1S0WA

1b lactamse/ b lactamase inhibitor
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords beta-lactamase TEM
publication title The modular architecture of protein-protein binding interfaces.
pubmed doi rcsb
source organism Escherichia coli
total genus 93
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2004-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1s0wA00
3ITAA 5DF7A 4R23A 5HAQA 2XH9A 1YMXA 4KZAA 2XQZA 1XPBA 4UA6A 4LENA 1U60A 1K4FA 1FSWA 4ZAMA 4PMAA 2VGJA 2EX9A 3G2YA 3N7WA 1XA1A 5GL9A 1K57C 1EI5A 3LO7A 5F82A 1S0WA 1HTZA 1K56D 2ZC7A 3Q82A 4QD4A 5CHMA 1ZKJA 3G32A 4P85A 5L2FA 3M6BA 3QHYA 1FR6A 2Y2JA 5CGWA 4CPKA 1J9MA 3SOIA 4NK3A 1BLSA 2EX2A 5FQQA 3ZFZA 2EXAA 3UPNA 1L2SA 1WYCA 1L0DA 5E2EA 2EFXA 4MBKA 3W8KA 4OPYA 1TVFA 3N8LA 4OPRA 5GHYA 3W4OA 1PW1A 4IVKA 4JXVA 2ZM8A 4DXCA 2HDQA 1K55A 2C5WB 4QHCA 3GR2A 3C7UA 2WGWA 3SS5A 5F1GA 3C4PA 1K38A 1YMSA 4LV2A 4WZ5C 1GHIA 1IKIA 3HUMA 3IH9A 4PM8A 4KG5A 4B4ZA 3A3IA 3ZHHA 5DTKA 1MWTA 5A90A 1N9BA 5EVIB 4RVAA 3WRTA 3ZCZA 4ZDXA 1NRFA 2Y2KA 5HW3A 5EUAA 1ZG6A 3SS4A 3EQUA 3ZVTA 1IYQA 1KGGA 1ES5A 3VP2A 1G6AA 3W4QA 1JVJA 3M2KA 3PTEA 4S2LA 1WE4A 1GHPA 1YLPA 3SS3A 3ZG8B 2H10A 1W79A 2WZXA 2OLUA 4OPZA 1WYBA 5FI2A 2WYXA 2ZC3B 2P9VA 4N9KA 2BLSA 2XEPA 4BQMA 2R9WA 2XFSA 4N9LA 1E25A 3MZDA 3FYZA 4BL3A 5GLDA 1IEMA 2HPBA 4DRTA 3HLBA 5FI7A 2PU2A 4R4SA 5CTNA 1HZOA 1BLPA 4Y7PA 3UPOA 3MXSA 4RX3A 1VQQA 4KG6A 1RP5A 2Y2MA 3HLWA 1ONGA 1IKGA 1O07A 2Y91A 3MBZA 2QMIA 4OQGA 5A92A 1PI5A 4E3LA 3VOYA 5JYPA 5EOOA 2H0TA 1ESIA 4JBFA 1K54A 1XXMA 3IXGA 5KSHA 4EV4A 1E4DA 2WGWB 2ZM2A 4EQIA 2J9OA 1FR1A 3G35A 3P98A 2Y59A 1E3UD 4DE1A 3UNWA 3OCNA 4PM7A 1CEGA 3ITBA 1TDLA 4R3JA 3BFGA 2HDRA 4R0QA 1FCOA 3M6HA 4ZJ2A 1PZOA 4X69A 4KQRA 4N1HA 2VGKA 1K57A 1FOFA 4ZBEA 1BULA 3IF5A 4ZTKA 2PBYA 4KENB 2RCXA 1JTDA 5D3OA 3JYIA 1CEFA 4M3KA 1BTLA 5AQAA 4YINA 3IF6C 5FATA 1TDGA 1RGZA 2WGIA 1YLZA 4L0LA 4WMCA 5TGFA 4UA7A 3UE1A 4DKIA 2P9VB 1JTGA 3IWOA 1PWGA 4QU3A 5EVID 1EWZA 3O87A 3IXDA 2Y2HA 4E3KA 2OLVA 4XUXA 4B88A 4IEDA 3GMWA 1HVBA 4P87A 3V50A 4IBRA 4WZ5A 4KZ9A 5DVAA 1ZC2A 4E3NA 3HLEA 4IVIA 1FCMA 5GLAA 4RX2A 1ERQA 3S22A 5DF9A 3GV9A 3PBQA 3Q07A 4WEKA 2WKEA 1ESUA 4E3OA 5A91A 4QJGA 4FSFA 1QMFA 4Z9QA 4DDSA 2XK1A 4QY5A 2GDNA 4GNUA 4QB8A 2DRWA 4OVDA 3UY6A 4OONA 2WKIA 3D4FA 1SDNA 5TFQA 4EBPA 2B5RA 2Q9NA 3ZDJA 4OOLA 3A3DA 3PBTA 4FH2A 3VFHA 2XLNA 3G30A 2PU4A 1KDWA 4WYYA 3UO9A 1PW8A 3BECA 1LL5A 2V2FF 4GZBA 1H8ZA 1ZG4A 1XGIA 4N1XA 1XA7A 4KZ3A 3C4OA 3CJMA 3IQAA 2JBFA 4CJNA 3DTMA 4R1GA 4DF6A 4MNRA 1KVLA 4DXBA 1LHYA 3IH8A 1MY8A 3VSKA 1KE0A 2ZD8A 3MKFA 4BD1A 3G34A 2XGNA 5E2HA 2WAFA 4GDBA 4C3QA 1ALQA 3TG9A 3G2ZA 4EBLA 2DCFA 2WAEA 2QZ6A 4JKTA 1PI4A 3M2JA 1PYYA 3RJUA 1XP4A 5M19A 4X56A 1K56A 4DE2A 5EECA 4B4XA 1RCJA 1KVMA 3Q7ZA 4JPMA 1PWDA 4GDNA 4JF6A 4S2IA 5AQBA 3PAEA 3TOIA 3N6IA 2X02A 3FWLA 2Y2GA 1NZUA 2Y2LA 1VM1A 5HX9A 1SCWA 4OKPA 4OQ0A 3G31A 3DW0A 3V3SA 5EVIC 1LI0A 3AGDA 2EX6A 4XUZA 4JXSA 4S2NA 4HEFA 3IF6A 4WELA 2ZQ8A 4X53A 5AQ9A 4QY6A 3RXWA 3FKVA 5FA7A 4JLFA 4DE3A 4MBHA 1IELA 2X71A 3Q1FA 1BSGA 1YLJA 5FAOA 2JE5A 1MPLA 3NY4A 4R3BA 3CG5A 4BLMA 3HUNA 5CEDA 1YLWA 1DJCA 4GB7A 4XXRA 5AQ7A 2EFUA 3V39A 1MXOA 3NBLA 2HDSA 3PBNA 4S2PA 5F83A 4UA9A 4EUZA 1Y54A 3DWZA 1XX2A 3VP0A 3ZNTA 1LI9A 3O86A 4LV0A 5GHZA 4JF5A 4JF4A 5CGXA 1BZAA 5GLCA 5E2GA 3NDEA 2A3UA 2HP9A 3WS0A 3N8RA 1SDEA 3Q81A 5F1FA 4X55A 1YQSA 1SHVA 3HUOA 4KZ8A 3WWXA 3ZG7B 5CERA 1I2SA 2DNSA 3A3JA 4Q8IA 3VSLA 1NJ4A 2OSUA 4S2JA 4Y0OA 1K55C 2IWCA 5FQ9A 1I2WA 4JXWA 1Q2QA 3WS2A 1L0EA 3E2KA 3O3VA 4WZ4A 3BLSA 5M1AA 1S6RA 5HL1A 2WZZA 3UE0A 4K91A 4KZ5A 3IHAA 3OPHA 1BLHA 5FQKA 3IXHA 4BENA 2Z2MB 1FSYA 3A3EA 4OQHA 3IWIA 4WBGA 3S4XA 4JXGA 3ZG9B 4H8RA 4U0TA 4GKUA 1FCNA 3LY4A 4GOGA 4LCLA 3IHBA 3WS5A 3IF6B 1M40A 2JCHA 4S2OA 4E6XA 4MLLA 4NETA 4OQIA 3ZG0A 2WGVA 1XGJA 4F94A 4X68A 2V1ZA 3I7JA 3OC2A 1N4OA 4OOYA 4PM9A 3N4IA 1JWZA 3RXXA 2A49A 3VOZA 4P0MA 2FFYA 5IHVA 4E3MA 2Y4AA 1E3UA 2IWDA 4OPQA 1W8QA 3V3RA 4Y0UA 3LEZA 3IXBA 4C6YA 1QMEA 3G4PA 3BRMA 3UDFA 3UDIA 3NC8A 1CI9A 4KZ7A 4LV1A 2UWXA 2V20A 3WS4A 1MBLA 2E8IA 3OPRA 5EE8A 1K6RA 1PZPA 3VMAA 3ZGAB 3BFFA 2HDUA 3VFFA 5FDHA 5EOEA 3NIAA 5A93A 3ZNYA 3CMZA 5I94A 3PBRA 3UE3A 3BM6A 3BFDA 3PBOA 1NYMA 3OCLA 3BYDA 2XD1A 3MFDA 4KZ4A 3HLDA 4KG2A 4MEZA 5TR7A 3HLCA 2H5SA 1MWSA 1H8YA 3BEBA 4MBFA 2ZM0A 4R4RA 2XR0A 2H0YA 3V5MA 3DWKA 1IYPA 1MWUA 2QPNA 3GQZA 2JC7A 2WADA 5CTMA 4N92A 5FQJA 5FQMA 1DJAA 1JWVA 1YLTA 3S1YA 1YT4A 2Y2IA 3AGFA 1W8YA 2Q9MA 3A3FA 5CXWA 2IWBA 3GVBA 3SH9A 4O7DA 2I72A 3NI9A 1NYYA 1OMEA 1GHMA 3E2LA 3Q7VA 2XF3A 1NXYA 4KZ6A 4HBTA 4OH0A 4DE0A 2G2WA 1ES3A 1NY0A 4HESA 2Y2PA 3UDXA 4E6WA 1NZOA 2ZC4B 3WRZA 4U3TA 5J8XA 3B3XA 5HARA 4HBUA 5FSRA 3MZEA 5FQIA 3UN7A 1IYSA 4K0XA 3GSGA 3ISGA 1I5QA 2Y2QA 2J7VA 1H5XA 3VP3A 4EWFA 2BG1A 1MWRA 3GTCA 3HLGA 1PIOA 2P74A 2Y2NA 1KDSA 3WS1A 2XD5A 2X01A 2ZQCA 3BFCA 3HREA 2ZJ9A 2RL3A 3TSGA 5KMWA 4PPRA 1AXBA 4OP8A 4ZJ1A 4GN2A 3VP1A 5CGSA 3W4PA 3LCEA 1YLYA 1O7EA 3HBRA 3SH7A 3GRJA 3LY3A 2R9XA 5M18A 5DTSA 5E43A 5CEBA 1ES2A 4UHUA 2FFFB 3IWQA 5CECA 4E3IA 1W7FA 5CHJA 4OLDA 3HVFA 5FI6A 3C5AA 3P09A 3QNCA 4OLGA 1Q2PA 3PAGA 4LCMA 5JYOA 2WKHA 1MKIA 5EPHA 1KE3A 5KSCA 1DY6A 4WM9A 2Y2OA 2ZLYA 3OPPA 5KZHA 3UPPA 5HAPA 3Q7VB 2ZC6B 4YFMA 1PWCA 1BUEA 1BT5A 1K4EA 2Y55A 1GA9A 3NDGA 4S2MA 1JWPA 1SKFA 4PM6A 1KGFA 4S2KA 4OP5A 5U47A 2J9PA 3EQVA 4OOMA 4KQQA 3OZHA 2XDMA 3N8SA 3IT9A 3O88A 1L0GA 2Z2LB 5BOHA 1CK3A 4RYEA 5DF8A 2ZMAA 3FZCA 4WMCD 2G2UA 3QNBA 1TEMA 3MZFA 1C3BA 1IYOA 4RA7A 1DJBA 4C75A 5GLBA 4KZBA 4D2OA 4FCFA 1HD8A 4A5RA 1RGYA 4EBNA 1XKZA 4WEJA 4PM5A 3HLFA 3OPLA 3PBSA 4U0XA 4FD8A 1CI8A 2EX8A 4FH4A 1ERMA 2ZQDA 3ZVWA 2CC1A 5EVLA 4UAAA 1ES4A 1EROA 2J8YA 3MKEA 4Y0TA 1Z6FA 2WUQA 2ZC5B 1BLCA 1LLBA 2HP6A 3HL9A 2OV5A 3SH8A 1KE4A 5E2FA 1W5DA 2HP5A 1KGEA 4LV3A 2EXBA 3BLMA 5DTTA 2ZQ7A 2C6WB 3BFEA 3MXRA 5G18A 1FQGA 4ZJ3A 4GD6A 4IBXA 3C7VA 4S2NC 4ID4A 4BJPA 1K6SA 1G68A 1YM1A 1GCEA 1K25A 1ONHA 2ZQ9A 3CZDA 1M6KA 2ZQAA 4GD8A 3ZG5A 1L0FA 3VP4A 3FKWA 4E3JA 4X6TA 5FASA 2WK0A 5CHUA 4P6BA 3FV7A 5FAPA 4BL2A 4BD0A 1LL9A 4KQOA 5HAIA 5HFOA 3AGEA 1GA0A 5EVIA 3NCKA 4K0WA 5FAQA 1K54C 5CRFA 2XFTA 5GHXA 4DDYA
chains in the Genus database with same CATH superfamily
4GJ4A 3ITAA 1YMXA 1YSPA 2A2LA 1XPBA 2VJWA 3KSIA 4PMAA 2VGJA 1XA1A 1T19A 2V1BA 3LO7A 1S0WA 3Q82A 4P85A 4DMZA 5I5LA 5CGWA 4WLAA 4NK3A 3CHWP 5FQQA 3ZFZA 1D1JA 5L10A 1WYCA 1L0DA 3W8KA 5GHYA 2FH5A 3W4OA 2GJ3A 2C5WB 4QHCA 3SS5A 4WZ5C 1KOUA 4PM8A 4B4ZA 3CUEC 3WRTA 4RVAA 4EW7A 3ZVTA 2VEAA 1IYQA 1ES5A 3M2KA 3QP4A 1GHPA 3ZYTA 3SS3A 4OPZA 4YWZA 1WYBA 2WYXA 2ZC3B 4GCZA 2BLSA 4BQMA 1TS6A 3MZDA 4BL3A 5GLDA 1GSWA 4R4SA 5CTNA 1HZOA 3UPOA 3MXSA 3T12B 2PD8A 1RP5A 2Y2MA 1ONGA 3MFXA 4X25A 3MBZA 1PI5A 4E3LA 3O5YA 2H0TA 1OJ5A 1K54A 5HDSA 4EQIA 3G35A 4HHDA 4DE1A 3UNWA 3ICYA 3ITBA 1TDLA 4Y17A 3EGDC 4R0QA 1FCOA 4ZJ2A 1PZOA 4X69A 4KQRA 1K57A 1FOFA 1BULA 3IF5A 2PBYA 4KENB 1CEFA 4UEYA 1IOUA 4DKIA 5TGFA 1JTGA 4QU3A 3NECA 1WA9A 3IXDA 3O87A 3GMWA 1HVBA 3V50A 4IBRA 4KZ9A 3HLEA 3GV9A 3PBQA 3UMEA 1PFLA 4Z9QA 4DDSA 2XK1A 4QY5A 4QB8A 2DRWA 4OVDA 4OONA 4L9FA 5TFQA 3ZDJA 3UO9A 3KSFA 1ZG4A 4Q0JA 4WUJA 1LHYA 2B18A 1MY8A 4BD1A 4HJ4A 4LRZE 4JKTA 3M2JA 1PYYA 2I9VA 1XP4A 3LI8A 4NXEA 4B4XA 1KVMA 4S2IA 4JF6A 5AQBA 2X02A 2Y2GA 1NZUA 4HP4A 2OAP1 4JXSA 3RXWA 1NRJA 2M1CA 4MBHA 2X71A 3NY4A 3CG5A 1G6OA 4BLMA 3K2NA 4Q0HA 2JKGA 4BWIA 5F83A 4UA9A 1Y54A 1XX2A 1Y28A 4JF5A 5CGXA 1G28A 3N8RA 5DKKA 3Q81A 4X55A 3WWXA 3A3JA 4Q8IA 1NJ4A 2OSUA 4ETZA 1Q2QA 1L0EA 3E2KA 1S6RA 4CLCE 4K91A 4KZ5A 2QYBA 3DTIA 4BENA 4OQHA 3F1PA 4HY8A 4JXGA 3ZG9B 5HDDA 3GDIA 4GOGA 5G4ZA 1L3LA 2JCHA 5DFYA 3I7JA 3OC2A 1N4OA 4P0MA 5IHVA 2Y4AA 4OPQA 2YKFA 5EM0A 4MN6A 4KZ7A 4ESPA 3U4LP 5EE8A 1PZPA 3T4KA 4EQ1A 4R38A 3PBOA 1NYMA 3OCLA 3E4PA 3HLCA 4L9GA 1H8YA 4MBFA 2XR0A 3DWKA 2PT7A 2QPNA 2R78A 3GQZA 5HD5A 2WADA 4N92A 5FQMA 3F1PB 1YLTA 4EESA 1YT4A 2Q9MA 3A3FA 3SH9A 1NYYA 1OMEA 3E2LA 4DE0A 2G2WA 4HESA 2Y2PA 4ETXA 3B3XA 3D72A 2XSSA 3MZEA 1T1CA 5FQIA 3U2AA 3ISGA 4JGRA 3R7WA 2Y2QA 3VP3A 4EWFA 2BG1A 3HLGA 1KDSA 2ZQCA 3HREA 1OJGA 4R6LA 3KYEA 1AXBA 3BQ8A 4DN0A 1PNEA 2J3WA 1YLYA 5EVEA 3LY3A 2R9XA 5E43A 5CEBA 4CLCC 3IWQA 3RTYA 5CECA 4E3IA 3BW6A 4QPRA 3PAGA 1KE3A 1BYWA 2Y2OA 4NXFA 2PDRA 5HAPA 4HP9A 2ZC6B 3UB5P 3EWKA 1BUEA 4S2MA 5FL3A 1SKFA 4S2KA 5U47A 3OZHA 3IT9A 3O88A 1CK3A 1DP6A 1VHMA 3R7WB 3LYXA 2P04A 2ZMAA 3FZCA 1TEMA 3MZFA 1IYOA 4RA7A 4C75A 4HJ6A 2W1TA 4KZBA 2MJ6A 4D2OA 4FCFA 4GHIA 1XKZA 3OPLA 2W1RA 3PBSA 4U0XA 5EV0A 1CI8A 2EX8A 4FH4A 1UWPX 3ZVWA 4UAAA 2IA2A 3BY9A 3OOVA 3HL9A 4Y3IA 2O9BA 4M4XA 2EXBA 2ZQ7A 1V9ZA 3BFEA 4ZJ3A 1OPXA 1K6SA 1G68A 5CX7A 1K25A 1ONHA 1LT0A 3T4QA 4GD8A 1L0FA 4E3JA 5L09A 4BD0A 5HAIA 5EVIA 5FAQA 2XFTA 2O9CA 5GHXA 2HF6A 4Z1WA 2W1TB 4GHIB 5IU1A 3LR0A 4LENA 1FSWA 1EI5A 2ZBBA 3UB7A 1K56D 2ZC7A 5CHMA 2D01A 3KYZA 3M6BA 3QHYA 2Y2JA 3B33A 4CPKA 2Z6DA 2EXAA 3UPNA 3SW1A 1W63Q 2EFXA 4MBKA 4OPYA 2HDQA 4IUKA 3GR2A 2WGWA 3QP6A 3C4PA 2O99A 4LV2A 3HUMA 3UB8A 5DTKA 5A90A 5EVIB 3ZCZA 1NRFA 2Y2KA 5EUAA 1YPRA 5HL6A 1KGGA 3SZTA 1G6AA 2QWSA 3W4QA 2W3DA 3PTEA 1CF0A 4UQIM 3ZG8B 2H10A 4ARZA 2P9VA 1H3QA 2XEPA 2DMWA 2R9WA 4N9LA 5K5BA 1IEMA 3T1SA 2HPBA 5LBRA 1XFNA 5F5YA 3LFVA 4XT2A 3IBRA 1BLPA 1DP9A 1S67L 2QMIA 2CMNA 1YKDA 4EV4A 1MC0A 2WGWB 3P98A 3CITA 3MXQA 4B9OA 4PM7A 1H0MA 4LRXC 4R3JA 3M6HA 4IUHA 2RCXA 2KLIA 3DTKA 4MN7A 3JYIA 1BTLA 3IF6C 4ARZB 4L0LA 4UA7A 2P9VB 1JNUA 4YNRA 2Y2HA 3LR4A 4YOFA 4B88A 4XT2B 3MSHA 2PR6A 1F98A 2D02A 2VV7A 4WZ5A 5DVAA 1ZC2A 3IX4A 3CUEA 1YAXA 4WN5A 4WEKA 2WKEA 1T1AA 2WKIA 2V1AA 1SDNA 2B5RA 3PBTA 3VFHA 3W2ZA 4KQDA 4NG2A 4WYYA 1KDWA 3CWFA 1PW8A 3V67A 5HSQA 3C4OA 3IQAA 3K3CA 1HLUP 4CJNA 3DTMA 4EERA 4DF6A 4MNRA 2H28A 5HD3A 3LIFA 3DAVA 3G34A 1P0ZA 5E2HA 3ZQ5A 2WAFA 4C3QA 3G2ZA 4EBLA 1PI4A 1IFQA 5HWVA 4X56A 1K56A 2HJ9C 5EECA 3Q7ZA 3TOIA 3N6IA 2JKFA 1DP8A 2WKQA 4HEFA 2ZQ8A 4X53A 5FA7A 2WKPA 3Q1FA 1BSGA 1MPLA 1NLZA 3HUNA 1YLWA 4GB7A 1MZUA 5GHZA 2O0YA 3NDEA 2HP9A 3WS0A 5HWWA 4H6JA 1SDEA 3LIEA 2KX6A 5EFWA 1YQSA 4KZ8A 3T4SA 5CERA 3VSLA 4Y0OA 5FQ9A 1I2WA 5DFXA 3HJIA 4JXWA 3WS2A 1XJ2A 4WZ4A 3O3VA 2JKTI 5DJTA 2WZZA 3NOPC 3LEQA 3OPHA 3IXHA 3S4XA 2K2NA 2K7SA 3LY4A 2VKSA 3UMDA 3IHBA 1XJ6A 3BWLA 4E6XA 4OQIA 1XGJA 4F94A 2L4RA 4X68A 2V1ZA 4CLCD 3HCYA 4OOYA 3RXXA 2FFYA 4E3MA 3V3RA 4DJ3A 3P01A 3LEZA 3NC8A 1CI9A 4LV1A 1MBLA 3VMAA 1K6RA 5FDHA 4GLQA 5EOEA 5A93A 5HPIA 3ZNYA 3UE3A 4H6JB 4KZ4A 3FPVA 2H5SA 2VLGA 2ZM0A 2JC7A 5CTMA 4O01A 1D7EA 2J3TC 1DJAA 3S1YA 3LI9A 3AGFA 4O7DA 3KX0X 2XF3A 3E0YA 4KZ6A 5J8XA 5HZHA 5FSRA 4O0PA 2BASA 4K0XA 3GSGA 3LR3A 5IT5A 1SZVA 1FIKA 3GTCA 3BFCA 2RL3A 3TSGA 4PPRA 4OP8A 4LFUA 3VP1A 3W4PA 3LCEA 3PHYA 3HBRA 5M18A 1ES2A 1T1BA 1W7FA 4CQHA 3JPUA 3HJKA 3P09A 1V9YA 5JYOA 2WKHA 2HJEA 4EU0A 2OWHA 3UPPA 4YFMA 1BT5A 2Y55A 3E4QA 1KGFA 2W3HA 2J9PA 1X0OA 4R3AA 4HH3A 1VEUA 4RYEA 4LGWA 1C3BA 4G3WA 4EBNA 4WEJA 3BQAA 4FD8A 2PYRA 2A24A 5J7EA 2ZQDA 4Y0TA 2WUQA 2ZC5B 2HP5A 1KGEA 3ULFA 4LV3A 3BLMA 5G18A 1FQGA 4GD6A 4IBXA 3QP5A 3ZG5A 4P6ZS 1UGUA 4X6TA 5CHUA 4P6BA 3QP1A 4KQOA 1G5UA 3MS6A 3TW8A 4EEPA 1VEUB 5CRFA 4DDYA 1TD5A 4R23A 1OTDA 5HAQA 3LIBA 1U60A 1K4FA 1OTIA 2XRNA 4ZAMA 3TRCA 2V0UA 4PAUA 2A24B 3N7WA 3F1OA 5F82A 1HTZA 5HDCA 1ZKJA 1FR6A 1J9MA 3EEAA 2K31A 3SOIA 1YSQA 1K0KA 1L2SA 4Y13A 5E2EA 3NJAA 3VE4A 4NXBA 1TVFA 3N8LA 3S7PA 4IVKA 2ZM8A 3MQOA 1K55A 2JN7A 3C7UA 2FZ0A 4EEUA 1MKMA 2VX8A 1LSVA 5F1GA 2W0NA 1K38A 1YMSA 3T1QB 1GHIA 3IH9A 1NWZA 4KG5A 3A3IA 4PKYA 3ZHHA 1MWTA 5HW3A 4ZDXA 3EQUA 4P6ZM 3T1XA 3T4LA 2INWA 3MR0A 1F2KA 1WE4A 4I3JA 1YLPA 3EEHA 1T18A 1W79A 2AVXA 2WZXA 3F1OB 4HOIA 1GSVA 1E25A 1UWNX 3TE8A 4DRTA 3HLBA 5AJGA 4IHQA 4Y7PA 1N9NA 4RX3A 1VQQA 3HLWA 4Y5FA 3VOYA 4JBFA 3TJZC 1XXMA 3IXGA 1H8MA 1E4DA 1FR1A 1ODVA 2Y59A 1E3UD 2P7JA 3OCNA 2JKRI 3R4KA 1CEGA 2HDRA 4HJ3A 4N1HA 2VGKA 4X1LA 4Y15A 4I38A 3C2WA 1JTDA 2B95A 4M3KA 4YINA 1RGZA 3P7NA 2WGIA 3UE1A 1CJFA 1EWZA 2W27A 2OLVA 4IEDA 1Y4OA 4P87A 1TS0A 3S22A 5DF9A 3Q07A 4HI4A 4II7A 1ESUA 3MQ0A 4E3OA 5IS1A 2W3GA 1J3WA 1QMFA 2GDNA 4GNUA 3UY6A 3D4FA 4EBPA 3A3DA 3VV4A 4FH2A 4NKPA 2PU4A 1N9LA 4GS9A 5FEGA 1LL5A 2V2FF 4GZBA 4N1XA 1XA7A 4O8GA 2JBFA 4R1GA 4EUVA 2EWVA 1LSWA 3IH8A 3NOTC 1N9OA 3MKFA 2XGNA 4GDBA 2DCFA 2PHYA 3LIAA 4K08A 4FOFA 3RJUA 5M19A 1S66L 2KDKA 1RCJA 5EM1A 4JPMA 1PWDA 3MJQA 3PAEA 2VA0A 5MC7A 2Y2LA 1VM1A 5HX9A 1SCWA 4OQ0A 3G31A 3V3SA 5EVIC 1LI0A 4XUZA 4S2NA 3MMHA 3IF6A 4JGOA 3LICA 2W3FA 4QY6A 3FKVA 4JLFA 4DE3A 1AWIA 4R3BA 3E4OA 4GS9B 3A0VA 5CEDA 2PD7A 2PAVP 1DJCA 4B93A 4D60A 3FC7A 5AQ7A 3T1RA 3V39A 1MXOA 3NBLA 3T4JA 2HDSA 3PYPA 2J3TD 4EUZA 3NHQA 3O86A 4JF4A 5E2GA 1F5MA 4Q0IA 5F1FA 2VGLS 4LLOB 2NUPC 3ZG7B 2DNSA 4S2JA 2IWCA 2G7UA 5M1AA 2PYPA 5HL1A 3UE0A 3LR5A 1OTAA 3IHAA 5FQKA 2NUTC 1FSYA 4WBGA 3IWIA 4MCWA 4H8RA 4EXOA 1FCNA 4LCLA 3WS5A 3IF6B 4S2OA 4NETA 2WGVA 2JHEA 4PM9A 1JWZA 2QJ5A 2A49A 3VOZA 1E3UA 1W8QA 4C6YA 3G4PA 3JVVA 3UDIA 2UWXA 2V20A 3ZGAB 1P97A 4I3IA 2HDUA 3K3DA 4BBTA 3CMZA 3DTEA 5I94A 3BFDA 2VZWA 2XD1A 3MFDA 4QWOA 1NLYA 4KG2A 3UE6A 2V8CA 4R4RA 4G3KA 4JGQA 3DBAA 2VGLM 5FQJA 1ACFA 1JWVA 3T50A 1W8YA 4BMWA 1P9RA 2I72A 1GHMA 1NXYA 4HBTA 1NY0A 4KUKA 4R70A 3UDXA 4E6WA 1NZOA 1GSXA 2ZC4B 3WRZA 2ZMVA 4ME4A 4HBUA 3UN7A 1IYSA 5G4YA 3B42A 2XROA 1MWRA 3CI6A 2P74A 3WS1A 2XD5A 2L0WA 2ZJ9A 4ZJ1A 1O7EA 3SH7A 3GRJA 5DTSA 5FDSA 4UHUA 1CQAA 5CHJA 4OLDA 3HVFA 3QNCA 4LCMA 4MMNA 1MKIA 5EPHA 2Y79A 3KYQA 4WM9A 3OPPA 5KZHA 4LPZA 3T4TA 1PWCA 4HQAA 1GA9A 1OT6A 1JWPA 4OP5A 2BTFP 3EQVA 4OOMA 4KQQA 3D3OA 1W63M 1L0GA 5FEFA 5DF8A 2JKTM 4WMCD 3QNBA 5GLBA 1HD8A 4A5RA 2LB5A 1RGYA 3HLFA 4DJ2A 2CC1A 4IJGA 1Z6FA 1BLCA 2HP6A 2OV5A 1KE4A 2VK3A 3C30A 5DTTA 2C6WB 1YM1A 1GCEA 2ZQ9A 1M6KA 2L1MA 2ZQAA 3RFBA 2M7UA 4GW9A 3FKWA 5FASA 5FAPA 1OTBA 1LL9A 5HFOA 2QJ7A 4K0WA 1K54C 3RH8B 3H82A 5DF7A 2XH9A 4KZAA 2XQZA 4UA6A 1S1YA 2EX9A 3G2YA 3GECA 2GZAA 5GL9A 4KUOA 1K57C 4QD4A 3G32A 5L2FA 4PKYG 1BLSA 2EX2A 3E98A 3S7OA 2V9AA 4OPRA 3H9WA 1PW1A 2EA9A 4JXVA 4DXCA 3S7NA 4NEED 1IKIA 1N9BA 1ZG6A 3SS4A 3H82B 2E8JA 3VP2A 1JVJA 4S2LA 4FUWA 3PXPA 1XJ4A 3B47A 1PRQA 2VV6A 4X1MA 2OLUA 2OAQ1 5FI2A 4N9KA 4HIAA 5KIZA 2XFSA 1EW0A 4WL9A 3FYZA 5DKLA 5HPFA 4BBVA 5FI7A 2PU2A 2OOLA 5AVFA 4KG6A 4OQGA 5A92A 1IKGA 1O07A 2Y91A 2P08A 5JYPA 5EOOA 1ESIA 4F3LA 5KSHA 2ZM2A 4AFIA 1LL8A 1VETA 2J9OA 4JGPA 4E04A 3CLOA 3BFGA 2Z6CA 4ZBEA 4ZTKA 4RQ9A 2GNXA 3EGXC 3UB9A 5D3OA 5AQAA 5FATA 1TDGA 1YLZA 4WMCA 3LUQA 4ZRRA 1P9WA 5TBMA 3IWOA 1PWGA 5EVID 4HNBA 3A0RA 4EETB 3UB6A 1OT9A 4E3KA 3H7WA 4XUXA 2LB9A 3EOIA 4E3NA 4IVIA 1FCMA 5GLAA 4RX2A 2OWJA 1ERQA 2Y8HA 4CLCA 4F3LB 2PBDP 5A91A 4QJGA 4FSFA 1VETB 2W3EA 1D06A 2Q9NA 4OOLA 2XLNA 3G30A 1TF1A 1Z09A 3BECA 3KO6A 1H8ZA 3L7HA 1XGIA 3D9YA 4KZ3A 3CJMA 5HWTA 5TBMB 1KVLA 4DXBA 1TS8A 3VSKA 1KE0A 2ZD8A 3H7WB 1ALQA 4BBUA 2M7VA 3TG9A 2HZ5A 1SKOA 2WAEA 2QZ6A 3IBJA 3VE3A 2KOIA 2ZOHA 4DE2A 2ZL1A 4I3AA 4CLCB 4GDNA 3FWLA 5F68A 3FG8A 4OKPA 3DW0A 3QP2A 2ZMFA 3IX3A 3AGDA 2EX6A 3BJNA 2GX5A 4WELA 5AQ9A 3BY8A 5L8MA 1IELA 2QKPA 1STZA 1YLJA 5FAOA 1XJ3A 2JE5A 2XA7S 1F9IA 2QHKA 4XXRA 2EFUA 2PRFA 3PBNA 4S2PA 3DWZA 3VP0A 3ZNTA 2O9AA 2ZOIA 4MDZA 1LI9A 4LV0A 5F69A 1BZAA 5GLCA 1VB6A 2V0WA 2A3UA 4MN5A 2JKRM 1SKOB 1SHVA 3HUOA 3NOUC 1I2SA 1K55C 2ZL1B 3BLSA 1BLHA 2Z2MB 3A3EA 3C38A 4U0TA 4GKUA 4I39A 3CPTA 1M40A 3G6OA 4MLLA 3ZG0A 5DJUA 3OLOA 2Q0OA 3N4IA 5J3WA 2IWDA 4Y0UA 3IXBA 1QMEA 3BRMA 1DRMA 3UDFA 1S4SA 1A0KA 3T4OA 1S1ZA 3WS4A 2E8IA 3OPRA 3BFFA 3VFFA 3CAXA 3MQQA 2XA7M 3NIAA 3PBRA 3BM6A 3BYDA 5C5KA 2UV0E 3HLDA 5A8BA 4MEZA 5TR7A 3QP8A 4UQIS 1MWSA 2EWWA 3BEBA 4FTXA 4PHTA 2H0YA 3V5MA 3OBFA 1IYPA 1MWUA 2Y2IA 5CXWA 2IWBA 3GVBA 3Q7VA 3NI9A 3CPTB 4OH0A 3IS2A 3JVUA 1ES3A 5AVEA 4U3TA 1TS7A 5HARA 2VV8A 1ZHHB 4NXGA 1I5QA 3NULA 2J7VA 1H5XA 4WF0A 1ZTUA 3A0SA 1PIOA 2Y2NA 5F6AA 2X01A 5KMWA 4GN2A 5CGSA 3C8CA 2FFFB 2WKRA 5FI6A 3IX8A 3C5AA 4OLGA 1Q2PA 4G3VA 4LRYC 3VOLA 5KSCA 1DY6A 2ZLYA 3FPWA 1XFQA 5L07A 3Q7VB 3L9KA 3LGOA 3MF0A 3IS2B 2B02A 1K4EA 5TJJA 3NDGA 4PM6A 1FILA 2XDMA 3F1NA 3N8SA 3S7QA 2Z2LB 5BOHA 2G2UA 4HH2A 1DJBA 4PM5A 3KSHA 5J4EA 1ERMA 5EVLA 1ES4A 1EROA 2J8YA 3MKEA 3LIDA 1LLBA 4Y2FA 2V8FA 4L9EA 3SH8A 1S4RA 2PR5A 2J80A 5E2FA 1W5DA 3MXRA 4I5SA 3C7VA 4S2NC 4ID4A 4BJPA 3CZDA 2YKHA 3VP4A 2WK0A 2ACGA 3FV7A 4BL2A 2HGVA 3PR6A 3KSGA 1OTEA 3F1NB 3AGEA 1GA0A 2HV1A 3NCKA 1LSXA
chains in the Genus database with same CATH topology
3ITAA 5DF7A 4R23A 5HAQA 2XH9A 1YMXA 4KZAA 2XQZA 1XPBA 4UA6A 4LENA 1U60A 1K4FA 1FSWA 4ZAMA 4PMAA 2VGJA 2EX9A 3G2YA 3N7WA 1XA1A 5GL9A 1K57C 1EI5A 3LO7A 5F82A 1S0WA 1HTZA 1K56D 2ZC7A 3Q82A 4QD4A 5CHMA 1ZKJA 3G32A 4P85A 5L2FA 3M6BA 3QHYA 1FR6A 2Y2JA 5CGWA 4CPKA 1J9MA 3SOIA 4NK3A 1BLSA 2EX2A 5FQQA 3ZFZA 2EXAA 3UPNA 1L2SA 1WYCA 1L0DA 5E2EA 2EFXA 4MBKA 3W8KA 4OPYA 1TVFA 3N8LA 4OPRA 5GHYA 3W4OA 1PW1A 4IVKA 4JXVA 2ZM8A 4DXCA 2HDQA 1K55A 2C5WB 4QHCA 3GR2A 3C7UA 2WGWA 3SS5A 5F1GA 3C4PA 1K38A 1YMSA 4LV2A 4WZ5C 1GHIA 1IKIA 3HUMA 3IH9A 4PM8A 4KG5A 4B4ZA 3A3IA 3ZHHA 5DTKA 1MWTA 5A90A 1N9BA 5EVIB 4RVAA 3WRTA 3ZCZA 4ZDXA 1NRFA 2Y2KA 5HW3A 5EUAA 1ZG6A 3SS4A 3EQUA 3ZVTA 1IYQA 1KGGA 1ES5A 3VP2A 1G6AA 3W4QA 1JVJA 3M2KA 3PTEA 4S2LA 1WE4A 1GHPA 1YLPA 3SS3A 3ZG8B 2H10A 1W79A 2WZXA 2OLUA 4OPZA 1WYBA 5FI2A 2WYXA 2ZC3B 2P9VA 4N9KA 2BLSA 2XEPA 4BQMA 2R9WA 2XFSA 4N9LA 1E25A 3MZDA 3FYZA 4BL3A 5GLDA 1IEMA 2HPBA 4DRTA 3HLBA 5FI7A 2PU2A 4R4SA 5CTNA 1HZOA 1BLPA 4Y7PA 3UPOA 3MXSA 4RX3A 1VQQA 4KG6A 1RP5A 2Y2MA 3HLWA 1ONGA 1IKGA 1O07A 2Y91A 3MBZA 2QMIA 4OQGA 5A92A 1PI5A 4E3LA 3VOYA 5JYPA 5EOOA 2H0TA 1ESIA 4JBFA 1K54A 1XXMA 3IXGA 5KSHA 4EV4A 1E4DA 2WGWB 2ZM2A 4EQIA 2J9OA 1FR1A 3G35A 3P98A 2Y59A 1E3UD 4DE1A 3UNWA 3OCNA 4PM7A 1CEGA 3ITBA 1TDLA 4R3JA 3BFGA 2HDRA 4R0QA 1FCOA 3M6HA 4ZJ2A 1PZOA 4X69A 4KQRA 4N1HA 2VGKA 1K57A 1FOFA 4ZBEA 1BULA 3IF5A 4ZTKA 2PBYA 4KENB 2RCXA 1JTDA 5D3OA 3JYIA 1CEFA 4M3KA 1BTLA 5AQAA 4YINA 3IF6C 5FATA 1TDGA 1RGZA 2WGIA 1YLZA 4L0LA 4WMCA 5TGFA 4UA7A 3UE1A 4DKIA 2P9VB 1JTGA 3IWOA 1PWGA 4QU3A 5EVID 1EWZA 3O87A 3IXDA 2Y2HA 4E3KA 2OLVA 4XUXA 4B88A 4IEDA 3GMWA 1HVBA 4P87A 3V50A 4IBRA 4WZ5A 4KZ9A 5DVAA 1ZC2A 4E3NA 3HLEA 4IVIA 1FCMA 5GLAA 4RX2A 1ERQA 3S22A 5DF9A 3GV9A 3PBQA 3Q07A 4WEKA 2WKEA 1ESUA 4E3OA 5A91A 4QJGA 4FSFA 1QMFA 4Z9QA 4DDSA 2XK1A 4QY5A 2GDNA 4GNUA 4QB8A 2DRWA 4OVDA 3UY6A 4OONA 2WKIA 3D4FA 1SDNA 5TFQA 4EBPA 2B5RA 2Q9NA 3ZDJA 4OOLA 3A3DA 3PBTA 4FH2A 3VFHA 2XLNA 3G30A 2PU4A 1KDWA 4WYYA 3UO9A 1PW8A 3BECA 1LL5A 2V2FF 4GZBA 1H8ZA 1ZG4A 1XGIA 4N1XA 1XA7A 4KZ3A 3C4OA 3CJMA 3IQAA 2JBFA 4CJNA 3DTMA 4R1GA 4DF6A 4MNRA 1KVLA 4DXBA 1LHYA 3IH8A 1MY8A 3VSKA 1KE0A 2ZD8A 3MKFA 4BD1A 3G34A 2XGNA 5E2HA 2WAFA 4GDBA 4C3QA 1ALQA 3TG9A 3G2ZA 4EBLA 2DCFA 2WAEA 2QZ6A 4JKTA 1PI4A 3M2JA 1PYYA 3RJUA 1XP4A 5M19A 4X56A 1K56A 4DE2A 5EECA 4B4XA 1RCJA 1KVMA 3Q7ZA 4JPMA 1PWDA 4GDNA 4JF6A 4S2IA 5AQBA 3PAEA 3TOIA 3N6IA 2X02A 3FWLA 2Y2GA 1NZUA 2Y2LA 1VM1A 5HX9A 1SCWA 4OKPA 4OQ0A 3G31A 3DW0A 3V3SA 5EVIC 1LI0A 3AGDA 2EX6A 4XUZA 4JXSA 4S2NA 4HEFA 3IF6A 4WELA 2ZQ8A 4X53A 5AQ9A 4QY6A 3RXWA 3FKVA 5FA7A 4JLFA 4DE3A 4MBHA 1IELA 2X71A 3Q1FA 1BSGA 1YLJA 5FAOA 2JE5A 1MPLA 3NY4A 4R3BA 3CG5A 4BLMA 3HUNA 5CEDA 1YLWA 1DJCA 4GB7A 4XXRA 5AQ7A 2EFUA 3V39A 1MXOA 3NBLA 2HDSA 3PBNA 4S2PA 5F83A 4UA9A 4EUZA 1Y54A 3DWZA 1XX2A 3VP0A 3ZNTA 1LI9A 3O86A 4LV0A 5GHZA 4JF5A 4JF4A 5CGXA 1BZAA 5GLCA 5E2GA 3NDEA 2A3UA 2HP9A 3WS0A 3N8RA 1SDEA 3Q81A 5F1FA 4X55A 1YQSA 1SHVA 3HUOA 4KZ8A 3WWXA 3ZG7B 5CERA 1I2SA 2DNSA 3A3JA 4Q8IA 3VSLA 1NJ4A 2OSUA 4S2JA 4Y0OA 1K55C 2IWCA 5FQ9A 1I2WA 4JXWA 1Q2QA 3WS2A 1L0EA 3E2KA 3O3VA 4WZ4A 3BLSA 5M1AA 1S6RA 5HL1A 2WZZA 3UE0A 4K91A 4KZ5A 3IHAA 3OPHA 1BLHA 5FQKA 3IXHA 4BENA 2Z2MB 1FSYA 3A3EA 4OQHA 3IWIA 4WBGA 3S4XA 4JXGA 3ZG9B 4H8RA 4U0TA 4GKUA 1FCNA 3LY4A 4GOGA 4LCLA 3IHBA 3WS5A 3IF6B 1M40A 2JCHA 4S2OA 4E6XA 4MLLA 4NETA 4OQIA 3ZG0A 2WGVA 1XGJA 4F94A 4X68A 2V1ZA 3I7JA 3OC2A 1N4OA 4OOYA 4PM9A 3N4IA 1JWZA 3RXXA 2A49A 3VOZA 4P0MA 2FFYA 5IHVA 4E3MA 2Y4AA 1E3UA 2IWDA 4OPQA 1W8QA 3V3RA 4Y0UA 3LEZA 3IXBA 4C6YA 1QMEA 3G4PA 3BRMA 3UDFA 3UDIA 3NC8A 1CI9A 4KZ7A 4LV1A 2UWXA 2V20A 3WS4A 1MBLA 2E8IA 3OPRA 5EE8A 1K6RA 1PZPA 3VMAA 3ZGAB 3BFFA 2HDUA 3VFFA 5FDHA 5EOEA 3NIAA 5A93A 3ZNYA 3CMZA 5I94A 3PBRA 3UE3A 3BM6A 3BFDA 3PBOA 1NYMA 3OCLA 3BYDA 2XD1A 3MFDA 4KZ4A 3HLDA 4KG2A 4MEZA 5TR7A 3HLCA 2H5SA 1MWSA 1H8YA 3BEBA 4MBFA 2ZM0A 4R4RA 2XR0A 2H0YA 3V5MA 3DWKA 1IYPA 1MWUA 2QPNA 3GQZA 2JC7A 2WADA 5CTMA 4N92A 5FQJA 5FQMA 1DJAA 1JWVA 1YLTA 3S1YA 1YT4A 2Y2IA 3AGFA 1W8YA 2Q9MA 3A3FA 5CXWA 2IWBA 3GVBA 3SH9A 4O7DA 2I72A 3NI9A 1NYYA 1OMEA 1GHMA 3E2LA 3Q7VA 2XF3A 1NXYA 4KZ6A 4HBTA 4OH0A 4DE0A 2G2WA 1ES3A 1NY0A 4HESA 2Y2PA 3UDXA 4E6WA 1NZOA 2ZC4B 3WRZA 4U3TA 5J8XA 3B3XA 5HARA 4HBUA 5FSRA 3MZEA 5FQIA 3UN7A 1IYSA 4K0XA 3GSGA 3ISGA 1I5QA 2Y2QA 2J7VA 1H5XA 3VP3A 4EWFA 2BG1A 1MWRA 3GTCA 3HLGA 1PIOA 2P74A 2Y2NA 1KDSA 3WS1A 2XD5A 2X01A 2ZQCA 3BFCA 3HREA 2ZJ9A 2RL3A 3TSGA 5KMWA 4PPRA 1AXBA 4OP8A 4ZJ1A 4GN2A 3VP1A 5CGSA 3W4PA 3LCEA 1YLYA 1O7EA 3HBRA 3SH7A 3GRJA 3LY3A 2R9XA 5M18A 5DTSA 5E43A 5CEBA 1ES2A 4UHUA 2FFFB 3IWQA 5CECA 4E3IA 1W7FA 5CHJA 4OLDA 3HVFA 5FI6A 3C5AA 3P09A 3QNCA 4OLGA 1Q2PA 3PAGA 4LCMA 5JYOA 2WKHA 1MKIA 5EPHA 1KE3A 5KSCA 1DY6A 4WM9A 2Y2OA 2ZLYA 3OPPA 5KZHA 3UPPA 5HAPA 3Q7VB 2ZC6B 4YFMA 1PWCA 1BUEA 1BT5A 1K4EA 2Y55A 1GA9A 3NDGA 4S2MA 1JWPA 1SKFA 4PM6A 1KGFA 4S2KA 4OP5A 5U47A 2J9PA 3EQVA 4OOMA 4KQQA 3OZHA 2XDMA 3N8SA 3IT9A 3O88A 1L0GA 2Z2LB 5BOHA 1CK3A 4RYEA 5DF8A 2ZMAA 3FZCA 4WMCD 2G2UA 3QNBA 1TEMA 3MZFA 1C3BA 1IYOA 4RA7A 1DJBA 4C75A 5GLBA 4KZBA 4D2OA 4FCFA 1HD8A 4A5RA 1RGYA 4EBNA 1XKZA 4WEJA 4PM5A 3HLFA 3OPLA 3PBSA 4U0XA 4FD8A 1CI8A 2EX8A 4FH4A 1ERMA 2ZQDA 3ZVWA 2CC1A 5EVLA 4UAAA 1ES4A 1EROA 2J8YA 3MKEA 4Y0TA 1Z6FA 2WUQA 2ZC5B 1BLCA 1LLBA 2HP6A 3HL9A 2OV5A 3SH8A 1KE4A 5E2FA 1W5DA 2HP5A 1KGEA 4LV3A 2EXBA 3BLMA 5DTTA 2ZQ7A 2C6WB 3BFEA 3MXRA 5G18A 1FQGA 4ZJ3A 4GD6A 4IBXA 3C7VA 4S2NC 4ID4A 4BJPA 1K6SA 1G68A 1YM1A 1GCEA 1K25A 1ONHA 2ZQ9A 3CZDA 1M6KA 2ZQAA 4GD8A 3ZG5A 1L0FA 3VP4A 3FKWA 4E3JA 4X6TA 5FASA 2WK0A 5CHUA 4P6BA 3FV7A 5FAPA 4BL2A 4BD0A 1LL9A 4KQOA 5HAIA 5HFOA 3AGEA 1GA0A 5EVIA 3NCKA 4K0WA 5FAQA 1K54C 5CRFA 2XFTA 5GHXA 4DDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ITA A;  5DF7 A;  4R23 A;  5HAQ A;  2XH9 A;  1YMX A;  4KZA A;  2XQZ A;  1XPB A;  4UA6 A;  4LEN A;  1U60 A;  1K4F A;  1FSW A;  4ZAM A;  4PMA A;  2VGJ A;  2EX9 A;  3G2Y A;  3N7W A;  1XA1 A;  5GL9 A;  1K57 C;  1EI5 A;  3LO7 A;  5F82 A;  1S0W A;  1HTZ A;  1K56 D;  2ZC7 A;  3Q82 A;  4QD4 A;  5CHM A;  1ZKJ A;  3G32 A;  4P85 A;  5L2F A;  3M6B A;  3QHY A;  1FR6 A;  2Y2J A;  5CGW A;  4CPK A;  1J9M A;  3SOI A;  4NK3 A;  1BLS A;  2EX2 A;  5FQQ A;  3ZFZ A;  2EXA A;  3UPN A;  1L2S A;  1WYC A;  1L0D A;  5E2E A;  2EFX A;  4MBK A;  3W8K A;  4OPY A;  1TVF A;  3N8L A;  4OPR A;  5GHY A;  3W4O A;  1PW1 A;  4IVK A;  4JXV A;  2ZM8 A;  4DXC A;  2HDQ A;  1K55 A;  2C5W B;  4QHC A;  3GR2 A;  3C7U A;  2WGW A;  3SS5 A;  5F1G A;  3C4P A;  1K38 A;  1YMS A;  4LV2 A;  4WZ5 C;  1GHI A;  1IKI A;  3HUM A;  3IH9 A;  4PM8 A;  4KG5 A;  4B4Z A;  3A3I A;  3ZHH A;  5DTK A;  1MWT A;  5A90 A;  1N9B A;  5EVI B;  4RVA A;  3WRT A;  3ZCZ A;  4ZDX A;  1NRF A;  2Y2K A;  5HW3 A;  5EUA A;  1ZG6 A;  3SS4 A;  3EQU A;  3ZVT A;  1IYQ A;  1KGG A;  1ES5 A;  3VP2 A;  1G6A A;  3W4Q A;  1JVJ A;  3M2K A;  3PTE A;  4S2L A;  1WE4 A;  1GHP A;  1YLP A;  3SS3 A;  3ZG8 B;  2H10 A;  1W79 A;  2WZX A;  2OLU A;  4OPZ A;  1WYB A;  5FI2 A;  2WYX A;  2ZC3 B;  2P9V A;  4N9K A;  2BLS A;  2XEP A;  4BQM A;  2R9W A;  2XFS A;  4N9L A;  1E25 A;  3MZD A;  3FYZ A;  4BL3 A;  5GLD A;  1IEM A;  2HPB A;  4DRT A;  3HLB A;  5FI7 A;  2PU2 A;  4R4S A;  5CTN A;  1HZO A;  1BLP A;  4Y7P A;  3UPO A;  3MXS A;  4RX3 A;  1VQQ A;  4KG6 A;  1RP5 A;  2Y2M A;  3HLW A;  1ONG A;  1IKG A;  1O07 A;  2Y91 A;  3MBZ A;  2QMI A;  4OQG A;  5A92 A;  1PI5 A;  4E3L A;  3VOY A;  5JYP A;  5EOO A;  2H0T A;  1ESI A;  4JBF A;  1K54 A;  1XXM A;  3IXG A;  5KSH A;  4EV4 A;  1E4D A;  2WGW B;  2ZM2 A;  4EQI A;  2J9O A;  1FR1 A;  3G35 A;  3P98 A;  2Y59 A;  1E3U D;  4DE1 A;  3UNW A;  3OCN A;  4PM7 A;  1CEG A;  3ITB A;  1TDL A;  4R3J A;  3BFG A;  2HDR A;  4R0Q A;  1FCO A;  3M6H A;  4ZJ2 A;  1PZO A;  4X69 A;  4KQR A;  4N1H A;  2VGK A;  1K57 A;  1FOF A;  4ZBE A;  1BUL A;  3IF5 A;  4ZTK A;  2PBY A;  4KEN B;  2RCX A;  1JTD A;  5D3O A;  3JYI A;  1CEF A;  4M3K A;  1BTL A;  5AQA A;  4YIN A;  3IF6 C;  5FAT A;  1TDG A;  1RGZ A;  2WGI A;  1YLZ A;  4L0L A;  4WMC A;  5TGF A;  4UA7 A;  3UE1 A;  4DKI A;  2P9V B;  1JTG A;  3IWO A;  1PWG A;  4QU3 A;  5EVI D;  1EWZ A;  3O87 A;  3IXD A;  2Y2H A;  4E3K A;  2OLV A;  4XUX A;  4B88 A;  4IED A;  3GMW A;  1HVB A;  4P87 A;  3V50 A;  4IBR A;  4WZ5 A;  4KZ9 A;  5DVA A;  1ZC2 A;  4E3N A;  3HLE A;  4IVI A;  1FCM A;  5GLA A;  4RX2 A;  1ERQ A;  3S22 A;  5DF9 A;  3GV9 A;  3PBQ A;  3Q07 A;  4WEK A;  2WKE A;  1ESU A;  4E3O A;  5A91 A;  4QJG A;  4FSF A;  1QMF A;  4Z9Q A;  4DDS A;  2XK1 A;  4QY5 A;  2GDN A;  4GNU A;  4QB8 A;  2DRW A;  4OVD A;  3UY6 A;  4OON A;  2WKI A;  3D4F A;  1SDN A;  5TFQ A;  4EBP A;  2B5R A;  2Q9N A;  3ZDJ A;  4OOL A;  3A3D A;  3PBT A;  4FH2 A;  3VFH A;  2XLN A;  3G30 A;  2PU4 A;  1KDW A;  4WYY A;  3UO9 A;  1PW8 A;  3BEC A;  1LL5 A;  2V2F F;  4GZB A;  1H8Z A;  1ZG4 A;  1XGI A;  4N1X A;  1XA7 A;  4KZ3 A;  3C4O A;  3CJM A;  3IQA A;  2JBF A;  4CJN A;  3DTM A;  4R1G A;  4DF6 A;  4MNR A;  1KVL A;  4DXB A;  1LHY A;  3IH8 A;  1MY8 A;  3VSK A;  1KE0 A;  2ZD8 A;  3MKF A;  4BD1 A;  3G34 A;  2XGN A;  5E2H A;  2WAF A;  4GDB A;  4C3Q A;  1ALQ A;  3TG9 A;  3G2Z A;  4EBL A;  2DCF A;  2WAE A;  2QZ6 A;  4JKT A;  1PI4 A;  3M2J A;  1PYY A;  3RJU A;  1XP4 A;  5M19 A;  4X56 A;  1K56 A;  4DE2 A;  5EEC A;  4B4X A;  1RCJ A;  1KVM A;  3Q7Z A;  4JPM A;  1PWD A;  4GDN A;  4JF6 A;  4S2I A;  5AQB A;  3PAE A;  3TOI A;  3N6I A;  2X02 A;  3FWL A;  2Y2G A;  1NZU A;  2Y2L A;  1VM1 A;  5HX9 A;  1SCW A;  4OKP A;  4OQ0 A;  3G31 A;  3DW0 A;  3V3S A;  5EVI C;  1LI0 A;  3AGD A;  2EX6 A;  4XUZ A;  4JXS A;  4S2N A;  4HEF A;  3IF6 A;  4WEL A;  2ZQ8 A;  4X53 A;  5AQ9 A;  4QY6 A;  3RXW A;  3FKV A;  5FA7 A;  4JLF A;  4DE3 A;  4MBH A;  1IEL A;  2X71 A;  3Q1F A;  1BSG A;  1YLJ A;  5FAO A;  2JE5 A;  1MPL A;  3NY4 A;  4R3B A;  3CG5 A;  4BLM A;  3HUN A;  5CED A;  1YLW A;  1DJC A;  4GB7 A;  4XXR A;  5AQ7 A;  2EFU A;  3V39 A;  1MXO A;  3NBL A;  2HDS A;  3PBN A;  4S2P A;  5F83 A;  4UA9 A;  4EUZ A;  1Y54 A;  3DWZ A;  1XX2 A;  3VP0 A;  3ZNT A;  1LI9 A;  3O86 A;  4LV0 A;  5GHZ A;  4JF5 A;  4JF4 A;  5CGX A;  1BZA A;  5GLC A;  5E2G A;  3NDE A;  2A3U A;  2HP9 A;  3WS0 A;  3N8R A;  1SDE A;  3Q81 A;  5F1F A;  4X55 A;  1YQS A;  1SHV A;  3HUO A;  4KZ8 A;  3WWX A;  3ZG7 B;  5CER A;  1I2S A;  2DNS A;  3A3J A;  4Q8I A;  3VSL A;  1NJ4 A;  2OSU A;  4S2J A;  4Y0O A;  1K55 C;  2IWC A;  5FQ9 A;  1I2W A;  4JXW A;  1Q2Q A;  3WS2 A;  1L0E A;  3E2K A;  3O3V A;  4WZ4 A;  3BLS A;  5M1A A;  1S6R A;  5HL1 A;  2WZZ A;  3UE0 A;  4K91 A;  4KZ5 A;  3IHA A;  3OPH A;  1BLH A;  5FQK A;  3IXH A;  4BEN A;  2Z2M B;  1FSY A;  3A3E A;  4OQH A;  3IWI A;  4WBG A;  3S4X A;  4JXG A;  3ZG9 B;  4H8R A;  4U0T A;  4GKU A;  1FCN A;  3LY4 A;  4GOG A;  4LCL A;  3IHB A;  3WS5 A;  3IF6 B;  1M40 A;  2JCH A;  4S2O A;  4E6X A;  4MLL A;  4NET A;  4OQI A;  3ZG0 A;  2WGV A;  1XGJ A;  4F94 A;  4X68 A;  2V1Z A;  3I7J A;  3OC2 A;  1N4O A;  4OOY A;  4PM9 A;  3N4I A;  1JWZ A;  3RXX A;  2A49 A;  3VOZ A;  4P0M A;  2FFY A;  5IHV A;  4E3M A;  2Y4A A;  1E3U A;  2IWD A;  4OPQ A;  1W8Q A;  3V3R A;  4Y0U A;  3LEZ A;  3IXB A;  4C6Y A;  1QME A;  3G4P A;  3BRM A;  3UDF A;  3UDI A;  3NC8 A;  1CI9 A;  4KZ7 A;  4LV1 A;  2UWX A;  2V20 A;  3WS4 A;  1MBL A;  2E8I A;  3OPR A;  5EE8 A;  1K6R A;  1PZP A;  3VMA A;  3ZGA B;  3BFF A;  2HDU A;  3VFF A;  5FDH A;  5EOE A;  3NIA A;  5A93 A;  3ZNY A;  3CMZ A;  5I94 A;  3PBR A;  3UE3 A;  3BM6 A;  3BFD A;  3PBO A;  1NYM A;  3OCL A;  3BYD A;  2XD1 A;  3MFD A;  4KZ4 A;  3HLD A;  4KG2 A;  4MEZ A;  5TR7 A;  3HLC A;  2H5S A;  1MWS A;  1H8Y A;  3BEB A;  4MBF A;  2ZM0 A;  4R4R A;  2XR0 A;  2H0Y A;  3V5M A;  3DWK A;  1IYP A;  1MWU A;  2QPN A;  3GQZ A;  2JC7 A;  2WAD A;  5CTM A;  4N92 A;  5FQJ A;  5FQM A;  1DJA A;  1JWV A;  1YLT A;  3S1Y A;  1YT4 A;  2Y2I A;  3AGF A;  1W8Y A;  2Q9M A;  3A3F A;  5CXW A;  2IWB A;  3GVB A;  3SH9 A;  4O7D A;  2I72 A;  3NI9 A;  1NYY A;  1OME A;  1GHM A;  3E2L A;  3Q7V A;  2XF3 A;  1NXY A;  4KZ6 A;  4HBT A;  4OH0 A;  4DE0 A;  2G2W A;  1ES3 A;  1NY0 A;  4HES A;  2Y2P A;  3UDX A;  4E6W A;  1NZO A;  2ZC4 B;  3WRZ A;  4U3T A;  5J8X A;  3B3X A;  5HAR A;  4HBU A;  5FSR A;  3MZE A;  5FQI A;  3UN7 A;  1IYS A;  4K0X A;  3GSG A;  3ISG A;  1I5Q A;  2Y2Q A;  2J7V A;  1H5X A;  3VP3 A;  4EWF A;  2BG1 A;  1MWR A;  3GTC A;  3HLG A;  1PIO A;  2P74 A;  2Y2N A;  1KDS A;  3WS1 A;  2XD5 A;  2X01 A;  2ZQC A;  3BFC A;  3HRE A;  2ZJ9 A;  2RL3 A;  3TSG A;  5KMW A;  4PPR A;  1AXB A;  4OP8 A;  4ZJ1 A;  4GN2 A;  3VP1 A;  5CGS A;  3W4P A;  3LCE A;  1YLY A;  1O7E A;  3HBR A;  3SH7 A;  3GRJ A;  3LY3 A;  2R9X A;  5M18 A;  5DTS A;  5E43 A;  5CEB A;  1ES2 A;  4UHU A;  2FFF B;  3IWQ A;  5CEC A;  4E3I A;  1W7F A;  5CHJ A;  4OLD A;  3HVF A;  5FI6 A;  3C5A A;  3P09 A;  3QNC A;  4OLG A;  1Q2P A;  3PAG A;  4LCM A;  5JYO A;  2WKH A;  1MKI A;  5EPH A;  1KE3 A;  5KSC A;  1DY6 A;  4WM9 A;  2Y2O A;  2ZLY A;  3OPP A;  5KZH A;  3UPP A;  5HAP A;  3Q7V B;  2ZC6 B;  4YFM A;  1PWC A;  1BUE A;  1BT5 A;  1K4E A;  2Y55 A;  1GA9 A;  3NDG A;  4S2M A;  1JWP A;  1SKF A;  4PM6 A;  1KGF A;  4S2K A;  4OP5 A;  5U47 A;  2J9P A;  3EQV A;  4OOM A;  4KQQ A;  3OZH A;  2XDM A;  3N8S A;  3IT9 A;  3O88 A;  1L0G A;  2Z2L B;  5BOH A;  1CK3 A;  4RYE A;  5DF8 A;  2ZMA A;  3FZC A;  4WMC D;  2G2U A;  3QNB A;  1TEM A;  3MZF A;  1C3B A;  1IYO A;  4RA7 A;  1DJB A;  4C75 A;  5GLB A;  4KZB A;  4D2O A;  4FCF A;  1HD8 A;  4A5R A;  1RGY A;  4EBN A;  1XKZ A;  4WEJ A;  4PM5 A;  3HLF A;  3OPL A;  3PBS A;  4U0X A;  4FD8 A;  1CI8 A;  2EX8 A;  4FH4 A;  1ERM A;  2ZQD A;  3ZVW A;  2CC1 A;  5EVL A;  4UAA A;  1ES4 A;  1ERO A;  2J8Y A;  3MKE A;  4Y0T A;  1Z6F A;  2WUQ A;  2ZC5 B;  1BLC A;  1LLB A;  2HP6 A;  3HL9 A;  2OV5 A;  3SH8 A;  1KE4 A;  5E2F A;  1W5D A;  2HP5 A;  1KGE A;  4LV3 A;  2EXB A;  3BLM A;  5DTT A;  2ZQ7 A;  2C6W B;  3BFE A;  3MXR A;  5G18 A;  1FQG A;  4ZJ3 A;  4GD6 A;  4IBX A;  3C7V A;  4S2N C;  4ID4 A;  4BJP A;  1K6S A;  1G68 A;  1YM1 A;  1GCE A;  1K25 A;  1ONH A;  2ZQ9 A;  3CZD A;  1M6K A;  2ZQA A;  4GD8 A;  3ZG5 A;  1L0F A;  3VP4 A;  3FKW A;  4E3J A;  4X6T A;  5FAS A;  2WK0 A;  5CHU A;  4P6B A;  3FV7 A;  5FAP A;  4BL2 A;  4BD0 A;  1LL9 A;  4KQO A;  5HAI A;  5HFO A;  3AGE A;  1GA0 A;  5EVI A;  3NCK A;  4K0W A;  5FAQ A;  1K54 C;  5CRF A;  2XFT A;  5GHX A;  4DDY A; 
#chains in the Genus database with same CATH topology
 4GJ4 A;  3ITA A;  1YMX A;  1YSP A;  2A2L A;  1XPB A;  2VJW A;  3KSI A;  4PMA A;  2VGJ A;  1XA1 A;  1T19 A;  2V1B A;  3LO7 A;  1S0W A;  3Q82 A;  4P85 A;  4DMZ A;  5I5L A;  5CGW A;  4WLA A;  4NK3 A;  3CHW P;  5FQQ A;  3ZFZ A;  1D1J A;  5L10 A;  1WYC A;  1L0D A;  3W8K A;  5GHY A;  2FH5 A;  3W4O A;  2GJ3 A;  2C5W B;  4QHC A;  3SS5 A;  4WZ5 C;  1KOU A;  4PM8 A;  4B4Z A;  3CUE C;  3WRT A;  4RVA A;  4EW7 A;  3ZVT A;  2VEA A;  1IYQ A;  1ES5 A;  3M2K A;  3QP4 A;  1GHP A;  3ZYT A;  3SS3 A;  4OPZ A;  4YWZ A;  1WYB A;  2WYX A;  2ZC3 B;  4GCZ A;  2BLS A;  4BQM A;  1TS6 A;  3MZD A;  4BL3 A;  5GLD A;  1GSW A;  4R4S A;  5CTN A;  1HZO A;  3UPO A;  3MXS A;  3T12 B;  2PD8 A;  1RP5 A;  2Y2M A;  1ONG A;  3MFX A;  4X25 A;  3MBZ A;  1PI5 A;  4E3L A;  3O5Y A;  2H0T A;  1OJ5 A;  1K54 A;  5HDS A;  4EQI A;  3G35 A;  4HHD A;  4DE1 A;  3UNW A;  3ICY A;  3ITB A;  1TDL A;  4Y17 A;  3EGD C;  4R0Q A;  1FCO A;  4ZJ2 A;  1PZO A;  4X69 A;  4KQR A;  1K57 A;  1FOF A;  1BUL A;  3IF5 A;  2PBY A;  4KEN B;  1CEF A;  4UEY A;  1IOU A;  4DKI A;  5TGF A;  1JTG A;  4QU3 A;  3NEC A;  1WA9 A;  3IXD A;  3O87 A;  3GMW A;  1HVB A;  3V50 A;  4IBR A;  4KZ9 A;  3HLE A;  3GV9 A;  3PBQ A;  3UME A;  1PFL A;  4Z9Q A;  4DDS A;  2XK1 A;  4QY5 A;  4QB8 A;  2DRW A;  4OVD A;  4OON A;  4L9F A;  5TFQ A;  3ZDJ A;  3UO9 A;  3KSF A;  1ZG4 A;  4Q0J A;  4WUJ A;  1LHY A;  2B18 A;  1MY8 A;  4BD1 A;  4HJ4 A;  4LRZ E;  4JKT A;  3M2J A;  1PYY A;  2I9V A;  1XP4 A;  3LI8 A;  4NXE A;  4B4X A;  1KVM A;  4S2I A;  4JF6 A;  5AQB A;  2X02 A;  2Y2G A;  1NZU A;  4HP4 A;  2OAP 1;  4JXS A;  3RXW A;  1NRJ A;  2M1C A;  4MBH A;  2X71 A;  3NY4 A;  3CG5 A;  1G6O A;  4BLM A;  3K2N A;  4Q0H A;  2JKG A;  4BWI A;  5F83 A;  4UA9 A;  1Y54 A;  1XX2 A;  1Y28 A;  4JF5 A;  5CGX A;  1G28 A;  3N8R A;  5DKK A;  3Q81 A;  4X55 A;  3WWX A;  3A3J A;  4Q8I A;  1NJ4 A;  2OSU A;  4ETZ A;  1Q2Q A;  1L0E A;  3E2K A;  1S6R A;  4CLC E;  4K91 A;  4KZ5 A;  2QYB A;  3DTI A;  4BEN A;  4OQH A;  3F1P A;  4HY8 A;  4JXG A;  3ZG9 B;  5HDD A;  3GDI A;  4GOG A;  5G4Z A;  1L3L A;  2JCH A;  5DFY A;  3I7J A;  3OC2 A;  1N4O A;  4P0M A;  5IHV A;  2Y4A A;  4OPQ A;  2YKF A;  5EM0 A;  4MN6 A;  4KZ7 A;  4ESP A;  3U4L P;  5EE8 A;  1PZP A;  3T4K A;  4EQ1 A;  4R38 A;  3PBO A;  1NYM A;  3OCL A;  3E4P A;  3HLC A;  4L9G A;  1H8Y A;  4MBF A;  2XR0 A;  3DWK A;  2PT7 A;  2QPN A;  2R78 A;  3GQZ A;  5HD5 A;  2WAD A;  4N92 A;  5FQM A;  3F1P B;  1YLT A;  4EES A;  1YT4 A;  2Q9M A;  3A3F A;  3SH9 A;  1NYY A;  1OME A;  3E2L A;  4DE0 A;  2G2W A;  4HES A;  2Y2P A;  4ETX A;  3B3X A;  3D72 A;  2XSS A;  3MZE A;  1T1C A;  5FQI A;  3U2A A;  3ISG A;  4JGR A;  3R7W A;  2Y2Q A;  3VP3 A;  4EWF A;  2BG1 A;  3HLG A;  1KDS A;  2ZQC A;  3HRE A;  1OJG A;  4R6L A;  3KYE A;  1AXB A;  3BQ8 A;  4DN0 A;  1PNE A;  2J3W A;  1YLY A;  5EVE A;  3LY3 A;  2R9X A;  5E43 A;  5CEB A;  4CLC C;  3IWQ A;  3RTY A;  5CEC A;  4E3I A;  3BW6 A;  4QPR A;  3PAG A;  1KE3 A;  1BYW A;  2Y2O A;  4NXF A;  2PDR A;  5HAP A;  4HP9 A;  2ZC6 B;  3UB5 P;  3EWK A;  1BUE A;  4S2M A;  5FL3 A;  1SKF A;  4S2K A;  5U47 A;  3OZH A;  3IT9 A;  3O88 A;  1CK3 A;  1DP6 A;  1VHM A;  3R7W B;  3LYX A;  2P04 A;  2ZMA A;  3FZC A;  1TEM A;  3MZF A;  1IYO A;  4RA7 A;  4C75 A;  4HJ6 A;  2W1T A;  4KZB A;  2MJ6 A;  4D2O A;  4FCF A;  4GHI A;  1XKZ A;  3OPL A;  2W1R A;  3PBS A;  4U0X A;  5EV0 A;  1CI8 A;  2EX8 A;  4FH4 A;  1UWP X;  3ZVW A;  4UAA A;  2IA2 A;  3BY9 A;  3OOV A;  3HL9 A;  4Y3I A;  2O9B A;  4M4X A;  2EXB A;  2ZQ7 A;  1V9Z A;  3BFE A;  4ZJ3 A;  1OPX A;  1K6S A;  1G68 A;  5CX7 A;  1K25 A;  1ONH A;  1LT0 A;  3T4Q A;  4GD8 A;  1L0F A;  4E3J A;  5L09 A;  4BD0 A;  5HAI A;  5EVI A;  5FAQ A;  2XFT A;  2O9C A;  5GHX A;  2HF6 A;  4Z1W A;  2W1T B;  4GHI B;  5IU1 A;  3LR0 A;  4LEN A;  1FSW A;  1EI5 A;  2ZBB A;  3UB7 A;  1K56 D;  2ZC7 A;  5CHM A;  2D01 A;  3KYZ A;  3M6B A;  3QHY A;  2Y2J A;  3B33 A;  4CPK A;  2Z6D A;  2EXA A;  3UPN A;  3SW1 A;  1W63 Q;  2EFX A;  4MBK A;  4OPY A;  2HDQ A;  4IUK A;  3GR2 A;  2WGW A;  3QP6 A;  3C4P A;  2O99 A;  4LV2 A;  3HUM A;  3UB8 A;  5DTK A;  5A90 A;  5EVI B;  3ZCZ A;  1NRF A;  2Y2K A;  5EUA A;  1YPR A;  5HL6 A;  1KGG A;  3SZT A;  1G6A A;  2QWS A;  3W4Q A;  2W3D A;  3PTE A;  1CF0 A;  4UQI M;  3ZG8 B;  2H10 A;  4ARZ A;  2P9V A;  1H3Q A;  2XEP A;  2DMW A;  2R9W A;  4N9L A;  5K5B A;  1IEM A;  3T1S A;  2HPB A;  5LBR A;  1XFN A;  5F5Y A;  3LFV A;  4XT2 A;  3IBR A;  1BLP A;  1DP9 A;  1S67 L;  2QMI A;  2CMN A;  1YKD A;  4EV4 A;  1MC0 A;  2WGW B;  3P98 A;  3CIT A;  3MXQ A;  4B9O A;  4PM7 A;  1H0M A;  4LRX C;  4R3J A;  3M6H A;  4IUH A;  2RCX A;  2KLI A;  3DTK A;  4MN7 A;  3JYI A;  1BTL A;  3IF6 C;  4ARZ B;  4L0L A;  4UA7 A;  2P9V B;  1JNU A;  4YNR A;  2Y2H A;  3LR4 A;  4YOF A;  4B88 A;  4XT2 B;  3MSH A;  2PR6 A;  1F98 A;  2D02 A;  2VV7 A;  4WZ5 A;  5DVA A;  1ZC2 A;  3IX4 A;  3CUE A;  1YAX A;  4WN5 A;  4WEK A;  2WKE A;  1T1A A;  2WKI A;  2V1A A;  1SDN A;  2B5R A;  3PBT A;  3VFH A;  3W2Z A;  4KQD A;  4NG2 A;  4WYY A;  1KDW A;  3CWF A;  1PW8 A;  3V67 A;  5HSQ A;  3C4O A;  3IQA A;  3K3C A;  1HLU P;  4CJN A;  3DTM A;  4EER A;  4DF6 A;  4MNR A;  2H28 A;  5HD3 A;  3LIF A;  3DAV A;  3G34 A;  1P0Z A;  5E2H A;  3ZQ5 A;  2WAF A;  4C3Q A;  3G2Z A;  4EBL A;  1PI4 A;  1IFQ A;  5HWV A;  4X56 A;  1K56 A;  2HJ9 C;  5EEC A;  3Q7Z A;  3TOI A;  3N6I A;  2JKF A;  1DP8 A;  2WKQ A;  4HEF A;  2ZQ8 A;  4X53 A;  5FA7 A;  2WKP A;  3Q1F A;  1BSG A;  1MPL A;  1NLZ A;  3HUN A;  1YLW A;  4GB7 A;  1MZU A;  5GHZ A;  2O0Y A;  3NDE A;  2HP9 A;  3WS0 A;  5HWW A;  4H6J A;  1SDE A;  3LIE A;  2KX6 A;  5EFW A;  1YQS A;  4KZ8 A;  3T4S A;  5CER A;  3VSL A;  4Y0O A;  5FQ9 A;  1I2W A;  5DFX A;  3HJI A;  4JXW A;  3WS2 A;  1XJ2 A;  4WZ4 A;  3O3V A;  2JKT I;  5DJT A;  2WZZ A;  3NOP C;  3LEQ A;  3OPH A;  3IXH A;  3S4X A;  2K2N A;  2K7S A;  3LY4 A;  2VKS A;  3UMD A;  3IHB A;  1XJ6 A;  3BWL A;  4E6X A;  4OQI A;  1XGJ A;  4F94 A;  2L4R A;  4X68 A;  2V1Z A;  4CLC D;  3HCY A;  4OOY A;  3RXX A;  2FFY A;  4E3M A;  3V3R A;  4DJ3 A;  3P01 A;  3LEZ A;  3NC8 A;  1CI9 A;  4LV1 A;  1MBL A;  3VMA A;  1K6R A;  5FDH A;  4GLQ A;  5EOE A;  5A93 A;  5HPI A;  3ZNY A;  3UE3 A;  4H6J B;  4KZ4 A;  3FPV A;  2H5S A;  2VLG A;  2ZM0 A;  2JC7 A;  5CTM A;  4O01 A;  1D7E A;  2J3T C;  1DJA A;  3S1Y A;  3LI9 A;  3AGF A;  4O7D A;  3KX0 X;  2XF3 A;  3E0Y A;  4KZ6 A;  5J8X A;  5HZH A;  5FSR A;  4O0P A;  2BAS A;  4K0X A;  3GSG A;  3LR3 A;  5IT5 A;  1SZV A;  1FIK A;  3GTC A;  3BFC A;  2RL3 A;  3TSG A;  4PPR A;  4OP8 A;  4LFU A;  3VP1 A;  3W4P A;  3LCE A;  3PHY A;  3HBR A;  5M18 A;  1ES2 A;  1T1B A;  1W7F A;  4CQH A;  3JPU A;  3HJK A;  3P09 A;  1V9Y A;  5JYO A;  2WKH A;  2HJE A;  4EU0 A;  2OWH A;  3UPP A;  4YFM A;  1BT5 A;  2Y55 A;  3E4Q A;  1KGF A;  2W3H A;  2J9P A;  1X0O A;  4R3A A;  4HH3 A;  1VEU A;  4RYE A;  4LGW A;  1C3B A;  4G3W A;  4EBN A;  4WEJ A;  3BQA A;  4FD8 A;  2PYR A;  2A24 A;  5J7E A;  2ZQD A;  4Y0T A;  2WUQ A;  2ZC5 B;  2HP5 A;  1KGE A;  3ULF A;  4LV3 A;  3BLM A;  5G18 A;  1FQG A;  4GD6 A;  4IBX A;  3QP5 A;  3ZG5 A;  4P6Z S;  1UGU A;  4X6T A;  5CHU A;  4P6B A;  3QP1 A;  4KQO A;  1G5U A;  3MS6 A;  3TW8 A;  4EEP A;  1VEU B;  5CRF A;  4DDY A;  1TD5 A;  4R23 A;  1OTD A;  5HAQ A;  3LIB A;  1U60 A;  1K4F A;  1OTI A;  2XRN A;  4ZAM A;  3TRC A;  2V0U A;  4PAU A;  2A24 B;  3N7W A;  3F1O A;  5F82 A;  1HTZ A;  5HDC A;  1ZKJ A;  1FR6 A;  1J9M A;  3EEA A;  2K31 A;  3SOI A;  1YSQ A;  1K0K A;  1L2S A;  4Y13 A;  5E2E A;  3NJA A;  3VE4 A;  4NXB A;  1TVF A;  3N8L A;  3S7P A;  4IVK A;  2ZM8 A;  3MQO A;  1K55 A;  2JN7 A;  3C7U A;  2FZ0 A;  4EEU A;  1MKM A;  2VX8 A;  1LSV A;  5F1G A;  2W0N A;  1K38 A;  1YMS A;  3T1Q B;  1GHI A;  3IH9 A;  1NWZ A;  4KG5 A;  3A3I A;  4PKY A;  3ZHH A;  1MWT A;  5HW3 A;  4ZDX A;  3EQU A;  4P6Z M;  3T1X A;  3T4L A;  2INW A;  3MR0 A;  1F2K A;  1WE4 A;  4I3J A;  1YLP A;  3EEH A;  1T18 A;  1W79 A;  2AVX A;  2WZX A;  3F1O B;  4HOI A;  1GSV A;  1E25 A;  1UWN X;  3TE8 A;  4DRT A;  3HLB A;  5AJG A;  4IHQ A;  4Y7P A;  1N9N A;  4RX3 A;  1VQQ A;  3HLW A;  4Y5F A;  3VOY A;  4JBF A;  3TJZ C;  1XXM A;  3IXG A;  1H8M A;  1E4D A;  1FR1 A;  1ODV A;  2Y59 A;  1E3U D;  2P7J A;  3OCN A;  2JKR I;  3R4K A;  1CEG A;  2HDR A;  4HJ3 A;  4N1H A;  2VGK A;  4X1L A;  4Y15 A;  4I38 A;  3C2W A;  1JTD A;  2B95 A;  4M3K A;  4YIN A;  1RGZ A;  3P7N A;  2WGI A;  3UE1 A;  1CJF A;  1EWZ A;  2W27 A;  2OLV A;  4IED A;  1Y4O A;  4P87 A;  1TS0 A;  3S22 A;  5DF9 A;  3Q07 A;  4HI4 A;  4II7 A;  1ESU A;  3MQ0 A;  4E3O A;  5IS1 A;  2W3G A;  1J3W A;  1QMF A;  2GDN A;  4GNU A;  3UY6 A;  3D4F A;  4EBP A;  3A3D A;  3VV4 A;  4FH2 A;  4NKP A;  2PU4 A;  1N9L A;  4GS9 A;  5FEG A;  1LL5 A;  2V2F F;  4GZB A;  4N1X A;  1XA7 A;  4O8G A;  2JBF A;  4R1G A;  4EUV A;  2EWV A;  1LSW A;  3IH8 A;  3NOT C;  1N9O A;  3MKF A;  2XGN A;  4GDB A;  2DCF A;  2PHY A;  3LIA A;  4K08 A;  4FOF A;  3RJU A;  5M19 A;  1S66 L;  2KDK A;  1RCJ A;  5EM1 A;  4JPM A;  1PWD A;  3MJQ A;  3PAE A;  2VA0 A;  5MC7 A;  2Y2L A;  1VM1 A;  5HX9 A;  1SCW A;  4OQ0 A;  3G31 A;  3V3S A;  5EVI C;  1LI0 A;  4XUZ A;  4S2N A;  3MMH A;  3IF6 A;  4JGO A;  3LIC A;  2W3F A;  4QY6 A;  3FKV A;  4JLF A;  4DE3 A;  1AWI A;  4R3B A;  3E4O A;  4GS9 B;  3A0V A;  5CED A;  2PD7 A;  2PAV P;  1DJC A;  4B93 A;  4D60 A;  3FC7 A;  5AQ7 A;  3T1R A;  3V39 A;  1MXO A;  3NBL A;  3T4J A;  2HDS A;  3PYP A;  2J3T D;  4EUZ A;  3NHQ A;  3O86 A;  4JF4 A;  5E2G A;  1F5M A;  4Q0I A;  5F1F A;  2VGL S;  4LLO B;  2NUP C;  3ZG7 B;  2DNS A;  4S2J A;  2IWC A;  2G7U A;  5M1A A;  2PYP A;  5HL1 A;  3UE0 A;  3LR5 A;  1OTA A;  3IHA A;  5FQK A;  2NUT C;  1FSY A;  4WBG A;  3IWI A;  4MCW A;  4H8R A;  4EXO A;  1FCN A;  4LCL A;  3WS5 A;  3IF6 B;  4S2O A;  4NET A;  2WGV A;  2JHE A;  4PM9 A;  1JWZ A;  2QJ5 A;  2A49 A;  3VOZ A;  1E3U A;  1W8Q A;  4C6Y A;  3G4P A;  3JVV A;  3UDI A;  2UWX A;  2V20 A;  3ZGA B;  1P97 A;  4I3I A;  2HDU A;  3K3D A;  4BBT A;  3CMZ A;  3DTE A;  5I94 A;  3BFD A;  2VZW A;  2XD1 A;  3MFD A;  4QWO A;  1NLY A;  4KG2 A;  3UE6 A;  2V8C A;  4R4R A;  4G3K A;  4JGQ A;  3DBA A;  2VGL M;  5FQJ A;  1ACF A;  1JWV A;  3T50 A;  1W8Y A;  4BMW A;  1P9R A;  2I72 A;  1GHM A;  1NXY A;  4HBT A;  1NY0 A;  4KUK A;  4R70 A;  3UDX A;  4E6W A;  1NZO A;  1GSX A;  2ZC4 B;  3WRZ A;  2ZMV A;  4ME4 A;  4HBU A;  3UN7 A;  1IYS A;  5G4Y A;  3B42 A;  2XRO A;  1MWR A;  3CI6 A;  2P74 A;  3WS1 A;  2XD5 A;  2L0W A;  2ZJ9 A;  4ZJ1 A;  1O7E A;  3SH7 A;  3GRJ A;  5DTS A;  5FDS A;  4UHU A;  1CQA A;  5CHJ A;  4OLD A;  3HVF A;  3QNC A;  4LCM A;  4MMN A;  1MKI A;  5EPH A;  2Y79 A;  3KYQ A;  4WM9 A;  3OPP A;  5KZH A;  4LPZ A;  3T4T A;  1PWC A;  4HQA A;  1GA9 A;  1OT6 A;  1JWP A;  4OP5 A;  2BTF P;  3EQV A;  4OOM A;  4KQQ A;  3D3O A;  1W63 M;  1L0G A;  5FEF A;  5DF8 A;  2JKT M;  4WMC D;  3QNB A;  5GLB A;  1HD8 A;  4A5R A;  2LB5 A;  1RGY A;  3HLF A;  4DJ2 A;  2CC1 A;  4IJG A;  1Z6F A;  1BLC A;  2HP6 A;  2OV5 A;  1KE4 A;  2VK3 A;  3C30 A;  5DTT A;  2C6W B;  1YM1 A;  1GCE A;  2ZQ9 A;  1M6K A;  2L1M A;  2ZQA A;  3RFB A;  2M7U A;  4GW9 A;  3FKW A;  5FAS A;  5FAP A;  1OTB A;  1LL9 A;  5HFO A;  2QJ7 A;  4K0W A;  1K54 C;  3RH8 B;  3H82 A;  5DF7 A;  2XH9 A;  4KZA A;  2XQZ A;  4UA6 A;  1S1Y A;  2EX9 A;  3G2Y A;  3GEC A;  2GZA A;  5GL9 A;  4KUO A;  1K57 C;  4QD4 A;  3G32 A;  5L2F A;  4PKY G;  1BLS A;  2EX2 A;  3E98 A;  3S7O A;  2V9A A;  4OPR A;  3H9W A;  1PW1 A;  2EA9 A;  4JXV A;  4DXC A;  3S7N A;  4NEE D;  1IKI A;  1N9B A;  1ZG6 A;  3SS4 A;  3H82 B;  2E8J A;  3VP2 A;  1JVJ A;  4S2L A;  4FUW A;  3PXP A;  1XJ4 A;  3B47 A;  1PRQ A;  2VV6 A;  4X1M A;  2OLU A;  2OAQ 1;  5FI2 A;  4N9K A;  4HIA A;  5KIZ A;  2XFS A;  1EW0 A;  4WL9 A;  3FYZ A;  5DKL A;  5HPF A;  4BBV A;  5FI7 A;  2PU2 A;  2OOL A;  5AVF A;  4KG6 A;  4OQG A;  5A92 A;  1IKG A;  1O07 A;  2Y91 A;  2P08 A;  5JYP A;  5EOO A;  1ESI A;  4F3L A;  5KSH A;  2ZM2 A;  4AFI A;  1LL8 A;  1VET A;  2J9O A;  4JGP A;  4E04 A;  3CLO A;  3BFG A;  2Z6C A;  4ZBE A;  4ZTK A;  4RQ9 A;  2GNX A;  3EGX C;  3UB9 A;  5D3O A;  5AQA A;  5FAT A;  1TDG A;  1YLZ A;  4WMC A;  3LUQ A;  4ZRR A;  1P9W A;  5TBM A;  3IWO A;  1PWG A;  5EVI D;  4HNB A;  3A0R A;  4EET B;  3UB6 A;  1OT9 A;  4E3K A;  3H7W A;  4XUX A;  2LB9 A;  3EOI A;  4E3N A;  4IVI A;  1FCM A;  5GLA A;  4RX2 A;  2OWJ A;  1ERQ A;  2Y8H A;  4CLC A;  4F3L B;  2PBD P;  5A91 A;  4QJG A;  4FSF A;  1VET B;  2W3E A;  1D06 A;  2Q9N A;  4OOL A;  2XLN A;  3G30 A;  1TF1 A;  1Z09 A;  3BEC A;  3KO6 A;  1H8Z A;  3L7H A;  1XGI A;  3D9Y A;  4KZ3 A;  3CJM A;  5HWT A;  5TBM B;  1KVL A;  4DXB A;  1TS8 A;  3VSK A;  1KE0 A;  2ZD8 A;  3H7W B;  1ALQ A;  4BBU A;  2M7V A;  3TG9 A;  2HZ5 A;  1SKO A;  2WAE A;  2QZ6 A;  3IBJ A;  3VE3 A;  2KOI A;  2ZOH A;  4DE2 A;  2ZL1 A;  4I3A A;  4CLC B;  4GDN A;  3FWL A;  5F68 A;  3FG8 A;  4OKP A;  3DW0 A;  3QP2 A;  2ZMF A;  3IX3 A;  3AGD A;  2EX6 A;  3BJN A;  2GX5 A;  4WEL A;  5AQ9 A;  3BY8 A;  5L8M A;  1IEL A;  2QKP A;  1STZ A;  1YLJ A;  5FAO A;  1XJ3 A;  2JE5 A;  2XA7 S;  1F9I A;  2QHK A;  4XXR A;  2EFU A;  2PRF A;  3PBN A;  4S2P A;  3DWZ A;  3VP0 A;  3ZNT A;  2O9A A;  2ZOI A;  4MDZ A;  1LI9 A;  4LV0 A;  5F69 A;  1BZA A;  5GLC A;  1VB6 A;  2V0W A;  2A3U A;  4MN5 A;  2JKR M;  1SKO B;  1SHV A;  3HUO A;  3NOU C;  1I2S A;  1K55 C;  2ZL1 B;  3BLS A;  1BLH A;  2Z2M B;  3A3E A;  3C38 A;  4U0T A;  4GKU A;  4I39 A;  3CPT A;  1M40 A;  3G6O A;  4MLL A;  3ZG0 A;  5DJU A;  3OLO A;  2Q0O A;  3N4I A;  5J3W A;  2IWD A;  4Y0U A;  3IXB A;  1QME A;  3BRM A;  1DRM A;  3UDF A;  1S4S A;  1A0K A;  3T4O A;  1S1Z A;  3WS4 A;  2E8I A;  3OPR A;  3BFF A;  3VFF A;  3CAX A;  3MQQ A;  2XA7 M;  3NIA A;  3PBR A;  3BM6 A;  3BYD A;  5C5K A;  2UV0 E;  3HLD A;  5A8B A;  4MEZ A;  5TR7 A;  3QP8 A;  4UQI S;  1MWS A;  2EWW A;  3BEB A;  4FTX A;  4PHT A;  2H0Y A;  3V5M A;  3OBF A;  1IYP A;  1MWU A;  2Y2I A;  5CXW A;  2IWB A;  3GVB A;  3Q7V A;  3NI9 A;  3CPT B;  4OH0 A;  3IS2 A;  3JVU A;  1ES3 A;  5AVE A;  4U3T A;  1TS7 A;  5HAR A;  2VV8 A;  1ZHH B;  4NXG A;  1I5Q A;  3NUL A;  2J7V A;  1H5X A;  4WF0 A;  1ZTU A;  3A0S A;  1PIO A;  2Y2N A;  5F6A A;  2X01 A;  5KMW A;  4GN2 A;  5CGS A;  3C8C A;  2FFF B;  2WKR A;  5FI6 A;  3IX8 A;  3C5A A;  4OLG A;  1Q2P A;  4G3V A;  4LRY C;  3VOL A;  5KSC A;  1DY6 A;  2ZLY A;  3FPW A;  1XFQ A;  5L07 A;  3Q7V B;  3L9K A;  3LGO A;  3MF0 A;  3IS2 B;  2B02 A;  1K4E A;  5TJJ A;  3NDG A;  4PM6 A;  1FIL A;  2XDM A;  3F1N A;  3N8S A;  3S7Q A;  2Z2L B;  5BOH A;  2G2U A;  4HH2 A;  1DJB A;  4PM5 A;  3KSH A;  5J4E A;  1ERM A;  5EVL A;  1ES4 A;  1ERO A;  2J8Y A;  3MKE A;  3LID A;  1LLB A;  4Y2F A;  2V8F A;  4L9E A;  3SH8 A;  1S4R A;  2PR5 A;  2J80 A;  5E2F A;  1W5D A;  3MXR A;  4I5S A;  3C7V A;  4S2N C;  4ID4 A;  4BJP A;  3CZD A;  2YKH A;  3VP4 A;  2WK0 A;  2ACG A;  3FV7 A;  4BL2 A;  2HGV A;  3PR6 A;  3KSG A;  1OTE A;  3F1N B;  3AGE A;  1GA0 A;  2HV1 A;  3NCK A;  1LSX A; 
#chains in the Genus database with same CATH homology
 3ITA A;  5DF7 A;  4R23 A;  5HAQ A;  2XH9 A;  1YMX A;  4KZA A;  2XQZ A;  1XPB A;  4UA6 A;  4LEN A;  1U60 A;  1K4F A;  1FSW A;  4ZAM A;  4PMA A;  2VGJ A;  2EX9 A;  3G2Y A;  3N7W A;  1XA1 A;  5GL9 A;  1K57 C;  1EI5 A;  3LO7 A;  5F82 A;  1S0W A;  1HTZ A;  1K56 D;  2ZC7 A;  3Q82 A;  4QD4 A;  5CHM A;  1ZKJ A;  3G32 A;  4P85 A;  5L2F A;  3M6B A;  3QHY A;  1FR6 A;  2Y2J A;  5CGW A;  4CPK A;  1J9M A;  3SOI A;  4NK3 A;  1BLS A;  2EX2 A;  5FQQ A;  3ZFZ A;  2EXA A;  3UPN A;  1L2S A;  1WYC A;  1L0D A;  5E2E A;  2EFX A;  4MBK A;  3W8K A;  4OPY A;  1TVF A;  3N8L A;  4OPR A;  5GHY A;  3W4O A;  1PW1 A;  4IVK A;  4JXV A;  2ZM8 A;  4DXC A;  2HDQ A;  1K55 A;  2C5W B;  4QHC A;  3GR2 A;  3C7U A;  2WGW A;  3SS5 A;  5F1G A;  3C4P A;  1K38 A;  1YMS A;  4LV2 A;  4WZ5 C;  1GHI A;  1IKI A;  3HUM A;  3IH9 A;  4PM8 A;  4KG5 A;  4B4Z A;  3A3I A;  3ZHH A;  5DTK A;  1MWT A;  5A90 A;  1N9B A;  5EVI B;  4RVA A;  3WRT A;  3ZCZ A;  4ZDX A;  1NRF A;  2Y2K A;  5HW3 A;  5EUA A;  1ZG6 A;  3SS4 A;  3EQU A;  3ZVT A;  1IYQ A;  1KGG A;  1ES5 A;  3VP2 A;  1G6A A;  3W4Q A;  1JVJ A;  3M2K A;  3PTE A;  4S2L A;  1WE4 A;  1GHP A;  1YLP A;  3SS3 A;  3ZG8 B;  2H10 A;  1W79 A;  2WZX A;  2OLU A;  4OPZ A;  1WYB A;  5FI2 A;  2WYX A;  2ZC3 B;  2P9V A;  4N9K A;  2BLS A;  2XEP A;  4BQM A;  2R9W A;  2XFS A;  4N9L A;  1E25 A;  3MZD A;  3FYZ A;  4BL3 A;  5GLD A;  1IEM A;  2HPB A;  4DRT A;  3HLB A;  5FI7 A;  2PU2 A;  4R4S A;  5CTN A;  1HZO A;  1BLP A;  4Y7P A;  3UPO A;  3MXS A;  4RX3 A;  1VQQ A;  4KG6 A;  1RP5 A;  2Y2M A;  3HLW A;  1ONG A;  1IKG A;  1O07 A;  2Y91 A;  3MBZ A;  2QMI A;  4OQG A;  5A92 A;  1PI5 A;  4E3L A;  3VOY A;  5JYP A;  5EOO A;  2H0T A;  1ESI A;  4JBF A;  1K54 A;  1XXM A;  3IXG A;  5KSH A;  4EV4 A;  1E4D A;  2WGW B;  2ZM2 A;  4EQI A;  2J9O A;  1FR1 A;  3G35 A;  3P98 A;  2Y59 A;  1E3U D;  4DE1 A;  3UNW A;  3OCN A;  4PM7 A;  1CEG A;  3ITB A;  1TDL A;  4R3J A;  3BFG A;  2HDR A;  4R0Q A;  1FCO A;  3M6H A;  4ZJ2 A;  1PZO A;  4X69 A;  4KQR A;  4N1H A;  2VGK A;  1K57 A;  1FOF A;  4ZBE A;  1BUL A;  3IF5 A;  4ZTK A;  2PBY A;  4KEN B;  2RCX A;  1JTD A;  5D3O A;  3JYI A;  1CEF A;  4M3K A;  1BTL A;  5AQA A;  4YIN A;  3IF6 C;  5FAT A;  1TDG A;  1RGZ A;  2WGI A;  1YLZ A;  4L0L A;  4WMC A;  5TGF A;  4UA7 A;  3UE1 A;  4DKI A;  2P9V B;  1JTG A;  3IWO A;  1PWG A;  4QU3 A;  5EVI D;  1EWZ A;  3O87 A;  3IXD A;  2Y2H A;  4E3K A;  2OLV A;  4XUX A;  4B88 A;  4IED A;  3GMW A;  1HVB A;  4P87 A;  3V50 A;  4IBR A;  4WZ5 A;  4KZ9 A;  5DVA A;  1ZC2 A;  4E3N A;  3HLE A;  4IVI A;  1FCM A;  5GLA A;  4RX2 A;  1ERQ A;  3S22 A;  5DF9 A;  3GV9 A;  3PBQ A;  3Q07 A;  4WEK A;  2WKE A;  1ESU A;  4E3O A;  5A91 A;  4QJG A;  4FSF A;  1QMF A;  4Z9Q A;  4DDS A;  2XK1 A;  4QY5 A;  2GDN A;  4GNU A;  4QB8 A;  2DRW A;  4OVD A;  3UY6 A;  4OON A;  2WKI A;  3D4F A;  1SDN A;  5TFQ A;  4EBP A;  2B5R A;  2Q9N A;  3ZDJ A;  4OOL A;  3A3D A;  3PBT A;  4FH2 A;  3VFH A;  2XLN A;  3G30 A;  2PU4 A;  1KDW A;  4WYY A;  3UO9 A;  1PW8 A;  3BEC A;  1LL5 A;  2V2F F;  4GZB A;  1H8Z A;  1ZG4 A;  1XGI A;  4N1X A;  1XA7 A;  4KZ3 A;  3C4O A;  3CJM A;  3IQA A;  2JBF A;  4CJN A;  3DTM A;  4R1G A;  4DF6 A;  4MNR A;  1KVL A;  4DXB A;  1LHY A;  3IH8 A;  1MY8 A;  3VSK A;  1KE0 A;  2ZD8 A;  3MKF A;  4BD1 A;  3G34 A;  2XGN A;  5E2H A;  2WAF A;  4GDB A;  4C3Q A;  1ALQ A;  3TG9 A;  3G2Z A;  4EBL A;  2DCF A;  2WAE A;  2QZ6 A;  4JKT A;  1PI4 A;  3M2J A;  1PYY A;  3RJU A;  1XP4 A;  5M19 A;  4X56 A;  1K56 A;  4DE2 A;  5EEC A;  4B4X A;  1RCJ A;  1KVM A;  3Q7Z A;  4JPM A;  1PWD A;  4GDN A;  4JF6 A;  4S2I A;  5AQB A;  3PAE A;  3TOI A;  3N6I A;  2X02 A;  3FWL A;  2Y2G A;  1NZU A;  2Y2L A;  1VM1 A;  5HX9 A;  1SCW A;  4OKP A;  4OQ0 A;  3G31 A;  3DW0 A;  3V3S A;  5EVI C;  1LI0 A;  3AGD A;  2EX6 A;  4XUZ A;  4JXS A;  4S2N A;  4HEF A;  3IF6 A;  4WEL A;  2ZQ8 A;  4X53 A;  5AQ9 A;  4QY6 A;  3RXW A;  3FKV A;  5FA7 A;  4JLF A;  4DE3 A;  4MBH A;  1IEL A;  2X71 A;  3Q1F A;  1BSG A;  1YLJ A;  5FAO A;  2JE5 A;  1MPL A;  3NY4 A;  4R3B A;  3CG5 A;  4BLM A;  3HUN A;  5CED A;  1YLW A;  1DJC A;  4GB7 A;  4XXR A;  5AQ7 A;  2EFU A;  3V39 A;  1MXO A;  3NBL A;  2HDS A;  3PBN A;  4S2P A;  5F83 A;  4UA9 A;  4EUZ A;  1Y54 A;  3DWZ A;  1XX2 A;  3VP0 A;  3ZNT A;  1LI9 A;  3O86 A;  4LV0 A;  5GHZ A;  4JF5 A;  4JF4 A;  5CGX A;  1BZA A;  5GLC A;  5E2G A;  3NDE A;  2A3U A;  2HP9 A;  3WS0 A;  3N8R A;  1SDE A;  3Q81 A;  5F1F A;  4X55 A;  1YQS A;  1SHV A;  3HUO A;  4KZ8 A;  3WWX A;  3ZG7 B;  5CER A;  1I2S A;  2DNS A;  3A3J A;  4Q8I A;  3VSL A;  1NJ4 A;  2OSU A;  4S2J A;  4Y0O A;  1K55 C;  2IWC A;  5FQ9 A;  1I2W A;  4JXW A;  1Q2Q A;  3WS2 A;  1L0E A;  3E2K A;  3O3V A;  4WZ4 A;  3BLS A;  5M1A A;  1S6R A;  5HL1 A;  2WZZ A;  3UE0 A;  4K91 A;  4KZ5 A;  3IHA A;  3OPH A;  1BLH A;  5FQK A;  3IXH A;  4BEN A;  2Z2M B;  1FSY A;  3A3E A;  4OQH A;  3IWI A;  4WBG A;  3S4X A;  4JXG A;  3ZG9 B;  4H8R A;  4U0T A;  4GKU A;  1FCN A;  3LY4 A;  4GOG A;  4LCL A;  3IHB A;  3WS5 A;  3IF6 B;  1M40 A;  2JCH A;  4S2O A;  4E6X A;  4MLL A;  4NET A;  4OQI A;  3ZG0 A;  2WGV A;  1XGJ A;  4F94 A;  4X68 A;  2V1Z A;  3I7J A;  3OC2 A;  1N4O A;  4OOY A;  4PM9 A;  3N4I A;  1JWZ A;  3RXX A;  2A49 A;  3VOZ A;  4P0M A;  2FFY A;  5IHV A;  4E3M A;  2Y4A A;  1E3U A;  2IWD A;  4OPQ A;  1W8Q A;  3V3R A;  4Y0U A;  3LEZ A;  3IXB A;  4C6Y A;  1QME A;  3G4P A;  3BRM A;  3UDF A;  3UDI A;  3NC8 A;  1CI9 A;  4KZ7 A;  4LV1 A;  2UWX A;  2V20 A;  3WS4 A;  1MBL A;  2E8I A;  3OPR A;  5EE8 A;  1K6R A;  1PZP A;  3VMA A;  3ZGA B;  3BFF A;  2HDU A;  3VFF A;  5FDH A;  5EOE A;  3NIA A;  5A93 A;  3ZNY A;  3CMZ A;  5I94 A;  3PBR A;  3UE3 A;  3BM6 A;  3BFD A;  3PBO A;  1NYM A;  3OCL A;  3BYD A;  2XD1 A;  3MFD A;  4KZ4 A;  3HLD A;  4KG2 A;  4MEZ A;  5TR7 A;  3HLC A;  2H5S A;  1MWS A;  1H8Y A;  3BEB A;  4MBF A;  2ZM0 A;  4R4R A;  2XR0 A;  2H0Y A;  3V5M A;  3DWK A;  1IYP A;  1MWU A;  2QPN A;  3GQZ A;  2JC7 A;  2WAD A;  5CTM A;  4N92 A;  5FQJ A;  5FQM A;  1DJA A;  1JWV A;  1YLT A;  3S1Y A;  1YT4 A;  2Y2I A;  3AGF A;  1W8Y A;  2Q9M A;  3A3F A;  5CXW A;  2IWB A;  3GVB A;  3SH9 A;  4O7D A;  2I72 A;  3NI9 A;  1NYY A;  1OME A;  1GHM A;  3E2L A;  3Q7V A;  2XF3 A;  1NXY A;  4KZ6 A;  4HBT A;  4OH0 A;  4DE0 A;  2G2W A;  1ES3 A;  1NY0 A;  4HES A;  2Y2P A;  3UDX A;  4E6W A;  1NZO A;  2ZC4 B;  3WRZ A;  4U3T A;  5J8X A;  3B3X A;  5HAR A;  4HBU A;  5FSR A;  3MZE A;  5FQI A;  3UN7 A;  1IYS A;  4K0X A;  3GSG A;  3ISG A;  1I5Q A;  2Y2Q A;  2J7V A;  1H5X A;  3VP3 A;  4EWF A;  2BG1 A;  1MWR A;  3GTC A;  3HLG A;  1PIO A;  2P74 A;  2Y2N A;  1KDS A;  3WS1 A;  2XD5 A;  2X01 A;  2ZQC A;  3BFC A;  3HRE A;  2ZJ9 A;  2RL3 A;  3TSG A;  5KMW A;  4PPR A;  1AXB A;  4OP8 A;  4ZJ1 A;  4GN2 A;  3VP1 A;  5CGS A;  3W4P A;  3LCE A;  1YLY A;  1O7E A;  3HBR A;  3SH7 A;  3GRJ A;  3LY3 A;  2R9X A;  5M18 A;  5DTS A;  5E43 A;  5CEB A;  1ES2 A;  4UHU A;  2FFF B;  3IWQ A;  5CEC A;  4E3I A;  1W7F A;  5CHJ A;  4OLD A;  3HVF A;  5FI6 A;  3C5A A;  3P09 A;  3QNC A;  4OLG A;  1Q2P A;  3PAG A;  4LCM A;  5JYO A;  2WKH A;  1MKI A;  5EPH A;  1KE3 A;  5KSC A;  1DY6 A;  4WM9 A;  2Y2O A;  2ZLY A;  3OPP A;  5KZH A;  3UPP A;  5HAP A;  3Q7V B;  2ZC6 B;  4YFM A;  1PWC A;  1BUE A;  1BT5 A;  1K4E A;  2Y55 A;  1GA9 A;  3NDG A;  4S2M A;  1JWP A;  1SKF A;  4PM6 A;  1KGF A;  4S2K A;  4OP5 A;  5U47 A;  2J9P A;  3EQV A;  4OOM A;  4KQQ A;  3OZH A;  2XDM A;  3N8S A;  3IT9 A;  3O88 A;  1L0G A;  2Z2L B;  5BOH A;  1CK3 A;  4RYE A;  5DF8 A;  2ZMA A;  3FZC A;  4WMC D;  2G2U A;  3QNB A;  1TEM A;  3MZF A;  1C3B A;  1IYO A;  4RA7 A;  1DJB A;  4C75 A;  5GLB A;  4KZB A;  4D2O A;  4FCF A;  1HD8 A;  4A5R A;  1RGY A;  4EBN A;  1XKZ A;  4WEJ A;  4PM5 A;  3HLF A;  3OPL A;  3PBS A;  4U0X A;  4FD8 A;  1CI8 A;  2EX8 A;  4FH4 A;  1ERM A;  2ZQD A;  3ZVW A;  2CC1 A;  5EVL A;  4UAA A;  1ES4 A;  1ERO A;  2J8Y A;  3MKE A;  4Y0T A;  1Z6F A;  2WUQ A;  2ZC5 B;  1BLC A;  1LLB A;  2HP6 A;  3HL9 A;  2OV5 A;  3SH8 A;  1KE4 A;  5E2F A;  1W5D A;  2HP5 A;  1KGE A;  4LV3 A;  2EXB A;  3BLM A;  5DTT A;  2ZQ7 A;  2C6W B;  3BFE A;  3MXR A;  5G18 A;  1FQG A;  4ZJ3 A;  4GD6 A;  4IBX A;  3C7V A;  4S2N C;  4ID4 A;  4BJP A;  1K6S A;  1G68 A;  1YM1 A;  1GCE A;  1K25 A;  1ONH A;  2ZQ9 A;  3CZD A;  1M6K A;  2ZQA A;  4GD8 A;  3ZG5 A;  1L0F A;  3VP4 A;  3FKW A;  4E3J A;  4X6T A;  5FAS A;  2WK0 A;  5CHU A;  4P6B A;  3FV7 A;  5FAP A;  4BL2 A;  4BD0 A;  1LL9 A;  4KQO A;  5HAI A;  5HFO A;  3AGE A;  1GA0 A;  5EVI A;  3NCK A;  4K0W A;  5FAQ A;  1K54 C;  5CRF A;  2XFT A;  5GHX A;  4DDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...