3TJZC

Crystal structure of arf1 bound to the gamma/zeta-cop core complex
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
140
structure length
140
Chain Sequence
EPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMTVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title A structure-based mechanism for arf1-dependent recruitment of coatomer to membranes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/protein binding
total genus 41
structure length 140
sequence length 140
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.60 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3tjzC00
2VGLM 4UQIM 4NEED 2HF6A 3TJZC 2JKRI 2JKTM 4P6ZM 2XA7S 2VGLS 4UQIS 1W63M 2FH5A 1NRJA 5MC7A 2JKRM 1W63Q 4P6ZS 2JKTI 2XA7M
chains in the Genus database with same CATH superfamily
3B47A 1BLSA 1PYYA 1S1ZA 4KENB 2Y2PA 3OPPA 5EFWA 1IELA 4PAUA 2XH9A 2ZMVA 4S2LA 2DRWA 4WZ4A 4IUHA 3DWZA 1BTLA 2V8CA 3VP0A 4EQ1A 2Y91A 1Y4OA 3BLSA 3MSHA 4F3LB 3O5YA 2JKTI 2EWWA 5CTMA 4EBPA 5EUAA 4Z9QA 4I3IA 1I2SA 3HLDA 2PHYA 5CEBA 1EROA 3LFVA 3ZVTA 1NJ4A 3BQAA 3T4OA 3ZHHA 3D9YA 4IUKA 1BSGA 3NY4A 4HQAA 4OOMA 3M2JA 5EM1A 4XXRA 1G6AA 4HESA 4UA9A 5EVID 5L07A 2WKHA 2DCFA 4EWFA 3WRZA 3ITBA 3MF0A 4ZAMA 3DWKA 5DTKA 4Q0JA 1VEUA 5CHJA 1XGIA 4FH4A 3LR0A 1PZPA 4R3BA 4P0MA 2VLGA 1IOUA 1KVMA 1ONHA 2H5SA 4OQHA 1P9RA 1JWZA 4JXGA 3MMHA 3P01A 4JF5A 2WKIA 3SH8A 5EVEA 3ZYTA 2X02A 3F1OB 2X71A 4ESPA 1CEGA 1H8ZA 3OOVA 4QWOA 2ZM8A 5GHXA 4JGOA 3UY6A 2JC7A 4DE3A 2G2WA 3O86A 1E3UD 2A2LA 3PAGA 1FR1A 3G32A 5L2FA 2Y2QA 1GSVA 3OCNA 3HLGA 2EFUA 4R23A 2L0WA 4WYYA 3RFBA 3U4LP 1DJCA 1STZA 5JYOA 1NRJA 3LICA 1T1AA 3LYXA 1Q2PA 4OOYA 3VFHA 4DN0A 1LL8A 2Q9MA 3MFDA 2WGVA 2Z6DA 1JWPA 2VV8A 2W0NA 3IXHA 4BBVA 3OBFA 2BG1A 4JGPA 2ZJ9A 3CHWP 5AQ9A 1SDEA 3BFEA 1M40A 1L2SA 5U47A 3CJMA 3O87A 1LT0A 4Y0UA 1DP8A 3MXSA 3G34A 1PW8A 4NK3A 4YNRA 4KZ9A 1KDSA 2HP6A 3N8LA 1D1JA 4JF4A 1K54C 2XF3A 3LIEA 3C4OA 4YFMA 2W1TB 1MKMA 1S0WA 1XPBA 3HBRA 4C6YA 3LY3A 4UAAA 3TE8A 5GHYA 1IYPA 3Q7VA 4EERA 1FOFA 1GSWA 4QY6A 3IF5A 4B93A 3QP6A 4X25A 2ZQDA 2K2NA 3GR2A 3EEAA 3SOIA 2WADA 3EQVA 2W3HA 4R6LA 1T19A 3S7QA 1ES4A 3RTYA 5F68A 5HW3A 1CK3A 5DTSA 1VEUB 3MFXA 4X1MA 2ZQ9A 3UB5P 3VP4A 4E3KA 5IT5A 3F1PB 5L09A 1I5QA 1K54A 2HF6A 3OPLA 5M18A 5E2HA 4XUZA 2C6WB 1SKOA 2J3TC 4HH2A 1FR6A 3WS2A 4DDSA 2R78A 4D2OA 1LI0A 1L0GA 1PW1A 1JTGA 1NZOA 1PI4A 3FKWA 1TD5A 3A3EA 3BM6A 1W63Q 3P98A 2Y8HA 3C5AA 3T1RA 1IEMA 1ERQA 3B42A 3ZG9B 3FKVA 4UQIM 2ZQ8A 3MS6A 3KYZA 2XSSA 1YM1A 4E6XA 3S1YA 3KX0X 4OONA 4Q0HA 4Y15A 5CGSA 4PPRA 1RGZA 3EGDC 2IWDA 4IHQA 3UB7A 3BJNA 4LV2A 3VV4A 3MQ0A 1PFLA 2WKQA 5DF8A 4OPRA 1ZC2A 2PRFA 4ETZA 3PBTA 3LI9A 4MMNA 1VQQA 3M6HA 3EEHA 1SDNA 2YKHA 4X53A 3UB6A 1AXBA 2DNSA 5FQKA 3NECA 3H7WA 4HH3A 1PWDA 2EX9A 3W4PA 5AQ7A 3TRCA 4ZTKA 1JTDA 1P9WA 1K56A 3LY4A 4K0XA 2GNXA 1LI9A 2M1CA 4RVAA 4BD1A 3G6OA 1OTDA 4HNBA 2B95A 4PM5A 4FOFA 2LB5A 5M19A 3DBAA 5FAQA 3HUMA 3TJZC 5FSRA 1MWUA 3DTMA 4EV4A 4KUKA 3GVBA 2ZQ7A 4PKYG 3S7NA 3DAVA 2W27A 4WM9A 3OPHA 4NXFA 1O07A 1F98A 3GSGA 1I2WA 4R3AA 2EXAA 5GLDA 4KUOA 1ERMA 1IKIA 3T1SA 2XLNA 1FCNA 4BLMA 4HP9A 1LSWA 2KLIA 4FUWA 4S2IA 4Y5FA 1NY0A 1NXYA 1IFQA 1N9LA 3IXGA 3MKEA 4S2NC 4LV0A 3C7UA 2Y55A 1K38A 2HJ9C 2B02A 5DFYA 5EOOA 3QNBA 4CPKA 3ITAA 4M3KA 4Y2FA 2QMIA 3AGEA 2OWJA 3P7NA 1YLWA 1OTEA 5DF9A 2PDRA 3D3OA 1KVLA 1TF1A 4X6TA 1W79A 2Z2MB 4PM9A 3C30A 2Y2IA 3T4JA 1OT9A 4F3LA 5FEGA 3I7JA 3GQZA 4R38A 3U2AA 1NZUA 1J3WA 4IBXA 4RX3A 1TDLA 2PYPA 2H10A 4C75A 1K55C 1W63M 2V9AA 5FQJA 2IWBA 4YWZA 1YSPA 3QP1A 1L3LA 3RJUA 3V67A 5HWWA 3DTIA 3PBNA 2WYXA 3MJQA 2PU4A 1NLZA 4S2NA 2PBYA 5F83A 2EXBA 2Y2LA 3V5MA 3SW1A 1K25A 4D60A 1WYBA 2UV0E 1PNEA 3PBOA 5FDSA 4DE2A 2QYBA 2V2FF 3IWOA 3UB9A 4R1GA 5CGXA 3LI8A 3JVUA 5HSQA 3JYIA 1GA9A 3IWIA 3UPNA 4LENA 5KMWA 3VP1A 1Y28A 1ESUA 1XKZA 4X56A 2J9PA 1W7FA 1K55A 3NIAA 5M1AA 4BL2A 2VZWA 2HZ5A 3KSFA 2K31A 3A3IA 3GV9A 2Y2MA 2H28A 4U0TA 4KZ8A 3NI9A 4S2OA 2HDRA 4EUVA 4JGQA 5CRFA 3M2KA 2RCXA 4IEDA 4WEJA 2HPBA 3EGXC 1FSYA 3G30A 2Y79A 5E2GA 1TS8A 1XJ6A 1YMSA 4S2KA 4LV3A 1YSQA 4MN6A 4ZBEA 4MCWA 2Z6CA 2WAFA 3BECA 4S2MA 4HJ4A 4UA6A 4FCFA 3N8SA 5JYPA 2O99A 2ZQCA 3IXBA 5BOHA 4DMZA 1SCWA 5HAIA 3PBSA 1MY8A 1H0MA 3KO6A 1G6OA 2JKFA 2QPNA 4GD6A 3HREA 3UDXA 2OV5A 3NOUC 1Y54A 2J3WA 2B5RA 3QP8A 2VGKA 4JXWA 3ISGA 4JF6A 4CLCB 1KGFA 3K3DA 2ZD8A 4GS9B 1GHIA 3QP5A 5E43A 3ZFZA 4EBLA 1O7EA 4G3VA 1FIKA 2ZM2A 3Q07A 4AFIA 3V3RA 4H8RA 1T1BA 1BLHA 3VE3A 2J9OA 5CXWA 5EPHA 3MQOA 2W1TA 2VGJA 4WLAA 2PD7A 2VA0A 4P85A 4WZ5C 5EVIC 4E04A 3VOZA 2XK1A 3KSHA 3R7WB 2WGWB 3OZHA 2YKFA 4Y7PA 1M6KA 3MXQA 5J3WA 1WYCA 3O3VA 3SH9A 4KZ3A 4LPZA 3K2NA 1BULA 4G3KA 3HJIA 2GZAA 3W2ZA 1JVJA 4ZJ3A 3D72A 5HD5A 3GTCA 4BQMA 2M7UA 3Q82A 3HLFA 4QY5A 1PZOA 4NETA 3F1PA 4GOGA 5TFQA 3PTEA 1OJ5A 3A0SA 3HLBA 5F1FA 4A5RA 1RCJA 4WL9A 3RXWA 1XJ3A 1CEFA 4PKYA 3LGOA 5DF7A 1N4OA 2BLSA 4HJ3A 1QMFA 2P9VB 4WZ5A 1FSWA 2FZ0A 3ULFA 2LB9A 4LCMA 2PR6A 3QHYA 4R3JA 1L0EA 4S2PA 3Q81A 4I38A 4HEFA 3UMEA 3FZCA 2VK3A 5IS1A 1RP5A 2JKRM 1KGGA 3CI6A 3H82B 3BFDA 4PMAA 2O9BA 2XGNA 3C4PA 4BMWA 4KQOA 1XXMA 3SS4A 3C2WA 3WS0A 5FA7A 3IXDA 5HZHA 2WZZA 4E3IA 3DW0A 1CQAA 4IJGA 2GJ3A 1KE0A 3OCLA 4JPMA 4B88A 5AJGA 3PXPA 1RGYA 2XD1A 3T1QB 3ZNYA 4BL3A 2X01A 3T4KA 1S66L 3ZG7B 1G68A 1ES5A 2PD8A 5FI6A 4MBKA 2ZOIA 1T1CA 4P87A 4Y17A 3LCEA 3FPVA 1ZG6A 1DP9A 2J8YA 2AVXA 3PBQA 2WKPA 4FTXA 1N9OA 5DJUA 3BEBA 1TS7A 4QD4A 1DP6A 1X0OA 1N9NA 4PM8A 3EOIA 4I5SA 4YOFA 2Y2JA 3E2LA 3A0VA 1IYOA 4BENA 3LR4A 1S4RA 2V1AA 1K4FA 1W8QA 3UE1A 4KZ4A 3MZDA 3FYZA 4E6WA 1LHYA 1GHPA 4M4XA 4OQ0A 4R4SA 2HP9A 1HD8A 1XA1A 2XEPA 3BY8A 5F69A 4EW7A 3K3CA 1LL9A 3G2ZA 1AWIA 3CPTA 3P09A 3BLMA 3T12B 2E8JA 3GMWA 5CHUA 4R0QA 3E98A 1JNUA 4E3OA 4HOIA 4DE1A 3GRJA 3FC7A 4UA7A 1Z6FA 4EXOA 1H3QA 1ZHHB 2VGLM 2XR0A 1BT5A 4Z1WA 1ACFA 4GD8A 4K08A 3LIAA 5CX7A 2VKSA 3BY9A 5DFXA 2GX5A 2FH5A 4N9KA 5EVIB 4G3WA 3QNCA 5MC7A 4NKPA 5FEFA 2Y59A 3V39A 5HPFA 2ZMFA 5EECA 4BWIA 1UWNX 1S6RA 2QJ5A 3SS5A 4HI4A 3PR6A 2XFTA 1S4SA 3E4PA 3IS2B 3OLOA 1S1YA 3FPWA 3BYDA 4WEKA 4NXEA 2XA7M 4OP8A 2WKRA 4LFUA 1EW0A 4JLFA 1EWZA 4K91A 4E3NA 4RA7A 2JKTM 2A49A 1GA0A 4UQIS 4QB8A 4IVIA 4I3AA 5KIZA 4MLLA 3BFGA 4WMCA 3B33A 2HGVA 2Y4AA 2BTFP 5CHMA 1K56D 1Q2QA 2ZC7A 2E8IA 2I9VA 1P0ZA 3CMZA 3E2KA 2Y2KA 3Q7ZA 3CLOA 3BWLA 3NCKA 2K7SA 5HD3A 3S4XA 5AVFA 4HBUA 2EX8A 2R9XA 3UNWA 3KYEA 2QKPA 2P7JA 1H5XA 1V9YA 4JKTA 5AVEA 4OOLA 5FI2A 2W3EA 3S7OA 3JPUA 3N8RA 4P6ZM 4CLCC 3IBRA 3UE3A 1TVFA 2OSUA 3UB8A 4Y13A 5F1GA 4BBTA 2KOIA 4MBFA 4KZ5A 1LLBA 3CPTB 3OC2A 1K57C 3V3SA 2HDSA 1BUEA 5HX9A 2P08A 4MBHA 4E3JA 4HP4A 4I39A 5HWTA 2XD5A 4C3QA 1OPXA 4X68A 2Z2LB 4IBRA 1H8MA 1DY6A 1DJAA 1NRFA 2G7UA 3QP4A 4GKUA 3HL9A 4EBNA 4B9OA 3N6IA 1W8YA 3FG8A 5TBMB 3CITA 1BYWA 2XDMA 1UGUA 4N92A 1VETB 3NBLA 5HFOA 5A93A 4L9GA 3T50A 3IX4A 1YT4A 4CLCA 4BJPA 3TG9A 4GS9A 2ZOHA 5GL9A 4CJNA 3E0YA 1TEMA 1K57A 2PU2A 3UN7A 5FDHA 5EOEA 4ETXA 2HP5A 4OPYA 3F1NB 3HLWA 3LIFA 2XQZA 1CI9A 3G31A 3PAEA 1EI5A 5FQQA 5CERA 3R7WA 2WGWA 5J7EA 2H0YA 2B18A 5GHZA 3UPPA 3C38A 5KSCA 3NHQA 4HJ6A 2WAEA 4OP5A 3BRMA 2PAVP 4BD0A 3DTKA 3KSIA 5DKLA 1DJBA 3UDFA 1XFNA 3AGFA 2Y2HA 5A90A 3IH8A 5DTTA 1H8YA 4OPZA 1CJFA 3G2YA 2C5WB 3HLCA 5CEDA 1LL5A 5HPIA 2WUQA 5FASA 3CAXA 1D7EA 3AGDA 5TGFA 5IU1A 3VOYA 1MXOA 1SZVA 1IYQA 1ODVA 5FQ9A 1MKIA 2P9VA 4JXVA 4O7DA 4OQGA 5I5LA 4DDYA 1XP4A 5HAPA 1XFQA 4DXBA 3L9KA 4FH2A 2WGIA 1XJ2A 4MN7A 4KZ6A 3VP3A 4R70A 4EUZA 4KZAA 5FQIA 1TDGA 4FD8A 4L0LA 3IT9A 2J7VA 3D4FA 3H82A 1T18A 4QHCA 2VEAA 2FFFB 5F82A 4GJ4A 3NOPC 3VFFA 1NYMA 5GLAA 3LR5A 1YMXA 1KGEA 3ZVWA 1YLJA 2W3FA 1ALQA 4II7A 2W3GA 3T4LA 3ZG5A 1JWVA 1PIOA 3C7VA 4LGWA 2A24B 1BLCA 2OLUA 2HDQA 2HV1A 2INWA 3RXXA 3UPOA 1LSXA 1UWPX 3E4QA 2VX8A 4UEYA 1OTBA 3IF6C 2V0WA 4NEED 3GDIA 1F9IA 4KQDA 5HDDA 3WS5A 2VJWA 3LIDA 4LV1A 4WBGA 3TOIA 4E3MA 4H6JA 1MPLA 1U60A 3SS3A 2QHKA 4QU3A 4ME4A 3UE6A 3VSKA 4MNRA 3ZCZA 4UHUA 4PM7A 2IWCA 3MXRA 4EESA 2O0YA 4XT2A 3NDGA 2ZM0A 1MWRA 4RX2A 4ZDXA 5HL6A 3DTEA 2Q0OA 4GZBA 4EQIA 2JN7A 4L9FA 4GB7A 4GLQA 3N4IA 1HTZA 3T4SA 3WRTA 3UDIA 1C3BA 1VM1A 3HVFA 4LLOB 1Z09A 1E4DA 3FV7A 2ZL1B 3KSGA 4R4RA 3IF6A 1KE4A 1XX2A 3PYPA 3MBZA 5HAQA 2D02A 2ZC3B 5C5KA 2JCHA 2EFXA 3M6BA 4S2JA 4B4ZA 4O0PA 2L4RA 5FL3A 3HCYA 3NULA 2EX6A 2JE5A 2ZC6B 3MZFA 5EVIA 5G4ZA 4XUXA 4LRXC 3IQAA 4GN2A 4WUJA 4P6BA 1IYSA 4U3TA 3RH8B 3ZNTA 2Y2NA 5FQMA 4X55A 5FATA 4JXSA 2RL3A 3EWKA 1G5UA 4ARZB 4QPRA 1TS6A 3IS2A 5CTNA 3UMDA 5TJJA 3JVVA 5FI7A 4KZBA 5E2FA 2ZC5B 1ESIA 2Y2GA 1HZOA 2Y2OA 4RYEA 2OWHA 1YLTA 2QWSA 3TW8A 1FCOA 5HARA 4NXGA 5AQAA 2OLVA 4DJ2A 5EVLA 4HY8A 1E3UA 3T1XA 4OKPA 3A3DA 2ZLYA 2ZMAA 3KYQA 4KG5A 2R9WA 2EA9A 1ZKJA 4O01A 3IX8A 5DKKA 3LIBA 2EX2A 2QJ7A 3WWXA 2DMWA 2NUPC 3IX3A 5G18A 4PM6A 2JBFA 2V1BA 3LEQA 2A3UA 4KQQA 1S67L 1FILA 1VHMA 2KDKA 1BLPA 3A3JA 4EEPA 4H6JB 3SH7A 3VSLA 3GECA 1YLPA 2L1MA 3BFCA 4IVKA 3LEZA 1HVBA 1MWTA 4DE0A 1K6SA 4XT2B 4EETB 1CF0A 4RQ9A 1L0FA 3NDEA 1N9BA 3QP2A 1L0DA 1GSXA 4GDBA 4N9LA 3NOTC 1DRMA 3T4QA 2WZXA 4B4XA 1G28A 2XRNA 4ZJ2A 4CLCE 1KDWA 3G4PA 5G4YA 1BZAA 2WKEA 4EU0A 3PHYA 5A8BA 1J9MA 1OT6A 1XJ4A 3O88A 3H9WA 3W4OA 3IF6B 1ONGA 4OLDA 3HLEA 2HDUA 3MR0A 2W3DA 2OOLA 3HUOA 5TBMA 1PWCA 3CUEC 4JGRA 3B3XA 1LSVA 5FAPA 2FFYA 2V8FA 3UE0A 1VETA 5A91A 4HIAA 3LO7A 2JKGA 1FQGA 2VGLS 1HLUP 2PT7A 1YKDA 5F5YA 3OPRA 2PBDP 4DXCA 2EWVA 3HJKA 4LRYC 3Q1FA 2J3TD 4ZJ1A 3F1NA 1WA9A 4WMCD 2IA2A 2J80A 4MDZA 4NG2A 3IHBA 5HL1A 3IH9A 4GCZA 1GCEA 2ACGA 4DKIA 1OJGA 3LUQA 3UO9A 5K5BA 4O8GA 3BFFA 4DRTA 1PI5A 3CUEA 4Q8IA 5E2EA 4HHDA 1ES3A 2ZC4B 1ZTUA 2XA7S 3ICYA 3VMAA 3IHAA 3VE4A 4DJ3A 3S22A 3NC8A 3SZTA 4NXBA 3ZGAB 2G2UA 4E3LA 4OPQA 3R4KA 2P74A 3MQQA 2GDNA 2W1RA 4DF6A 4GHIA 3MZEA 2OAQ1 2PR5A 3T4TA 5EE8A 1NWZA 5AQBA 4LCLA 5GLBA 3LR3A 5L8MA 1MWSA 1QMEA 4U0XA 1E25A 1D06A 4OLGA 5D3OA 1GHMA 2MJ6A 1XGJA 2O9CA 4X1LA 2VV6A 3W4QA 4MEZA 3CZDA 5A92A 3Q7VB 5GLCA 1KE3A 2VV7A 4KZ7A 4OVDA 4Y0TA 2WK0A 2V0UA 4WF0A 2XROA 3A3FA 4KG2A 2KX6A 4P6ZS 1ZG4A 4EEUA 3BQ8A 3CWFA 4OH0A 3IBJA 4CLCD 1A0KA 2M7VA 2A24A 1PRQA 1K4EA 3FWLA 1SKOB 3G35A 3L7HA 1YPRA 3WS1A 4GW9A 2D01A 2V1ZA 1WE4A 5IHVA 2JKRI 3VP2A 3S7PA 3W8KA 5FAOA 5CECA 1K6RA 2CC1A 4WELA 1IKGA 2BASA 2PYRA 4X69A 1SKFA 2UWXA 2I72A 3ZDJA 2ZQAA 3EQUA 1MBLA 2HJEA 1YLYA 5KZHA 5CGWA 3ZQ5A 5I94A 1YLZA 1NYYA 2CMNA 4Q0IA 3TSGA 1P97A 2OAP1 5KSHA 2P04A 4HBTA 3BW6A 1YQSA 1VB6A 4GNUA 1ES2A 1PWGA 4PHTA 1YAXA 4OQIA 2ZL1A 1OTAA 4MN5A 4F94A 3H7WB 5J4EA 1FCMA 3HUNA 5HWVA 3A0RA 4GHIB 3VOLA 1F5MA 4I3JA 2Q9NA 4FSFA 4WN5A 2QZ6A 4QJGA 2ZBBA 4JBFA 3NJAA 5L10A 4BBUA 5F6AA 5DJTA 2NUTC 1SHVA 3PBRA 1OMEA 3N7WA 1MZUA 4CQHA 3C8CA 1OTIA 5HDSA 1NLYA 4GDNA 4Y0OA 4ID4A 5TR7A 4K0WA 2V20A 4L9EA 4ARZA 4YINA 1CI8A 3F1OA 3ZG8B 1TS0A 2JHEA 3WS4A 1F2KA 3CG5A 5J8XA 2H0TA 3E4OA 4KG6A 5HDCA 3MKFA 2XFSA 4LRZE 3IWQA 5DVAA 3V50A 1KOUA 4N1XA 4N1HA 4Y3IA 3ZG0A 5LBRA 1MC0A 1XA7A 4ZRRA 1V9ZA 5EV0A 2O9AA 5EM0A 1K0KA 4KQRA 1W5DA
chains in the Genus database with same CATH topology
3C30A 3B47A 3T4JA 1EW0A 1OT9A 3KYQA 4F3LA 1S1ZA 4R38A 2EA9A 3U2AA 5EFWA 4PAUA 4O01A 2PYPA 2JKTM 2ZMVA 5DKKA 3LIBA 4IUHA 2QJ7A 2DMWA 2NUPC 4UQIS 1W63M 5KIZA 4I3AA 4EQ1A 2V9AA 2V1BA 4YWZA 3B33A 1YSPA 2HGVA 4F3LB 1S67L 3O5YA 3V67A 5HWWA 3PBNA 2JKTI 3MJQA 1VHMA 2EWWA 2KDKA 2I9VA 1P0ZA 4EEPA 1NLZA 4H6JB 3GECA 3CLOA 3BWLA 2L1MA 4I3IA 2K7SA 2PHYA 3SW1A 5HD3A 5AVFA 3LFVA 3BQAA 4XT2B 3T4OA 3PBOA 4EETB 2QKPA 2P7JA 4IUKA 4RQ9A 2QYBA 1V9YA 5AVEA 3UB9A 4HQAA 4OOMA 1GSXA 3LI8A 4OOLA 3NOTC 3JVUA 5HSQA 1DRMA 3T4QA 2W3EA 3S7OA 4P6ZM 1G28A 2XRNA 4CLCC 3IBRA 3UE3A 4CLCE 1Y28A 3UB8A 5G4YA 4BBTA 4EU0A 2KOIA 3PHYA 3MF0A 5A8BA 1OT6A 1XJ4A 2VZWA 4Q0JA 3H9WA 3KSFA 2K31A 3OC2A 2H28A 3LR0A 2P08A 3MR0A 2W3DA 4EUVA 2VLGA 4JGQA 1IOUA 4HP4A 4I39A 2OOLA 5HWTA 4WEJA 5TBMA 3EGXC 1P9RA 3CUEC 4JGRA 1OPXA 1LSVA 3MMHA 2Y79A 3P01A 1TS8A 1XJ6A 3ZYTA 1H8MA 2G7UA 1YSQA 4MN6A 3F1OB 3OOVA 4MCWA 2Z6CA 4HIAA 4B9OA 4JGOA 3FG8A 5TBMB 4HJ4A 3CITA 1BYWA 2A2LA 1UGUA 2O99A 1GSVA 2VGLS 2PT7A 3OCNA 1YKDA 4DMZA 5F5YA 2L0WA 3RFBA 4L9GA 1STZA 3T50A 1NRJA 3PBSA 3LICA 2EWVA 1T1AA 3KO6A 3HJKA 1G6OA 4CLCA 4LRYC 4BJPA 3LYXA 4GS9A 2J3TD 2ZOHA 3NOUC 3F1NA 1WA9A 2J3WA 2IA2A 2J80A 4MDZA 3E0YA 4DN0A 1LL8A 4GCZA 4CLCB 4ETXA 3K3DA 1OJGA 2Z6DA 3LUQA 4GS9B 2VV8A 2W0NA 4BBVA 5K5BA 3OBFA 4JGPA 3F1NB 3LIFA 4O8GA 3CUEA 4G3VA 4AFIA 4HHDA 1T1BA 3VE3A 1LT0A 1DP8A 3R7WA 5J7EA 3MQOA 2B18A 2W1TA 4YNRA 1ZTUA 2XA7S 3ICYA 3C38A 4WLAA 2PD7A 2VA0A 4DJ3A 3VE4A 3NHQA 4HJ6A 4NXBA 4E04A 3LIEA 3KSHA 3R7WB 3KSIA 3R4KA 5DKLA 2YKFA 2W1TB 1MKMA 3MQQA 2W1RA 4GHIA 3MXQA 5J3WA 2OAQ1 1XFNA 2PR5A 3T4TA 1NWZA 3TE8A 4LPZA 3K2NA 3LR3A 4G3KA 3HJIA 5L8MA 5HPIA 2GZAA 3W2ZA 4EERA 3D72A 5HD5A 1GSWA 1D06A 3CAXA 2M7UA 1D7EA 2MJ6A 5IU1A 4B93A 2O9CA 1ODVA 2VV6A 3F1PA 5I5LA 2K2NA 3EEAA 1OJ5A 3EQVA 2W3HA 3A0SA 4R6LA 1T19A 1XFQA 2VV7A 4WL9A 3S7QA 3RTYA 1XJ3A 5F68A 4PKYA 2V0UA 4WF0A 1XJ2A 4MN7A 2XROA 3MFXA 4HJ3A 4R70A 2KX6A 4P6ZS 4EEUA 4L0LA 3F1PB 5IT5A 2FZ0A 3ULFA 2LB9A 3BQ8A 3CWFA 2PR6A 2HF6A 3IBJA 4CLCD 2J3TC 3H82A 4HH2A 2R78A 1T18A 2M7VA 4I38A 2VEAA 3UMEA 4GJ4A 5IS1A 3NOPC 2A24A 3LR5A 2JKRM 1TD5A 2W3FA 1W63Q 4II7A 2Y8HA 3CI6A 3H82B 2W3GA 3B42A 3T4LA 2O9BA 4GW9A 4UQIM 4BMWA 4KQOA 2D01A 3C2WA 3KYZA 2XSSA 2JKRI 2A24B 3S7PA 5HZHA 3KX0X 4IJGA 4Q0HA 2HV1A 2INWA 3EGDC 1LSXA 1UWPX 4WELA 4IHQA 2GJ3A 3E4QA 3UB7A 3BJNA 3OCLA 2VX8A 4UEYA 3VV4A 2BASA 2PYRA 5AJGA 1OTBA 3PXPA 2V0WA 4NEED 3GDIA 1F9IA 4KQDA 3MQ0A 3T4KA 1S66L 2WKQA 5HDDA 4ETZA 2VJWA 3LIDA 2PD8A 3EQUA 4H6JA 2ZOIA 3PBTA 3LI9A 1T1CA 4MMNA 2QHKA 2HJEA 3FPVA 4ME4A 3ZQ5A 3UE6A 3EEHA 2YKHA 1DP9A 3UB6A 2CMNA 3PBQA 4Q0IA 2WKPA 1P97A 2OAP1 1N9OA 5DJUA 3H7WA 2O0YA 4EESA 5KSHA 4XT2A 4HH3A 2P04A 3BW6A 1TS7A 1DP6A 1VB6A 1X0OA 1N9NA 5HL6A 3TRCA 3EOIA 4I5SA 4YOFA 2JN7A 4L9FA 1P9WA 4PHTA 3A0VA 3LR4A 1YAXA 1S4RA 2V1AA 1OTAA 4MN5A 3H7WB 2GNXA 5J4EA 2M1CA 4GLQA 3G6OA 1OTDA 4HNBA 5HWVA 3A0RA 4M4XA 4FOFA 4GHIB 3T4SA 3VOLA 1F5MA 2LB5A 4I3JA 4FSFA 3BY8A 5F69A 4EW7A 3K3CA 3DBAA 4WN5A 3TJZC 4LLOB 2ZBBA 3NJAA 3KSGA 4KUKA 3PYPA 4BBUA 2D02A 5F6AA 5C5KA 4PKYG 5DJTA 3S7NA 2NUTC 3E98A 2W27A 3PBRA 4O0PA 1JNUA 1MZUA 2L4RA 4HOIA 4CQHA 5FL3A 3HCYA 4NXFA 3FC7A 3C8CA 1F98A 1OTIA 4EXOA 5HDSA 1H3QA 1ZHHB 5G4ZA 1NLYA 4R3AA 2VGLM 4KUOA 4LRXC 4L9EA 4Z1WA 4ARZA 4K08A 3F1OA 1TS0A 3LIAA 4WUJA 4HP9A 1LSWA 2KLIA 5CX7A 2JHEA 3RH8B 2VKSA 3BY9A 4Y5FA 5DFXA 2GX5A 2FH5A 1IFQA 3E4OA 1N9LA 5HDCA 4G3WA 5MC7A 4NKPA 3EWKA 4LRZE 4ARZB 4QPRA 1TS6A 3IS2A 3UMDA 5HPFA 2HJ9C 5DFYA 2B02A 2ZMFA 1KOUA 5TJJA 3JVVA 4BWIA 1UWNX 2QJ5A 4HI4A 4Y2FA 4Y3IA 3PR6A 5LBRA 2OWHA 1S4SA 3E4PA 2OWJA 2QWSA 1MC0A 3IS2B 3P7NA 1OTEA 5DF9A 3TW8A 3OLOA 2PDRA 4ZRRA 1V9ZA 1S1YA 3D3OA 4NXGA 3FPWA 1TF1A 2O9AA 4DJ2A 4WEKA 4NXEA 2XA7M 2WKRA 4HY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGL M;  4UQI M;  4NEE D;  2HF6 A;  3TJZ C;  2JKR I;  2JKT M;  4P6Z M;  2XA7 S;  2VGL S;  4UQI S;  1W63 M;  2FH5 A;  1NRJ A;  5MC7 A;  2JKR M;  1W63 Q;  4P6Z S;  2JKT I;  2XA7 M; 
#chains in the Genus database with same CATH topology
 3B47 A;  1BLS A;  1PYY A;  1S1Z A;  4KEN B;  2Y2P A;  3OPP A;  5EFW A;  1IEL A;  4PAU A;  2XH9 A;  2ZMV A;  4S2L A;  2DRW A;  4WZ4 A;  4IUH A;  3DWZ A;  1BTL A;  2V8C A;  3VP0 A;  4EQ1 A;  2Y91 A;  1Y4O A;  3BLS A;  3MSH A;  4F3L B;  3O5Y A;  2JKT I;  2EWW A;  5CTM A;  4EBP A;  5EUA A;  4Z9Q A;  4I3I A;  1I2S A;  3HLD A;  2PHY A;  5CEB A;  1ERO A;  3LFV A;  3ZVT A;  1NJ4 A;  3BQA A;  3T4O A;  3ZHH A;  3D9Y A;  4IUK A;  1BSG A;  3NY4 A;  4HQA A;  4OOM A;  3M2J A;  5EM1 A;  4XXR A;  1G6A A;  4HES A;  4UA9 A;  5EVI D;  5L07 A;  2WKH A;  2DCF A;  4EWF A;  3WRZ A;  3ITB A;  3MF0 A;  4ZAM A;  3DWK A;  5DTK A;  4Q0J A;  1VEU A;  5CHJ A;  1XGI A;  4FH4 A;  3LR0 A;  1PZP A;  4R3B A;  4P0M A;  2VLG A;  1IOU A;  1KVM A;  1ONH A;  2H5S A;  4OQH A;  1P9R A;  1JWZ A;  4JXG A;  3MMH A;  3P01 A;  4JF5 A;  2WKI A;  3SH8 A;  5EVE A;  3ZYT A;  2X02 A;  3F1O B;  2X71 A;  4ESP A;  1CEG A;  1H8Z A;  3OOV A;  4QWO A;  2ZM8 A;  5GHX A;  4JGO A;  3UY6 A;  2JC7 A;  4DE3 A;  2G2W A;  3O86 A;  1E3U D;  2A2L A;  3PAG A;  1FR1 A;  3G32 A;  5L2F A;  2Y2Q A;  1GSV A;  3OCN A;  3HLG A;  2EFU A;  4R23 A;  2L0W A;  4WYY A;  3RFB A;  3U4L P;  1DJC A;  1STZ A;  5JYO A;  1NRJ A;  3LIC A;  1T1A A;  3LYX A;  1Q2P A;  4OOY A;  3VFH A;  4DN0 A;  1LL8 A;  2Q9M A;  3MFD A;  2WGV A;  2Z6D A;  1JWP A;  2VV8 A;  2W0N A;  3IXH A;  4BBV A;  3OBF A;  2BG1 A;  4JGP A;  2ZJ9 A;  3CHW P;  5AQ9 A;  1SDE A;  3BFE A;  1M40 A;  1L2S A;  5U47 A;  3CJM A;  3O87 A;  1LT0 A;  4Y0U A;  1DP8 A;  3MXS A;  3G34 A;  1PW8 A;  4NK3 A;  4YNR A;  4KZ9 A;  1KDS A;  2HP6 A;  3N8L A;  1D1J A;  4JF4 A;  1K54 C;  2XF3 A;  3LIE A;  3C4O A;  4YFM A;  2W1T B;  1MKM A;  1S0W A;  1XPB A;  3HBR A;  4C6Y A;  3LY3 A;  4UAA A;  3TE8 A;  5GHY A;  1IYP A;  3Q7V A;  4EER A;  1FOF A;  1GSW A;  4QY6 A;  3IF5 A;  4B93 A;  3QP6 A;  4X25 A;  2ZQD A;  2K2N A;  3GR2 A;  3EEA A;  3SOI A;  2WAD A;  3EQV A;  2W3H A;  4R6L A;  1T19 A;  3S7Q A;  1ES4 A;  3RTY A;  5F68 A;  5HW3 A;  1CK3 A;  5DTS A;  1VEU B;  3MFX A;  4X1M A;  2ZQ9 A;  3UB5 P;  3VP4 A;  4E3K A;  5IT5 A;  3F1P B;  5L09 A;  1I5Q A;  1K54 A;  2HF6 A;  3OPL A;  5M18 A;  5E2H A;  4XUZ A;  2C6W B;  1SKO A;  2J3T C;  4HH2 A;  1FR6 A;  3WS2 A;  4DDS A;  2R78 A;  4D2O A;  1LI0 A;  1L0G A;  1PW1 A;  1JTG A;  1NZO A;  1PI4 A;  3FKW A;  1TD5 A;  3A3E A;  3BM6 A;  1W63 Q;  3P98 A;  2Y8H A;  3C5A A;  3T1R A;  1IEM A;  1ERQ A;  3B42 A;  3ZG9 B;  3FKV A;  4UQI M;  2ZQ8 A;  3MS6 A;  3KYZ A;  2XSS A;  1YM1 A;  4E6X A;  3S1Y A;  3KX0 X;  4OON A;  4Q0H A;  4Y15 A;  5CGS A;  4PPR A;  1RGZ A;  3EGD C;  2IWD A;  4IHQ A;  3UB7 A;  3BJN A;  4LV2 A;  3VV4 A;  3MQ0 A;  1PFL A;  2WKQ A;  5DF8 A;  4OPR A;  1ZC2 A;  2PRF A;  4ETZ A;  3PBT A;  3LI9 A;  4MMN A;  1VQQ A;  3M6H A;  3EEH A;  1SDN A;  2YKH A;  4X53 A;  3UB6 A;  1AXB A;  2DNS A;  5FQK A;  3NEC A;  3H7W A;  4HH3 A;  1PWD A;  2EX9 A;  3W4P A;  5AQ7 A;  3TRC A;  4ZTK A;  1JTD A;  1P9W A;  1K56 A;  3LY4 A;  4K0X A;  2GNX A;  1LI9 A;  2M1C A;  4RVA A;  4BD1 A;  3G6O A;  1OTD A;  4HNB A;  2B95 A;  4PM5 A;  4FOF A;  2LB5 A;  5M19 A;  3DBA A;  5FAQ A;  3HUM A;  3TJZ C;  5FSR A;  1MWU A;  3DTM A;  4EV4 A;  4KUK A;  3GVB A;  2ZQ7 A;  4PKY G;  3S7N A;  3DAV A;  2W27 A;  4WM9 A;  3OPH A;  4NXF A;  1O07 A;  1F98 A;  3GSG A;  1I2W A;  4R3A A;  2EXA A;  5GLD A;  4KUO A;  1ERM A;  1IKI A;  3T1S A;  2XLN A;  1FCN A;  4BLM A;  4HP9 A;  1LSW A;  2KLI A;  4FUW A;  4S2I A;  4Y5F A;  1NY0 A;  1NXY A;  1IFQ A;  1N9L A;  3IXG A;  3MKE A;  4S2N C;  4LV0 A;  3C7U A;  2Y55 A;  1K38 A;  2HJ9 C;  2B02 A;  5DFY A;  5EOO A;  3QNB A;  4CPK A;  3ITA A;  4M3K A;  4Y2F A;  2QMI A;  3AGE A;  2OWJ A;  3P7N A;  1YLW A;  1OTE A;  5DF9 A;  2PDR A;  3D3O A;  1KVL A;  1TF1 A;  4X6T A;  1W79 A;  2Z2M B;  4PM9 A;  3C30 A;  2Y2I A;  3T4J A;  1OT9 A;  4F3L A;  5FEG A;  3I7J A;  3GQZ A;  4R38 A;  3U2A A;  1NZU A;  1J3W A;  4IBX A;  4RX3 A;  1TDL A;  2PYP A;  2H10 A;  4C75 A;  1K55 C;  1W63 M;  2V9A A;  5FQJ A;  2IWB A;  4YWZ A;  1YSP A;  3QP1 A;  1L3L A;  3RJU A;  3V67 A;  5HWW A;  3DTI A;  3PBN A;  2WYX A;  3MJQ A;  2PU4 A;  1NLZ A;  4S2N A;  2PBY A;  5F83 A;  2EXB A;  2Y2L A;  3V5M A;  3SW1 A;  1K25 A;  4D60 A;  1WYB A;  2UV0 E;  1PNE A;  3PBO A;  5FDS A;  4DE2 A;  2QYB A;  2V2F F;  3IWO A;  3UB9 A;  4R1G A;  5CGX A;  3LI8 A;  3JVU A;  5HSQ A;  3JYI A;  1GA9 A;  3IWI A;  3UPN A;  4LEN A;  5KMW A;  3VP1 A;  1Y28 A;  1ESU A;  1XKZ A;  4X56 A;  2J9P A;  1W7F A;  1K55 A;  3NIA A;  5M1A A;  4BL2 A;  2VZW A;  2HZ5 A;  3KSF A;  2K31 A;  3A3I A;  3GV9 A;  2Y2M A;  2H28 A;  4U0T A;  4KZ8 A;  3NI9 A;  4S2O A;  2HDR A;  4EUV A;  4JGQ A;  5CRF A;  3M2K A;  2RCX A;  4IED A;  4WEJ A;  2HPB A;  3EGX C;  1FSY A;  3G30 A;  2Y79 A;  5E2G A;  1TS8 A;  1XJ6 A;  1YMS A;  4S2K A;  4LV3 A;  1YSQ A;  4MN6 A;  4ZBE A;  4MCW A;  2Z6C A;  2WAF A;  3BEC A;  4S2M A;  4HJ4 A;  4UA6 A;  4FCF A;  3N8S A;  5JYP A;  2O99 A;  2ZQC A;  3IXB A;  5BOH A;  4DMZ A;  1SCW A;  5HAI A;  3PBS A;  1MY8 A;  1H0M A;  3KO6 A;  1G6O A;  2JKF A;  2QPN A;  4GD6 A;  3HRE A;  3UDX A;  2OV5 A;  3NOU C;  1Y54 A;  2J3W A;  2B5R A;  3QP8 A;  2VGK A;  4JXW A;  3ISG A;  4JF6 A;  4CLC B;  1KGF A;  3K3D A;  2ZD8 A;  4GS9 B;  1GHI A;  3QP5 A;  5E43 A;  3ZFZ A;  4EBL A;  1O7E A;  4G3V A;  1FIK A;  2ZM2 A;  3Q07 A;  4AFI A;  3V3R A;  4H8R A;  1T1B A;  1BLH A;  3VE3 A;  2J9O A;  5CXW A;  5EPH A;  3MQO A;  2W1T A;  2VGJ A;  4WLA A;  2PD7 A;  2VA0 A;  4P85 A;  4WZ5 C;  5EVI C;  4E04 A;  3VOZ A;  2XK1 A;  3KSH A;  3R7W B;  2WGW B;  3OZH A;  2YKF A;  4Y7P A;  1M6K A;  3MXQ A;  5J3W A;  1WYC A;  3O3V A;  3SH9 A;  4KZ3 A;  4LPZ A;  3K2N A;  1BUL A;  4G3K A;  3HJI A;  2GZA A;  3W2Z A;  1JVJ A;  4ZJ3 A;  3D72 A;  5HD5 A;  3GTC A;  4BQM A;  2M7U A;  3Q82 A;  3HLF A;  4QY5 A;  1PZO A;  4NET A;  3F1P A;  4GOG A;  5TFQ A;  3PTE A;  1OJ5 A;  3A0S A;  3HLB A;  5F1F A;  4A5R A;  1RCJ A;  4WL9 A;  3RXW A;  1XJ3 A;  1CEF A;  4PKY A;  3LGO A;  5DF7 A;  1N4O A;  2BLS A;  4HJ3 A;  1QMF A;  2P9V B;  4WZ5 A;  1FSW A;  2FZ0 A;  3ULF A;  2LB9 A;  4LCM A;  2PR6 A;  3QHY A;  4R3J A;  1L0E A;  4S2P A;  3Q81 A;  4I38 A;  4HEF A;  3UME A;  3FZC A;  2VK3 A;  5IS1 A;  1RP5 A;  2JKR M;  1KGG A;  3CI6 A;  3H82 B;  3BFD A;  4PMA A;  2O9B A;  2XGN A;  3C4P A;  4BMW A;  4KQO A;  1XXM A;  3SS4 A;  3C2W A;  3WS0 A;  5FA7 A;  3IXD A;  5HZH A;  2WZZ A;  4E3I A;  3DW0 A;  1CQA A;  4IJG A;  2GJ3 A;  1KE0 A;  3OCL A;  4JPM A;  4B88 A;  5AJG A;  3PXP A;  1RGY A;  2XD1 A;  3T1Q B;  3ZNY A;  4BL3 A;  2X01 A;  3T4K A;  1S66 L;  3ZG7 B;  1G68 A;  1ES5 A;  2PD8 A;  5FI6 A;  4MBK A;  2ZOI A;  1T1C A;  4P87 A;  4Y17 A;  3LCE A;  3FPV A;  1ZG6 A;  1DP9 A;  2J8Y A;  2AVX A;  3PBQ A;  2WKP A;  4FTX A;  1N9O A;  5DJU A;  3BEB A;  1TS7 A;  4QD4 A;  1DP6 A;  1X0O A;  1N9N A;  4PM8 A;  3EOI A;  4I5S A;  4YOF A;  2Y2J A;  3E2L A;  3A0V A;  1IYO A;  4BEN A;  3LR4 A;  1S4R A;  2V1A A;  1K4F A;  1W8Q A;  3UE1 A;  4KZ4 A;  3MZD A;  3FYZ A;  4E6W A;  1LHY A;  1GHP A;  4M4X A;  4OQ0 A;  4R4S A;  2HP9 A;  1HD8 A;  1XA1 A;  2XEP A;  3BY8 A;  5F69 A;  4EW7 A;  3K3C A;  1LL9 A;  3G2Z A;  1AWI A;  3CPT A;  3P09 A;  3BLM A;  3T12 B;  2E8J A;  3GMW A;  5CHU A;  4R0Q A;  3E98 A;  1JNU A;  4E3O A;  4HOI A;  4DE1 A;  3GRJ A;  3FC7 A;  4UA7 A;  1Z6F A;  4EXO A;  1H3Q A;  1ZHH B;  2VGL M;  2XR0 A;  1BT5 A;  4Z1W A;  1ACF A;  4GD8 A;  4K08 A;  3LIA A;  5CX7 A;  2VKS A;  3BY9 A;  5DFX A;  2GX5 A;  2FH5 A;  4N9K A;  5EVI B;  4G3W A;  3QNC A;  5MC7 A;  4NKP A;  5FEF A;  2Y59 A;  3V39 A;  5HPF A;  2ZMF A;  5EEC A;  4BWI A;  1UWN X;  1S6R A;  2QJ5 A;  3SS5 A;  4HI4 A;  3PR6 A;  2XFT A;  1S4S A;  3E4P A;  3IS2 B;  3OLO A;  1S1Y A;  3FPW A;  3BYD A;  4WEK A;  4NXE A;  2XA7 M;  4OP8 A;  2WKR A;  4LFU A;  1EW0 A;  4JLF A;  1EWZ A;  4K91 A;  4E3N A;  4RA7 A;  2JKT M;  2A49 A;  1GA0 A;  4UQI S;  4QB8 A;  4IVI A;  4I3A A;  5KIZ A;  4MLL A;  3BFG A;  4WMC A;  3B33 A;  2HGV A;  2Y4A A;  2BTF P;  5CHM A;  1K56 D;  1Q2Q A;  2ZC7 A;  2E8I A;  2I9V A;  1P0Z A;  3CMZ A;  3E2K A;  2Y2K A;  3Q7Z A;  3CLO A;  3BWL A;  3NCK A;  2K7S A;  5HD3 A;  3S4X A;  5AVF A;  4HBU A;  2EX8 A;  2R9X A;  3UNW A;  3KYE A;  2QKP A;  2P7J A;  1H5X A;  1V9Y A;  4JKT A;  5AVE A;  4OOL A;  5FI2 A;  2W3E A;  3S7O A;  3JPU A;  3N8R A;  4P6Z M;  4CLC C;  3IBR A;  3UE3 A;  1TVF A;  2OSU A;  3UB8 A;  4Y13 A;  5F1G A;  4BBT A;  2KOI A;  4MBF A;  4KZ5 A;  1LLB A;  3CPT B;  3OC2 A;  1K57 C;  3V3S A;  2HDS A;  1BUE A;  5HX9 A;  2P08 A;  4MBH A;  4E3J A;  4HP4 A;  4I39 A;  5HWT A;  2XD5 A;  4C3Q A;  1OPX A;  4X68 A;  2Z2L B;  4IBR A;  1H8M A;  1DY6 A;  1DJA A;  1NRF A;  2G7U A;  3QP4 A;  4GKU A;  3HL9 A;  4EBN A;  4B9O A;  3N6I A;  1W8Y A;  3FG8 A;  5TBM B;  3CIT A;  1BYW A;  2XDM A;  1UGU A;  4N92 A;  1VET B;  3NBL A;  5HFO A;  5A93 A;  4L9G A;  3T50 A;  3IX4 A;  1YT4 A;  4CLC A;  4BJP A;  3TG9 A;  4GS9 A;  2ZOH A;  5GL9 A;  4CJN A;  3E0Y A;  1TEM A;  1K57 A;  2PU2 A;  3UN7 A;  5FDH A;  5EOE A;  4ETX A;  2HP5 A;  4OPY A;  3F1N B;  3HLW A;  3LIF A;  2XQZ A;  1CI9 A;  3G31 A;  3PAE A;  1EI5 A;  5FQQ A;  5CER A;  3R7W A;  2WGW A;  5J7E A;  2H0Y A;  2B18 A;  5GHZ A;  3UPP A;  3C38 A;  5KSC A;  3NHQ A;  4HJ6 A;  2WAE A;  4OP5 A;  3BRM A;  2PAV P;  4BD0 A;  3DTK A;  3KSI A;  5DKL A;  1DJB A;  3UDF A;  1XFN A;  3AGF A;  2Y2H A;  5A90 A;  3IH8 A;  5DTT A;  1H8Y A;  4OPZ A;  1CJF A;  3G2Y A;  2C5W B;  3HLC A;  5CED A;  1LL5 A;  5HPI A;  2WUQ A;  5FAS A;  3CAX A;  1D7E A;  3AGD A;  5TGF A;  5IU1 A;  3VOY A;  1MXO A;  1SZV A;  1IYQ A;  1ODV A;  5FQ9 A;  1MKI A;  2P9V A;  4JXV A;  4O7D A;  4OQG A;  5I5L A;  4DDY A;  1XP4 A;  5HAP A;  1XFQ A;  4DXB A;  3L9K A;  4FH2 A;  2WGI A;  1XJ2 A;  4MN7 A;  4KZ6 A;  3VP3 A;  4R70 A;  4EUZ A;  4KZA A;  5FQI A;  1TDG A;  4FD8 A;  4L0L A;  3IT9 A;  2J7V A;  3D4F A;  3H82 A;  1T18 A;  4QHC A;  2VEA A;  2FFF B;  5F82 A;  4GJ4 A;  3NOP C;  3VFF A;  1NYM A;  5GLA A;  3LR5 A;  1YMX A;  1KGE A;  3ZVW A;  1YLJ A;  2W3F A;  1ALQ A;  4II7 A;  2W3G A;  3T4L A;  3ZG5 A;  1JWV A;  1PIO A;  3C7V A;  4LGW A;  2A24 B;  1BLC A;  2OLU A;  2HDQ A;  2HV1 A;  2INW A;  3RXX A;  3UPO A;  1LSX A;  1UWP X;  3E4Q A;  2VX8 A;  4UEY A;  1OTB A;  3IF6 C;  2V0W A;  4NEE D;  3GDI A;  1F9I A;  4KQD A;  5HDD A;  3WS5 A;  2VJW A;  3LID A;  4LV1 A;  4WBG A;  3TOI A;  4E3M A;  4H6J A;  1MPL A;  1U60 A;  3SS3 A;  2QHK A;  4QU3 A;  4ME4 A;  3UE6 A;  3VSK A;  4MNR A;  3ZCZ A;  4UHU A;  4PM7 A;  2IWC A;  3MXR A;  4EES A;  2O0Y A;  4XT2 A;  3NDG A;  2ZM0 A;  1MWR A;  4RX2 A;  4ZDX A;  5HL6 A;  3DTE A;  2Q0O A;  4GZB A;  4EQI A;  2JN7 A;  4L9F A;  4GB7 A;  4GLQ A;  3N4I A;  1HTZ A;  3T4S A;  3WRT A;  3UDI A;  1C3B A;  1VM1 A;  3HVF A;  4LLO B;  1Z09 A;  1E4D A;  3FV7 A;  2ZL1 B;  3KSG A;  4R4R A;  3IF6 A;  1KE4 A;  1XX2 A;  3PYP A;  3MBZ A;  5HAQ A;  2D02 A;  2ZC3 B;  5C5K A;  2JCH A;  2EFX A;  3M6B A;  4S2J A;  4B4Z A;  4O0P A;  2L4R A;  5FL3 A;  3HCY A;  3NUL A;  2EX6 A;  2JE5 A;  2ZC6 B;  3MZF A;  5EVI A;  5G4Z A;  4XUX A;  4LRX C;  3IQA A;  4GN2 A;  4WUJ A;  4P6B A;  1IYS A;  4U3T A;  3RH8 B;  3ZNT A;  2Y2N A;  5FQM A;  4X55 A;  5FAT A;  4JXS A;  2RL3 A;  3EWK A;  1G5U A;  4ARZ B;  4QPR A;  1TS6 A;  3IS2 A;  5CTN A;  3UMD A;  5TJJ A;  3JVV A;  5FI7 A;  4KZB A;  5E2F A;  2ZC5 B;  1ESI A;  2Y2G A;  1HZO A;  2Y2O A;  4RYE A;  2OWH A;  1YLT A;  2QWS A;  3TW8 A;  1FCO A;  5HAR A;  4NXG A;  5AQA A;  2OLV A;  4DJ2 A;  5EVL A;  4HY8 A;  1E3U A;  3T1X A;  4OKP A;  3A3D A;  2ZLY A;  2ZMA A;  3KYQ A;  4KG5 A;  2R9W A;  2EA9 A;  1ZKJ A;  4O01 A;  3IX8 A;  5DKK A;  3LIB A;  2EX2 A;  2QJ7 A;  3WWX A;  2DMW A;  2NUP C;  3IX3 A;  5G18 A;  4PM6 A;  2JBF A;  2V1B A;  3LEQ A;  2A3U A;  4KQQ A;  1S67 L;  1FIL A;  1VHM A;  2KDK A;  1BLP A;  3A3J A;  4EEP A;  4H6J B;  3SH7 A;  3VSL A;  3GEC A;  1YLP A;  2L1M A;  3BFC A;  4IVK A;  3LEZ A;  1HVB A;  1MWT A;  4DE0 A;  1K6S A;  4XT2 B;  4EET B;  1CF0 A;  4RQ9 A;  1L0F A;  3NDE A;  1N9B A;  3QP2 A;  1L0D A;  1GSX A;  4GDB A;  4N9L A;  3NOT C;  1DRM A;  3T4Q A;  2WZX A;  4B4X A;  1G28 A;  2XRN A;  4ZJ2 A;  4CLC E;  1KDW A;  3G4P A;  5G4Y A;  1BZA A;  2WKE A;  4EU0 A;  3PHY A;  5A8B A;  1J9M A;  1OT6 A;  1XJ4 A;  3O88 A;  3H9W A;  3W4O A;  3IF6 B;  1ONG A;  4OLD A;  3HLE A;  2HDU A;  3MR0 A;  2W3D A;  2OOL A;  3HUO A;  5TBM A;  1PWC A;  3CUE C;  4JGR A;  3B3X A;  1LSV A;  5FAP A;  2FFY A;  2V8F A;  3UE0 A;  1VET A;  5A91 A;  4HIA A;  3LO7 A;  2JKG A;  1FQG A;  2VGL S;  1HLU P;  2PT7 A;  1YKD A;  5F5Y A;  3OPR A;  2PBD P;  4DXC A;  2EWV A;  3HJK A;  4LRY C;  3Q1F A;  2J3T D;  4ZJ1 A;  3F1N A;  1WA9 A;  4WMC D;  2IA2 A;  2J80 A;  4MDZ A;  4NG2 A;  3IHB A;  5HL1 A;  3IH9 A;  4GCZ A;  1GCE A;  2ACG A;  4DKI A;  1OJG A;  3LUQ A;  3UO9 A;  5K5B A;  4O8G A;  3BFF A;  4DRT A;  1PI5 A;  3CUE A;  4Q8I A;  5E2E A;  4HHD A;  1ES3 A;  2ZC4 B;  1ZTU A;  2XA7 S;  3ICY A;  3VMA A;  3IHA A;  3VE4 A;  4DJ3 A;  3S22 A;  3NC8 A;  3SZT A;  4NXB A;  3ZGA B;  2G2U A;  4E3L A;  4OPQ A;  3R4K A;  2P74 A;  3MQQ A;  2GDN A;  2W1R A;  4DF6 A;  4GHI A;  3MZE A;  2OAQ 1;  2PR5 A;  3T4T A;  5EE8 A;  1NWZ A;  5AQB A;  4LCL A;  5GLB A;  3LR3 A;  5L8M A;  1MWS A;  1QME A;  4U0X A;  1E25 A;  1D06 A;  4OLG A;  5D3O A;  1GHM A;  2MJ6 A;  1XGJ A;  2O9C A;  4X1L A;  2VV6 A;  3W4Q A;  4MEZ A;  3CZD A;  5A92 A;  3Q7V B;  5GLC A;  1KE3 A;  2VV7 A;  4KZ7 A;  4OVD A;  4Y0T A;  2WK0 A;  2V0U A;  4WF0 A;  2XRO A;  3A3F A;  4KG2 A;  2KX6 A;  4P6Z S;  1ZG4 A;  4EEU A;  3BQ8 A;  3CWF A;  4OH0 A;  3IBJ A;  4CLC D;  1A0K A;  2M7V A;  2A24 A;  1PRQ A;  1K4E A;  3FWL A;  1SKO B;  3G35 A;  3L7H A;  1YPR A;  3WS1 A;  4GW9 A;  2D01 A;  2V1Z A;  1WE4 A;  5IHV A;  2JKR I;  3VP2 A;  3S7P A;  3W8K A;  5FAO A;  5CEC A;  1K6R A;  2CC1 A;  4WEL A;  1IKG A;  2BAS A;  2PYR A;  4X69 A;  1SKF A;  2UWX A;  2I72 A;  3ZDJ A;  2ZQA A;  3EQU A;  1MBL A;  2HJE A;  1YLY A;  5KZH A;  5CGW A;  3ZQ5 A;  5I94 A;  1YLZ A;  1NYY A;  2CMN A;  4Q0I A;  3TSG A;  1P97 A;  2OAP 1;  5KSH A;  2P04 A;  4HBT A;  3BW6 A;  1YQS A;  1VB6 A;  4GNU A;  1ES2 A;  1PWG A;  4PHT A;  1YAX A;  4OQI A;  2ZL1 A;  1OTA A;  4MN5 A;  4F94 A;  3H7W B;  5J4E A;  1FCM A;  3HUN A;  5HWV A;  3A0R A;  4GHI B;  3VOL A;  1F5M A;  4I3J A;  2Q9N A;  4FSF A;  4WN5 A;  2QZ6 A;  4QJG A;  2ZBB A;  4JBF A;  3NJA A;  5L10 A;  4BBU A;  5F6A A;  5DJT A;  2NUT C;  1SHV A;  3PBR A;  1OME A;  3N7W A;  1MZU A;  4CQH A;  3C8C A;  1OTI A;  5HDS A;  1NLY A;  4GDN A;  4Y0O A;  4ID4 A;  5TR7 A;  4K0W A;  2V20 A;  4L9E A;  4ARZ A;  4YIN A;  1CI8 A;  3F1O A;  3ZG8 B;  1TS0 A;  2JHE A;  3WS4 A;  1F2K A;  3CG5 A;  5J8X A;  2H0T A;  3E4O A;  4KG6 A;  5HDC A;  3MKF A;  2XFS A;  4LRZ E;  3IWQ A;  5DVA A;  3V50 A;  1KOU A;  4N1X A;  4N1H A;  4Y3I A;  3ZG0 A;  5LBR A;  1MC0 A;  1XA7 A;  4ZRR A;  1V9Z A;  5EV0 A;  2O9A A;  5EM0 A;  1K0K A;  4KQR A;  1W5D A; 
#chains in the Genus database with same CATH homology
 3C30 A;  3B47 A;  3T4J A;  1EW0 A;  1OT9 A;  3KYQ A;  4F3L A;  1S1Z A;  4R38 A;  2EA9 A;  3U2A A;  5EFW A;  4PAU A;  4O01 A;  2PYP A;  2JKT M;  2ZMV A;  5DKK A;  3LIB A;  4IUH A;  2QJ7 A;  2DMW A;  2NUP C;  4UQI S;  1W63 M;  5KIZ A;  4I3A A;  4EQ1 A;  2V9A A;  2V1B A;  4YWZ A;  3B33 A;  1YSP A;  2HGV A;  4F3L B;  1S67 L;  3O5Y A;  3V67 A;  5HWW A;  3PBN A;  2JKT I;  3MJQ A;  1VHM A;  2EWW A;  2KDK A;  2I9V A;  1P0Z A;  4EEP A;  1NLZ A;  4H6J B;  3GEC A;  3CLO A;  3BWL A;  2L1M A;  4I3I A;  2K7S A;  2PHY A;  3SW1 A;  5HD3 A;  5AVF A;  3LFV A;  3BQA A;  4XT2 B;  3T4O A;  3PBO A;  4EET B;  2QKP A;  2P7J A;  4IUK A;  4RQ9 A;  2QYB A;  1V9Y A;  5AVE A;  3UB9 A;  4HQA A;  4OOM A;  1GSX A;  3LI8 A;  4OOL A;  3NOT C;  3JVU A;  5HSQ A;  1DRM A;  3T4Q A;  2W3E A;  3S7O A;  4P6Z M;  1G28 A;  2XRN A;  4CLC C;  3IBR A;  3UE3 A;  4CLC E;  1Y28 A;  3UB8 A;  5G4Y A;  4BBT A;  4EU0 A;  2KOI A;  3PHY A;  3MF0 A;  5A8B A;  1OT6 A;  1XJ4 A;  2VZW A;  4Q0J A;  3H9W A;  3KSF A;  2K31 A;  3OC2 A;  2H28 A;  3LR0 A;  2P08 A;  3MR0 A;  2W3D A;  4EUV A;  2VLG A;  4JGQ A;  1IOU A;  4HP4 A;  4I39 A;  2OOL A;  5HWT A;  4WEJ A;  5TBM A;  3EGX C;  1P9R A;  3CUE C;  4JGR A;  1OPX A;  1LSV A;  3MMH A;  2Y79 A;  3P01 A;  1TS8 A;  1XJ6 A;  3ZYT A;  1H8M A;  2G7U A;  1YSQ A;  4MN6 A;  3F1O B;  3OOV A;  4MCW A;  2Z6C A;  4HIA A;  4B9O A;  4JGO A;  3FG8 A;  5TBM B;  4HJ4 A;  3CIT A;  1BYW A;  2A2L A;  1UGU A;  2O99 A;  1GSV A;  2VGL S;  2PT7 A;  3OCN A;  1YKD A;  4DMZ A;  5F5Y A;  2L0W A;  3RFB A;  4L9G A;  1STZ A;  3T50 A;  1NRJ A;  3PBS A;  3LIC A;  2EWV A;  1T1A A;  3KO6 A;  3HJK A;  1G6O A;  4CLC A;  4LRY C;  4BJP A;  3LYX A;  4GS9 A;  2J3T D;  2ZOH A;  3NOU C;  3F1N A;  1WA9 A;  2J3W A;  2IA2 A;  2J80 A;  4MDZ A;  3E0Y A;  4DN0 A;  1LL8 A;  4GCZ A;  4CLC B;  4ETX A;  3K3D A;  1OJG A;  2Z6D A;  3LUQ A;  4GS9 B;  2VV8 A;  2W0N A;  4BBV A;  5K5B A;  3OBF A;  4JGP A;  3F1N B;  3LIF A;  4O8G A;  3CUE A;  4G3V A;  4AFI A;  4HHD A;  1T1B A;  3VE3 A;  1LT0 A;  1DP8 A;  3R7W A;  5J7E A;  3MQO A;  2B18 A;  2W1T A;  4YNR A;  1ZTU A;  2XA7 S;  3ICY A;  3C38 A;  4WLA A;  2PD7 A;  2VA0 A;  4DJ3 A;  3VE4 A;  3NHQ A;  4HJ6 A;  4NXB A;  4E04 A;  3LIE A;  3KSH A;  3R7W B;  3KSI A;  3R4K A;  5DKL A;  2YKF A;  2W1T B;  1MKM A;  3MQQ A;  2W1R A;  4GHI A;  3MXQ A;  5J3W A;  2OAQ 1;  1XFN A;  2PR5 A;  3T4T A;  1NWZ A;  3TE8 A;  4LPZ A;  3K2N A;  3LR3 A;  4G3K A;  3HJI A;  5L8M A;  5HPI A;  2GZA A;  3W2Z A;  4EER A;  3D72 A;  5HD5 A;  1GSW A;  1D06 A;  3CAX A;  2M7U A;  1D7E A;  2MJ6 A;  5IU1 A;  4B93 A;  2O9C A;  1ODV A;  2VV6 A;  3F1P A;  5I5L A;  2K2N A;  3EEA A;  1OJ5 A;  3EQV A;  2W3H A;  3A0S A;  4R6L A;  1T19 A;  1XFQ A;  2VV7 A;  4WL9 A;  3S7Q A;  3RTY A;  1XJ3 A;  5F68 A;  4PKY A;  2V0U A;  4WF0 A;  1XJ2 A;  4MN7 A;  2XRO A;  3MFX A;  4HJ3 A;  4R70 A;  2KX6 A;  4P6Z S;  4EEU A;  4L0L A;  3F1P B;  5IT5 A;  2FZ0 A;  3ULF A;  2LB9 A;  3BQ8 A;  3CWF A;  2PR6 A;  2HF6 A;  3IBJ A;  4CLC D;  2J3T C;  3H82 A;  4HH2 A;  2R78 A;  1T18 A;  2M7V A;  4I38 A;  2VEA A;  3UME A;  4GJ4 A;  5IS1 A;  3NOP C;  2A24 A;  3LR5 A;  2JKR M;  1TD5 A;  2W3F A;  1W63 Q;  4II7 A;  2Y8H A;  3CI6 A;  3H82 B;  2W3G A;  3B42 A;  3T4L A;  2O9B A;  4GW9 A;  4UQI M;  4BMW A;  4KQO A;  2D01 A;  3C2W A;  3KYZ A;  2XSS A;  2JKR I;  2A24 B;  3S7P A;  5HZH A;  3KX0 X;  4IJG A;  4Q0H A;  2HV1 A;  2INW A;  3EGD C;  1LSX A;  1UWP X;  4WEL A;  4IHQ A;  2GJ3 A;  3E4Q A;  3UB7 A;  3BJN A;  3OCL A;  2VX8 A;  4UEY A;  3VV4 A;  2BAS A;  2PYR A;  5AJG A;  1OTB A;  3PXP A;  2V0W A;  4NEE D;  3GDI A;  1F9I A;  4KQD A;  3MQ0 A;  3T4K A;  1S66 L;  2WKQ A;  5HDD A;  4ETZ A;  2VJW A;  3LID A;  2PD8 A;  3EQU A;  4H6J A;  2ZOI A;  3PBT A;  3LI9 A;  1T1C A;  4MMN A;  2QHK A;  2HJE A;  3FPV A;  4ME4 A;  3ZQ5 A;  3UE6 A;  3EEH A;  2YKH A;  1DP9 A;  3UB6 A;  2CMN A;  3PBQ A;  4Q0I A;  2WKP A;  1P97 A;  2OAP 1;  1N9O A;  5DJU A;  3H7W A;  2O0Y A;  4EES A;  5KSH A;  4XT2 A;  4HH3 A;  2P04 A;  3BW6 A;  1TS7 A;  1DP6 A;  1VB6 A;  1X0O A;  1N9N A;  5HL6 A;  3TRC A;  3EOI A;  4I5S A;  4YOF A;  2JN7 A;  4L9F A;  1P9W A;  4PHT A;  3A0V A;  3LR4 A;  1YAX A;  1S4R A;  2V1A A;  1OTA A;  4MN5 A;  3H7W B;  2GNX A;  5J4E A;  2M1C A;  4GLQ A;  3G6O A;  1OTD A;  4HNB A;  5HWV A;  3A0R A;  4M4X A;  4FOF A;  4GHI B;  3T4S A;  3VOL A;  1F5M A;  2LB5 A;  4I3J A;  4FSF A;  3BY8 A;  5F69 A;  4EW7 A;  3K3C A;  3DBA A;  4WN5 A;  3TJZ C;  4LLO B;  2ZBB A;  3NJA A;  3KSG A;  4KUK A;  3PYP A;  4BBU A;  2D02 A;  5F6A A;  5C5K A;  4PKY G;  5DJT A;  3S7N A;  2NUT C;  3E98 A;  2W27 A;  3PBR A;  4O0P A;  1JNU A;  1MZU A;  2L4R A;  4HOI A;  4CQH A;  5FL3 A;  3HCY A;  4NXF A;  3FC7 A;  3C8C A;  1F98 A;  1OTI A;  4EXO A;  5HDS A;  1H3Q A;  1ZHH B;  5G4Z A;  1NLY A;  4R3A A;  2VGL M;  4KUO A;  4LRX C;  4L9E A;  4Z1W A;  4ARZ A;  4K08 A;  3F1O A;  1TS0 A;  3LIA A;  4WUJ A;  4HP9 A;  1LSW A;  2KLI A;  5CX7 A;  2JHE A;  3RH8 B;  2VKS A;  3BY9 A;  4Y5F A;  5DFX A;  2GX5 A;  2FH5 A;  1IFQ A;  3E4O A;  1N9L A;  5HDC A;  4G3W A;  5MC7 A;  4NKP A;  3EWK A;  4LRZ E;  4ARZ B;  4QPR A;  1TS6 A;  3IS2 A;  3UMD A;  5HPF A;  2HJ9 C;  5DFY A;  2B02 A;  2ZMF A;  1KOU A;  5TJJ A;  3JVV A;  4BWI A;  1UWN X;  2QJ5 A;  4HI4 A;  4Y2F A;  4Y3I A;  3PR6 A;  5LBR A;  2OWH A;  1S4S A;  3E4P A;  2OWJ A;  2QWS A;  1MC0 A;  3IS2 B;  3P7N A;  1OTE A;  5DF9 A;  3TW8 A;  3OLO A;  2PDR A;  4ZRR A;  1V9Z A;  1S1Y A;  3D3O A;  4NXG A;  3FPW A;  1TF1 A;  2O9A A;  4DJ2 A;  4WEK A;  4NXE A;  2XA7 M;  2WKR A;  4HY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...