4UQIS

Ap2 controls clathrin polymerization with a membrane-activated switch
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
142
structure length
142
Chain Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-2 COMPLEX SUBUNIT ALPHA-2
publication title Clathrin Adaptors. Ap2 Controls Clathrin Polymerization with a Membrane-Activated Switch.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 49
structure length 142
sequence length 142
ec nomenclature
pdb deposition date 2014-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4uqiS00
1W63Q 2JKTM 4UQIS 2JKRM 4NEED 1W63M 4UQIM 2FH5A 2HF6A 2VGLS 2JKTI 1NRJA 2JKRI 2VGLM 3TJZC 4P6ZS 2XA7S 5MC7A 4P6ZM 2XA7M
chains in the Genus database with same CATH superfamily
3NBLA 1E4DA 1MC0A 3NOTC 3C2WA 4JXSA 2INWA 5HPIA 4EV4A 4B9OA 3V50A 1OTBA 5CTNA 4BLMA 3BQ8A 2XFSA 2O9AA 2WAFA 3BECA 3D4FA 2QPNA 1PZPA 4MBHA 1PZOA 2V1ZA 3T50A 1IEMA 1KE0A 2H0TA 5FI2A 3FV7A 3VOYA 2A49A 3UB5P 2A24A 3NI9A 4KQQA 5FL3A 2PBDP 2P04A 4RQ9A 1AXBA 4U3TA 3S7QA 1IKIA 3SW1A 1XJ3A 1EW0A 4LENA 4BBUA 4OLGA 2NUPC 4ESPA 3LCEA 1VQQA 2OV5A 1PWCA 2ZM8A 3MXSA 2ZM0A 4WZ4A 2R78A 1ERQA 5CGWA 2WKPA 5U47A 1L0FA 3IF5A 1LHYA 1YKDA 4AFIA 1KDWA 2VKSA 2XROA 2W3DA 2ZC6B 1IYPA 1F2KA 2XGNA 3IX8A 2JC7A 4GJ4A 3B33A 1XX2A 2P7JA 3V3SA 2P74A 4X53A 1N4OA 2Z6CA 4KZBA 5EVIC 5F1FA 1E25A 1Z6FA 4X56A 4DKIA 3CPTA 4FTXA 3ZG8B 3GR2A 4IHQA 1MBLA 2RL3A 4X69A 1WYBA 3T1XA 1PWDA 3C4OA 3F1PB 4ZTKA 4P87A 4OOLA 2ZQCA 2VLGA 2ZC3B 1ESIA 4BENA 1L0DA 4E3NA 3LO7A 3KYQA 4KQDA 3TOIA 5FATA 4XUZA 3W4OA 4DRTA 2O0YA 3B47A 4Z1WA 4I38A 1YMXA 1NRJA 5DTSA 3EQUA 3LFVA 4MMNA 3S7NA 4MEZA 4R3BA 1T1AA 3UE3A 5DF9A 3P09A 4BQMA 2HGVA 4NEED 3T4KA 4S2LA 1ZKJA 3M2JA 3QP2A 3GECA 4HHDA 1W5DA 3E98A 5J3WA 2HDSA 1LLBA 3CZDA 5L10A 4DDSA 2GJ3A 5FQJA 4D2OA 2JHEA 3B42A 3UPPA 4RX2A 5FDSA 1KGGA 2HPBA 2NUTC 4JF5A 3A0RA 1WYCA 2OWJA 4Y17A 5C5KA 5F5YA 1STZA 4GB7A 2J3TD 2QYBA 5KSHA 1MWTA 4KZAA 3MS6A 1W8QA 4L9FA 5HAQA 3LY4A 1Y4OA 5HWTA 5AQBA 3PBTA 5HX9A 1UWNX 4L9GA 2ZQ9A 3R7WB 1TD5A 5TJJA 2VX8A 5FA7A 1G68A 4A5RA 5GLCA 4QHCA 2VZWA 4Q8IA 4Z9QA 2UV0E 3ZYTA 2XF3A 4ZAMA 3FPWA 4CLCA 4ME4A 2P9VB 2O9BA 3OZHA 4HOIA 2K2NA 2K7SA 4I3JA 3A3EA 3AGFA 3JVVA 4OONA 2YKHA 2X02A 4WEJA 2QJ5A 3S7OA 5KSCA 4GS9B 2W1TA 1TS7A 3G32A 3ZG0A 3UDXA 4ZJ1A 4PKYG 4OPZA 3UNWA 3GDIA 4CJNA 1Y54A 1XJ6A 3LR5A 3GRJA 2J80A 4P6BA 2O99A 2CC1A 4PM7A 3A3DA 4OPYA 3WWXA 1DP8A 1YLTA 4IJGA 3OOVA 1N9OA 4Y7PA 2Q0OA 1NLYA 1M6KA 1TDLA 1K6RA 2W27A 3V67A 4MBFA 2HDRA 4Y0OA 3VSKA 3NJAA 3SOIA 1SZVA 3RTYA 4YINA 4C3QA 3DTEA 3W4PA 4KZ3A 2PU4A 4Q0HA 4DF6A 3NCKA 1VEUA 3O87A 3VFHA 3S4XA 1DJCA 3SH7A 1PW8A 3K3CA 3G34A 1H3QA 2WUQA 5F69A 3T4LA 2Y55A 3IHAA 4HESA 2R9WA 3UE1A 2Z6DA 3ZFZA 3LYXA 1XXMA 2BLSA 4GDBA 1L0GA 3UO9A 4UAAA 1YM1A 4EQIA 4EESA 4YFMA 4UEYA 3IWIA 4HBUA 1YLJA 5EVIB 1NZOA 4NETA 4KG2A 4OPRA 3A0VA 1K55C 4EBPA 2XD5A 4I3AA 5IHVA 2G7UA 3C30A 2Y8HA 4I3IA 5CEDA 1CI8A 3PBNA 3CI6A 4BBVA 2QJ7A 5HPFA 2V2FF 2XR0A 3C5AA 3HLBA 4H6JA 1BYWA 3CJMA 5CHMA 2FFYA 4JXWA 5J4EA 4UA7A 2FH5A 3HL9A 4EWFA 2EX8A 2WGWB 3IF6A 4LPZA 3WRTA 5I94A 1ES2A 1ZHHB 4K91A 3G4PA 5K5BA 1SKOA 4JGOA 2ZMFA 2WKRA 4HI4A 3BYDA 4R4SA 2GX5A 1K56A 4QY6A 1G6OA 4WEKA 3QP6A 3SS4A 4XUXA 1IELA 4Y5FA 4OQIA 3AGDA 4X68A 1YQSA 3ZG9B 2OWHA 4O8GA 4KG6A 3BFEA 4X1LA 4S2NA 1LSVA 1IFQA 3OC2A 4QB8A 4X6TA 2ZOHA 2VJWA 1GHMA 4NXGA 4WMCA 1N9LA 5HWWA 1JNUA 3KSFA 4RVAA 2ZJ9A 1ES3A 1HLUP 3T1QB 1Z09A 3ZNYA 3HLGA 4HIAA 4ARZA 1P9WA 3PBQA 3TSGA 4BJPA 4UA9A 5HDDA 4JGQA 3Q7ZA 5CRFA 3OCNA 1JTDA 3LI8A 3MZDA 4IEDA 1E3UD 2PR5A 4GZBA 5FQ9A 3LEQA 1S4RA 4Y0UA 2HV1A 4DDYA 5DFXA 3HLWA 4LV1A 4EQ1A 2HDQA 3LY3A 4Y15A 5HDSA 2XK1A 5FASA 4LV3A 3F1NA 5D3OA 4GOGA 4KZ5A 2W3EA 2WGIA 5FAOA 1PI4A 5KZHA 2V8CA 5AVEA 3VP1A 3MKEA 3I7JA 1OT6A 1EWZA 5M18A 4U0XA 3KSHA 3LR0A 2PT7A 4EW7A 4IVKA 5F6AA 1GHPA 1K57A 2VGLS 5EVID 2J9OA 4OQGA 1DJBA 5AQ9A 1SDNA 3VE4A 4P6ZS 5HAIA 4OPQA 1ODVA 3BWLA 1XFNA 2XRNA 3ZGAB 3TRCA 2JKTM 1LL5A 4H8RA 5HW3A 1XA7A 1PW1A 2Y2PA 4RYEA 3R7WA 3C7UA 5HSQA 4JKTA 3B3XA 3T1RA 2UWXA 4KZ9A 4JF4A 3N6IA 3LUQA 3UB9A 1K54C 1XGIA 4LRXC 1JWZA 4QU3A 4DN0A 3SH8A 3BLSA 3W2ZA 1XJ4A 3LIBA 1LSWA 2VGJA 5EVEA 2RCXA 2XFTA 4B93A 4II7A 4NK3A 5L07A 1K38A 3E4OA 3CWFA 4R4RA 2ZQ7A 2GDNA 1NXYA 1K0KA 2JKRM 3BM6A 3QP4A 4IUHA 1FR1A 2ZL1B 1H8YA 2Y79A 1P0ZA 5GLDA 5GLBA 3GTCA 3VFFA 2G2UA 3LGOA 2Y2MA 2V8FA 2PD7A 3PXPA 2JKGA 3S1YA 1JTGA 4M3KA 3RH8B 4KUOA 3ZG7B 4C6YA 1HZOA 2BTFP 4QJGA 5TR7A 1I2WA 5DKKA 4JPMA 1MKMA 2PYPA 1CK3A 3VE3A 4HNBA 1LL8A 4WL9A 4G3KA 2M7UA 4DXCA 5EM0A 1MWSA 1PFLA 1NYMA 4IUKA 5CECA 5DTKA 1K4EA 2XSSA 5A92A 4LRZE 1DY6A 2A2LA 3MKFA 1QMFA 3NECA 4EXOA 3E4PA 3HJKA 3HVFA 3MZEA 5FQMA 4ETXA 3GQZA 4CQHA 4S2JA 2Y2OA 1GHIA 3G31A 5AQAA 3L7HA 3UB6A 5DJUA 3NY4A 5GHYA 5F68A 5A91A 3SZTA 3VP3A 3UE0A 2OSUA 1TEMA 4B4ZA 4G3VA 2ZD8A 5HL6A 2E8IA 1DP9A 4CPKA 4DE0A 4EUZA 3ZVWA 4FSFA 4EU0A 2KOIA 4NXBA 2WZXA 4WELA 3MFXA 2ZBBA 5CHUA 3OPRA 3O3VA 3H7WB 3BY9A 5DTTA 4WBGA 3VOZA 1CF0A 1S1ZA 3IWOA 4R1GA 2KLIA 2HZ5A 1HD8A 4OH0A 3FG8A 2M7VA 5EV0A 5A90A 3F1OB 3T12B 3T4JA 2VGKA 4CLCC 2QWSA 1D1JA 3M2KA 3EWKA 2ZOIA 3AGEA 2PDRA 1JWVA 3Q82A 5FSRA 5E2GA 1MPLA 1ONGA 3OPLA 5CXWA 1FSWA 2Y2NA 4IVIA 1W79A 4KENB 4RX3A 5DJTA 4X25A 2J8YA 3BQAA 3PBRA 2W0NA 2O9CA 1YT4A 3Q7VA 4GLQA 1YSQA 3DTKA 3WS2A 1D06A 4GN2A 2DNSA 4DE1A 1BLHA 1F98A 3HUNA 2V1AA 3IWQA 2V20A 4OP8A 1NJ4A 4BL3A 2VK3A 1TVFA 3IXHA 4E3JA 1OTAA 5E2FA 2EX6A 3BLMA 3IBJA 2XA7M 3OPHA 5FI6A 2XLNA 1GA0A 4R23A 4F3LA 4K08A 4JLFA 1CI9A 1XKZA 2WADA 1FCMA 1W63M 4JF6A 4GHIA 2J3WA 1NZUA 5M1AA 1V9YA 4O7DA 2WYXA 4HJ3A 2H5SA 3SH9A 4R3JA 3PTEA 1TF1A 1BTLA 2ZMAA 3OLOA 4DMZA 2OAP1 1OTEA 4GD8A 1VETA 4HH3A 3MBZA 3S7PA 2Y4AA 3GVBA 1GSWA 1PIOA 2W1RA 2XEPA 2JKTI 4XT2A 1BZAA 4BL2A 3UY6A 3ZG5A 4KZ4A 4OLDA 2ZC5B 3T4TA 3NOUC 3VSLA 2EFUA 2H10A 5GHZA 2XD1A 5AVFA 2EX9A 1RP5A 1GSVA 1JWPA 3M6BA 3CPTB 1PRQA 2ZLYA 2W3GA 2WAEA 5DFYA 5EOOA 3KSIA 4P85A 1RGYA 3HREA 2JKRI 4LLOB 1I2SA 4YOFA 1MKIA 2P08A 1MWRA 3TG9A 4QD4A 3FC7A 3ULFA 1DJAA 1XGJA 1AWIA 1ES5A 1M40A 3QNCA 4R6LA 3G2ZA 3K2NA 1CEGA 5A8BA 3IF6C 5L09A 2Y91A 2M1CA 3IH9A 2IWBA 3PYPA 1YLPA 2HJ9C 3OBFA 3CUEC 3CHWP 4JXGA 3QP1A 3ZVTA 4KZ6A 3IXBA 4HJ4A 5L2FA 1H8MA 4HQAA 3M6HA 1BLSA 1BSGA 2FZ0A 4C75A 2W3HA 2EXBA 2V0UA 3A3FA 1Y28A 4PMAA 4Y13A 3HUMA 4GCZA 1FCOA 4S2NC 5EFWA 2BG1A 1IYOA 3LIFA 1GA9A 1RGZA 1WA9A 3MQ0A 4N9LA 5EUAA 2Y2GA 3UPOA 3KYEA 4GKUA 4WN5A 1C3BA 5CHJA 4R38A 1F5MA 2VV8A 3D3OA 4FH2A 3ITBA 2ZQ8A 5CERA 2W3FA 1K25A 2JKFA 1KVMA 5DKLA 2Y2IA 1CQAA 1KGEA 5FI7A 3FPVA 4LGWA 4WYYA 4LRYC 1NLZA 5DF8A 4CLCB 3UDIA 3LEZA 1L0EA 1LSXA 4QPRA 4UA6A 4Y0TA 3F1PA 1BULA 1PYYA 1BLCA 3E0YA 1DP6A 3A0SA 3Q1FA 4EERA 4ZJ2A 3MZFA 5DVAA 5TFQA 2PRFA 3IHBA 4HP4A 4EBNA 3NDGA 2K31A 3NULA 4OVDA 4XXRA 3TE8A 2W1TB 2PR6A 4ZRRA 1ONHA 5CTMA 2Z2LB 4KZ7A 3BRMA 4EEPA 4B4XA 4B88A 4ETZA 3GSGA 1NRFA 3RXWA 3FZCA 3CMZA 4R70A 3V5MA 2WKIA 5J7EA 5HAPA 3DTMA 1SKFA 2HJEA 1G6AA 4FOFA 4I39A 1LI9A 5EPHA 3UDFA 5FDHA 1OJGA 2EX2A 1OMEA 2C6WB 1MWUA 1FQGA 3LIAA 2HP9A 1OTDA 1SCWA 5G4ZA 1KE4A 4UQIM 4E3KA 2HF6A 1PNEA 3N7WA 5J8XA 2ZMVA 4RA7A 1VM1A 2PHYA 1PI5A 2VA0A 2L1MA 4LCMA 2V1BA 2L4RA 4MBKA 1W8YA 4X55A 4K0XA 4BBTA 2BASA 1VEUB 4KUKA 3P98A 4S2PA 3KX0X 3F1OA 3QNBA 1ALQA 5BOHA 3IQAA 2X01A 1BT5A 2KDKA 1FOFA 4DXBA 5M19A 2DMWA 2ZM2A 4D60A 3T4OA 3OPPA 1YAXA 5G4YA 3N8LA 1XP4A 3ZDJA 3IX4A 1UWPX 3CITA 5CGSA 2EXAA 4HEFA 2ZC4B 1CEFA 5E43A 4N1HA 1BLPA 3H82B 3PAGA 3ZQ5A 3TW8A 1MZUA 2V9AA 5GLAA 1ES4A 3IS2B 3BFCA 2P9VA 3PAEA 3UB7A 1Q2QA 4HH2A 3IT9A 3UPNA 2OLUA 3EGXC 1J3WA 1CJFA 4P0MA 4L9EA 2Y2JA 4HP9A 5I5LA 4E04A 1D7EA 3R4KA 4H6JB 3ISGA 3HLEA 4GS9A 4WZ5A 1XJ2A 3D9YA 2IWDA 4GW9A 1FSYA 4F94A 5IT5A 2D02A 3LIDA 3KO6A 2E8JA 5TBMB 3C8CA 1K54A 1K6SA 3VOLA 4CLCD 3WS1A 3IF6B 1T1CA 2B02A 5IU1A 1SKOB 2ZQAA 3VP2A 5IS1A 2MJ6A 3UN7A 3WS5A 4EBLA 4KQRA 3K3DA 5CX7A 3CG5A 4PM9A 1W63Q 4N9KA 3O5YA 4JGPA 5EM1A 1V9ZA 3VP0A 4DE2A 4EEUA 2YKFA 5EECA 2J7VA 1E3UA 1L2SA 4LFUA 3CLOA 5GL9A 5FAPA 3KYZA 2C5WB 4QWOA 3IXGA 3MSHA 1P97A 2WKHA 2FFFB 3G30A 5G18A 3VMAA 1OTIA 3RFBA 3LR3A 1P9RA 5HZHA 2Y2HA 5FQQA 1H0MA 3GV9A 1S4SA 3JYIA 1S6RA 4ARZB 3PBSA 1H5XA 3FKWA 3EQVA 3EGDC 4S2IA 3DWKA 2GZAA 1W7FA 5TGFA 3GMWA 5EVIA 1Q2PA 1RCJA 2B5RA 4WLAA 3IH8A 2ZC7A 4HJ6A 2B95A 2DCFA 4ZDXA 5FAQA 3U4LP 1WE4A 2HP5A 4KG5A 1QMEA 4U0TA 1NWZA 3F1NB 1OPXA 4S2OA 3MFDA 3QP8A 1FCNA 4UHUA 3UMDA 4E3OA 2PAVP 1YSPA 4BD1A 4MNRA 1MY8A 4HY8A 5LBRA 1S1YA 3MXRA 3BJNA 3O88A 1FILA 1HVBA 3NIAA 3HLCA 1KGFA 4WF0A 4IBXA 4DE3A 3BFDA 1JVJA 2WGWA 2JBFA 3ZHHA 3E2LA 3G6OA 2G2WA 3ZNTA 2XDMA 1TDGA 2GNXA 3U2AA 5E2EA 2OOLA 4NXFA 4OOYA 4N92A 4NG2A 3WS4A 2EWVA 3N4IA 3N8RA 4ZBEA 1U60A 1O7EA 1T18A 2H28A 5FQKA 5HL1A 5HDCA 4WM9A 1XPBA 2WKEA 1SHVA 2JCHA 3ITAA 1IOUA 3T4SA 3HCYA 1ZG4A 2HP6A 2IA2A 2X71A 2QMIA 1J9MA 2AVXA 2PBYA 4N1XA 4QY5A 3G2YA 2D01A 1L3LA 2J9PA 1K56D 2A24B 2XA7S 1HTZA 3BFFA 1EI5A 4PAUA 1X0OA 3E4QA 4OOMA 2R9XA 5F82A 4WMCD 1G5UA 4JGRA 5KIZA 4FD8A 3HBRA 3T1SA 3BW6A 2Y2LA 4MDZA 3RJUA 3HLDA 2DRWA 4WUJA 1PWGA 4E3IA 4CLCE 4ZJ3A 3MQQA 3MF0A 1N9BA 4X1MA 2LB9A 1ZC2A 3E2KA 3DW0A 5A93A 4JXVA 1H8ZA 1LI0A 2PD8A 4IBRA 1ZG6A 1TS0A 5JYOA 1GCEA 2Y59A 2J3TC 3BFGA 3A3IA 2L0WA 4PM5A 3IX3A 5DF7A 3IXDA 4MLLA 3MJQA 4DJ2A 4PPRA 2JN7A 5HWVA 4Q0IA 4HBTA 3RXXA 1G28A 1MXOA 1FIKA 1IYSA 3LI9A 2EFXA 4YWZA 3H82A 3TJZC 1LL9A 4E3MA 3LICA 1N9NA 2H0YA 4Q0JA 2Q9NA 3IS2A 1IKGA 5EOEA 1KOUA 2ACGA 2XQZA 4I5SA 4EUVA 3NDEA 3JPUA 1ACFA 4GNUA 3JVUA 5HD5A 3DWZA 3PBOA 4YNRA 5F1GA 5FEGA 5EE8A 2ZL1A 2QZ6A 3DTIA 1OJ5A 4K0WA 5AQ7A 2Q9MA 2VV6A 4M4XA 4NKPA 1A0KA 3UB8A 2CMNA 1TS6A 5TBMA 4OQHA 3DBAA 2IWCA 1K55A 3MMHA 3FKVA 2OAQ1 3P01A 3NHQA 4LV2A 3CUEA 2Y2KA 3BY8A 4L0LA 4MN5A 4R0QA 4EETB 3PHYA 1YMSA 5FEFA 2KX6A 1ERMA 3IBRA 3MR0A 2PU2A 3VV4A 2VV7A 1KVLA 5CEBA 4E3LA 3P7NA 5HD3A 3Q07A 3UMEA 3HJIA 1XA1A 1YLZA 4FH4A 4NXEA 3KSGA 4E6XA 3Q7VB 4BWIA 3WS0A 4Y3IA 4BMWA 5EVLA 3C4PA 4KQOA 1OT9A 4GDNA 3ZCZA 2QKPA 4OKPA 4PM8A 3QHYA 1T19A 1KE3A 3HLFA 2A3UA 3VP4A 2V0WA 2WKQA 3D72A 4GD6A 3SS3A 2Z2MB 4O01A 2LB5A 4LV0A 4F3LB 1NY0A 3PR6A 2WK0A 1YPRA 4GHIB 2B18A 3EEHA 3MQOA 1LT0A 4OP5A 3FWLA 1GSXA 3G35A 3LR4A 1K57C 4PM6A 1TS8A 3W4QA 3MXQA 4FUWA 2Y2QA 4OQ0A 2I9VA 3EEAA 3V39A 1S67L 1VETB 3FYZA 2WGVA 5GHXA 2EA9A 3W8KA 1S66L 1DRMA 2XH9A 4KZ8A 5HFOA 5MC7A 2HDUA 1YLWA 3UE6A 3L9KA 4XT2B 1KDSA 3CAXA 1BUEA 1NYYA 2WZZA 4FCFA 5HARA 1EROA 3NOPC 2QHKA 5L8MA 3H7WA 4MN6A 3A3JA 1IYQA 3EOIA 2VGLM 2VEAA 3Q81A 2I72A 3C7VA 3LIEA 3NC8A 5JYPA 4P6ZM 1I5QA 5E2HA 4UQIS 2OLVA 4S2KA 1ESUA 4O0PA 4MCWA 5CGXA 4DJ3A 1O07A 1FR6A 4BD0A 4R3AA 3HUOA 3T4QA 1K4FA 4ID4A 4Y2FA 1SDEA 3OCLA 5AJGA 3ICYA 3N8SA 3QP5A 4G3WA 4PKYA 3O86A 1F9IA 4JBFA 1YLYA 2ZQDA 4WZ5C 3C38A 5FQIA 3V3RA 1VHMA 4LCLA 4E6WA 1ZTUA 3BEBA 1T1BA 2EWWA 5KMWA 3WRZA 1VB6A 4S2MA 2JE5A 3H9WA 1XFQA 4PHTA 3DAVA 5F83A 1S0WA 3S22A 1UGUA 2PYRA 3SS5A 4MN7A
chains in the Genus database with same CATH topology
1OPXA 1MC0A 3NOTC 3UMDA 1LSVA 1IFQA 1YSPA 3C2WA 3OC2A 2INWA 5HPIA 2ZOHA 2VJWA 4B9OA 4NXGA 1N9LA 5HWWA 1OTBA 3BQ8A 5AVFA 1JNUA 4HY8A 5LBRA 1S1YA 2O9AA 3KSFA 3BJNA 1GSVA 3T50A 4WF0A 2A24A 4HIAA 2W3GA 5FL3A 4ARZA 1P9WA 3PBQA 2P04A 4RQ9A 3G6OA 5DFYA 3KSIA 3S7QA 2GNXA 4BJPA 3U2AA 5HDDA 4JGQA 3SW1A 2JKRI 1XJ3A 1EW0A 2OOLA 3LI8A 3OCNA 4LLOB 4NXFA 4BBUA 4YOFA 2NUPC 2EWVA 2PR5A 2P08A 3FC7A 2R78A 3ULFA 1T18A 2WKPA 1S4RA 2H28A 2HV1A 5DFXA 5HDCA 4EQ1A 1YKDA 4AFIA 5HDSA 2VKSA 4R6LA 3K2NA 3F1NA 2XROA 5A8BA 2W3DA 2M1CA 3PYPA 2W3EA 2HJ9C 3OBFA 3CUEC 5AVEA 1IOUA 4GJ4A 3B33A 3T4SA 2P7JA 3HCYA 1OT6A 2Z6CA 2IA2A 4HJ4A 3KSHA 3LR0A 2PT7A 4EW7A 5F6AA 1H8MA 4HQAA 2VGLS 2FZ0A 4IHQA 2D01A 2W3HA 2V0UA 2A24B 3F1PB 3VE4A 4P6ZS 2XA7S 4OOLA 1Y28A 2VLGA 1ODVA 3BWLA 1XFNA 2XRNA 4GCZA 5EFWA 3TRCA 4PAUA 3LIFA 1X0OA 2JKTM 1WA9A 3KYQA 4KQDA 3MQ0A 3E4QA 4OOMA 2O0YA 3B47A 4Z1WA 4I38A 4WN5A 3R7WA 1NRJA 5HSQA 3EQUA 4R38A 3LFVA 1F5MA 4MMNA 3S7NA 4JGRA 2VV8A 3D3OA 5KIZA 1T1AA 2W3FA 3LUQA 3UB9A 3BW6A 3UE3A 5DF9A 4LRXC 4MDZA 5DKLA 2HGVA 4NEED 3T4KA 4DN0A 4WUJA 4CLCE 3FPVA 3W2ZA 1XJ4A 3LIBA 3GECA 1LSWA 3MQQA 4HHDA 3MF0A 4LRYC 1NLZA 3E98A 4B93A 4II7A 5J3WA 2LB9A 4CLCB 2GJ3A 1LSXA 3CWFA 2JHEA 3E4OA 4QPRA 3B42A 2PD8A 3F1PA 2NUTC 1TS0A 3A0RA 2JKRM 2OWJA 2J3TC 3E0YA 1DP6A 4IUHA 3A0SA 5C5KA 4EERA 2Y79A 5F5YA 4HP4A 1STZA 2L0WA 2K31A 2J3TD 2QYBA 1P0ZA 5KSHA 3TE8A 2W1TB 2PR6A 4L9FA 4ZRRA 2PD7A 5HWTA 3MJQA 3PBTA 3PXPA 4DJ2A 1UWNX 4EEPA 4ETZA 4L9GA 2JN7A 3R7WB 5HWVA 3RH8B 4Q0IA 1TD5A 4KUOA 4R70A 5TJJA 5J7EA 1G28A 2VX8A 2HJEA 4FOFA 3LI9A 4I39A 5DKKA 4YWZA 3H82A 1MKMA 2PYPA 3TJZC 2VZWA 3LICA 1N9NA 3VE3A 1OJGA 4HNBA 4Q0JA 3ZYTA 3IS2A 1LL8A 4WL9A 3FPWA 1KOUA 3LIAA 4G3KA 4I5SA 4EUVA 4CLCA 1OTDA 2M7UA 4ME4A 5G4ZA 4UQIM 2HF6A 2O9BA 4IUKA 4HOIA 2K2NA 2K7SA 4I3JA 3JVUA 5HD5A 3PBOA 2ZMVA 2XSSA 4YNRA 2PHYA 4LRZE 2VA0A 2L1MA 2V1BA 3JVVA 2L4RA 2A2LA 2YKHA 1OJ5A 4BBTA 4EXOA 2BASA 4WEJA 2VV6A 3E4PA 2QJ5A 3S7OA 3HJKA 4KUKA 4M4XA 4NKPA 4GS9B 3KX0X 3F1OA 2W1TA 1TS7A 3UB8A 2CMNA 1TS6A 5TBMA 3DBAA 4ETXA 2KDKA 4PKYG 2DMWA 3MMHA 4CQHA 2OAQ1 3GDIA 3T4OA 1YAXA 5G4YA 3P01A 3NHQA 3UB6A 1XJ6A 5DJUA 3CUEA 3BY8A 4L0LA 4MN5A 4EETB 3LR5A 3PHYA 5F68A 1UWPX 2J80A 3CITA 2O99A 2KX6A 3IBRA 3MR0A 4G3VA 5HL6A 3VV4A 2VV7A 3H82B 3ZQ5A 1DP8A 3TW8A 4IJGA 3P7NA 3OOVA 1MZUA 1N9OA 2V9AA 5HD3A 1NLYA 1DP9A 3UMEA 3HJIA 4NXEA 3IS2B 2W27A 3KSGA 4FSFA 3UB7A 4HH2A 3V67A 2KOIA 4BWIA 4NXBA 4WELA 4EU0A 3MFXA 2ZBBA 4Y3IA 4BMWA 4KQOA 1OT9A 3NJAA 3H7WB 3BY9A 3RTYA 3EGXC 2QKPA 1S1ZA 1T19A 4L9EA 4Q0HA 2KLIA 4HP9A 5I5LA 4E04A 1D7EA 2V0WA 2WKQA 3R4KA 3D72A 4H6JB 4GS9A 3FG8A 1XJ2A 2M7VA 4GW9A 4O01A 2LB5A 4F3LB 3F1OB 5IT5A 3PR6A 2D02A 3LIDA 3KO6A 3T4JA 3K3CA 4CLCC 1H3QA 3C8CA 4GHIB 2B18A 2QWSA 5TBMB 3EEHA 5F69A 3MQOA 3T4LA 1LT0A 3EWKA 1GSXA 2ZOIA 3LR4A 2PDRA 3VOLA 4CLCD 1TS8A 2Z6DA 3MXQA 1T1CA 2B02A 3LYXA 2I9VA 3EEAA 5IU1A 1S67L 2EA9A 5IS1A 1S66L 1DRMA 4EESA 2MJ6A 5DJTA 4UEYA 3BQAA 3PBRA 2W0NA 5MC7A 3K3DA 3UE6A 5CX7A 2O9CA 4XT2B 1W63Q 3CAXA 3O5YA 4JGPA 3A0VA 4GLQA 1YSQA 1D06A 4I3AA 1V9ZA 2G7UA 3C30A 2Y8HA 3NOPC 2QHKA 5L8MA 3H7WA 4MN6A 1F98A 4I3IA 4EEUA 2YKFA 2V1AA 3EOIA 2VGLM 2VEAA 3PBNA 3CI6A 3LIEA 4BBVA 3CLOA 1OTAA 2QJ7A 3KYZA 5HPFA 3IBJA 4H6JA 1BYWA 4P6ZM 2XA7M 1P97A 4UQIS 4F3LA 4K08A 1OTIA 4O0PA 5J4EA 3RFBA 3LR3A 1W63M 1P9RA 4MCWA 5HZHA 2FH5A 4GHIA 2J3WA 4DJ3A 1V9YA 4R3AA 3T4QA 1S4SA 4HJ3A 4ARZB 3PBSA 4Y2FA 4LPZA 3OCLA 1TF1A 3OLOA 4DMZA 5AJGA 2OAP1 3ICYA 1OTEA 1ZHHB 3EQVA 5K5BA 3EGDC 4G3WA 4PKYA 4HH3A 4JGOA 2ZMFA 3S7PA 2WKRA 1F9IA 2GZAA 1GSWA 4HI4A 2W1RA 3C38A 2JKTI 4XT2A 4WLAA 2GX5A 1VHMA 1G6OA 4HJ6A 4WEKA 1ZTUA 1T1BA 2EWWA 1VB6A 3H9WA 4PHTA 1XFQA 4Y5FA 1UGUA 3T4TA 3NOUC 2PYRA 2OWHA 4O8GA 1NWZA 4MN7A 3F1NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W63 Q;  2JKT M;  4UQI S;  2JKR M;  4NEE D;  1W63 M;  4UQI M;  2FH5 A;  2HF6 A;  2VGL S;  2JKT I;  1NRJ A;  2JKR I;  2VGL M;  3TJZ C;  4P6Z S;  2XA7 S;  5MC7 A;  4P6Z M;  2XA7 M; 
#chains in the Genus database with same CATH topology
 3NBL A;  1E4D A;  1MC0 A;  3NOT C;  3C2W A;  4JXS A;  2INW A;  5HPI A;  4EV4 A;  4B9O A;  3V50 A;  1OTB A;  5CTN A;  4BLM A;  3BQ8 A;  2XFS A;  2O9A A;  2WAF A;  3BEC A;  3D4F A;  2QPN A;  1PZP A;  4MBH A;  1PZO A;  2V1Z A;  3T50 A;  1IEM A;  1KE0 A;  2H0T A;  5FI2 A;  3FV7 A;  3VOY A;  2A49 A;  3UB5 P;  2A24 A;  3NI9 A;  4KQQ A;  5FL3 A;  2PBD P;  2P04 A;  4RQ9 A;  1AXB A;  4U3T A;  3S7Q A;  1IKI A;  3SW1 A;  1XJ3 A;  1EW0 A;  4LEN A;  4BBU A;  4OLG A;  2NUP C;  4ESP A;  3LCE A;  1VQQ A;  2OV5 A;  1PWC A;  2ZM8 A;  3MXS A;  2ZM0 A;  4WZ4 A;  2R78 A;  1ERQ A;  5CGW A;  2WKP A;  5U47 A;  1L0F A;  3IF5 A;  1LHY A;  1YKD A;  4AFI A;  1KDW A;  2VKS A;  2XRO A;  2W3D A;  2ZC6 B;  1IYP A;  1F2K A;  2XGN A;  3IX8 A;  2JC7 A;  4GJ4 A;  3B33 A;  1XX2 A;  2P7J A;  3V3S A;  2P74 A;  4X53 A;  1N4O A;  2Z6C A;  4KZB A;  5EVI C;  5F1F A;  1E25 A;  1Z6F A;  4X56 A;  4DKI A;  3CPT A;  4FTX A;  3ZG8 B;  3GR2 A;  4IHQ A;  1MBL A;  2RL3 A;  4X69 A;  1WYB A;  3T1X A;  1PWD A;  3C4O A;  3F1P B;  4ZTK A;  4P87 A;  4OOL A;  2ZQC A;  2VLG A;  2ZC3 B;  1ESI A;  4BEN A;  1L0D A;  4E3N A;  3LO7 A;  3KYQ A;  4KQD A;  3TOI A;  5FAT A;  4XUZ A;  3W4O A;  4DRT A;  2O0Y A;  3B47 A;  4Z1W A;  4I38 A;  1YMX A;  1NRJ A;  5DTS A;  3EQU A;  3LFV A;  4MMN A;  3S7N A;  4MEZ A;  4R3B A;  1T1A A;  3UE3 A;  5DF9 A;  3P09 A;  4BQM A;  2HGV A;  4NEE D;  3T4K A;  4S2L A;  1ZKJ A;  3M2J A;  3QP2 A;  3GEC A;  4HHD A;  1W5D A;  3E98 A;  5J3W A;  2HDS A;  1LLB A;  3CZD A;  5L10 A;  4DDS A;  2GJ3 A;  5FQJ A;  4D2O A;  2JHE A;  3B42 A;  3UPP A;  4RX2 A;  5FDS A;  1KGG A;  2HPB A;  2NUT C;  4JF5 A;  3A0R A;  1WYC A;  2OWJ A;  4Y17 A;  5C5K A;  5F5Y A;  1STZ A;  4GB7 A;  2J3T D;  2QYB A;  5KSH A;  1MWT A;  4KZA A;  3MS6 A;  1W8Q A;  4L9F A;  5HAQ A;  3LY4 A;  1Y4O A;  5HWT A;  5AQB A;  3PBT A;  5HX9 A;  1UWN X;  4L9G A;  2ZQ9 A;  3R7W B;  1TD5 A;  5TJJ A;  2VX8 A;  5FA7 A;  1G68 A;  4A5R A;  5GLC A;  4QHC A;  2VZW A;  4Q8I A;  4Z9Q A;  2UV0 E;  3ZYT A;  2XF3 A;  4ZAM A;  3FPW A;  4CLC A;  4ME4 A;  2P9V B;  2O9B A;  3OZH A;  4HOI A;  2K2N A;  2K7S A;  4I3J A;  3A3E A;  3AGF A;  3JVV A;  4OON A;  2YKH A;  2X02 A;  4WEJ A;  2QJ5 A;  3S7O A;  5KSC A;  4GS9 B;  2W1T A;  1TS7 A;  3G32 A;  3ZG0 A;  3UDX A;  4ZJ1 A;  4PKY G;  4OPZ A;  3UNW A;  3GDI A;  4CJN A;  1Y54 A;  1XJ6 A;  3LR5 A;  3GRJ A;  2J80 A;  4P6B A;  2O99 A;  2CC1 A;  4PM7 A;  3A3D A;  4OPY A;  3WWX A;  1DP8 A;  1YLT A;  4IJG A;  3OOV A;  1N9O A;  4Y7P A;  2Q0O A;  1NLY A;  1M6K A;  1TDL A;  1K6R A;  2W27 A;  3V67 A;  4MBF A;  2HDR A;  4Y0O A;  3VSK A;  3NJA A;  3SOI A;  1SZV A;  3RTY A;  4YIN A;  4C3Q A;  3DTE A;  3W4P A;  4KZ3 A;  2PU4 A;  4Q0H A;  4DF6 A;  3NCK A;  1VEU A;  3O87 A;  3VFH A;  3S4X A;  1DJC A;  3SH7 A;  1PW8 A;  3K3C A;  3G34 A;  1H3Q A;  2WUQ A;  5F69 A;  3T4L A;  2Y55 A;  3IHA A;  4HES A;  2R9W A;  3UE1 A;  2Z6D A;  3ZFZ A;  3LYX A;  1XXM A;  2BLS A;  4GDB A;  1L0G A;  3UO9 A;  4UAA A;  1YM1 A;  4EQI A;  4EES A;  4YFM A;  4UEY A;  3IWI A;  4HBU A;  1YLJ A;  5EVI B;  1NZO A;  4NET A;  4KG2 A;  4OPR A;  3A0V A;  1K55 C;  4EBP A;  2XD5 A;  4I3A A;  5IHV A;  2G7U A;  3C30 A;  2Y8H A;  4I3I A;  5CED A;  1CI8 A;  3PBN A;  3CI6 A;  4BBV A;  2QJ7 A;  5HPF A;  2V2F F;  2XR0 A;  3C5A A;  3HLB A;  4H6J A;  1BYW A;  3CJM A;  5CHM A;  2FFY A;  4JXW A;  5J4E A;  4UA7 A;  2FH5 A;  3HL9 A;  4EWF A;  2EX8 A;  2WGW B;  3IF6 A;  4LPZ A;  3WRT A;  5I94 A;  1ES2 A;  1ZHH B;  4K91 A;  3G4P A;  5K5B A;  1SKO A;  4JGO A;  2ZMF A;  2WKR A;  4HI4 A;  3BYD A;  4R4S A;  2GX5 A;  1K56 A;  4QY6 A;  1G6O A;  4WEK A;  3QP6 A;  3SS4 A;  4XUX A;  1IEL A;  4Y5F A;  4OQI A;  3AGD A;  4X68 A;  1YQS A;  3ZG9 B;  2OWH A;  4O8G A;  4KG6 A;  3BFE A;  4X1L A;  4S2N A;  1LSV A;  1IFQ A;  3OC2 A;  4QB8 A;  4X6T A;  2ZOH A;  2VJW A;  1GHM A;  4NXG A;  4WMC A;  1N9L A;  5HWW A;  1JNU A;  3KSF A;  4RVA A;  2ZJ9 A;  1ES3 A;  1HLU P;  3T1Q B;  1Z09 A;  3ZNY A;  3HLG A;  4HIA A;  4ARZ A;  1P9W A;  3PBQ A;  3TSG A;  4BJP A;  4UA9 A;  5HDD A;  4JGQ A;  3Q7Z A;  5CRF A;  3OCN A;  1JTD A;  3LI8 A;  3MZD A;  4IED A;  1E3U D;  2PR5 A;  4GZB A;  5FQ9 A;  3LEQ A;  1S4R A;  4Y0U A;  2HV1 A;  4DDY A;  5DFX A;  3HLW A;  4LV1 A;  4EQ1 A;  2HDQ A;  3LY3 A;  4Y15 A;  5HDS A;  2XK1 A;  5FAS A;  4LV3 A;  3F1N A;  5D3O A;  4GOG A;  4KZ5 A;  2W3E A;  2WGI A;  5FAO A;  1PI4 A;  5KZH A;  2V8C A;  5AVE A;  3VP1 A;  3MKE A;  3I7J A;  1OT6 A;  1EWZ A;  5M18 A;  4U0X A;  3KSH A;  3LR0 A;  2PT7 A;  4EW7 A;  4IVK A;  5F6A A;  1GHP A;  1K57 A;  2VGL S;  5EVI D;  2J9O A;  4OQG A;  1DJB A;  5AQ9 A;  1SDN A;  3VE4 A;  4P6Z S;  5HAI A;  4OPQ A;  1ODV A;  3BWL A;  1XFN A;  2XRN A;  3ZGA B;  3TRC A;  2JKT M;  1LL5 A;  4H8R A;  5HW3 A;  1XA7 A;  1PW1 A;  2Y2P A;  4RYE A;  3R7W A;  3C7U A;  5HSQ A;  4JKT A;  3B3X A;  3T1R A;  2UWX A;  4KZ9 A;  4JF4 A;  3N6I A;  3LUQ A;  3UB9 A;  1K54 C;  1XGI A;  4LRX C;  1JWZ A;  4QU3 A;  4DN0 A;  3SH8 A;  3BLS A;  3W2Z A;  1XJ4 A;  3LIB A;  1LSW A;  2VGJ A;  5EVE A;  2RCX A;  2XFT A;  4B93 A;  4II7 A;  4NK3 A;  5L07 A;  1K38 A;  3E4O A;  3CWF A;  4R4R A;  2ZQ7 A;  2GDN A;  1NXY A;  1K0K A;  2JKR M;  3BM6 A;  3QP4 A;  4IUH A;  1FR1 A;  2ZL1 B;  1H8Y A;  2Y79 A;  1P0Z A;  5GLD A;  5GLB A;  3GTC A;  3VFF A;  2G2U A;  3LGO A;  2Y2M A;  2V8F A;  2PD7 A;  3PXP A;  2JKG A;  3S1Y A;  1JTG A;  4M3K A;  3RH8 B;  4KUO A;  3ZG7 B;  4C6Y A;  1HZO A;  2BTF P;  4QJG A;  5TR7 A;  1I2W A;  5DKK A;  4JPM A;  1MKM A;  2PYP A;  1CK3 A;  3VE3 A;  4HNB A;  1LL8 A;  4WL9 A;  4G3K A;  2M7U A;  4DXC A;  5EM0 A;  1MWS A;  1PFL A;  1NYM A;  4IUK A;  5CEC A;  5DTK A;  1K4E A;  2XSS A;  5A92 A;  4LRZ E;  1DY6 A;  2A2L A;  3MKF A;  1QMF A;  3NEC A;  4EXO A;  3E4P A;  3HJK A;  3HVF A;  3MZE A;  5FQM A;  4ETX A;  3GQZ A;  4CQH A;  4S2J A;  2Y2O A;  1GHI A;  3G31 A;  5AQA A;  3L7H A;  3UB6 A;  5DJU A;  3NY4 A;  5GHY A;  5F68 A;  5A91 A;  3SZT A;  3VP3 A;  3UE0 A;  2OSU A;  1TEM A;  4B4Z A;  4G3V A;  2ZD8 A;  5HL6 A;  2E8I A;  1DP9 A;  4CPK A;  4DE0 A;  4EUZ A;  3ZVW A;  4FSF A;  4EU0 A;  2KOI A;  4NXB A;  2WZX A;  4WEL A;  3MFX A;  2ZBB A;  5CHU A;  3OPR A;  3O3V A;  3H7W B;  3BY9 A;  5DTT A;  4WBG A;  3VOZ A;  1CF0 A;  1S1Z A;  3IWO A;  4R1G A;  2KLI A;  2HZ5 A;  1HD8 A;  4OH0 A;  3FG8 A;  2M7V A;  5EV0 A;  5A90 A;  3F1O B;  3T12 B;  3T4J A;  2VGK A;  4CLC C;  2QWS A;  1D1J A;  3M2K A;  3EWK A;  2ZOI A;  3AGE A;  2PDR A;  1JWV A;  3Q82 A;  5FSR A;  5E2G A;  1MPL A;  1ONG A;  3OPL A;  5CXW A;  1FSW A;  2Y2N A;  4IVI A;  1W79 A;  4KEN B;  4RX3 A;  5DJT A;  4X25 A;  2J8Y A;  3BQA A;  3PBR A;  2W0N A;  2O9C A;  1YT4 A;  3Q7V A;  4GLQ A;  1YSQ A;  3DTK A;  3WS2 A;  1D06 A;  4GN2 A;  2DNS A;  4DE1 A;  1BLH A;  1F98 A;  3HUN A;  2V1A A;  3IWQ A;  2V20 A;  4OP8 A;  1NJ4 A;  4BL3 A;  2VK3 A;  1TVF A;  3IXH A;  4E3J A;  1OTA A;  5E2F A;  2EX6 A;  3BLM A;  3IBJ A;  2XA7 M;  3OPH A;  5FI6 A;  2XLN A;  1GA0 A;  4R23 A;  4F3L A;  4K08 A;  4JLF A;  1CI9 A;  1XKZ A;  2WAD A;  1FCM A;  1W63 M;  4JF6 A;  4GHI A;  2J3W A;  1NZU A;  5M1A A;  1V9Y A;  4O7D A;  2WYX A;  4HJ3 A;  2H5S A;  3SH9 A;  4R3J A;  3PTE A;  1TF1 A;  1BTL A;  2ZMA A;  3OLO A;  4DMZ A;  2OAP 1;  1OTE A;  4GD8 A;  1VET A;  4HH3 A;  3MBZ A;  3S7P A;  2Y4A A;  3GVB A;  1GSW A;  1PIO A;  2W1R A;  2XEP A;  2JKT I;  4XT2 A;  1BZA A;  4BL2 A;  3UY6 A;  3ZG5 A;  4KZ4 A;  4OLD A;  2ZC5 B;  3T4T A;  3NOU C;  3VSL A;  2EFU A;  2H10 A;  5GHZ A;  2XD1 A;  5AVF A;  2EX9 A;  1RP5 A;  1GSV A;  1JWP A;  3M6B A;  3CPT B;  1PRQ A;  2ZLY A;  2W3G A;  2WAE A;  5DFY A;  5EOO A;  3KSI A;  4P85 A;  1RGY A;  3HRE A;  2JKR I;  4LLO B;  1I2S A;  4YOF A;  1MKI A;  2P08 A;  1MWR A;  3TG9 A;  4QD4 A;  3FC7 A;  3ULF A;  1DJA A;  1XGJ A;  1AWI A;  1ES5 A;  1M40 A;  3QNC A;  4R6L A;  3G2Z A;  3K2N A;  1CEG A;  5A8B A;  3IF6 C;  5L09 A;  2Y91 A;  2M1C A;  3IH9 A;  2IWB A;  3PYP A;  1YLP A;  2HJ9 C;  3OBF A;  3CUE C;  3CHW P;  4JXG A;  3QP1 A;  3ZVT A;  4KZ6 A;  3IXB A;  4HJ4 A;  5L2F A;  1H8M A;  4HQA A;  3M6H A;  1BLS A;  1BSG A;  2FZ0 A;  4C75 A;  2W3H A;  2EXB A;  2V0U A;  3A3F A;  1Y28 A;  4PMA A;  4Y13 A;  3HUM A;  4GCZ A;  1FCO A;  4S2N C;  5EFW A;  2BG1 A;  1IYO A;  3LIF A;  1GA9 A;  1RGZ A;  1WA9 A;  3MQ0 A;  4N9L A;  5EUA A;  2Y2G A;  3UPO A;  3KYE A;  4GKU A;  4WN5 A;  1C3B A;  5CHJ A;  4R38 A;  1F5M A;  2VV8 A;  3D3O A;  4FH2 A;  3ITB A;  2ZQ8 A;  5CER A;  2W3F A;  1K25 A;  2JKF A;  1KVM A;  5DKL A;  2Y2I A;  1CQA A;  1KGE A;  5FI7 A;  3FPV A;  4LGW A;  4WYY A;  4LRY C;  1NLZ A;  5DF8 A;  4CLC B;  3UDI A;  3LEZ A;  1L0E A;  1LSX A;  4QPR A;  4UA6 A;  4Y0T A;  3F1P A;  1BUL A;  1PYY A;  1BLC A;  3E0Y A;  1DP6 A;  3A0S A;  3Q1F A;  4EER A;  4ZJ2 A;  3MZF A;  5DVA A;  5TFQ A;  2PRF A;  3IHB A;  4HP4 A;  4EBN A;  3NDG A;  2K31 A;  3NUL A;  4OVD A;  4XXR A;  3TE8 A;  2W1T B;  2PR6 A;  4ZRR A;  1ONH A;  5CTM A;  2Z2L B;  4KZ7 A;  3BRM A;  4EEP A;  4B4X A;  4B88 A;  4ETZ A;  3GSG A;  1NRF A;  3RXW A;  3FZC A;  3CMZ A;  4R70 A;  3V5M A;  2WKI A;  5J7E A;  5HAP A;  3DTM A;  1SKF A;  2HJE A;  1G6A A;  4FOF A;  4I39 A;  1LI9 A;  5EPH A;  3UDF A;  5FDH A;  1OJG A;  2EX2 A;  1OME A;  2C6W B;  1MWU A;  1FQG A;  3LIA A;  2HP9 A;  1OTD A;  1SCW A;  5G4Z A;  1KE4 A;  4UQI M;  4E3K A;  2HF6 A;  1PNE A;  3N7W A;  5J8X A;  2ZMV A;  4RA7 A;  1VM1 A;  2PHY A;  1PI5 A;  2VA0 A;  2L1M A;  4LCM A;  2V1B A;  2L4R A;  4MBK A;  1W8Y A;  4X55 A;  4K0X A;  4BBT A;  2BAS A;  1VEU B;  4KUK A;  3P98 A;  4S2P A;  3KX0 X;  3F1O A;  3QNB A;  1ALQ A;  5BOH A;  3IQA A;  2X01 A;  1BT5 A;  2KDK A;  1FOF A;  4DXB A;  5M19 A;  2DMW A;  2ZM2 A;  4D60 A;  3T4O A;  3OPP A;  1YAX A;  5G4Y A;  3N8L A;  1XP4 A;  3ZDJ A;  3IX4 A;  1UWP X;  3CIT A;  5CGS A;  2EXA A;  4HEF A;  2ZC4 B;  1CEF A;  5E43 A;  4N1H A;  1BLP A;  3H82 B;  3PAG A;  3ZQ5 A;  3TW8 A;  1MZU A;  2V9A A;  5GLA A;  1ES4 A;  3IS2 B;  3BFC A;  2P9V A;  3PAE A;  3UB7 A;  1Q2Q A;  4HH2 A;  3IT9 A;  3UPN A;  2OLU A;  3EGX C;  1J3W A;  1CJF A;  4P0M A;  4L9E A;  2Y2J A;  4HP9 A;  5I5L A;  4E04 A;  1D7E A;  3R4K A;  4H6J B;  3ISG A;  3HLE A;  4GS9 A;  4WZ5 A;  1XJ2 A;  3D9Y A;  2IWD A;  4GW9 A;  1FSY A;  4F94 A;  5IT5 A;  2D02 A;  3LID A;  3KO6 A;  2E8J A;  5TBM B;  3C8C A;  1K54 A;  1K6S A;  3VOL A;  4CLC D;  3WS1 A;  3IF6 B;  1T1C A;  2B02 A;  5IU1 A;  1SKO B;  2ZQA A;  3VP2 A;  5IS1 A;  2MJ6 A;  3UN7 A;  3WS5 A;  4EBL A;  4KQR A;  3K3D A;  5CX7 A;  3CG5 A;  4PM9 A;  1W63 Q;  4N9K A;  3O5Y A;  4JGP A;  5EM1 A;  1V9Z A;  3VP0 A;  4DE2 A;  4EEU A;  2YKF A;  5EEC A;  2J7V A;  1E3U A;  1L2S A;  4LFU A;  3CLO A;  5GL9 A;  5FAP A;  3KYZ A;  2C5W B;  4QWO A;  3IXG A;  3MSH A;  1P97 A;  2WKH A;  2FFF B;  3G30 A;  5G18 A;  3VMA A;  1OTI A;  3RFB A;  3LR3 A;  1P9R A;  5HZH A;  2Y2H A;  5FQQ A;  1H0M A;  3GV9 A;  1S4S A;  3JYI A;  1S6R A;  4ARZ B;  3PBS A;  1H5X A;  3FKW A;  3EQV A;  3EGD C;  4S2I A;  3DWK A;  2GZA A;  1W7F A;  5TGF A;  3GMW A;  5EVI A;  1Q2P A;  1RCJ A;  2B5R A;  4WLA A;  3IH8 A;  2ZC7 A;  4HJ6 A;  2B95 A;  2DCF A;  4ZDX A;  5FAQ A;  3U4L P;  1WE4 A;  2HP5 A;  4KG5 A;  1QME A;  4U0T A;  1NWZ A;  3F1N B;  1OPX A;  4S2O A;  3MFD A;  3QP8 A;  1FCN A;  4UHU A;  3UMD A;  4E3O A;  2PAV P;  1YSP A;  4BD1 A;  4MNR A;  1MY8 A;  4HY8 A;  5LBR A;  1S1Y A;  3MXR A;  3BJN A;  3O88 A;  1FIL A;  1HVB A;  3NIA A;  3HLC A;  1KGF A;  4WF0 A;  4IBX A;  4DE3 A;  3BFD A;  1JVJ A;  2WGW A;  2JBF A;  3ZHH A;  3E2L A;  3G6O A;  2G2W A;  3ZNT A;  2XDM A;  1TDG A;  2GNX A;  3U2A A;  5E2E A;  2OOL A;  4NXF A;  4OOY A;  4N92 A;  4NG2 A;  3WS4 A;  2EWV A;  3N4I A;  3N8R A;  4ZBE A;  1U60 A;  1O7E A;  1T18 A;  2H28 A;  5FQK A;  5HL1 A;  5HDC A;  4WM9 A;  1XPB A;  2WKE A;  1SHV A;  2JCH A;  3ITA A;  1IOU A;  3T4S A;  3HCY A;  1ZG4 A;  2HP6 A;  2IA2 A;  2X71 A;  2QMI A;  1J9M A;  2AVX A;  2PBY A;  4N1X A;  4QY5 A;  3G2Y A;  2D01 A;  1L3L A;  2J9P A;  1K56 D;  2A24 B;  2XA7 S;  1HTZ A;  3BFF A;  1EI5 A;  4PAU A;  1X0O A;  3E4Q A;  4OOM A;  2R9X A;  5F82 A;  4WMC D;  1G5U A;  4JGR A;  5KIZ A;  4FD8 A;  3HBR A;  3T1S A;  3BW6 A;  2Y2L A;  4MDZ A;  3RJU A;  3HLD A;  2DRW A;  4WUJ A;  1PWG A;  4E3I A;  4CLC E;  4ZJ3 A;  3MQQ A;  3MF0 A;  1N9B A;  4X1M A;  2LB9 A;  1ZC2 A;  3E2K A;  3DW0 A;  5A93 A;  4JXV A;  1H8Z A;  1LI0 A;  2PD8 A;  4IBR A;  1ZG6 A;  1TS0 A;  5JYO A;  1GCE A;  2Y59 A;  2J3T C;  3BFG A;  3A3I A;  2L0W A;  4PM5 A;  3IX3 A;  5DF7 A;  3IXD A;  4MLL A;  3MJQ A;  4DJ2 A;  4PPR A;  2JN7 A;  5HWV A;  4Q0I A;  4HBT A;  3RXX A;  1G28 A;  1MXO A;  1FIK A;  1IYS A;  3LI9 A;  2EFX A;  4YWZ A;  3H82 A;  3TJZ C;  1LL9 A;  4E3M A;  3LIC A;  1N9N A;  2H0Y A;  4Q0J A;  2Q9N A;  3IS2 A;  1IKG A;  5EOE A;  1KOU A;  2ACG A;  2XQZ A;  4I5S A;  4EUV A;  3NDE A;  3JPU A;  1ACF A;  4GNU A;  3JVU A;  5HD5 A;  3DWZ A;  3PBO A;  4YNR A;  5F1G A;  5FEG A;  5EE8 A;  2ZL1 A;  2QZ6 A;  3DTI A;  1OJ5 A;  4K0W A;  5AQ7 A;  2Q9M A;  2VV6 A;  4M4X A;  4NKP A;  1A0K A;  3UB8 A;  2CMN A;  1TS6 A;  5TBM A;  4OQH A;  3DBA A;  2IWC A;  1K55 A;  3MMH A;  3FKV A;  2OAQ 1;  3P01 A;  3NHQ A;  4LV2 A;  3CUE A;  2Y2K A;  3BY8 A;  4L0L A;  4MN5 A;  4R0Q A;  4EET B;  3PHY A;  1YMS A;  5FEF A;  2KX6 A;  1ERM A;  3IBR A;  3MR0 A;  2PU2 A;  3VV4 A;  2VV7 A;  1KVL A;  5CEB A;  4E3L A;  3P7N A;  5HD3 A;  3Q07 A;  3UME A;  3HJI A;  1XA1 A;  1YLZ A;  4FH4 A;  4NXE A;  3KSG A;  4E6X A;  3Q7V B;  4BWI A;  3WS0 A;  4Y3I A;  4BMW A;  5EVL A;  3C4P A;  4KQO A;  1OT9 A;  4GDN A;  3ZCZ A;  2QKP A;  4OKP A;  4PM8 A;  3QHY A;  1T19 A;  1KE3 A;  3HLF A;  2A3U A;  3VP4 A;  2V0W A;  2WKQ A;  3D72 A;  4GD6 A;  3SS3 A;  2Z2M B;  4O01 A;  2LB5 A;  4LV0 A;  4F3L B;  1NY0 A;  3PR6 A;  2WK0 A;  1YPR A;  4GHI B;  2B18 A;  3EEH A;  3MQO A;  1LT0 A;  4OP5 A;  3FWL A;  1GSX A;  3G35 A;  3LR4 A;  1K57 C;  4PM6 A;  1TS8 A;  3W4Q A;  3MXQ A;  4FUW A;  2Y2Q A;  4OQ0 A;  2I9V A;  3EEA A;  3V39 A;  1S67 L;  1VET B;  3FYZ A;  2WGV A;  5GHX A;  2EA9 A;  3W8K A;  1S66 L;  1DRM A;  2XH9 A;  4KZ8 A;  5HFO A;  5MC7 A;  2HDU A;  1YLW A;  3UE6 A;  3L9K A;  4XT2 B;  1KDS A;  3CAX A;  1BUE A;  1NYY A;  2WZZ A;  4FCF A;  5HAR A;  1ERO A;  3NOP C;  2QHK A;  5L8M A;  3H7W A;  4MN6 A;  3A3J A;  1IYQ A;  3EOI A;  2VGL M;  2VEA A;  3Q81 A;  2I72 A;  3C7V A;  3LIE A;  3NC8 A;  5JYP A;  4P6Z M;  1I5Q A;  5E2H A;  4UQI S;  2OLV A;  4S2K A;  1ESU A;  4O0P A;  4MCW A;  5CGX A;  4DJ3 A;  1O07 A;  1FR6 A;  4BD0 A;  4R3A A;  3HUO A;  3T4Q A;  1K4F A;  4ID4 A;  4Y2F A;  1SDE A;  3OCL A;  5AJG A;  3ICY A;  3N8S A;  3QP5 A;  4G3W A;  4PKY A;  3O86 A;  1F9I A;  4JBF A;  1YLY A;  2ZQD A;  4WZ5 C;  3C38 A;  5FQI A;  3V3R A;  1VHM A;  4LCL A;  4E6W A;  1ZTU A;  3BEB A;  1T1B A;  2EWW A;  5KMW A;  3WRZ A;  1VB6 A;  4S2M A;  2JE5 A;  3H9W A;  1XFQ A;  4PHT A;  3DAV A;  5F83 A;  1S0W A;  3S22 A;  1UGU A;  2PYR A;  3SS5 A;  4MN7 A; 
#chains in the Genus database with same CATH homology
 1OPX A;  1MC0 A;  3NOT C;  3UMD A;  1LSV A;  1IFQ A;  1YSP A;  3C2W A;  3OC2 A;  2INW A;  5HPI A;  2ZOH A;  2VJW A;  4B9O A;  4NXG A;  1N9L A;  5HWW A;  1OTB A;  3BQ8 A;  5AVF A;  1JNU A;  4HY8 A;  5LBR A;  1S1Y A;  2O9A A;  3KSF A;  3BJN A;  1GSV A;  3T50 A;  4WF0 A;  2A24 A;  4HIA A;  2W3G A;  5FL3 A;  4ARZ A;  1P9W A;  3PBQ A;  2P04 A;  4RQ9 A;  3G6O A;  5DFY A;  3KSI A;  3S7Q A;  2GNX A;  4BJP A;  3U2A A;  5HDD A;  4JGQ A;  3SW1 A;  2JKR I;  1XJ3 A;  1EW0 A;  2OOL A;  3LI8 A;  3OCN A;  4LLO B;  4NXF A;  4BBU A;  4YOF A;  2NUP C;  2EWV A;  2PR5 A;  2P08 A;  3FC7 A;  2R78 A;  3ULF A;  1T18 A;  2WKP A;  1S4R A;  2H28 A;  2HV1 A;  5DFX A;  5HDC A;  4EQ1 A;  1YKD A;  4AFI A;  5HDS A;  2VKS A;  4R6L A;  3K2N A;  3F1N A;  2XRO A;  5A8B A;  2W3D A;  2M1C A;  3PYP A;  2W3E A;  2HJ9 C;  3OBF A;  3CUE C;  5AVE A;  1IOU A;  4GJ4 A;  3B33 A;  3T4S A;  2P7J A;  3HCY A;  1OT6 A;  2Z6C A;  2IA2 A;  4HJ4 A;  3KSH A;  3LR0 A;  2PT7 A;  4EW7 A;  5F6A A;  1H8M A;  4HQA A;  2VGL S;  2FZ0 A;  4IHQ A;  2D01 A;  2W3H A;  2V0U A;  2A24 B;  3F1P B;  3VE4 A;  4P6Z S;  2XA7 S;  4OOL A;  1Y28 A;  2VLG A;  1ODV A;  3BWL A;  1XFN A;  2XRN A;  4GCZ A;  5EFW A;  3TRC A;  4PAU A;  3LIF A;  1X0O A;  2JKT M;  1WA9 A;  3KYQ A;  4KQD A;  3MQ0 A;  3E4Q A;  4OOM A;  2O0Y A;  3B47 A;  4Z1W A;  4I38 A;  4WN5 A;  3R7W A;  1NRJ A;  5HSQ A;  3EQU A;  4R38 A;  3LFV A;  1F5M A;  4MMN A;  3S7N A;  4JGR A;  2VV8 A;  3D3O A;  5KIZ A;  1T1A A;  2W3F A;  3LUQ A;  3UB9 A;  3BW6 A;  3UE3 A;  5DF9 A;  4LRX C;  4MDZ A;  5DKL A;  2HGV A;  4NEE D;  3T4K A;  4DN0 A;  4WUJ A;  4CLC E;  3FPV A;  3W2Z A;  1XJ4 A;  3LIB A;  3GEC A;  1LSW A;  3MQQ A;  4HHD A;  3MF0 A;  4LRY C;  1NLZ A;  3E98 A;  4B93 A;  4II7 A;  5J3W A;  2LB9 A;  4CLC B;  2GJ3 A;  1LSX A;  3CWF A;  2JHE A;  3E4O A;  4QPR A;  3B42 A;  2PD8 A;  3F1P A;  2NUT C;  1TS0 A;  3A0R A;  2JKR M;  2OWJ A;  2J3T C;  3E0Y A;  1DP6 A;  4IUH A;  3A0S A;  5C5K A;  4EER A;  2Y79 A;  5F5Y A;  4HP4 A;  1STZ A;  2L0W A;  2K31 A;  2J3T D;  2QYB A;  1P0Z A;  5KSH A;  3TE8 A;  2W1T B;  2PR6 A;  4L9F A;  4ZRR A;  2PD7 A;  5HWT A;  3MJQ A;  3PBT A;  3PXP A;  4DJ2 A;  1UWN X;  4EEP A;  4ETZ A;  4L9G A;  2JN7 A;  3R7W B;  5HWV A;  3RH8 B;  4Q0I A;  1TD5 A;  4KUO A;  4R70 A;  5TJJ A;  5J7E A;  1G28 A;  2VX8 A;  2HJE A;  4FOF A;  3LI9 A;  4I39 A;  5DKK A;  4YWZ A;  3H82 A;  1MKM A;  2PYP A;  3TJZ C;  2VZW A;  3LIC A;  1N9N A;  3VE3 A;  1OJG A;  4HNB A;  4Q0J A;  3ZYT A;  3IS2 A;  1LL8 A;  4WL9 A;  3FPW A;  1KOU A;  3LIA A;  4G3K A;  4I5S A;  4EUV A;  4CLC A;  1OTD A;  2M7U A;  4ME4 A;  5G4Z A;  4UQI M;  2HF6 A;  2O9B A;  4IUK A;  4HOI A;  2K2N A;  2K7S A;  4I3J A;  3JVU A;  5HD5 A;  3PBO A;  2ZMV A;  2XSS A;  4YNR A;  2PHY A;  4LRZ E;  2VA0 A;  2L1M A;  2V1B A;  3JVV A;  2L4R A;  2A2L A;  2YKH A;  1OJ5 A;  4BBT A;  4EXO A;  2BAS A;  4WEJ A;  2VV6 A;  3E4P A;  2QJ5 A;  3S7O A;  3HJK A;  4KUK A;  4M4X A;  4NKP A;  4GS9 B;  3KX0 X;  3F1O A;  2W1T A;  1TS7 A;  3UB8 A;  2CMN A;  1TS6 A;  5TBM A;  3DBA A;  4ETX A;  2KDK A;  4PKY G;  2DMW A;  3MMH A;  4CQH A;  2OAQ 1;  3GDI A;  3T4O A;  1YAX A;  5G4Y A;  3P01 A;  3NHQ A;  3UB6 A;  1XJ6 A;  5DJU A;  3CUE A;  3BY8 A;  4L0L A;  4MN5 A;  4EET B;  3LR5 A;  3PHY A;  5F68 A;  1UWP X;  2J80 A;  3CIT A;  2O99 A;  2KX6 A;  3IBR A;  3MR0 A;  4G3V A;  5HL6 A;  3VV4 A;  2VV7 A;  3H82 B;  3ZQ5 A;  1DP8 A;  3TW8 A;  4IJG A;  3P7N A;  3OOV A;  1MZU A;  1N9O A;  2V9A A;  5HD3 A;  1NLY A;  1DP9 A;  3UME A;  3HJI A;  4NXE A;  3IS2 B;  2W27 A;  3KSG A;  4FSF A;  3UB7 A;  4HH2 A;  3V67 A;  2KOI A;  4BWI A;  4NXB A;  4WEL A;  4EU0 A;  3MFX A;  2ZBB A;  4Y3I A;  4BMW A;  4KQO A;  1OT9 A;  3NJA A;  3H7W B;  3BY9 A;  3RTY A;  3EGX C;  2QKP A;  1S1Z A;  1T19 A;  4L9E A;  4Q0H A;  2KLI A;  4HP9 A;  5I5L A;  4E04 A;  1D7E A;  2V0W A;  2WKQ A;  3R4K A;  3D72 A;  4H6J B;  4GS9 A;  3FG8 A;  1XJ2 A;  2M7V A;  4GW9 A;  4O01 A;  2LB5 A;  4F3L B;  3F1O B;  5IT5 A;  3PR6 A;  2D02 A;  3LID A;  3KO6 A;  3T4J A;  3K3C A;  4CLC C;  1H3Q A;  3C8C A;  4GHI B;  2B18 A;  2QWS A;  5TBM B;  3EEH A;  5F69 A;  3MQO A;  3T4L A;  1LT0 A;  3EWK A;  1GSX A;  2ZOI A;  3LR4 A;  2PDR A;  3VOL A;  4CLC D;  1TS8 A;  2Z6D A;  3MXQ A;  1T1C A;  2B02 A;  3LYX A;  2I9V A;  3EEA A;  5IU1 A;  1S67 L;  2EA9 A;  5IS1 A;  1S66 L;  1DRM A;  4EES A;  2MJ6 A;  5DJT A;  4UEY A;  3BQA A;  3PBR A;  2W0N A;  5MC7 A;  3K3D A;  3UE6 A;  5CX7 A;  2O9C A;  4XT2 B;  1W63 Q;  3CAX A;  3O5Y A;  4JGP A;  3A0V A;  4GLQ A;  1YSQ A;  1D06 A;  4I3A A;  1V9Z A;  2G7U A;  3C30 A;  2Y8H A;  3NOP C;  2QHK A;  5L8M A;  3H7W A;  4MN6 A;  1F98 A;  4I3I A;  4EEU A;  2YKF A;  2V1A A;  3EOI A;  2VGL M;  2VEA A;  3PBN A;  3CI6 A;  3LIE A;  4BBV A;  3CLO A;  1OTA A;  2QJ7 A;  3KYZ A;  5HPF A;  3IBJ A;  4H6J A;  1BYW A;  4P6Z M;  2XA7 M;  1P97 A;  4UQI S;  4F3L A;  4K08 A;  1OTI A;  4O0P A;  5J4E A;  3RFB A;  3LR3 A;  1W63 M;  1P9R A;  4MCW A;  5HZH A;  2FH5 A;  4GHI A;  2J3W A;  4DJ3 A;  1V9Y A;  4R3A A;  3T4Q A;  1S4S A;  4HJ3 A;  4ARZ B;  3PBS A;  4Y2F A;  4LPZ A;  3OCL A;  1TF1 A;  3OLO A;  4DMZ A;  5AJG A;  2OAP 1;  3ICY A;  1OTE A;  1ZHH B;  3EQV A;  5K5B A;  3EGD C;  4G3W A;  4PKY A;  4HH3 A;  4JGO A;  2ZMF A;  3S7P A;  2WKR A;  1F9I A;  2GZA A;  1GSW A;  4HI4 A;  2W1R A;  3C38 A;  2JKT I;  4XT2 A;  4WLA A;  2GX5 A;  1VHM A;  1G6O A;  4HJ6 A;  4WEK A;  1ZTU A;  1T1B A;  2EWW A;  1VB6 A;  3H9W A;  4PHT A;  1XFQ A;  4Y5F A;  1UGU A;  3T4T A;  3NOU C;  2PYR A;  2OWH A;  4O8G A;  1NWZ A;  4MN7 A;  3F1N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...