3TJZC

Crystal structure of arf1 bound to the gamma/zeta-cop core complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
140
structure length
140
Chain Sequence
b'EPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMTVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title A structure-based mechanism for arf1-dependent recruitment of coatomer to membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/protein binding
total genus 41
structure length 140
sequence length 140
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3tjzC00
2JKRM 2VGLS 2JKRI 2JKTM 2JKTI 1W63Q 2XA7S 4NEED 2VGLM 2XA7M 2HF6A 5MC7A 1NRJA 4P6ZS 3TJZC 4UQIS 4P6ZM 2FH5A 4UQIM 1W63M
chains in the Genus database with same CATH superfamily
3IT9A 3QP6A 4GD6A 1V9ZA 2V1AA 4X53A 3IWIA 2V2FF 1GHMA 1K56D 2G2UA 1FSYA 2QJ7A 3KSFA 3IX8A 3NC8A 3V67A 2HV1A 1NWZA 5FQQA 3NECA 3HUOA 3QP4A 1ERMA 4XUZA 4ZDXA 4BL3A 5DKLA 1K6SA 3BWLA 3RFBA 2ACGA 4EERA 2PU2A 1DY6A 3CZDA 2VK3A 1F2KA 3M6BA 1P9WA 4RYEA 5KIZA 3UO9A 3HREA 5HDDA 3PBSA 4Y0UA 4BWIA 5EOEA 1S66L 3ZNYA 2B02A 5L07A 1BLCA 4UA9A 4GKUA 2VV7A 4Y0OA 1OT6A 3O88A 3W8KA 4X68A 1CEFA 4Q8IA 1VB6A 4YNRA 4AFIA 2FFFB 4OQ0A 1F98A 3VSKA 4I39A 3MF0A 1Y54A 1LI9A 5F1GA 3PYPA 4R3JA 4UEYA 3V39A 4R4SA 1T18A 4IVKA 3IF5A 4EETB 2J3TC 2YKFA 5GLDA 2DRWA 4R70A 2VEAA 5DKKA 2VV8A 4QJGA 2VV6A 3FC7A 4LLOB 3HVFA 3ZVTA 5AVFA 4E3MA 5FI7A 1DJBA 4ZRRA 1YKDA 1LL9A 1RCJA 4GOGA 4II7A 1YSPA 3GTCA 3T1SA 4GJ4A 3VE3A 4HP9A 3BJNA 1TF1A 3T4QA 3ULFA 3EEHA 3FWLA 4L0LA 4U0TA 4ETZA 1ZHHB 4OVDA 3M6HA 5FL3A 4EBLA 1PZOA 2XA7S 2JCHA 2VGLM 4I3AA 3WWXA 3C5AA 3UPPA 5DJUA 3R7WB 5DTKA 3Q1FA 2W3HA 2FFYA 4WBGA 1Q2QA 5CTMA 3QP5A 4C6YA 1G28A 4ARZA 2WKQA 2EWWA 5CTNA 2HP6A 2VGJA 3IXHA 4JKTA 1XX2A 3VFFA 3OPLA 5GLBA 1MWUA 2QJ5A 1SZVA 2C6WB 3JYIA 4EBPA 2OOLA 4B4XA 2W3GA 5J3WA 3V5MA 2Y91A 3IS2A 5TR7A 4LENA 4LPZA 3WS5A 1C3BA 2Y2PA 4RQ9A 4KZ8A 1H8YA 5CXWA 1EW0A 3LR4A 5L8MA 4G3WA 1W5DA 5CEBA 4P6BA 2JKFA 4N1XA 1VETB 5HPFA 4HNBA 4OQHA 5M18A 3LR5A 2E8JA 2QHKA 4EV4A 4O01A 3F1PB 4GCZA 2O9AA 1XFNA 2R9XA 4DE3A 3LIEA 3VOZA 2A24B 2J7VA 3DWZA 3U2AA 4DKIA 1YAXA 4B88A 3SW1A 3IF6B 3BW6A 4EXOA 4A5RA 4UQIS 1T1CA 2V1BA 1S0WA 4RVAA 3LEZA 4JF6A 2W3FA 1YMSA 1OTBA 2A2LA 3EOIA 2M1CA 1L0DA 3LGOA 2AVXA 3BYDA 3FPVA 4S2NC 1P9RA 4KG5A 4Y7PA 1YSQA 4H8RA 1OPXA 1K4EA 2KDKA 4XUXA 1CJFA 1HVBA 3CPTB 5CEDA 2WGWA 1LSXA 5FASA 2YKHA 3FKVA 1ONHA 3PBNA 1OMEA 5A90A 4GHIA 4WMCA 1MXOA 2ZD8A 4JF5A 5L09A 4BBVA 2EA9A 3Q82A 4IHQA 1EI5A 4E04A 2P7JA 1I5QA 2Y4AA 4YINA 4EQIA 2IWDA 1ZC2A 3LYXA 3D9YA 3H82B 3S4XA 5EM0A 3BQ8A 1L0EA 3S7OA 3MXRA 2V0WA 1OT9A 5LBRA 3VP3A 4R1GA 5FA7A 1MBLA 2XDMA 1PW8A 3IF6C 5CRFA 4EU0A 1MY8A 1EROA 1K0KA 4LCMA 5EVID 4JGQA 4E3IA 1OTAA 4KZ5A 1H0MA 5F82A 2Y2HA 2J9OA 1YT4A 1TDLA 5HD3A 4WN5A 4LRXC 3P7NA 3QP1A 5I5LA 4R23A 2CMNA 3BQAA 3UB5P 2JKRI 2KX6A 3L7HA 4KZ4A 2XRNA 5C5KA 4S2LA 3ZDJA 2VKSA 2Y2JA 4K0WA 4I3JA 5HPIA 1OTEA 1VQQA 1WA9A 2J3TD 2Y2LA 1A0KA 5E2FA 3JVVA 1Z09A 4U0XA 2JKTI 3M2KA 4I3IA 3HLFA 3RXXA 1S4RA 3SS5A 2DMWA 4RA7A 4R38A 4R3BA 4OLGA 3OBFA 4O7DA 1P97A 4FUWA 2Y55A 3W4OA 3MXSA 1DJAA 3DW0A 2WK0A 5FI6A 4O0PA 4ZBEA 2UWXA 3JPUA 3U4LP 4HJ6A 2Y2GA 2H0YA 3VMAA 3NIAA 3UMEA 4CLCD 3OCNA 4DN0A 2EX2A 1NLYA 5CGXA 2ZMFA 1FOFA 1K25A 1NRJA 4Q0HA 3TJZC 3PTEA 2PD8A 2V0UA 4LV3A 4QPRA 1M40A 5TFQA 4PM8A 4DJ2A 4GZBA 3VFHA 2ZQDA 3CAXA 5DF7A 4GHIB 1CEGA 5D3OA 4RX3A 4QU3A 2XROA 4H6JB 3N8LA 4WLAA 5DTTA 3NOUC 1CI9A 1XJ3A 4YWZA 1XA1A 3E0YA 3CLOA 3EWKA 5F83A 2J80A 1ZG6A 2HPBA 2NUTC 1FIKA 1TS7A 3DTMA 2OWHA 5J8XA 2L0WA 4MCWA 3OOVA 1GA0A 2PT7A 2P9VA 1NLZA 2WAEA 4QHCA 4DE0A 2H10A 3D4FA 2WKIA 4UA7A 4HESA 3BFGA 3N6IA 3S7QA 2XA7M 1K55A 4HQAA 1XJ2A 4JPMA 1T1AA 5HW3A 3MSHA 4QB8A 1H8MA 4WF0A 1M6KA 5E2GA 1K57C 4BQMA 3KSIA 2W1RA 5HZHA 4Z9QA 1XFQA 1MPLA 3EGXC 2Y2NA 3VE4A 3NY4A 3V3RA 1BULA 1W63Q 1JWVA 3HLCA 5FSRA 3G6OA 3UPOA 3A0VA 3EQUA 5DJTA 3NULA 1RP5A 5FDSA 1BLHA 5EVIB 4WUJA 3ZG0A 2R78A 3ZCZA 3ZG5A 5F5YA 3RTYA 2DNSA 1JWZA 1K54C 4M4XA 3D3OA 4NXGA 2ZC5B 4PM9A 1STZA 3A0SA 4S2PA 4XT2B 1W8QA 3UY6A 1ES2A 1YLZA 2R9WA 2Z2MB 1GSXA 3HJKA 4EW7A 3EGDC 1WYBA 2EXAA 2VZWA 1ALQA 5AVEA 2HDRA 3IHBA 5EE8A 1QMFA 2WKRA 3N8RA 5G4ZA 4B9OA 3QP8A 4KZ3A 4FH2A 4UQIM 2K31A 2ZL1B 3SS4A 1JNUA 5CECA 4Y3IA 1D06A 3VP0A 1YLJA 3WRZA 1SKOB 2XLNA 5HARA 4EQ1A 2ZJ9A 3HBRA 3RH8B 5HDCA 3RJUA 3FYZA 4CLCB 3MZFA 4EESA 4G3VA 1LI0A 2W27A 3B33A 2Z6CA 5EVIC 4QWOA 3DWKA 4UHUA 2Z2LB 3QHYA 2HP9A 4JXVA 4Y15A 4Q0JA 5DF8A 3S1YA 4B93A 1G6OA 3LR0A 4OONA 1PWCA 2Y79A 1OJ5A 1TVFA 3MBZA 2JKGA 4Y17A 1UWPX 1ZKJA 4LV1A 2Y2KA 5M19A 1W8YA 3PBTA 5A93A 3C8CA 1PWDA 3C2WA 2X71A 3W4PA 4CQHA 1SKFA 2XEPA 2XD1A 1K56A 4K0XA 4LV2A 3MQOA 4PHTA 4HH3A 1PYYA 2V8FA 2WKEA 5HDSA 1DP6A 4DDYA 4PM5A 1P0ZA 3KYQA 4MN5A 2EX9A 2PR5A 4OQIA 2V8CA 4ME4A 3LICA 2XK1A 2ZLYA 2FH5A 5GLCA 1GCEA 5A8BA 4NXEA 3T1RA 4CLCC 2EFXA 4N92A 5A91A 3GSGA 4HEFA 2PYPA 2W1TB 1GSVA 2XFTA 2EXBA 3G4PA 3V50A 4ETXA 3WS4A 3UE1A 3E2KA 4F3LB 3LO7A 3T1QB 2QKPA 4FH4A 5HX9A 4S2OA 5K5BA 2JKTM 4WYYA 5FQMA 5DFXA 3DBAA 3CMZA 2VGKA 5TBMB 4HOIA 3UB8A 2IWCA 5AJGA 3QP2A 3TRCA 2XD5A 1D7EA 3PAEA 3VOYA 1ZTUA 1RGZA 2ZBBA 3NOTC 2HJEA 3NJAA 1W79A 3G30A 1VHMA 2C5WB 2WYXA 3LY4A 4X1LA 4MLLA 3SH9A 3KYEA 5HL1A 4QY6A 4S2IA 3CUEA 4S2MA 1DRMA 2JBFA 3R4KA 2UV0E 4Z1WA 3SOIA 4DMZA 5FEGA 3LI9A 3GV9A 3MS6A 1KDSA 3MXQA 5HSQA 2I9VA 4D60A 3VSLA 4GNUA 4RX2A 2G7UA 4JGPA 4JGOA 2WZZA 4X25A 2P04A 1XJ6A 1LSWA 1YLTA 3BLSA 1PI5A 3LIFA 1FCNA 4HBTA 5AQ9A 3DAVA 1ZG4A 3ZQ5A 2XFSA 5FQIA 5GL9A 2M7VA 4WZ5A 2IWBA 3UPNA 1NXYA 3MFXA 1YLYA 5I94A 2LB9A 2BASA 4R4RA 1L3LA 4WEKA 1N9NA 3O87A 2B95A 3MR0A 2J8YA 3LUQA 4Y13A 2W0NA 1IYPA 1XKZA 1KE3A 4GLQA 4HJ4A 3HUNA 1ES3A 4MEZA 4KUOA 3C7UA 5CX7A 5AQ7A 4OKPA 2ZQ7A 3BECA 3FG8A 1PNEA 1JVJA 2ZC3B 3CITA 1U60A 3A3JA 5E2HA 2VJWA 3VP2A 4R0QA 3KSGA 4MN7A 1E3UA 1MWTA 3BEBA 4KQDA 3E4QA 1IOUA 2QWSA 2Q9NA 4ARZB 1K54A 3DTKA 3OLOA 4HJ3A 1O7EA 1XGIA 1G5UA 1PW1A 1XJ4A 5HFOA 3S7NA 4OQGA 4N9KA 1PI4A 1H8ZA 4ZJ1A 3UB6A 1Q2PA 2WAFA 2WUQA 3IS2B 3B3XA 2H0TA 1BZAA 2OSUA 4GS9A 1G68A 2JE5A 2ZQAA 4K91A 4JXGA 5EECA 1NY0A 2G2WA 2PBDP 1GA9A 5EOOA 1KGFA 4E3JA 3IX4A 2X01A 3G2YA 1L2SA 4UA6A 1QMEA 2ZMAA 4XXRA 1YM1A 3HLEA 2VGLS 3O5YA 4BBTA 4OP8A 3A3FA 2O99A 3VOLA 1IKGA 1MZUA 5EM1A 5F68A 3HUMA 4G3KA 3Q81A 5IT5A 2V9AA 1K4FA 3LIAA 4ID4A 3C38A 5KZHA 4PPRA 1CQAA 1HLUP 3E4PA 1OTIA 3IHAA 4MN6A 1TS6A 4EEPA 1MWRA 1J9MA 5FQ9A 4KENB 1NZOA 3G2ZA 3OZHA 1KVMA 2H28A 2WGWB 4EWFA 3LY3A 1KE0A 2ZM2A 4ZJ3A 2ZQ8A 5FATA 4PM6A 3GRJA 4X55A 3F1OA 4LV0A 3SH7A 4CPKA 1GHIA 5DF9A 2ZC6B 2HP5A 2PHYA 2KLIA 1S1YA 1W7FA 5GLAA 1CK3A 1NYYA 1ODVA 5TJJA 4IBXA 2GX5A 5EFWA 3PHYA 4ZJ2A 4JGRA 3UE3A 2VLGA 4BBUA 1SDNA 3IWQA 4WL9A 1TEMA 4MBHA 2WGVA 1BTLA 4NG2A 4DE1A 3KYZA 1CF0A 5F6AA 4L9GA 2A49A 3O86A 4JF4A 4Y5FA 3T1XA 3I7JA 3K3CA 1H5XA 3CJMA 2A3UA 4IUKA 2J3WA 5CGSA 4F94A 1FSWA 2H5SA 4BL2A 1NJ4A 2P74A 3IX3A 4M3KA 2RL3A 2BG1A 4PAUA 5DFYA 5G4YA 1IYQA 4WM9A 2BTFP 2EX8A 3IXDA 1KE4A 2JN7A 1ONGA 1ESUA 3B47A 4P6ZS 3N8SA 1X0OA 4P85A 5TGFA 4OPRA 3N4IA 2HZ5A 4PKYA 1CI8A 2O9BA 3BRMA 3CG5A 1FR1A 4R3AA 3HCYA 1BSGA 1OJGA 5F1FA 1AXBA 4C75A 4NKPA 4ZTKA 2XR0A 5L10A 2XH9A 5FAPA 4MNRA 1ES4A 3T4LA 5DTSA 3R7WA 4GDBA 2XGNA 4OLDA 1L0GA 4PMAA 3C7VA 1K6RA 1UWNX 3W2ZA 4UAAA 4HY8A 3NDGA 5KSCA 1HD8A 1DP8A 2HDUA 1YPRA 1OTDA 4DE2A 1IEMA 1TS0A 2Q9MA 4E6XA 1WYCA 4E6WA 2ZQ9A 4FCFA 3WRTA 4S2NA 4WEJA 1LL8A 1FCOA 3BFCA 1MKMA 3W4QA 1BLSA 1ACFA 1BT5A 3MQQA 4OP5A 4L9FA 2XQZA 2M7UA 3NCKA 3GDIA 4B4ZA 3MJQA 1I2WA 5CERA 3MZDA 5F69A 2I72A 4BD0A 3L9KA 1PIOA 4GDNA 5JYPA 2P9VB 3P98A 5EVLA 3AGFA 3E4OA 4BENA 1TD5A 1I2SA 4CJNA 1VETA 4X69A 1DP9A 3ITAA 4KQOA 3BLMA 3VV4A 4E3LA 4KZBA 3F1PA 2EX6A 1AWIA 1UGUA 3KSHA 2A24A 3LCEA 4D2OA 3PBRA 3IF6A 3PBOA 4NK3A 3HLGA 1E25A 3V3SA 3FKWA 5FQJA 1JTGA 2QMIA 3Q7VA 5HAIA 4OPYA 3UDXA 4NXBA 3ZFZA 1IELA 1XGJA 5G18A 3DTIA 3UB7A 4LFUA 3UDIA 3CI6A 3CPTA 4BD1A 3MQ0A 2JKRM 2V20A 4P87A 4S2JA 1G6AA 1TDGA 4DXCA 2HDQA 2BLSA 4KZ6A 4L9EA 1S67L 3BFFA 2QPNA 1HTZA 1XP4A 3G31A 3MZEA 2GNXA 3ITBA 4X56A 3ZNTA 3BM6A 1O07A 1PRQA 1N9BA 1XXMA 3ZYTA 4FD8A 1NRFA 2HJ9C 1JWPA 2GJ3A 1KVLA 3N7WA 3IXGA 3H82A 4KZAA 3UDFA 3FPWA 3QNCA 5J4EA 1K55C 1LT0A 5IHVA 3H9WA 5J7EA 2VA0A 3HL9A 3UN7A 2XF3A 5EPHA 5HAQA 2OAP1 2PU4A 3NDEA 3UB9A 2J9PA 5GHYA 1IYOA 2WZXA 2OV5A 4PKYG 3GVBA 5FQKA 4HH2A 3C4PA 4Y0TA 3H7WA 5CHMA 4OPZA 3TSGA 4Y2FA 3NHQA 4KG6A 2PYRA 3A0RA 4EBNA 3T4KA 4OOLA 1MKIA 2QYBA 3B42A 2GZAA 1LSVA 4ESPA 5FDHA 3QNBA 1JTDA 3JVUA 5GHXA 2OAQ1 1SHVA 4MBKA 3UMDA 3BFDA 1FQGA 5AQBA 4KZ9A 1Y4OA 4X1MA 1FILA 1PFLA 5CHUA 3A3EA 4KUKA 4X6TA 3OPPA 5FAOA 4WMCD 2V1ZA 3E98A 2ZMVA 2K2NA 2PBYA 1Z6FA 3TOIA 3IXBA 4GN2A 4DJ3A 2ZOHA 1IKIA 1E3UD 2P08A 3UNWA 3Q7VB 3NI9A 3P09A 4YOFA 4WZ4A 4IVIA 3IBRA 4LRZE 4ZAMA 4HIAA 3A3IA 5FEFA 1KGGA 4S2KA 1K57A 3LFVA 3T4OA 1E4DA 3PR6A 2X02A 4C3QA 4EUVA 4Q0IA 3T50A 4JLFA 3O3VA 2K7SA 4GD8A 3CHWP 1LL5A 2Z6DA 3LIBA 4CLCE 2EFUA 2EWVA 4HHDA 1GSWA 5M1AA 2Q0OA 3EQVA 3KO6A 1FR6A 3ZHHA 4BMWA 1SCWA 1PWGA 4P6ZM 3AGDA 3MKFA 4H6JA 4O8GA 4E3NA 4OH0A 3E2LA 1YMXA 1Y28A 4OOYA 1F5MA 4MBFA 4DRTA 4BLMA 4BJPA 2ZQCA 2GDNA 1TS8A 2ZM0A 3K2NA 1LLBA 4GB7A 3PXPA 3HLWA 1KOUA 1HZOA 3AGEA 2WGIA 1KGEA 3ZGAB 3F1NA 2OLUA 2NUPC 2WKPA 5JYOA 4FOFA 3T4SA 3ZG8B 3VP4A 2E8IA 4KQQA 2ZC7A 3GMWA 3NOPC 4IBRA 5E2EA 3PBQA 4LGWA 4DXBA 4OPQA 1YLPA 1F9IA 3H7WB 4R6LA 2WADA 2HGVA 1S6RA 5FI2A 1N9OA 5U47A 1ERQA 1S4SA 1IFQA 1SDEA 2D02A 2B5RA 4PM7A 3PAGA 4I38A 1N4OA 1K38A 3SS3A 3Q7ZA 1MWSA 2PDRA 3OC2A 5EVIA 2KOIA 3C4OA 5FAQA 3UE6A 5HAPA 3D72A 1T1BA 4JBFA 2RCXA 4DDSA 1VEUA 4IJGA 5HWTA 2HDSA 4XT2A 3CWFA 3G32A 4HBUA 4JXSA 3RXWA 4DF6A 2PRFA 3ZG7B 2PD7A 3WS1A 1NZUA 2VX8A 3S7PA 3NBLA 4WELA 2DCFA 1BYWA 4I5SA 2MJ6A 1WE4A 5HL6A 2D01A 4E3OA 5A92A 4FSFA 4GW9A 2O0YA 5GHZA 3ZG9B 3WS2A 1DJCA 1XPBA 2L4RA 2ZL1A 1T19A 3IBJA 2INWA 1LHYA 5CGWA 3CUEC 3OCLA 4KZ7A 3SH8A 1ES5A 5AQAA 3HJIA 1N9LA 3BY9A 4N9LA 1SKOA 2CC1A 2OLVA 4FTXA 3TW8A 2L1MA 5KSHA 3WS0A 4CLCA 5BOHA 1S1ZA 2W3EA 2Y8HA 5HWVA 1YLWA 4KG2A 4IUHA 2LB5A 4JXWA 3F1NB 1RGYA 3LEQA 3TG9A 3LIDA 3G35A 2IA2A 3G34A 4GS9B 3VP1A 4WZ5C 2Y2IA 3C30A 4K08A 3BFEA 4MMNA 4NXFA 3SZTA 4YFMA 3T4JA 4LRYC 4NEED 1NYMA 1L0FA 5DVAA 4KQRA 2HF6A 1PZPA 5MC7A 2JHEA 4MDZA 1EWZA 3ZVWA 3FZCA 3GQZA 3EEAA 3KX0X 1IYSA 3IH8A 5HD5A 2OWJA 4OOMA 4HI4A 5EVEA 3Q07A 2Y2QA 2ZOIA 5HWWA 2FZ0A 3IH9A 4QY5A 3ISGA 2ZC4B 2O9CA 5CHJA 3A3DA 2PAVP 4U3TA 3M2JA 1MC0A 3P01A 3UE0A 3ICYA 2PR6A 3LI8A 4EUZA 1KDWA 1BLPA 3MKEA 1VM1A 1V9YA 3T12B 3OPHA 3OPRA 1VEUB 5EV0A 4P0MA 1YQSA 2W1TA 4QD4A 3GR2A 3TE8A 4N1HA 2Y2OA 3K3DA 3FV7A 1XA7A 4F3LA 3IQAA 1FCMA 3MFDA 5IS1A 2W3DA 5IU1A 2Y59A 1J3WA 3HLDA 3IWOA 1W63M 3HLBA 3MMHA 5KMWA 5E43A 1H3QA 1ESIA 2QZ6A 4IEDA 3F1OB 4EEUA 4HP4A 5EUAA 3T4TA 2Y2MA 3GECA 1D1JA 2ZM8A 1GHPA 5TBMA 3S22A 3DTEA 3BY8A 1BUEA 2JC7A 2WKHA 4LCLA 2B18A 5L2FA 3LR3A 4E3KA 4NETA 2XSSA
chains in the Genus database with same CATH topology
1V9ZA 3UB9A 2J80A 1XJ4A 2NUTC 2V1AA 1TS7A 4PKYG 3S7NA 2OWHA 4HH2A 2L0WA 2QJ7A 4MCWA 3OOVA 2PT7A 3KSFA 3H7WA 3UB6A 3V67A 4Y2FA 3NHQA 2HV1A 1NLZA 1NWZA 2PYRA 3A0RA 3IS2B 3T4KA 4OOLA 4GS9A 2QYBA 3B42A 5DKLA 2GZAA 1LSVA 3BWLA 3RFBA 4EERA 3JVUA 2OAQ1 2XA7M 3S7QA 4HQAA 1P9WA 5KIZA 1XJ2A 1T1AA 3UMDA 5HDDA 1H8MA 4WF0A 3PBSA 4BWIA 1S66L 2B02A 3KSIA 2VV7A 2W1RA 5HZHA 1OT6A 4KUKA 1XFQA 1VB6A 4YNRA 4AFIA 3EGXC 2VGLS 3O5YA 3VE4A 1F98A 4BBTA 4I39A 3E98A 1W63Q 2ZMVA 2K2NA 3MF0A 2O99A 3G6OA 3VOLA 3PYPA 3A0VA 1MZUA 3EQUA 4UEYA 5DJTA 5F68A 4G3KA 4DJ3A 1T18A 4WUJA 5IT5A 4EETB 2J3TC 2YKFA 2R78A 2V9AA 2ZOHA 5F5YA 4R70A 2VEAA 5DKKA 2P08A 3RTYA 2VV8A 2VV6A 3FC7A 4LLOB 4YOFA 3LIAA 4M4XA 3IBRA 3D3OA 4LRZE 3C38A 5AVFA 4HIAA 4ZRRA 1YKDA 4NXGA 3LFVA 3E4PA 1OTIA 1STZA 4MN6A 1TS6A 3T4OA 4EEPA 3PR6A 3A0SA 4II7A 1YSPA 4EUVA 4XT2B 4GJ4A 4Q0IA 3T50A 3VE3A 4HP9A 3BJNA 1TF1A 2K7SA 3T4QA 3ULFA 3EEHA 4L0LA 1GSXA 3HJKA 4ETZA 1ZHHB 4EW7A 3EGDC 3LIBA 2Z6DA 5FL3A 2H28A 4CLCE 2VZWA 5AVEA 2EWVA 4HHDA 1GSWA 2XA7S 2VGLM 4I3AA 3EQVA 3F1OA 5DJUA 3R7WB 2W3HA 3KO6A 2WKRA 5G4ZA 4B9OA 5DF9A 4BMWA 4P6ZM 4O8GA 1G28A 4H6JA 2PHYA 4UQIM 2K31A 2KLIA 4ARZA 1S1YA 2WKQA 1Y28A 2EWWA 1JNUA 1ODVA 4Y3IA 1F5MA 1D06A 5TJJA 4BJPA 1TS8A 2GX5A 2QJ5A 3K2NA 5EFWA 3PHYA 3UE3A 4JGRA 4BBUA 2VLGA 4WL9A 2OOLA 4EQ1A 3PXPA 1KOUA 3RH8B 3F1NA 5HDCA 2W3GA 5J3WA 2WKPA 2NUPC 4FOFA 4CLCB 4EESA 3T4SA 4G3VA 3IS2A 2W27A 3B33A 2Z6CA 4LPZA 3NOPC 3KYZA 5F6AA 4L9GA 4RQ9A 3PBQA 4Q0JA 1EW0A 4B93A 1G6OA 3LR0A 3LR4A 5L8MA 4G3WA 1F9IA 3H7WB 2Y79A 4R6LA 1OJ5A 4Y5FA 3K3CA 2HGVA 5HPFA 1N9OA 4HNBA 1UWPX 3LR5A 4IUKA 2J3WA 1S4SA 2QHKA 1IFQA 2D02A 4O01A 3F1PB 4GCZA 3PBTA 2O9AA 4PAUA 1XFNA 5DFYA 5G4YA 4I38A 3LIEA 2A24B 3U2AA 1YAXA 3C8CA 2JN7A 3C2WA 3B47A 3SW1A 3BW6A 4P6ZS 4EXOA 4CQHA 4UQIS 1T1CA 2PDRA 2V1BA 3OC2A 2KOIA 1X0OA 3UE6A 2W3FA 3MQOA 3D72A 4PHTA 4HH3A 1OTBA 2A2LA 4PKYA 1T1BA 2O9BA 5HDSA 1DP6A 3EOIA 2M1CA 1P0ZA 3KYQA 4R3AA 4MN5A 2PR5A 3HCYA 4IJGA 5HWTA 3FPVA 4ME4A 1P9RA 1OJGA 3LICA 1YSQA 1OPXA 4XT2A 3CWFA 2KDKA 2FH5A 5A8BA 2PD7A 4NKPA 4NXEA 2VX8A 3S7PA 4WELA 4CLCC 1LSXA 2YKHA 1BYWA 4I5SA 2MJ6A 3T4LA 5HL6A 2D01A 2PYPA 2W1TB 1GSVA 3PBNA 4FSFA 4GW9A 4GHIA 3R7WA 4ETXA 2O0YA 4F3LB 4BBVA 2EA9A 1UWNX 3W2ZA 4HY8A 4IHQA 4E04A 2P7JA 2QKPA 2L4RA 1DP8A 1T19A 3IBJA 2INWA 3CUEC 3OCLA 1OTDA 5K5BA 2JKTM 1TS0A 3LYXA 3H82B 3HJIA 1N9LA 3BY9A 3BQ8A 5DFXA 4WEJA 1LL8A 3DBAA 3S7OA 1MKMA 5TBMB 4HOIA 3UB8A 3MQQA 2V0WA 1OT9A 5LBRA 3TW8A 4L9FA 2L1MA 2M7UA 3GDIA 5AJGA 5KSHA 3TRCA 4CLCA 3MJQA 4EU0A 1S1ZA 1D7EA 2W3EA 2Y8HA 5HWVA 1ZTUA 5F69A 4JGQA 2ZBBA 1OTAA 3NOTC 2HJEA 3NJAA 4IUHA 2LB5A 3F1NB 1VHMA 3E4OA 5HD3A 1TD5A 4WN5A 3LIDA 4LRXC 3P7NA 3CUEA 1DP9A 2IA2A 5I5LA 4GS9B 2CMNA 1DRMA 4KQOA 3R4KA 3C30A 4K08A 3VV4A 3BQAA 4Z1WA 2JKRI 4MMNA 4NXFA 2KX6A 3T4JA 3F1PA 4LRYC 4DMZA 4NEED 2XRNA 1UGUA 3KSHA 2HF6A 3LI9A 2A24A 5C5KA 5MC7A 2JHEA 4MDZA 3PBRA 3PBOA 3MXQA 2VKSA 3EEAA 3KX0X 4I3JA 5HPIA 5HSQA 2I9VA 5HD5A 2OWJA 1OTEA 2G7UA 4JGPA 1WA9A 4HI4A 4JGOA 4OOMA 2J3TD 3JVVA 2P04A 1XJ6A 1LSWA 2JKTI 2ZOIA 5HWWA 4I3IA 1S4RA 2FZ0A 3LIFA 2DMWA 4NXBA 4R38A 3ZQ5A 3OBFA 3UB7A 1P97A 2M7VA 2O9CA 3MFXA 2LB9A 3CI6A 2BASA 1MC0A 1N9NA 3MQ0A 4WEKA 3P01A 4O0PA 2JKRM 3ICYA 3MR0A 2PR6A 3LI8A 3LUQA 2W0NA 4HJ6A 1V9YA 4L9EA 3UMEA 1S67L 4CLCD 3OCNA 4DN0A 4GLQA 1NLYA 2W1TA 4HJ4A 2ZMFA 3TE8A 3K3DA 1NRJA 4Q0HA 3TJZC 4F3LA 2PD8A 2V0UA 2GNXA 4QPRA 4KUOA 5IS1A 2W3DA 5IU1A 5CX7A 1W63M 4DJ2A 3MMHA 3ZYTA 2HJ9C 3FG8A 2GJ3A 1H3QA 3CITA 3CAXA 3F1OB 4EEUA 4GHIB 2VJWA 4HP4A 3T4TA 3H82A 3GECA 3KSGA 4MN7A 3FPWA 2XROA 5J4EA 1LT0A 4KQDA 3E4QA 5TBMA 3H9WA 4H6JB 5J7EA 2QWSA 4WLAA 3BY8A 3NOUC 1IOUA 1XJ3A 4ARZB 4YWZA 2VA0A 2B18A 3E0YA 3CLOA 3LR3A 3EWKA 2OAP1 3OLOA 4HJ3A 2XSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKR M;  2VGL S;  2JKR I;  2JKT M;  2JKT I;  1W63 Q;  2XA7 S;  4NEE D;  2VGL M;  2XA7 M;  2HF6 A;  5MC7 A;  1NRJ A;  4P6Z S;  3TJZ C;  4UQI S;  4P6Z M;  2FH5 A;  4UQI M;  1W63 M; 
#chains in the Genus database with same CATH topology
 3IT9 A;  3QP6 A;  4GD6 A;  1V9Z A;  2V1A A;  4X53 A;  3IWI A;  2V2F F;  1GHM A;  1K56 D;  2G2U A;  1FSY A;  2QJ7 A;  3KSF A;  3IX8 A;  3NC8 A;  3V67 A;  2HV1 A;  1NWZ A;  5FQQ A;  3NEC A;  3HUO A;  3QP4 A;  1ERM A;  4XUZ A;  4ZDX A;  4BL3 A;  5DKL A;  1K6S A;  3BWL A;  3RFB A;  2ACG A;  4EER A;  2PU2 A;  1DY6 A;  3CZD A;  2VK3 A;  1F2K A;  3M6B A;  1P9W A;  4RYE A;  5KIZ A;  3UO9 A;  3HRE A;  5HDD A;  3PBS A;  4Y0U A;  4BWI A;  5EOE A;  1S66 L;  3ZNY A;  2B02 A;  5L07 A;  1BLC A;  4UA9 A;  4GKU A;  2VV7 A;  4Y0O A;  1OT6 A;  3O88 A;  3W8K A;  4X68 A;  1CEF A;  4Q8I A;  1VB6 A;  4YNR A;  4AFI A;  2FFF B;  4OQ0 A;  1F98 A;  3VSK A;  4I39 A;  3MF0 A;  1Y54 A;  1LI9 A;  5F1G A;  3PYP A;  4R3J A;  4UEY A;  3V39 A;  4R4S A;  1T18 A;  4IVK A;  3IF5 A;  4EET B;  2J3T C;  2YKF A;  5GLD A;  2DRW A;  4R70 A;  2VEA A;  5DKK A;  2VV8 A;  4QJG A;  2VV6 A;  3FC7 A;  4LLO B;  3HVF A;  3ZVT A;  5AVF A;  4E3M A;  5FI7 A;  1DJB A;  4ZRR A;  1YKD A;  1LL9 A;  1RCJ A;  4GOG A;  4II7 A;  1YSP A;  3GTC A;  3T1S A;  4GJ4 A;  3VE3 A;  4HP9 A;  3BJN A;  1TF1 A;  3T4Q A;  3ULF A;  3EEH A;  3FWL A;  4L0L A;  4U0T A;  4ETZ A;  1ZHH B;  4OVD A;  3M6H A;  5FL3 A;  4EBL A;  1PZO A;  2XA7 S;  2JCH A;  2VGL M;  4I3A A;  3WWX A;  3C5A A;  3UPP A;  5DJU A;  3R7W B;  5DTK A;  3Q1F A;  2W3H A;  2FFY A;  4WBG A;  1Q2Q A;  5CTM A;  3QP5 A;  4C6Y A;  1G28 A;  4ARZ A;  2WKQ A;  2EWW A;  5CTN A;  2HP6 A;  2VGJ A;  3IXH A;  4JKT A;  1XX2 A;  3VFF A;  3OPL A;  5GLB A;  1MWU A;  2QJ5 A;  1SZV A;  2C6W B;  3JYI A;  4EBP A;  2OOL A;  4B4X A;  2W3G A;  5J3W A;  3V5M A;  2Y91 A;  3IS2 A;  5TR7 A;  4LEN A;  4LPZ A;  3WS5 A;  1C3B A;  2Y2P A;  4RQ9 A;  4KZ8 A;  1H8Y A;  5CXW A;  1EW0 A;  3LR4 A;  5L8M A;  4G3W A;  1W5D A;  5CEB A;  4P6B A;  2JKF A;  4N1X A;  1VET B;  5HPF A;  4HNB A;  4OQH A;  5M18 A;  3LR5 A;  2E8J A;  2QHK A;  4EV4 A;  4O01 A;  3F1P B;  4GCZ A;  2O9A A;  1XFN A;  2R9X A;  4DE3 A;  3LIE A;  3VOZ A;  2A24 B;  2J7V A;  3DWZ A;  3U2A A;  4DKI A;  1YAX A;  4B88 A;  3SW1 A;  3IF6 B;  3BW6 A;  4EXO A;  4A5R A;  4UQI S;  1T1C A;  2V1B A;  1S0W A;  4RVA A;  3LEZ A;  4JF6 A;  2W3F A;  1YMS A;  1OTB A;  2A2L A;  3EOI A;  2M1C A;  1L0D A;  3LGO A;  2AVX A;  3BYD A;  3FPV A;  4S2N C;  1P9R A;  4KG5 A;  4Y7P A;  1YSQ A;  4H8R A;  1OPX A;  1K4E A;  2KDK A;  4XUX A;  1CJF A;  1HVB A;  3CPT B;  5CED A;  2WGW A;  1LSX A;  5FAS A;  2YKH A;  3FKV A;  1ONH A;  3PBN A;  1OME A;  5A90 A;  4GHI A;  4WMC A;  1MXO A;  2ZD8 A;  4JF5 A;  5L09 A;  4BBV A;  2EA9 A;  3Q82 A;  4IHQ A;  1EI5 A;  4E04 A;  2P7J A;  1I5Q A;  2Y4A A;  4YIN A;  4EQI A;  2IWD A;  1ZC2 A;  3LYX A;  3D9Y A;  3H82 B;  3S4X A;  5EM0 A;  3BQ8 A;  1L0E A;  3S7O A;  3MXR A;  2V0W A;  1OT9 A;  5LBR A;  3VP3 A;  4R1G A;  5FA7 A;  1MBL A;  2XDM A;  1PW8 A;  3IF6 C;  5CRF A;  4EU0 A;  1MY8 A;  1ERO A;  1K0K A;  4LCM A;  5EVI D;  4JGQ A;  4E3I A;  1OTA A;  4KZ5 A;  1H0M A;  5F82 A;  2Y2H A;  2J9O A;  1YT4 A;  1TDL A;  5HD3 A;  4WN5 A;  4LRX C;  3P7N A;  3QP1 A;  5I5L A;  4R23 A;  2CMN A;  3BQA A;  3UB5 P;  2JKR I;  2KX6 A;  3L7H A;  4KZ4 A;  2XRN A;  5C5K A;  4S2L A;  3ZDJ A;  2VKS A;  2Y2J A;  4K0W A;  4I3J A;  5HPI A;  1OTE A;  1VQQ A;  1WA9 A;  2J3T D;  2Y2L A;  1A0K A;  5E2F A;  3JVV A;  1Z09 A;  4U0X A;  2JKT I;  3M2K A;  4I3I A;  3HLF A;  3RXX A;  1S4R A;  3SS5 A;  2DMW A;  4RA7 A;  4R38 A;  4R3B A;  4OLG A;  3OBF A;  4O7D A;  1P97 A;  4FUW A;  2Y55 A;  3W4O A;  3MXS A;  1DJA A;  3DW0 A;  2WK0 A;  5FI6 A;  4O0P A;  4ZBE A;  2UWX A;  3JPU A;  3U4L P;  4HJ6 A;  2Y2G A;  2H0Y A;  3VMA A;  3NIA A;  3UME A;  4CLC D;  3OCN A;  4DN0 A;  2EX2 A;  1NLY A;  5CGX A;  2ZMF A;  1FOF A;  1K25 A;  1NRJ A;  4Q0H A;  3TJZ C;  3PTE A;  2PD8 A;  2V0U A;  4LV3 A;  4QPR A;  1M40 A;  5TFQ A;  4PM8 A;  4DJ2 A;  4GZB A;  3VFH A;  2ZQD A;  3CAX A;  5DF7 A;  4GHI B;  1CEG A;  5D3O A;  4RX3 A;  4QU3 A;  2XRO A;  4H6J B;  3N8L A;  4WLA A;  5DTT A;  3NOU C;  1CI9 A;  1XJ3 A;  4YWZ A;  1XA1 A;  3E0Y A;  3CLO A;  3EWK A;  5F83 A;  2J80 A;  1ZG6 A;  2HPB A;  2NUT C;  1FIK A;  1TS7 A;  3DTM A;  2OWH A;  5J8X A;  2L0W A;  4MCW A;  3OOV A;  1GA0 A;  2PT7 A;  2P9V A;  1NLZ A;  2WAE A;  4QHC A;  4DE0 A;  2H10 A;  3D4F A;  2WKI A;  4UA7 A;  4HES A;  3BFG A;  3N6I A;  3S7Q A;  2XA7 M;  1K55 A;  4HQA A;  1XJ2 A;  4JPM A;  1T1A A;  5HW3 A;  3MSH A;  4QB8 A;  1H8M A;  4WF0 A;  1M6K A;  5E2G A;  1K57 C;  4BQM A;  3KSI A;  2W1R A;  5HZH A;  4Z9Q A;  1XFQ A;  1MPL A;  3EGX C;  2Y2N A;  3VE4 A;  3NY4 A;  3V3R A;  1BUL A;  1W63 Q;  1JWV A;  3HLC A;  5FSR A;  3G6O A;  3UPO A;  3A0V A;  3EQU A;  5DJT A;  3NUL A;  1RP5 A;  5FDS A;  1BLH A;  5EVI B;  4WUJ A;  3ZG0 A;  2R78 A;  3ZCZ A;  3ZG5 A;  5F5Y A;  3RTY A;  2DNS A;  1JWZ A;  1K54 C;  4M4X A;  3D3O A;  4NXG A;  2ZC5 B;  4PM9 A;  1STZ A;  3A0S A;  4S2P A;  4XT2 B;  1W8Q A;  3UY6 A;  1ES2 A;  1YLZ A;  2R9W A;  2Z2M B;  1GSX A;  3HJK A;  4EW7 A;  3EGD C;  1WYB A;  2EXA A;  2VZW A;  1ALQ A;  5AVE A;  2HDR A;  3IHB A;  5EE8 A;  1QMF A;  2WKR A;  3N8R A;  5G4Z A;  4B9O A;  3QP8 A;  4KZ3 A;  4FH2 A;  4UQI M;  2K31 A;  2ZL1 B;  3SS4 A;  1JNU A;  5CEC A;  4Y3I A;  1D06 A;  3VP0 A;  1YLJ A;  3WRZ A;  1SKO B;  2XLN A;  5HAR A;  4EQ1 A;  2ZJ9 A;  3HBR A;  3RH8 B;  5HDC A;  3RJU A;  3FYZ A;  4CLC B;  3MZF A;  4EES A;  4G3V A;  1LI0 A;  2W27 A;  3B33 A;  2Z6C A;  5EVI C;  4QWO A;  3DWK A;  4UHU A;  2Z2L B;  3QHY A;  2HP9 A;  4JXV A;  4Y15 A;  4Q0J A;  5DF8 A;  3S1Y A;  4B93 A;  1G6O A;  3LR0 A;  4OON A;  1PWC A;  2Y79 A;  1OJ5 A;  1TVF A;  3MBZ A;  2JKG A;  4Y17 A;  1UWP X;  1ZKJ A;  4LV1 A;  2Y2K A;  5M19 A;  1W8Y A;  3PBT A;  5A93 A;  3C8C A;  1PWD A;  3C2W A;  2X71 A;  3W4P A;  4CQH A;  1SKF A;  2XEP A;  2XD1 A;  1K56 A;  4K0X A;  4LV2 A;  3MQO A;  4PHT A;  4HH3 A;  1PYY A;  2V8F A;  2WKE A;  5HDS A;  1DP6 A;  4DDY A;  4PM5 A;  1P0Z A;  3KYQ A;  4MN5 A;  2EX9 A;  2PR5 A;  4OQI A;  2V8C A;  4ME4 A;  3LIC A;  2XK1 A;  2ZLY A;  2FH5 A;  5GLC A;  1GCE A;  5A8B A;  4NXE A;  3T1R A;  4CLC C;  2EFX A;  4N92 A;  5A91 A;  3GSG A;  4HEF A;  2PYP A;  2W1T B;  1GSV A;  2XFT A;  2EXB A;  3G4P A;  3V50 A;  4ETX A;  3WS4 A;  3UE1 A;  3E2K A;  4F3L B;  3LO7 A;  3T1Q B;  2QKP A;  4FH4 A;  5HX9 A;  4S2O A;  5K5B A;  2JKT M;  4WYY A;  5FQM A;  5DFX A;  3DBA A;  3CMZ A;  2VGK A;  5TBM B;  4HOI A;  3UB8 A;  2IWC A;  5AJG A;  3QP2 A;  3TRC A;  2XD5 A;  1D7E A;  3PAE A;  3VOY A;  1ZTU A;  1RGZ A;  2ZBB A;  3NOT C;  2HJE A;  3NJA A;  1W79 A;  3G30 A;  1VHM A;  2C5W B;  2WYX A;  3LY4 A;  4X1L A;  4MLL A;  3SH9 A;  3KYE A;  5HL1 A;  4QY6 A;  4S2I A;  3CUE A;  4S2M A;  1DRM A;  2JBF A;  3R4K A;  2UV0 E;  4Z1W A;  3SOI A;  4DMZ A;  5FEG A;  3LI9 A;  3GV9 A;  3MS6 A;  1KDS A;  3MXQ A;  5HSQ A;  2I9V A;  4D60 A;  3VSL A;  4GNU A;  4RX2 A;  2G7U A;  4JGP A;  4JGO A;  2WZZ A;  4X25 A;  2P04 A;  1XJ6 A;  1LSW A;  1YLT A;  3BLS A;  1PI5 A;  3LIF A;  1FCN A;  4HBT A;  5AQ9 A;  3DAV A;  1ZG4 A;  3ZQ5 A;  2XFS A;  5FQI A;  5GL9 A;  2M7V A;  4WZ5 A;  2IWB A;  3UPN A;  1NXY A;  3MFX A;  1YLY A;  5I94 A;  2LB9 A;  2BAS A;  4R4R A;  1L3L A;  4WEK A;  1N9N A;  3O87 A;  2B95 A;  3MR0 A;  2J8Y A;  3LUQ A;  4Y13 A;  2W0N A;  1IYP A;  1XKZ A;  1KE3 A;  4GLQ A;  4HJ4 A;  3HUN A;  1ES3 A;  4MEZ A;  4KUO A;  3C7U A;  5CX7 A;  5AQ7 A;  4OKP A;  2ZQ7 A;  3BEC A;  3FG8 A;  1PNE A;  1JVJ A;  2ZC3 B;  3CIT A;  1U60 A;  3A3J A;  5E2H A;  2VJW A;  3VP2 A;  4R0Q A;  3KSG A;  4MN7 A;  1E3U A;  1MWT A;  3BEB A;  4KQD A;  3E4Q A;  1IOU A;  2QWS A;  2Q9N A;  4ARZ B;  1K54 A;  3DTK A;  3OLO A;  4HJ3 A;  1O7E A;  1XGI A;  1G5U A;  1PW1 A;  1XJ4 A;  5HFO A;  3S7N A;  4OQG A;  4N9K A;  1PI4 A;  1H8Z A;  4ZJ1 A;  3UB6 A;  1Q2P A;  2WAF A;  2WUQ A;  3IS2 B;  3B3X A;  2H0T A;  1BZA A;  2OSU A;  4GS9 A;  1G68 A;  2JE5 A;  2ZQA A;  4K91 A;  4JXG A;  5EEC A;  1NY0 A;  2G2W A;  2PBD P;  1GA9 A;  5EOO A;  1KGF A;  4E3J A;  3IX4 A;  2X01 A;  3G2Y A;  1L2S A;  4UA6 A;  1QME A;  2ZMA A;  4XXR A;  1YM1 A;  3HLE A;  2VGL S;  3O5Y A;  4BBT A;  4OP8 A;  3A3F A;  2O99 A;  3VOL A;  1IKG A;  1MZU A;  5EM1 A;  5F68 A;  3HUM A;  4G3K A;  3Q81 A;  5IT5 A;  2V9A A;  1K4F A;  3LIA A;  4ID4 A;  3C38 A;  5KZH A;  4PPR A;  1CQA A;  1HLU P;  3E4P A;  1OTI A;  3IHA A;  4MN6 A;  1TS6 A;  4EEP A;  1MWR A;  1J9M A;  5FQ9 A;  4KEN B;  1NZO A;  3G2Z A;  3OZH A;  1KVM A;  2H28 A;  2WGW B;  4EWF A;  3LY3 A;  1KE0 A;  2ZM2 A;  4ZJ3 A;  2ZQ8 A;  5FAT A;  4PM6 A;  3GRJ A;  4X55 A;  3F1O A;  4LV0 A;  3SH7 A;  4CPK A;  1GHI A;  5DF9 A;  2ZC6 B;  2HP5 A;  2PHY A;  2KLI A;  1S1Y A;  1W7F A;  5GLA A;  1CK3 A;  1NYY A;  1ODV A;  5TJJ A;  4IBX A;  2GX5 A;  5EFW A;  3PHY A;  4ZJ2 A;  4JGR A;  3UE3 A;  2VLG A;  4BBU A;  1SDN A;  3IWQ A;  4WL9 A;  1TEM A;  4MBH A;  2WGV A;  1BTL A;  4NG2 A;  4DE1 A;  3KYZ A;  1CF0 A;  5F6A A;  4L9G A;  2A49 A;  3O86 A;  4JF4 A;  4Y5F A;  3T1X A;  3I7J A;  3K3C A;  1H5X A;  3CJM A;  2A3U A;  4IUK A;  2J3W A;  5CGS A;  4F94 A;  1FSW A;  2H5S A;  4BL2 A;  1NJ4 A;  2P74 A;  3IX3 A;  4M3K A;  2RL3 A;  2BG1 A;  4PAU A;  5DFY A;  5G4Y A;  1IYQ A;  4WM9 A;  2BTF P;  2EX8 A;  3IXD A;  1KE4 A;  2JN7 A;  1ONG A;  1ESU A;  3B47 A;  4P6Z S;  3N8S A;  1X0O A;  4P85 A;  5TGF A;  4OPR A;  3N4I A;  2HZ5 A;  4PKY A;  1CI8 A;  2O9B A;  3BRM A;  3CG5 A;  1FR1 A;  4R3A A;  3HCY A;  1BSG A;  1OJG A;  5F1F A;  1AXB A;  4C75 A;  4NKP A;  4ZTK A;  2XR0 A;  5L10 A;  2XH9 A;  5FAP A;  4MNR A;  1ES4 A;  3T4L A;  5DTS A;  3R7W A;  4GDB A;  2XGN A;  4OLD A;  1L0G A;  4PMA A;  3C7V A;  1K6R A;  1UWN X;  3W2Z A;  4UAA A;  4HY8 A;  3NDG A;  5KSC A;  1HD8 A;  1DP8 A;  2HDU A;  1YPR A;  1OTD A;  4DE2 A;  1IEM A;  1TS0 A;  2Q9M A;  4E6X A;  1WYC A;  4E6W A;  2ZQ9 A;  4FCF A;  3WRT A;  4S2N A;  4WEJ A;  1LL8 A;  1FCO A;  3BFC A;  1MKM A;  3W4Q A;  1BLS A;  1ACF A;  1BT5 A;  3MQQ A;  4OP5 A;  4L9F A;  2XQZ A;  2M7U A;  3NCK A;  3GDI A;  4B4Z A;  3MJQ A;  1I2W A;  5CER A;  3MZD A;  5F69 A;  2I72 A;  4BD0 A;  3L9K A;  1PIO A;  4GDN A;  5JYP A;  2P9V B;  3P98 A;  5EVL A;  3AGF A;  3E4O A;  4BEN A;  1TD5 A;  1I2S A;  4CJN A;  1VET A;  4X69 A;  1DP9 A;  3ITA A;  4KQO A;  3BLM A;  3VV4 A;  4E3L A;  4KZB A;  3F1P A;  2EX6 A;  1AWI A;  1UGU A;  3KSH A;  2A24 A;  3LCE A;  4D2O A;  3PBR A;  3IF6 A;  3PBO A;  4NK3 A;  3HLG A;  1E25 A;  3V3S A;  3FKW A;  5FQJ A;  1JTG A;  2QMI A;  3Q7V A;  5HAI A;  4OPY A;  3UDX A;  4NXB A;  3ZFZ A;  1IEL A;  1XGJ A;  5G18 A;  3DTI A;  3UB7 A;  4LFU A;  3UDI A;  3CI6 A;  3CPT A;  4BD1 A;  3MQ0 A;  2JKR M;  2V20 A;  4P87 A;  4S2J A;  1G6A A;  1TDG A;  4DXC A;  2HDQ A;  2BLS A;  4KZ6 A;  4L9E A;  1S67 L;  3BFF A;  2QPN A;  1HTZ A;  1XP4 A;  3G31 A;  3MZE A;  2GNX A;  3ITB A;  4X56 A;  3ZNT A;  3BM6 A;  1O07 A;  1PRQ A;  1N9B A;  1XXM A;  3ZYT A;  4FD8 A;  1NRF A;  2HJ9 C;  1JWP A;  2GJ3 A;  1KVL A;  3N7W A;  3IXG A;  3H82 A;  4KZA A;  3UDF A;  3FPW A;  3QNC A;  5J4E A;  1K55 C;  1LT0 A;  5IHV A;  3H9W A;  5J7E A;  2VA0 A;  3HL9 A;  3UN7 A;  2XF3 A;  5EPH A;  5HAQ A;  2OAP 1;  2PU4 A;  3NDE A;  3UB9 A;  2J9P A;  5GHY A;  1IYO A;  2WZX A;  2OV5 A;  4PKY G;  3GVB A;  5FQK A;  4HH2 A;  3C4P A;  4Y0T A;  3H7W A;  5CHM A;  4OPZ A;  3TSG A;  4Y2F A;  3NHQ A;  4KG6 A;  2PYR A;  3A0R A;  4EBN A;  3T4K A;  4OOL A;  1MKI A;  2QYB A;  3B42 A;  2GZA A;  1LSV A;  4ESP A;  5FDH A;  3QNB A;  1JTD A;  3JVU A;  5GHX A;  2OAQ 1;  1SHV A;  4MBK A;  3UMD A;  3BFD A;  1FQG A;  5AQB A;  4KZ9 A;  1Y4O A;  4X1M A;  1FIL A;  1PFL A;  5CHU A;  3A3E A;  4KUK A;  4X6T A;  3OPP A;  5FAO A;  4WMC D;  2V1Z A;  3E98 A;  2ZMV A;  2K2N A;  2PBY A;  1Z6F A;  3TOI A;  3IXB A;  4GN2 A;  4DJ3 A;  2ZOH A;  1IKI A;  1E3U D;  2P08 A;  3UNW A;  3Q7V B;  3NI9 A;  3P09 A;  4YOF A;  4WZ4 A;  4IVI A;  3IBR A;  4LRZ E;  4ZAM A;  4HIA A;  3A3I A;  5FEF A;  1KGG A;  4S2K A;  1K57 A;  3LFV A;  3T4O A;  1E4D A;  3PR6 A;  2X02 A;  4C3Q A;  4EUV A;  4Q0I A;  3T50 A;  4JLF A;  3O3V A;  2K7S A;  4GD8 A;  3CHW P;  1LL5 A;  2Z6D A;  3LIB A;  4CLC E;  2EFU A;  2EWV A;  4HHD A;  1GSW A;  5M1A A;  2Q0O A;  3EQV A;  3KO6 A;  1FR6 A;  3ZHH A;  4BMW A;  1SCW A;  1PWG A;  4P6Z M;  3AGD A;  3MKF A;  4H6J A;  4O8G A;  4E3N A;  4OH0 A;  3E2L A;  1YMX A;  1Y28 A;  4OOY A;  1F5M A;  4MBF A;  4DRT A;  4BLM A;  4BJP A;  2ZQC A;  2GDN A;  1TS8 A;  2ZM0 A;  3K2N A;  1LLB A;  4GB7 A;  3PXP A;  3HLW A;  1KOU A;  1HZO A;  3AGE A;  2WGI A;  1KGE A;  3ZGA B;  3F1N A;  2OLU A;  2NUP C;  2WKP A;  5JYO A;  4FOF A;  3T4S A;  3ZG8 B;  3VP4 A;  2E8I A;  4KQQ A;  2ZC7 A;  3GMW A;  3NOP C;  4IBR A;  5E2E A;  3PBQ A;  4LGW A;  4DXB A;  4OPQ A;  1YLP A;  1F9I A;  3H7W B;  4R6L A;  2WAD A;  2HGV A;  1S6R A;  5FI2 A;  1N9O A;  5U47 A;  1ERQ A;  1S4S A;  1IFQ A;  1SDE A;  2D02 A;  2B5R A;  4PM7 A;  3PAG A;  4I38 A;  1N4O A;  1K38 A;  3SS3 A;  3Q7Z A;  1MWS A;  2PDR A;  3OC2 A;  5EVI A;  2KOI A;  3C4O A;  5FAQ A;  3UE6 A;  5HAP A;  3D72 A;  1T1B A;  4JBF A;  2RCX A;  4DDS A;  1VEU A;  4IJG A;  5HWT A;  2HDS A;  4XT2 A;  3CWF A;  3G32 A;  4HBU A;  4JXS A;  3RXW A;  4DF6 A;  2PRF A;  3ZG7 B;  2PD7 A;  3WS1 A;  1NZU A;  2VX8 A;  3S7P A;  3NBL A;  4WEL A;  2DCF A;  1BYW A;  4I5S A;  2MJ6 A;  1WE4 A;  5HL6 A;  2D01 A;  4E3O A;  5A92 A;  4FSF A;  4GW9 A;  2O0Y A;  5GHZ A;  3ZG9 B;  3WS2 A;  1DJC A;  1XPB A;  2L4R A;  2ZL1 A;  1T19 A;  3IBJ A;  2INW A;  1LHY A;  5CGW A;  3CUE C;  3OCL A;  4KZ7 A;  3SH8 A;  1ES5 A;  5AQA A;  3HJI A;  1N9L A;  3BY9 A;  4N9L A;  1SKO A;  2CC1 A;  2OLV A;  4FTX A;  3TW8 A;  2L1M A;  5KSH A;  3WS0 A;  4CLC A;  5BOH A;  1S1Z A;  2W3E A;  2Y8H A;  5HWV A;  1YLW A;  4KG2 A;  4IUH A;  2LB5 A;  4JXW A;  3F1N B;  1RGY A;  3LEQ A;  3TG9 A;  3LID A;  3G35 A;  2IA2 A;  3G34 A;  4GS9 B;  3VP1 A;  4WZ5 C;  2Y2I A;  3C30 A;  4K08 A;  3BFE A;  4MMN A;  4NXF A;  3SZT A;  4YFM A;  3T4J A;  4LRY C;  4NEE D;  1NYM A;  1L0F A;  5DVA A;  4KQR A;  2HF6 A;  1PZP A;  5MC7 A;  2JHE A;  4MDZ A;  1EWZ A;  3ZVW A;  3FZC A;  3GQZ A;  3EEA A;  3KX0 X;  1IYS A;  3IH8 A;  5HD5 A;  2OWJ A;  4OOM A;  4HI4 A;  5EVE A;  3Q07 A;  2Y2Q A;  2ZOI A;  5HWW A;  2FZ0 A;  3IH9 A;  4QY5 A;  3ISG A;  2ZC4 B;  2O9C A;  5CHJ A;  3A3D A;  2PAV P;  4U3T A;  3M2J A;  1MC0 A;  3P01 A;  3UE0 A;  3ICY A;  2PR6 A;  3LI8 A;  4EUZ A;  1KDW A;  1BLP A;  3MKE A;  1VM1 A;  1V9Y A;  3T12 B;  3OPH A;  3OPR A;  1VEU B;  5EV0 A;  4P0M A;  1YQS A;  2W1T A;  4QD4 A;  3GR2 A;  3TE8 A;  4N1H A;  2Y2O A;  3K3D A;  3FV7 A;  1XA7 A;  4F3L A;  3IQA A;  1FCM A;  3MFD A;  5IS1 A;  2W3D A;  5IU1 A;  2Y59 A;  1J3W A;  3HLD A;  3IWO A;  1W63 M;  3HLB A;  3MMH A;  5KMW A;  5E43 A;  1H3Q A;  1ESI A;  2QZ6 A;  4IED A;  3F1O B;  4EEU A;  4HP4 A;  5EUA A;  3T4T A;  2Y2M A;  3GEC A;  1D1J A;  2ZM8 A;  1GHP A;  5TBM A;  3S22 A;  3DTE A;  3BY8 A;  1BUE A;  2JC7 A;  2WKH A;  4LCL A;  2B18 A;  5L2F A;  3LR3 A;  4E3K A;  4NET A;  2XSS A; 
#chains in the Genus database with same CATH homology
 1V9Z A;  3UB9 A;  2J80 A;  1XJ4 A;  2NUT C;  2V1A A;  1TS7 A;  4PKY G;  3S7N A;  2OWH A;  4HH2 A;  2L0W A;  2QJ7 A;  4MCW A;  3OOV A;  2PT7 A;  3KSF A;  3H7W A;  3UB6 A;  3V67 A;  4Y2F A;  3NHQ A;  2HV1 A;  1NLZ A;  1NWZ A;  2PYR A;  3A0R A;  3IS2 B;  3T4K A;  4OOL A;  4GS9 A;  2QYB A;  3B42 A;  5DKL A;  2GZA A;  1LSV A;  3BWL A;  3RFB A;  4EER A;  3JVU A;  2OAQ 1;  2XA7 M;  3S7Q A;  4HQA A;  1P9W A;  5KIZ A;  1XJ2 A;  1T1A A;  3UMD A;  5HDD A;  1H8M A;  4WF0 A;  3PBS A;  4BWI A;  1S66 L;  2B02 A;  3KSI A;  2VV7 A;  2W1R A;  5HZH A;  1OT6 A;  4KUK A;  1XFQ A;  1VB6 A;  4YNR A;  4AFI A;  3EGX C;  2VGL S;  3O5Y A;  3VE4 A;  1F98 A;  4BBT A;  4I39 A;  3E98 A;  1W63 Q;  2ZMV A;  2K2N A;  3MF0 A;  2O99 A;  3G6O A;  3VOL A;  3PYP A;  3A0V A;  1MZU A;  3EQU A;  4UEY A;  5DJT A;  5F68 A;  4G3K A;  4DJ3 A;  1T18 A;  4WUJ A;  5IT5 A;  4EET B;  2J3T C;  2YKF A;  2R78 A;  2V9A A;  2ZOH A;  5F5Y A;  4R70 A;  2VEA A;  5DKK A;  2P08 A;  3RTY A;  2VV8 A;  2VV6 A;  3FC7 A;  4LLO B;  4YOF A;  3LIA A;  4M4X A;  3IBR A;  3D3O A;  4LRZ E;  3C38 A;  5AVF A;  4HIA A;  4ZRR A;  1YKD A;  4NXG A;  3LFV A;  3E4P A;  1OTI A;  1STZ A;  4MN6 A;  1TS6 A;  3T4O A;  4EEP A;  3PR6 A;  3A0S A;  4II7 A;  1YSP A;  4EUV A;  4XT2 B;  4GJ4 A;  4Q0I A;  3T50 A;  3VE3 A;  4HP9 A;  3BJN A;  1TF1 A;  2K7S A;  3T4Q A;  3ULF A;  3EEH A;  4L0L A;  1GSX A;  3HJK A;  4ETZ A;  1ZHH B;  4EW7 A;  3EGD C;  3LIB A;  2Z6D A;  5FL3 A;  2H28 A;  4CLC E;  2VZW A;  5AVE A;  2EWV A;  4HHD A;  1GSW A;  2XA7 S;  2VGL M;  4I3A A;  3EQV A;  3F1O A;  5DJU A;  3R7W B;  2W3H A;  3KO6 A;  2WKR A;  5G4Z A;  4B9O A;  5DF9 A;  4BMW A;  4P6Z M;  4O8G A;  1G28 A;  4H6J A;  2PHY A;  4UQI M;  2K31 A;  2KLI A;  4ARZ A;  1S1Y A;  2WKQ A;  1Y28 A;  2EWW A;  1JNU A;  1ODV A;  4Y3I A;  1F5M A;  1D06 A;  5TJJ A;  4BJP A;  1TS8 A;  2GX5 A;  2QJ5 A;  3K2N A;  5EFW A;  3PHY A;  3UE3 A;  4JGR A;  4BBU A;  2VLG A;  4WL9 A;  2OOL A;  4EQ1 A;  3PXP A;  1KOU A;  3RH8 B;  3F1N A;  5HDC A;  2W3G A;  5J3W A;  2WKP A;  2NUP C;  4FOF A;  4CLC B;  4EES A;  3T4S A;  4G3V A;  3IS2 A;  2W27 A;  3B33 A;  2Z6C A;  4LPZ A;  3NOP C;  3KYZ A;  5F6A A;  4L9G A;  4RQ9 A;  3PBQ A;  4Q0J A;  1EW0 A;  4B93 A;  1G6O A;  3LR0 A;  3LR4 A;  5L8M A;  4G3W A;  1F9I A;  3H7W B;  2Y79 A;  4R6L A;  1OJ5 A;  4Y5F A;  3K3C A;  2HGV A;  5HPF A;  1N9O A;  4HNB A;  1UWP X;  3LR5 A;  4IUK A;  2J3W A;  1S4S A;  2QHK A;  1IFQ A;  2D02 A;  4O01 A;  3F1P B;  4GCZ A;  3PBT A;  2O9A A;  4PAU A;  1XFN A;  5DFY A;  5G4Y A;  4I38 A;  3LIE A;  2A24 B;  3U2A A;  1YAX A;  3C8C A;  2JN7 A;  3C2W A;  3B47 A;  3SW1 A;  3BW6 A;  4P6Z S;  4EXO A;  4CQH A;  4UQI S;  1T1C A;  2PDR A;  2V1B A;  3OC2 A;  2KOI A;  1X0O A;  3UE6 A;  2W3F A;  3MQO A;  3D72 A;  4PHT A;  4HH3 A;  1OTB A;  2A2L A;  4PKY A;  1T1B A;  2O9B A;  5HDS A;  1DP6 A;  3EOI A;  2M1C A;  1P0Z A;  3KYQ A;  4R3A A;  4MN5 A;  2PR5 A;  3HCY A;  4IJG A;  5HWT A;  3FPV A;  4ME4 A;  1P9R A;  1OJG A;  3LIC A;  1YSQ A;  1OPX A;  4XT2 A;  3CWF A;  2KDK A;  2FH5 A;  5A8B A;  2PD7 A;  4NKP A;  4NXE A;  2VX8 A;  3S7P A;  4WEL A;  4CLC C;  1LSX A;  2YKH A;  1BYW A;  4I5S A;  2MJ6 A;  3T4L A;  5HL6 A;  2D01 A;  2PYP A;  2W1T B;  1GSV A;  3PBN A;  4FSF A;  4GW9 A;  4GHI A;  3R7W A;  4ETX A;  2O0Y A;  4F3L B;  4BBV A;  2EA9 A;  1UWN X;  3W2Z A;  4HY8 A;  4IHQ A;  4E04 A;  2P7J A;  2QKP A;  2L4R A;  1DP8 A;  1T19 A;  3IBJ A;  2INW A;  3CUE C;  3OCL A;  1OTD A;  5K5B A;  2JKT M;  1TS0 A;  3LYX A;  3H82 B;  3HJI A;  1N9L A;  3BY9 A;  3BQ8 A;  5DFX A;  4WEJ A;  1LL8 A;  3DBA A;  3S7O A;  1MKM A;  5TBM B;  4HOI A;  3UB8 A;  3MQQ A;  2V0W A;  1OT9 A;  5LBR A;  3TW8 A;  4L9F A;  2L1M A;  2M7U A;  3GDI A;  5AJG A;  5KSH A;  3TRC A;  4CLC A;  3MJQ A;  4EU0 A;  1S1Z A;  1D7E A;  2W3E A;  2Y8H A;  5HWV A;  1ZTU A;  5F69 A;  4JGQ A;  2ZBB A;  1OTA A;  3NOT C;  2HJE A;  3NJA A;  4IUH A;  2LB5 A;  3F1N B;  1VHM A;  3E4O A;  5HD3 A;  1TD5 A;  4WN5 A;  3LID A;  4LRX C;  3P7N A;  3CUE A;  1DP9 A;  2IA2 A;  5I5L A;  4GS9 B;  2CMN A;  1DRM A;  4KQO A;  3R4K A;  3C30 A;  4K08 A;  3VV4 A;  3BQA A;  4Z1W A;  2JKR I;  4MMN A;  4NXF A;  2KX6 A;  3T4J A;  3F1P A;  4LRY C;  4DMZ A;  4NEE D;  2XRN A;  1UGU A;  3KSH A;  2HF6 A;  3LI9 A;  2A24 A;  5C5K A;  5MC7 A;  2JHE A;  4MDZ A;  3PBR A;  3PBO A;  3MXQ A;  2VKS A;  3EEA A;  3KX0 X;  4I3J A;  5HPI A;  5HSQ A;  2I9V A;  5HD5 A;  2OWJ A;  1OTE A;  2G7U A;  4JGP A;  1WA9 A;  4HI4 A;  4JGO A;  4OOM A;  2J3T D;  3JVV A;  2P04 A;  1XJ6 A;  1LSW A;  2JKT I;  2ZOI A;  5HWW A;  4I3I A;  1S4R A;  2FZ0 A;  3LIF A;  2DMW A;  4NXB A;  4R38 A;  3ZQ5 A;  3OBF A;  3UB7 A;  1P97 A;  2M7V A;  2O9C A;  3MFX A;  2LB9 A;  3CI6 A;  2BAS A;  1MC0 A;  1N9N A;  3MQ0 A;  4WEK A;  3P01 A;  4O0P A;  2JKR M;  3ICY A;  3MR0 A;  2PR6 A;  3LI8 A;  3LUQ A;  2W0N A;  4HJ6 A;  1V9Y A;  4L9E A;  3UME A;  1S67 L;  4CLC D;  3OCN A;  4DN0 A;  4GLQ A;  1NLY A;  2W1T A;  4HJ4 A;  2ZMF A;  3TE8 A;  3K3D A;  1NRJ A;  4Q0H A;  3TJZ C;  4F3L A;  2PD8 A;  2V0U A;  2GNX A;  4QPR A;  4KUO A;  5IS1 A;  2W3D A;  5IU1 A;  5CX7 A;  1W63 M;  4DJ2 A;  3MMH A;  3ZYT A;  2HJ9 C;  3FG8 A;  2GJ3 A;  1H3Q A;  3CIT A;  3CAX A;  3F1O B;  4EEU A;  4GHI B;  2VJW A;  4HP4 A;  3T4T A;  3H82 A;  3GEC A;  3KSG A;  4MN7 A;  3FPW A;  2XRO A;  5J4E A;  1LT0 A;  4KQD A;  3E4Q A;  5TBM A;  3H9W A;  4H6J B;  5J7E A;  2QWS A;  4WLA A;  3BY8 A;  3NOU C;  1IOU A;  1XJ3 A;  4ARZ B;  4YWZ A;  2VA0 A;  2B18 A;  3E0Y A;  3CLO A;  3LR3 A;  3EWK A;  2OAP 1;  3OLO A;  4HJ3 A;  2XSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...