1K0KA

Yeast profilin, cubic crystal form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
125
Chain Sequence
SWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADYLIGVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROFILIN
publication title A Comparative Structural Analysis of Profilins
rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 40
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2001-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1k0kA00
2PRFA 5EV0A 3CPTA 1CJFA 5EVEA 1SZVA 2VK3A 4X1MA 1VEUB 1K0KA 1PFLA 4D60A 2HZ5A 2PBDP 2ZL1A 1ACFA 3DAVA 3KYEA 5FEFA 3L9KA 4X25A 1VETB 3T1XA 4FUWA 2JKFA 1F2KA 2E8JA 5FDSA 1PRQA 3MS6A 1D1JA 4X1LA 4QWOA 1G5UA 2V8CA 4FTXA 1SKOB 1HLUP 3T12B 2BTFP 2ZL1B 3LGOA 3L7HA 1FILA 3LEQA 2JKGA 1FIKA 1VETA 2ACGA 1Y4OA 3U4LP 3CPTB 1YPRA 3UB5P 5FEGA 3CHWP 3T1RA 3T1QB 3T1SA 1AWIA 1VEUA 3NULA 5EM1A 3D9YA 2B95A 4ESPA 1CQAA 1CF0A 5EM0A 1SKOA 1Z09A 1A0KA 3NECA 1J3WA 2V8FA 3MSHA 2PAVP 1PNEA
chains in the Genus database with same CATH superfamily
1ZG6A 3W4PA 2ZM0A 2VGKA 1I2WA 1YLYA 3MQ0A 3MXSA 2WKQA 3ZDJA 1BLHA 2WADA 4BD1A 1H5XA 3IHAA 2M7UA 2PU4A 2ZMVA 1LL5A 2H0YA 2PR5A 1Y54A 2PT7A 4BWIA 1W63M 4K91A 3BFCA 3BECA 5GLCA 4UEYA 1KVMA 2HDUA 2VGLM 2VEAA 2NUTC 5DJUA 4OONA 4UA7A 2Y79A 4WEJA 5J3WA 2E8IA 1T1AA 3DWKA 1ESIA 1PYYA 5GL9A 5HARA 2JN7A 3CWFA 2IWBA 1FQGA 4Y3IA 3PHYA 2WGIA 5CXWA 3BJNA 3E2LA 2ZLYA 3RJUA 3ZFZA 4OLGA 3DBAA 1VEUA 3PXPA 2XD5A 3LI8A 1L0GA 5TFQA 3GVBA 1K57A 1K4FA 3M6BA 5GHZA 1GA9A 1BUEA 1UWNX 1WYCA 3DW0A 5TGFA 4PHTA 4ZAMA 3CLOA 1BTLA 3E4QA 1PNEA 2HDSA 4XT2B 3IS2A 1ONHA 3UPNA 3SOIA 4ME4A 3AGEA 5FAOA 4OOMA 4GHIA 1TS0A 4R1GA 1RGZA 2PU2A 2HZ5A 5DFYA 4MBKA 5CGSA 3VE4A 1Y28A 1TDLA 4HESA 5HD3A 3QP6A 1F2KA 3N8LA 2J3TD 5CEDA 3H7WB 3BFFA 1YKDA 1XJ2A 3V3SA 1YT4A 2XD1A 4EESA 3LIDA 4MN7A 4HNBA 4RYEA 1XPBA 5HFOA 4RA7A 3K2NA 1SDEA 1RGYA 3EWKA 2PYRA 4OLDA 4HHDA 3UPOA 5EE8A 5EOEA 4O01A 3PBRA 4DKIA 4ETXA 5DTSA 3IX3A 3PAEA 3UDXA 1Y4OA 1ONGA 3CPTB 3OPPA 4I3JA 3OZHA 1BZAA 2ZQAA 3C30A 3NC8A 3T1RA 1F98A 3IX4A 3RFBA 1G28A 3D9YA 3UO9A 4BLMA 4KZBA 2J7VA 4X55A 3SH8A 4IVIA 1TF1A 4EBPA 3G31A 3GMWA 5L8MA 1OT6A 4R4SA 3MF0A 2IWDA 1SKFA 5EVIC 2B18A 1XJ6A 2H10A 1XJ4A 4PM8A 3R7WB 5CX7A 1NZUA 1Q2QA 4NXEA 4X1MA 2KLIA 3AGDA 3H82B 3UMDA 2VV7A 3P7NA 4WLAA 5JYPA 2ZL1A 1NYYA 1G6AA 1GSVA 5D3OA 2JE5A 2HP9A 2R78A 3MBZA 2WKHA 5HDSA 3GV9A 2W3DA 4DF6A 3HCYA 3F1NB 3F1PB 5FQMA 1K55C 3FKVA 3P98A 1D1JA 4U3TA 3FC7A 3LIBA 2QKPA 3LY3A 4X1LA 2ZJ9A 1UGUA 1UWPX 4KUOA 3U2AA 1JWPA 4B93A 4Q0HA 1ZC2A 3NDEA 2WUQA 1YMXA 2J9PA 3UDFA 3UPPA 3HUNA 3W4QA 2Y2JA 1Z6FA 4WZ5C 2EX2A 3JYIA 3LIAA 3O86A 5AVFA 1PWDA 4CJNA 5L2FA 3P01A 3EQVA 5HL1A 4WELA 3G35A 3MKFA 5EM1A 1K4EA 4UQIM 4Y0OA 3LR5A 3VFHA 5HPIA 4B9OA 4NK3A 4KZ6A 1FOFA 1Z09A 4S2NA 5MC7A 1S6RA 4Y17A 2EX9A 4JGPA 4OQIA 4QJGA 5CGXA 4X56A 2QZ6A 2O9AA 1W79A 1T1BA 2HPBA 1QMEA 5M18A 5AQAA 4ETZA 2ZMAA 2XGNA 4FCFA 4B88A 1ERQA 1YLJA 1FSYA 4QY6A 4R3AA 4Q0JA 3KSHA 2A2LA 1P9WA 5TBMB 1N4OA 1HD8A 3HLEA 4BL3A 4MBHA 1GHPA 2A3UA 2O9BA 4R0QA 1OJGA 2HGVA 5KSHA 1P97A 3IH8A 3FG8A 3KX0X 4XT2A 3CMZA 5GLAA 4S2JA 2Z2LB 2W3FA 4FSFA 3TSGA 3HLCA 2CC1A 4XUXA 2W3HA 1FILA 1P0ZA 2HP6A 3BRMA 4Z1WA 5HL6A 3SW1A 5I5LA 3H7WA 1J9MA 3W8KA 2W27A 1OTBA 2HDQA 3OOVA 3IF6C 4HQAA 4S2OA 3Q7ZA 2Y2QA 4NXGA 3EGDC 3ZGAB 4DE0A 4S2IA 5FQJA 2H0TA 4OPRA 2BG1A 4E3IA 3CPTA 3KSGA 3WS0A 3HLGA 2EX8A 2V1BA 3HVFA 4WL9A 1K54A 4PM7A 4UQIS 2QJ5A 1LL8A 4EEPA 1AXBA 1DRMA 4KG6A 4I38A 4GLQA 4H8RA 4BL2A 3IXHA 5CTNA 5EOOA 1E4DA 1W8YA 5EECA 3VP1A 3UY6A 3JPUA 4FOFA 1VETB 5EUAA 5EVID 4C3QA 2JKFA 1TDGA 3VFFA 2PR6A 4M4XA 3OC2A 5G18A 2FH5A 3R7WA 1PIOA 4KZ9A 5HZHA 2KX6A 2GNXA 3H82A 4JGOA 2HP5A 1K57C 3GSGA 2ZC3B 3E2KA 4KENB 1DJBA 1ES5A 1H8MA 2DNSA 5TJJA 4ZTKA 2JKGA 4X53A 1XX2A 3K3CA 1IEMA 2WGWB 3TRCA 4WN5A 1PW8A 1MKMA 3F1NA 3F1PA 5HWVA 1JWZA 2QYBA 3HREA 1AWIA 3KYZA 3T1SA 1YMSA 2OAQ1 5K5BA 5A8BA 4GJ4A 1YQSA 3NOPC 2IA2A 3UB6A 3BFDA 2W3GA 1SDNA 4UA6A 4GS9B 2A24B 3IWOA 3A0RA 3MFXA 3G6OA 3IT9A 3UB9A 3EGXC 4GOGA 3EQUA 5DVAA 3MQQA 3WS4A 2V8FA 3MSHA 4GW9A 2PD7A 3ZCZA 5KMWA 3LIEA 5KIZA 4GN2A 3CITA 2VK3A 4BBUA 3UMEA 5FAPA 2HDRA 4GZBA 5FQKA 2WZZA 2P9VB 4OQGA 5DKKA 3V67A 5FI2A 4OP5A 4CQHA 2L4RA 4Y7PA 1E25A 3V39A 1BULA 2FFFB 5HAIA 5LBRA 2XFSA 1D7EA 4NXFA 4MCWA 2E8JA 1W63Q 2A49A 2JKRM 4M3KA 1P9RA 3IWIA 3KSFA 5M19A 4Y0TA 4ZBEA 2K7SA 3KYQA 4X6TA 2AVXA 4P87A 5E43A 4JXGA 4LGWA 4HJ6A 2K31A 3UB8A 3ZHHA 4KQQA 3IBJA 4S2MA 4MEZA 3RTYA 5F69A 3W2ZA 4HBUA 4HJ3A 3U4LP 2W1TB 3ZG7B 1LSXA 1CEGA 3HL9A 2QHKA 4I3IA 3CHWP 4JLFA 3C2WA 3T1QB 1L3LA 5E2HA 4R4RA 3A0VA 4HJ4A 3NULA 2V2FF 5HSQA 1MWRA 4KG2A 4RX3A 2UV0E 5A92A 2XSSA 3C5AA 3LO7A 3UE0A 1LHYA 1EI5A 2JC7A 3LICA 4EU0A 3DWZA 1EWZA 2G2UA 3SH7A 4PPRA 3EOIA 1LSVA 4UAAA 5HD5A 1WA9A 2C6WB 3QP4A 4F94A 1XKZA 2WYXA 3C4PA 4E04A 3GDIA 1IELA 1T19A 5FQ9A 2HF6A 3GQZA 3S1YA 3BW6A 2VX8A 4JF5A 3T1XA 2ZM8A 5F1FA 1OTAA 4RX2A 2O0YA 4JPMA 5AVEA 3JVUA 2O99A 4D2OA 2V1AA 2ZBBA 4JXVA 4E3NA 3C4OA 4FH4A 1LL9A 4CLCC 5C5KA 3G2ZA 3ZG0A 5DTTA 3NHQA 4JF6A 3PBOA 1T1CA 2ZOHA 3G34A 1MXOA 1MPLA 4MMNA 4LFUA 2V20A 5U47A 5F83A 1VETA 3Q1FA 4OPYA 2H28A 5IHVA 1OJ5A 1YAXA 4G3KA 3UB5P 4EXOA 3CUEA 1S66L 4DE2A 2ZC6B 1TS6A 1ZG4A 1K38A 1PI4A 4HBTA 3AGFA 2XA7S 4B4ZA 3B33A 3WS2A 1IYSA 4UA9A 3VP0A 4JXWA 4DJ3A 1CF0A 1FSWA 3LYXA 4BENA 2EWWA 4KZ7A 4S2PA 3LR4A 3Q82A 4DE1A 1IKIA 3M2KA 2OAP1 4LV1A 2P74A 2M7VA 3V50A 2VV6A 4N1XA 1ZTUA 3CJMA 2WGWA 1DJAA 3Q7VB 1GSXA 1PFLA 3RXWA 4D60A 1XP4A 2WZXA 2PBDP 3DAVA 3MZFA 4GS9A 2A24A 3A0SA 5IS1A 3DTEA 2GZAA 4O7DA 3QNBA 2Q0OA 1K25A 2VZWA 4O0PA 4QU3A 4A5RA 1DP9A 4S2KA 3C7VA 2ZC4B 1FR1A 4MDZA 3QNCA 2XROA 4R38A 2VJWA 2P9VA 4FTXA 3VOZA 3S7PA 2PBYA 3D4FA 5BOHA 1V9YA 3LGOA 1NLZA 3S7QA 1FCOA 3LR3A 2X71A 3LEQA 1VHMA 2OSUA 2VA0A 1ERMA 1BSGA 2EFUA 2XFTA 3QP8A 1JVJA 2WK0A 3K3DA 4L9GA 4U0XA 2ZC7A 1ES4A 5CHJA 2EWVA 3JVVA 2Y2IA 1ODVA 4DXCA 4GD6A 3CG5A 3EEHA 4DN0A 3ZNTA 3PAGA 5A90A 3M6HA 4DXBA 3HBRA 1NWZA 4OP8A 4HY8A 3IBRA 2D01A 2PAVP 2PHYA 4IVKA 3G2YA 3FPVA 2OV5A 2Z2MB 1YLPA 1CEFA 5DKLA 2W1TA 5HDCA 3SZTA 4G3VA 2W1RA 1XA7A 4LV0A 3VOLA 3B42A 4KQRA 2ZQDA 2FZ0A 5IT5A 1L0FA 1JTGA 2J80A 1MBLA 3BFEA 4BJPA 1X0OA 3KYEA 1PWGA 4YFMA 3O87A 1TEMA 3MZEA 3L9KA 3VOYA 1RCJA 3PBTA 4KZ8A 3GRJA 3N7WA 4II7A 4N9LA 1XGIA 4NEED 5HDDA 2PD8A 4LRXC 3UB7A 4YWZA 3OCLA 2ZMFA 2JKRI 3LFVA 3SS3A 3IWQA 1LLBA 4N92A 3VP2A 3IF6B 3UE1A 2XLNA 4OPQA 4QB8A 2OLVA 4HH2A 5FQIA 3ZG8B 2V0WA 1L0EA 2UWXA 3TG9A 4UHUA 4BBVA 3IHBA 3LCEA 4PM9A 3OLOA 1ZHHB 2EXBA 2B5RA 3BM6A 3ULFA 4YNRA 4CLCD 4FH2A 4MLLA 2Y8HA 3A3EA 4KZ5A 1M6KA 1H8ZA 1NLYA 5L10A 4P6BA 3EEAA 4HH3A 5FI6A 1N9NA 3BYDA 3V5MA 5EM0A 2P08A 2B02A 2GJ3A 4G3WA 1YM1A 2CMNA 1KGFA 2OLUA 2EFXA 4E3JA 4P6ZS 4Y13A 4C75A 1HZOA 2WAEA 2V9AA 2EXAA 3MR0A 1F9IA 2XQZA 3A3DA 1K56D 2R9WA 2C5WB 4X68A 2QJ7A 5EVEA 2M1CA 4HIAA 4LV2A 1VEUB 1S1ZA 3E98A 1M40A 3CAXA 1YLZA 1EW0A 4WMCD 4HP9A 1ACFA 1FR6A 4XXRA 4WM9A 4EW7A 5AQ7A 1W5DA 3HUMA 4DMZA 4NG2A 2L0WA 3N8SA 4YINA 4B4XA 4OQ0A 3NDGA 1VB6A 2LB9A 4H6JB 4LRZE 3HJIA 1H0MA 5DFXA 3VSKA 3BFGA 3S7OA 4QHCA 2Y2KA 4CLCE 1XFNA 1K55A 2HV1A 1TS8A 3T4LA 3Q7VA 5G4YA 1TVFA 3OBFA 1E3UA 2Y4AA 3VE3A 3T4QA 3A3IA 3IX8A 4EV4A 4DDSA 3BQAA 5HWTA 1MZUA 1FCNA 2Y2HA 4KG5A 3PBNA 4ZJ3A 4WZ5A 3E0YA 2P7JA 4GKUA 4DE3A 2WKEA 2VKSA 3PYPA 4Y15A 1CQAA 4ZJ2A 3SH9A 3GECA 2PYPA 3SS5A 2H5SA 3N4IA 3NIAA 1OT9A 2R9XA 2Y2PA 4BBTA 5A91A 3GTCA 3MJQA 1CJFA 1BLCA 2QMIA 2JCHA 2PDRA 1I2SA 1LI0A 3ZVWA 5HX9A 4NKPA 1MWTA 3IXGA 1EROA 4Q0IA 5HWWA 4EQ1A 4E3KA 3M2JA 3IQAA 2ZQ7A 1DP6A 4X69A 3A3JA 2LB5A 5CECA 4C6YA 1GHMA 3FZCA 4KZ4A 4GDBA 2VV8A 2WKRA 2V0UA 1PRQA 2XDMA 5GLDA 4AFIA 1MC0A 5DTKA 4F3LB 2DMWA 3CUEC 2XH9A 3MKEA 2I72A 3ITAA 3HJKA 4ZJ1A 4MN5A 4EBNA 4YOFA 4HP4A 3PTEA 2Z6DA 1JNUA 1T18A 2ZL1B 1OPXA 2VLGA 4EERA 1DP8A 2XK1A 1I5QA 1KDWA 2FFYA 4L9FA 1STZA 5CHMA 4E3OA 4EUZA 5IU1A 4MBFA 4GB7A 2J3WA 1YPRA 2WKPA 3T4JA 5A93A 2X02A 3HLDA 2XA7M 1YSPA 4R23A 3R4KA 4ZRRA 4WZ4A 4LPZA 3F1OB 4R6LA 3S4XA 1KE3A 4LLOB 5TBMA 2JKTM 3IF6A 3P09A 2Y2NA 3UE6A 5KSCA 2WGVA 1IKGA 3BWLA 3D3OA 5HAQA 1F5MA 4MNRA 1KOUA 3ZYTA 3ICYA 2OOLA 1PW1A 1NRFA 1LT0A 4HEFA 4WBGA 4L9EA 2YKFA 4PAUA 4CLCB 5E2EA 3NY4A 3TE8A 4OKPA 1GCEA 4LRYC 1GHIA 5FEFA 3MMHA 1S67L 3QHYA 3G4PA 1KGGA 1YSQA 5TR7A 5HW3A 4FUWA 2NUPC 5FDSA 5JYOA 4BQMA 4EEUA 4LCMA 5J7EA 4RQ9A 4WEKA 2Y55A 4QWOA 2Y2GA 3MFDA 4DDYA 1G5UA 3T4KA 2DRWA 2RL3A 4EUVA 2Y2LA 3HUOA 1SKOB 1GA0A 5EPHA 1WYBA 1O07A 1N9OA 1K6SA 2L1MA 1S4SA 3BEBA 3UDIA 1JTDA 2Y2MA 4IUKA 2V1ZA 4OOLA 3ZG5A 3B47A 3C38A 4ARZB 4N9KA 4H6JA 1U60A 5L09A 4LCLA 2Z6CA 1BT5A 1S0WA 1N9LA 2HJ9C 4LV3A 2RCXA 2Y59A 4QY5A 4I39A 2B95A 3TOIA 4OOYA 4S2NC 3ITBA 3RXXA 4EQIA 3LEZA 5EVIB 5FAQA 3KSIA 3FWLA 1XJ3A 1H3QA 3ZNYA 5GHXA 5E2GA 3V3RA 4KZAA 1XA1A 1RP5A 1O7EA 3QP2A 2IWCA 5GLBA 4R3JA 3FV7A 3E4PA 4PM5A 5FDHA 1K0KA 5E2FA 3HLFA 4OH0A 1WE4A 5J8XA 1LI9A 4KZ3A 2BLSA 3OPLA 2ZC5B 5CERA 2ZOIA 4Y5FA 3UNWA 4QD4A 3WRZA 1GSWA 1BLSA 3Q07A 2VGLS 1V9ZA 2GDNA 2OWJA 1H8YA 3E4OA 5F1GA 2W0NA 1OTDA 1C3BA 2OWHA 2ZQ9A 3MXRA 2WAFA 3OCNA 3PR6A 5DF8A 3NJAA 2GX5A 5DF7A 1HVBA 4I5SA 3C7UA 2O9CA 3NI9A 2XRNA 4IJGA 1G68A 3D72A 4F3LA 1SHVA 3IXDA 5I94A 3OPHA 2QWSA 5EFWA 1YLWA 3CZDA 4ESPA 1XXMA 3C8CA 4I3AA 1HTZA 3OPRA 4P6ZM 4K0XA 4EWFA 1ES3A 5F68A 5FI7A 3FPWA 1VQQA 3S22A 3T50A 4K0WA 3PBSA 4FD8A 2JHEA 1LSWA 4OVDA 1K54C 4WF0A 1S1YA 1SZVA 3BLMA 5CEBA 3BLSA 5KZHA 1ALQA 4L0LA 2EA9A 4EBLA 3VV4A 2YKHA 5FQQA 1NY0A 3F1OA 1SCWA 3VP3A 4X25A 1IYOA 2Q9MA 3T4SA 1KGEA 3PBQA 3S7NA 3WS1A 5DJTA 4MN6A 4E3LA 5GHYA 1PI5A 2VGJA 3MS6A 4P85A 3LI9A 4KQOA 1PWCA 1VM1A 4IHQA 4R3BA 5CGWA 3G30A 1OTIA 3BQ8A 4CLCA 1DY6A 1HLUP 3O5YA 3T12B 2BTFP 1CK3A 3TW8A 4XUZA 4HOIA 3VP4A 3L7HA 3H9WA 3I7JA 3HLBA 3O88A 3NOTC 3IH9A 4PM6A 1IFQA 1L0DA 3NBLA 3N8RA 4P0MA 2I9VA 1MWUA 3LUQA 4Q8IA 1TS7A 1PZOA 4HI4A 4GNUA 1K56A 4ID4A 4R70A 1CI9A 2J8YA 4EETB 3UN7A 2KOIA 4PKYA 4IUHA 1SKOA 3NECA 4WMCA 1XFQA 1IOUA 4E6XA 4JF4A 2Y2OA 3RH8B 4KQDA 3LY4A 2JKTI 2PRFA 4CPKA 1S4RA 3CI6A 5M1AA 3O3VA 2MJ6A 2ZM2A 4NETA 4ARZA 5HPFA 3G32A 2XF3A 4GD8A 1Q2PA 3N6IA 4DJ2A 4Y0UA 1IYPA 2BASA 3QP5A 1N9BA 4WYYA 3MZDA 1NZOA 3HLWA 4OQHA 5EVIA 3LIFA 5AQBA 3WRTA 3ZVTA 1OMEA 1ZKJA 3ZQ5A 1G6OA 2D02A 1FCMA 1NXYA 2Y91A 5CHUA 3W4OA 4PKYG 4JGQA 1MWSA 4IBXA 3GR2A 4JGRA 4KUKA 1JWVA 1DJCA 3A3FA 3UE3A 2G2WA 5EVLA 4K08A 2ZQ8A 4O8GA 2EX6A 1XGJA 1BLPA 4JKTA 3IF5A 3IS2B 5FATA 1NRJA 3WWXA 2K2NA 1K6RA 5FEGA 3FKWA 2WKIA 4GHIB 4N1HA 1ES2A 4GDNA 1OTEA 1KE0A 1D06A 5AQ9A 1ESUA 5FSRA 3ZG9B 1TD5A 3MXQA 5J4EA 4BMWA 1MKIA 3WS5A 2XR0A 5F82A 5G4ZA 5EV0A 2J3TC 2J9OA 3QP1A 1IYQA 4IEDA 4E6WA 1PZPA 5HAPA 1W8QA 2XEPA 4Z9QA 3T4OA 5FL3A 4BD0A 3DTKA 5F6AA 2DCFA 4RVAA 2QPNA 5FA7A 1CI8A 5CTMA 2W3EA 1BYWA 3LR0A 4JBFA 3TJZC 3NCKA 2X01A 3NOUC 2P04A 1KE4A 2ZD8A 3Q81A 5F5YA 4GCZA 4E3MA 3MQOA 4LENA 3DTMA 2V8CA 3DTIA 3VMAA 4PMAA 1E3UD 1NJ4A 3BY9A 3BY8A 2JBFA 5AJGA 3B3XA 2Q9NA 2G7UA 3VSLA 1W7FA 1FIKA 2ACGA 2HJEA 4QPRA 3SS4A 2INWA 4IBRA 4U0TA 3ISGA 1MY8A 3IXBA 3T4TA 2ZQCA 1KVLA 1L2SA 5DF9A 4OPZA 5CRFA 1NYMA 4S2LA 1QMFA 4JXSA 4ZDXA 4WUJA 5FASA 1A0KA 1KDSA 1J3WA 5L07A 3KO6A 4DRTA 3FYZA 4Y2FA 4NXBA 1YLTA 2KDKA
chains in the Genus database with same CATH topology
2PRFA 5EV0A 3CPTA 1CJFA 5EVEA 1SZVA 2VK3A 4X1MA 1VEUB 1K0KA 1PFLA 4D60A 2HZ5A 2PBDP 2ZL1A 1ACFA 3DAVA 3KYEA 5FEFA 3L9KA 4X25A 1VETB 3T1XA 4FUWA 2JKFA 1F2KA 2E8JA 5FDSA 1PRQA 3MS6A 1D1JA 4X1LA 4QWOA 1G5UA 2V8CA 4FTXA 1SKOB 1HLUP 3T12B 2BTFP 2ZL1B 3LGOA 3L7HA 1FILA 3LEQA 2JKGA 1FIKA 1VETA 2ACGA 1Y4OA 3U4LP 3CPTB 1YPRA 3UB5P 5FEGA 3CHWP 3T1RA 3T1QB 3T1SA 1AWIA 1VEUA 3NULA 5EM1A 3D9YA 2B95A 4ESPA 1CQAA 1CF0A 5EM0A 1SKOA 1Z09A 1A0KA 3NECA 1J3WA 2V8FA 3MSHA 2PAVP 1PNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PRF A;  5EV0 A;  3CPT A;  1CJF A;  5EVE A;  1SZV A;  2VK3 A;  4X1M A;  1VEU B;  1K0K A;  1PFL A;  4D60 A;  2HZ5 A;  2PBD P;  2ZL1 A;  1ACF A;  3DAV A;  3KYE A;  5FEF A;  3L9K A;  4X25 A;  1VET B;  3T1X A;  4FUW A;  2JKF A;  1F2K A;  2E8J A;  5FDS A;  1PRQ A;  3MS6 A;  1D1J A;  4X1L A;  4QWO A;  1G5U A;  2V8C A;  4FTX A;  1SKO B;  1HLU P;  3T12 B;  2BTF P;  2ZL1 B;  3LGO A;  3L7H A;  1FIL A;  3LEQ A;  2JKG A;  1FIK A;  1VET A;  2ACG A;  1Y4O A;  3U4L P;  3CPT B;  1YPR A;  3UB5 P;  5FEG A;  3CHW P;  3T1R A;  3T1Q B;  3T1S A;  1AWI A;  1VEU A;  3NUL A;  5EM1 A;  3D9Y A;  2B95 A;  4ESP A;  1CQA A;  1CF0 A;  5EM0 A;  1SKO A;  1Z09 A;  1A0K A;  3NEC A;  1J3W A;  2V8F A;  3MSH A;  2PAV P;  1PNE A; 
#chains in the Genus database with same CATH topology
 1ZG6 A;  3W4P A;  2ZM0 A;  2VGK A;  1I2W A;  1YLY A;  3MQ0 A;  3MXS A;  2WKQ A;  3ZDJ A;  1BLH A;  2WAD A;  4BD1 A;  1H5X A;  3IHA A;  2M7U A;  2PU4 A;  2ZMV A;  1LL5 A;  2H0Y A;  2PR5 A;  1Y54 A;  2PT7 A;  4BWI A;  1W63 M;  4K91 A;  3BFC A;  3BEC A;  5GLC A;  4UEY A;  1KVM A;  2HDU A;  2VGL M;  2VEA A;  2NUT C;  5DJU A;  4OON A;  4UA7 A;  2Y79 A;  4WEJ A;  5J3W A;  2E8I A;  1T1A A;  3DWK A;  1ESI A;  1PYY A;  5GL9 A;  5HAR A;  2JN7 A;  3CWF A;  2IWB A;  1FQG A;  4Y3I A;  3PHY A;  2WGI A;  5CXW A;  3BJN A;  3E2L A;  2ZLY A;  3RJU A;  3ZFZ A;  4OLG A;  3DBA A;  1VEU A;  3PXP A;  2XD5 A;  3LI8 A;  1L0G A;  5TFQ A;  3GVB A;  1K57 A;  1K4F A;  3M6B A;  5GHZ A;  1GA9 A;  1BUE A;  1UWN X;  1WYC A;  3DW0 A;  5TGF A;  4PHT A;  4ZAM A;  3CLO A;  1BTL A;  3E4Q A;  1PNE A;  2HDS A;  4XT2 B;  3IS2 A;  1ONH A;  3UPN A;  3SOI A;  4ME4 A;  3AGE A;  5FAO A;  4OOM A;  4GHI A;  1TS0 A;  4R1G A;  1RGZ A;  2PU2 A;  2HZ5 A;  5DFY A;  4MBK A;  5CGS A;  3VE4 A;  1Y28 A;  1TDL A;  4HES A;  5HD3 A;  3QP6 A;  1F2K A;  3N8L A;  2J3T D;  5CED A;  3H7W B;  3BFF A;  1YKD A;  1XJ2 A;  3V3S A;  1YT4 A;  2XD1 A;  4EES A;  3LID A;  4MN7 A;  4HNB A;  4RYE A;  1XPB A;  5HFO A;  4RA7 A;  3K2N A;  1SDE A;  1RGY A;  3EWK A;  2PYR A;  4OLD A;  4HHD A;  3UPO A;  5EE8 A;  5EOE A;  4O01 A;  3PBR A;  4DKI A;  4ETX A;  5DTS A;  3IX3 A;  3PAE A;  3UDX A;  1Y4O A;  1ONG A;  3CPT B;  3OPP A;  4I3J A;  3OZH A;  1BZA A;  2ZQA A;  3C30 A;  3NC8 A;  3T1R A;  1F98 A;  3IX4 A;  3RFB A;  1G28 A;  3D9Y A;  3UO9 A;  4BLM A;  4KZB A;  2J7V A;  4X55 A;  3SH8 A;  4IVI A;  1TF1 A;  4EBP A;  3G31 A;  3GMW A;  5L8M A;  1OT6 A;  4R4S A;  3MF0 A;  2IWD A;  1SKF A;  5EVI C;  2B18 A;  1XJ6 A;  2H10 A;  1XJ4 A;  4PM8 A;  3R7W B;  5CX7 A;  1NZU A;  1Q2Q A;  4NXE A;  4X1M A;  2KLI A;  3AGD A;  3H82 B;  3UMD A;  2VV7 A;  3P7N A;  4WLA A;  5JYP A;  2ZL1 A;  1NYY A;  1G6A A;  1GSV A;  5D3O A;  2JE5 A;  2HP9 A;  2R78 A;  3MBZ A;  2WKH A;  5HDS A;  3GV9 A;  2W3D A;  4DF6 A;  3HCY A;  3F1N B;  3F1P B;  5FQM A;  1K55 C;  3FKV A;  3P98 A;  1D1J A;  4U3T A;  3FC7 A;  3LIB A;  2QKP A;  3LY3 A;  4X1L A;  2ZJ9 A;  1UGU A;  1UWP X;  4KUO A;  3U2A A;  1JWP A;  4B93 A;  4Q0H A;  1ZC2 A;  3NDE A;  2WUQ A;  1YMX A;  2J9P A;  3UDF A;  3UPP A;  3HUN A;  3W4Q A;  2Y2J A;  1Z6F A;  4WZ5 C;  2EX2 A;  3JYI A;  3LIA A;  3O86 A;  5AVF A;  1PWD A;  4CJN A;  5L2F A;  3P01 A;  3EQV A;  5HL1 A;  4WEL A;  3G35 A;  3MKF A;  5EM1 A;  1K4E A;  4UQI M;  4Y0O A;  3LR5 A;  3VFH A;  5HPI A;  4B9O A;  4NK3 A;  4KZ6 A;  1FOF A;  1Z09 A;  4S2N A;  5MC7 A;  1S6R A;  4Y17 A;  2EX9 A;  4JGP A;  4OQI A;  4QJG A;  5CGX A;  4X56 A;  2QZ6 A;  2O9A A;  1W79 A;  1T1B A;  2HPB A;  1QME A;  5M18 A;  5AQA A;  4ETZ A;  2ZMA A;  2XGN A;  4FCF A;  4B88 A;  1ERQ A;  1YLJ A;  1FSY A;  4QY6 A;  4R3A A;  4Q0J A;  3KSH A;  2A2L A;  1P9W A;  5TBM B;  1N4O A;  1HD8 A;  3HLE A;  4BL3 A;  4MBH A;  1GHP A;  2A3U A;  2O9B A;  4R0Q A;  1OJG A;  2HGV A;  5KSH A;  1P97 A;  3IH8 A;  3FG8 A;  3KX0 X;  4XT2 A;  3CMZ A;  5GLA A;  4S2J A;  2Z2L B;  2W3F A;  4FSF A;  3TSG A;  3HLC A;  2CC1 A;  4XUX A;  2W3H A;  1FIL A;  1P0Z A;  2HP6 A;  3BRM A;  4Z1W A;  5HL6 A;  3SW1 A;  5I5L A;  3H7W A;  1J9M A;  3W8K A;  2W27 A;  1OTB A;  2HDQ A;  3OOV A;  3IF6 C;  4HQA A;  4S2O A;  3Q7Z A;  2Y2Q A;  4NXG A;  3EGD C;  3ZGA B;  4DE0 A;  4S2I A;  5FQJ A;  2H0T A;  4OPR A;  2BG1 A;  4E3I A;  3CPT A;  3KSG A;  3WS0 A;  3HLG A;  2EX8 A;  2V1B A;  3HVF A;  4WL9 A;  1K54 A;  4PM7 A;  4UQI S;  2QJ5 A;  1LL8 A;  4EEP A;  1AXB A;  1DRM A;  4KG6 A;  4I38 A;  4GLQ A;  4H8R A;  4BL2 A;  3IXH A;  5CTN A;  5EOO A;  1E4D A;  1W8Y A;  5EEC A;  3VP1 A;  3UY6 A;  3JPU A;  4FOF A;  1VET B;  5EUA A;  5EVI D;  4C3Q A;  2JKF A;  1TDG A;  3VFF A;  2PR6 A;  4M4X A;  3OC2 A;  5G18 A;  2FH5 A;  3R7W A;  1PIO A;  4KZ9 A;  5HZH A;  2KX6 A;  2GNX A;  3H82 A;  4JGO A;  2HP5 A;  1K57 C;  3GSG A;  2ZC3 B;  3E2K A;  4KEN B;  1DJB A;  1ES5 A;  1H8M A;  2DNS A;  5TJJ A;  4ZTK A;  2JKG A;  4X53 A;  1XX2 A;  3K3C A;  1IEM A;  2WGW B;  3TRC A;  4WN5 A;  1PW8 A;  1MKM A;  3F1N A;  3F1P A;  5HWV A;  1JWZ A;  2QYB A;  3HRE A;  1AWI A;  3KYZ A;  3T1S A;  1YMS A;  2OAQ 1;  5K5B A;  5A8B A;  4GJ4 A;  1YQS A;  3NOP C;  2IA2 A;  3UB6 A;  3BFD A;  2W3G A;  1SDN A;  4UA6 A;  4GS9 B;  2A24 B;  3IWO A;  3A0R A;  3MFX A;  3G6O A;  3IT9 A;  3UB9 A;  3EGX C;  4GOG A;  3EQU A;  5DVA A;  3MQQ A;  3WS4 A;  2V8F A;  3MSH A;  4GW9 A;  2PD7 A;  3ZCZ A;  5KMW A;  3LIE A;  5KIZ A;  4GN2 A;  3CIT A;  2VK3 A;  4BBU A;  3UME A;  5FAP A;  2HDR A;  4GZB A;  5FQK A;  2WZZ A;  2P9V B;  4OQG A;  5DKK A;  3V67 A;  5FI2 A;  4OP5 A;  4CQH A;  2L4R A;  4Y7P A;  1E25 A;  3V39 A;  1BUL A;  2FFF B;  5HAI A;  5LBR A;  2XFS A;  1D7E A;  4NXF A;  4MCW A;  2E8J A;  1W63 Q;  2A49 A;  2JKR M;  4M3K A;  1P9R A;  3IWI A;  3KSF A;  5M19 A;  4Y0T A;  4ZBE A;  2K7S A;  3KYQ A;  4X6T A;  2AVX A;  4P87 A;  5E43 A;  4JXG A;  4LGW A;  4HJ6 A;  2K31 A;  3UB8 A;  3ZHH A;  4KQQ A;  3IBJ A;  4S2M A;  4MEZ A;  3RTY A;  5F69 A;  3W2Z A;  4HBU A;  4HJ3 A;  3U4L P;  2W1T B;  3ZG7 B;  1LSX A;  1CEG A;  3HL9 A;  2QHK A;  4I3I A;  3CHW P;  4JLF A;  3C2W A;  3T1Q B;  1L3L A;  5E2H A;  4R4R A;  3A0V A;  4HJ4 A;  3NUL A;  2V2F F;  5HSQ A;  1MWR A;  4KG2 A;  4RX3 A;  2UV0 E;  5A92 A;  2XSS A;  3C5A A;  3LO7 A;  3UE0 A;  1LHY A;  1EI5 A;  2JC7 A;  3LIC A;  4EU0 A;  3DWZ A;  1EWZ A;  2G2U A;  3SH7 A;  4PPR A;  3EOI A;  1LSV A;  4UAA A;  5HD5 A;  1WA9 A;  2C6W B;  3QP4 A;  4F94 A;  1XKZ A;  2WYX A;  3C4P A;  4E04 A;  3GDI A;  1IEL A;  1T19 A;  5FQ9 A;  2HF6 A;  3GQZ A;  3S1Y A;  3BW6 A;  2VX8 A;  4JF5 A;  3T1X A;  2ZM8 A;  5F1F A;  1OTA A;  4RX2 A;  2O0Y A;  4JPM A;  5AVE A;  3JVU A;  2O99 A;  4D2O A;  2V1A A;  2ZBB A;  4JXV A;  4E3N A;  3C4O A;  4FH4 A;  1LL9 A;  4CLC C;  5C5K A;  3G2Z A;  3ZG0 A;  5DTT A;  3NHQ A;  4JF6 A;  3PBO A;  1T1C A;  2ZOH A;  3G34 A;  1MXO A;  1MPL A;  4MMN A;  4LFU A;  2V20 A;  5U47 A;  5F83 A;  1VET A;  3Q1F A;  4OPY A;  2H28 A;  5IHV A;  1OJ5 A;  1YAX A;  4G3K A;  3UB5 P;  4EXO A;  3CUE A;  1S66 L;  4DE2 A;  2ZC6 B;  1TS6 A;  1ZG4 A;  1K38 A;  1PI4 A;  4HBT A;  3AGF A;  2XA7 S;  4B4Z A;  3B33 A;  3WS2 A;  1IYS A;  4UA9 A;  3VP0 A;  4JXW A;  4DJ3 A;  1CF0 A;  1FSW A;  3LYX A;  4BEN A;  2EWW A;  4KZ7 A;  4S2P A;  3LR4 A;  3Q82 A;  4DE1 A;  1IKI A;  3M2K A;  2OAP 1;  4LV1 A;  2P74 A;  2M7V A;  3V50 A;  2VV6 A;  4N1X A;  1ZTU A;  3CJM A;  2WGW A;  1DJA A;  3Q7V B;  1GSX A;  1PFL A;  3RXW A;  4D60 A;  1XP4 A;  2WZX A;  2PBD P;  3DAV A;  3MZF A;  4GS9 A;  2A24 A;  3A0S A;  5IS1 A;  3DTE A;  2GZA A;  4O7D A;  3QNB A;  2Q0O A;  1K25 A;  2VZW A;  4O0P A;  4QU3 A;  4A5R A;  1DP9 A;  4S2K A;  3C7V A;  2ZC4 B;  1FR1 A;  4MDZ A;  3QNC A;  2XRO A;  4R38 A;  2VJW A;  2P9V A;  4FTX A;  3VOZ A;  3S7P A;  2PBY A;  3D4F A;  5BOH A;  1V9Y A;  3LGO A;  1NLZ A;  3S7Q A;  1FCO A;  3LR3 A;  2X71 A;  3LEQ A;  1VHM A;  2OSU A;  2VA0 A;  1ERM A;  1BSG A;  2EFU A;  2XFT A;  3QP8 A;  1JVJ A;  2WK0 A;  3K3D A;  4L9G A;  4U0X A;  2ZC7 A;  1ES4 A;  5CHJ A;  2EWV A;  3JVV A;  2Y2I A;  1ODV A;  4DXC A;  4GD6 A;  3CG5 A;  3EEH A;  4DN0 A;  3ZNT A;  3PAG A;  5A90 A;  3M6H A;  4DXB A;  3HBR A;  1NWZ A;  4OP8 A;  4HY8 A;  3IBR A;  2D01 A;  2PAV P;  2PHY A;  4IVK A;  3G2Y A;  3FPV A;  2OV5 A;  2Z2M B;  1YLP A;  1CEF A;  5DKL A;  2W1T A;  5HDC A;  3SZT A;  4G3V A;  2W1R A;  1XA7 A;  4LV0 A;  3VOL A;  3B42 A;  4KQR A;  2ZQD A;  2FZ0 A;  5IT5 A;  1L0F A;  1JTG A;  2J80 A;  1MBL A;  3BFE A;  4BJP A;  1X0O A;  3KYE A;  1PWG A;  4YFM A;  3O87 A;  1TEM A;  3MZE A;  3L9K A;  3VOY A;  1RCJ A;  3PBT A;  4KZ8 A;  3GRJ A;  3N7W A;  4II7 A;  4N9L A;  1XGI A;  4NEE D;  5HDD A;  2PD8 A;  4LRX C;  3UB7 A;  4YWZ A;  3OCL A;  2ZMF A;  2JKR I;  3LFV A;  3SS3 A;  3IWQ A;  1LLB A;  4N92 A;  3VP2 A;  3IF6 B;  3UE1 A;  2XLN A;  4OPQ A;  4QB8 A;  2OLV A;  4HH2 A;  5FQI A;  3ZG8 B;  2V0W A;  1L0E A;  2UWX A;  3TG9 A;  4UHU A;  4BBV A;  3IHB A;  3LCE A;  4PM9 A;  3OLO A;  1ZHH B;  2EXB A;  2B5R A;  3BM6 A;  3ULF A;  4YNR A;  4CLC D;  4FH2 A;  4MLL A;  2Y8H A;  3A3E A;  4KZ5 A;  1M6K A;  1H8Z A;  1NLY A;  5L10 A;  4P6B A;  3EEA A;  4HH3 A;  5FI6 A;  1N9N A;  3BYD A;  3V5M A;  5EM0 A;  2P08 A;  2B02 A;  2GJ3 A;  4G3W A;  1YM1 A;  2CMN A;  1KGF A;  2OLU A;  2EFX A;  4E3J A;  4P6Z S;  4Y13 A;  4C75 A;  1HZO A;  2WAE A;  2V9A A;  2EXA A;  3MR0 A;  1F9I A;  2XQZ A;  3A3D A;  1K56 D;  2R9W A;  2C5W B;  4X68 A;  2QJ7 A;  5EVE A;  2M1C A;  4HIA A;  4LV2 A;  1VEU B;  1S1Z A;  3E98 A;  1M40 A;  3CAX A;  1YLZ A;  1EW0 A;  4WMC D;  4HP9 A;  1ACF A;  1FR6 A;  4XXR A;  4WM9 A;  4EW7 A;  5AQ7 A;  1W5D A;  3HUM A;  4DMZ A;  4NG2 A;  2L0W A;  3N8S A;  4YIN A;  4B4X A;  4OQ0 A;  3NDG A;  1VB6 A;  2LB9 A;  4H6J B;  4LRZ E;  3HJI A;  1H0M A;  5DFX A;  3VSK A;  3BFG A;  3S7O A;  4QHC A;  2Y2K A;  4CLC E;  1XFN A;  1K55 A;  2HV1 A;  1TS8 A;  3T4L A;  3Q7V A;  5G4Y A;  1TVF A;  3OBF A;  1E3U A;  2Y4A A;  3VE3 A;  3T4Q A;  3A3I A;  3IX8 A;  4EV4 A;  4DDS A;  3BQA A;  5HWT A;  1MZU A;  1FCN A;  2Y2H A;  4KG5 A;  3PBN A;  4ZJ3 A;  4WZ5 A;  3E0Y A;  2P7J A;  4GKU A;  4DE3 A;  2WKE A;  2VKS A;  3PYP A;  4Y15 A;  1CQA A;  4ZJ2 A;  3SH9 A;  3GEC A;  2PYP A;  3SS5 A;  2H5S A;  3N4I A;  3NIA A;  1OT9 A;  2R9X A;  2Y2P A;  4BBT A;  5A91 A;  3GTC A;  3MJQ A;  1CJF A;  1BLC A;  2QMI A;  2JCH A;  2PDR A;  1I2S A;  1LI0 A;  3ZVW A;  5HX9 A;  4NKP A;  1MWT A;  3IXG A;  1ERO A;  4Q0I A;  5HWW A;  4EQ1 A;  4E3K A;  3M2J A;  3IQA A;  2ZQ7 A;  1DP6 A;  4X69 A;  3A3J A;  2LB5 A;  5CEC A;  4C6Y A;  1GHM A;  3FZC A;  4KZ4 A;  4GDB A;  2VV8 A;  2WKR A;  2V0U A;  1PRQ A;  2XDM A;  5GLD A;  4AFI A;  1MC0 A;  5DTK A;  4F3L B;  2DMW A;  3CUE C;  2XH9 A;  3MKE A;  2I72 A;  3ITA A;  3HJK A;  4ZJ1 A;  4MN5 A;  4EBN A;  4YOF A;  4HP4 A;  3PTE A;  2Z6D A;  1JNU A;  1T18 A;  2ZL1 B;  1OPX A;  2VLG A;  4EER A;  1DP8 A;  2XK1 A;  1I5Q A;  1KDW A;  2FFY A;  4L9F A;  1STZ A;  5CHM A;  4E3O A;  4EUZ A;  5IU1 A;  4MBF A;  4GB7 A;  2J3W A;  1YPR A;  2WKP A;  3T4J A;  5A93 A;  2X02 A;  3HLD A;  2XA7 M;  1YSP A;  4R23 A;  3R4K A;  4ZRR A;  4WZ4 A;  4LPZ A;  3F1O B;  4R6L A;  3S4X A;  1KE3 A;  4LLO B;  5TBM A;  2JKT M;  3IF6 A;  3P09 A;  2Y2N A;  3UE6 A;  5KSC A;  2WGV A;  1IKG A;  3BWL A;  3D3O A;  5HAQ A;  1F5M A;  4MNR A;  1KOU A;  3ZYT A;  3ICY A;  2OOL A;  1PW1 A;  1NRF A;  1LT0 A;  4HEF A;  4WBG A;  4L9E A;  2YKF A;  4PAU A;  4CLC B;  5E2E A;  3NY4 A;  3TE8 A;  4OKP A;  1GCE A;  4LRY C;  1GHI A;  5FEF A;  3MMH A;  1S67 L;  3QHY A;  3G4P A;  1KGG A;  1YSQ A;  5TR7 A;  5HW3 A;  4FUW A;  2NUP C;  5FDS A;  5JYO A;  4BQM A;  4EEU A;  4LCM A;  5J7E A;  4RQ9 A;  4WEK A;  2Y55 A;  4QWO A;  2Y2G A;  3MFD A;  4DDY A;  1G5U A;  3T4K A;  2DRW A;  2RL3 A;  4EUV A;  2Y2L A;  3HUO A;  1SKO B;  1GA0 A;  5EPH A;  1WYB A;  1O07 A;  1N9O A;  1K6S A;  2L1M A;  1S4S A;  3BEB A;  3UDI A;  1JTD A;  2Y2M A;  4IUK A;  2V1Z A;  4OOL A;  3ZG5 A;  3B47 A;  3C38 A;  4ARZ B;  4N9K A;  4H6J A;  1U60 A;  5L09 A;  4LCL A;  2Z6C A;  1BT5 A;  1S0W A;  1N9L A;  2HJ9 C;  4LV3 A;  2RCX A;  2Y59 A;  4QY5 A;  4I39 A;  2B95 A;  3TOI A;  4OOY A;  4S2N C;  3ITB A;  3RXX A;  4EQI A;  3LEZ A;  5EVI B;  5FAQ A;  3KSI A;  3FWL A;  1XJ3 A;  1H3Q A;  3ZNY A;  5GHX A;  5E2G A;  3V3R A;  4KZA A;  1XA1 A;  1RP5 A;  1O7E A;  3QP2 A;  2IWC A;  5GLB A;  4R3J A;  3FV7 A;  3E4P A;  4PM5 A;  5FDH A;  1K0K A;  5E2F A;  3HLF A;  4OH0 A;  1WE4 A;  5J8X A;  1LI9 A;  4KZ3 A;  2BLS A;  3OPL A;  2ZC5 B;  5CER A;  2ZOI A;  4Y5F A;  3UNW A;  4QD4 A;  3WRZ A;  1GSW A;  1BLS A;  3Q07 A;  2VGL S;  1V9Z A;  2GDN A;  2OWJ A;  1H8Y A;  3E4O A;  5F1G A;  2W0N A;  1OTD A;  1C3B A;  2OWH A;  2ZQ9 A;  3MXR A;  2WAF A;  3OCN A;  3PR6 A;  5DF8 A;  3NJA A;  2GX5 A;  5DF7 A;  1HVB A;  4I5S A;  3C7U A;  2O9C A;  3NI9 A;  2XRN A;  4IJG A;  1G68 A;  3D72 A;  4F3L A;  1SHV A;  3IXD A;  5I94 A;  3OPH A;  2QWS A;  5EFW A;  1YLW A;  3CZD A;  4ESP A;  1XXM A;  3C8C A;  4I3A A;  1HTZ A;  3OPR A;  4P6Z M;  4K0X A;  4EWF A;  1ES3 A;  5F68 A;  5FI7 A;  3FPW A;  1VQQ A;  3S22 A;  3T50 A;  4K0W A;  3PBS A;  4FD8 A;  2JHE A;  1LSW A;  4OVD A;  1K54 C;  4WF0 A;  1S1Y A;  1SZV A;  3BLM A;  5CEB A;  3BLS A;  5KZH A;  1ALQ A;  4L0L A;  2EA9 A;  4EBL A;  3VV4 A;  2YKH A;  5FQQ A;  1NY0 A;  3F1O A;  1SCW A;  3VP3 A;  4X25 A;  1IYO A;  2Q9M A;  3T4S A;  1KGE A;  3PBQ A;  3S7N A;  3WS1 A;  5DJT A;  4MN6 A;  4E3L A;  5GHY A;  1PI5 A;  2VGJ A;  3MS6 A;  4P85 A;  3LI9 A;  4KQO A;  1PWC A;  1VM1 A;  4IHQ A;  4R3B A;  5CGW A;  3G30 A;  1OTI A;  3BQ8 A;  4CLC A;  1DY6 A;  1HLU P;  3O5Y A;  3T12 B;  2BTF P;  1CK3 A;  3TW8 A;  4XUZ A;  4HOI A;  3VP4 A;  3L7H A;  3H9W A;  3I7J A;  3HLB A;  3O88 A;  3NOT C;  3IH9 A;  4PM6 A;  1IFQ A;  1L0D A;  3NBL A;  3N8R A;  4P0M A;  2I9V A;  1MWU A;  3LUQ A;  4Q8I A;  1TS7 A;  1PZO A;  4HI4 A;  4GNU A;  1K56 A;  4ID4 A;  4R70 A;  1CI9 A;  2J8Y A;  4EET B;  3UN7 A;  2KOI A;  4PKY A;  4IUH A;  1SKO A;  3NEC A;  4WMC A;  1XFQ A;  1IOU A;  4E6X A;  4JF4 A;  2Y2O A;  3RH8 B;  4KQD A;  3LY4 A;  2JKT I;  2PRF A;  4CPK A;  1S4R A;  3CI6 A;  5M1A A;  3O3V A;  2MJ6 A;  2ZM2 A;  4NET A;  4ARZ A;  5HPF A;  3G32 A;  2XF3 A;  4GD8 A;  1Q2P A;  3N6I A;  4DJ2 A;  4Y0U A;  1IYP A;  2BAS A;  3QP5 A;  1N9B A;  4WYY A;  3MZD A;  1NZO A;  3HLW A;  4OQH A;  5EVI A;  3LIF A;  5AQB A;  3WRT A;  3ZVT A;  1OME A;  1ZKJ A;  3ZQ5 A;  1G6O A;  2D02 A;  1FCM A;  1NXY A;  2Y91 A;  5CHU A;  3W4O A;  4PKY G;  4JGQ A;  1MWS A;  4IBX A;  3GR2 A;  4JGR A;  4KUK A;  1JWV A;  1DJC A;  3A3F A;  3UE3 A;  2G2W A;  5EVL A;  4K08 A;  2ZQ8 A;  4O8G A;  2EX6 A;  1XGJ A;  1BLP A;  4JKT A;  3IF5 A;  3IS2 B;  5FAT A;  1NRJ A;  3WWX A;  2K2N A;  1K6R A;  5FEG A;  3FKW A;  2WKI A;  4GHI B;  4N1H A;  1ES2 A;  4GDN A;  1OTE A;  1KE0 A;  1D06 A;  5AQ9 A;  1ESU A;  5FSR A;  3ZG9 B;  1TD5 A;  3MXQ A;  5J4E A;  4BMW A;  1MKI A;  3WS5 A;  2XR0 A;  5F82 A;  5G4Z A;  5EV0 A;  2J3T C;  2J9O A;  3QP1 A;  1IYQ A;  4IED A;  4E6W A;  1PZP A;  5HAP A;  1W8Q A;  2XEP A;  4Z9Q A;  3T4O A;  5FL3 A;  4BD0 A;  3DTK A;  5F6A A;  2DCF A;  4RVA A;  2QPN A;  5FA7 A;  1CI8 A;  5CTM A;  2W3E A;  1BYW A;  3LR0 A;  4JBF A;  3TJZ C;  3NCK A;  2X01 A;  3NOU C;  2P04 A;  1KE4 A;  2ZD8 A;  3Q81 A;  5F5Y A;  4GCZ A;  4E3M A;  3MQO A;  4LEN A;  3DTM A;  2V8C A;  3DTI A;  3VMA A;  4PMA A;  1E3U D;  1NJ4 A;  3BY9 A;  3BY8 A;  2JBF A;  5AJG A;  3B3X A;  2Q9N A;  2G7U A;  3VSL A;  1W7F A;  1FIK A;  2ACG A;  2HJE A;  4QPR A;  3SS4 A;  2INW A;  4IBR A;  4U0T A;  3ISG A;  1MY8 A;  3IXB A;  3T4T A;  2ZQC A;  1KVL A;  1L2S A;  5DF9 A;  4OPZ A;  5CRF A;  1NYM A;  4S2L A;  1QMF A;  4JXS A;  4ZDX A;  4WUJ A;  5FAS A;  1A0K A;  1KDS A;  1J3W A;  5L07 A;  3KO6 A;  4DRT A;  3FYZ A;  4Y2F A;  4NXB A;  1YLT A;  2KDK A; 
#chains in the Genus database with same CATH homology
 2PRF A;  5EV0 A;  3CPT A;  1CJF A;  5EVE A;  1SZV A;  2VK3 A;  4X1M A;  1VEU B;  1K0K A;  1PFL A;  4D60 A;  2HZ5 A;  2PBD P;  2ZL1 A;  1ACF A;  3DAV A;  3KYE A;  5FEF A;  3L9K A;  4X25 A;  1VET B;  3T1X A;  4FUW A;  2JKF A;  1F2K A;  2E8J A;  5FDS A;  1PRQ A;  3MS6 A;  1D1J A;  4X1L A;  4QWO A;  1G5U A;  2V8C A;  4FTX A;  1SKO B;  1HLU P;  3T12 B;  2BTF P;  2ZL1 B;  3LGO A;  3L7H A;  1FIL A;  3LEQ A;  2JKG A;  1FIK A;  1VET A;  2ACG A;  1Y4O A;  3U4L P;  3CPT B;  1YPR A;  3UB5 P;  5FEG A;  3CHW P;  3T1R A;  3T1Q B;  3T1S A;  1AWI A;  1VEU A;  3NUL A;  5EM1 A;  3D9Y A;  2B95 A;  4ESP A;  1CQA A;  1CF0 A;  5EM0 A;  1SKO A;  1Z09 A;  1A0K A;  3NEC A;  1J3W A;  2V8F A;  3MSH A;  2PAV P;  1PNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...