4UQIS

Ap2 controls clathrin polymerization with a membrane-activated switch
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
publication title Clathrin Adaptors. Ap2 Controls Clathrin Polymerization with a Membrane-Activated Switch.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 49
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4uqiS00
2XA7S 2XA7M 2HF6A 5MC7A 4NEED 2VGLS 1W63M 1W63Q 2JKRI 4UQIS 2VGLM 2JKTI 4UQIM 3TJZC 1NRJA 4P6ZS 2JKRM 4P6ZM 2JKTM 2FH5A
chains in the Genus database with same CATH superfamily
4O01A 4QHCA 2QKPA 4JPMA 5TBMB 2J80A 5DTKA 3VOZA 3QP2A 4X25A 5GLCA 4GZBA 3HLBA 5CHJA 4JGPA 1XGIA 3DAVA 2EFUA 3AGFA 4ZAMA 4FCFA 2V2FF 3NIAA 5TGFA 2VGJA 3FZCA 2OLVA 1PFLA 1L0DA 1BLSA 5G4ZA 4HH2A 5MC7A 5E2FA 4FD8A 3D3OA 3UDIA 4KQDA 1GSWA 3TJZC 4IEDA 4QU3A 1K4FA 5AQBA 3E4OA 3UE3A 1P0ZA 4YWZA 1F9IA 3RTYA 1LSXA 5I5LA 1OTDA 4GDBA 1PI4A 3EWKA 3SH8A 1VETA 4OH0A 2KDKA 3GTCA 1OT6A 1CI8A 1XJ4A 3KSFA 4WMCA 5HWTA 4LV3A 1CF0A 4I3IA 4QY5A 4JXWA 4WZ5A 3IX3A 3GSGA 4ZDXA 1L0GA 1H8MA 1OT9A 4MBKA 1L2SA 3SW1A 2EX8A 4OOLA 2WKPA 1BSGA 3HLGA 5HD5A 3MF0A 4R3BA 4DN0A 1SCWA 3UE0A 5FASA 3T4JA 3HREA 3WRTA 3E4QA 5AVFA 4DMZA 4LFUA 4Y0TA 3DWZA 3V50A 4IBXA 4ZRRA 3VE3A 4X1MA 4Y2FA 4B4ZA 3HVFA 1YLPA 5GHXA 4DE1A 4OOMA 3FPWA 4NETA 4R3AA 4FUWA 5HZHA 2Y2PA 4CLCD 3EEHA 4EESA 3DTIA 4I3JA 1XXMA 4BBUA 1K57A 3CI6A 3UB6A 5HX9A 2JN7A 4UHUA 4E3IA 1C3BA 1J9MA 4RX2A 2CMNA 3OC2A 2J8YA 4KZ3A 5CGXA 3PAGA 1X0OA 2Y2OA 3BWLA 4NXBA 3F1NA 5EUAA 2PAVP 4MBHA 4YOFA 1FSWA 1I2WA 1TDLA 3WS5A 3MZEA 3IWOA 3VMAA 1ES3A 4XUXA 1K6SA 4PKYG 1ZG4A 2Y8HA 2XR0A 4R3JA 5DTSA 4GLQA 2XK1A 3LR4A 5A92A 3UB7A 2ZMAA 3MXSA 2W1TB 3GECA 1CQAA 1XA7A 5HPIA 3A3DA 3FYZA 1CI9A 3EQUA 5FAQA 3PHYA 4OP5A 4E3JA 4EUZA 1W7FA 3LEZA 3C4OA 1WYCA 5FI2A 2VZWA 1YSPA 5FQMA 2A49A 5HFOA 4BD0A 4H6JB 1ODVA 1BUEA 3M2JA 4KZ8A 5CHMA 5FDSA 3BJNA 1IFQA 2GJ3A 2J9PA 2V0WA 3LGOA 4MN7A 4S2OA 3T4QA 1YLZA 1MWUA 3KSIA 3NC8A 4S2JA 1NRFA 1EROA 5J8XA 3ZHHA 1PW1A 3BY8A 2JKRM 2EX2A 3PXPA 2XA7S 1YLWA 3BFEA 4HP9A 2OV5A 3W2ZA 1SKOB 1BULA 4S2LA 4WEKA 4IJGA 4S2NC 4ETZA 2XSSA 3A3JA 2ZC5B 2VGLS 4KG5A 5EVIB 1S6RA 3OPHA 4ZJ2A 5LBRA 5TR7A 2BLSA 3DTEA 5C5KA 3ZFZA 4L9GA 2QMIA 2WAEA 3LR0A 1QMEA 3MZFA 1XPBA 3NHQA 3NECA 3LY4A 1N9LA 3AGDA 1WE4A 4WLAA 4G3WA 3SS4A 4CJNA 3CZDA 1QMFA 3MR0A 3T1RA 2X71A 2QJ7A 3F1PA 3LO7A 3N4IA 1CJFA 2YKFA 2V9AA 4GW9A 1K4EA 4KENB 1BLHA 4IVKA 1F98A 2FZ0A 1SKFA 3LUQA 4KUKA 2K2NA 4CPKA 4HOIA 2ZMFA 2C6WB 3DW0A 5TBMA 3LY3A 3CITA 2A24B 1WYBA 2OOLA 3O87A 1K25A 1IYSA 4UA7A 4FOFA 1PRQA 2INWA 3BY9A 2ZM0A 1FCOA 2I72A 1E3UD 1NZOA 4MCWA 5HD3A 4P0MA 1OJ5A 2WK0A 1YSQA 4JF5A 2HGVA 1KDWA 5IS1A 3QP5A 4JGQA 4GD6A 1K55A 1T19A 2EXBA 5JYPA 4ZTKA 1NZUA 1NYMA 4WYYA 5L8MA 4WEJA 3T1QB 1Y4OA 1FR1A 3BECA 4O0PA 4R38A 2ZQCA 2X02A 1LL8A 1S1ZA 4S2KA 1FILA 2UWXA 3ZVTA 2ZM2A 2P74A 3MFDA 5F69A 3SH9A 3EOIA 5EFWA 1N9BA 4FTXA 1YMXA 3N6IA 4RQ9A 3S4XA 3ULFA 2GDNA 2ZQDA 4HH3A 3VP3A 1PNEA 4HEFA 3UN7A 3ZG7B 5FDHA 5GHZA 1MBLA 3H7WB 2VV7A 5FQKA 4EWFA 5FAPA 1GSXA 2J9OA 4L9FA 2QZ6A 2CC1A 2ZL1B 3VSLA 4PAUA 1KVMA 3QHYA 2ZQ9A 3A3FA 4P6BA 5KSHA 3NULA 4D60A 3OCNA 4EU0A 2W3FA 3KSHA 4BQMA 3UPPA 1S1YA 2EFXA 2QPNA 3S7PA 3BLMA 3W4PA 2P04A 3LFVA 4KZ7A 4DE2A 2ZC7A 1S0WA 4OONA 4EEUA 1BLCA 4PM8A 5E43A 4PMAA 3CWFA 1S4SA 4K91A 3TW8A 4R4SA 3RFBA 3TOIA 1VB6A 1F2KA 3B47A 1KE4A 5A91A 4M3KA 4YNRA 4M4XA 2WYXA 1I2SA 1A0KA 4E6WA 2PYPA 4IUKA 1GHPA 1VEUB 2W0NA 1K38A 1XFQA 4X56A 2W1TA 3ZYTA 2Y2GA 1NXYA 3ISGA 4KQRA 4CLCC 4GKUA 5DJTA 5CX7A 2E8IA 3WRZA 4NG2A 5EV0A 5HARA 3T4LA 3W8KA 2WKQA 2W3EA 2GZAA 3IS2B 3JVUA 5EVLA 3JYIA 4KG2A 3C30A 1H8YA 2VA0A 1K57C 3WS2A 4H6JA 1PW8A 4NXFA 3S7NA 2VJWA 1LT0A 4X6TA 4ME4A 4QPRA 2JKRI 5EM0A 3FPVA 4OOYA 1NYYA 4IBRA 1MKMA 1HTZA 2NUTC 5CHUA 1DJCA 5M19A 4UA6A 2IWBA 3UE6A 3BFFA 5CTNA 3BFCA 4DE0A 1CEGA 4BD1A 4Y3IA 2QJ5A 4HJ4A 3T4SA 1HLUP 1SKOA 4D2OA 2EWWA 2W1RA 4OVDA 4BL2A 2IA2A 5L07A 4JGOA 1FSYA 1TS7A 1SHVA 5EVIA 2B95A 4C3QA 3IHAA 4BMWA 3BYDA 2KX6A 1NJ4A 5EVID 4EUVA 4LRZE 4OPRA 5EM1A 4F3LB 1EI5A 5DJUA 4HHDA 5I94A 3PAEA 2EA9A 1G6OA 3IF5A 2PR5A 3G6OA 1ZHHB 1D1JA 4X69A 1TD5A 3VP1A 2XA7M 3LR3A 1P97A 1KE0A 3OPRA 2WKIA 3IWQA 3BFDA 2VGLM 4ZJ1A 3L7HA 1W79A 3VP2A 4MN5A 3VP0A 2Q9NA 4B93A 2KOIA 1XJ6A 4Z1WA 5FI6A 1G68A 2O9BA 3NJAA 2ZQAA 4JGRA 3FKVA 4GN2A 2HF6A 3MJQA 2A24A 3WS4A 3G35A 4KQQA 2WKRA 3FV7A 3SZTA 5HSQA 1H3QA 3NOPC 2FFYA 1L0FA 2OLUA 4WMCD 1XA1A 1UGUA 3OZHA 5FQJA 3NDEA 2Y55A 2Y2LA 3ZDJA 5EE8A 5FQ9A 2HV1A 4R23A 5L10A 2QHKA 1U60A 1L0EA 1ONHA 4JLFA 5FATA 4G3KA 1TS0A 1GA9A 3G34A 2P08A 1SDNA 1ZTUA 2D02A 4EERA 1LL9A 4HBUA 1T1BA 1YPRA 4GD8A 2RCXA 1KE3A 5KZHA 2B18A 2WGVA 4LENA 5L2FA 4UAAA 3IXDA 2G2UA 1TDGA 1ES5A 3HJIA 1G5UA 4OPQA 2Z6DA 3LIFA 1PWDA 2ZBBA 3M2KA 3IXGA 1XP4A 4BL3A 5HL1A 3LYXA 4E04A 2W3HA 4QD4A 4GCZA 1N9NA 4U3TA 4HESA 3O5YA 4Y7PA 3V39A 3S7QA 5EVEA 3H7WA 1J3WA 2Q0OA 3VP4A 2ZQ7A 3N7WA 1OTEA 3G30A 2JC7A 5BOHA 1PIOA 2W3DA 3UY6A 4JXGA 2JKTM 5EECA 3BQ8A 3K2NA 2ZL1A 3NDGA 1K55C 3MS6A 3IF6C 2PHYA 3C2WA 2DCFA 1MC0A 3IQAA 4Y15A 2PU4A 4JF4A 4YINA 5KMWA 4OQIA 3T50A 3BM6A 5HAPA 4DJ3A 2KLIA 5HWVA 3C4PA 3MSHA 2PR6A 3BQAA 3Q7VB 1H5XA 4ID4A 4XXRA 3ZG5A 3U2AA 2A3UA 3CMZA 3RH8B 1DP9A 1GHIA 2P7JA 5DF9A 3P98A 5EPHA 3VOYA 2FH5A 2WKEA 2WGIA 2XF3A 5DF7A 4KG6A 4R70A 1XFNA 2OAQ1 2RL3A 4IHQA 3P01A 1OTAA 4BENA 3ZGAB 5HDCA 1XGJA 4NEED 1IELA 5E2EA 2O9AA 3DBAA 1VEUA 4GB7A 4GHIA 3FC7A 4F94A 5J3WA 5U47A 3NOTC 3SH7A 1HZOA 1DJBA 2EWVA 3MXQA 4MMNA 3E98A 2YKHA 3IS2A 3LI9A 1NLYA 4OPYA 3BW6A 2O0YA 3G32A 5J7EA 4KZBA 1UWNX 1IOUA 5GLBA 4BJPA 4BLMA 1CK3A 4X53A 2J7VA 4KZ5A 1LSWA 2Y2MA 4GS9B 1OPXA 4NXGA 2XH9A 2DRWA 5HWWA 3V3SA 3UB5P 2VEAA 3RJUA 4EETB 3V3RA 1LI9A 3NOUC 4LRXC 3A0RA 4XUZA 1PZOA 2Y4AA 1ES4A 3L9KA 2NUPC 4EW7A 3K3DA 4E3LA 5DKKA 1PYYA 1JTDA 1VQQA 2WAFA 3I7JA 3LICA 2PRFA 3V5MA 4XT2B 3NBLA 1K6RA 5CRFA 3GMWA 4K0WA 2JE5A 4F3LA 4Y17A 1BLPA 4WF0A 3WWXA 5E2HA 3PYPA 4N1XA 2PBYA 4DJ2A 5FEFA 4N1HA 5GL9A 4NK3A 2ZLYA 3C7UA 2M1CA 5CGWA 2GX5A 5K5BA 1Q2PA 2VV8A 2HDUA 2HZ5A 3D72A 2D01A 2W27A 1F5MA 3HLWA 3VFFA 3GR2A 5HPFA 1XJ2A 2MJ6A 4AFIA 3CPTB 2WUQA 2Y2KA 3D4FA 3OCLA 5HDDA 3PBTA 4JXSA 1MZUA 3A0VA 2V1BA 4O8GA 3LIEA 4GJ4A 4C6YA 4EQ1A 3WS0A 3UPOA 5FEGA 2L1MA 3VE4A 3O86A 3Q1FA 5EVIC 3LCEA 1Z6FA 1IKIA 2EX6A 3PBQA 3MQ0A 3C5AA 4CLCB 4WM9A 3FKWA 3G2YA 3B33A 4DDYA 3IWIA 1WA9A 3HUNA 3MXRA 1E25A 3HL9A 4WUJA 1ERMA 1KVLA 4RA7A 5M1AA 1ZC2A 2ACGA 3UO9A 3KSGA 4PHTA 3EGXC 3UMEA 4PM5A 1ZKJA 4Y0OA 1MWRA 3LIBA 3R7WB 3UDFA 1N4OA 1K0KA 2K31A 3HCYA 5EOOA 4MEZA 5A8BA 5FQQA 4JKTA 2R9XA 4MN6A 4JXVA 4A5RA 2HP6A 1RGZA 2E8JA 3LI8A 1JWPA 1G28A 4WZ5C 5KIZA 3P7NA 5CERA 1OTBA 3N8SA 1K54A 3O3VA 4E6XA 5FI7A 4LLOB 3S7OA 4Q8IA 2HDRA 5HAQA 4UQIS 3B3XA 1FCMA 1DY6A 4GNUA 2XRNA 1IYPA 2H0YA 3ICYA 4GDNA 4QB8A 2DNSA 3N8RA 2Q9MA 4X55A 3UB9A 1JTGA 3T1SA 4GHIB 3LIDA 4E3NA 1MXOA 2JBFA 4KZ9A 3C8CA 2Y2JA 1OJGA 1NY0A 1Q2QA 3N8LA 2HPBA 1KGGA 3Q7VA 4E3OA 2H10A 2HJEA 1I5QA 2BTFP 2W3GA 4OQ0A 5F68A 2XROA 4PKYA 1RP5A 1IYOA 2AVXA 1FR6A 5A93A 1ZG6A 3GRJA 2HDSA 5AQ9A 3CUEA 1JWZA 1T18A 3RXWA 2JKFA 4IVIA 1KGEA 3TE8A 1KGFA 3G2ZA 3DTKA 3SS5A 2ZOIA 3PR6A 5IT5A 3S22A 3P09A 3NCKA 5TFQA 4DKIA 4K08A 5HAIA 3JVVA 1Y28A 2J3WA 3G4PA 3QNBA 3OPLA 4C75A 2VV6A 3H82A 2V20A 4ESPA 2C5WB 3OBFA 3FG8A 2HJ9C 4N9LA 2UV0E 4DXCA 3HJKA 2M7VA 4HQAA 3ZNTA 3VV4A 2Z2LB 1TS6A 2ZQ8A 4LGWA 3HLDA 3ITBA 2XD5A 2VGKA 4LPZA 5FL3A 4GS9A 3A3EA 5A90A 3Q82A 2PU2A 2Z2MB 2XD1A 3LEQA 1ONGA 1S66L 2Y91A 3HLEA 4EBNA 2L4RA 2PD8A 3BFGA 3KYQA 1H8ZA 3T12B 1ALQA 4JF6A 2Z6CA 4OKPA 2VLGA 1M40A 1NRJA 3UE1A 1PWCA 4U0TA 3QP4A 5FSRA 4EBLA 2ZD8A 3CHWP 2XFTA 4X1LA 4XT2A 3WS1A 4LV1A 4I5SA 4Z9QA 3HUMA 3EEAA 2H28A 4PM7A 3T4TA 3DTMA 2VK3A 3O88A 3UNWA 5JYOA 3CJMA 2G2WA 4S2MA 2WADA 3IF6B 1STZA 4OLDA 3IH8A 2OSUA 4FH2A 3S1YA 4EV4A 1LL5A 1YKDA 3RXXA 3M6BA 3FWLA 2ZMVA 2G7UA 3T4KA 3IHBA 1VHMA 1NWZA 3CPTA 5TJJA 1XJ3A 3ZVWA 1BZAA 4O7DA 2O9CA 5DF8A 5HL6A 2J3TD 5CECA 3IBJA 3SS3A 4B4XA 4BWIA 1YQSA 2H5SA 2OAP1 3KYEA 4WBGA 4N9KA 2Y79A 1OTIA 3PBRA 1H0MA 1O7EA 2XDMA 3VSKA 2Y2QA 3E4PA 4CLCA 3V67A 2OWHA 1MKIA 1P9WA 3H9WA 2JHEA 3GVBA 1HVBA 1KOUA 1YM1A 3Q7ZA 2HP5A 3Q81A 4Q0HA 4MNRA 4P6ZS 2Y2NA 4Q0JA 1IYQA 1SZVA 2DMWA 4L0LA 2EX9A 1FOFA 2V8CA 2WGWB 1MPLA 4KZ4A 3AGEA 1GHMA 1JNUA 3R7WA 5CTMA 2B02A 5GHYA 4R6LA 3U4LP 4CQHA 4S2IA 4HIAA 3MKEA 3R4KA 4OPZA 3BEBA 5D3OA 4B9OA 3IXHA 3QP6A 2GNXA 2V1ZA 2PT7A 4R0QA 3GDIA 1XKZA 4MLLA 2QYBA 4E3MA 5GLDA 1V9ZA 1W63M 3K3CA 1KDSA 4N92A 5M18A 2ZC4B 4OQGA 4PM6A 4DE3A 1IKGA 1ES2A 3MQOA 4ZBEA 1YT4A 4OP8A 5F1GA 2Y2IA 3G31A 4EXOA 5CEBA 1MY8A 3ZQ5A 4P87A 1T1CA 4WN5A 3OOVA 1TEMA 5AQ7A 4FSFA 1FQGA 3TG9A 2PD7A 1OMEA 1G6AA 3HBRA 1D06A 3IXBA 2O99A 3H82B 4I3AA 3MFXA 2ZC3B 1TVFA 4ARZB 5DFXA 3QP1A 2X01A 2P9VB 1EW0A 1DP8A 1LSVA 3A0SA 3B42A 4UQIM 2VKSA 3E2LA 1Z09A 2R9WA 4QY6A 1MWSA 5F1FA 3F1OB 3MMHA 5CXWA 1K56A 1K54C 4U0XA 3T4OA 4E3KA 3UMDA 2WKHA 4II7A 2ZOHA 1GA0A 1LI0A 4QJGA 1PZPA 1K56D 4I38A 4DRTA 1W8QA 4GOGA 3W4QA 3ZG8B 3E0YA 3MKFA 3M6HA 4JBFA 4Y13A 1ESUA 2V0UA 2XQZA 3C38A 3MBZA 4OQHA 4X68A 3IH9A 3QP8A 2JKGA 4KQOA 5DKLA 4KUOA 1DRMA 1W5DA 4IUHA 2ZM8A 4ETXA 1SDEA 2XLNA 1N9OA 1XX2A 5CEDA 4QWOA 4RYEA 4EEPA 4DF6A 2JCHA 3CUEC 2ZC6B 1VETB 2OWJA 3VFHA 4ZJ3A 3CAXA 4DXBA 5AJGA 5IU1A 5DTTA 3LIAA 1E3UA 3EGDC 4MDZA 1AXBA 1CEFA 2EXAA 3NI9A 4WL9A 4Y5FA 1VM1A 2QWSA 2Y2HA 2BG1A 4G3VA 3BRMA 3TSGA 1DP6A 1PWGA 2PDRA 3C7VA 3LR5A 4I39A 3IT9A 4MBFA 4HY8A 1GSVA 3IF6A 2IWCA 4KZ6A 1YLYA 2V8FA 1TF1A 2BASA 5FQIA 3EQVA 3VOLA 1RGYA 2PYRA 1FCNA 5F83A 1YMSA 3SOIA 3DWKA 1JVJA 4HJ3A 5J4EA 3PBSA 1JWVA 4NKPA 4BBVA 3IX4A 3QNCA 1ACFA 5E2GA 3UPNA 3BLSA 3ZNYA 1YAXA 4LCMA 1D7EA 3UB8A 3CG5A 1L3LA 1S4RA 4BBTA 2R78A 5F6AA 3JPUA 3F1NB 4B88A 1LHYA 1LLBA 4P85A 3A3IA 2K7SA 3UDXA 3ITAA 1V9YA 5G18A 4LCLA 1GCEA 2JKTI 1YLJA 5GLAA 2XFSA 3KYZA 2IWDA 3PBNA 5CGSA 4H8RA 2B5RA 4KZAA 4FH4A 3GV9A 2FFFB 2A2LA 4S2NA 3CLOA 2LB9A 3PBOA 3IBRA 5KSCA 2H0TA 3HUOA 3HLFA 2WGWA 4DDSA 4L9EA 1ERQA 3GQZA 1EWZA 3TRCA 3PTEA 2J3TC 4RVAA 1PI5A 2ZJ9A 2XEPA 4UA9A 1M6KA 5AQAA 3KO6A 4UEYA 4EQIA 1NLZA 3Q07A 4R1GA 4EBPA 4HP4A 3E2KA 4WZ4A 1FIKA 3IX8A 1BT5A 4OLGA 4LV0A 2L0WA 3OPPA 1UWPX 4P6ZM 4PM9A 2M7UA 4HJ6A 4NXEA 1MWTA 5HDSA 5L09A 3OLOA 5IHVA 2HP9A 1W8YA 1TS8A 1W63Q 4K0XA 4LRYC 4HI4A 1BTLA 2V1AA 3W4OA 3MQQA 2XGNA 1AWIA 4S2PA 3NY4A 3MZDA 4YFMA 3KX0X 4CLCE 2VX8A 4LV2A 3ZG9B 4HBTA 4Q0IA 5DFYA 4ARZA 1P9RA 5F82A 4HNBA 1ESIA 2P9VA 4WELA 3HLCA 5FAOA 4Y0UA 1Y54A 1YLTA 5DVAA 2WZXA 5EOEA 5AVEA 4PPRA 3ZCZA 3ZG0A 1HD8A 1RCJA 1E4DA 2LB5A 3F1PB 3T1XA 5F5YA 3F1OA 4R4RA 1IEMA 1DJAA 1T1AA 3D9YA 1BYWA 5FA7A 2PBDP 5HW3A 1O07A 2WZZA 2HDQA 5G4YA 4RX3A 2Y59A 2I9VA 1S67L
chains in the Genus database with same CATH topology
4O01A 5KSHA 2QKPA 3OCNA 4EU0A 2W3FA 3KSHA 5TBMB 2J80A 5DKKA 1JNUA 1S1YA 3R7WA 3LICA 3S7PA 2B02A 4R6LA 4JGPA 2P04A 3LFVA 4CQHA 4XT2B 4HIAA 3R4KA 4F3LA 4B9OA 4EEUA 2GNXA 2PT7A 4WF0A 3CWFA 3GDIA 1S4SA 2QYBA 5G4ZA 4HH2A 3TW8A 3RFBA 3PYPA 5MC7A 1VB6A 4DJ2A 3B47A 4L0LA 1V9ZA 1W63M 4YNRA 3K3CA 3D3OA 2M1CA 2GX5A 5K5BA 4KQDA 1GSWA 4M4XA 3TJZC 2VV8A 3UE3A 3E4OA 1P0ZA 4YWZA 1F9IA 3D72A 2PYPA 2D01A 2W27A 3RTYA 1LSXA 4IUKA 3MQOA 5I5LA 1F5MA 1OTDA 5HPFA 1XJ2A 2MJ6A 3EWKA 2KDKA 4AFIA 2W0NA 1XFQA 1OT6A 2W1TA 1XJ4A 3ZYTA 4EXOA 3KSFA 3OCLA 5HDDA 3PBTA 5HWTA 4CLCC 5DJTA 5CX7A 1MZUA 3ZQ5A 4I3IA 3A0VA 2V1BA 1T1CA 4O8GA 3T4LA 4WN5A 3OOVA 2WKQA 2W3EA 3LIEA 4FSFA 1H8MA 1OT9A 4GJ4A 2GZAA 2PD7A 4EQ1A 3SW1A 3IS2B 3JVUA 1D06A 3C30A 2O99A 2L1MA 3VE4A 2VA0A 3H82B 4I3AA 3MFXA 4OOLA 2WKPA 4H6JA 4NXFA 3S7NA 4ARZB 5DFXA 2VJWA 5HD5A 3MF0A 1LT0A 1EW0A 1DP8A 3PBQA 4ME4A 4QPRA 1LSVA 4DN0A 2JKRI 3A0SA 3B42A 3FPVA 3MQ0A 4UQIM 3T4JA 3E4QA 2VKSA 4CLCB 1MKMA 5AVFA 4DMZA 2NUTC 4ZRRA 3B33A 3VE3A 4Y2FA 3UE6A 1WA9A 3F1OB 3MMHA 4OOMA 3FPWA 4WUJA 3T4OA 4R3AA 3UMDA 5HZHA 4II7A 2ZOHA 4Y3IA 2QJ5A 4CLCD 4I38A 3KSGA 4HJ4A 3T4SA 4PHTA 3EEHA 3EGXC 4EESA 2EWWA 2W1RA 3UMEA 2IA2A 4I3JA 4BBUA 3E0YA 1TS7A 3LIBA 4JGOA 3CI6A 3R7WB 3UB6A 2K31A 3HCYA 5A8BA 2JN7A 4BMWA 2KX6A 4MN6A 4EUVA 4LRZE 2CMNA 3OC2A 2V0UA 3C38A 4F3LB 1X0OA 3BWLA 4NXBA 4HHDA 5DJUA 3F1NA 3LI8A 4YOFA 2EA9A 1G28A 1G6OA 4KQOA 5DKLA 4KUOA 2PR5A 3G6OA 5KIZA 1DRMA 1ZHHB 3P7NA 1OTBA 4IUHA 1TD5A 4ETXA 2XA7M 4PKYG 3LR3A 4LLOB 2Y8HA 1N9OA 3S7OA 1P97A 4GLQA 4EEPA 3LR4A 3CUEC 4UQIS 2VGLM 2OWJA 3UB7A 2XRNA 3CAXA 4MN5A 5AJGA 2W1TB 3ICYA 3GECA 5IU1A 4B93A 2KOIA 1XJ6A 3LIAA 4Z1WA 5HPIA 2O9BA 3NJAA 3EQUA 3EGDC 4JGRA 4MDZA 3UB9A 3PHYA 2HF6A 3MJQA 2A24A 4GHIB 4WL9A 3LIDA 2WKRA 4Y5FA 5HSQA 1H3QA 3NOPC 3C8CA 1OJGA 2QWSA 2VZWA 1YSPA 4G3VA 1UGUA 4H6JB 1DP6A 1ODVA 2PDRA 2HJEA 3LR5A 4I39A 2W3GA 5F68A 2XROA 3BJNA 4PKYA 1IFQA 2GJ3A 4HY8A 2V0WA 4MN7A 1GSVA 2HV1A 2QHKA 3T4QA 1TF1A 2BASA 3CUEA 3EQVA 1T18A 3VOLA 3KSIA 4G3KA 1TS0A 2PYRA 3TE8A 2P08A 2ZOIA 3PR6A 4HJ3A 1ZTUA 2D02A 3BY8A 4EERA 5IT5A 5J4EA 2JKRM 3PBSA 3PXPA 4K08A 3JVVA 2XA7S 4NKPA 1Y28A 4BBVA 2J3WA 4HP9A 3W2ZA 1T1BA 2VV6A 2B18A 4WEKA 4IJGA 3H82A 2XSSA 1YAXA 4ETZA 2VGLS 1D7EA 3UB8A 3OBFA 3FG8A 2HJ9C 3HJIA 1S4RA 4BBTA 5LBRA 3HJKA 5C5KA 2M7VA 4HQAA 2Z6DA 3LIFA 3VV4A 4L9GA 2R78A 5F6AA 2ZBBA 1TS6A 3F1NB 3LR0A 3LYXA 4E04A 2W3HA 3NHQA 2K7SA 4GCZA 1N9NA 1V9YA 1N9LA 4LPZA 3O5YA 5FL3A 4WLAA 4GS9A 3S7QA 4G3WA 2JKTI 3H7WA 3MR0A 3KYZA 1OTEA 3PBNA 2QJ7A 2W3DA 3F1PA 2JKTM 1S66L 2V9AA 2YKFA 3BQ8A 4GW9A 3K2NA 2A2LA 1F98A 2FZ0A 3CLOA 2L4RA 2LB9A 2PD8A 3PBOA 3IBRA 3KYQA 2PHYA 3LUQA 4KUKA 2K2NA 4HOIA 3C2WA 2ZMFA 2Z6CA 4L9EA 1MC0A 5TBMA 2VLGA 1NRJA 3CITA 2A24B 3TRCA 2OOLA 2J3TC 3T50A 4FOFA 2INWA 3BY9A 4DJ3A 2KLIA 4XT2A 3KO6A 5HWVA 4I5SA 4UEYA 1NLZA 2PR6A 3EEAA 2H28A 3BQAA 3T4TA 4MCWA 4HP4A 5HD3A 3U2AA 1OJ5A 1YSQA 3RH8B 2HGVA 1DP9A 2L0WA 1STZA 1UWPX 2P7JA 4P6ZM 5DF9A 5IS1A 2M7UA 4HJ6A 2FH5A 4JGQA 4NXEA 1T19A 4R70A 5HDSA 1XFNA 2OAQ1 1YKDA 4IHQA 3P01A 3OLOA 1OTAA 5HDCA 4NEED 5L8MA 2ZMVA 2G7UA 4WEJA 1TS8A 1W63Q 3T4KA 2O9AA 1VHMA 3DBAA 1NWZA 5TJJA 4O0PA 4LRYC 4R38A 1XJ3A 4GHIA 1LL8A 1S1ZA 3FC7A 4HI4A 2O9CA 2V1AA 5J3WA 5HL6A 3MQQA 3NOTC 2J3TD 2EWVA 3MXQA 4MMNA 3IBJA 3KX0X 4CLCE 3E98A 5F69A 4BWIA 2YKHA 3IS2A 3LI9A 2VX8A 1NLYA 2OAP1 3BW6A 2O0YA 3EOIA 5EFWA 5J7EA 4Q0IA 5DFYA 4ARZA 2Y79A 1OTIA 1UWNX 3PBRA 1P9RA 4RQ9A 3ULFA 4HNBA 1IOUA 4HH3A 4WELA 4BJPA 5AVEA 1LSWA 4GS9B 1OPXA 4NXGA 3E4PA 4CLCA 3H7WB 3V67A 2VV7A 2OWHA 2LB5A 1P9WA 3H9WA 5HWWA 2JHEA 3F1PB 1GSXA 2VEAA 4L9FA 5F5YA 4EETB 1KOUA 3F1OA 3NOUC 4LRXC 3A0RA 4Q0HA 1T1AA 4P6ZS 4Q0JA 1BYWA 4PAUA 2DMWA 2NUPC 4EW7A 5G4YA 3K3DA 2I9VA 1S67L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XA7 S;  2XA7 M;  2HF6 A;  5MC7 A;  4NEE D;  2VGL S;  1W63 M;  1W63 Q;  2JKR I;  4UQI S;  2VGL M;  2JKT I;  4UQI M;  3TJZ C;  1NRJ A;  4P6Z S;  2JKR M;  4P6Z M;  2JKT M;  2FH5 A; 
#chains in the Genus database with same CATH topology
 4O01 A;  4QHC A;  2QKP A;  4JPM A;  5TBM B;  2J80 A;  5DTK A;  3VOZ A;  3QP2 A;  4X25 A;  5GLC A;  4GZB A;  3HLB A;  5CHJ A;  4JGP A;  1XGI A;  3DAV A;  2EFU A;  3AGF A;  4ZAM A;  4FCF A;  2V2F F;  3NIA A;  5TGF A;  2VGJ A;  3FZC A;  2OLV A;  1PFL A;  1L0D A;  1BLS A;  5G4Z A;  4HH2 A;  5MC7 A;  5E2F A;  4FD8 A;  3D3O A;  3UDI A;  4KQD A;  1GSW A;  3TJZ C;  4IED A;  4QU3 A;  1K4F A;  5AQB A;  3E4O A;  3UE3 A;  1P0Z A;  4YWZ A;  1F9I A;  3RTY A;  1LSX A;  5I5L A;  1OTD A;  4GDB A;  1PI4 A;  3EWK A;  3SH8 A;  1VET A;  4OH0 A;  2KDK A;  3GTC A;  1OT6 A;  1CI8 A;  1XJ4 A;  3KSF A;  4WMC A;  5HWT A;  4LV3 A;  1CF0 A;  4I3I A;  4QY5 A;  4JXW A;  4WZ5 A;  3IX3 A;  3GSG A;  4ZDX A;  1L0G A;  1H8M A;  1OT9 A;  4MBK A;  1L2S A;  3SW1 A;  2EX8 A;  4OOL A;  2WKP A;  1BSG A;  3HLG A;  5HD5 A;  3MF0 A;  4R3B A;  4DN0 A;  1SCW A;  3UE0 A;  5FAS A;  3T4J A;  3HRE A;  3WRT A;  3E4Q A;  5AVF A;  4DMZ A;  4LFU A;  4Y0T A;  3DWZ A;  3V50 A;  4IBX A;  4ZRR A;  3VE3 A;  4X1M A;  4Y2F A;  4B4Z A;  3HVF A;  1YLP A;  5GHX A;  4DE1 A;  4OOM A;  3FPW A;  4NET A;  4R3A A;  4FUW A;  5HZH A;  2Y2P A;  4CLC D;  3EEH A;  4EES A;  3DTI A;  4I3J A;  1XXM A;  4BBU A;  1K57 A;  3CI6 A;  3UB6 A;  5HX9 A;  2JN7 A;  4UHU A;  4E3I A;  1C3B A;  1J9M A;  4RX2 A;  2CMN A;  3OC2 A;  2J8Y A;  4KZ3 A;  5CGX A;  3PAG A;  1X0O A;  2Y2O A;  3BWL A;  4NXB A;  3F1N A;  5EUA A;  2PAV P;  4MBH A;  4YOF A;  1FSW A;  1I2W A;  1TDL A;  3WS5 A;  3MZE A;  3IWO A;  3VMA A;  1ES3 A;  4XUX A;  1K6S A;  4PKY G;  1ZG4 A;  2Y8H A;  2XR0 A;  4R3J A;  5DTS A;  4GLQ A;  2XK1 A;  3LR4 A;  5A92 A;  3UB7 A;  2ZMA A;  3MXS A;  2W1T B;  3GEC A;  1CQA A;  1XA7 A;  5HPI A;  3A3D A;  3FYZ A;  1CI9 A;  3EQU A;  5FAQ A;  3PHY A;  4OP5 A;  4E3J A;  4EUZ A;  1W7F A;  3LEZ A;  3C4O A;  1WYC A;  5FI2 A;  2VZW A;  1YSP A;  5FQM A;  2A49 A;  5HFO A;  4BD0 A;  4H6J B;  1ODV A;  1BUE A;  3M2J A;  4KZ8 A;  5CHM A;  5FDS A;  3BJN A;  1IFQ A;  2GJ3 A;  2J9P A;  2V0W A;  3LGO A;  4MN7 A;  4S2O A;  3T4Q A;  1YLZ A;  1MWU A;  3KSI A;  3NC8 A;  4S2J A;  1NRF A;  1ERO A;  5J8X A;  3ZHH A;  1PW1 A;  3BY8 A;  2JKR M;  2EX2 A;  3PXP A;  2XA7 S;  1YLW A;  3BFE A;  4HP9 A;  2OV5 A;  3W2Z A;  1SKO B;  1BUL A;  4S2L A;  4WEK A;  4IJG A;  4S2N C;  4ETZ A;  2XSS A;  3A3J A;  2ZC5 B;  2VGL S;  4KG5 A;  5EVI B;  1S6R A;  3OPH A;  4ZJ2 A;  5LBR A;  5TR7 A;  2BLS A;  3DTE A;  5C5K A;  3ZFZ A;  4L9G A;  2QMI A;  2WAE A;  3LR0 A;  1QME A;  3MZF A;  1XPB A;  3NHQ A;  3NEC A;  3LY4 A;  1N9L A;  3AGD A;  1WE4 A;  4WLA A;  4G3W A;  3SS4 A;  4CJN A;  3CZD A;  1QMF A;  3MR0 A;  3T1R A;  2X71 A;  2QJ7 A;  3F1P A;  3LO7 A;  3N4I A;  1CJF A;  2YKF A;  2V9A A;  4GW9 A;  1K4E A;  4KEN B;  1BLH A;  4IVK A;  1F98 A;  2FZ0 A;  1SKF A;  3LUQ A;  4KUK A;  2K2N A;  4CPK A;  4HOI A;  2ZMF A;  2C6W B;  3DW0 A;  5TBM A;  3LY3 A;  3CIT A;  2A24 B;  1WYB A;  2OOL A;  3O87 A;  1K25 A;  1IYS A;  4UA7 A;  4FOF A;  1PRQ A;  2INW A;  3BY9 A;  2ZM0 A;  1FCO A;  2I72 A;  1E3U D;  1NZO A;  4MCW A;  5HD3 A;  4P0M A;  1OJ5 A;  2WK0 A;  1YSQ A;  4JF5 A;  2HGV A;  1KDW A;  5IS1 A;  3QP5 A;  4JGQ A;  4GD6 A;  1K55 A;  1T19 A;  2EXB A;  5JYP A;  4ZTK A;  1NZU A;  1NYM A;  4WYY A;  5L8M A;  4WEJ A;  3T1Q B;  1Y4O A;  1FR1 A;  3BEC A;  4O0P A;  4R38 A;  2ZQC A;  2X02 A;  1LL8 A;  1S1Z A;  4S2K A;  1FIL A;  2UWX A;  3ZVT A;  2ZM2 A;  2P74 A;  3MFD A;  5F69 A;  3SH9 A;  3EOI A;  5EFW A;  1N9B A;  4FTX A;  1YMX A;  3N6I A;  4RQ9 A;  3S4X A;  3ULF A;  2GDN A;  2ZQD A;  4HH3 A;  3VP3 A;  1PNE A;  4HEF A;  3UN7 A;  3ZG7 B;  5FDH A;  5GHZ A;  1MBL A;  3H7W B;  2VV7 A;  5FQK A;  4EWF A;  5FAP A;  1GSX A;  2J9O A;  4L9F A;  2QZ6 A;  2CC1 A;  2ZL1 B;  3VSL A;  4PAU A;  1KVM A;  3QHY A;  2ZQ9 A;  3A3F A;  4P6B A;  5KSH A;  3NUL A;  4D60 A;  3OCN A;  4EU0 A;  2W3F A;  3KSH A;  4BQM A;  3UPP A;  1S1Y A;  2EFX A;  2QPN A;  3S7P A;  3BLM A;  3W4P A;  2P04 A;  3LFV A;  4KZ7 A;  4DE2 A;  2ZC7 A;  1S0W A;  4OON A;  4EEU A;  1BLC A;  4PM8 A;  5E43 A;  4PMA A;  3CWF A;  1S4S A;  4K91 A;  3TW8 A;  4R4S A;  3RFB A;  3TOI A;  1VB6 A;  1F2K A;  3B47 A;  1KE4 A;  5A91 A;  4M3K A;  4YNR A;  4M4X A;  2WYX A;  1I2S A;  1A0K A;  4E6W A;  2PYP A;  4IUK A;  1GHP A;  1VEU B;  2W0N A;  1K38 A;  1XFQ A;  4X56 A;  2W1T A;  3ZYT A;  2Y2G A;  1NXY A;  3ISG A;  4KQR A;  4CLC C;  4GKU A;  5DJT A;  5CX7 A;  2E8I A;  3WRZ A;  4NG2 A;  5EV0 A;  5HAR A;  3T4L A;  3W8K A;  2WKQ A;  2W3E A;  2GZA A;  3IS2 B;  3JVU A;  5EVL A;  3JYI A;  4KG2 A;  3C30 A;  1H8Y A;  2VA0 A;  1K57 C;  3WS2 A;  4H6J A;  1PW8 A;  4NXF A;  3S7N A;  2VJW A;  1LT0 A;  4X6T A;  4ME4 A;  4QPR A;  2JKR I;  5EM0 A;  3FPV A;  4OOY A;  1NYY A;  4IBR A;  1MKM A;  1HTZ A;  2NUT C;  5CHU A;  1DJC A;  5M19 A;  4UA6 A;  2IWB A;  3UE6 A;  3BFF A;  5CTN A;  3BFC A;  4DE0 A;  1CEG A;  4BD1 A;  4Y3I A;  2QJ5 A;  4HJ4 A;  3T4S A;  1HLU P;  1SKO A;  4D2O A;  2EWW A;  2W1R A;  4OVD A;  4BL2 A;  2IA2 A;  5L07 A;  4JGO A;  1FSY A;  1TS7 A;  1SHV A;  5EVI A;  2B95 A;  4C3Q A;  3IHA A;  4BMW A;  3BYD A;  2KX6 A;  1NJ4 A;  5EVI D;  4EUV A;  4LRZ E;  4OPR A;  5EM1 A;  4F3L B;  1EI5 A;  5DJU A;  4HHD A;  5I94 A;  3PAE A;  2EA9 A;  1G6O A;  3IF5 A;  2PR5 A;  3G6O A;  1ZHH B;  1D1J A;  4X69 A;  1TD5 A;  3VP1 A;  2XA7 M;  3LR3 A;  1P97 A;  1KE0 A;  3OPR A;  2WKI A;  3IWQ A;  3BFD A;  2VGL M;  4ZJ1 A;  3L7H A;  1W79 A;  3VP2 A;  4MN5 A;  3VP0 A;  2Q9N A;  4B93 A;  2KOI A;  1XJ6 A;  4Z1W A;  5FI6 A;  1G68 A;  2O9B A;  3NJA A;  2ZQA A;  4JGR A;  3FKV A;  4GN2 A;  2HF6 A;  3MJQ A;  2A24 A;  3WS4 A;  3G35 A;  4KQQ A;  2WKR A;  3FV7 A;  3SZT A;  5HSQ A;  1H3Q A;  3NOP C;  2FFY A;  1L0F A;  2OLU A;  4WMC D;  1XA1 A;  1UGU A;  3OZH A;  5FQJ A;  3NDE A;  2Y55 A;  2Y2L A;  3ZDJ A;  5EE8 A;  5FQ9 A;  2HV1 A;  4R23 A;  5L10 A;  2QHK A;  1U60 A;  1L0E A;  1ONH A;  4JLF A;  5FAT A;  4G3K A;  1TS0 A;  1GA9 A;  3G34 A;  2P08 A;  1SDN A;  1ZTU A;  2D02 A;  4EER A;  1LL9 A;  4HBU A;  1T1B A;  1YPR A;  4GD8 A;  2RCX A;  1KE3 A;  5KZH A;  2B18 A;  2WGV A;  4LEN A;  5L2F A;  4UAA A;  3IXD A;  2G2U A;  1TDG A;  1ES5 A;  3HJI A;  1G5U A;  4OPQ A;  2Z6D A;  3LIF A;  1PWD A;  2ZBB A;  3M2K A;  3IXG A;  1XP4 A;  4BL3 A;  5HL1 A;  3LYX A;  4E04 A;  2W3H A;  4QD4 A;  4GCZ A;  1N9N A;  4U3T A;  4HES A;  3O5Y A;  4Y7P A;  3V39 A;  3S7Q A;  5EVE A;  3H7W A;  1J3W A;  2Q0O A;  3VP4 A;  2ZQ7 A;  3N7W A;  1OTE A;  3G30 A;  2JC7 A;  5BOH A;  1PIO A;  2W3D A;  3UY6 A;  4JXG A;  2JKT M;  5EEC A;  3BQ8 A;  3K2N A;  2ZL1 A;  3NDG A;  1K55 C;  3MS6 A;  3IF6 C;  2PHY A;  3C2W A;  2DCF A;  1MC0 A;  3IQA A;  4Y15 A;  2PU4 A;  4JF4 A;  4YIN A;  5KMW A;  4OQI A;  3T50 A;  3BM6 A;  5HAP A;  4DJ3 A;  2KLI A;  5HWV A;  3C4P A;  3MSH A;  2PR6 A;  3BQA A;  3Q7V B;  1H5X A;  4ID4 A;  4XXR A;  3ZG5 A;  3U2A A;  2A3U A;  3CMZ A;  3RH8 B;  1DP9 A;  1GHI A;  2P7J A;  5DF9 A;  3P98 A;  5EPH A;  3VOY A;  2FH5 A;  2WKE A;  2WGI A;  2XF3 A;  5DF7 A;  4KG6 A;  4R70 A;  1XFN A;  2OAQ 1;  2RL3 A;  4IHQ A;  3P01 A;  1OTA A;  4BEN A;  3ZGA B;  5HDC A;  1XGJ A;  4NEE D;  1IEL A;  5E2E A;  2O9A A;  3DBA A;  1VEU A;  4GB7 A;  4GHI A;  3FC7 A;  4F94 A;  5J3W A;  5U47 A;  3NOT C;  3SH7 A;  1HZO A;  1DJB A;  2EWV A;  3MXQ A;  4MMN A;  3E98 A;  2YKH A;  3IS2 A;  3LI9 A;  1NLY A;  4OPY A;  3BW6 A;  2O0Y A;  3G32 A;  5J7E A;  4KZB A;  1UWN X;  1IOU A;  5GLB A;  4BJP A;  4BLM A;  1CK3 A;  4X53 A;  2J7V A;  4KZ5 A;  1LSW A;  2Y2M A;  4GS9 B;  1OPX A;  4NXG A;  2XH9 A;  2DRW A;  5HWW A;  3V3S A;  3UB5 P;  2VEA A;  3RJU A;  4EET B;  3V3R A;  1LI9 A;  3NOU C;  4LRX C;  3A0R A;  4XUZ A;  1PZO A;  2Y4A A;  1ES4 A;  3L9K A;  2NUP C;  4EW7 A;  3K3D A;  4E3L A;  5DKK A;  1PYY A;  1JTD A;  1VQQ A;  2WAF A;  3I7J A;  3LIC A;  2PRF A;  3V5M A;  4XT2 B;  3NBL A;  1K6R A;  5CRF A;  3GMW A;  4K0W A;  2JE5 A;  4F3L A;  4Y17 A;  1BLP A;  4WF0 A;  3WWX A;  5E2H A;  3PYP A;  4N1X A;  2PBY A;  4DJ2 A;  5FEF A;  4N1H A;  5GL9 A;  4NK3 A;  2ZLY A;  3C7U A;  2M1C A;  5CGW A;  2GX5 A;  5K5B A;  1Q2P A;  2VV8 A;  2HDU A;  2HZ5 A;  3D72 A;  2D01 A;  2W27 A;  1F5M A;  3HLW A;  3VFF A;  3GR2 A;  5HPF A;  1XJ2 A;  2MJ6 A;  4AFI A;  3CPT B;  2WUQ A;  2Y2K A;  3D4F A;  3OCL A;  5HDD A;  3PBT A;  4JXS A;  1MZU A;  3A0V A;  2V1B A;  4O8G A;  3LIE A;  4GJ4 A;  4C6Y A;  4EQ1 A;  3WS0 A;  3UPO A;  5FEG A;  2L1M A;  3VE4 A;  3O86 A;  3Q1F A;  5EVI C;  3LCE A;  1Z6F A;  1IKI A;  2EX6 A;  3PBQ A;  3MQ0 A;  3C5A A;  4CLC B;  4WM9 A;  3FKW A;  3G2Y A;  3B33 A;  4DDY A;  3IWI A;  1WA9 A;  3HUN A;  3MXR A;  1E25 A;  3HL9 A;  4WUJ A;  1ERM A;  1KVL A;  4RA7 A;  5M1A A;  1ZC2 A;  2ACG A;  3UO9 A;  3KSG A;  4PHT A;  3EGX C;  3UME A;  4PM5 A;  1ZKJ A;  4Y0O A;  1MWR A;  3LIB A;  3R7W B;  3UDF A;  1N4O A;  1K0K A;  2K31 A;  3HCY A;  5EOO A;  4MEZ A;  5A8B A;  5FQQ A;  4JKT A;  2R9X A;  4MN6 A;  4JXV A;  4A5R A;  2HP6 A;  1RGZ A;  2E8J A;  3LI8 A;  1JWP A;  1G28 A;  4WZ5 C;  5KIZ A;  3P7N A;  5CER A;  1OTB A;  3N8S A;  1K54 A;  3O3V A;  4E6X A;  5FI7 A;  4LLO B;  3S7O A;  4Q8I A;  2HDR A;  5HAQ A;  4UQI S;  3B3X A;  1FCM A;  1DY6 A;  4GNU A;  2XRN A;  1IYP A;  2H0Y A;  3ICY A;  4GDN A;  4QB8 A;  2DNS A;  3N8R A;  2Q9M A;  4X55 A;  3UB9 A;  1JTG A;  3T1S A;  4GHI B;  3LID A;  4E3N A;  1MXO A;  2JBF A;  4KZ9 A;  3C8C A;  2Y2J A;  1OJG A;  1NY0 A;  1Q2Q A;  3N8L A;  2HPB A;  1KGG A;  3Q7V A;  4E3O A;  2H10 A;  2HJE A;  1I5Q A;  2BTF P;  2W3G A;  4OQ0 A;  5F68 A;  2XRO A;  4PKY A;  1RP5 A;  1IYO A;  2AVX A;  1FR6 A;  5A93 A;  1ZG6 A;  3GRJ A;  2HDS A;  5AQ9 A;  3CUE A;  1JWZ A;  1T18 A;  3RXW A;  2JKF A;  4IVI A;  1KGE A;  3TE8 A;  1KGF A;  3G2Z A;  3DTK A;  3SS5 A;  2ZOI A;  3PR6 A;  5IT5 A;  3S22 A;  3P09 A;  3NCK A;  5TFQ A;  4DKI A;  4K08 A;  5HAI A;  3JVV A;  1Y28 A;  2J3W A;  3G4P A;  3QNB A;  3OPL A;  4C75 A;  2VV6 A;  3H82 A;  2V20 A;  4ESP A;  2C5W B;  3OBF A;  3FG8 A;  2HJ9 C;  4N9L A;  2UV0 E;  4DXC A;  3HJK A;  2M7V A;  4HQA A;  3ZNT A;  3VV4 A;  2Z2L B;  1TS6 A;  2ZQ8 A;  4LGW A;  3HLD A;  3ITB A;  2XD5 A;  2VGK A;  4LPZ A;  5FL3 A;  4GS9 A;  3A3E A;  5A90 A;  3Q82 A;  2PU2 A;  2Z2M B;  2XD1 A;  3LEQ A;  1ONG A;  1S66 L;  2Y91 A;  3HLE A;  4EBN A;  2L4R A;  2PD8 A;  3BFG A;  3KYQ A;  1H8Z A;  3T12 B;  1ALQ A;  4JF6 A;  2Z6C A;  4OKP A;  2VLG A;  1M40 A;  1NRJ A;  3UE1 A;  1PWC A;  4U0T A;  3QP4 A;  5FSR A;  4EBL A;  2ZD8 A;  3CHW P;  2XFT A;  4X1L A;  4XT2 A;  3WS1 A;  4LV1 A;  4I5S A;  4Z9Q A;  3HUM A;  3EEA A;  2H28 A;  4PM7 A;  3T4T A;  3DTM A;  2VK3 A;  3O88 A;  3UNW A;  5JYO A;  3CJM A;  2G2W A;  4S2M A;  2WAD A;  3IF6 B;  1STZ A;  4OLD A;  3IH8 A;  2OSU A;  4FH2 A;  3S1Y A;  4EV4 A;  1LL5 A;  1YKD A;  3RXX A;  3M6B A;  3FWL A;  2ZMV A;  2G7U A;  3T4K A;  3IHB A;  1VHM A;  1NWZ A;  3CPT A;  5TJJ A;  1XJ3 A;  3ZVW A;  1BZA A;  4O7D A;  2O9C A;  5DF8 A;  5HL6 A;  2J3T D;  5CEC A;  3IBJ A;  3SS3 A;  4B4X A;  4BWI A;  1YQS A;  2H5S A;  2OAP 1;  3KYE A;  4WBG A;  4N9K A;  2Y79 A;  1OTI A;  3PBR A;  1H0M A;  1O7E A;  2XDM A;  3VSK A;  2Y2Q A;  3E4P A;  4CLC A;  3V67 A;  2OWH A;  1MKI A;  1P9W A;  3H9W A;  2JHE A;  3GVB A;  1HVB A;  1KOU A;  1YM1 A;  3Q7Z A;  2HP5 A;  3Q81 A;  4Q0H A;  4MNR A;  4P6Z S;  2Y2N A;  4Q0J A;  1IYQ A;  1SZV A;  2DMW A;  4L0L A;  2EX9 A;  1FOF A;  2V8C A;  2WGW B;  1MPL A;  4KZ4 A;  3AGE A;  1GHM A;  1JNU A;  3R7W A;  5CTM A;  2B02 A;  5GHY A;  4R6L A;  3U4L P;  4CQH A;  4S2I A;  4HIA A;  3MKE A;  3R4K A;  4OPZ A;  3BEB A;  5D3O A;  4B9O A;  3IXH A;  3QP6 A;  2GNX A;  2V1Z A;  2PT7 A;  4R0Q A;  3GDI A;  1XKZ A;  4MLL A;  2QYB A;  4E3M A;  5GLD A;  1V9Z A;  1W63 M;  3K3C A;  1KDS A;  4N92 A;  5M18 A;  2ZC4 B;  4OQG A;  4PM6 A;  4DE3 A;  1IKG A;  1ES2 A;  3MQO A;  4ZBE A;  1YT4 A;  4OP8 A;  5F1G A;  2Y2I A;  3G31 A;  4EXO A;  5CEB A;  1MY8 A;  3ZQ5 A;  4P87 A;  1T1C A;  4WN5 A;  3OOV A;  1TEM A;  5AQ7 A;  4FSF A;  1FQG A;  3TG9 A;  2PD7 A;  1OME A;  1G6A A;  3HBR A;  1D06 A;  3IXB A;  2O99 A;  3H82 B;  4I3A A;  3MFX A;  2ZC3 B;  1TVF A;  4ARZ B;  5DFX A;  3QP1 A;  2X01 A;  2P9V B;  1EW0 A;  1DP8 A;  1LSV A;  3A0S A;  3B42 A;  4UQI M;  2VKS A;  3E2L A;  1Z09 A;  2R9W A;  4QY6 A;  1MWS A;  5F1F A;  3F1O B;  3MMH A;  5CXW A;  1K56 A;  1K54 C;  4U0X A;  3T4O A;  4E3K A;  3UMD A;  2WKH A;  4II7 A;  2ZOH A;  1GA0 A;  1LI0 A;  4QJG A;  1PZP A;  1K56 D;  4I38 A;  4DRT A;  1W8Q A;  4GOG A;  3W4Q A;  3ZG8 B;  3E0Y A;  3MKF A;  3M6H A;  4JBF A;  4Y13 A;  1ESU A;  2V0U A;  2XQZ A;  3C38 A;  3MBZ A;  4OQH A;  4X68 A;  3IH9 A;  3QP8 A;  2JKG A;  4KQO A;  5DKL A;  4KUO A;  1DRM A;  1W5D A;  4IUH A;  2ZM8 A;  4ETX A;  1SDE A;  2XLN A;  1N9O A;  1XX2 A;  5CED A;  4QWO A;  4RYE A;  4EEP A;  4DF6 A;  2JCH A;  3CUE C;  2ZC6 B;  1VET B;  2OWJ A;  3VFH A;  4ZJ3 A;  3CAX A;  4DXB A;  5AJG A;  5IU1 A;  5DTT A;  3LIA A;  1E3U A;  3EGD C;  4MDZ A;  1AXB A;  1CEF A;  2EXA A;  3NI9 A;  4WL9 A;  4Y5F A;  1VM1 A;  2QWS A;  2Y2H A;  2BG1 A;  4G3V A;  3BRM A;  3TSG A;  1DP6 A;  1PWG A;  2PDR A;  3C7V A;  3LR5 A;  4I39 A;  3IT9 A;  4MBF A;  4HY8 A;  1GSV A;  3IF6 A;  2IWC A;  4KZ6 A;  1YLY A;  2V8F A;  1TF1 A;  2BAS A;  5FQI A;  3EQV A;  3VOL A;  1RGY A;  2PYR A;  1FCN A;  5F83 A;  1YMS A;  3SOI A;  3DWK A;  1JVJ A;  4HJ3 A;  5J4E A;  3PBS A;  1JWV A;  4NKP A;  4BBV A;  3IX4 A;  3QNC A;  1ACF A;  5E2G A;  3UPN A;  3BLS A;  3ZNY A;  1YAX A;  4LCM A;  1D7E A;  3UB8 A;  3CG5 A;  1L3L A;  1S4R A;  4BBT A;  2R78 A;  5F6A A;  3JPU A;  3F1N B;  4B88 A;  1LHY A;  1LLB A;  4P85 A;  3A3I A;  2K7S A;  3UDX A;  3ITA A;  1V9Y A;  5G18 A;  4LCL A;  1GCE A;  2JKT I;  1YLJ A;  5GLA A;  2XFS A;  3KYZ A;  2IWD A;  3PBN A;  5CGS A;  4H8R A;  2B5R A;  4KZA A;  4FH4 A;  3GV9 A;  2FFF B;  2A2L A;  4S2N A;  3CLO A;  2LB9 A;  3PBO A;  3IBR A;  5KSC A;  2H0T A;  3HUO A;  3HLF A;  2WGW A;  4DDS A;  4L9E A;  1ERQ A;  3GQZ A;  1EWZ A;  3TRC A;  3PTE A;  2J3T C;  4RVA A;  1PI5 A;  2ZJ9 A;  2XEP A;  4UA9 A;  1M6K A;  5AQA A;  3KO6 A;  4UEY A;  4EQI A;  1NLZ A;  3Q07 A;  4R1G A;  4EBP A;  4HP4 A;  3E2K A;  4WZ4 A;  1FIK A;  3IX8 A;  1BT5 A;  4OLG A;  4LV0 A;  2L0W A;  3OPP A;  1UWP X;  4P6Z M;  4PM9 A;  2M7U A;  4HJ6 A;  4NXE A;  1MWT A;  5HDS A;  5L09 A;  3OLO A;  5IHV A;  2HP9 A;  1W8Y A;  1TS8 A;  1W63 Q;  4K0X A;  4LRY C;  4HI4 A;  1BTL A;  2V1A A;  3W4O A;  3MQQ A;  2XGN A;  1AWI A;  4S2P A;  3NY4 A;  3MZD A;  4YFM A;  3KX0 X;  4CLC E;  2VX8 A;  4LV2 A;  3ZG9 B;  4HBT A;  4Q0I A;  5DFY A;  4ARZ A;  1P9R A;  5F82 A;  4HNB A;  1ESI A;  2P9V A;  4WEL A;  3HLC A;  5FAO A;  4Y0U A;  1Y54 A;  1YLT A;  5DVA A;  2WZX A;  5EOE A;  5AVE A;  4PPR A;  3ZCZ A;  3ZG0 A;  1HD8 A;  1RCJ A;  1E4D A;  2LB5 A;  3F1P B;  3T1X A;  5F5Y A;  3F1O A;  4R4R A;  1IEM A;  1DJA A;  1T1A A;  3D9Y A;  1BYW A;  5FA7 A;  2PBD P;  5HW3 A;  1O07 A;  2WZZ A;  2HDQ A;  5G4Y A;  4RX3 A;  2Y59 A;  2I9V A;  1S67 L; 
#chains in the Genus database with same CATH homology
 4O01 A;  5KSH A;  2QKP A;  3OCN A;  4EU0 A;  2W3F A;  3KSH A;  5TBM B;  2J80 A;  5DKK A;  1JNU A;  1S1Y A;  3R7W A;  3LIC A;  3S7P A;  2B02 A;  4R6L A;  4JGP A;  2P04 A;  3LFV A;  4CQH A;  4XT2 B;  4HIA A;  3R4K A;  4F3L A;  4B9O A;  4EEU A;  2GNX A;  2PT7 A;  4WF0 A;  3CWF A;  3GDI A;  1S4S A;  2QYB A;  5G4Z A;  4HH2 A;  3TW8 A;  3RFB A;  3PYP A;  5MC7 A;  1VB6 A;  4DJ2 A;  3B47 A;  4L0L A;  1V9Z A;  1W63 M;  4YNR A;  3K3C A;  3D3O A;  2M1C A;  2GX5 A;  5K5B A;  4KQD A;  1GSW A;  4M4X A;  3TJZ C;  2VV8 A;  3UE3 A;  3E4O A;  1P0Z A;  4YWZ A;  1F9I A;  3D72 A;  2PYP A;  2D01 A;  2W27 A;  3RTY A;  1LSX A;  4IUK A;  3MQO A;  5I5L A;  1F5M A;  1OTD A;  5HPF A;  1XJ2 A;  2MJ6 A;  3EWK A;  2KDK A;  4AFI A;  2W0N A;  1XFQ A;  1OT6 A;  2W1T A;  1XJ4 A;  3ZYT A;  4EXO A;  3KSF A;  3OCL A;  5HDD A;  3PBT A;  5HWT A;  4CLC C;  5DJT A;  5CX7 A;  1MZU A;  3ZQ5 A;  4I3I A;  3A0V A;  2V1B A;  1T1C A;  4O8G A;  3T4L A;  4WN5 A;  3OOV A;  2WKQ A;  2W3E A;  3LIE A;  4FSF A;  1H8M A;  1OT9 A;  4GJ4 A;  2GZA A;  2PD7 A;  4EQ1 A;  3SW1 A;  3IS2 B;  3JVU A;  1D06 A;  3C30 A;  2O99 A;  2L1M A;  3VE4 A;  2VA0 A;  3H82 B;  4I3A A;  3MFX A;  4OOL A;  2WKP A;  4H6J A;  4NXF A;  3S7N A;  4ARZ B;  5DFX A;  2VJW A;  5HD5 A;  3MF0 A;  1LT0 A;  1EW0 A;  1DP8 A;  3PBQ A;  4ME4 A;  4QPR A;  1LSV A;  4DN0 A;  2JKR I;  3A0S A;  3B42 A;  3FPV A;  3MQ0 A;  4UQI M;  3T4J A;  3E4Q A;  2VKS A;  4CLC B;  1MKM A;  5AVF A;  4DMZ A;  2NUT C;  4ZRR A;  3B33 A;  3VE3 A;  4Y2F A;  3UE6 A;  1WA9 A;  3F1O B;  3MMH A;  4OOM A;  3FPW A;  4WUJ A;  3T4O A;  4R3A A;  3UMD A;  5HZH A;  4II7 A;  2ZOH A;  4Y3I A;  2QJ5 A;  4CLC D;  4I38 A;  3KSG A;  4HJ4 A;  3T4S A;  4PHT A;  3EEH A;  3EGX C;  4EES A;  2EWW A;  2W1R A;  3UME A;  2IA2 A;  4I3J A;  4BBU A;  3E0Y A;  1TS7 A;  3LIB A;  4JGO A;  3CI6 A;  3R7W B;  3UB6 A;  2K31 A;  3HCY A;  5A8B A;  2JN7 A;  4BMW A;  2KX6 A;  4MN6 A;  4EUV A;  4LRZ E;  2CMN A;  3OC2 A;  2V0U A;  3C38 A;  4F3L B;  1X0O A;  3BWL A;  4NXB A;  4HHD A;  5DJU A;  3F1N A;  3LI8 A;  4YOF A;  2EA9 A;  1G28 A;  1G6O A;  4KQO A;  5DKL A;  4KUO A;  2PR5 A;  3G6O A;  5KIZ A;  1DRM A;  1ZHH B;  3P7N A;  1OTB A;  4IUH A;  1TD5 A;  4ETX A;  2XA7 M;  4PKY G;  3LR3 A;  4LLO B;  2Y8H A;  1N9O A;  3S7O A;  1P97 A;  4GLQ A;  4EEP A;  3LR4 A;  3CUE C;  4UQI S;  2VGL M;  2OWJ A;  3UB7 A;  2XRN A;  3CAX A;  4MN5 A;  5AJG A;  2W1T B;  3ICY A;  3GEC A;  5IU1 A;  4B93 A;  2KOI A;  1XJ6 A;  3LIA A;  4Z1W A;  5HPI A;  2O9B A;  3NJA A;  3EQU A;  3EGD C;  4JGR A;  4MDZ A;  3UB9 A;  3PHY A;  2HF6 A;  3MJQ A;  2A24 A;  4GHI B;  4WL9 A;  3LID A;  2WKR A;  4Y5F A;  5HSQ A;  1H3Q A;  3NOP C;  3C8C A;  1OJG A;  2QWS A;  2VZW A;  1YSP A;  4G3V A;  1UGU A;  4H6J B;  1DP6 A;  1ODV A;  2PDR A;  2HJE A;  3LR5 A;  4I39 A;  2W3G A;  5F68 A;  2XRO A;  3BJN A;  4PKY A;  1IFQ A;  2GJ3 A;  4HY8 A;  2V0W A;  4MN7 A;  1GSV A;  2HV1 A;  2QHK A;  3T4Q A;  1TF1 A;  2BAS A;  3CUE A;  3EQV A;  1T18 A;  3VOL A;  3KSI A;  4G3K A;  1TS0 A;  2PYR A;  3TE8 A;  2P08 A;  2ZOI A;  3PR6 A;  4HJ3 A;  1ZTU A;  2D02 A;  3BY8 A;  4EER A;  5IT5 A;  5J4E A;  2JKR M;  3PBS A;  3PXP A;  4K08 A;  3JVV A;  2XA7 S;  4NKP A;  1Y28 A;  4BBV A;  2J3W A;  4HP9 A;  3W2Z A;  1T1B A;  2VV6 A;  2B18 A;  4WEK A;  4IJG A;  3H82 A;  2XSS A;  1YAX A;  4ETZ A;  2VGL S;  1D7E A;  3UB8 A;  3OBF A;  3FG8 A;  2HJ9 C;  3HJI A;  1S4R A;  4BBT A;  5LBR A;  3HJK A;  5C5K A;  2M7V A;  4HQA A;  2Z6D A;  3LIF A;  3VV4 A;  4L9G A;  2R78 A;  5F6A A;  2ZBB A;  1TS6 A;  3F1N B;  3LR0 A;  3LYX A;  4E04 A;  2W3H A;  3NHQ A;  2K7S A;  4GCZ A;  1N9N A;  1V9Y A;  1N9L A;  4LPZ A;  3O5Y A;  5FL3 A;  4WLA A;  4GS9 A;  3S7Q A;  4G3W A;  2JKT I;  3H7W A;  3MR0 A;  3KYZ A;  1OTE A;  3PBN A;  2QJ7 A;  2W3D A;  3F1P A;  2JKT M;  1S66 L;  2V9A A;  2YKF A;  3BQ8 A;  4GW9 A;  3K2N A;  2A2L A;  1F98 A;  2FZ0 A;  3CLO A;  2L4R A;  2LB9 A;  2PD8 A;  3PBO A;  3IBR A;  3KYQ A;  2PHY A;  3LUQ A;  4KUK A;  2K2N A;  4HOI A;  3C2W A;  2ZMF A;  2Z6C A;  4L9E A;  1MC0 A;  5TBM A;  2VLG A;  1NRJ A;  3CIT A;  2A24 B;  3TRC A;  2OOL A;  2J3T C;  3T50 A;  4FOF A;  2INW A;  3BY9 A;  4DJ3 A;  2KLI A;  4XT2 A;  3KO6 A;  5HWV A;  4I5S A;  4UEY A;  1NLZ A;  2PR6 A;  3EEA A;  2H28 A;  3BQA A;  3T4T A;  4MCW A;  4HP4 A;  5HD3 A;  3U2A A;  1OJ5 A;  1YSQ A;  3RH8 B;  2HGV A;  1DP9 A;  2L0W A;  1STZ A;  1UWP X;  2P7J A;  4P6Z M;  5DF9 A;  5IS1 A;  2M7U A;  4HJ6 A;  2FH5 A;  4JGQ A;  4NXE A;  1T19 A;  4R70 A;  5HDS A;  1XFN A;  2OAQ 1;  1YKD A;  4IHQ A;  3P01 A;  3OLO A;  1OTA A;  5HDC A;  4NEE D;  5L8M A;  2ZMV A;  2G7U A;  4WEJ A;  1TS8 A;  1W63 Q;  3T4K A;  2O9A A;  1VHM A;  3DBA A;  1NWZ A;  5TJJ A;  4O0P A;  4LRY C;  4R38 A;  1XJ3 A;  4GHI A;  1LL8 A;  1S1Z A;  3FC7 A;  4HI4 A;  2O9C A;  2V1A A;  5J3W A;  5HL6 A;  3MQQ A;  3NOT C;  2J3T D;  2EWV A;  3MXQ A;  4MMN A;  3IBJ A;  3KX0 X;  4CLC E;  3E98 A;  5F69 A;  4BWI A;  2YKH A;  3IS2 A;  3LI9 A;  2VX8 A;  1NLY A;  2OAP 1;  3BW6 A;  2O0Y A;  3EOI A;  5EFW A;  5J7E A;  4Q0I A;  5DFY A;  4ARZ A;  2Y79 A;  1OTI A;  1UWN X;  3PBR A;  1P9R A;  4RQ9 A;  3ULF A;  4HNB A;  1IOU A;  4HH3 A;  4WEL A;  4BJP A;  5AVE A;  1LSW A;  4GS9 B;  1OPX A;  4NXG A;  3E4P A;  4CLC A;  3H7W B;  3V67 A;  2VV7 A;  2OWH A;  2LB5 A;  1P9W A;  3H9W A;  5HWW A;  2JHE A;  3F1P B;  1GSX A;  2VEA A;  4L9F A;  5F5Y A;  4EET B;  1KOU A;  3F1O A;  3NOU C;  4LRX C;  3A0R A;  4Q0H A;  1T1A A;  4P6Z S;  4Q0J A;  1BYW A;  4PAU A;  2DMW A;  2NUP C;  4EW7 A;  5G4Y A;  3K3D A;  2I9V A;  1S67 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...