YLPA 4OPRA 2W1TA 4OOYA 1IYOA 3OCNA 4HH2A 5CEDA 3HREA 2XD1A 5A92A 1S0WA 4GLQA 4LRXC 4HH3A 4FOFA 3LIBA 4L9EA 5CGXA 5HFOA 3TOIA 2ZMAA 3E2KA 3O88A 3NI9A 1L0EA 3BLSA 1KGGA 3BLMA 3N6IA 2ZOIA 2EA9A 4KUOA 3S7NA 4YWZA 3M2KA 3DWKA 1Z6FA 3IX8A 2V9AA 2FFFB 3KYZA 4K91A 4DXCA 4Z9QA 1PIOA 5E2HA 5CX7A 1YLWA 4OQIA 1EWZA 3HLWA 4XT2B 4CLCE 4HOIA 3IF6A 1G68A 4LV2A 1PYYA 1ERQA 3T1SA 2Y2MA 2O9BA 5EECA 1XJ2A 1K54C 3LI9A 2J7VA 4GNUA 4GHIA 4Y0TA 3FWLA 4DRTA 2Y4AA 4NXEA 3DTEA 4X6TA 3HJKA 2M1CA 2BASA 3CPTB 5KMWA 2ZQAA 4DE0A 4XUXA 4FCFA 1VEUB 2ZC3B 3ZVWA 3UDXA 4Y0OA 5L10A 4LRZE 2EWWA 1JWPA 1KE0A 3QP6A 3DW0A 4R0QA 4FSFA 4IBRA 2XH9A 1MXOA 1RGZA 4FH2A 4EQ1A 3ZG0A 2YKHA 4OKPA 4E3OA 2WKRA 4JXSA 2K31A 3UB5P 3G6OA 4RQ9A 4U0TA 5DTSA 3Q81A 2O0YA 3LICA 3KSHA 2WZXA 3CAXA 2P08A 2GDNA 1AXBA 1PI4A 5EV0A 1RGYA 4NK3A 5DFYA 2H10A 2OOLA 3HUMA 5A93A 4WEKA 4X1MA 2J80A 2XFSA 1XX2A 5TGFA 2FZ0A 3IH9A 4NETA 3UO9A 1D7EA 3NIAA 4RX3A 5GHYA 3MR0A 3V3RA 4OONA 4N9LA 4WN5A 4DDSA 5J7EA 3H82B 4BQMA 1GCEA 3MSHA 3ZNTA 3GRJA 1GSXA 5FAQA 3WRTA 1HVBA 1KGFA 3ZG8B 1GHIA 4KG6A 3RXXA 2V8CA 4ZJ1A 4KQOA 1ACFA 3ICYA 5HARA 2GNXA 1L0FA 1NZOA 4MMNA 2H0TA 1DJCA 3BWLA 1ALQA 2OLVA 2OV5A 1GA9A 5CXWA 3S4XA 2B02A 3WS1A 4ZRRA 2OSUA 4HP9A 5IS1A 1OTAA 2EX8A 3CZDA 2H0YA 4JXGA 4PHTA 4HJ4A 2UWXA 3LCEA 1N9NA 4EESA 2Q0OA 4I5SA 4D2OA 5FL3A 3T4QA 4KZ7A 2ZMVA 3MKEA 1MKMA 2JKTI 5IT5A 1M40A 1CEGA 3P01A 3LY4A 1MPLA 1FSYA 4HNBA 1XXMA 3C8CA 2JKRI 2VV6A 4OPYA 3KSIA 5TBMA 4F3LB 1D1JA 4OP5A 3ZDJA 4EU0A 4HBUA 2X01A 3HLFA 1GHPA 4X1LA 4MEZA 4PKYA 4F3LA 3S7QA 2Y2JA 1TS0A 3A3JA 2ZQ8A 2W0NA 1SDNA 4GB7A 3HVFA 1PNEA 4Y2FA 3LIEA 3P09A 2PD8A 3HL9A 3VE3A 2ZC4B 4FUWA 4DE1A 1JTGA 1TS7A 1WE4A 1P9WA 2OLUA 4DDYA 3D9YA 3FZCA 4JKTA 2EWVA 3PAGA 4IJGA 1GSVA 3VP3A 5AQAA 5F83A 4PMAA 4PKYG 3VSKA 3UB8A 4NKPA 2QMIA 1ONGA 5L09A 1VETB 4X69A 1EROA 3T1XA 4KZ5A 3A0VA 4EWFA 4S2LA 4DN0A 4MBFA 4RVAA 1ES2A 4E3JA 4EV4A 4WZ4A 5EVEA 2EXBA 4UQIM 4ME4A 4N92A 2ZQDA 4BL2A 3G34A 4I3JA 3SS4A 4O0PA 3NDGA 5MC7A 3DBAA 4MBKA 3VOZA 5FQQA 5M19A 1MWRA 2M7VA 1ZHHB 3CWFA 3H9WA 4B4ZA 4BBUA 4BBVA 5E2GA 4G3VA 4UAAA 3F1OA 1YMSA 2Y55A 2IWCA 4WM9A 3K3CA 4ZTKA 1IYPA 3OPHA 1S4SA 2VV7A 1NXYA 4PM5A 1PZPA 1TD5A 1KVMA 1W7FA 1VHMA 4BWIA 4NXGA 5GHXA 4ARZA 3QNCA 3E98A 4UA6A 3VP1A 2H5SA 2G2WA 3BQAA 4FTXA 3T1RA 2XROA 4EW7A 3IXBA 2ZL1B 2NUTC 2XFTA 3BM6A 4GS9B 1IFQA 2VV8A 3KX0X 3QP1A 2Q9MA 2L1MA 3MXSA 3NOUC 4LLOB 3B33A 1SCWA 2WKIA 4S2PA 3IXGA 2RL3A 3V5MA 3HCYA 3LR3A 1K6SA 3RFBA 1Y54A 2PU4A 3IS2B 5GLBA 4JGOA 1BT5A 1F5MA 3FC7A 4MBHA 3OBFA 2XK1A 3PR6A 4A5RA 4PAUA 3GTCA 2XSSA 2WGIA 3HLGA 4Y13A 1XJ6A 2Y2QA 4C75A 1MKIA 1E3UD 3VP4A 3PBRA 3S7PA 3ZHHA 2J8YA 3UE6A 3ZG9B 3ZFZA 1NLZA 1PFLA 3G31A 3UDFA 1CQAA 3T50A 1MWTA 3LYXA 1XGIA 1W5DA 3SH9A 4E3NA 4R3JA 3BY8A 2ZQCA 3IX3A 2XRNA 3PHYA 5GLDA 2VK3A 2VGKA 1DJAA 3P98A 4X55A 4WELA 2JKGA 1S1YA 3V39A 1XJ4A 4M4XA 5HAIA 3C30A 4R1GA 2ZQ7A 2ZMFA 4GDBA 2JKRM 4K08A 2NUPC 5U47A 1LL5A 1NRJA 3ZQ5A 2JHEA 3CUEA 5FDHA 1LSVA 3LR4A 5GL9A 1FILA 2WAFA 1K57C 2P7JA 3A3FA 5AVFA 5EUAA 3NECA 4LRYC 4NXBA 2ZM0A 1T1AA 2VLGA 3M6HA 5EVIB 4KZAA 3MZDA 1EW0A 1W79A 1MY8A 2C5WB 3ITBA 4LCMA 2PHYA 4N9KA 4EETB 4WUJA 1LSWA 4C3QA 3W4PA 5A8BA 3MFDA 4OOMA 3F1PA 2OWJA 3Q1FA 4OQGA 4QJGA 4BLMA 3OCLA 3PBQA 3BFEA 4Q0JA 3IS2A 1I5QA 3MJQA 1FSWA 4MN6A 1K54A 3UN7A 2XA7M 5F5YA 5F6AA 3FV7A 1F9IA 4OQHA 5G4ZA 3V50A 3R7WB 5L07A 3IWQA 2AVXA 5TBMB 1QMFA 2P9VA 4S2JA 1ES3A 3IWOA 4RYEA 4GHIB 4E3MA 1E25A 1HD8A 3LEZA 3VP0A 5IU1A 3LGOA 2HZ5A 2ZM2A 3NDEA 1JTDA 4JXVA 2ZC6B 3HUNA 1JNUA 3QP4A 4ARZB 3K2NA 1V9ZA 3N8LA 1VQQA 4HI4A 1ZG6A 3G35A 3UB7A 4P6BA 2Y2GA 5FAOA 1XA1A 3CI6A 2V1BA 3MFXA 1LL8A 1NYMA 3JPUA 3JVVA 3Q82A 1O07A 5HDDA 4R3BA 3TJZC 1H8YA 1LL9A 1OTBA 2ZD8A 4I39A 5AQ7A 1GSWA 3UMDA 2UV0E 1BLPA 5HPIA 1Q2PA 1W8QA 4HJ3A 1F2KA 3LY3A 3MKFA 4HY8A 5EPHA 2H28A 4E3IA 3AGFA 4OP8A 5F69A 5E43A 5EM0A 1A0KA 2W3HA 2QKPA 4NEED 4Q8IA 4X25A 2W1RA 5A90A 5G4YA 2VX8A 1ES4A 3LO7A 4FD8A 3MXRA 5CHUA 5FATA 4O7DA 2XLNA 5BOHA 1H8ZA 2EX6A 3GQZA 1HZOA 2HDRA 3QP8A 3SH7A 5DJTA 2VGLM 4GD6A 3H7WB 4RX2A 3BJNA 3M2JA 3UE0A 3TSGA 2DCFA 4DJ2A 4HQAA 3EOIA 1OPXA 1YSQA 1HLUP 1Q2QA 4WMCA 4UEYA 4IVIA 2PDRA 3FKWA 1WYBA 2XGNA 4EEPA 4BL3A 4KG5A 5HD3A 1FCNA 4P6ZS 5HDSA 3OOVA 3BYDA 2HJEA 4P87A 3E2LA 5FQKA 4E3KA 3MF0A 2Y2KA 3SZTA 3EWKA 2P9VB 4MN7A 1G28A 2QPNA 5DTTA 3RXWA 3WS0A 4Y3IA 3W4QA 4LCLA 2CMNA 4S2IA 5HDCA 4YNRA 3EEHA 2PD7A 5HD5A 4YOFA 2ZM8A 2L4RA 1H5XA 4GS9A 5GLCA 4XXRA 5CGSA 4B9OA 2ZJ9A 4YFMA 1WYCA 2JN7A 2PYPA 3T4KA 3UNWA 3DAVA 1UWPX 5JYPA 1LI9A 3HLDA 4CLCA 3CPTA 4CPKA 1SKOB 1H0MA 5EFWA 2HP5A 1DP9A 1FQGA 4L9GA 3VFHA 3PBOA 4LFUA 2W3FA 2WGWB 1H3QA 5KSCA 3OPPA 5HZHA 1BSGA 3EEAA 1XPBA 3IQAA 5C5KA 3NHQA 3BQ8A 2W3GA 4ZDXA 1CK3A 1PWCA 5TR7A 2KOIA 5K5BA 3ZG7B 2QWSA 2J3WA 5EVID 1FOFA 3ITAA 1XP4A 1X0OA 1KDWA 4ESPA 5FSRA 5TFQA 1KGEA 1K0KA 3O3VA 3T1QB 3IHBA 4Y7PA 4MLLA 2VGLS 1XGJA 4BENA 3HLCA 2LB9A 1XKZA 3N4IA 3PXPA 1N9LA 3FPWA 3S22A 2G7UA 4JF4A 3VE4A 1BTLA 2HV1A 5E2FA 4GKUA 1SDEA 2OWHA 4GD8A 4WF0A 4CLCC 3NOTC 4N1HA 5CEBA 4MDZA 3PBNA 4H6JA 4WLAA 5HAQA 2DMWA 1FR6A 1CI8A 1MBLA 3SOIA 1KE4A 1OTEA 4Q0HA 2IWDA 1YQSA 1ZG4A 2ZC7A 1L0GA 3VOLA 1LI0A 1TDGA 5EVIA 3MS6A 4Y17A 2KLIA 5DF7A 1RP5A 3W2ZA 3BEBA 3MZEA 4LENA 4JBFA 3JVUA 2Z2MB 4EXOA 5GHZA 4EUVA 4GJ4A 3D3OA 3VFFA 4JF6A 3CHWP 3ZG5A 2INWA 1N9OA 4QWOA 1BYWA 3C4OA 5L8MA 3S1YA 1ZTUA 1QMEA 1IKIA 1V9YA 3D72A 4LV0A 1ERMA 4JPMA 3RH8B 2Y2IA 3KYEA 1U60A 3W8KA 4ZJ3A 2GZAA 2VEAA 3V3SA 3QHYA 3PBTA 2WGVA 1PWDA 4WBGA 5DF9A 5AQBA 1IOUA 2HGVA 4L0LA 2PBYA 5FEGA 3GMWA 4MNRA 2X02A 5HW3A 3M6BA 3UY6A 5F1FA 1FCOA 5AVEA 3U2AA 4UA7A 2PYRA 1IYQA 1JWVA 4MN5A 4S2NA 3A3DA 5EVLA 4WL9A 5FASA 5EVIC 1YAXA 1S6RA 3O86A 4F94A 1GA0A 1RCJA 3LIAA 5CHMA 3UPOA 1NY0A 5FQJA 2V20A 3MXQA 2ZLYA 1J9MA 2M7UA 3EQUA 3JYIA 5D3OA 3DTIA 3CG5A 4QPRA 4XUZA 4R3AA 2EFUA 3ISGA 4M3KA 4P85A 4DE3A 3C4PA 3E4PA 4JF5A 4QD4A 2PRFA 4BD0A 2HJ9C 5I94A 5FAPA 3ZYTA 1DJBA 3L7HA 2Y2PA 3ZNYA 2K2NA 3IXHA 3DWZA 1DP8A 2WUQA 3TRCA 3U4LP 1TF1A 3LIFA 4KZ6A 2QJ5A 2O9CA 2BLSA 2VJWA 3O5YA 3CITA 3IBJA 5AJGA 4DKIA 5HWVA 4HHDA 4H6JB 5DKLA 4X53A 3N8SA 1L3LA 1K55C 5KSHA 1OJGA 5E2EA 1EI5A 2LB5A 1C3BA 1ES5A 1BULA 1P9RA 5KIZA 2P74A 3G2YA 2HP9A 1KOUA 5FQ9A 4L9FA 1S4RA 3BFDA 2W27A 2V1ZA 3BFCA 3PTEA 2HDUA 4LGWA 2PU2A 3BW6A 2XQZA 4HJ6A 2O99A 3A3IA 3MQOA 1T1CA 1N4OA 2PR5A 3ULFA 3AGEA 1YSPA 4OPQA 5DTKA 5IHVA 2K7SA 1OTIA 2Y2HA 2C6WB 4S2KA 2QJ7A 2WKQA 3EQVA 1STZA 3Q07A 1ZKJA 1Z09A 2B18A 4OQ0A 2W3DA 1ZC2A 3G4PA 1YKDA 4EBNA 3LEQA 1JWZA 2Y2OA 3IT9A 2D01A 2EXAA 1LLBA
chains in the Genus database with same CATH topology
1OPXA 1YSQA 3EGXC 4UEYA 2PDRA 4I38A 4Y2FA 3LIEA 4BBTA 2PD8A 4EEPA 3PYPA 5HD3A 4R6LA 4P6ZS 3VE3A 5HDSA 3OOVA 3FG8A 4IHQA 2HJEA 1TS6A 4II7A 3UB9A 1TS7A 1NWZA 1P9WA 3MF0A 2V0UA 1TS8A 3EWKA 3LUQA 3T4SA 2EWVA 4MN7A 1G28A 4IJGA 1GSVA 2L0WA 2V1AA 2Z6DA 4Y3IA 2A2LA 2CMNA 3GDIA 4PKYG 5HDCA 4YNRA 3UB8A 4NKPA 3EEHA 2PD7A 5HD5A 4YOFA 3E4QA 4JGRA 2L4RA 1DRMA 4GS9A 4EEUA 4DMZA 4GCZA 1LT0A 4XT2A 5F68A 4B9OA 1LSXA 3C2WA 2OAP1 3A0VA 4EERA 3T4KA 2JN7A 2PYPA 3BY9A 1UWPX 4CLCA 4DN0A 3B42A 4UQIS 1Y28A 4JGQA 5EFWA 1DP9A 4UQIM 4ME4A 2GX5A 1T1BA 3TW8A 1P97A 4L9GA 4ETXA 4CLCB 3MMHA 2I9VA 3F1NB 4I3JA 4O0PA 3H7WA 3PBOA 2PR6A 4JGPA 5MC7A 3DBAA 4O8GA 3KSFA 2W3FA 3VV4A 2Z6CA 2M7VA 1H3QA 1ZHHB 3CWFA 1OT9A 3H9WA 4HP4A 5HZHA 3EEAA 1P0ZA 2VZWA 4HIAA 2A24B 4BBUA 4BBVA 5C5KA 1T19A 4G3VA 3NHQA 2QYBA 2A24A 3BQ8A 1WA9A 3F1OA 2W3GA 3TE8A 3K3CA 3H82A 1S4SA 2VV7A 4I3AA 1S67L 2KX6A 3LFVA 3OLOA 2KOIA 5K5BA 2QWSA 3LR0A 2J3WA 2J3TC 4Q0IA 1TD5A 4BJPA 3F1NA 4BMWA 1VHMA 4IUKA 4BWIA 3T4TA 1MZUA 4NXGA 2Y8HA 2YKFA 3HJIA 5DFXA 5HL6A 3B47A 3R4KA 1X0OA 3SW1A 3A0RA 4ARZA 2XA7S 4Z1WA 5J3WA 3E98A 1DP6A 3T4JA 1VB6A 4R38A 3BQAA 1OJ5A 3NJAA 2XROA 4GW9A 2IA2A 4I3IA 4EW7A 2QHKA 2R78A 1D06A 2NUTC 2VKSA 4GS9B 2VGLS 1IFQA 3IBRA 2VV8A 2LB9A 3KX0X 3FPVA 2V0WA 2FH5A 3PXPA 2L1MA 2Y79A 3NOUC 4LLOB 1N9LA 3B33A 3FPWA 2G7UA 3VE4A 3UMEA 2HV1A 1NLYA 4O01A 2PT7A 3HCYA 2OWHA 4WF0A 5HSQA 4CLCC 3LR3A 3NOTC 1F98A 5TJJA 3RFBA 3IS2B 4JGOA 1F5MA 3FC7A 4MDZA 4E04A 2W1TA 2WKPA 3OBFA 3OCNA 4HH2A 3CLOA 3PR6A 3PBNA 4PAUA 4H6JA 4WLAA 2XSSA 2DMWA 4GLQA 4AFIA 1XJ6A 4LRXC 4HH3A 2JKTM 1MC0A 1OTEA 4FOFA 4Q0HA 1W63Q 3LIBA 4L9EA 4LPZA 3PBRA 3S7PA 3VOLA 3UE6A 3PBSA 2O9AA 3R7WA 1NLZA 2KLIA 3T50A 3W2ZA 1W63M 3LYXA 3T4LA 4G3KA 2ZOIA 2EA9A 4KUOA 1H8MA 4YWZA 3S7NA 4R70A 3JVUA 2V9AA 4EXOA 3BY8A 4EUVA 3KYZA 2XRNA 4GJ4A 3PHYA 2W1TB 3D3OA 5CX7A 1UWNX 4NXFA 1S1ZA 4XT2B 2INWA 1N9OA 5HWTA 3NOPC 1BYWA 2J3TD 4CLCE 5L8MA 4WEJA 4HOIA 1ZTUA 3KYQA 4WELA 1V9YA 5HPFA 3D72A 3A0SA 1S1YA 3RH8B 1XJ4A 2O9BA 4M4XA 3EGDC 2MJ6A 1XJ2A 2GZAA 2VEAA 3C30A 3LI9A 3PBTA 2ZMFA 4GHIA 2JKRM 4NXEA 4IUHA 4K08A 3HJKA 5J4EA 5DF9A 2NUPC 2M1CA 4B93A 2BASA 4MCWA 1NRJA 1IOUA 2HGVA 3ZQ5A 2OAQ1 2JHEA 3CUEA 4L0LA 1LSVA 3LR4A 2P7JA 5AVFA 4LRZE 2EWWA 4LRYC 4NXBA 3OC2A 1XFQA 1T1AA 2VLGA 5AVEA 3U2AA 4FSFA 4KUKA 3UB6A 5HWWA 3RTYA 2PYRA 1EW0A 4EQ1A 2YKHA 2GJ3A 4MN5A 1UGUA 2WKRA 2K31A 2PHYA 4EETB 4WL9A 3G6OA 4WUJA 1YAXA 3E4OA 4RQ9A 3CUEC 1LSWA 3LIAA 2O0YA 3LICA 3KSHA 3CAXA 2P08A 5A8BA 4OOMA 5DFYA 3F1PA 2OWJA 2OOLA 3MXQA 5I5LA 3OCLA 3LI8A 3PBQA 4Q0JA 3IS2A 3MQ0A 3MJQA 4WEKA 2J80A 2M7UA 3EQUA 3LR5A 4MN6A 4CLCD 2FZ0A 2XA7M 5F5YA 5F6AA 4QPRA 1F9IA 1D7EA 4R3AA 5G4ZA 3E4PA 3R7WB 3MR0A 5DJUA 3V67A 2HJ9C 1S66L 4WN5A 3ZYTA 5J7EA 3H82B 5TBMB 3UE3A 3S7OA 4GHIB 2K2NA 4KQDA 1DP8A 5DKKA 2P04A 5IU1A 3TRCA 1GSXA 1TF1A 3LIFA 2QJ5A 2O9CA 4Y5FA 2VJWA 3O5YA 1JNUA 3CITA 4KQOA 3IBJA 3ICYA 3K2NA 5AJGA 4HHDA 3C38A 1G6OA 1V9ZA 4ARZB 5HWVA 2GNXA 1XFNA 4H6JB 4HI4A 1XJ3A 5DKLA 4OOLA 3UB7A 2W3EA 4MMNA 3BWLA 3K3DA 3KO6A 2B02A 3CI6A 2V1BA 4ZRRA 5KSHA 1OJGA 3MFXA 2LB5A 1LL8A 2D02A 4HP9A 5IS1A 3JVVA 1OT6A 1OTAA 5HDDA 1OTDA 4DJ3A 3TJZC 3E0YA 5LBRA 4PHTA 1P9RA 4HJ4A 4G3WA 5KIZA 1N9NA 1OTBA 2HF6A 4I39A 1GSWA 3UMDA 3LIDA 4EESA 4I5SA 1KOUA 3GECA 5HPIA 4CQHA 4HJ3A 3F1PB 4L9FA 4ETZA 5FL3A 3T4QA 1S4RA 4HY8A 2W27A 2ZMVA 2H28A 1MKMA 2JKTI 5F69A 2ZOHA 2KDKA 2W3HA 5IT5A 2QKPA 4NEED 1T18A 4HJ6A 3BW6A 2O99A 2W1RA 2ZBBA 3MQOA 1T1CA 5G4YA 2PR5A 3F1OB 3P01A 2VX8A 3ULFA 4HNBA 3C8CA 1YSPA 2JKRI 2VV6A 3KSGA 3KSIA 5TBMA 4P6ZM 3P7NA 4F3LB 2K7SA 1OTIA 2QJ7A 5DJTA 2VGLM 4EU0A 2WKQA 3H7WB 3EQVA 1STZA 3BJNA 2B18A 3MQQA 4PKYA 4F3LA 2W3DA 3S7QA 1TS0A 3T4OA 1YKDA 2VA0A 1ODVA 2W0NA 4DJ2A 2D01A 4HQAA 3EOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FH5 A;  2JKT M;  2HF6 A;  2VGL S;  1W63 Q;  4UQI M;  3TJZ C;  4P6Z S;  4NEE D;  1W63 M;  2XA7 M;  2XA7 S;  2VGL M;  4UQI S;  2JKR I;  4P6Z M;  5MC7 A;  2JKT I;  2JKR M;  1NRJ A; 
#chains in the Genus database with same CATH topology
 3N8R A;  3PYP A;  1PW1 A;  4R6L A;  3QP5 A;  1PI5 A;  1SKF A;  1TS6 A;  3Q7V A;  3UB9 A;  4R23 A;  1K55 A;  1BLS A;  2WAD A;  3C7U A;  3D4F A;  4KQR A;  2V1A A;  1YM1 A;  4RA7 A;  2A2L A;  3SS5 A;  2PBD P;  1VET A;  4IVK A;  4UHU A;  4B4X A;  3NBL A;  1G6A A;  3E4Q A;  2B5R A;  1DRM A;  4PM9 A;  4EEU A;  3QNB A;  4GCZ A;  4OH0 A;  5F68 A;  2J9P A;  3GR2 A;  4WYY A;  1SHV A;  4IED A;  3WRZ A;  4KEN B;  3UPP A;  3BY9 A;  3NY4 A;  2XF3 A;  3B42 A;  4UQI S;  4JGQ A;  2DNS A;  1T1B A;  3TW8 A;  1P97 A;  3MMH A;  4HEF A;  1K6R A;  3F1N B;  5CHJ A;  4OLD A;  1YMX A;  4OPZ A;  1LHY A;  3H7W A;  2FFY A;  4O8G A;  3UE1 A;  1TEM A;  1MWS A;  5FQM A;  2Z6C A;  4ZJ2 A;  2Y59 A;  2VZW A;  2R9X A;  4HIA A;  2A24 B;  4DE2 A;  2WK0 A;  5J8X A;  1SZV A;  3G2Z A;  1WA9 A;  3IF6 C;  4PPR A;  3T12 B;  4I3A A;  1S67 L;  2KX6 A;  3OLO A;  5HAP A;  5G18 A;  5FA7 A;  4Q0I A;  3Q7V B;  3G30 A;  1KDS A;  3G32 A;  1MZU A;  4QB8 A;  1FCM A;  4JXW A;  2YKF A;  3HJI A;  5DFX A;  3A0R A;  1CF0 A;  4Z1W A;  2WAE A;  2V2F F;  1DP6 A;  2Y2N A;  1VB6 A;  4OVD A;  4R38 A;  2CC1 A;  3IF6 B;  2QHK A;  3CMZ A;  2R78 A;  1D06 A;  3IBR A;  4KZ9 A;  5CTN A;  2FH5 A;  2Y79 A;  4KG2 A;  4JLF A;  3UME A;  1NLY A;  4O01 A;  2EX2 A;  4H8R A;  1K4F A;  4EBL A;  3MBZ A;  5TJJ A;  1F98 A;  1I2W A;  4P0M A;  4E04 A;  2WKP A;  3CLO A;  3FKV A;  5EOO A;  4AFI A;  2E8J A;  2J9O A;  2XR0 A;  1FR1 A;  4Y15 A;  2JKT M;  1MC0 A;  4X68 A;  3GV9 A;  3ZGA B;  1W63 Q;  5EOE A;  3BFF A;  4LPZ A;  4B88 A;  4E6W A;  1PWG A;  3PBS A;  2O9A A;  3R7W A;  1YLY A;  1K56 D;  4X56 A;  1TDL A;  1W63 M;  2Z2L B;  3T4L A;  1KE3 A;  4G3K A;  1CI9 A;  1H8M A;  4KZ3 A;  4R70 A;  5FDS A;  1ONH A;  1E3U A;  3QP2 A;  1AWI A;  2W1T B;  1UWN X;  3O87 A;  1HTZ A;  4NXF A;  1S1Z A;  4E3L A;  5HWT A;  1NYY A;  3NOP C;  2J3T D;  1YLT A;  4WEJ A;  1K38 A;  3KYQ A;  5HPF A;  3A0S A;  3EGD C;  2MJ6 A;  1CJF A;  3Q7Z A;  4PM6 A;  2JBF A;  3NC8 A;  5A91 A;  1KVL A;  2Y2L A;  4IUH A;  5J4E A;  4WMC D;  4B93 A;  2RCX A;  1YLJ A;  4MCW A;  4QY6 A;  2OAQ 1;  2DRW A;  3UDI A;  3SS3 A;  1BLC A;  2HDS A;  5JYO A;  3OC2 A;  1XFQ A;  2A3U A;  2WKE A;  5AQ9 A;  4KUK A;  5FEF A;  3UB6 A;  5F82 A;  2G2U A;  5HWW A;  3RTY A;  3IX4 A;  5KZH A;  5FI7 A;  2GJ3 A;  1UGU A;  1PW8 A;  3IHA A;  3E4O A;  4HBT A;  4S2M A;  1I2S A;  3CUE C;  1TVF A;  1YT4 A;  1Y4O A;  4DXB A;  3ZVT A;  3HLB A;  2B95 A;  5I5L A;  2WKH A;  2EFX A;  3LI8 A;  3MQ0 A;  4QY5 A;  2BTF P;  3N7W A;  1G5U A;  3LR5 A;  2VGJ A;  5CGW A;  3WS5 A;  4CLC D;  4GOG A;  4KZB A;  4EUZ A;  2XEP A;  1N9B A;  5DJU A;  2JCH A;  3V67 A;  1S66 L;  2JE5 A;  2BG1 A;  3UE3 A;  3S7O A;  4KQD A;  5DKK A;  2P04 A;  3VSL A;  4ZAM A;  1FIK A;  3RJU A;  4HES A;  3CJM A;  4LV1 A;  3FYZ A;  2ZC5 B;  4Y5F A;  4QHC A;  2XD5 A;  3C38 A;  1G6O A;  1XFN A;  1XJ3 A;  4OOL A;  2I72 A;  2W3E A;  1W8Y A;  3IH8 A;  3BEC A;  3K3D A;  4EBP A;  1M6K A;  3KO6 A;  5M18 A;  1VM1 A;  2IWB A;  4GN2 A;  1K4E A;  1NJ4 A;  4U3T A;  2D02 A;  1BUE A;  3VP2 A;  1OT6 A;  2HDQ A;  1IEL A;  1OTD A;  3IWI A;  4DJ3 A;  3E0Y A;  5LBR A;  3TG9 A;  4G3W A;  1NRF A;  2HF6 A;  2ZQ9 A;  3LID A;  3BRM A;  3GEC A;  4CQH A;  3HBR A;  3UPN A;  3F1P B;  4ETZ A;  2V8F A;  4BD1 A;  5EE8 A;  2ZOH A;  2KDK A;  3OPR A;  4S2N C;  1DY6 A;  1T18 A;  5DVA A;  2QZ6 A;  3BFG A;  2ZBB A;  1ESU A;  3F1O B;  4GDN A;  4KZ4 A;  4KZ8 A;  1PZO A;  1IYS A;  3VOY A;  3KSG A;  4UA9 A;  1CEF A;  4P6Z M;  3P7N A;  4Y0U A;  3OZH A;  3ZCZ A;  5CER A;  5M1A A;  1J3W A;  3VMA A;  3MQQ A;  1L0D A;  3T4O A;  2VA0 A;  3AGD A;  1ODV A;  3C5A A;  3HUO A;  4LV3 A;  2XDM A;  1GHM A;  1ESI A;  3EGX C;  2A49 A;  1O7E A;  2PAV P;  4I38 A;  2ACG A;  4BBT A;  1K25 A;  3FG8 A;  4IHQ A;  4II7 A;  1NWZ A;  2V0U A;  3GVB A;  1TS8 A;  3L9K A;  3LUQ A;  3T4S A;  3NCK A;  1JVJ A;  2L0W A;  4WZ5 A;  5FI6 A;  5L2F A;  2Z6D A;  3C7V A;  5GLA A;  2WGW A;  3GDI A;  5CTM A;  4CJN A;  3DTM A;  2WZZ A;  4EQI A;  5HX9 A;  3DTK A;  4JGR A;  4GZB A;  4KQQ A;  4DMZ A;  1LT0 A;  4XT2 A;  5CEC A;  2HP6 A;  3IXD A;  1LSX A;  2WYX A;  4N1X A;  3C2W A;  2OAP 1;  4EER A;  3HLE A;  4D60 A;  2HPB A;  5FQI A;  1Y28 A;  2Y91 A;  3IF5 A;  1BLH A;  2GX5 A;  1SKO A;  2X71 A;  1OME A;  4ETX A;  4CLC B;  2I9V A;  4R4R A;  3NUL A;  2PR6 A;  4JGP A;  4IBX A;  4DF6 A;  4C6Y A;  4ID4 A;  3KSF A;  3VV4 A;  5FI2 A;  1OT9 A;  4HP4 A;  4YIN A;  3SH8 A;  1VEU A;  1P0Z A;  4S2O A;  2ZL1 A;  3A3E A;  1IKG A;  1L2S A;  1T19 A;  5CRF A;  1K56 A;  2QYB A;  2A24 A;  1IEM A;  4OLG A;  3TE8 A;  3H82 A;  3W4O A;  1YPR A;  1XA7 A;  4E6X A;  5F1G A;  5DF8 A;  3LFV A;  4FH4 A;  3LR0 A;  3B3X A;  1K57 A;  2J3T C;  4BJP A;  1BZA A;  3F1N A;  3GSG A;  1NZU A;  4BMW A;  4IUK A;  3T4T A;  4QU3 A;  4ZBE A;  2Y8H A;  5HL6 A;  1YLZ A;  3B47 A;  4R4S A;  3R4K A;  3WWX A;  3SW1 A;  2XA7 S;  5J3W A;  2Q9N A;  3T4J A;  4WZ5 C;  3I7J A;  1OJ5 A;  3NJA A;  2JC7 A;  3WS4 A;  4GW9 A;  2IA2 A;  4I3I A;  4K0X A;  2JKF A;  2EX9 A;  4NG2 A;  3PAE A;  4K0W A;  2VKS A;  4PM8 A;  3FPV A;  2V0W A;  4U0X A;  3WS2 A;  2R9W A;  3OPL A;  5EM1 A;  3MZF A;  2PT7 A;  2E8I A;  1E4D A;  4PM7 A;  5HSQ A;  5HL1 A;  1MWU A;  1PRQ A;  1YLP A;  4OPR A;  2W1T A;  4OOY A;  1IYO A;  3OCN A;  4HH2 A;  5CED A;  3HRE A;  2XD1 A;  5A92 A;  1S0W A;  4GLQ A;  4LRX C;  4HH3 A;  4FOF A;  3LIB A;  4L9E A;  5CGX A;  5HFO A;  3TOI A;  2ZMA A;  3E2K A;  3O88 A;  3NI9 A;  1L0E A;  3BLS A;  1KGG A;  3BLM A;  3N6I A;  2ZOI A;  2EA9 A;  4KUO A;  3S7N A;  4YWZ A;  3M2K A;  3DWK A;  1Z6F A;  3IX8 A;  2V9A A;  2FFF B;  3KYZ A;  4K91 A;  4DXC A;  4Z9Q A;  1PIO A;  5E2H A;  5CX7 A;  1YLW A;  4OQI A;  1EWZ A;  3HLW A;  4XT2 B;  4CLC E;  4HOI A;  3IF6 A;  1G68 A;  4LV2 A;  1PYY A;  1ERQ A;  3T1S A;  2Y2M A;  2O9B A;  5EEC A;  1XJ2 A;  1K54 C;  3LI9 A;  2J7V A;  4GNU A;  4GHI A;  4Y0T A;  3FWL A;  4DRT A;  2Y4A A;  4NXE A;  3DTE A;  4X6T A;  3HJK A;  2M1C A;  2BAS A;  3CPT B;  5KMW A;  2ZQA A;  4DE0 A;  4XUX A;  4FCF A;  1VEU B;  2ZC3 B;  3ZVW A;  3UDX A;  4Y0O A;  5L10 A;  4LRZ E;  2EWW A;  1JWP A;  1KE0 A;  3QP6 A;  3DW0 A;  4R0Q A;  4FSF A;  4IBR A;  2XH9 A;  1MXO A;  1RGZ A;  4FH2 A;  4EQ1 A;  3ZG0 A;  2YKH A;  4OKP A;  4E3O A;  2WKR A;  4JXS A;  2K31 A;  3UB5 P;  3G6O A;  4RQ9 A;  4U0T A;  5DTS A;  3Q81 A;  2O0Y A;  3LIC A;  3KSH A;  2WZX A;  3CAX A;  2P08 A;  2GDN A;  1AXB A;  1PI4 A;  5EV0 A;  1RGY A;  4NK3 A;  5DFY A;  2H10 A;  2OOL A;  3HUM A;  5A93 A;  4WEK A;  4X1M A;  2J80 A;  2XFS A;  1XX2 A;  5TGF A;  2FZ0 A;  3IH9 A;  4NET A;  3UO9 A;  1D7E A;  3NIA A;  4RX3 A;  5GHY A;  3MR0 A;  3V3R A;  4OON A;  4N9L A;  4WN5 A;  4DDS A;  5J7E A;  3H82 B;  4BQM A;  1GCE A;  3MSH A;  3ZNT A;  3GRJ A;  1GSX A;  5FAQ A;  3WRT A;  1HVB A;  1KGF A;  3ZG8 B;  1GHI A;  4KG6 A;  3RXX A;  2V8C A;  4ZJ1 A;  4KQO A;  1ACF A;  3ICY A;  5HAR A;  2GNX A;  1L0F A;  1NZO A;  4MMN A;  2H0T A;  1DJC A;  3BWL A;  1ALQ A;  2OLV A;  2OV5 A;  1GA9 A;  5CXW A;  3S4X A;  2B02 A;  3WS1 A;  4ZRR A;  2OSU A;  4HP9 A;  5IS1 A;  1OTA A;  2EX8 A;  3CZD A;  2H0Y A;  4JXG A;  4PHT A;  4HJ4 A;  2UWX A;  3LCE A;  1N9N A;  4EES A;  2Q0O A;  4I5S A;  4D2O A;  5FL3 A;  3T4Q A;  4KZ7 A;  2ZMV A;  3MKE A;  1MKM A;  2JKT I;  5IT5 A;  1M40 A;  1CEG A;  3P01 A;  3LY4 A;  1MPL A;  1FSY A;  4HNB A;  1XXM A;  3C8C A;  2JKR I;  2VV6 A;  4OPY A;  3KSI A;  5TBM A;  4F3L B;  1D1J A;  4OP5 A;  3ZDJ A;  4EU0 A;  4HBU A;  2X01 A;  3HLF A;  1GHP A;  4X1L A;  4MEZ A;  4PKY A;  4F3L A;  3S7Q A;  2Y2J A;  1TS0 A;  3A3J A;  2ZQ8 A;  2W0N A;  1SDN A;  4GB7 A;  3HVF A;  1PNE A;  4Y2F A;  3LIE A;  3P09 A;  2PD8 A;  3HL9 A;  3VE3 A;  2ZC4 B;  4FUW A;  4DE1 A;  1JTG A;  1TS7 A;  1WE4 A;  1P9W A;  2OLU A;  4DDY A;  3D9Y A;  3FZC A;  4JKT A;  2EWV A;  3PAG A;  4IJG A;  1GSV A;  3VP3 A;  5AQA A;  5F83 A;  4PMA A;  4PKY G;  3VSK A;  3UB8 A;  4NKP A;  2QMI A;  1ONG A;  5L09 A;  1VET B;  4X69 A;  1ERO A;  3T1X A;  4KZ5 A;  3A0V A;  4EWF A;  4S2L A;  4DN0 A;  4MBF A;  4RVA A;  1ES2 A;  4E3J A;  4EV4 A;  4WZ4 A;  5EVE A;  2EXB A;  4UQI M;  4ME4 A;  4N92 A;  2ZQD A;  4BL2 A;  3G34 A;  4I3J A;  3SS4 A;  4O0P A;  3NDG A;  5MC7 A;  3DBA A;  4MBK A;  3VOZ A;  5FQQ A;  5M19 A;  1MWR A;  2M7V A;  1ZHH B;  3CWF A;  3H9W A;  4B4Z A;  4BBU A;  4BBV A;  5E2G A;  4G3V A;  4UAA A;  3F1O A;  1YMS A;  2Y55 A;  2IWC A;  4WM9 A;  3K3C A;  4ZTK A;  1IYP A;  3OPH A;  1S4S A;  2VV7 A;  1NXY A;  4PM5 A;  1PZP A;  1TD5 A;  1KVM A;  1W7F A;  1VHM A;  4BWI A;  4NXG A;  5GHX A;  4ARZ A;  3QNC A;  3E98 A;  4UA6 A;  3VP1 A;  2H5S A;  2G2W A;  3BQA A;  4FTX A;  3T1R A;  2XRO A;  4EW7 A;  3IXB A;  2ZL1 B;  2NUT C;  2XFT A;  3BM6 A;  4GS9 B;  1IFQ A;  2VV8 A;  3KX0 X;  3QP1 A;  2Q9M A;  2L1M A;  3MXS A;  3NOU C;  4LLO B;  3B33 A;  1SCW A;  2WKI A;  4S2P A;  3IXG A;  2RL3 A;  3V5M A;  3HCY A;  3LR3 A;  1K6S A;  3RFB A;  1Y54 A;  2PU4 A;  3IS2 B;  5GLB A;  4JGO A;  1BT5 A;  1F5M A;  3FC7 A;  4MBH A;  3OBF A;  2XK1 A;  3PR6 A;  4A5R A;  4PAU A;  3GTC A;  2XSS A;  2WGI A;  3HLG A;  4Y13 A;  1XJ6 A;  2Y2Q A;  4C75 A;  1MKI A;  1E3U D;  3VP4 A;  3PBR A;  3S7P A;  3ZHH A;  2J8Y A;  3UE6 A;  3ZG9 B;  3ZFZ A;  1NLZ A;  1PFL A;  3G31 A;  3UDF A;  1CQA A;  3T50 A;  1MWT A;  3LYX A;  1XGI A;  1W5D A;  3SH9 A;  4E3N A;  4R3J A;  3BY8 A;  2ZQC A;  3IX3 A;  2XRN A;  3PHY A;  5GLD A;  2VK3 A;  2VGK A;  1DJA A;  3P98 A;  4X55 A;  4WEL A;  2JKG A;  1S1Y A;  3V39 A;  1XJ4 A;  4M4X A;  5HAI A;  3C30 A;  4R1G A;  2ZQ7 A;  2ZMF A;  4GDB A;  2JKR M;  4K08 A;  2NUP C;  5U47 A;  1LL5 A;  1NRJ A;  3ZQ5 A;  2JHE A;  3CUE A;  5FDH A;  1LSV A;  3LR4 A;  5GL9 A;  1FIL A;  2WAF A;  1K57 C;  2P7J A;  3A3F A;  5AVF A;  5EUA A;  3NEC A;  4LRY C;  4NXB A;  2ZM0 A;  1T1A A;  2VLG A;  3M6H A;  5EVI B;  4KZA A;  3MZD A;  1EW0 A;  1W79 A;  1MY8 A;  2C5W B;  3ITB A;  4LCM A;  2PHY A;  4N9K A;  4EET B;  4WUJ A;  1LSW A;  4C3Q A;  3W4P A;  5A8B A;  3MFD A;  4OOM A;  3F1P A;  2OWJ A;  3Q1F A;  4OQG A;  4QJG A;  4BLM A;  3OCL A;  3PBQ A;  3BFE A;  4Q0J A;  3IS2 A;  1I5Q A;  3MJQ A;  1FSW A;  4MN6 A;  1K54 A;  3UN7 A;  2XA7 M;  5F5Y A;  5F6A A;  3FV7 A;  1F9I A;  4OQH A;  5G4Z A;  3V50 A;  3R7W B;  5L07 A;  3IWQ A;  2AVX A;  5TBM B;  1QMF A;  2P9V A;  4S2J A;  1ES3 A;  3IWO A;  4RYE A;  4GHI B;  4E3M A;  1E25 A;  1HD8 A;  3LEZ A;  3VP0 A;  5IU1 A;  3LGO A;  2HZ5 A;  2ZM2 A;  3NDE A;  1JTD A;  4JXV A;  2ZC6 B;  3HUN A;  1JNU A;  3QP4 A;  4ARZ B;  3K2N A;  1V9Z A;  3N8L A;  1VQQ A;  4HI4 A;  1ZG6 A;  3G35 A;  3UB7 A;  4P6B A;  2Y2G A;  5FAO A;  1XA1 A;  3CI6 A;  2V1B A;  3MFX A;  1LL8 A;  1NYM A;  3JPU A;  3JVV A;  3Q82 A;  1O07 A;  5HDD A;  4R3B A;  3TJZ C;  1H8Y A;  1LL9 A;  1OTB A;  2ZD8 A;  4I39 A;  5AQ7 A;  1GSW A;  3UMD A;  2UV0 E;  1BLP A;  5HPI A;  1Q2P A;  1W8Q A;  4HJ3 A;  1F2K A;  3LY3 A;  3MKF A;  4HY8 A;  5EPH A;  2H28 A;  4E3I A;  3AGF A;  4OP8 A;  5F69 A;  5E43 A;  5EM0 A;  1A0K A;  2W3H A;  2QKP A;  4NEE D;  4Q8I A;  4X25 A;  2W1R A;  5A90 A;  5G4Y A;  2VX8 A;  1ES4 A;  3LO7 A;  4FD8 A;  3MXR A;  5CHU A;  5FAT A;  4O7D A;  2XLN A;  5BOH A;  1H8Z A;  2EX6 A;  3GQZ A;  1HZO A;  2HDR A;  3QP8 A;  3SH7 A;  5DJT A;  2VGL M;  4GD6 A;  3H7W B;  4RX2 A;  3BJN A;  3M2J A;  3UE0 A;  3TSG A;  2DCF A;  4DJ2 A;  4HQA A;  3EOI A;  1OPX A;  1YSQ A;  1HLU P;  1Q2Q A;  4WMC A;  4UEY A;  4IVI A;  2PDR A;  3FKW A;  1WYB A;  2XGN A;  4EEP A;  4BL3 A;  4KG5 A;  5HD3 A;  1FCN A;  4P6Z S;  5HDS A;  3OOV A;  3BYD A;  2HJE A;  4P87 A;  3E2L A;  5FQK A;  4E3K A;  3MF0 A;  2Y2K A;  3SZT A;  3EWK A;  2P9V B;  4MN7 A;  1G28 A;  2QPN A;  5DTT A;  3RXW A;  3WS0 A;  4Y3I A;  3W4Q A;  4LCL A;  2CMN A;  4S2I A;  5HDC A;  4YNR A;  3EEH A;  2PD7 A;  5HD5 A;  4YOF A;  2ZM8 A;  2L4R A;  1H5X A;  4GS9 A;  5GLC A;  4XXR A;  5CGS A;  4B9O A;  2ZJ9 A;  4YFM A;  1WYC A;  2JN7 A;  2PYP A;  3T4K A;  3UNW A;  3DAV A;  1UWP X;  5JYP A;  1LI9 A;  3HLD A;  4CLC A;  3CPT A;  4CPK A;  1SKO B;  1H0M A;  5EFW A;  2HP5 A;  1DP9 A;  1FQG A;  4L9G A;  3VFH A;  3PBO A;  4LFU A;  2W3F A;  2WGW B;  1H3Q A;  5KSC A;  3OPP A;  5HZH A;  1BSG A;  3EEA A;  1XPB A;  3IQA A;  5C5K A;  3NHQ A;  3BQ8 A;  2W3G A;  4ZDX A;  1CK3 A;  1PWC A;  5TR7 A;  2KOI A;  5K5B A;  3ZG7 B;  2QWS A;  2J3W A;  5EVI D;  1FOF A;  3ITA A;  1XP4 A;  1X0O A;  1KDW A;  4ESP A;  5FSR A;  5TFQ A;  1KGE A;  1K0K A;  3O3V A;  3T1Q B;  3IHB A;  4Y7P A;  4MLL A;  2VGL S;  1XGJ A;  4BEN A;  3HLC A;  2LB9 A;  1XKZ A;  3N4I A;  3PXP A;  1N9L A;  3FPW A;  3S22 A;  2G7U A;  4JF4 A;  3VE4 A;  1BTL A;  2HV1 A;  5E2F A;  4GKU A;  1SDE A;  2OWH A;  4GD8 A;  4WF0 A;  4CLC C;  3NOT C;  4N1H A;  5CEB A;  4MDZ A;  3PBN A;  4H6J A;  4WLA A;  5HAQ A;  2DMW A;  1FR6 A;  1CI8 A;  1MBL A;  3SOI A;  1KE4 A;  1OTE A;  4Q0H A;  2IWD A;  1YQS A;  1ZG4 A;  2ZC7 A;  1L0G A;  3VOL A;  1LI0 A;  1TDG A;  5EVI A;  3MS6 A;  4Y17 A;  2KLI A;  5DF7 A;  1RP5 A;  3W2Z A;  3BEB A;  3MZE A;  4LEN A;  4JBF A;  3JVU A;  2Z2M B;  4EXO A;  5GHZ A;  4EUV A;  4GJ4 A;  3D3O A;  3VFF A;  4JF6 A;  3CHW P;  3ZG5 A;  2INW A;  1N9O A;  4QWO A;  1BYW A;  3C4O A;  5L8M A;  3S1Y A;  1ZTU A;  1QME A;  1IKI A;  1V9Y A;  3D72 A;  4LV0 A;  1ERM A;  4JPM A;  3RH8 B;  2Y2I A;  3KYE A;  1U60 A;  3W8K A;  4ZJ3 A;  2GZA A;  2VEA A;  3V3S A;  3QHY A;  3PBT A;  2WGV A;  1PWD A;  4WBG A;  5DF9 A;  5AQB A;  1IOU A;  2HGV A;  4L0L A;  2PBY A;  5FEG A;  3GMW A;  4MNR A;  2X02 A;  5HW3 A;  3M6B A;  3UY6 A;  5F1F A;  1FCO A;  5AVE A;  3U2A A;  4UA7 A;  2PYR A;  1IYQ A;  1JWV A;  4MN5 A;  4S2N A;  3A3D A;  5EVL A;  4WL9 A;  5FAS A;  5EVI C;  1YAX A;  1S6R A;  3O86 A;  4F94 A;  1GA0 A;  1RCJ A;  3LIA A;  5CHM A;  3UPO A;  1NY0 A;  5FQJ A;  2V20 A;  3MXQ A;  2ZLY A;  1J9M A;  2M7U A;  3EQU A;  3JYI A;  5D3O A;  3DTI A;  3CG5 A;  4QPR A;  4XUZ A;  4R3A A;  2EFU A;  3ISG A;  4M3K A;  4P85 A;  4DE3 A;  3C4P A;  3E4P A;  4JF5 A;  4QD4 A;  2PRF A;  4BD0 A;  2HJ9 C;  5I94 A;  5FAP A;  3ZYT A;  1DJB A;  3L7H A;  2Y2P A;  3ZNY A;  2K2N A;  3IXH A;  3DWZ A;  1DP8 A;  2WUQ A;  3TRC A;  3U4L P;  1TF1 A;  3LIF A;  4KZ6 A;  2QJ5 A;  2O9C A;  2BLS A;  2VJW A;  3O5Y A;  3CIT A;  3IBJ A;  5AJG A;  4DKI A;  5HWV A;  4HHD A;  4H6J B;  5DKL A;  4X53 A;  3N8S A;  1L3L A;  1K55 C;  5KSH A;  1OJG A;  5E2E A;  1EI5 A;  2LB5 A;  1C3B A;  1ES5 A;  1BUL A;  1P9R A;  5KIZ A;  2P74 A;  3G2Y A;  2HP9 A;  1KOU A;  5FQ9 A;  4L9F A;  1S4R A;  3BFD A;  2W27 A;  2V1Z A;  3BFC A;  3PTE A;  2HDU A;  4LGW A;  2PU2 A;  3BW6 A;  2XQZ A;  4HJ6 A;  2O99 A;  3A3I A;  3MQO A;  1T1C A;  1N4O A;  2PR5 A;  3ULF A;  3AGE A;  1YSP A;  4OPQ A;  5DTK A;  5IHV A;  2K7S A;  1OTI A;  2Y2H A;  2C6W B;  4S2K A;  2QJ7 A;  2WKQ A;  3EQV A;  1STZ A;  3Q07 A;  1ZKJ A;  1Z09 A;  2B18 A;  4OQ0 A;  2W3D A;  1ZC2 A;  3G4P A;  1YKD A;  4EBN A;  3LEQ A;  1JWZ A;  2Y2O A;  3IT9 A;  2D01 A;  2EXA A;  1LLB A; 
#chains in the Genus database with same CATH homology
 1OPX A;  1YSQ A;  3EGX C;  4UEY A;  2PDR A;  4I38 A;  4Y2F A;  3LIE A;  4BBT A;  2PD8 A;  4EEP A;  3PYP A;  5HD3 A;  4R6L A;  4P6Z S;  3VE3 A;  5HDS A;  3OOV A;  3FG8 A;  4IHQ A;  2HJE A;  1TS6 A;  4II7 A;  3UB9 A;  1TS7 A;  1NWZ A;  1P9W A;  3MF0 A;  2V0U A;  1TS8 A;  3EWK A;  3LUQ A;  3T4S A;  2EWV A;  4MN7 A;  1G28 A;  4IJG A;  1GSV A;  2L0W A;  2V1A A;  2Z6D A;  4Y3I A;  2A2L A;  2CMN A;  3GDI A;  4PKY G;  5HDC A;  4YNR A;  3UB8 A;  4NKP A;  3EEH A;  2PD7 A;  5HD5 A;  4YOF A;  3E4Q A;  4JGR A;  2L4R A;  1DRM A;  4GS9 A;  4EEU A;  4DMZ A;  4GCZ A;  1LT0 A;  4XT2 A;  5F68 A;  4B9O A;  1LSX A;  3C2W A;  2OAP 1;  3A0V A;  4EER A;  3T4K A;  2JN7 A;  2PYP A;  3BY9 A;  1UWP X;  4CLC A;  4DN0 A;  3B42 A;  4UQI S;  1Y28 A;  4JGQ A;  5EFW A;  1DP9 A;  4UQI M;  4ME4 A;  2GX5 A;  1T1B A;  3TW8 A;  1P97 A;  4L9G A;  4ETX A;  4CLC B;  3MMH A;  2I9V A;  3F1N B;  4I3J A;  4O0P A;  3H7W A;  3PBO A;  2PR6 A;  4JGP A;  5MC7 A;  3DBA A;  4O8G A;  3KSF A;  2W3F A;  3VV4 A;  2Z6C A;  2M7V A;  1H3Q A;  1ZHH B;  3CWF A;  1OT9 A;  3H9W A;  4HP4 A;  5HZH A;  3EEA A;  1P0Z A;  2VZW A;  4HIA A;  2A24 B;  4BBU A;  4BBV A;  5C5K A;  1T19 A;  4G3V A;  3NHQ A;  2QYB A;  2A24 A;  3BQ8 A;  1WA9 A;  3F1O A;  2W3G A;  3TE8 A;  3K3C A;  3H82 A;  1S4S A;  2VV7 A;  4I3A A;  1S67 L;  2KX6 A;  3LFV A;  3OLO A;  2KOI A;  5K5B A;  2QWS A;  3LR0 A;  2J3W A;  2J3T C;  4Q0I A;  1TD5 A;  4BJP A;  3F1N A;  4BMW A;  1VHM A;  4IUK A;  4BWI A;  3T4T A;  1MZU A;  4NXG A;  2Y8H A;  2YKF A;  3HJI A;  5DFX A;  5HL6 A;  3B47 A;  3R4K A;  1X0O A;  3SW1 A;  3A0R A;  4ARZ A;  2XA7 S;  4Z1W A;  5J3W A;  3E98 A;  1DP6 A;  3T4J A;  1VB6 A;  4R38 A;  3BQA A;  1OJ5 A;  3NJA A;  2XRO A;  4GW9 A;  2IA2 A;  4I3I A;  4EW7 A;  2QHK A;  2R78 A;  1D06 A;  2NUT C;  2VKS A;  4GS9 B;  2VGL S;  1IFQ A;  3IBR A;  2VV8 A;  2LB9 A;  3KX0 X;  3FPV A;  2V0W A;  2FH5 A;  3PXP A;  2L1M A;  2Y79 A;  3NOU C;  4LLO B;  1N9L A;  3B33 A;  3FPW A;  2G7U A;  3VE4 A;  3UME A;  2HV1 A;  1NLY A;  4O01 A;  2PT7 A;  3HCY A;  2OWH A;  4WF0 A;  5HSQ A;  4CLC C;  3LR3 A;  3NOT C;  1F98 A;  5TJJ A;  3RFB A;  3IS2 B;  4JGO A;  1F5M A;  3FC7 A;  4MDZ A;  4E04 A;  2W1T A;  2WKP A;  3OBF A;  3OCN A;  4HH2 A;  3CLO A;  3PR6 A;  3PBN A;  4PAU A;  4H6J A;  4WLA A;  2XSS A;  2DMW A;  4GLQ A;  4AFI A;  1XJ6 A;  4LRX C;  4HH3 A;  2JKT M;  1MC0 A;  1OTE A;  4FOF A;  4Q0H A;  1W63 Q;  3LIB A;  4L9E A;  4LPZ A;  3PBR A;  3S7P A;  3VOL A;  3UE6 A;  3PBS A;  2O9A A;  3R7W A;  1NLZ A;  2KLI A;  3T50 A;  3W2Z A;  1W63 M;  3LYX A;  3T4L A;  4G3K A;  2ZOI A;  2EA9 A;  4KUO A;  1H8M A;  4YWZ A;  3S7N A;  4R70 A;  3JVU A;  2V9A A;  4EXO A;  3BY8 A;  4EUV A;  3KYZ A;  2XRN A;  4GJ4 A;  3PHY A;  2W1T B;  3D3O A;  5CX7 A;  1UWN X;  4NXF A;  1S1Z A;  4XT2 B;  2INW A;  1N9O A;  5HWT A;  3NOP C;  1BYW A;  2J3T D;  4CLC E;  5L8M A;  4WEJ A;  4HOI A;  1ZTU A;  3KYQ A;  4WEL A;  1V9Y A;  5HPF A;  3D72 A;  3A0S A;  1S1Y A;  3RH8 B;  1XJ4 A;  2O9B A;  4M4X A;  3EGD C;  2MJ6 A;  1XJ2 A;  2GZA A;  2VEA A;  3C30 A;  3LI9 A;  3PBT A;  2ZMF A;  4GHI A;  2JKR M;  4NXE A;  4IUH A;  4K08 A;  3HJK A;  5J4E A;  5DF9 A;  2NUP C;  2M1C A;  4B93 A;  2BAS A;  4MCW A;  1NRJ A;  1IOU A;  2HGV A;  3ZQ5 A;  2OAQ 1;  2JHE A;  3CUE A;  4L0L A;  1LSV A;  3LR4 A;  2P7J A;  5AVF A;  4LRZ E;  2EWW A;  4LRY C;  4NXB A;  3OC2 A;  1XFQ A;  1T1A A;  2VLG A;  5AVE A;  3U2A A;  4FSF A;  4KUK A;  3UB6 A;  5HWW A;  3RTY A;  2PYR A;  1EW0 A;  4EQ1 A;  2YKH A;  2GJ3 A;  4MN5 A;  1UGU A;  2WKR A;  2K31 A;  2PHY A;  4EET B;  4WL9 A;  3G6O A;  4WUJ A;  1YAX A;  3E4O A;  4RQ9 A;  3CUE C;  1LSW A;  3LIA A;  2O0Y A;  3LIC A;  3KSH A;  3CAX A;  2P08 A;  5A8B A;  4OOM A;  5DFY A;  3F1P A;  2OWJ A;  2OOL A;  3MXQ A;  5I5L A;  3OCL A;  3LI8 A;  3PBQ A;  4Q0J A;  3IS2 A;  3MQ0 A;  3MJQ A;  4WEK A;  2J80 A;  2M7U A;  3EQU A;  3LR5 A;  4MN6 A;  4CLC D;  2FZ0 A;  2XA7 M;  5F5Y A;  5F6A A;  4QPR A;  1F9I A;  1D7E A;  4R3A A;  5G4Z A;  3E4P A;  3R7W B;  3MR0 A;  5DJU A;  3V67 A;  2HJ9 C;  1S66 L;  4WN5 A;  3ZYT A;  5J7E A;  3H82 B;  5TBM B;  3UE3 A;  3S7O A;  4GHI B;  2K2N A;  4KQD A;  1DP8 A;  5DKK A;  2P04 A;  5IU1 A;  3TRC A;  1GSX A;  1TF1 A;  3LIF A;  2QJ5 A;  2O9C A;  4Y5F A;  2VJW A;  3O5Y A;  1JNU A;  3CIT A;  4KQO A;  3IBJ A;  3ICY A;  3K2N A;  5AJG A;  4HHD A;  3C38 A;  1G6O A;  1V9Z A;  4ARZ B;  5HWV A;  2GNX A;  1XFN A;  4H6J B;  4HI4 A;  1XJ3 A;  5DKL A;  4OOL A;  3UB7 A;  2W3E A;  4MMN A;  3BWL A;  3K3D A;  3KO6 A;  2B02 A;  3CI6 A;  2V1B A;  4ZRR A;  5KSH A;  1OJG A;  3MFX A;  2LB5 A;  1LL8 A;  2D02 A;  4HP9 A;  5IS1 A;  3JVV A;  1OT6 A;  1OTA A;  5HDD A;  1OTD A;  4DJ3 A;  3TJZ C;  3E0Y A;  5LBR A;  4PHT A;  1P9R A;  4HJ4 A;  4G3W A;  5KIZ A;  1N9N A;  1OTB A;  2HF6 A;  4I39 A;  1GSW A;  3UMD A;  3LID A;  4EES A;  4I5S A;  1KOU A;  3GEC A;  5HPI A;  4CQH A;  4HJ3 A;  3F1P B;  4L9F A;  4ETZ A;  5FL3 A;  3T4Q A;  1S4R A;  4HY8 A;  2W27 A;  2ZMV A;  2H28 A;  1MKM A;  2JKT I;  5F69 A;  2ZOH A;  2KDK A;  2W3H A;  5IT5 A;  2QKP A;  4NEE D;  1T18 A;  4HJ6 A;  3BW6 A;  2O99 A;  2W1R A;  2ZBB A;  3MQO A;  1T1C A;  5G4Y A;  2PR5 A;  3F1O B;  3P01 A;  2VX8 A;  3ULF A;  4HNB A;  3C8C A;  1YSP A;  2JKR I;  2VV6 A;  3KSG A;  3KSI A;  5TBM A;  4P6Z M;  3P7N A;  4F3L B;  2K7S A;  1OTI A;  2QJ7 A;  5DJT A;  2VGL M;  4EU0 A;  2WKQ A;  3H7W B;  3EQV A;  1STZ A;  3BJN A;  2B18 A;  3MQQ A;  4PKY A;  4F3L A;  2W3D A;  3S7Q A;  1TS0 A;  3T4O A;  1YKD A;  2VA0 A;  1ODV A;  2W0N A;  4DJ2 A;  2D01 A;  4HQA A;  3EOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...