1K0KA

Yeast profilin, cubic crystal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
SWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN
publication title A Comparative Structural Analysis of Profilins
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 40
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2001-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1k0kA00
1YPRA 3T1XA 5FDSA 3T1RA 4X1MA 3NULA 2HZ5A 1K0KA 2V8FA 2ZL1B 1F2KA 2V8CA 1J3WA 3LEQA 3CPTA 2JKGA 3CHWP 2E8JA 1SKOA 1CJFA 2PRFA 3T1QB 1G5UA 1Y4OA 3NECA 3L9KA 1A0KA 5EM1A 5EM0A 2BTFP 1PFLA 3MSHA 3LGOA 5FEGA 3D9YA 2B95A 4ESPA 1D1JA 1VETB 4X25A 1CF0A 3UB5P 1CQAA 1VEUB 2ACGA 3MS6A 3T12B 3U4LP 2ZL1A 2JKFA 5EVEA 4FUWA 1PRQA 3L7HA 1FILA 5EV0A 3KYEA 4D60A 1VEUA 2VK3A 5FEFA 1ACFA 4QWOA 1AWIA 1SZVA 4X1LA 3T1SA 2PBDP 1FIKA 1Z09A 3DAVA 4FTXA 3CPTB 1HLUP 1VETA 2PAVP 1SKOB 1PNEA
chains in the Genus database with same CATH superfamily
1OT9A 4G3KA 5CECA 3DBAA 4HOIA 2P9VB 4KZ3A 2WYXA 1CI9A 1J3WA 3QNBA 4HJ4A 2H28A 1SKOA 3CZDA 4Y0TA 3IS2A 1S67L 2A24B 4HH3A 1FQGA 1LLBA 3D3OA 4ZJ1A 3ZDJA 3GRJA 5HPIA 2A3UA 2HDUA 2AVXA 3UPOA 3R4KA 2P9VA 1ERQA 1S6RA 4IVKA 3FC7A 4Y0OA 4GNUA 5CGXA 1D1JA 4GW9A 2XDMA 4B4XA 2QMIA 3LI9A 3EWKA 5FL3A 1CQAA 3N6IA 1DP6A 3UE6A 2A49A 1D06A 1NY0A 4E3LA 5GHYA 1LSVA 1F98A 1XX2A 4FUWA 2V1ZA 3Q07A 3NJAA 4MBFA 2LB9A 4KZ6A 1MC0A 4NXEA 4MLLA 4RX3A 1ACFA 5FI7A 2OWHA 1IELA 4C6YA 3P98A 3WRTA 3PAGA 5I94A 1BLCA 4PM5A 2HP6A 5HFOA 4GLQA 3PR6A 1MWRA 3B42A 2EFXA 4N9KA 3IX3A 1ES4A 1LL9A 1BSGA 4H6JB 5A8BA 3RTYA 1TDGA 3SH7A 1YLPA 4X1MA 3PBRA 3DW0A 3O5YA 2Q0OA 3HLEA 3LIAA 5J3WA 1L3LA 2HJ9C 2UWXA 3PBNA 4OLDA 3VP3A 1DJAA 4WN5A 3RXWA 3KSIA 1IYSA 1BUEA 4B88A 2J9PA 2Y91A 3S4XA 4E3MA 4ME4A 3G32A 5FQIA 5FEGA 1NLZA 1SDNA 2VV7A 3A3IA 5IT5A 3SH9A 2Y2HA 3NOTC 2Y2GA 3E0YA 1D7EA 4QY6A 4C75A 3M6BA 4KZ7A 3GVBA 1W63Q 3IXDA 2DCFA 4UA7A 4GD8A 5AQBA 3SS4A 5J8XA 2ZM2A 3GQZA 5CX7A 1NYYA 2XK1A 3UB8A 2EXBA 2VLGA 4OQGA 2O9AA 4Y3IA 2WUQA 2INWA 1H8YA 4R6LA 2J3TD 3LIEA 4I38A 1K25A 1I5QA 3V39A 3IH8A 1AWIA 2HP9A 1ERMA 3IWQA 3T1SA 1L0DA 3ZHHA 5EPHA 2H0TA 4LENA 4EU0A 2PYRA 3IT9A 4IBXA 1JVJA 1YPRA 1ONHA 3HLCA 5AQAA 1P9WA 4S2KA 5CRFA 5M1AA 2PYPA 3C7VA 2WKQA 4P6ZM 2DMWA 2ZC4B 2V1BA 1BYWA 2FZ0A 5DTTA 4QJGA 2XH9A 2JKGA 1FR1A 1CJFA 1LL5A 4ZJ2A 2Y2IA 4CLCC 3PBSA 2XA7M 4X53A 4MMNA 4LRXC 5L8MA 5AVFA 1ZC2A 1Q2QA 5GHXA 3CAXA 1XP4A 3AGEA 1CEFA 2WKPA 1W7FA 2PR5A 3MF0A 3LICA 4JPMA 5KZHA 2NUPC 1Q2PA 1VHMA 5HDCA 4CLCB 3VP0A 2ACGA 2ZM0A 3VV4A 4IBRA 3OPRA 4HESA 3G2ZA 2HPBA 4Y0UA 5CGSA 1OTIA 3HJKA 4MN7A 3HREA 3KYEA 4R70A 4CLCA 5DTSA 3N8SA 1ZG6A 2VJWA 4E3KA 5HAPA 4JF5A 3N7WA 4S2PA 3LR0A 1KE4A 1DJCA 3B47A 3V3SA 3N8LA 3S7PA 3BW6A 2NUTC 2HJEA 4PMAA 3PBQA 1PWGA 1MXOA 1TS0A 4GZBA 4S2IA 3UN7A 1SKFA 4EV4A 5U47A 2HZ5A 2IWDA 2VV8A 1XFQA 1PZPA 3Q7VB 1PIOA 3KYZA 3GTCA 4JLFA 3G31A 4U3TA 2XFTA 3D4FA 4QHCA 3K3DA 3D72A 3VOLA 1A0KA 5HAQA 5GL9A 3Q7VA 4I5SA 2WK0A 2Y2KA 3OZHA 2EWVA 3D9YA 4HBUA 3T4JA 3LR3A 4BWIA 4BD1A 4JGPA 3V5MA 4KG6A 3S7OA 1VEUB 5JYPA 3KSFA 1K4EA 4IEDA 2ZL1A 1H0MA 5EE8A 2JKFA 4PM7A 5F6AA 3BYDA 4P6ZS 4GHIB 3BFGA 4KENB 1XJ6A 1OTEA 2O0YA 5CHUA 3RFBA 3CLOA 1N9NA 3IQAA 4R0QA 1RCJA 4Y15A 1LI9A 3EEAA 1VEUA 2HGVA 1OPXA 4WMCA 2W0NA 4QWOA 5DF7A 1E3UD 4BENA 2ZJ9A 2XA7S 5DKKA 4GHIA 4OONA 2FFYA 4DN0A 3PTEA 4LRZE 3GSGA 3LIFA 3UDXA 1QMEA 1Z6FA 1BZAA 3VE3A 3O88A 4N9LA 2PD8A 2XR0A 1K6SA 2LB5A 5FQKA 1MZUA 4DXCA 4PM6A 4GDNA 3K3CA 3GR2A 3HL9A 3IF6B 3IWOA 1GHMA 1HVBA 4OPQA 5GLCA 4WEKA 4RQ9A 3BFEA 2QZ6A 5KSHA 3MZFA 4I3IA 2P04A 4HP9A 3E4OA 4S2NC 2JN7A 4K91A 5EOEA 2E8JA 1H5XA 3C4PA 1Y4OA 4KZ4A 5DJTA 1XPBA 4LGWA 3L9KA 5I5LA 4JGOA 3A3DA 1T1AA 3AGDA 3LR4A 4DXBA 3TSGA 1JNUA 1MWTA 4EBLA 1NLYA 1FSYA 3WS2A 4ETXA 4R4SA 1MY8A 1S1ZA 1KGGA 1BULA 3IHAA 2WAFA 2IWBA 2QWSA 4X56A 1MKMA 2W1TA 1JWVA 1H3QA 2EXAA 1OT6A 5GHZA 2PD7A 3B33A 3RJUA 1NYMA 4II7A 3QP1A 4GCZA 2K7SA 5A90A 4S2NA 3CITA 1U60A 4JGRA 1YLYA 5EVIC 3BY9A 5MC7A 2B02A 5FQMA 1ZG4A 4PPRA 5E2GA 3WS4A 3S7QA 3G4PA 2WZXA 4ZBEA 2O99A 2DNSA 1EI5A 3BFFA 4X68A 1XXMA 2H10A 4WZ4A 3R7WB 4F3LB 3K2NA 3H7WB 4Y17A 4HHDA 1YSPA 4LLOB 4C3QA 5AQ7A 2Z2LB 4OVDA 2PR6A 5GLAA 1IYPA 3BECA 4LRYC 4LPZA 3N8RA 4R3JA 1YLZA 5EVIA 5AVEA 3R7WA 4F3LA 1ZTUA 1E25A 4E6WA 3ZFZA 3NDEA 1PW1A 3HLGA 4KZ9A 4B9OA 3M6HA 1N4OA 3F1OA 3ZNTA 1V9YA 1SHVA 4S2JA 2Y2LA 2ZQ8A 2VX8A 1LHYA 4CLCE 3LUQA 2M7VA 4EWFA 3LEZA 4IJGA 3A3EA 2WADA 4DRTA 3P09A 3UE3A 4O01A 4QD4A 2J7VA 3MKFA 3DTIA 2WKHA 1UWNX 4I39A 3Q81A 5HX9A 3LFVA 3MQ0A 3V50A 2XD1A 4FOFA 1N9BA 2A24A 4B93A 4PAUA 3Q1FA 2VK3A 1YLJA 4LCLA 1SZVA 5CTNA 5GLDA 2KOIA 4Z1WA 4ZDXA 4X55A 4NXFA 3CPTB 1HD8A 2ZMFA 2VKSA 4N1HA 4GS9B 3MXQA 4DJ3A 1FR6A 4KZ8A 4D2OA 1DP9A 4GJ4A 4G3VA 1K6RA 3T4OA 4EBPA 1JTGA 3BLMA 3Q82A 4R4RA 1S4SA 2WKIA 4KZ5A 2WZZA 2Z6CA 2ZOHA 3CPTA 3VMAA 4GS9A 3H82B 4R3BA 2HDRA 4IHQA 4O8GA 4BMWA 1IFQA 3N4IA 4HH2A 3NECA 3A0SA 4EQ1A 5FASA 1W8YA 3HLBA 4MN6A 4UEYA 3CUEC 3E4PA 4DDSA 4XT2B 4MDZA 3H82A 2JC7A 3LYXA 4XXRA 4H6JA 5EFWA 4Q8IA 1ES5A 2GDNA 5EUAA 3WS1A 3DTEA 5DTKA 4WZ5C 4GB7A 4BL2A 4XT2A 3QHYA 2JKRM 3EGDC 4EEUA 3UB7A 3BQAA 3FZCA 4YNRA 3A3JA 2JCHA 3UO9A 4E3JA 3CUEA 4FD8A 1TS6A 5FAOA 1KDSA 1MBLA 2D02A 4MBHA 3MFXA 4X69A 4DE1A 1YKDA 2HDQA 4FTXA 1HLUP 1UWPX 4NEED 4P85A 2J80A 4KUOA 4Q0IA 3BLSA 3BRMA 4NXGA 2PBYA 2KLIA 1ESUA 2WGVA 1W5DA 5G4ZA 4WZ5A 3VFHA 3W2ZA 5L2FA 3JPUA 5EVID 5AQ9A 1K56A 3FYZA 1H8ZA 1L0GA 2XFSA 3MZEA 2JKTM 3NBLA 2EX9A 2OV5A 3ISGA 4RX2A 2VEAA 2WKEA 2J8YA 5KMWA 3VFFA 3ULFA 4BJPA 3LIDA 4ZTKA 3E2KA 1RGZA 3IH9A 3PYPA 4I3JA 3U2AA 3ZG0A 5E43A 3ZVWA 2KDKA 2IA2A 3CMZA 1IKIA 4UQIS 4KQRA 3EEHA 1VM1A 3QP8A 4L9EA 4GDBA 4KQQA 4K0WA 3C4OA 1ALQA 2J3WA 3IBRA 5EV0A 3PBTA 4D60A 3UE0A 4JXGA 3BWLA 2ZM8A 2PHYA 3SZTA 4A5RA 3NDGA 4OQHA 4X1LA 3SH8A 1GHIA 1BLSA 1V9ZA 1WA9A 2OWJA 2ZQDA 1O07A 1FCOA 3IX8A 1YLTA 2V0WA 3NOPC 3FPVA 2YKHA 1PI4A 4BBUA 1WE4A 5FSRA 3NIAA 2B5RA 2XSSA 5F1FA 3UPNA 3GV9A 4JF6A 1LL8A 5A93A 2ZLYA 1MWUA 2JE5A 2Y2QA 2ZC5B 1G5UA 1XA7A 3CI6A 3TJZC 1KDWA 3C5AA 3ZGAB 3VOZA 1T1BA 5HDSA 3F1PB 1ES3A 4L9GA 4FSFA 3CG5A 3UPPA 4WF0A 3FKVA 2P7JA 4ARZB 4Y13A 4Q0JA 3FWLA 2Y2MA 1E4DA 2MJ6A 2G2UA 1PWDA 2L0WA 2C6WB 2PDRA 4CPKA 2W3GA 4U0TA 1I2WA 2GX5A 3HJIA 4DJ2A 5EVEA 3T4TA 4ARZA 2XF3A 4O7DA 4XUZA 3L7HA 4S2OA 5GLBA 4DE2A 1NZOA 1FSWA 4DE3A 3HLWA 5L09A 3CJMA 4OLGA 1GSWA 5HW3A 5HSQA 1PWCA 3MQOA 4EW7A 3EQVA 3UNWA 5DJUA 1K38A 1WYBA 2FFFB 3C2WA 5DF9A 1XA1A 5CGWA 1STZA 2Q9MA 4L0LA 3DAVA 3QNCA 1ES2A 3HLDA 4K08A 5F69A 5HWWA 1OTBA 2PU2A 4BLMA 2OLVA 1P9RA 2A2LA 3T1XA 1EWZA 3IF6C 4HY8A 4HIAA 4ZAMA 1K0KA 3F1NB 1PW8A 2VGJA 2VGLM 2CC1A 4IUHA 4RVAA 1AXBA 3BQ8A 3QP4A 2FH5A 3ZCZA 2PRFA 1H8MA 4WBGA 3EQUA 3IF5A 1BTLA 4BQMA 5TFQA 5CEBA 3GDIA 1YLWA 2Y79A 4WELA 4BBVA 4DKIA 4HP4A 2J9OA 3OLOA 5M19A 1F9IA 5G18A 3T4SA 1W8QA 3S7NA 4FCFA 4EETB 3LGOA 3T4QA 4GOGA 1MPLA 1QMFA 2Y2PA 1L0EA 4DF6A 4JF4A 5J4EA 4RYEA 1RP5A 3LO7A 4E3NA 5J7EA 1VETB 1CF0A 3LY4A 3UB5P 2L4RA 3ZG5A 3IF6A 5TJJA 5IU1A 2E8IA 5D3OA 5IHVA 4OH0A 3VSKA 2JHEA 1M40A 4OP8A 4EBNA 5DFXA 3OBFA 3LY3A 4ZRRA 1K55C 1ODVA 1T1CA 3C38A 2ZBBA 5F5YA 4EESA 4IUKA 4DMZA 4NK3A 3RXXA 3T4LA 2ZMVA 4KG2A 3P01A 4CLCD 2J3TC 3HLFA 1XGJA 4ZJ3A 5FATA 1TDLA 3T1RA 2H0YA 5DFYA 4OQIA 5EOOA 1T19A 4MNRA 1NJ4A 3MBZA 2X71A 1HZOA 3LEQA 5LBRA 4WYYA 3IXBA 1G6AA 1ZKJA 2OAP1 1K55A 3LR5A 4MEZA 2Y8HA 1M6KA 2V9AA 5AJGA 4QB8A 1KOUA 3G30A 4R1GA 4E3OA 4OKPA 4EUZA 1OTAA 4JXVA 4HNBA 1PFLA 3UB9A 4EERA 2X01A 3MSHA 3ZQ5A 3MFDA 3BY8A 5FQ9A 1SCWA 5E2FA 1KGEA 2JBFA 2PT7A 3H7WA 1CK3A 4X25A 4EQIA 1GHPA 3UB6A 1NRJA 3SOIA 3MS6A 4KG5A 1BLHA 3H9WA 4MBKA 1Y54A 4I3AA 5JYOA 2I72A 2X02A 4P0MA 3WWXA 3TOIA 2VGLS 5A92A 4KZAA 3NHQA 1YAXA 2YKFA 3FV7A 2R78A 4GD6A 4OQ0A 4OPZA 3PAEA 1YT4A 4JBFA 3VP4A 1TS8A 2VA0A 4JXWA 1O7EA 4HJ3A 4H8RA 1FIKA 5E2HA 3JYIA 5FAQA 2QJ5A 2Y2JA 5BOHA 1LSXA 4PM8A 5F68A 5FQQA 4BL3A 1YQSA 1VB6A 2JKRI 4LV3A 3VE4A 4KQOA 3T50A 1HTZA 1S0WA 2DRWA 4WMCD 5A91A 3NULA 3ZG7B 2W3HA 3IXHA 4LCMA 4LV0A 4ID4A 3ITBA 1JWZA 5CTMA 3VSLA 4DE0A 4Y5FA 2XRNA 4CQHA 1MKIA 2R9XA 1F5MA 1DRMA 3TE8A 5DF8A 2EX8A 5F83A 4UQIM 3EGXC 5FI6A 1IYOA 2QKPA 2IWCA 1GSXA 5HAIA 4UA6A 1EW0A 4ETZA 2EWWA 2EA9A 2XQZA 1PYYA 3OCLA 3RH8B 5EECA 4P87A 3O3VA 1PI5A 2M1CA 5HL6A 3MMHA 1TD5A 2JKTI 5HD5A 4LV1A 2VGKA 3LI8A 4JKTA 3T12B 4EXOA 5L10A 3ICYA 3G35A 2WGWB 2RL3A 1L0FA 4DDYA 2ZQ7A 5KSCA 4YWZA 4QPRA 4HEFA 3VOYA 4B4ZA 1G68A 5FEFA 3ZYTA 2QHKA 2Y2NA 4LFUA 2WGWA 4S2LA 3M2KA 4BBTA 1LT0A 1Z09A 3TW8A 1FOFA 2PAVP 2W1RA 2B18A 2W3DA 2QPNA 3DTMA 4JGQA 1P0ZA 3QP6A 2P08A 2Y59A 2HDSA 3PXPA 4WM9A 3W8KA 1RGYA 4QU3A 1G6OA 2C5WB 2L1MA 3UMEA 3SS5A 2V1AA 3CHWP 3P7NA 4BD0A 4OPRA 2QYBA 5HZHA 1OTDA 3ZVTA 4UA9A 2OAQ1 3W4OA 3OPHA 5EM1A 1XJ3A 2W3FA 1XKZA 3OOVA 1I2SA 2ZC6B 3DWZA 4HJ6A 3BFDA 3PBOA 1GCEA 5IS1A 1JWPA 4IVIA 1XFNA 4XUXA 4WL9A 4E3IA 4ESPA 2QJ7A 1GA0A 1LSWA 1K54C 4OOYA 3WS5A 2G2WA 3MXSA 1E3UA 1IYQA 3U4LP 1NRFA 3S1YA 2ZD8A 5TBMB 3OC2A 3UMDA 4RA7A 1K4FA 1FILA 2Q9NA 1N9LA 3FKWA 2W3EA 3TRCA 2XLNA 1IOUA 4HBTA 2EX6A 1C3BA 2Y2OA 3QP5A 3DTKA 2OOLA 4S2MA 2M7UA 2XROA 5TBMA 4JXSA 2Y55A 2BASA 5CHJA 1S4RA 4N92A 1T18A 3I7JA 3G34A 3G6OA 3BEBA 3IX4A 1NWZA 3MR0A 2Y4AA 1PNEA 5K5BA 1K54A 3NC8A 1XJ4A 1ZHHB 4O0PA 5FQJA 4KUKA 2ZC7A 1YM1A 5HPFA 2RCXA 1W63M 3E98A 2VV6A 4MCWA 3WRZA 2WAEA 4Z9QA 5HDDA 3JVVA 1MWSA 4KQDA 2R9WA 4NKPA 5EM0A 3A3FA 3W4QA 4M3KA 1WYCA 3BJNA 3OPLA 3E2LA 3O86A 1UGUA 4HI4A 1YSQA 3MKEA 1J9MA 1DY6A 4GN2A 5HL1A 4X6TA 2V2FF 2GJ3A 2K31A 3NCKA 2W27A 4FH4A 1IEMA 5FDHA 2UV0E 3GECA 3OPPA 4NXBA 2XGNA 2BG1A 1ESIA 5F82A 4WUJA 2ZQAA 5HWTA 4E6XA 3EOIA 3F1PA 2PBDP 2GNXA 5HD3A 2V20A 5TR7A 2Z6DA 5CHMA 1JTDA 1VQQA 4QY5A 5FA7A 4N1XA 4WLAA 1K57C 2XEPA 2O9CA 3UDIA 1TF1A 2G7UA 4PKYG 5HARA 5FDSA 1CEGA 2ZC3B 3LCEA 5EVLA 5FAPA 4PKYA 2KX6A 1GSVA 3DWKA 2V8FA 4Y2FA 2ZL1B 1LI0A 3JVUA 4EEPA 2BLSA 2O9BA 3MQQA 4L9FA 1N9OA 3Q7ZA 4G3WA 4LV2A 2EFUA 1TS7A 2I9VA 3IXGA 1YMSA 2GZAA 4OOMA 3M2JA 4CJNA 3KO6A 3IHBA 4YFMA 4P6BA 2ZQCA 3CWFA 1NXYA 2BTFP 1OMEA 3NI9A 3LIBA 4K0XA 3MZDA 3KYQA 5DKLA 3ZG8B 1TVFA 3IBJA 3V67A 2B95A 3UY6A 1K57A 4UAAA 1K56D 3QP2A 3MXRA 4R23A 3C8CA 2HV1A 3NOUC 3F1NA 3S22A 4F94A 3VP2A 1NZUA 5DVAA 3W4PA 2K2NA 3C30A 4R38A 1BT5A 1YMXA 1KVMA 3NY4A 5CERA 3HUOA 3ZNYA 3KSGA 3B3XA 3OCNA 3PHYA 1KE3A 2Z2MB 5G4YA 1SDEA 1FCNA 3HCYA 3ZG9B 2P74A 3BM6A 4YINA 1OJGA 3UDFA 4M4XA 1ONGA 2H5SA 3HUNA 4NG2A 5FI2A 1CI8A 1DJBA 1VETA 2WGIA 3TG9A 1X0OA 2W1TB 2CMNA 3FPWA 1W79A 3A0RA 3MJQA 1Y28A 4AFIA 5KIZA 4Q0HA 4UHUA 1F2KA 1XGIA 2V8CA 4E04A 1TEMA 3T4KA 2ZOIA 4Y7PA 3SS3A 5C5KA 4GKUA 3T1QB 3WS0A 1S1YA 3HVFA 5E2EA 4PM9A 1FCMA 2HP5A 4NETA 2EX2A 1L2SA 3ITAA 2V0UA 4KZBA 3HUMA 1S66L 1BLPA 3KSHA 2OLUA 2D01A 1KGFA 4EUVA 4HQAA 5CEDA 3BFCA 1P97A 4OPYA 1PZOA 5TGFA 4MN5A 1XJ2A 2PU4A 3E4QA 4U0XA 2WKRA 1KVLA 3SW1A 3V3RA 1G28A 2OSUA 1PRQA 1EROA 4OP5A 2XD5A 1KE0A 2ZMAA 5EVIB 3GMWA 4R3AA 3C7UA 3AGFA 5HWVA 2HF6A 1IKGA 3UE1A 5M18A 1GA9A 3F1OB 4YOFA 3G2YA 3HBRA 3KX0X 4FH2A 2ZQ9A 3IWIA 4WEJA 4OOLA 1DP8A 1OJ5A 3FG8A 3A0VA 5F1GA 4PHTA 5CXWA 3O87A 2VZWA 5L07A 3VP1A 1SKOB 3IS2B
chains in the Genus database with same CATH topology
1YPRA 3T1XA 5FDSA 3T1RA 4X1MA 3NULA 2HZ5A 1K0KA 2V8FA 2ZL1B 1F2KA 2V8CA 1J3WA 3LEQA 3CPTA 2JKGA 3CHWP 2E8JA 1SKOA 1CJFA 2PRFA 3T1QB 1G5UA 1Y4OA 3NECA 3L9KA 1A0KA 5EM1A 5EM0A 2BTFP 1PFLA 3MSHA 3LGOA 5FEGA 3D9YA 2B95A 4ESPA 1D1JA 1VETB 4X25A 1CF0A 3UB5P 1CQAA 1VEUB 2ACGA 3MS6A 3T12B 3U4LP 2ZL1A 2JKFA 5EVEA 4FUWA 1PRQA 3L7HA 1FILA 5EV0A 3KYEA 4D60A 1VEUA 2VK3A 5FEFA 1ACFA 4QWOA 1AWIA 1SZVA 4X1LA 3T1SA 2PBDP 1FIKA 1Z09A 3DAVA 4FTXA 3CPTB 1HLUP 1VETA 2PAVP 1SKOB 1PNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YPR A;  3T1X A;  5FDS A;  3T1R A;  4X1M A;  3NUL A;  2HZ5 A;  1K0K A;  2V8F A;  2ZL1 B;  1F2K A;  2V8C A;  1J3W A;  3LEQ A;  3CPT A;  2JKG A;  3CHW P;  2E8J A;  1SKO A;  1CJF A;  2PRF A;  3T1Q B;  1G5U A;  1Y4O A;  3NEC A;  3L9K A;  1A0K A;  5EM1 A;  5EM0 A;  2BTF P;  1PFL A;  3MSH A;  3LGO A;  5FEG A;  3D9Y A;  2B95 A;  4ESP A;  1D1J A;  1VET B;  4X25 A;  1CF0 A;  3UB5 P;  1CQA A;  1VEU B;  2ACG A;  3MS6 A;  3T12 B;  3U4L P;  2ZL1 A;  2JKF A;  5EVE A;  4FUW A;  1PRQ A;  3L7H A;  1FIL A;  5EV0 A;  3KYE A;  4D60 A;  1VEU A;  2VK3 A;  5FEF A;  1ACF A;  4QWO A;  1AWI A;  1SZV A;  4X1L A;  3T1S A;  2PBD P;  1FIK A;  1Z09 A;  3DAV A;  4FTX A;  3CPT B;  1HLU P;  1VET A;  2PAV P;  1SKO B;  1PNE A; 
#chains in the Genus database with same CATH topology
 1OT9 A;  4G3K A;  5CEC A;  3DBA A;  4HOI A;  2P9V B;  4KZ3 A;  2WYX A;  1CI9 A;  1J3W A;  3QNB A;  4HJ4 A;  2H28 A;  1SKO A;  3CZD A;  4Y0T A;  3IS2 A;  1S67 L;  2A24 B;  4HH3 A;  1FQG A;  1LLB A;  3D3O A;  4ZJ1 A;  3ZDJ A;  3GRJ A;  5HPI A;  2A3U A;  2HDU A;  2AVX A;  3UPO A;  3R4K A;  2P9V A;  1ERQ A;  1S6R A;  4IVK A;  3FC7 A;  4Y0O A;  4GNU A;  5CGX A;  1D1J A;  4GW9 A;  2XDM A;  4B4X A;  2QMI A;  3LI9 A;  3EWK A;  5FL3 A;  1CQA A;  3N6I A;  1DP6 A;  3UE6 A;  2A49 A;  1D06 A;  1NY0 A;  4E3L A;  5GHY A;  1LSV A;  1F98 A;  1XX2 A;  4FUW A;  2V1Z A;  3Q07 A;  3NJA A;  4MBF A;  2LB9 A;  4KZ6 A;  1MC0 A;  4NXE A;  4MLL A;  4RX3 A;  1ACF A;  5FI7 A;  2OWH A;  1IEL A;  4C6Y A;  3P98 A;  3WRT A;  3PAG A;  5I94 A;  1BLC A;  4PM5 A;  2HP6 A;  5HFO A;  4GLQ A;  3PR6 A;  1MWR A;  3B42 A;  2EFX A;  4N9K A;  3IX3 A;  1ES4 A;  1LL9 A;  1BSG A;  4H6J B;  5A8B A;  3RTY A;  1TDG A;  3SH7 A;  1YLP A;  4X1M A;  3PBR A;  3DW0 A;  3O5Y A;  2Q0O A;  3HLE A;  3LIA A;  5J3W A;  1L3L A;  2HJ9 C;  2UWX A;  3PBN A;  4OLD A;  3VP3 A;  1DJA A;  4WN5 A;  3RXW A;  3KSI A;  1IYS A;  1BUE A;  4B88 A;  2J9P A;  2Y91 A;  3S4X A;  4E3M A;  4ME4 A;  3G32 A;  5FQI A;  5FEG A;  1NLZ A;  1SDN A;  2VV7 A;  3A3I A;  5IT5 A;  3SH9 A;  2Y2H A;  3NOT C;  2Y2G A;  3E0Y A;  1D7E A;  4QY6 A;  4C75 A;  3M6B A;  4KZ7 A;  3GVB A;  1W63 Q;  3IXD A;  2DCF A;  4UA7 A;  4GD8 A;  5AQB A;  3SS4 A;  5J8X A;  2ZM2 A;  3GQZ A;  5CX7 A;  1NYY A;  2XK1 A;  3UB8 A;  2EXB A;  2VLG A;  4OQG A;  2O9A A;  4Y3I A;  2WUQ A;  2INW A;  1H8Y A;  4R6L A;  2J3T D;  3LIE A;  4I38 A;  1K25 A;  1I5Q A;  3V39 A;  3IH8 A;  1AWI A;  2HP9 A;  1ERM A;  3IWQ A;  3T1S A;  1L0D A;  3ZHH A;  5EPH A;  2H0T A;  4LEN A;  4EU0 A;  2PYR A;  3IT9 A;  4IBX A;  1JVJ A;  1YPR A;  1ONH A;  3HLC A;  5AQA A;  1P9W A;  4S2K A;  5CRF A;  5M1A A;  2PYP A;  3C7V A;  2WKQ A;  4P6Z M;  2DMW A;  2ZC4 B;  2V1B A;  1BYW A;  2FZ0 A;  5DTT A;  4QJG A;  2XH9 A;  2JKG A;  1FR1 A;  1CJF A;  1LL5 A;  4ZJ2 A;  2Y2I A;  4CLC C;  3PBS A;  2XA7 M;  4X53 A;  4MMN A;  4LRX C;  5L8M A;  5AVF A;  1ZC2 A;  1Q2Q A;  5GHX A;  3CAX A;  1XP4 A;  3AGE A;  1CEF A;  2WKP A;  1W7F A;  2PR5 A;  3MF0 A;  3LIC A;  4JPM A;  5KZH A;  2NUP C;  1Q2P A;  1VHM A;  5HDC A;  4CLC B;  3VP0 A;  2ACG A;  2ZM0 A;  3VV4 A;  4IBR A;  3OPR A;  4HES A;  3G2Z A;  2HPB A;  4Y0U A;  5CGS A;  1OTI A;  3HJK A;  4MN7 A;  3HRE A;  3KYE A;  4R70 A;  4CLC A;  5DTS A;  3N8S A;  1ZG6 A;  2VJW A;  4E3K A;  5HAP A;  4JF5 A;  3N7W A;  4S2P A;  3LR0 A;  1KE4 A;  1DJC A;  3B47 A;  3V3S A;  3N8L A;  3S7P A;  3BW6 A;  2NUT C;  2HJE A;  4PMA A;  3PBQ A;  1PWG A;  1MXO A;  1TS0 A;  4GZB A;  4S2I A;  3UN7 A;  1SKF A;  4EV4 A;  5U47 A;  2HZ5 A;  2IWD A;  2VV8 A;  1XFQ A;  1PZP A;  3Q7V B;  1PIO A;  3KYZ A;  3GTC A;  4JLF A;  3G31 A;  4U3T A;  2XFT A;  3D4F A;  4QHC A;  3K3D A;  3D72 A;  3VOL A;  1A0K A;  5HAQ A;  5GL9 A;  3Q7V A;  4I5S A;  2WK0 A;  2Y2K A;  3OZH A;  2EWV A;  3D9Y A;  4HBU A;  3T4J A;  3LR3 A;  4BWI A;  4BD1 A;  4JGP A;  3V5M A;  4KG6 A;  3S7O A;  1VEU B;  5JYP A;  3KSF A;  1K4E A;  4IED A;  2ZL1 A;  1H0M A;  5EE8 A;  2JKF A;  4PM7 A;  5F6A A;  3BYD A;  4P6Z S;  4GHI B;  3BFG A;  4KEN B;  1XJ6 A;  1OTE A;  2O0Y A;  5CHU A;  3RFB A;  3CLO A;  1N9N A;  3IQA A;  4R0Q A;  1RCJ A;  4Y15 A;  1LI9 A;  3EEA A;  1VEU A;  2HGV A;  1OPX A;  4WMC A;  2W0N A;  4QWO A;  5DF7 A;  1E3U D;  4BEN A;  2ZJ9 A;  2XA7 S;  5DKK A;  4GHI A;  4OON A;  2FFY A;  4DN0 A;  3PTE A;  4LRZ E;  3GSG A;  3LIF A;  3UDX A;  1QME A;  1Z6F A;  1BZA A;  3VE3 A;  3O88 A;  4N9L A;  2PD8 A;  2XR0 A;  1K6S A;  2LB5 A;  5FQK A;  1MZU A;  4DXC A;  4PM6 A;  4GDN A;  3K3C A;  3GR2 A;  3HL9 A;  3IF6 B;  3IWO A;  1GHM A;  1HVB A;  4OPQ A;  5GLC A;  4WEK A;  4RQ9 A;  3BFE A;  2QZ6 A;  5KSH A;  3MZF A;  4I3I A;  2P04 A;  4HP9 A;  3E4O A;  4S2N C;  2JN7 A;  4K91 A;  5EOE A;  2E8J A;  1H5X A;  3C4P A;  1Y4O A;  4KZ4 A;  5DJT A;  1XPB A;  4LGW A;  3L9K A;  5I5L A;  4JGO A;  3A3D A;  1T1A A;  3AGD A;  3LR4 A;  4DXB A;  3TSG A;  1JNU A;  1MWT A;  4EBL A;  1NLY A;  1FSY A;  3WS2 A;  4ETX A;  4R4S A;  1MY8 A;  1S1Z A;  1KGG A;  1BUL A;  3IHA A;  2WAF A;  2IWB A;  2QWS A;  4X56 A;  1MKM A;  2W1T A;  1JWV A;  1H3Q A;  2EXA A;  1OT6 A;  5GHZ A;  2PD7 A;  3B33 A;  3RJU A;  1NYM A;  4II7 A;  3QP1 A;  4GCZ A;  2K7S A;  5A90 A;  4S2N A;  3CIT A;  1U60 A;  4JGR A;  1YLY A;  5EVI C;  3BY9 A;  5MC7 A;  2B02 A;  5FQM A;  1ZG4 A;  4PPR A;  5E2G A;  3WS4 A;  3S7Q A;  3G4P A;  2WZX A;  4ZBE A;  2O99 A;  2DNS A;  1EI5 A;  3BFF A;  4X68 A;  1XXM A;  2H10 A;  4WZ4 A;  3R7W B;  4F3L B;  3K2N A;  3H7W B;  4Y17 A;  4HHD A;  1YSP A;  4LLO B;  4C3Q A;  5AQ7 A;  2Z2L B;  4OVD A;  2PR6 A;  5GLA A;  1IYP A;  3BEC A;  4LRY C;  4LPZ A;  3N8R A;  4R3J A;  1YLZ A;  5EVI A;  5AVE A;  3R7W A;  4F3L A;  1ZTU A;  1E25 A;  4E6W A;  3ZFZ A;  3NDE A;  1PW1 A;  3HLG A;  4KZ9 A;  4B9O A;  3M6H A;  1N4O A;  3F1O A;  3ZNT A;  1V9Y A;  1SHV A;  4S2J A;  2Y2L A;  2ZQ8 A;  2VX8 A;  1LHY A;  4CLC E;  3LUQ A;  2M7V A;  4EWF A;  3LEZ A;  4IJG A;  3A3E A;  2WAD A;  4DRT A;  3P09 A;  3UE3 A;  4O01 A;  4QD4 A;  2J7V A;  3MKF A;  3DTI A;  2WKH A;  1UWN X;  4I39 A;  3Q81 A;  5HX9 A;  3LFV A;  3MQ0 A;  3V50 A;  2XD1 A;  4FOF A;  1N9B A;  2A24 A;  4B93 A;  4PAU A;  3Q1F A;  2VK3 A;  1YLJ A;  4LCL A;  1SZV A;  5CTN A;  5GLD A;  2KOI A;  4Z1W A;  4ZDX A;  4X55 A;  4NXF A;  3CPT B;  1HD8 A;  2ZMF A;  2VKS A;  4N1H A;  4GS9 B;  3MXQ A;  4DJ3 A;  1FR6 A;  4KZ8 A;  4D2O A;  1DP9 A;  4GJ4 A;  4G3V A;  1K6R A;  3T4O A;  4EBP A;  1JTG A;  3BLM A;  3Q82 A;  4R4R A;  1S4S A;  2WKI A;  4KZ5 A;  2WZZ A;  2Z6C A;  2ZOH A;  3CPT A;  3VMA A;  4GS9 A;  3H82 B;  4R3B A;  2HDR A;  4IHQ A;  4O8G A;  4BMW A;  1IFQ A;  3N4I A;  4HH2 A;  3NEC A;  3A0S A;  4EQ1 A;  5FAS A;  1W8Y A;  3HLB A;  4MN6 A;  4UEY A;  3CUE C;  3E4P A;  4DDS A;  4XT2 B;  4MDZ A;  3H82 A;  2JC7 A;  3LYX A;  4XXR A;  4H6J A;  5EFW A;  4Q8I A;  1ES5 A;  2GDN A;  5EUA A;  3WS1 A;  3DTE A;  5DTK A;  4WZ5 C;  4GB7 A;  4BL2 A;  4XT2 A;  3QHY A;  2JKR M;  3EGD C;  4EEU A;  3UB7 A;  3BQA A;  3FZC A;  4YNR A;  3A3J A;  2JCH A;  3UO9 A;  4E3J A;  3CUE A;  4FD8 A;  1TS6 A;  5FAO A;  1KDS A;  1MBL A;  2D02 A;  4MBH A;  3MFX A;  4X69 A;  4DE1 A;  1YKD A;  2HDQ A;  4FTX A;  1HLU P;  1UWP X;  4NEE D;  4P85 A;  2J80 A;  4KUO A;  4Q0I A;  3BLS A;  3BRM A;  4NXG A;  2PBY A;  2KLI A;  1ESU A;  2WGV A;  1W5D A;  5G4Z A;  4WZ5 A;  3VFH A;  3W2Z A;  5L2F A;  3JPU A;  5EVI D;  5AQ9 A;  1K56 A;  3FYZ A;  1H8Z A;  1L0G A;  2XFS A;  3MZE A;  2JKT M;  3NBL A;  2EX9 A;  2OV5 A;  3ISG A;  4RX2 A;  2VEA A;  2WKE A;  2J8Y A;  5KMW A;  3VFF A;  3ULF A;  4BJP A;  3LID A;  4ZTK A;  3E2K A;  1RGZ A;  3IH9 A;  3PYP A;  4I3J A;  3U2A A;  3ZG0 A;  5E43 A;  3ZVW A;  2KDK A;  2IA2 A;  3CMZ A;  1IKI A;  4UQI S;  4KQR A;  3EEH A;  1VM1 A;  3QP8 A;  4L9E A;  4GDB A;  4KQQ A;  4K0W A;  3C4O A;  1ALQ A;  2J3W A;  3IBR A;  5EV0 A;  3PBT A;  4D60 A;  3UE0 A;  4JXG A;  3BWL A;  2ZM8 A;  2PHY A;  3SZT A;  4A5R A;  3NDG A;  4OQH A;  4X1L A;  3SH8 A;  1GHI A;  1BLS A;  1V9Z A;  1WA9 A;  2OWJ A;  2ZQD A;  1O07 A;  1FCO A;  3IX8 A;  1YLT A;  2V0W A;  3NOP C;  3FPV A;  2YKH A;  1PI4 A;  4BBU A;  1WE4 A;  5FSR A;  3NIA A;  2B5R A;  2XSS A;  5F1F A;  3UPN A;  3GV9 A;  4JF6 A;  1LL8 A;  5A93 A;  2ZLY A;  1MWU A;  2JE5 A;  2Y2Q A;  2ZC5 B;  1G5U A;  1XA7 A;  3CI6 A;  3TJZ C;  1KDW A;  3C5A A;  3ZGA B;  3VOZ A;  1T1B A;  5HDS A;  3F1P B;  1ES3 A;  4L9G A;  4FSF A;  3CG5 A;  3UPP A;  4WF0 A;  3FKV A;  2P7J A;  4ARZ B;  4Y13 A;  4Q0J A;  3FWL A;  2Y2M A;  1E4D A;  2MJ6 A;  2G2U A;  1PWD A;  2L0W A;  2C6W B;  2PDR A;  4CPK A;  2W3G A;  4U0T A;  1I2W A;  2GX5 A;  3HJI A;  4DJ2 A;  5EVE A;  3T4T A;  4ARZ A;  2XF3 A;  4O7D A;  4XUZ A;  3L7H A;  4S2O A;  5GLB A;  4DE2 A;  1NZO A;  1FSW A;  4DE3 A;  3HLW A;  5L09 A;  3CJM A;  4OLG A;  1GSW A;  5HW3 A;  5HSQ A;  1PWC A;  3MQO A;  4EW7 A;  3EQV A;  3UNW A;  5DJU A;  1K38 A;  1WYB A;  2FFF B;  3C2W A;  5DF9 A;  1XA1 A;  5CGW A;  1STZ A;  2Q9M A;  4L0L A;  3DAV A;  3QNC A;  1ES2 A;  3HLD A;  4K08 A;  5F69 A;  5HWW A;  1OTB A;  2PU2 A;  4BLM A;  2OLV A;  1P9R A;  2A2L A;  3T1X A;  1EWZ A;  3IF6 C;  4HY8 A;  4HIA A;  4ZAM A;  1K0K A;  3F1N B;  1PW8 A;  2VGJ A;  2VGL M;  2CC1 A;  4IUH A;  4RVA A;  1AXB A;  3BQ8 A;  3QP4 A;  2FH5 A;  3ZCZ A;  2PRF A;  1H8M A;  4WBG A;  3EQU A;  3IF5 A;  1BTL A;  4BQM A;  5TFQ A;  5CEB A;  3GDI A;  1YLW A;  2Y79 A;  4WEL A;  4BBV A;  4DKI A;  4HP4 A;  2J9O A;  3OLO A;  5M19 A;  1F9I A;  5G18 A;  3T4S A;  1W8Q A;  3S7N A;  4FCF A;  4EET B;  3LGO A;  3T4Q A;  4GOG A;  1MPL A;  1QMF A;  2Y2P A;  1L0E A;  4DF6 A;  4JF4 A;  5J4E A;  4RYE A;  1RP5 A;  3LO7 A;  4E3N A;  5J7E A;  1VET B;  1CF0 A;  3LY4 A;  3UB5 P;  2L4R A;  3ZG5 A;  3IF6 A;  5TJJ A;  5IU1 A;  2E8I A;  5D3O A;  5IHV A;  4OH0 A;  3VSK A;  2JHE A;  1M40 A;  4OP8 A;  4EBN A;  5DFX A;  3OBF A;  3LY3 A;  4ZRR A;  1K55 C;  1ODV A;  1T1C A;  3C38 A;  2ZBB A;  5F5Y A;  4EES A;  4IUK A;  4DMZ A;  4NK3 A;  3RXX A;  3T4L A;  2ZMV A;  4KG2 A;  3P01 A;  4CLC D;  2J3T C;  3HLF A;  1XGJ A;  4ZJ3 A;  5FAT A;  1TDL A;  3T1R A;  2H0Y A;  5DFY A;  4OQI A;  5EOO A;  1T19 A;  4MNR A;  1NJ4 A;  3MBZ A;  2X71 A;  1HZO A;  3LEQ A;  5LBR A;  4WYY A;  3IXB A;  1G6A A;  1ZKJ A;  2OAP 1;  1K55 A;  3LR5 A;  4MEZ A;  2Y8H A;  1M6K A;  2V9A A;  5AJG A;  4QB8 A;  1KOU A;  3G30 A;  4R1G A;  4E3O A;  4OKP A;  4EUZ A;  1OTA A;  4JXV A;  4HNB A;  1PFL A;  3UB9 A;  4EER A;  2X01 A;  3MSH A;  3ZQ5 A;  3MFD A;  3BY8 A;  5FQ9 A;  1SCW A;  5E2F A;  1KGE A;  2JBF A;  2PT7 A;  3H7W A;  1CK3 A;  4X25 A;  4EQI A;  1GHP A;  3UB6 A;  1NRJ A;  3SOI A;  3MS6 A;  4KG5 A;  1BLH A;  3H9W A;  4MBK A;  1Y54 A;  4I3A A;  5JYO A;  2I72 A;  2X02 A;  4P0M A;  3WWX A;  3TOI A;  2VGL S;  5A92 A;  4KZA A;  3NHQ A;  1YAX A;  2YKF A;  3FV7 A;  2R78 A;  4GD6 A;  4OQ0 A;  4OPZ A;  3PAE A;  1YT4 A;  4JBF A;  3VP4 A;  1TS8 A;  2VA0 A;  4JXW A;  1O7E A;  4HJ3 A;  4H8R A;  1FIK A;  5E2H A;  3JYI A;  5FAQ A;  2QJ5 A;  2Y2J A;  5BOH A;  1LSX A;  4PM8 A;  5F68 A;  5FQQ A;  4BL3 A;  1YQS A;  1VB6 A;  2JKR I;  4LV3 A;  3VE4 A;  4KQO A;  3T50 A;  1HTZ A;  1S0W A;  2DRW A;  4WMC D;  5A91 A;  3NUL A;  3ZG7 B;  2W3H A;  3IXH A;  4LCM A;  4LV0 A;  4ID4 A;  3ITB A;  1JWZ A;  5CTM A;  3VSL A;  4DE0 A;  4Y5F A;  2XRN A;  4CQH A;  1MKI A;  2R9X A;  1F5M A;  1DRM A;  3TE8 A;  5DF8 A;  2EX8 A;  5F83 A;  4UQI M;  3EGX C;  5FI6 A;  1IYO A;  2QKP A;  2IWC A;  1GSX A;  5HAI A;  4UA6 A;  1EW0 A;  4ETZ A;  2EWW A;  2EA9 A;  2XQZ A;  1PYY A;  3OCL A;  3RH8 B;  5EEC A;  4P87 A;  3O3V A;  1PI5 A;  2M1C A;  5HL6 A;  3MMH A;  1TD5 A;  2JKT I;  5HD5 A;  4LV1 A;  2VGK A;  3LI8 A;  4JKT A;  3T12 B;  4EXO A;  5L10 A;  3ICY A;  3G35 A;  2WGW B;  2RL3 A;  1L0F A;  4DDY A;  2ZQ7 A;  5KSC A;  4YWZ A;  4QPR A;  4HEF A;  3VOY A;  4B4Z A;  1G68 A;  5FEF A;  3ZYT A;  2QHK A;  2Y2N A;  4LFU A;  2WGW A;  4S2L A;  3M2K A;  4BBT A;  1LT0 A;  1Z09 A;  3TW8 A;  1FOF A;  2PAV P;  2W1R A;  2B18 A;  2W3D A;  2QPN A;  3DTM A;  4JGQ A;  1P0Z A;  3QP6 A;  2P08 A;  2Y59 A;  2HDS A;  3PXP A;  4WM9 A;  3W8K A;  1RGY A;  4QU3 A;  1G6O A;  2C5W B;  2L1M A;  3UME A;  3SS5 A;  2V1A A;  3CHW P;  3P7N A;  4BD0 A;  4OPR A;  2QYB A;  5HZH A;  1OTD A;  3ZVT A;  4UA9 A;  2OAQ 1;  3W4O A;  3OPH A;  5EM1 A;  1XJ3 A;  2W3F A;  1XKZ A;  3OOV A;  1I2S A;  2ZC6 B;  3DWZ A;  4HJ6 A;  3BFD A;  3PBO A;  1GCE A;  5IS1 A;  1JWP A;  4IVI A;  1XFN A;  4XUX A;  4WL9 A;  4E3I A;  4ESP A;  2QJ7 A;  1GA0 A;  1LSW A;  1K54 C;  4OOY A;  3WS5 A;  2G2W A;  3MXS A;  1E3U A;  1IYQ A;  3U4L P;  1NRF A;  3S1Y A;  2ZD8 A;  5TBM B;  3OC2 A;  3UMD A;  4RA7 A;  1K4F A;  1FIL A;  2Q9N A;  1N9L A;  3FKW A;  2W3E A;  3TRC A;  2XLN A;  1IOU A;  4HBT A;  2EX6 A;  1C3B A;  2Y2O A;  3QP5 A;  3DTK A;  2OOL A;  4S2M A;  2M7U A;  2XRO A;  5TBM A;  4JXS A;  2Y55 A;  2BAS A;  5CHJ A;  1S4R A;  4N92 A;  1T18 A;  3I7J A;  3G34 A;  3G6O A;  3BEB A;  3IX4 A;  1NWZ A;  3MR0 A;  2Y4A A;  1PNE A;  5K5B A;  1K54 A;  3NC8 A;  1XJ4 A;  1ZHH B;  4O0P A;  5FQJ A;  4KUK A;  2ZC7 A;  1YM1 A;  5HPF A;  2RCX A;  1W63 M;  3E98 A;  2VV6 A;  4MCW A;  3WRZ A;  2WAE A;  4Z9Q A;  5HDD A;  3JVV A;  1MWS A;  4KQD A;  2R9W A;  4NKP A;  5EM0 A;  3A3F A;  3W4Q A;  4M3K A;  1WYC A;  3BJN A;  3OPL A;  3E2L A;  3O86 A;  1UGU A;  4HI4 A;  1YSQ A;  3MKE A;  1J9M A;  1DY6 A;  4GN2 A;  5HL1 A;  4X6T A;  2V2F F;  2GJ3 A;  2K31 A;  3NCK A;  2W27 A;  4FH4 A;  1IEM A;  5FDH A;  2UV0 E;  3GEC A;  3OPP A;  4NXB A;  2XGN A;  2BG1 A;  1ESI A;  5F82 A;  4WUJ A;  2ZQA A;  5HWT A;  4E6X A;  3EOI A;  3F1P A;  2PBD P;  2GNX A;  5HD3 A;  2V20 A;  5TR7 A;  2Z6D A;  5CHM A;  1JTD A;  1VQQ A;  4QY5 A;  5FA7 A;  4N1X A;  4WLA A;  1K57 C;  2XEP A;  2O9C A;  3UDI A;  1TF1 A;  2G7U A;  4PKY G;  5HAR A;  5FDS A;  1CEG A;  2ZC3 B;  3LCE A;  5EVL A;  5FAP A;  4PKY A;  2KX6 A;  1GSV A;  3DWK A;  2V8F A;  4Y2F A;  2ZL1 B;  1LI0 A;  3JVU A;  4EEP A;  2BLS A;  2O9B A;  3MQQ A;  4L9F A;  1N9O A;  3Q7Z A;  4G3W A;  4LV2 A;  2EFU A;  1TS7 A;  2I9V A;  3IXG A;  1YMS A;  2GZA A;  4OOM A;  3M2J A;  4CJN A;  3KO6 A;  3IHB A;  4YFM A;  4P6B A;  2ZQC A;  3CWF A;  1NXY A;  2BTF P;  1OME A;  3NI9 A;  3LIB A;  4K0X A;  3MZD A;  3KYQ A;  5DKL A;  3ZG8 B;  1TVF A;  3IBJ A;  3V67 A;  2B95 A;  3UY6 A;  1K57 A;  4UAA A;  1K56 D;  3QP2 A;  3MXR A;  4R23 A;  3C8C A;  2HV1 A;  3NOU C;  3F1N A;  3S22 A;  4F94 A;  3VP2 A;  1NZU A;  5DVA A;  3W4P A;  2K2N A;  3C30 A;  4R38 A;  1BT5 A;  1YMX A;  1KVM A;  3NY4 A;  5CER A;  3HUO A;  3ZNY A;  3KSG A;  3B3X A;  3OCN A;  3PHY A;  1KE3 A;  2Z2M B;  5G4Y A;  1SDE A;  1FCN A;  3HCY A;  3ZG9 B;  2P74 A;  3BM6 A;  4YIN A;  1OJG A;  3UDF A;  4M4X A;  1ONG A;  2H5S A;  3HUN A;  4NG2 A;  5FI2 A;  1CI8 A;  1DJB A;  1VET A;  2WGI A;  3TG9 A;  1X0O A;  2W1T B;  2CMN A;  3FPW A;  1W79 A;  3A0R A;  3MJQ A;  1Y28 A;  4AFI A;  5KIZ A;  4Q0H A;  4UHU A;  1F2K A;  1XGI A;  2V8C A;  4E04 A;  1TEM A;  3T4K A;  2ZOI A;  4Y7P A;  3SS3 A;  5C5K A;  4GKU A;  3T1Q B;  3WS0 A;  1S1Y A;  3HVF A;  5E2E A;  4PM9 A;  1FCM A;  2HP5 A;  4NET A;  2EX2 A;  1L2S A;  3ITA A;  2V0U A;  4KZB A;  3HUM A;  1S66 L;  1BLP A;  3KSH A;  2OLU A;  2D01 A;  1KGF A;  4EUV A;  4HQA A;  5CED A;  3BFC A;  1P97 A;  4OPY A;  1PZO A;  5TGF A;  4MN5 A;  1XJ2 A;  2PU4 A;  3E4Q A;  4U0X A;  2WKR A;  1KVL A;  3SW1 A;  3V3R A;  1G28 A;  2OSU A;  1PRQ A;  1ERO A;  4OP5 A;  2XD5 A;  1KE0 A;  2ZMA A;  5EVI B;  3GMW A;  4R3A A;  3C7U A;  3AGF A;  5HWV A;  2HF6 A;  1IKG A;  3UE1 A;  5M18 A;  1GA9 A;  3F1O B;  4YOF A;  3G2Y A;  3HBR A;  3KX0 X;  4FH2 A;  2ZQ9 A;  3IWI A;  4WEJ A;  4OOL A;  1DP8 A;  1OJ5 A;  3FG8 A;  3A0V A;  5F1G A;  4PHT A;  5CXW A;  3O87 A;  2VZW A;  5L07 A;  3VP1 A;  1SKO B;  3IS2 B; 
#chains in the Genus database with same CATH homology
 1YPR A;  3T1X A;  5FDS A;  3T1R A;  4X1M A;  3NUL A;  2HZ5 A;  1K0K A;  2V8F A;  2ZL1 B;  1F2K A;  2V8C A;  1J3W A;  3LEQ A;  3CPT A;  2JKG A;  3CHW P;  2E8J A;  1SKO A;  1CJF A;  2PRF A;  3T1Q B;  1G5U A;  1Y4O A;  3NEC A;  3L9K A;  1A0K A;  5EM1 A;  5EM0 A;  2BTF P;  1PFL A;  3MSH A;  3LGO A;  5FEG A;  3D9Y A;  2B95 A;  4ESP A;  1D1J A;  1VET B;  4X25 A;  1CF0 A;  3UB5 P;  1CQA A;  1VEU B;  2ACG A;  3MS6 A;  3T12 B;  3U4L P;  2ZL1 A;  2JKF A;  5EVE A;  4FUW A;  1PRQ A;  3L7H A;  1FIL A;  5EV0 A;  3KYE A;  4D60 A;  1VEU A;  2VK3 A;  5FEF A;  1ACF A;  4QWO A;  1AWI A;  1SZV A;  4X1L A;  3T1S A;  2PBD P;  1FIK A;  1Z09 A;  3DAV A;  4FTX A;  3CPT B;  1HLU P;  1VET A;  2PAV P;  1SKO B;  1PNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...