1K0KA

Yeast profilin, cubic crystal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
SWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Contractile protein
molecule keywords PROFILIN
publication title A Comparative Structural Analysis of Profilins
rcsb
source organism Saccharomyces cerevisiae
total genus 40
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2001-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1k0kA00
4FTXA 1F2KA 1G5UA 2E8JA 3KYEA 3MSHA 3T1QB 3MS6A 4ESPA 2V8FA 3T1SA 2V8CA 2BTFP 2VK3A 5EV0A 1VETB 1A0KA 1PNEA 1CJFA 3T12B 5EM0A 3L7HA 4X1MA 5EM1A 2ACGA 1ACFA 1CF0A 1K0KA 1SKOB 1VETA 1PFLA 1HLUP 1YPRA 1Z09A 3T1XA 3T1RA 3D9YA 3CHWP 5FDSA 1FILA 1FIKA 1SKOA 5EVEA 4X25A 2PRFA 3NECA 1D1JA 3U4LP 1SZVA 2JKGA 3CPTB 5FEGA 1VEUB 3L9KA 4X1LA 3NULA 2B95A 2ZL1B 4QWOA 5FEFA 3UB5P 4FUWA 1Y4OA 3CPTA 2PAVP 3LEQA 1PRQA 2PBDP 1VEUA 1J3WA 3DAVA 2HZ5A 1CQAA 2ZL1A 2JKFA 1AWIA 4D60A 3LGOA
chains in the Genus database with same CATH superfamily
1KVMA 3RJUA 1ESUA 4CQHA 4UEYA 1D7EA 1G5UA 2J7VA 3S7OA 4G3WA 2OWJA 3IWIA 2ZBBA 3DWKA 4R6LA 5FDHA 3T4KA 1S4RA 3ZGAB 5AQ7A 4XUXA 1FR6A 4ETZA 5IS1A 3KSGA 3H7WA 3C7VA 1OTAA 3C38A 1TDLA 3T50A 3EQUA 2XH9A 5HWVA 1ACFA 4DXCA 5CERA 5FI6A 3IF6C 4R3AA 3VFFA 3G30A 3UE6A 1XFNA 3RH8B 1MC0A 4HJ6A 3TE8A 4EERA 3S7PA 4UA6A 1L0FA 1PZOA 3Q81A 3ITBA 3NHQA 3E98A 4EW7A 1YT4A 1ES2A 4KQDA 4WMCA 4JLFA 3CHWP 2P08A 1PIOA 2KDKA 1F9IA 4WMCD 1W63M 2RL3A 4OONA 1NXYA 2PRFA 3G2ZA 3W4OA 1EI5A 1NZOA 2EX2A 2R78A 3FG8A 5EECA 3QP6A 5AVEA 2XD5A 4KG6A 4LV3A 3PYPA 4EEUA 4X1LA 3ZNYA 2Y8HA 2ZC4B 2DRWA 2HP9A 4OOYA 1MZUA 4S2IA 2GJ3A 5DTKA 5HPIA 3G6OA 2WGWA 3G4PA 5FL3A 3ZVWA 2GDNA 2Z2LB 4L9FA 3VE3A 3KSIA 1RP5A 3IF6A 5EVIC 2HDSA 2NUTC 4BBVA 4P0MA 2Y4AA 1TEMA 4P6ZS 1MWSA 4YOFA 1LI9A 2J3TC 3E4QA 4DJ2A 4KZAA 3CI6A 4Y3IA 3V3SA 2V0WA 3H7WB 3PAGA 3DTKA 4ESPA 1S66L 3NI9A 1CEGA 1NZUA 2VV8A 4R70A 5EV0A 3PBRA 2ZQAA 1YSQA 1GSXA 1WE4A 5F83A 3LCEA 3PXPA 4I3IA 3T4QA 2HJEA 5GHZA 1ERMA 3NC8A 4GDBA 1GSWA 4LV2A 4S2NC 2WK0A 2IA2A 2PT7A 4BD1A 3UDFA 3GSGA 1W63Q 4MDZA 3KX0X 3UE3A 5EVIA 5CGXA 3S22A 5EVID 4NXBA 4PPRA 5F1FA 3KYZA 1IYQA 3GVBA 4R38A 4X25A 5FAOA 5L10A 2J3TD 5CECA 5GL9A 3FYZA 1K57A 1IYPA 5J8XA 5HARA 2Y2OA 3S1YA 2B18A 2UV0E 4U0XA 2Q9MA 4OQGA 2O0YA 2WGWB 1U60A 1VB6A 4MBHA 2W3FA 3IF6B 3WRTA 1N9NA 1S67L 2YKHA 4KZ5A 1VEUA 3ZFZA 3UDXA 4XUZA 4S2NA 2RCXA 3LEZA 4KUKA 1ZC2A 2KX6A 3V3RA 4A5RA 3KYEA 3VP2A 3OCNA 1K38A 2PD8A 3MS6A 2Y2PA 2ZOHA 4P6ZM 1YLTA 4EUVA 1ES3A 3E4OA 4ID4A 3A3DA 4OPRA 4K08A 3K3DA 4E3LA 3HVFA 4EUZA 1IYSA 2WKIA 2C5WB 3TJZC 5EVIB 3P98A 4DF6A 2XROA 2NUPC 4E04A 4NXEA 2OSUA 1VETA 2JKRI 3OLOA 1JTGA 1WA9A 4OQHA 1YPRA 1XXMA 3IWOA 2VEAA 4KZ8A 3BYDA 4N1HA 3BFDA 1FILA 5CHJA 3LR5A 3R7WA 4HH2A 5DTTA 4YFMA 5HL1A 4ZAMA 4BWIA 1ESIA 4LGWA 5HDCA 1ODVA 4JBFA 1Y54A 2W3EA 1VEUB 4UA9A 5EVLA 1TVFA 1PW1A 1S0WA 2PD7A 1L3LA 3CPTA 3IXBA 1EWZA 3IX8A 4O7DA 2EXBA 3DAVA 3T4OA 1XJ2A 4DE3A 1BLCA 1CEFA 4KUOA 4WN5A 2PU2A 1SDNA 5EPHA 4NG2A 3EEHA 3UB7A 2E8JA 3ZNTA 4C6YA 3GECA 2XA7M 2K2NA 4UQIS 2J80A 1AXBA 1WYCA 3UDIA 1OT9A 4I39A 2OLUA 2MJ6A 1I5QA 2M1CA 1W8YA 3P01A 4BD0A 1K54C 2AVXA 4IJGA 4QPRA 3PTEA 3BQAA 1VETB 1HZOA 1UGUA 4DXBA 2G2WA 5EM0A 3L7HA 4H6JA 3UB8A 2J9OA 3C30A 1K56A 3R7WB 3LI8A 2HPBA 1K56D 2YKFA 1QMEA 2HP6A 3IXHA 3JVVA 5A93A 1OPXA 1CI9A 4N9KA 3DBAA 3LFVA 3W2ZA 1L0EA 3C4OA 1N9LA 4LFUA 3WS0A 2JKGA 3CPTB 4Q0IA 4DDYA 5EE8A 3QP1A 4HBTA 3HL9A 5CXWA 1P9RA 1K54A 3RTYA 3P7NA 4X53A 2WGIA 3O5YA 4ZBEA 2W3GA 4P85A 3V67A 2PBDP 1OT6A 4JGRA 2D02A 2ZOIA 1L2SA 2VV7A 1GCEA 4DJ3A 5FSRA 4QY5A 1XJ4A 3IBJA 1LL5A 4OLGA 3ZVTA 3CMZA 1V9ZA 4S2LA 3N4IA 1OTDA 4H6JB 4Y17A 3UE0A 5DVAA 5FQIA 3Q1FA 1SDEA 3IH9A 3GR2A 3GDIA 3SS5A 3LUQA 4GS9A 1TDGA 1CF0A 4NEED 3ZG8B 5HD5A 2VGKA 4RYEA 1I2WA 1XJ6A 1FCNA 3GV9A 4MEZA 3ZQ5A 1O07A 4GLQA 5DKLA 2JE5A 3N6IA 4JGQA 1PW8A 4KZ9A 3M2KA 4E3IA 4NXGA 4FSFA 2GNXA 4YWZA 1ONGA 1H0MA 4EBLA 2QWSA 4ETXA 1LLBA 2J3WA 4GD6A 5M18A 4GW9A 3OPLA 4PKYG 5IU1A 3NULA 4L9GA 4X55A 4MN6A 4LRXC 4JXVA 1DJBA 3BFEA 3ZCZA 1XFQA 4OPQA 3SH9A 3MR0A 3R4KA 3NBLA 4QJGA 1TD5A 4DRTA 3W8KA 1LL9A 5GLAA 2V2FF 1ES5A 4HP4A 4LENA 1OMEA 1MWTA 5AQ9A 3VFHA 1DP6A 3MSHA 4EV4A 4E3MA 2GX5A 5AQAA 3LIBA 4HP9A 3ZHHA 1HTZA 2QYBA 4GS9B 1PWCA 3D3OA 2XR0A 2ZLYA 3GMWA 5FQKA 3A0SA 4KZ3A 2HDRA 2Y91A 3T12B 2XGNA 1DRMA 3LI9A 4K91A 1KOUA 1CK3A 1ZHHB 4X69A 3MXRA 2ZQDA 2Y59A 4Q0HA 1CI8A 4GHIA 3KSHA 5L07A 3EWKA 2D01A 3T1XA 3C7UA 1BLHA 4UA7A 3PBSA 1F5MA 5E2EA 2W1RA 4WZ5C 3N8SA 1TS6A 4JF5A 3F1OA 1LSWA 4Y2FA 2B02A 4HESA 3WS2A 4CPKA 5CEBA 3CWFA 3MZFA 5KZHA 5HAIA 4KG2A 3VP3A 4EEPA 1S4SA 3H9WA 1IELA 2ZC3B 4HY8A 4B4XA 5FEFA 2JN7A 1IKGA 3BY8A 3ISGA 2EWVA 4EQIA 3K3CA 2WZXA 3S7QA 2VGJA 1L0GA 1MWUA 4JGOA 1FOFA 2V1AA 4KZ7A 1T1CA 3HLBA 3MF0A 4WZ5A 2B5RA 2V8FA 4R23A 1ZG4A 2FFYA 3SS4A 4JXWA 4E3JA 4OKPA 3B33A 4WF0A 4GHIB 4MBFA 1KGFA 2KLIA 2Y2GA 2J8YA 4JF6A 1YLZA 5E43A 1K57C 2H0TA 5DJUA 4OP5A 3NIAA 5A91A 1PFLA 5HZHA 4EESA 1S1YA 1D06A 4IBRA 1M6KA 3BY9A 1BUEA 4FH4A 4LRYC 3F1OB 5HWWA 4EBPA 5FDSA 5EOEA 1XJ3A 4X68A 3UPOA 5FQQA 2PYPA 3SS3A 3HBRA 3D72A 4EU0A 1YLJA 3D4FA 5AQBA 1K4EA 1FCMA 3MJQA 2O9CA 3Q7VA 3L9KA 2VJWA 4OP8A 4IEDA 1EW0A 4NETA 2LB9A 2XLNA 1E25A 5IT5A 2V20A 4FUWA 3W4PA 3KYQA 1KGGA 4Q8IA 4M4XA 1PWDA 1DJCA 3AGFA 3V39A 2K31A 4DE1A 3UB6A 4Y15A 3WWXA 1SKFA 4WBGA 3JPUA 4D60A 3PBNA 1FSWA 1P97A 2WYXA 3LIFA 3S7NA 4ZJ1A 4JXSA 4MN7A 4BQMA 4LLOB 3M2JA 5IHVA 4II7A 4RA7A 2W3DA 3DTMA 1HD8A 1RGYA 2XA7S 1HVBA 1ZKJA 2WGVA 4IUHA 3WRZA 2OV5A 3I7JA 4XT2A 5A92A 1UWPX 3G32A 5FQMA 2VK3A 3LO7A 4IVIA 1PWGA 2IWDA 1T18A 4JKTA 1PNEA 3CG5A 2QJ5A 4MLLA 3LIDA 2G2UA 3SZTA 2HDQA 3IQAA 4GKUA 4K0WA 1ALQA 1ERQA 2VGLM 4O0PA 4G3VA 3ZG0A 1S6RA 2PYRA 1NYMA 2K7SA 2ZC5B 4R3JA 4KZ6A 1BSGA 5TJJA 3Q7VB 1E3UA 4OOLA 4E3NA 3T4SA 1BULA 1E3UD 5L2FA 1XPBA 3LR0A 3CUEA 1GHPA 1SZVA 2O9BA 2Y2IA 5M19A 1M40A 3MXSA 3UNWA 2B95A 3SH8A 4LPZA 2JBFA 3QP8A 3A0VA 2EX6A 4X56A 3T4TA 5DF7A 1FQGA 2XK1A 2EWWA 1FR1A 4KENB 1O7EA 2WAFA 2EFUA 4HH3A 2PDRA 4Y7PA 4ZRRA 1YLWA 5EFWA 1F2KA 1K6RA 3IX3A 4XT2B 4PHTA 4OVDA 4PM5A 3PHYA 3VOYA 1NYYA 4WUJA 2ZC7A 3NOUC 3BWLA 3IS2A 5I5LA 1T1AA 3BW6A 5KSCA 4L9EA 3IHBA 3PBQA 5F5YA 1H8MA 3OCLA 4E3OA 5F68A 2A3UA 1A0KA 5HSQA 2L4RA 4IHQA 5D3OA 3VV4A 4FCFA 3UPPA 5FAQA 1NRJA 4HIAA 4Y0UA 1JWZA 3VOZA 3UE1A 2BG1A 4S2OA 5HD3A 2X02A 4E6XA 1HLUP 4BENA 2G7UA 3LICA 3FKVA 3Q07A 5GLDA 3BLMA 2VV6A 1BT5A 3N8LA 3SOIA 3U4LP 5CTNA 2Y2HA 5DFXA 2JKTM 3WS1A 2DNSA 5TFQA 3MMHA 2VKSA 4C3QA 3C4PA 5EOOA 5GHXA 3ZYTA 3N8RA 4EETB 2IWCA 2FZ0A 4CLCC 5JYPA 2W1TA 3TSGA 2PAVP 5DFYA 3M6BA 5F82A 1C3BA 3CITA 3O86A 1H5XA 4BL2A 3PAEA 1NRFA 1WYBA 5CEDA 1DP8A 2X71A 1NY0A 2I72A 3NY4A 3IS2B 4YINA 3VP4A 2P74A 4O8GA 2HJ9C 5CHMA 1YM1A 1XGIA 3V50A 4GDNA 1T19A 5TBMA 1FCOA 3C5AA 3ITAA 1NJ4A 3S4XA 5HWTA 4LV1A 2VA0A 2W3HA 3LIEA 5FASA 1STZA 4S2PA 5CHUA 2ZQ7A 1H3QA 4CLCA 3NDEA 3DWZA 4CLCD 5FI2A 4RQ9A 2IWBA 3NJAA 2V1ZA 4KZ4A 4JXGA 3DTEA 1QMFA 4BJPA 3BFCA 3SW1A 1JVJA 1KE3A 2FH5A 4Y0TA 2V1BA 1IFQA 2OAQ1 3VSLA 3HLDA 5DJTA 3G35A 2VX8A 4JGPA 4KQOA 4RX2A 2L0WA 3UO9A 1MPLA 1RGZA 2W1TB 2Y2JA 3UPNA 5GHYA 2ZMFA 4Y0OA 4E6WA 4O01A 3DTIA 4LRZE 5C5KA 1K55C 5AJGA 3G34A 4GB7A 3E2KA 4D2OA 1H8ZA 1PYYA 3FPVA 1I2SA 3CLOA 4Z1WA 1W5DA 2V9AA 4KQQA 4OLDA 4U0TA 4OQ0A 3IXGA 3BQ8A 3NDGA 5TBMB 3UMDA 4OOMA 1XGJA 4WYYA 4XXRA 3QNBA 3T1QB 5KMWA 4BBTA 3HUOA 4CLCB 3EEAA 4UAAA 4Z9QA 1K4FA 2V8CA 3ULFA 1YMXA 3G31A 2ZM2A 4PM6A 5HAQA 5FQJA 3LIAA 4B4ZA 1K55A 2XDMA 4PM8A 3A0RA 1LI0A 1BTLA 1Q2PA 3LY3A 4PKYA 4MBKA 1DY6A 1KDWA 2HGVA 3FZCA 3QP4A 2WKEA 2Y2MA 4UHUA 4M3KA 3F1NA 5A90A 4DN0A 3MXQA 5J3WA 5DTSA 2WZZA 1ES4A 5BOHA 5JYOA 4GN2A 3W4QA 4WM9A 2EA9A 4HJ3A 3VP0A 4EQ1A 4HOIA 2R9WA 4OH0A 3BECA 2XSSA 3RXWA 4WLAA 5FQ9A 2WKHA 4MN5A 4EXOA 1ZTUA 3OOVA 3LEQA 3MFXA 1YSPA 2HP5A 4DE2A 3M6HA 3VMAA 1CQAA 2Y2LA 2JKFA 4PM7A 2Y55A 3IHAA 5M1AA 4PMAA 4GD8A 3C2WA 4WELA 1L0DA 4IUKA 2HF6A 1MXOA 1P9WA 4F94A 1LSVA 3IF5A 2PHYA 5CX7A 1W79A 4ZJ3A 3BRMA 1PI5A 1VM1A 3HLFA 4HBUA 3EGXC 4WEJA 2XEPA 3EQVA 1ONHA 4QHCA 4NKPA 2QZ6A 4K0XA 4OPYA 1YKDA 1XX2A 2ZD8A 5HFOA 1DP9A 1Z6FA 1LHYA 1V9YA 2Z6DA 4HNBA 1Q2QA 4R1GA 3VOLA 3QP2A 3HLEA 1J9MA 1K0KA 3F1NB 3CJMA 3ZG5A 4AFIA 3FV7A 4N92A 4R4RA 2OOLA 3ZG9B 2QHKA 2A2LA 2VGLS 2WUQA 4Q0JA 4IVKA 4QY6A 2XFTA 3LYXA 5K5BA 3T1RA 1LT0A 1GSVA 4MMNA 1SKOA 5DF9A 4EBNA 3BM6A 4HJ4A 2WADA 5HL6A 4PAUA 3JVUA 4C75A 4IBXA 3IXDA 3RXXA 2JC7A 3RFBA 3B42A 2H0YA 2CC1A 5A8BA 4JPMA 4ZJ2A 1KE4A 2PR6A 3OPPA 3QNCA 4GOGA 3BJNA 3UN7A 2A24A 1JTDA 5J7EA 2PU4A 3UY6A 3MBZA 2J9PA 3V5MA 3VSKA 4KZBA 2X01A 2XFSA 1NLZA 2W27A 4R3BA 1OTIA 2V0UA 4B93A 5KIZA 3AGEA 3BFGA 3BFFA 3SH7A 1XP4A 5HPFA 4HQAA 3MQOA 1K25A 1MKIA 1KDSA 2E8IA 2EFXA 5FAPA 5HX9A 3FKWA 3GTCA 3IWQA 2H5SA 3ZDJA 3HUNA 3T4JA 2JKRM 3MKEA 4QU3A 1OJ5A 4HEFA 3CUEC 2JHEA 5G4ZA 4N1XA 1SKOB 4FH2A 4I38A 5EUAA 4I5SA 1GHMA 5TR7A 4BLMA 5I94A 5HDDA 3JYIA 4S2JA 1N9OA 2Y79A 3VP1A 1E4DA 5HAPA 1BZAA 5AVFA 4QB8A 2ZQ8A 4GZBA 1FIKA 2WKRA 1W8QA 1JWVA 2QMIA 3MKFA 4OQIA 4HHDA 4LV0A 2A24B 4PM9A 1OTBA 1T1BA 3ZG7B 3OPRA 3HCYA 4GJ4A 4KG5A 1LL8A 4JF4A 3GRJA 3T4LA 5E2HA 3HLWA 1MY8A 2ZQCA 2JCHA 2VLGA 3C8CA 2XRNA 4F3LA 2PBYA 3QP5A 4R4SA 2EX9A 3OBFA 1P0ZA 1OTEA 1EROA 4WEKA 1YLYA 4LCMA 4X6TA 1GHIA 3OZHA 5F69A 3O87A 1BYWA 2WKPA 3WS4A 1PI4A 3DW0A 1S1ZA 1MBLA 2OWHA 5L8MA 3GQZA 3AGDA 4EWFA 3LR4A 5TGFA 3T1SA 1G28A 2ZJ9A 3PBOA 4ME4A 2P7JA 3HJKA 2Z6CA 1N4OA 4H8RA 1CJFA 2HV1A 3FPWA 2BLSA 1F98A 5EM1A 3UB9A 5G4YA 2I9VA 3MQQA 5HW3A 2O99A 1GA0A 1G6AA 1Z09A 4YNRA 3NOTC 3O88A 1JNUA 3ICYA 3TRCA 5DF8A 4B88A 3G2YA 3NECA 1XKZA 2H28A 2VZWA 2PR5A 3UMEA 4B9OA 2C6WB 2QJ7A 3IX4A 3F1PA 4QWOA 4F3LB 3LR3A 3NCKA 2LB5A 1TS0A 1LSXA 1PRQA 4L0LA 3A3IA 3NOPC 2KOIA 1J3WA 5CGWA 2DCFA 4NK3A 2ZL1A 3QHYA 2XF3A 2ZMVA 2ZM8A 3IH8A 1RCJA 2INWA 4CJNA 3HLGA 5L09A 3TOIA 3TW8A 4ZDXA 3FWLA 4Y5FA 3A3EA 5DKKA 2Q9NA 1TS8A 5GLBA 1ZG6A 1KE0A 4CLCE 4MCWA 3E2LA 4KQRA 1W7FA 4DKIA 4DMZA 2EXAA 1SHVA 4ZTKA 5HDSA 1TS7A 3PR6A 2BTFP 1KVLA 1XA7A 2Y2NA 5E2FA 3OC2A 1N9BA 2XQZA 4X1MA 2ACGA 3TG9A 3IBRA 1Y28A 3H82A 4S2KA 2BASA 1H8YA 4U3TA 2ZM0A 2GZAA 1OJGA 5FI7A 3CAXA 2ZC6B 3D9YA 3LY4A 2ZQ9A 3F1PB 1TF1A 1IKIA 2ZMAA 1G6OA 4GCZA 1IYOA 4FOFA 5CGSA 5FEGA 4I3AA 3E4PA 1MWRA 5G18A 3U2AA 1MKMA 2ZL1B 4WL9A 3EGDC 3MFDA 4DDSA 4ARZA 3UB5P 3B3XA 2P9VA 3MZDA 2Z2MB 2JKTI 2HDUA 4P87A 1Y4OA 2EX8A 1UWNX 4G3KA 4DE0A 3K2NA 3HLCA 1SCWA 4HI4A 4NXFA 2QKPA 4FD8A 3KO6A 3MZEA 1AWIA 2R9XA 2UWXA 1XA1A 2DMWA 1YLPA 4N9LA 3Q82A 4FTXA 4UQIM 2Y2QA 5KSHA 2FFFB 1YMSA 3FC7A 2Q0OA 3BEBA 5F6AA 1IOUA 2QPNA 4LCLA 3E0YA 2XD1A 4P6BA 3O3VA 2O9AA 1K6SA 3P09A 3A3JA 3KSFA 3H82B 1FSYA 1YAXA 5F1GA 3MQ0A 2WAEA 3CZDA 1NWZA 4RX3A 4GNUA 1GA9A 3BLSA 5FATA 1NLYA 4E3KA 4Y13A 1VHMA 4BMWA 2M7VA 4BBUA 4BL3A 3HJIA 5U47A 1VQQA 3N7WA 4QD4A 2W0NA 5EVEA 3VE4A 3HUMA 1DJAA 1BLSA 1BLPA 5GLCA 1D1JA 4ARZB 5E2GA 2L1MA 2P9VB 2WKQA 3B47A 5CRFA 3IT9A 4OPZA 1YQSA 4S2MA 2Y2KA 3A3FA 2OAP1 5CTMA 1X0OA 2P04A 2A49A 2CMNA 3OPHA 4I3JA 3WS5A 3Q7ZA 5LBRA 2M7UA 1JWPA 4MNRA 4R0QA 2HZ5A 5MC7A 2H10A 3HREA 4WZ4A 1KGEA 3PBTA 1IEMA 1PZPA 2OLVA 5J4EA 1G68A 5FA7A 3EOIA 3LGOA 4RVAA
chains in the Genus database with same CATH topology
4FTXA 1F2KA 1G5UA 2E8JA 3KYEA 3MSHA 3T1QB 3MS6A 4ESPA 2V8FA 3T1SA 2V8CA 2BTFP 2VK3A 5EV0A 1VETB 1A0KA 1PNEA 1CJFA 3T12B 5EM0A 3L7HA 4X1MA 5EM1A 2ACGA 1ACFA 1CF0A 1K0KA 1SKOB 1VETA 1PFLA 1HLUP 1YPRA 1Z09A 3T1XA 3T1RA 3D9YA 3CHWP 5FDSA 1FILA 1FIKA 1SKOA 5EVEA 4X25A 2PRFA 3NECA 1D1JA 3U4LP 1SZVA 2JKGA 3CPTB 5FEGA 1VEUB 3L9KA 4X1LA 3NULA 2B95A 2ZL1B 4QWOA 5FEFA 3UB5P 4FUWA 1Y4OA 3CPTA 2PAVP 3LEQA 1PRQA 2PBDP 1VEUA 1J3WA 3DAVA 2HZ5A 1CQAA 2ZL1A 2JKFA 1AWIA 4D60A 3LGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FTX A;  1F2K A;  1G5U A;  2E8J A;  3KYE A;  3MSH A;  3T1Q B;  3MS6 A;  4ESP A;  2V8F A;  3T1S A;  2V8C A;  2BTF P;  2VK3 A;  5EV0 A;  1VET B;  1A0K A;  1PNE A;  1CJF A;  3T12 B;  5EM0 A;  3L7H A;  4X1M A;  5EM1 A;  2ACG A;  1ACF A;  1CF0 A;  1K0K A;  1SKO B;  1VET A;  1PFL A;  1HLU P;  1YPR A;  1Z09 A;  3T1X A;  3T1R A;  3D9Y A;  3CHW P;  5FDS A;  1FIL A;  1FIK A;  1SKO A;  5EVE A;  4X25 A;  2PRF A;  3NEC A;  1D1J A;  3U4L P;  1SZV A;  2JKG A;  3CPT B;  5FEG A;  1VEU B;  3L9K A;  4X1L A;  3NUL A;  2B95 A;  2ZL1 B;  4QWO A;  5FEF A;  3UB5 P;  4FUW A;  1Y4O A;  3CPT A;  2PAV P;  3LEQ A;  1PRQ A;  2PBD P;  1VEU A;  1J3W A;  3DAV A;  2HZ5 A;  1CQA A;  2ZL1 A;  2JKF A;  1AWI A;  4D60 A;  3LGO A; 
#chains in the Genus database with same CATH topology
 1KVM A;  3RJU A;  1ESU A;  4CQH A;  4UEY A;  1D7E A;  1G5U A;  2J7V A;  3S7O A;  4G3W A;  2OWJ A;  3IWI A;  2ZBB A;  3DWK A;  4R6L A;  5FDH A;  3T4K A;  1S4R A;  3ZGA B;  5AQ7 A;  4XUX A;  1FR6 A;  4ETZ A;  5IS1 A;  3KSG A;  3H7W A;  3C7V A;  1OTA A;  3C38 A;  1TDL A;  3T50 A;  3EQU A;  2XH9 A;  5HWV A;  1ACF A;  4DXC A;  5CER A;  5FI6 A;  3IF6 C;  4R3A A;  3VFF A;  3G30 A;  3UE6 A;  1XFN A;  3RH8 B;  1MC0 A;  4HJ6 A;  3TE8 A;  4EER A;  3S7P A;  4UA6 A;  1L0F A;  1PZO A;  3Q81 A;  3ITB A;  3NHQ A;  3E98 A;  4EW7 A;  1YT4 A;  1ES2 A;  4KQD A;  4WMC A;  4JLF A;  3CHW P;  2P08 A;  1PIO A;  2KDK A;  1F9I A;  4WMC D;  1W63 M;  2RL3 A;  4OON A;  1NXY A;  2PRF A;  3G2Z A;  3W4O A;  1EI5 A;  1NZO A;  2EX2 A;  2R78 A;  3FG8 A;  5EEC A;  3QP6 A;  5AVE A;  2XD5 A;  4KG6 A;  4LV3 A;  3PYP A;  4EEU A;  4X1L A;  3ZNY A;  2Y8H A;  2ZC4 B;  2DRW A;  2HP9 A;  4OOY A;  1MZU A;  4S2I A;  2GJ3 A;  5DTK A;  5HPI A;  3G6O A;  2WGW A;  3G4P A;  5FL3 A;  3ZVW A;  2GDN A;  2Z2L B;  4L9F A;  3VE3 A;  3KSI A;  1RP5 A;  3IF6 A;  5EVI C;  2HDS A;  2NUT C;  4BBV A;  4P0M A;  2Y4A A;  1TEM A;  4P6Z S;  1MWS A;  4YOF A;  1LI9 A;  2J3T C;  3E4Q A;  4DJ2 A;  4KZA A;  3CI6 A;  4Y3I A;  3V3S A;  2V0W A;  3H7W B;  3PAG A;  3DTK A;  4ESP A;  1S66 L;  3NI9 A;  1CEG A;  1NZU A;  2VV8 A;  4R70 A;  5EV0 A;  3PBR A;  2ZQA A;  1YSQ A;  1GSX A;  1WE4 A;  5F83 A;  3LCE A;  3PXP A;  4I3I A;  3T4Q A;  2HJE A;  5GHZ A;  1ERM A;  3NC8 A;  4GDB A;  1GSW A;  4LV2 A;  4S2N C;  2WK0 A;  2IA2 A;  2PT7 A;  4BD1 A;  3UDF A;  3GSG A;  1W63 Q;  4MDZ A;  3KX0 X;  3UE3 A;  5EVI A;  5CGX A;  3S22 A;  5EVI D;  4NXB A;  4PPR A;  5F1F A;  3KYZ A;  1IYQ A;  3GVB A;  4R38 A;  4X25 A;  5FAO A;  5L10 A;  2J3T D;  5CEC A;  5GL9 A;  3FYZ A;  1K57 A;  1IYP A;  5J8X A;  5HAR A;  2Y2O A;  3S1Y A;  2B18 A;  2UV0 E;  4U0X A;  2Q9M A;  4OQG A;  2O0Y A;  2WGW B;  1U60 A;  1VB6 A;  4MBH A;  2W3F A;  3IF6 B;  3WRT A;  1N9N A;  1S67 L;  2YKH A;  4KZ5 A;  1VEU A;  3ZFZ A;  3UDX A;  4XUZ A;  4S2N A;  2RCX A;  3LEZ A;  4KUK A;  1ZC2 A;  2KX6 A;  3V3R A;  4A5R A;  3KYE A;  3VP2 A;  3OCN A;  1K38 A;  2PD8 A;  3MS6 A;  2Y2P A;  2ZOH A;  4P6Z M;  1YLT A;  4EUV A;  1ES3 A;  3E4O A;  4ID4 A;  3A3D A;  4OPR A;  4K08 A;  3K3D A;  4E3L A;  3HVF A;  4EUZ A;  1IYS A;  2WKI A;  2C5W B;  3TJZ C;  5EVI B;  3P98 A;  4DF6 A;  2XRO A;  2NUP C;  4E04 A;  4NXE A;  2OSU A;  1VET A;  2JKR I;  3OLO A;  1JTG A;  1WA9 A;  4OQH A;  1YPR A;  1XXM A;  3IWO A;  2VEA A;  4KZ8 A;  3BYD A;  4N1H A;  3BFD A;  1FIL A;  5CHJ A;  3LR5 A;  3R7W A;  4HH2 A;  5DTT A;  4YFM A;  5HL1 A;  4ZAM A;  4BWI A;  1ESI A;  4LGW A;  5HDC A;  1ODV A;  4JBF A;  1Y54 A;  2W3E A;  1VEU B;  4UA9 A;  5EVL A;  1TVF A;  1PW1 A;  1S0W A;  2PD7 A;  1L3L A;  3CPT A;  3IXB A;  1EWZ A;  3IX8 A;  4O7D A;  2EXB A;  3DAV A;  3T4O A;  1XJ2 A;  4DE3 A;  1BLC A;  1CEF A;  4KUO A;  4WN5 A;  2PU2 A;  1SDN A;  5EPH A;  4NG2 A;  3EEH A;  3UB7 A;  2E8J A;  3ZNT A;  4C6Y A;  3GEC A;  2XA7 M;  2K2N A;  4UQI S;  2J80 A;  1AXB A;  1WYC A;  3UDI A;  1OT9 A;  4I39 A;  2OLU A;  2MJ6 A;  1I5Q A;  2M1C A;  1W8Y A;  3P01 A;  4BD0 A;  1K54 C;  2AVX A;  4IJG A;  4QPR A;  3PTE A;  3BQA A;  1VET B;  1HZO A;  1UGU A;  4DXB A;  2G2W A;  5EM0 A;  3L7H A;  4H6J A;  3UB8 A;  2J9O A;  3C30 A;  1K56 A;  3R7W B;  3LI8 A;  2HPB A;  1K56 D;  2YKF A;  1QME A;  2HP6 A;  3IXH A;  3JVV A;  5A93 A;  1OPX A;  1CI9 A;  4N9K A;  3DBA A;  3LFV A;  3W2Z A;  1L0E A;  3C4O A;  1N9L A;  4LFU A;  3WS0 A;  2JKG A;  3CPT B;  4Q0I A;  4DDY A;  5EE8 A;  3QP1 A;  4HBT A;  3HL9 A;  5CXW A;  1P9R A;  1K54 A;  3RTY A;  3P7N A;  4X53 A;  2WGI A;  3O5Y A;  4ZBE A;  2W3G A;  4P85 A;  3V67 A;  2PBD P;  1OT6 A;  4JGR A;  2D02 A;  2ZOI A;  1L2S A;  2VV7 A;  1GCE A;  4DJ3 A;  5FSR A;  4QY5 A;  1XJ4 A;  3IBJ A;  1LL5 A;  4OLG A;  3ZVT A;  3CMZ A;  1V9Z A;  4S2L A;  3N4I A;  1OTD A;  4H6J B;  4Y17 A;  3UE0 A;  5DVA A;  5FQI A;  3Q1F A;  1SDE A;  3IH9 A;  3GR2 A;  3GDI A;  3SS5 A;  3LUQ A;  4GS9 A;  1TDG A;  1CF0 A;  4NEE D;  3ZG8 B;  5HD5 A;  2VGK A;  4RYE A;  1I2W A;  1XJ6 A;  1FCN A;  3GV9 A;  4MEZ A;  3ZQ5 A;  1O07 A;  4GLQ A;  5DKL A;  2JE5 A;  3N6I A;  4JGQ A;  1PW8 A;  4KZ9 A;  3M2K A;  4E3I A;  4NXG A;  4FSF A;  2GNX A;  4YWZ A;  1ONG A;  1H0M A;  4EBL A;  2QWS A;  4ETX A;  1LLB A;  2J3W A;  4GD6 A;  5M18 A;  4GW9 A;  3OPL A;  4PKY G;  5IU1 A;  3NUL A;  4L9G A;  4X55 A;  4MN6 A;  4LRX C;  4JXV A;  1DJB A;  3BFE A;  3ZCZ A;  1XFQ A;  4OPQ A;  3SH9 A;  3MR0 A;  3R4K A;  3NBL A;  4QJG A;  1TD5 A;  4DRT A;  3W8K A;  1LL9 A;  5GLA A;  2V2F F;  1ES5 A;  4HP4 A;  4LEN A;  1OME A;  1MWT A;  5AQ9 A;  3VFH A;  1DP6 A;  3MSH A;  4EV4 A;  4E3M A;  2GX5 A;  5AQA A;  3LIB A;  4HP9 A;  3ZHH A;  1HTZ A;  2QYB A;  4GS9 B;  1PWC A;  3D3O A;  2XR0 A;  2ZLY A;  3GMW A;  5FQK A;  3A0S A;  4KZ3 A;  2HDR A;  2Y91 A;  3T12 B;  2XGN A;  1DRM A;  3LI9 A;  4K91 A;  1KOU A;  1CK3 A;  1ZHH B;  4X69 A;  3MXR A;  2ZQD A;  2Y59 A;  4Q0H A;  1CI8 A;  4GHI A;  3KSH A;  5L07 A;  3EWK A;  2D01 A;  3T1X A;  3C7U A;  1BLH A;  4UA7 A;  3PBS A;  1F5M A;  5E2E A;  2W1R A;  4WZ5 C;  3N8S A;  1TS6 A;  4JF5 A;  3F1O A;  1LSW A;  4Y2F A;  2B02 A;  4HES A;  3WS2 A;  4CPK A;  5CEB A;  3CWF A;  3MZF A;  5KZH A;  5HAI A;  4KG2 A;  3VP3 A;  4EEP A;  1S4S A;  3H9W A;  1IEL A;  2ZC3 B;  4HY8 A;  4B4X A;  5FEF A;  2JN7 A;  1IKG A;  3BY8 A;  3ISG A;  2EWV A;  4EQI A;  3K3C A;  2WZX A;  3S7Q A;  2VGJ A;  1L0G A;  1MWU A;  4JGO A;  1FOF A;  2V1A A;  4KZ7 A;  1T1C A;  3HLB A;  3MF0 A;  4WZ5 A;  2B5R A;  2V8F A;  4R23 A;  1ZG4 A;  2FFY A;  3SS4 A;  4JXW A;  4E3J A;  4OKP A;  3B33 A;  4WF0 A;  4GHI B;  4MBF A;  1KGF A;  2KLI A;  2Y2G A;  2J8Y A;  4JF6 A;  1YLZ A;  5E43 A;  1K57 C;  2H0T A;  5DJU A;  4OP5 A;  3NIA A;  5A91 A;  1PFL A;  5HZH A;  4EES A;  1S1Y A;  1D06 A;  4IBR A;  1M6K A;  3BY9 A;  1BUE A;  4FH4 A;  4LRY C;  3F1O B;  5HWW A;  4EBP A;  5FDS A;  5EOE A;  1XJ3 A;  4X68 A;  3UPO A;  5FQQ A;  2PYP A;  3SS3 A;  3HBR A;  3D72 A;  4EU0 A;  1YLJ A;  3D4F A;  5AQB A;  1K4E A;  1FCM A;  3MJQ A;  2O9C A;  3Q7V A;  3L9K A;  2VJW A;  4OP8 A;  4IED A;  1EW0 A;  4NET A;  2LB9 A;  2XLN A;  1E25 A;  5IT5 A;  2V20 A;  4FUW A;  3W4P A;  3KYQ A;  1KGG A;  4Q8I A;  4M4X A;  1PWD A;  1DJC A;  3AGF A;  3V39 A;  2K31 A;  4DE1 A;  3UB6 A;  4Y15 A;  3WWX A;  1SKF A;  4WBG A;  3JPU A;  4D60 A;  3PBN A;  1FSW A;  1P97 A;  2WYX A;  3LIF A;  3S7N A;  4ZJ1 A;  4JXS A;  4MN7 A;  4BQM A;  4LLO B;  3M2J A;  5IHV A;  4II7 A;  4RA7 A;  2W3D A;  3DTM A;  1HD8 A;  1RGY A;  2XA7 S;  1HVB A;  1ZKJ A;  2WGV A;  4IUH A;  3WRZ A;  2OV5 A;  3I7J A;  4XT2 A;  5A92 A;  1UWP X;  3G32 A;  5FQM A;  2VK3 A;  3LO7 A;  4IVI A;  1PWG A;  2IWD A;  1T18 A;  4JKT A;  1PNE A;  3CG5 A;  2QJ5 A;  4MLL A;  3LID A;  2G2U A;  3SZT A;  2HDQ A;  3IQA A;  4GKU A;  4K0W A;  1ALQ A;  1ERQ A;  2VGL M;  4O0P A;  4G3V A;  3ZG0 A;  1S6R A;  2PYR A;  1NYM A;  2K7S A;  2ZC5 B;  4R3J A;  4KZ6 A;  1BSG A;  5TJJ A;  3Q7V B;  1E3U A;  4OOL A;  4E3N A;  3T4S A;  1BUL A;  1E3U D;  5L2F A;  1XPB A;  3LR0 A;  3CUE A;  1GHP A;  1SZV A;  2O9B A;  2Y2I A;  5M19 A;  1M40 A;  3MXS A;  3UNW A;  2B95 A;  3SH8 A;  4LPZ A;  2JBF A;  3QP8 A;  3A0V A;  2EX6 A;  4X56 A;  3T4T A;  5DF7 A;  1FQG A;  2XK1 A;  2EWW A;  1FR1 A;  4KEN B;  1O7E A;  2WAF A;  2EFU A;  4HH3 A;  2PDR A;  4Y7P A;  4ZRR A;  1YLW A;  5EFW A;  1F2K A;  1K6R A;  3IX3 A;  4XT2 B;  4PHT A;  4OVD A;  4PM5 A;  3PHY A;  3VOY A;  1NYY A;  4WUJ A;  2ZC7 A;  3NOU C;  3BWL A;  3IS2 A;  5I5L A;  1T1A A;  3BW6 A;  5KSC A;  4L9E A;  3IHB A;  3PBQ A;  5F5Y A;  1H8M A;  3OCL A;  4E3O A;  5F68 A;  2A3U A;  1A0K A;  5HSQ A;  2L4R A;  4IHQ A;  5D3O A;  3VV4 A;  4FCF A;  3UPP A;  5FAQ A;  1NRJ A;  4HIA A;  4Y0U A;  1JWZ A;  3VOZ A;  3UE1 A;  2BG1 A;  4S2O A;  5HD3 A;  2X02 A;  4E6X A;  1HLU P;  4BEN A;  2G7U A;  3LIC A;  3FKV A;  3Q07 A;  5GLD A;  3BLM A;  2VV6 A;  1BT5 A;  3N8L A;  3SOI A;  3U4L P;  5CTN A;  2Y2H A;  5DFX A;  2JKT M;  3WS1 A;  2DNS A;  5TFQ A;  3MMH A;  2VKS A;  4C3Q A;  3C4P A;  5EOO A;  5GHX A;  3ZYT A;  3N8R A;  4EET B;  2IWC A;  2FZ0 A;  4CLC C;  5JYP A;  2W1T A;  3TSG A;  2PAV P;  5DFY A;  3M6B A;  5F82 A;  1C3B A;  3CIT A;  3O86 A;  1H5X A;  4BL2 A;  3PAE A;  1NRF A;  1WYB A;  5CED A;  1DP8 A;  2X71 A;  1NY0 A;  2I72 A;  3NY4 A;  3IS2 B;  4YIN A;  3VP4 A;  2P74 A;  4O8G A;  2HJ9 C;  5CHM A;  1YM1 A;  1XGI A;  3V50 A;  4GDN A;  1T19 A;  5TBM A;  1FCO A;  3C5A A;  3ITA A;  1NJ4 A;  3S4X A;  5HWT A;  4LV1 A;  2VA0 A;  2W3H A;  3LIE A;  5FAS A;  1STZ A;  4S2P A;  5CHU A;  2ZQ7 A;  1H3Q A;  4CLC A;  3NDE A;  3DWZ A;  4CLC D;  5FI2 A;  4RQ9 A;  2IWB A;  3NJA A;  2V1Z A;  4KZ4 A;  4JXG A;  3DTE A;  1QMF A;  4BJP A;  3BFC A;  3SW1 A;  1JVJ A;  1KE3 A;  2FH5 A;  4Y0T A;  2V1B A;  1IFQ A;  2OAQ 1;  3VSL A;  3HLD A;  5DJT A;  3G35 A;  2VX8 A;  4JGP A;  4KQO A;  4RX2 A;  2L0W A;  3UO9 A;  1MPL A;  1RGZ A;  2W1T B;  2Y2J A;  3UPN A;  5GHY A;  2ZMF A;  4Y0O A;  4E6W A;  4O01 A;  3DTI A;  4LRZ E;  5C5K A;  1K55 C;  5AJG A;  3G34 A;  4GB7 A;  3E2K A;  4D2O A;  1H8Z A;  1PYY A;  3FPV A;  1I2S A;  3CLO A;  4Z1W A;  1W5D A;  2V9A A;  4KQQ A;  4OLD A;  4U0T A;  4OQ0 A;  3IXG A;  3BQ8 A;  3NDG A;  5TBM B;  3UMD A;  4OOM A;  1XGJ A;  4WYY A;  4XXR A;  3QNB A;  3T1Q B;  5KMW A;  4BBT A;  3HUO A;  4CLC B;  3EEA A;  4UAA A;  4Z9Q A;  1K4F A;  2V8C A;  3ULF A;  1YMX A;  3G31 A;  2ZM2 A;  4PM6 A;  5HAQ A;  5FQJ A;  3LIA A;  4B4Z A;  1K55 A;  2XDM A;  4PM8 A;  3A0R A;  1LI0 A;  1BTL A;  1Q2P A;  3LY3 A;  4PKY A;  4MBK A;  1DY6 A;  1KDW A;  2HGV A;  3FZC A;  3QP4 A;  2WKE A;  2Y2M A;  4UHU A;  4M3K A;  3F1N A;  5A90 A;  4DN0 A;  3MXQ A;  5J3W A;  5DTS A;  2WZZ A;  1ES4 A;  5BOH A;  5JYO A;  4GN2 A;  3W4Q A;  4WM9 A;  2EA9 A;  4HJ3 A;  3VP0 A;  4EQ1 A;  4HOI A;  2R9W A;  4OH0 A;  3BEC A;  2XSS A;  3RXW A;  4WLA A;  5FQ9 A;  2WKH A;  4MN5 A;  4EXO A;  1ZTU A;  3OOV A;  3LEQ A;  3MFX A;  1YSP A;  2HP5 A;  4DE2 A;  3M6H A;  3VMA A;  1CQA A;  2Y2L A;  2JKF A;  4PM7 A;  2Y55 A;  3IHA A;  5M1A A;  4PMA A;  4GD8 A;  3C2W A;  4WEL A;  1L0D A;  4IUK A;  2HF6 A;  1MXO A;  1P9W A;  4F94 A;  1LSV A;  3IF5 A;  2PHY A;  5CX7 A;  1W79 A;  4ZJ3 A;  3BRM A;  1PI5 A;  1VM1 A;  3HLF A;  4HBU A;  3EGX C;  4WEJ A;  2XEP A;  3EQV A;  1ONH A;  4QHC A;  4NKP A;  2QZ6 A;  4K0X A;  4OPY A;  1YKD A;  1XX2 A;  2ZD8 A;  5HFO A;  1DP9 A;  1Z6F A;  1LHY A;  1V9Y A;  2Z6D A;  4HNB A;  1Q2Q A;  4R1G A;  3VOL A;  3QP2 A;  3HLE A;  1J9M A;  1K0K A;  3F1N B;  3CJM A;  3ZG5 A;  4AFI A;  3FV7 A;  4N92 A;  4R4R A;  2OOL A;  3ZG9 B;  2QHK A;  2A2L A;  2VGL S;  2WUQ A;  4Q0J A;  4IVK A;  4QY6 A;  2XFT A;  3LYX A;  5K5B A;  3T1R A;  1LT0 A;  1GSV A;  4MMN A;  1SKO A;  5DF9 A;  4EBN A;  3BM6 A;  4HJ4 A;  2WAD A;  5HL6 A;  4PAU A;  3JVU A;  4C75 A;  4IBX A;  3IXD A;  3RXX A;  2JC7 A;  3RFB A;  3B42 A;  2H0Y A;  2CC1 A;  5A8B A;  4JPM A;  4ZJ2 A;  1KE4 A;  2PR6 A;  3OPP A;  3QNC A;  4GOG A;  3BJN A;  3UN7 A;  2A24 A;  1JTD A;  5J7E A;  2PU4 A;  3UY6 A;  3MBZ A;  2J9P A;  3V5M A;  3VSK A;  4KZB A;  2X01 A;  2XFS A;  1NLZ A;  2W27 A;  4R3B A;  1OTI A;  2V0U A;  4B93 A;  5KIZ A;  3AGE A;  3BFG A;  3BFF A;  3SH7 A;  1XP4 A;  5HPF A;  4HQA A;  3MQO A;  1K25 A;  1MKI A;  1KDS A;  2E8I A;  2EFX A;  5FAP A;  5HX9 A;  3FKW A;  3GTC A;  3IWQ A;  2H5S A;  3ZDJ A;  3HUN A;  3T4J A;  2JKR M;  3MKE A;  4QU3 A;  1OJ5 A;  4HEF A;  3CUE C;  2JHE A;  5G4Z A;  4N1X A;  1SKO B;  4FH2 A;  4I38 A;  5EUA A;  4I5S A;  1GHM A;  5TR7 A;  4BLM A;  5I94 A;  5HDD A;  3JYI A;  4S2J A;  1N9O A;  2Y79 A;  3VP1 A;  1E4D A;  5HAP A;  1BZA A;  5AVF A;  4QB8 A;  2ZQ8 A;  4GZB A;  1FIK A;  2WKR A;  1W8Q A;  1JWV A;  2QMI A;  3MKF A;  4OQI A;  4HHD A;  4LV0 A;  2A24 B;  4PM9 A;  1OTB A;  1T1B A;  3ZG7 B;  3OPR A;  3HCY A;  4GJ4 A;  4KG5 A;  1LL8 A;  4JF4 A;  3GRJ A;  3T4L A;  5E2H A;  3HLW A;  1MY8 A;  2ZQC A;  2JCH A;  2VLG A;  3C8C A;  2XRN A;  4F3L A;  2PBY A;  3QP5 A;  4R4S A;  2EX9 A;  3OBF A;  1P0Z A;  1OTE A;  1ERO A;  4WEK A;  1YLY A;  4LCM A;  4X6T A;  1GHI A;  3OZH A;  5F69 A;  3O87 A;  1BYW A;  2WKP A;  3WS4 A;  1PI4 A;  3DW0 A;  1S1Z A;  1MBL A;  2OWH A;  5L8M A;  3GQZ A;  3AGD A;  4EWF A;  3LR4 A;  5TGF A;  3T1S A;  1G28 A;  2ZJ9 A;  3PBO A;  4ME4 A;  2P7J A;  3HJK A;  2Z6C A;  1N4O A;  4H8R A;  1CJF A;  2HV1 A;  3FPW A;  2BLS A;  1F98 A;  5EM1 A;  3UB9 A;  5G4Y A;  2I9V A;  3MQQ A;  5HW3 A;  2O99 A;  1GA0 A;  1G6A A;  1Z09 A;  4YNR A;  3NOT C;  3O88 A;  1JNU A;  3ICY A;  3TRC A;  5DF8 A;  4B88 A;  3G2Y A;  3NEC A;  1XKZ A;  2H28 A;  2VZW A;  2PR5 A;  3UME A;  4B9O A;  2C6W B;  2QJ7 A;  3IX4 A;  3F1P A;  4QWO A;  4F3L B;  3LR3 A;  3NCK A;  2LB5 A;  1TS0 A;  1LSX A;  1PRQ A;  4L0L A;  3A3I A;  3NOP C;  2KOI A;  1J3W A;  5CGW A;  2DCF A;  4NK3 A;  2ZL1 A;  3QHY A;  2XF3 A;  2ZMV A;  2ZM8 A;  3IH8 A;  1RCJ A;  2INW A;  4CJN A;  3HLG A;  5L09 A;  3TOI A;  3TW8 A;  4ZDX A;  3FWL A;  4Y5F A;  3A3E A;  5DKK A;  2Q9N A;  1TS8 A;  5GLB A;  1ZG6 A;  1KE0 A;  4CLC E;  4MCW A;  3E2L A;  4KQR A;  1W7F A;  4DKI A;  4DMZ A;  2EXA A;  1SHV A;  4ZTK A;  5HDS A;  1TS7 A;  3PR6 A;  2BTF P;  1KVL A;  1XA7 A;  2Y2N A;  5E2F A;  3OC2 A;  1N9B A;  2XQZ A;  4X1M A;  2ACG A;  3TG9 A;  3IBR A;  1Y28 A;  3H82 A;  4S2K A;  2BAS A;  1H8Y A;  4U3T A;  2ZM0 A;  2GZA A;  1OJG A;  5FI7 A;  3CAX A;  2ZC6 B;  3D9Y A;  3LY4 A;  2ZQ9 A;  3F1P B;  1TF1 A;  1IKI A;  2ZMA A;  1G6O A;  4GCZ A;  1IYO A;  4FOF A;  5CGS A;  5FEG A;  4I3A A;  3E4P A;  1MWR A;  5G18 A;  3U2A A;  1MKM A;  2ZL1 B;  4WL9 A;  3EGD C;  3MFD A;  4DDS A;  4ARZ A;  3UB5 P;  3B3X A;  2P9V A;  3MZD A;  2Z2M B;  2JKT I;  2HDU A;  4P87 A;  1Y4O A;  2EX8 A;  1UWN X;  4G3K A;  4DE0 A;  3K2N A;  3HLC A;  1SCW A;  4HI4 A;  4NXF A;  2QKP A;  4FD8 A;  3KO6 A;  3MZE A;  1AWI A;  2R9X A;  2UWX A;  1XA1 A;  2DMW A;  1YLP A;  4N9L A;  3Q82 A;  4FTX A;  4UQI M;  2Y2Q A;  5KSH A;  2FFF B;  1YMS A;  3FC7 A;  2Q0O A;  3BEB A;  5F6A A;  1IOU A;  2QPN A;  4LCL A;  3E0Y A;  2XD1 A;  4P6B A;  3O3V A;  2O9A A;  1K6S A;  3P09 A;  3A3J A;  3KSF A;  3H82 B;  1FSY A;  1YAX A;  5F1G A;  3MQ0 A;  2WAE A;  3CZD A;  1NWZ A;  4RX3 A;  4GNU A;  1GA9 A;  3BLS A;  5FAT A;  1NLY A;  4E3K A;  4Y13 A;  1VHM A;  4BMW A;  2M7V A;  4BBU A;  4BL3 A;  3HJI A;  5U47 A;  1VQQ A;  3N7W A;  4QD4 A;  2W0N A;  5EVE A;  3VE4 A;  3HUM A;  1DJA A;  1BLS A;  1BLP A;  5GLC A;  1D1J A;  4ARZ B;  5E2G A;  2L1M A;  2P9V B;  2WKQ A;  3B47 A;  5CRF A;  3IT9 A;  4OPZ A;  1YQS A;  4S2M A;  2Y2K A;  3A3F A;  2OAP 1;  5CTM A;  1X0O A;  2P04 A;  2A49 A;  2CMN A;  3OPH A;  4I3J A;  3WS5 A;  3Q7Z A;  5LBR A;  2M7U A;  1JWP A;  4MNR A;  4R0Q A;  2HZ5 A;  5MC7 A;  2H10 A;  3HRE A;  4WZ4 A;  1KGE A;  3PBT A;  1IEM A;  1PZP A;  2OLV A;  5J4E A;  1G68 A;  5FA7 A;  3EOI A;  3LGO A;  4RVA A; 
#chains in the Genus database with same CATH homology
 4FTX A;  1F2K A;  1G5U A;  2E8J A;  3KYE A;  3MSH A;  3T1Q B;  3MS6 A;  4ESP A;  2V8F A;  3T1S A;  2V8C A;  2BTF P;  2VK3 A;  5EV0 A;  1VET B;  1A0K A;  1PNE A;  1CJF A;  3T12 B;  5EM0 A;  3L7H A;  4X1M A;  5EM1 A;  2ACG A;  1ACF A;  1CF0 A;  1K0K A;  1SKO B;  1VET A;  1PFL A;  1HLU P;  1YPR A;  1Z09 A;  3T1X A;  3T1R A;  3D9Y A;  3CHW P;  5FDS A;  1FIL A;  1FIK A;  1SKO A;  5EVE A;  4X25 A;  2PRF A;  3NEC A;  1D1J A;  3U4L P;  1SZV A;  2JKG A;  3CPT B;  5FEG A;  1VEU B;  3L9K A;  4X1L A;  3NUL A;  2B95 A;  2ZL1 B;  4QWO A;  5FEF A;  3UB5 P;  4FUW A;  1Y4O A;  3CPT A;  2PAV P;  3LEQ A;  1PRQ A;  2PBD P;  1VEU A;  1J3W A;  3DAV A;  2HZ5 A;  1CQA A;  2ZL1 A;  2JKF A;  1AWI A;  4D60 A;  3LGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...