4FUWA

Crystal structure of ego3 mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
151
structure length
140
Chain Sequence
SKNVKGFLENTLKPYGSLQSSMIITATNGGILSYATSNNSINEINSVNNLKMMSLLIKDKWSEDENDNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SLM4
publication title Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 40
structure length 140
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16818 SLM4 Protein SLM4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4fuwA01
4FUWA 3T1XA 2ZL1A 3T12B 1D1JA 5FEFA 3NULA 5EM1A 2PBDP 3LEQA 3L7HA 1J3WA 1ACFA 3KYEA 3NECA 1AWIA 3LGOA 1VEUA 1CJFA 5EM0A 3MS6A 2ACGA 1A0KA 3UB5P 2E8JA 1PNEA 3DAVA 2V8FA 1Y4OA 1Z09A 1FILA 1CQAA 1SKOA 1CF0A 4X1LA 4X25A 5EV0A 4X1MA 3CPTB 1PFLA 1VETB 2BTFP 5FEGA 1HLUP 2VK3A 1VEUB 3CHWP 4QWOA 5FDSA 2ZL1B 2V8CA 1K0KA 1FIKA 1G5UA 2PRFA 2B95A 3D9YA 2PAVP 1F2KA 1SKOB 2HZ5A 1SZVA 2JKGA 4FTXA 3CPTA 1PRQA 3T1RA 1VETA 4D60A 3L9KA 4ESPA 1YPRA 3MSHA 5EVEA 3T1QB 3T1SA 3U4LP 2JKFA
chains in the Genus database with same CATH superfamily
5FI7A 3ZFZA 2WAEA 4WELA 5KMWA 1HTZA 5FEFA 3T4JA 3BM6A 4OVDA 1ES2A 3JVVA 1XPBA 4YWZA 4DRTA 5BOHA 3A3FA 4NK3A 1YM1A 4I5SA 4KZAA 3BFFA 3UDXA 1H8YA 2HGVA 4EUVA 5EPHA 4KUKA 3M6HA 1LLBA 1FOFA 3G32A 1WA9A 2HDQA 4MCWA 2V8FA 4R38A 3A0RA 1KOUA 1SKOA 3KYZA 3CITA 5CHJA 5FSRA 1OJ5A 3B42A 3MZFA 4WMCD 3UPNA 1S4RA 4C6YA 1Q2QA 3VOZA 4WEKA 2PHYA 5EUAA 3VSLA 1JWVA 3AGFA 4YOFA 2Z6CA 2B02A 3IX3A 1LI0A 5E2HA 2JKTI 4N9KA 5DF7A 3D9YA 3FG8A 3NCKA 4Y0TA 2G7UA 4JGRA 4X68A 5KSCA 1PRQA 1XP4A 2O9CA 2AVXA 3MSHA 4F3LA 1K56A 3RFBA 3D72A 5CECA 3Q82A 1K38A 4Y17A 3N7WA 1FCOA 2WYXA 3ITBA 3ZGAB 3OCLA 2PYPA 1KGFA 2QPNA 1G28A 3QP2A 5EFWA 5HPFA 2O0YA 3GRJA 4HY8A 2DNSA 3BQ8A 2ZC6B 4Q8IA 4FD8A 4PKYA 3UB5P 2Y2LA 3N8LA 5GHYA 3ZG0A 4AFIA 2BG1A 4R1GA 3HLDA 1BYWA 3GSGA 4IHQA 3UDIA 1TS8A 2VZWA 4X1MA 4DKIA 3WS5A 2OWHA 1PI5A 3F1PB 1MZUA 1P97A 3A0SA 3E4OA 1JWPA 1OTEA 3PXPA 4OPZA 3EQVA 1T19A 5D3OA 1MWUA 3T4LA 5J8XA 3P09A 5FQIA 5CGWA 4GDNA 2FH5A 1P9RA 1OJGA 3A0VA 1FIKA 3RJUA 5FATA 2B95A 3FWLA 3B47A 4MDZA 1SKOB 4KQOA 2XA7S 4LPZA 1QMEA 3QP1A 4HP9A 4XXRA 3FPVA 1OTDA 2ZQ8A 3SS3A 4LV3A 4JXVA 3GR2A 4OLDA 1ZTUA 2W1RA 3LIFA 3HJIA 5I5LA 4OQGA 1NLYA 4E3OA 2Y91A 3OCNA 3VP4A 2KDKA 3R7WA 4ARZA 1MKMA 2VGLM 4U3TA 5EVID 4NKPA 4WM9A 1CJFA 2VJWA 4GNUA 3VP2A 4ME4A 3FYZA 2Y59A 1MXOA 2LB5A 2WKPA 3HUNA 4WF0A 5HAQA 1K57A 4MNRA 5HFOA 2V1BA 4F3LB 1IELA 3ZDJA 2HF6A 5A92A 1M6KA 1FILA 2VV7A 2OWJA 4QB8A 1CF0A 1JTGA 5EOEA 2JE5A 1IEMA 3CPTB 2D02A 1T1CA 1PYYA 2JC7A 1BTLA 4O8GA 4BD1A 3UMDA 2EFUA 5HWWA 2W27A 3O87A 5CGSA 2VK3A 1Z6FA 4U0TA 3DWKA 2H0YA 5AQAA 5GLCA 2HJEA 2HDSA 4I3JA 3CZDA 1LL8A 2M7VA 3ZG5A 4S2IA 2XEPA 1RGYA 1KE3A 3CG5A 2H0TA 4Y5FA 2K31A 1XXMA 1W8QA 3P98A 3S1YA 4XUXA 2EA9A 1GSXA 4KZ4A 2Y2OA 4GZBA 3LR0A 3CUEA 2O9AA 1S66L 3HLEA 3O86A 4HH2A 5M19A 2J80A 5FQKA 1IFQA 2ZM0A 4BJPA 1J9MA 3DTMA 4XT2A 1BULA 5G4ZA 4GD6A 4FUWA 4P6BA 1W8YA 5GHZA 5KIZA 2FFFB 2PBDP 2O99A 3LEQA 2W3EA 4II7A 3LI8A 4HJ4A 4GKUA 3ULFA 1ACFA 3S7NA 3VP1A 5DKKA 1IYOA 2W3GA 3MQ0A 4OOMA 4ZJ3A 4M3KA 2Q9MA 2ZOIA 2CC1A 4JF6A 1CK3A 4BMWA 4CLCB 2VEAA 5M18A 1PNEA 2XRNA 2J9PA 4RQ9A 1TF1A 1Z09A 3P01A 2UWXA 3UNWA 3H82B 3S7OA 4HBUA 3ZYTA 4KZ5A 4RX2A 4JXSA 4UAAA 1XX2A 2HDRA 3UE1A 4P85A 2EX9A 5E2FA 5K5BA 2Y2NA 3PBSA 4KENB 4KZ7A 1CEGA 1EROA 4DDSA 4ZJ1A 5HARA 4QWOA 4L9FA 4KUOA 1OTBA 2ZQ9A 2PU4A 2ZL1B 4JPMA 5DFYA 3HJKA 4JKTA 1NYMA 2PAVP 1DJBA 2EFXA 1X0OA 1VHMA 1DP9A 3KSIA 5TJJA 4PM7A 2M1CA 4FTXA 4LENA 1BLSA 4E6WA 2Y79A 4KG5A 3HBRA 3WS4A 4IVKA 1NRFA 3U4LP 2JKRM 4WMCA 3WRZA 3VP3A 2XD1A 4HP4A 3SOIA 3T4TA 4BD0A 3TW8A 4D2OA 5L10A 1GHPA 5TR7A 3VFHA 1G6AA 2WGIA 2ZD8A 3KYEA 1D7EA 1LL5A 3IS2B 1YMXA 5F68A 1L0GA 3MS6A 1OTAA 3WS2A 2ZC7A 3K3DA 4R6LA 2A49A 1AXBA 1ONGA 1Y4OA 4XT2B 1ONHA 5FAOA 4OLGA 3NIAA 1LT0A 1UWNX 3GVBA 2I9VA 4R3AA 1VETB 5MC7A 3C8CA 5F1FA 2XD5A 3GV9A 3MBZA 3IHAA 1LI9A 5HAPA 2B18A 4BWIA 3MFXA 4EEUA 5FDSA 4OQ0A 3DTEA 3LIDA 5GLDA 3D4FA 4NETA 2QHKA 3VMAA 2RL3A 2HZ5A 2QZ6A 2WKQA 1KVLA 4LRYC 1TD5A 5G18A 4EBLA 3I7JA 1NRJA 4ESPA 1JNUA 1YLJA 4P6ZM 3IX4A 4EW7A 3ISGA 4Y15A 5FQMA 2Y2QA 3DBAA 3SZTA 3VOYA 5CEDA 4Q0JA 3MZEA 1D1JA 1C3BA 2XSSA 1SHVA 3MFDA 1IKGA 3C4OA 3S7QA 2ZM8A 4HNBA 2L1MA 3LIBA 2JKTM 3LYXA 3Q1FA 3LGOA 4PM6A 3OPRA 3UPPA 5M1AA 2PR5A 2ZOHA 4EBNA 3EGXC 3G4PA 1ZKJA 2WGWA 3VV4A 4ZTKA 5EOOA 2ZQCA 3MQOA 1CQAA 1PWGA 5F1GA 3Q07A 5CRFA 1ZG4A 3W8KA 3VSKA 3IQAA 5AQBA 4PM8A 4JGOA 4X6TA 3B3XA 3BY9A 5E2EA 3CMZA 4EERA 3EGDC 4N1XA 4WZ5C 2EWVA 1O07A 5CHMA 5EVIA 5FASA 5TBMA 3UE0A 3W2ZA 1F98A 1PWDA 1EI5A 2XDMA 2V9AA 2Y4AA 5HDDA 4MN5A 3UB7A 3MKFA 4OQHA 1MWRA 1YKDA 1YLYA 2P08A 1WE4A 4Z9QA 1L0EA 4G3VA 3A3EA 2ZC3B 3T1QB 5DTTA 2WKEA 2HDUA 1QMFA 2VGLS 3IF6A 3UDFA 1NYYA 3UE6A 3S22A 2H10A 3T12B 5DKLA 4LLOB 4PAUA 5EM1A 4B9OA 5DF9A 4HEFA 4PM9A 3HLBA 1ESIA 5A90A 2ZMAA 1PZOA 2W0NA 4DE3A 1TVFA 2QMIA 3BEBA 4HHDA 2GJ3A 4FH2A 4PMAA 5J7EA 2E8JA 2Y55A 2EX2A 4R23A 4OKPA 1OMEA 4LV0A 3QP8A 4E3LA 1YLTA 3QNCA 4LV1A 1PIOA 2KOIA 4B4ZA 3MR0A 3NOTC 4Y0OA 5FEGA 3UB9A 5FL3A 5CEBA 2XLNA 3VE3A 1PWCA 2HPBA 3UO9A 1LSWA 3BY8A 3HLFA 3OLOA 5FDHA 3M6BA 5TGFA 5DVAA 1YLZA 3PYPA 4M4XA 3UY6A 4EESA 1L2SA 3BYDA 4ZDXA 4UQIM 2WGWB 1FCNA 5CX7A 1F2KA 1RCJA 3HUOA 3W4PA 4HJ6A 1Y28A 3LFVA 3V50A 1RGZA 1S4SA 3T4OA 4IVIA 4EUZA 2XH9A 4GS9A 1YPRA 3PR6A 3NC8A 3QHYA 1K4EA 1IYSA 3K3CA 3T4SA 3C5AA 5DTSA 3GECA 1SKFA 5FQJA 1ERQA 5EVIB 3VP0A 2A3UA 2L4RA 2WK0A 5J4EA 1KDSA 2Y2KA 4RVAA 4EQIA 3MZDA 3HLWA 1EWZA 3UE3A 2K7SA 1ES3A 2ACGA 3O5YA 3KYQA 3P7NA 3LUQA 3BRMA 4QY5A 5GLBA 4X56A 1GA0A 5F69A 3LIAA 3IF6B 1S1ZA 4E3KA 1ES4A 1H8ZA 3LI9A 4B88A 5C5KA 2ZBBA 5FA7A 4DN0A 2H28A 3FZCA 1EW0A 4NXFA 5TFQA 2YKFA 3C7UA 1STZA 5HWVA 1YAXA 3ZG7B 4EWFA 2Y8HA 5HD3A 1P9WA 1XJ6A 3UPOA 2HP5A 4WUJA 4KZ8A 1K55C 1E25A 1M40A 3VE4A 3K2NA 2X71A 4U0XA 5IT5A 1SZVA 3G6OA 3HREA 4IBRA 2OSUA 1KE4A 3SH9A 2BASA 1F9IA 3SS4A 3B33A 3T1SA 4IEDA 4MMNA 3RXWA 3LR3A 4WZ5A 2OAQ1 4FH4A 4CLCE 4HOIA 2P9VA 1YQSA 5FAQA 3PTEA 2VX8A 1N4OA 1IOUA 4BL3A 2ZM2A 1J3WA 2W3FA 2ZMVA 4HBTA 2X02A 1N9NA 4JXWA 4LRXC 4KQQA 3N6IA 1K6RA 5FQQA 1AWIA 3FV7A 3A3JA 3IBRA 3BFCA 4JXGA 3BWLA 3V67A 5L8MA 3IH9A 3ZHHA 4GS9B 1A0KA 1TDLA 1MWSA 3R4KA 4YFMA 1DRMA 1KE0A 3G2YA 3VFFA 3NI9A 1WYCA 4OONA 1F5MA 3F1NA 4S2KA 1GHIA 4N1HA 1JTDA 1E3UD 3V39A 2B5RA 5AJGA 1XGJA 2FFYA 2VV8A 4C3QA 3KSGA 4PM5A 1KGEA 3PBNA 1ZHHB 2W3DA 4EBPA 4DDYA 4EU0A 2XF3A 3FKWA 2XFSA 3NBLA 4P6ZS 1BUEA 4DXBA 1H0MA 2P7JA 2Y2JA 3KSHA 1UWPX 1YT4A 3NOUC 4KZBA 3OZHA 2IWBA 3R7WB 3NHQA 4ARZB 2V1AA 2JBFA 1CI9A 2JKGA 1K54C 3E2LA 1GHMA 5A91A 3GQZA 3EEHA 2R9XA 4E3NA 1W79A 4GN2A 1L0DA 4HESA 3F1OA 2J3TD 3NY4A 3H7WA 1CEFA 4E3MA 4XUZA 1N9OA 1ES5A 4H6JA 4H8RA 4IUHA 3PHYA 4CLCD 4R4SA 1BT5A 1S6RA 5AQ9A 5EVLA 5HW3A 5CTMA 1W5DA 5EE8A 2DMWA 4Z1WA 1DP6A 1HZOA 2JN7A 2JHEA 2V20A 4JLFA 2VKSA 5GL9A 1OTIA 3CWFA 4K91A 4R0QA 4DE2A 3W4OA 2M7UA 4X1LA 1DP8A 1S67L 3BJNA 5HDSA 1OPXA 1XJ3A 2K2NA 4Y2FA 2BTFP 3HVFA 2GNXA 2WGVA 1TS6A 2E8IA 4WEJA 4YNRA 4DE1A 4DJ3A 3OOVA 2PDRA 1XJ2A 3U2AA 4CPKA 1ODVA 4S2MA 2G2WA 4A5RA 3G35A 1MC0A 1RP5A 4WZ4A 3RXXA 1G5UA 4DJ2A 2XK1A 4NXBA 2WZXA 3V3RA 3JVUA 3KSFA 5CGXA 1HD8A 4WYYA 2OV5A 4QD4A 4S2LA 4IBXA 4WN5A 4LV2A 4NEED 1KDWA 2D01A 3MKEA 1K4FA 1GA9A 4F94A 4R4RA 5IU1A 2PR6A 3EQUA 2QJ5A 3UB8A 4DF6A 3NULA 1LSXA 3DWZA 3TOIA 3DTIA 2Z2LB 3SH8A 5HL6A 2J3TC 4WBGA 2OLVA 3IWIA 4LCMA 5G4YA 4MN7A 2J9OA 4ETZA 3DTKA 4G3WA 2V0WA 4QJGA 3PBTA 4NXGA 3S4XA 4OH0A 3LY3A 4QY6A 4CLCC 3DAVA 2H5SA 1I2SA 4L9GA 4CJNA 4WL9A 4OPQA 4BQMA 4HIAA 4X25A 3H7WB 5HZHA 1NJ4A 5HD5A 4O01A 4WLAA 4JF4A 4I3IA 3HL9A 5KZHA 4S2JA 3CHWP 3CAXA 2PBYA 2DCFA 3KX0X 1K0KA 5AVEA 4Q0IA 4S2OA 4DXCA 5DJTA 4FCFA 4HJ3A 3N8RA 2FZ0A 1VQQA 1SCWA 1K57C 2PD7A 4X69A 4IUKA 2Y2GA 4PPRA 3T4QA 2C6WB 1XA1A 3PBQA 3T50A 3T1RA 3F1PA 1KGGA 4KQDA 1MWTA 2W3HA 1BLHA 3E0YA 5F82A 4BL2A 3S7PA 3C7VA 4Y7PA 4KG2A 4QPRA 2X01A 2XQZA 1ERMA 4IJGA 5JYPA 5E43A 3MXSA 2WAFA 3IH8A 3QP5A 2GX5A 4FSFA 1UGUA 3L7HA 4E3IA 3SS5A 5CERA 5F83A 1K54A 2IA2A 2YKHA 2EX8A 4PKYG 1G6OA 3G34A 2NUPC 3WS0A 3IF5A 3WS1A 5EM0A 2INWA 3CUEC 1BSGA 3BFGA 5AQ7A 1Y54A 1TS7A 2GDNA 5HL1A 3NJAA 3Q81A 3ZCZA 4LFUA 4UEYA 5CXWA 1PW1A 4P87A 1HVBA 5L07A 1XGIA 2R9WA 5HX9A 4N92A 4GB7A 4KQRA 4OOLA 1H5XA 3JPUA 4ETXA 3PAGA 1WYBA 4GDBA 3A3IA 4X53A 4Y13A 4G3KA 1TS0A 1GSWA 2P04A 4Y0UA 4Q0HA 4ZRRA 3EEAA 3SH7A 3PBRA 4BBTA 1NLZA 3V5MA 5CTNA 4MBHA 2P74A 1FR1A 4EETB 2PRFA 4OQIA 2KLIA 2G2UA 3N8SA 2Y2PA 4BLMA 3M2KA 3C38A 2JCHA 2KX6A 3CPTA 2PT7A 1XA7A 1U60A 3ZG9B 1H3QA 3E4PA 3E2KA 3IXGA 4KZ3A 3KO6A 1DJCA 3ZG8B 1E3UA 2VA0A 2Q9NA 2IWDA 4B93A 3IT9A 1MPLA 3DW0A 2L0WA 1NWZA 3IXDA 1N9LA 3VOLA 2PD8A 2W1TA 1IKIA 1ZC2A 4S2NC 3HCYA 4FOFA 5A93A 1K6SA 2A24A 3MF0A 3ITAA 3IHBA 3LICA 4QHCA 3CLOA 1VEUA 2HP6A 4GCZA 3FPWA 3W4QA 4HQAA 5J3WA 3NDGA 3OPHA 1VB6A 5TBMB 3MQQA 2IWCA 5EV0A 3ICYA 3BLSA 5LBRA 1H8MA 5AVFA 3MXRA 2Y2HA 1PFLA 4K0WA 5F6AA 5KSHA 1S0WA 4GJ4A 4LRZE 2EX6A 1LHYA 1N9BA 5HAIA 3M2JA 1BLPA 3JYIA 2HV1A 2EXAA 3IXBA 4K0XA 1I2WA 4CLCA 1CI8A 3IX8A 4DE0A 3LR4A 4O0PA 3TRCA 4JGQA 3LO7A 5A8BA 3H82A 3C4PA 4MEZA 4EV4A 4CQHA 1W63M 1PW8A 5E2GA 2V2FF 3CJMA 4NG2A 1L3LA 1BZAA 3ZVTA 1IYPA 5EVEA 1SDNA 1DY6A 1FR6A 5F5YA 5HWTA 4KZ9A 2JKFA 3IBJA 4I3AA 2QWSA 1MY8A 2ZL1A 3PAEA 5HDCA 2VGKA 2XR0A 4MN6A 2QKPA 4B4XA 1PZPA 2WKHA 2XFTA 3H9WA 4E6XA 2QJ7A 4RYEA 2I72A 5EECA 5L09A 4K08A 1LL9A 5DFXA 1T1AA 1TEMA 2ZMFA 1I5QA 4I39A 5CHUA 3BECA 5DF8A 3D3OA 4HH3A 4X55A 1ALQA 1IYQA 4GD8A 5DJUA 1V9ZA 3WRTA 4JGPA 3BFEA 2ZJ9A 3QNBA 2W1TB 3MXQA 1K56D 5U47A 4MBFA 1GCEA 3IS2A 4OOYA 1HLUP 2A24B 2RCXA 1ESUA 5JYOA 1VM1A 4NXEA 4OP5A 1VEUB 1W63Q 2MJ6A 4UHUA 4BBUA 3T4KA 4EXOA 1XKZA 4YINA 3LR5A 1FQGA 3TJZC 2V8CA 3Q7VA 5IHVA 3E4QA 3TG9A 1ZG6A 1PI4A 3QP4A 3G31A 4MBKA 2HJ9C 4E04A 3OPLA 4UA9A 1VETA 4D60A 3L9KA 3OC2A 4N9LA 4RA7A 3Q7ZA 3G2ZA 3EWKA 2WADA 1YSQA 1OT6A 3CI6A 4ZBEA 4P0MA 2XA7M 4R3JA 2UV0E 2O9BA 2J3WA 5EVIC 4MLLA 2NUTC 4UA6A 5HSQA 3RH8B 1YLWA 4ID4A 3NECA 2J8YA 3QP6A 3ZVWA 4L0LA 1NZUA 4DMZA 4ZAMA 3V3SA 1GSVA 2OAP1 5DTKA 2VGJA 3IXHA 3UMEA 3TE8A 1SDEA 2CMNA 1O7EA 4GW9A 2C5WB 2PYRA 1XFNA 1OT9A 2Q0OA 3LEZA 3IF6C 5I94A 3ZQ5A 4GHIA 2ZQ7A 4S2NA 5FQ9A 2DRWA 3MJQA 2EWWA 1V9YA 3C2WA 3GDIA 3UN7A 5IS1A 1T18A 2VV6A 5HPIA 2GZAA 2J7VA 1T1BA 2P9VB 4E3JA 2ZQAA 3G30A 2V0UA 3ZNTA 4OPYA 4EEPA 3C30A 2XROA 2ZLYA 4R3BA 1JVJA 5L2FA 1MBLA 4LCLA 4ZJ2A 4LGWA 1G68A 3PBOA 4RX3A 3SW1A 5GLAA 4KZ6A 3FC7A 3EOIA 3ZNYA 1DJAA 2Y2IA 1E4DA 4GOGA 1NY0A 3T1XA 5FI2A 3F1NB 4L9EA 2EXBA 3IWOA 3BFDA 3MMHA 3Q7VB 1K25A 2V1ZA 4R70A 4OP8A 1P0ZA 1S1YA 4QU3A 1MKIA 1D06A 5GHXA 2WKRA 4Y3IA 4PHTA 2XGNA 4BENA 4EQ1A 5FI6A 1XFQA 4HI4A 2ZC5B 1Q2PA 2OLUA 1JWZA 2Y2MA 4BBVA 3BLMA 2WKIA 3GMWA 3UB6A 1XJ4A 1K55A 3GTCA 3NOPC 3O88A 3BQAA 2ZQDA 1YSPA 3AGEA 3IWQA 3N4IA 5FAPA 3AGDA 2OOLA 3BW6A 4UA7A 2JKRI 2BLSA 2A2LA 1W7FA 3FKVA 1LSVA 2Z6DA 2QYBA 1NXYA 2ZC4B 1L0FA 2WUQA 3WWXA 3F1OB 3LY4A 4JBFA 4JF5A 2HP9A 2WZZA 4OPRA 3TSGA 3A3DA 1TDGA 4H6JB 1BLCA 3RTYA 3NDEA 4UQIS 1FCMA 1NZOA 3HUMA 2LB9A 3E98A 2PU2A 4KG6A 4I38A 1YLPA 1FSWA 1YMSA 2VLGA 4GHIB 4GLQA 4S2PA 3OPPA 1KVMA 3OBFA 2Z2MB 3LIEA 1FSYA 3HLGA 3LCEA 3O3VA 2R78A 4O7DA 4C75A 3HLCA
chains in the Genus database with same CATH topology
4FUWA 3T1XA 2ZL1A 3T12B 1D1JA 5FEFA 3NULA 5EM1A 2PBDP 3LEQA 3L7HA 1J3WA 1ACFA 3KYEA 3NECA 1AWIA 3LGOA 1VEUA 1CJFA 5EM0A 3MS6A 2ACGA 1A0KA 3UB5P 2E8JA 1PNEA 3DAVA 2V8FA 1Y4OA 1Z09A 1FILA 1CQAA 1SKOA 1CF0A 4X1LA 4X25A 5EV0A 4X1MA 3CPTB 1PFLA 1VETB 2BTFP 5FEGA 1HLUP 2VK3A 1VEUB 3CHWP 4QWOA 5FDSA 2ZL1B 2V8CA 1K0KA 1FIKA 1G5UA 2PRFA 2B95A 3D9YA 2PAVP 1F2KA 1SKOB 2HZ5A 1SZVA 2JKGA 4FTXA 3CPTA 1PRQA 3T1RA 1VETA 4D60A 3L9KA 4ESPA 1YPRA 3MSHA 5EVEA 3T1QB 3T1SA 3U4LP 2JKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FUW A;  3T1X A;  2ZL1 A;  3T12 B;  1D1J A;  5FEF A;  3NUL A;  5EM1 A;  2PBD P;  3LEQ A;  3L7H A;  1J3W A;  1ACF A;  3KYE A;  3NEC A;  1AWI A;  3LGO A;  1VEU A;  1CJF A;  5EM0 A;  3MS6 A;  2ACG A;  1A0K A;  3UB5 P;  2E8J A;  1PNE A;  3DAV A;  2V8F A;  1Y4O A;  1Z09 A;  1FIL A;  1CQA A;  1SKO A;  1CF0 A;  4X1L A;  4X25 A;  5EV0 A;  4X1M A;  3CPT B;  1PFL A;  1VET B;  2BTF P;  5FEG A;  1HLU P;  2VK3 A;  1VEU B;  3CHW P;  4QWO A;  5FDS A;  2ZL1 B;  2V8C A;  1K0K A;  1FIK A;  1G5U A;  2PRF A;  2B95 A;  3D9Y A;  2PAV P;  1F2K A;  1SKO B;  2HZ5 A;  1SZV A;  2JKG A;  4FTX A;  3CPT A;  1PRQ A;  3T1R A;  1VET A;  4D60 A;  3L9K A;  4ESP A;  1YPR A;  3MSH A;  5EVE A;  3T1Q B;  3T1S A;  3U4L P;  2JKF A; 
#chains in the Genus database with same CATH topology
 5FI7 A;  3ZFZ A;  2WAE A;  4WEL A;  5KMW A;  1HTZ A;  5FEF A;  3T4J A;  3BM6 A;  4OVD A;  1ES2 A;  3JVV A;  1XPB A;  4YWZ A;  4DRT A;  5BOH A;  3A3F A;  4NK3 A;  1YM1 A;  4I5S A;  4KZA A;  3BFF A;  3UDX A;  1H8Y A;  2HGV A;  4EUV A;  5EPH A;  4KUK A;  3M6H A;  1LLB A;  1FOF A;  3G32 A;  1WA9 A;  2HDQ A;  4MCW A;  2V8F A;  4R38 A;  3A0R A;  1KOU A;  1SKO A;  3KYZ A;  3CIT A;  5CHJ A;  5FSR A;  1OJ5 A;  3B42 A;  3MZF A;  4WMC D;  3UPN A;  1S4R A;  4C6Y A;  1Q2Q A;  3VOZ A;  4WEK A;  2PHY A;  5EUA A;  3VSL A;  1JWV A;  3AGF A;  4YOF A;  2Z6C A;  2B02 A;  3IX3 A;  1LI0 A;  5E2H A;  2JKT I;  4N9K A;  5DF7 A;  3D9Y A;  3FG8 A;  3NCK A;  4Y0T A;  2G7U A;  4JGR A;  4X68 A;  5KSC A;  1PRQ A;  1XP4 A;  2O9C A;  2AVX A;  3MSH A;  4F3L A;  1K56 A;  3RFB A;  3D72 A;  5CEC A;  3Q82 A;  1K38 A;  4Y17 A;  3N7W A;  1FCO A;  2WYX A;  3ITB A;  3ZGA B;  3OCL A;  2PYP A;  1KGF A;  2QPN A;  1G28 A;  3QP2 A;  5EFW A;  5HPF A;  2O0Y A;  3GRJ A;  4HY8 A;  2DNS A;  3BQ8 A;  2ZC6 B;  4Q8I A;  4FD8 A;  4PKY A;  3UB5 P;  2Y2L A;  3N8L A;  5GHY A;  3ZG0 A;  4AFI A;  2BG1 A;  4R1G A;  3HLD A;  1BYW A;  3GSG A;  4IHQ A;  3UDI A;  1TS8 A;  2VZW A;  4X1M A;  4DKI A;  3WS5 A;  2OWH A;  1PI5 A;  3F1P B;  1MZU A;  1P97 A;  3A0S A;  3E4O A;  1JWP A;  1OTE A;  3PXP A;  4OPZ A;  3EQV A;  1T19 A;  5D3O A;  1MWU A;  3T4L A;  5J8X A;  3P09 A;  5FQI A;  5CGW A;  4GDN A;  2FH5 A;  1P9R A;  1OJG A;  3A0V A;  1FIK A;  3RJU A;  5FAT A;  2B95 A;  3FWL A;  3B47 A;  4MDZ A;  1SKO B;  4KQO A;  2XA7 S;  4LPZ A;  1QME A;  3QP1 A;  4HP9 A;  4XXR A;  3FPV A;  1OTD A;  2ZQ8 A;  3SS3 A;  4LV3 A;  4JXV A;  3GR2 A;  4OLD A;  1ZTU A;  2W1R A;  3LIF A;  3HJI A;  5I5L A;  4OQG A;  1NLY A;  4E3O A;  2Y91 A;  3OCN A;  3VP4 A;  2KDK A;  3R7W A;  4ARZ A;  1MKM A;  2VGL M;  4U3T A;  5EVI D;  4NKP A;  4WM9 A;  1CJF A;  2VJW A;  4GNU A;  3VP2 A;  4ME4 A;  3FYZ A;  2Y59 A;  1MXO A;  2LB5 A;  2WKP A;  3HUN A;  4WF0 A;  5HAQ A;  1K57 A;  4MNR A;  5HFO A;  2V1B A;  4F3L B;  1IEL A;  3ZDJ A;  2HF6 A;  5A92 A;  1M6K A;  1FIL A;  2VV7 A;  2OWJ A;  4QB8 A;  1CF0 A;  1JTG A;  5EOE A;  2JE5 A;  1IEM A;  3CPT B;  2D02 A;  1T1C A;  1PYY A;  2JC7 A;  1BTL A;  4O8G A;  4BD1 A;  3UMD A;  2EFU A;  5HWW A;  2W27 A;  3O87 A;  5CGS A;  2VK3 A;  1Z6F A;  4U0T A;  3DWK A;  2H0Y A;  5AQA A;  5GLC A;  2HJE A;  2HDS A;  4I3J A;  3CZD A;  1LL8 A;  2M7V A;  3ZG5 A;  4S2I A;  2XEP A;  1RGY A;  1KE3 A;  3CG5 A;  2H0T A;  4Y5F A;  2K31 A;  1XXM A;  1W8Q A;  3P98 A;  3S1Y A;  4XUX A;  2EA9 A;  1GSX A;  4KZ4 A;  2Y2O A;  4GZB A;  3LR0 A;  3CUE A;  2O9A A;  1S66 L;  3HLE A;  3O86 A;  4HH2 A;  5M19 A;  2J80 A;  5FQK A;  1IFQ A;  2ZM0 A;  4BJP A;  1J9M A;  3DTM A;  4XT2 A;  1BUL A;  5G4Z A;  4GD6 A;  4FUW A;  4P6B A;  1W8Y A;  5GHZ A;  5KIZ A;  2FFF B;  2PBD P;  2O99 A;  3LEQ A;  2W3E A;  4II7 A;  3LI8 A;  4HJ4 A;  4GKU A;  3ULF A;  1ACF A;  3S7N A;  3VP1 A;  5DKK A;  1IYO A;  2W3G A;  3MQ0 A;  4OOM A;  4ZJ3 A;  4M3K A;  2Q9M A;  2ZOI A;  2CC1 A;  4JF6 A;  1CK3 A;  4BMW A;  4CLC B;  2VEA A;  5M18 A;  1PNE A;  2XRN A;  2J9P A;  4RQ9 A;  1TF1 A;  1Z09 A;  3P01 A;  2UWX A;  3UNW A;  3H82 B;  3S7O A;  4HBU A;  3ZYT A;  4KZ5 A;  4RX2 A;  4JXS A;  4UAA A;  1XX2 A;  2HDR A;  3UE1 A;  4P85 A;  2EX9 A;  5E2F A;  5K5B A;  2Y2N A;  3PBS A;  4KEN B;  4KZ7 A;  1CEG A;  1ERO A;  4DDS A;  4ZJ1 A;  5HAR A;  4QWO A;  4L9F A;  4KUO A;  1OTB A;  2ZQ9 A;  2PU4 A;  2ZL1 B;  4JPM A;  5DFY A;  3HJK A;  4JKT A;  1NYM A;  2PAV P;  1DJB A;  2EFX A;  1X0O A;  1VHM A;  1DP9 A;  3KSI A;  5TJJ A;  4PM7 A;  2M1C A;  4FTX A;  4LEN A;  1BLS A;  4E6W A;  2Y79 A;  4KG5 A;  3HBR A;  3WS4 A;  4IVK A;  1NRF A;  3U4L P;  2JKR M;  4WMC A;  3WRZ A;  3VP3 A;  2XD1 A;  4HP4 A;  3SOI A;  3T4T A;  4BD0 A;  3TW8 A;  4D2O A;  5L10 A;  1GHP A;  5TR7 A;  3VFH A;  1G6A A;  2WGI A;  2ZD8 A;  3KYE A;  1D7E A;  1LL5 A;  3IS2 B;  1YMX A;  5F68 A;  1L0G A;  3MS6 A;  1OTA A;  3WS2 A;  2ZC7 A;  3K3D A;  4R6L A;  2A49 A;  1AXB A;  1ONG A;  1Y4O A;  4XT2 B;  1ONH A;  5FAO A;  4OLG A;  3NIA A;  1LT0 A;  1UWN X;  3GVB A;  2I9V A;  4R3A A;  1VET B;  5MC7 A;  3C8C A;  5F1F A;  2XD5 A;  3GV9 A;  3MBZ A;  3IHA A;  1LI9 A;  5HAP A;  2B18 A;  4BWI A;  3MFX A;  4EEU A;  5FDS A;  4OQ0 A;  3DTE A;  3LID A;  5GLD A;  3D4F A;  4NET A;  2QHK A;  3VMA A;  2RL3 A;  2HZ5 A;  2QZ6 A;  2WKQ A;  1KVL A;  4LRY C;  1TD5 A;  5G18 A;  4EBL A;  3I7J A;  1NRJ A;  4ESP A;  1JNU A;  1YLJ A;  4P6Z M;  3IX4 A;  4EW7 A;  3ISG A;  4Y15 A;  5FQM A;  2Y2Q A;  3DBA A;  3SZT A;  3VOY A;  5CED A;  4Q0J A;  3MZE A;  1D1J A;  1C3B A;  2XSS A;  1SHV A;  3MFD A;  1IKG A;  3C4O A;  3S7Q A;  2ZM8 A;  4HNB A;  2L1M A;  3LIB A;  2JKT M;  3LYX A;  3Q1F A;  3LGO A;  4PM6 A;  3OPR A;  3UPP A;  5M1A A;  2PR5 A;  2ZOH A;  4EBN A;  3EGX C;  3G4P A;  1ZKJ A;  2WGW A;  3VV4 A;  4ZTK A;  5EOO A;  2ZQC A;  3MQO A;  1CQA A;  1PWG A;  5F1G A;  3Q07 A;  5CRF A;  1ZG4 A;  3W8K A;  3VSK A;  3IQA A;  5AQB A;  4PM8 A;  4JGO A;  4X6T A;  3B3X A;  3BY9 A;  5E2E A;  3CMZ A;  4EER A;  3EGD C;  4N1X A;  4WZ5 C;  2EWV A;  1O07 A;  5CHM A;  5EVI A;  5FAS A;  5TBM A;  3UE0 A;  3W2Z A;  1F98 A;  1PWD A;  1EI5 A;  2XDM A;  2V9A A;  2Y4A A;  5HDD A;  4MN5 A;  3UB7 A;  3MKF A;  4OQH A;  1MWR A;  1YKD A;  1YLY A;  2P08 A;  1WE4 A;  4Z9Q A;  1L0E A;  4G3V A;  3A3E A;  2ZC3 B;  3T1Q B;  5DTT A;  2WKE A;  2HDU A;  1QMF A;  2VGL S;  3IF6 A;  3UDF A;  1NYY A;  3UE6 A;  3S22 A;  2H10 A;  3T12 B;  5DKL A;  4LLO B;  4PAU A;  5EM1 A;  4B9O A;  5DF9 A;  4HEF A;  4PM9 A;  3HLB A;  1ESI A;  5A90 A;  2ZMA A;  1PZO A;  2W0N A;  4DE3 A;  1TVF A;  2QMI A;  3BEB A;  4HHD A;  2GJ3 A;  4FH2 A;  4PMA A;  5J7E A;  2E8J A;  2Y55 A;  2EX2 A;  4R23 A;  4OKP A;  1OME A;  4LV0 A;  3QP8 A;  4E3L A;  1YLT A;  3QNC A;  4LV1 A;  1PIO A;  2KOI A;  4B4Z A;  3MR0 A;  3NOT C;  4Y0O A;  5FEG A;  3UB9 A;  5FL3 A;  5CEB A;  2XLN A;  3VE3 A;  1PWC A;  2HPB A;  3UO9 A;  1LSW A;  3BY8 A;  3HLF A;  3OLO A;  5FDH A;  3M6B A;  5TGF A;  5DVA A;  1YLZ A;  3PYP A;  4M4X A;  3UY6 A;  4EES A;  1L2S A;  3BYD A;  4ZDX A;  4UQI M;  2WGW B;  1FCN A;  5CX7 A;  1F2K A;  1RCJ A;  3HUO A;  3W4P A;  4HJ6 A;  1Y28 A;  3LFV A;  3V50 A;  1RGZ A;  1S4S A;  3T4O A;  4IVI A;  4EUZ A;  2XH9 A;  4GS9 A;  1YPR A;  3PR6 A;  3NC8 A;  3QHY A;  1K4E A;  1IYS A;  3K3C A;  3T4S A;  3C5A A;  5DTS A;  3GEC A;  1SKF A;  5FQJ A;  1ERQ A;  5EVI B;  3VP0 A;  2A3U A;  2L4R A;  2WK0 A;  5J4E A;  1KDS A;  2Y2K A;  4RVA A;  4EQI A;  3MZD A;  3HLW A;  1EWZ A;  3UE3 A;  2K7S A;  1ES3 A;  2ACG A;  3O5Y A;  3KYQ A;  3P7N A;  3LUQ A;  3BRM A;  4QY5 A;  5GLB A;  4X56 A;  1GA0 A;  5F69 A;  3LIA A;  3IF6 B;  1S1Z A;  4E3K A;  1ES4 A;  1H8Z A;  3LI9 A;  4B88 A;  5C5K A;  2ZBB A;  5FA7 A;  4DN0 A;  2H28 A;  3FZC A;  1EW0 A;  4NXF A;  5TFQ A;  2YKF A;  3C7U A;  1STZ A;  5HWV A;  1YAX A;  3ZG7 B;  4EWF A;  2Y8H A;  5HD3 A;  1P9W A;  1XJ6 A;  3UPO A;  2HP5 A;  4WUJ A;  4KZ8 A;  1K55 C;  1E25 A;  1M40 A;  3VE4 A;  3K2N A;  2X71 A;  4U0X A;  5IT5 A;  1SZV A;  3G6O A;  3HRE A;  4IBR A;  2OSU A;  1KE4 A;  3SH9 A;  2BAS A;  1F9I A;  3SS4 A;  3B33 A;  3T1S A;  4IED A;  4MMN A;  3RXW A;  3LR3 A;  4WZ5 A;  2OAQ 1;  4FH4 A;  4CLC E;  4HOI A;  2P9V A;  1YQS A;  5FAQ A;  3PTE A;  2VX8 A;  1N4O A;  1IOU A;  4BL3 A;  2ZM2 A;  1J3W A;  2W3F A;  2ZMV A;  4HBT A;  2X02 A;  1N9N A;  4JXW A;  4LRX C;  4KQQ A;  3N6I A;  1K6R A;  5FQQ A;  1AWI A;  3FV7 A;  3A3J A;  3IBR A;  3BFC A;  4JXG A;  3BWL A;  3V67 A;  5L8M A;  3IH9 A;  3ZHH A;  4GS9 B;  1A0K A;  1TDL A;  1MWS A;  3R4K A;  4YFM A;  1DRM A;  1KE0 A;  3G2Y A;  3VFF A;  3NI9 A;  1WYC A;  4OON A;  1F5M A;  3F1N A;  4S2K A;  1GHI A;  4N1H A;  1JTD A;  1E3U D;  3V39 A;  2B5R A;  5AJG A;  1XGJ A;  2FFY A;  2VV8 A;  4C3Q A;  3KSG A;  4PM5 A;  1KGE A;  3PBN A;  1ZHH B;  2W3D A;  4EBP A;  4DDY A;  4EU0 A;  2XF3 A;  3FKW A;  2XFS A;  3NBL A;  4P6Z S;  1BUE A;  4DXB A;  1H0M A;  2P7J A;  2Y2J A;  3KSH A;  1UWP X;  1YT4 A;  3NOU C;  4KZB A;  3OZH A;  2IWB A;  3R7W B;  3NHQ A;  4ARZ B;  2V1A A;  2JBF A;  1CI9 A;  2JKG A;  1K54 C;  3E2L A;  1GHM A;  5A91 A;  3GQZ A;  3EEH A;  2R9X A;  4E3N A;  1W79 A;  4GN2 A;  1L0D A;  4HES A;  3F1O A;  2J3T D;  3NY4 A;  3H7W A;  1CEF A;  4E3M A;  4XUZ A;  1N9O A;  1ES5 A;  4H6J A;  4H8R A;  4IUH A;  3PHY A;  4CLC D;  4R4S A;  1BT5 A;  1S6R A;  5AQ9 A;  5EVL A;  5HW3 A;  5CTM A;  1W5D A;  5EE8 A;  2DMW A;  4Z1W A;  1DP6 A;  1HZO A;  2JN7 A;  2JHE A;  2V20 A;  4JLF A;  2VKS A;  5GL9 A;  1OTI A;  3CWF A;  4K91 A;  4R0Q A;  4DE2 A;  3W4O A;  2M7U A;  4X1L A;  1DP8 A;  1S67 L;  3BJN A;  5HDS A;  1OPX A;  1XJ3 A;  2K2N A;  4Y2F A;  2BTF P;  3HVF A;  2GNX A;  2WGV A;  1TS6 A;  2E8I A;  4WEJ A;  4YNR A;  4DE1 A;  4DJ3 A;  3OOV A;  2PDR A;  1XJ2 A;  3U2A A;  4CPK A;  1ODV A;  4S2M A;  2G2W A;  4A5R A;  3G35 A;  1MC0 A;  1RP5 A;  4WZ4 A;  3RXX A;  1G5U A;  4DJ2 A;  2XK1 A;  4NXB A;  2WZX A;  3V3R A;  3JVU A;  3KSF A;  5CGX A;  1HD8 A;  4WYY A;  2OV5 A;  4QD4 A;  4S2L A;  4IBX A;  4WN5 A;  4LV2 A;  4NEE D;  1KDW A;  2D01 A;  3MKE A;  1K4F A;  1GA9 A;  4F94 A;  4R4R A;  5IU1 A;  2PR6 A;  3EQU A;  2QJ5 A;  3UB8 A;  4DF6 A;  3NUL A;  1LSX A;  3DWZ A;  3TOI A;  3DTI A;  2Z2L B;  3SH8 A;  5HL6 A;  2J3T C;  4WBG A;  2OLV A;  3IWI A;  4LCM A;  5G4Y A;  4MN7 A;  2J9O A;  4ETZ A;  3DTK A;  4G3W A;  2V0W A;  4QJG A;  3PBT A;  4NXG A;  3S4X A;  4OH0 A;  3LY3 A;  4QY6 A;  4CLC C;  3DAV A;  2H5S A;  1I2S A;  4L9G A;  4CJN A;  4WL9 A;  4OPQ A;  4BQM A;  4HIA A;  4X25 A;  3H7W B;  5HZH A;  1NJ4 A;  5HD5 A;  4O01 A;  4WLA A;  4JF4 A;  4I3I A;  3HL9 A;  5KZH A;  4S2J A;  3CHW P;  3CAX A;  2PBY A;  2DCF A;  3KX0 X;  1K0K A;  5AVE A;  4Q0I A;  4S2O A;  4DXC A;  5DJT A;  4FCF A;  4HJ3 A;  3N8R A;  2FZ0 A;  1VQQ A;  1SCW A;  1K57 C;  2PD7 A;  4X69 A;  4IUK A;  2Y2G A;  4PPR A;  3T4Q A;  2C6W B;  1XA1 A;  3PBQ A;  3T50 A;  3T1R A;  3F1P A;  1KGG A;  4KQD A;  1MWT A;  2W3H A;  1BLH A;  3E0Y A;  5F82 A;  4BL2 A;  3S7P A;  3C7V A;  4Y7P A;  4KG2 A;  4QPR A;  2X01 A;  2XQZ A;  1ERM A;  4IJG A;  5JYP A;  5E43 A;  3MXS A;  2WAF A;  3IH8 A;  3QP5 A;  2GX5 A;  4FSF A;  1UGU A;  3L7H A;  4E3I A;  3SS5 A;  5CER A;  5F83 A;  1K54 A;  2IA2 A;  2YKH A;  2EX8 A;  4PKY G;  1G6O A;  3G34 A;  2NUP C;  3WS0 A;  3IF5 A;  3WS1 A;  5EM0 A;  2INW A;  3CUE C;  1BSG A;  3BFG A;  5AQ7 A;  1Y54 A;  1TS7 A;  2GDN A;  5HL1 A;  3NJA A;  3Q81 A;  3ZCZ A;  4LFU A;  4UEY A;  5CXW A;  1PW1 A;  4P87 A;  1HVB A;  5L07 A;  1XGI A;  2R9W A;  5HX9 A;  4N92 A;  4GB7 A;  4KQR A;  4OOL A;  1H5X A;  3JPU A;  4ETX A;  3PAG A;  1WYB A;  4GDB A;  3A3I A;  4X53 A;  4Y13 A;  4G3K A;  1TS0 A;  1GSW A;  2P04 A;  4Y0U A;  4Q0H A;  4ZRR A;  3EEA A;  3SH7 A;  3PBR A;  4BBT A;  1NLZ A;  3V5M A;  5CTN A;  4MBH A;  2P74 A;  1FR1 A;  4EET B;  2PRF A;  4OQI A;  2KLI A;  2G2U A;  3N8S A;  2Y2P A;  4BLM A;  3M2K A;  3C38 A;  2JCH A;  2KX6 A;  3CPT A;  2PT7 A;  1XA7 A;  1U60 A;  3ZG9 B;  1H3Q A;  3E4P A;  3E2K A;  3IXG A;  4KZ3 A;  3KO6 A;  1DJC A;  3ZG8 B;  1E3U A;  2VA0 A;  2Q9N A;  2IWD A;  4B93 A;  3IT9 A;  1MPL A;  3DW0 A;  2L0W A;  1NWZ A;  3IXD A;  1N9L A;  3VOL A;  2PD8 A;  2W1T A;  1IKI A;  1ZC2 A;  4S2N C;  3HCY A;  4FOF A;  5A93 A;  1K6S A;  2A24 A;  3MF0 A;  3ITA A;  3IHB A;  3LIC A;  4QHC A;  3CLO A;  1VEU A;  2HP6 A;  4GCZ A;  3FPW A;  3W4Q A;  4HQA A;  5J3W A;  3NDG A;  3OPH A;  1VB6 A;  5TBM B;  3MQQ A;  2IWC A;  5EV0 A;  3ICY A;  3BLS A;  5LBR A;  1H8M A;  5AVF A;  3MXR A;  2Y2H A;  1PFL A;  4K0W A;  5F6A A;  5KSH A;  1S0W A;  4GJ4 A;  4LRZ E;  2EX6 A;  1LHY A;  1N9B A;  5HAI A;  3M2J A;  1BLP A;  3JYI A;  2HV1 A;  2EXA A;  3IXB A;  4K0X A;  1I2W A;  4CLC A;  1CI8 A;  3IX8 A;  4DE0 A;  3LR4 A;  4O0P A;  3TRC A;  4JGQ A;  3LO7 A;  5A8B A;  3H82 A;  3C4P A;  4MEZ A;  4EV4 A;  4CQH A;  1W63 M;  1PW8 A;  5E2G A;  2V2F F;  3CJM A;  4NG2 A;  1L3L A;  1BZA A;  3ZVT A;  1IYP A;  5EVE A;  1SDN A;  1DY6 A;  1FR6 A;  5F5Y A;  5HWT A;  4KZ9 A;  2JKF A;  3IBJ A;  4I3A A;  2QWS A;  1MY8 A;  2ZL1 A;  3PAE A;  5HDC A;  2VGK A;  2XR0 A;  4MN6 A;  2QKP A;  4B4X A;  1PZP A;  2WKH A;  2XFT A;  3H9W A;  4E6X A;  2QJ7 A;  4RYE A;  2I72 A;  5EEC A;  5L09 A;  4K08 A;  1LL9 A;  5DFX A;  1T1A A;  1TEM A;  2ZMF A;  1I5Q A;  4I39 A;  5CHU A;  3BEC A;  5DF8 A;  3D3O A;  4HH3 A;  4X55 A;  1ALQ A;  1IYQ A;  4GD8 A;  5DJU A;  1V9Z A;  3WRT A;  4JGP A;  3BFE A;  2ZJ9 A;  3QNB A;  2W1T B;  3MXQ A;  1K56 D;  5U47 A;  4MBF A;  1GCE A;  3IS2 A;  4OOY A;  1HLU P;  2A24 B;  2RCX A;  1ESU A;  5JYO A;  1VM1 A;  4NXE A;  4OP5 A;  1VEU B;  1W63 Q;  2MJ6 A;  4UHU A;  4BBU A;  3T4K A;  4EXO A;  1XKZ A;  4YIN A;  3LR5 A;  1FQG A;  3TJZ C;  2V8C A;  3Q7V A;  5IHV A;  3E4Q A;  3TG9 A;  1ZG6 A;  1PI4 A;  3QP4 A;  3G31 A;  4MBK A;  2HJ9 C;  4E04 A;  3OPL A;  4UA9 A;  1VET A;  4D60 A;  3L9K A;  3OC2 A;  4N9L A;  4RA7 A;  3Q7Z A;  3G2Z A;  3EWK A;  2WAD A;  1YSQ A;  1OT6 A;  3CI6 A;  4ZBE A;  4P0M A;  2XA7 M;  4R3J A;  2UV0 E;  2O9B A;  2J3W A;  5EVI C;  4MLL A;  2NUT C;  4UA6 A;  5HSQ A;  3RH8 B;  1YLW A;  4ID4 A;  3NEC A;  2J8Y A;  3QP6 A;  3ZVW A;  4L0L A;  1NZU A;  4DMZ A;  4ZAM A;  3V3S A;  1GSV A;  2OAP 1;  5DTK A;  2VGJ A;  3IXH A;  3UME A;  3TE8 A;  1SDE A;  2CMN A;  1O7E A;  4GW9 A;  2C5W B;  2PYR A;  1XFN A;  1OT9 A;  2Q0O A;  3LEZ A;  3IF6 C;  5I94 A;  3ZQ5 A;  4GHI A;  2ZQ7 A;  4S2N A;  5FQ9 A;  2DRW A;  3MJQ A;  2EWW A;  1V9Y A;  3C2W A;  3GDI A;  3UN7 A;  5IS1 A;  1T18 A;  2VV6 A;  5HPI A;  2GZA A;  2J7V A;  1T1B A;  2P9V B;  4E3J A;  2ZQA A;  3G30 A;  2V0U A;  3ZNT A;  4OPY A;  4EEP A;  3C30 A;  2XRO A;  2ZLY A;  4R3B A;  1JVJ A;  5L2F A;  1MBL A;  4LCL A;  4ZJ2 A;  4LGW A;  1G68 A;  3PBO A;  4RX3 A;  3SW1 A;  5GLA A;  4KZ6 A;  3FC7 A;  3EOI A;  3ZNY A;  1DJA A;  2Y2I A;  1E4D A;  4GOG A;  1NY0 A;  3T1X A;  5FI2 A;  3F1N B;  4L9E A;  2EXB A;  3IWO A;  3BFD A;  3MMH A;  3Q7V B;  1K25 A;  2V1Z A;  4R70 A;  4OP8 A;  1P0Z A;  1S1Y A;  4QU3 A;  1MKI A;  1D06 A;  5GHX A;  2WKR A;  4Y3I A;  4PHT A;  2XGN A;  4BEN A;  4EQ1 A;  5FI6 A;  1XFQ A;  4HI4 A;  2ZC5 B;  1Q2P A;  2OLU A;  1JWZ A;  2Y2M A;  4BBV A;  3BLM A;  2WKI A;  3GMW A;  3UB6 A;  1XJ4 A;  1K55 A;  3GTC A;  3NOP C;  3O88 A;  3BQA A;  2ZQD A;  1YSP A;  3AGE A;  3IWQ A;  3N4I A;  5FAP A;  3AGD A;  2OOL A;  3BW6 A;  4UA7 A;  2JKR I;  2BLS A;  2A2L A;  1W7F A;  3FKV A;  1LSV A;  2Z6D A;  2QYB A;  1NXY A;  2ZC4 B;  1L0F A;  2WUQ A;  3WWX A;  3F1O B;  3LY4 A;  4JBF A;  4JF5 A;  2HP9 A;  2WZZ A;  4OPR A;  3TSG A;  3A3D A;  1TDG A;  4H6J B;  1BLC A;  3RTY A;  3NDE A;  4UQI S;  1FCM A;  1NZO A;  3HUM A;  2LB9 A;  3E98 A;  2PU2 A;  4KG6 A;  4I38 A;  1YLP A;  1FSW A;  1YMS A;  2VLG A;  4GHI B;  4GLQ A;  4S2P A;  3OPP A;  1KVM A;  3OBF A;  2Z2M B;  3LIE A;  1FSY A;  3HLG A;  3LCE A;  3O3V A;  2R78 A;  4O7D A;  4C75 A;  3HLC A; 
#chains in the Genus database with same CATH homology
 4FUW A;  3T1X A;  2ZL1 A;  3T12 B;  1D1J A;  5FEF A;  3NUL A;  5EM1 A;  2PBD P;  3LEQ A;  3L7H A;  1J3W A;  1ACF A;  3KYE A;  3NEC A;  1AWI A;  3LGO A;  1VEU A;  1CJF A;  5EM0 A;  3MS6 A;  2ACG A;  1A0K A;  3UB5 P;  2E8J A;  1PNE A;  3DAV A;  2V8F A;  1Y4O A;  1Z09 A;  1FIL A;  1CQA A;  1SKO A;  1CF0 A;  4X1L A;  4X25 A;  5EV0 A;  4X1M A;  3CPT B;  1PFL A;  1VET B;  2BTF P;  5FEG A;  1HLU P;  2VK3 A;  1VEU B;  3CHW P;  4QWO A;  5FDS A;  2ZL1 B;  2V8C A;  1K0K A;  1FIK A;  1G5U A;  2PRF A;  2B95 A;  3D9Y A;  2PAV P;  1F2K A;  1SKO B;  2HZ5 A;  1SZV A;  2JKG A;  4FTX A;  3CPT A;  1PRQ A;  3T1R A;  1VET A;  4D60 A;  3L9K A;  4ESP A;  1YPR A;  3MSH A;  5EVE A;  3T1Q B;  3T1S A;  3U4L P;  2JKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...