4FUWA

Crystal structure of ego3 mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
151
structure length
140
Chain Sequence
SKNVKGFLENTLKPYGSLQSSMIITATNGGILSYATSNNSINEINSVNNLKMMSLLIKDKWSEDENDNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords Protein SLM4
total genus 40
structure length 140
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16818 SLM4 Protein SLM4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4fuwA01
2JKFA 2ZL1A 3L9KA 3NULA 1FILA 4FUWA 1F2KA 3LEQA 1G5UA 2PAVP 1VEUB 3L7HA 1SZVA 4X25A 1FIKA 1Y4OA 2V8FA 3D9YA 3T1RA 3T1SA 1VEUA 4QWOA 2E8JA 3T1QB 1AWIA 1J3WA 5FEFA 5EV0A 5FEGA 4D60A 3U4LP 3MS6A 3UB5P 1SKOB 1K0KA 1ACFA 1VETB 2B95A 2ACGA 1VETA 1YPRA 1CF0A 3T12B 1D1JA 2HZ5A 3CHWP 3NECA 2BTFP 5FDSA 4X1LA 3KYEA 2PRFA 1SKOA 3T1XA 1PRQA 4FTXA 1HLUP 2PBDP 1CQAA 2JKGA 2V8CA 3CPTB 1Z09A 1PNEA 5EM1A 5EVEA 2ZL1B 3CPTA 3DAVA 3LGOA 5EM0A 1A0KA 2VK3A 4ESPA 4X1MA 1PFLA 1CJFA 3MSHA
chains in the Genus database with same CATH superfamily
3B42A 2EXBA 5HZHA 4ID4A 3F1NA 4UEYA 1NWZA 5DFXA 2VLGA 2HP6A 2GJ3A 5FI2A 1T1CA 4KZ8A 5HDSA 5E2FA 2ZQAA 1K54C 4ZJ1A 3E2LA 2WGWB 4JF4A 4C75A 2JKFA 4B88A 2K31A 3CUEA 4RVAA 1W63Q 3QP4A 5CHMA 1TS7A 3ULFA 3H7WB 1CI8A 4DDSA 2EWVA 3PXPA 1N9OA 4DF6A 4WBGA 4DE1A 1YM1A 3F1PB 2EX6A 1XA7A 4BBVA 4NEED 4S2KA 4GD6A 1ZKJA 4FUWA 2KDKA 2EX9A 1WYCA 3NOTC 1MY8A 2W3EA 2W3DA 3C7UA 1ERMA 1NY0A 3N7WA 4GHIB 2R9XA 5HD3A 1OTEA 3KSGA 2VK3A 2Y59A 4S2OA 3ZG8B 1VQQA 3D9YA 1ONHA 3NDEA 4P6ZM 1V9ZA 3PBTA 5HDCA 1IEMA 3IF6A 2HV1A 3R4KA 5JYPA 5KMWA 1E4DA 5CGXA 3IWIA 2OV5A 3CWFA 2IWCA 4U0XA 3HUNA 1OT9A 3K2NA 1PZPA 4X25A 2VV8A 4DKIA 5EVID 1KDSA 2Y2KA 4S2MA 1JNUA 3GRJA 3NIAA 2CMNA 2WKRA 1DJAA 5CXWA 3IQAA 1NJ4A 3UN7A 3ITAA 5CECA 2ZQCA 4WL9A 1O7EA 3OLOA 3WS5A 3CUEC 1IKGA 1JTGA 4E04A 4ZRRA 4Q8IA 2VJWA 2XA7S 3HBRA 1S6RA 3HLEA 2IA2A 4ZJ3A 4PKYA 2B5RA 4O0PA 1JWVA 5IT5A 2H0TA 1T19A 2IWDA 3M6BA 3UDIA 1BLPA 3ZVTA 3TE8A 4R4SA 2H0YA 2XD1A 3OOVA 2BASA 3NY4A 4ARZA 3ITBA 3A3EA 2ZC4B 2DMWA 4MEZA 3OPHA 2Y2MA 3G4PA 1VB6A 1G5UA 5HL6A 2WKIA 3UDXA 2WZZA 2M7UA 4QY5A 4IUHA 1C3BA 1MXOA 2OOLA 3NI9A 2YKHA 3BY8A 4Y15A 1EI5A 2W27A 4R0QA 5A91A 4RX3A 3FKWA 2HDQA 3H7WA 3LR3A 5FAPA 3VFFA 5FQKA 3S7PA 4R4RA 3LFVA 3IWQA 3Q7VA 5GHZA 3ZNYA 2WKQA 2WGVA 1LLBA 2XFTA 3ZQ5A 4P85A 3WS2A 5F1GA 3NULA 2ZMVA 1ES3A 1KVMA 2AVXA 1FCMA 4JF6A 1J3WA 4DJ2A 2H28A 5F1FA 3EOIA 4GHIA 4EQ1A 2V1ZA 1E25A 3EGDC 1G6OA 2XD5A 1OPXA 3W4PA 2INWA 2J3TC 4NKPA 1FILA 4GS9B 3BWLA 4S2JA 1MWTA 4ARZB 3BQ8A 3HLWA 4XT2A 3ZG5A 3OCLA 1K38A 1SKFA 3U4LP 1CK3A 2W1RA 5HDDA 3JYIA 2BLSA 4WEJA 4GN2A 1LT0A 1BTLA 3KSFA 1BT5A 1HLUP 3FYZA 2DNSA 3HLDA 1D06A 3HLBA 1MWRA 3LIBA 5HWWA 3Q7ZA 4D2OA 4N9LA 1PYYA 5F82A 4PMAA 1FIKA 5IHVA 2NUTC 3WWXA 1SKOB 1K0KA 1RP5A 4H8RA 1CEFA 1L0FA 4BMWA 3DTEA 1I2SA 3P98A 3PBNA 5AVEA 1GCEA 3E98A 3M2KA 2A24B 4GB7A 3TSGA 1PIOA 3TG9A 4OPYA 3T1SA 2WGIA 2E8JA 3PBOA 5GLCA 2W3GA 4NETA 2RL3A 3VP3A 1DP9A 4EEUA 4DJ3A 1ES5A 4LV3A 3W4QA 4S2NA 3KSIA 3BFGA 4EETB 4KZAA 3W4OA 4DXBA 4P6ZS 2I72A 1ZG6A 2OLUA 2ZBBA 3IF5A 3V50A 5BOHA 5FQ9A 2ZM8A 4PM5A 4S2IA 1JVJA 4MBFA 1XFQA 5E43A 1L0EA 3FC7A 3MFXA 4X6TA 2BG1A 1MKIA 2XROA 2A24A 2VA0A 2PBDP 3NOPC 4HIAA 3IHAA 1TS0A 1KGGA 3NOUC 4R38A 3GSGA 4DN0A 3BY9A 1X0OA 4WEKA 4MBKA 1YAXA 5A90A 4E3OA 3MS6A 1HTZA 2QJ7A 3MR0A 4L9EA 2WUQA 1PW1A 5HPIA 2WGWA 4F94A 4BENA 3JVUA 3NDGA 5G4ZA 2ZD8A 4H6JB 4YWZA 1FCNA 4F3LB 2HP9A 1LL5A 2Y2PA 3HCYA 1YT4A 2VV7A 2J8YA 3BLSA 3QP2A 4LLOB 3UE0A 1VEUA 1K56D 4EXOA 3IS2A 4I3JA 3DWZA 2G2UA 4YOFA 5EE8A 4HJ6A 3MXSA 3KYEA 1L0DA 1NYYA 3IHBA 4OONA 1PI4A 4E3JA 2XK1A 5G4YA 4BBTA 4GNUA 1XGIA 3EWKA 4YNRA 5J3WA 5EVLA 3BYDA 2XRNA 4R1GA 2EXAA 3BFDA 2X71A 2JKTI 3OBFA 5EVIB 3ZHHA 4R3JA 2GZAA 4HY8A 2OSUA 1ZG4A 2OWHA 3NJAA 1OTBA 5HAQA 1XJ6A 3MQOA 2H10A 3LR0A 3CPTA 1H0MA 2GNXA 1KE4A 4ETXA 4G3KA 4MN5A 1VM1A 3BJNA 1DY6A 3RJUA 3KSHA 5DTTA 2B95A 4LFUA 2CC1A 2KOIA 3T12B 1ZC2A 4ETZA 1NLZA 3CG5A 2PU4A 4E3MA 3HJIA 3LCEA 1CEGA 1YSQA 3EEAA 1MZUA 2JKRI 3PBSA 3MQ0A 5CEDA 4HH3A 1LI9A 4HBTA 4I38A 3UPNA 4MMNA 3UE1A 2XF3A 2PR5A 3CAXA 3V67A 4CLCC 4E3LA 5FAOA 4ESPA 1E3UD 1H8YA 4LCLA 1OTIA 1SDNA 3LR4A 3Q81A 2VKSA 1IYSA 2JBFA 5FATA 5A8BA 4HP4A 3LIEA 2WK0A 3HLGA 2XLNA 1WYBA 5HX9A 5CHUA 1CQAA 3D3OA 2G2WA 4HHDA 4G3WA 5LBRA 2Y8HA 3R7WA 3BM6A 3BLMA 1IYQA 3BEBA 3DTIA 4I5SA 3O86A 4KZ4A 4OLGA 3O87A 4MN6A 1DP8A 5HD5A 3LYXA 3IT9A 2ZQ9A 2L1MA 1EROA 1CJFA 2Q9NA 4DE2A 1SZVA 3ZG0A 4LV1A 4RYEA 4DE3A 3AGFA 1N9LA 3MQQA 1S1YA 3FV7A 1CI9A 4MBHA 3D72A 3BQAA 1YQSA 2PDRA 2K7SA 3RFBA 2V1AA 2VX8A 3LO7A 4OQ0A 1WE4A 4GDBA 4K08A 5L09A 5E2HA 4GKUA 1F5MA 1P0ZA 2V0WA 4ZAMA 1YLJA 5J7EA 3A3DA 5EVIC 1NRFA 5AQBA 4Q0JA 2JN7A 3S7OA 4PM9A 3UB9A 4I3AA 3HL9A 2J3TD 3T4OA 1BLHA 4GOGA 3RXXA 4X1MA 4IHQA 2ZLYA 1P9RA 3HLFA 1KDWA 1NYMA 1OJGA 3IBJA 5HSQA 4JGQA 3HVFA 2ZQ8A 1GHMA 2WYXA 3IS2B 3A0RA 1G28A 4WZ5A 1PW8A 4Y3IA 4EBLA 1GHIA 5F6AA 3JPUA 2GDNA 3QHYA 5KIZA 3GQZA 2FH5A 2JC7A 2FFFB 1STZA 2EX2A 1FSYA 3WRTA 1D7EA 1L0GA 5I5LA 2ZQ7A 3SH9A 4CJNA 3ZG9B 2WAFA 2ACGA 4WELA 2BTFP 3HUMA 1U60A 3NCKA 5E2GA 4N9KA 5L07A 1XKZA 2JKTM 1ACFA 3NBLA 4C3QA 4DRTA 5KZHA 4WMCA 3VP0A 4YFMA 4K0WA 1PWCA 3SS3A 5GHXA 2OLVA 3VFHA 3VP2A 4O8GA 1K54A 1W8QA 1HZOA 3KO6A 1AWIA 4S2LA 5EOOA 4X53A 4OQIA 4WYYA 3PR6A 1KE3A 2IWBA 4FSFA 5CHJA 3E2KA 1S4RA 4X1LA 3IWOA 4OLDA 4BD1A 1JWPA 5HWTA 4JGRA 2XDMA 3IBRA 3V3RA 3LR5A 4R70A 5EECA 2EX8A 1F2KA 1Q2PA 3ISGA 3IX4A 2D01A 3SH8A 1TDLA 3M6HA 5MC7A 5DF9A 4WMCD 1XFNA 4MNRA 2PD8A 4EBNA 4CLCD 4EW7A 2RCXA 4MDZA 5F69A 5IS1A 3N8SA 3O3VA 4CLCB 3KYQA 4BD0A 4XUXA 2PAVP 3Q1FA 4AFIA 1H3QA 1YSPA 3GDIA 2QZ6A 4IVKA 1IELA 3A0VA 3G31A 4DMZA 4KUKA 2HGVA 1BUEA 2KLIA 5L10A 4Y17A 3FPVA 1NXYA 1MWSA 4JPMA 3QP1A 4KZ6A 4F3LA 4Q0HA 4U0TA 1OJ5A 3DWKA 4I39A 4QHCA 4HI4A 1ODVA 3N4IA 2A3UA 2W0NA 5TBMB 2VGJA 5FEFA 4RQ9A 5KSCA 3N8LA 4E3KA 1XPBA 1I2WA 3OPPA 3PBRA 3GV9A 4WN5A 4CLCE 4ZBEA 2E8IA 1TVFA 1Y28A 5EVEA 2PU2A 1BYWA 3T50A 1GA0A 5U47A 4BQMA 5CGSA 2VZWA 3UB8A 3NC8A 3G30A 4HJ4A 3G2YA 2WAEA 3T4KA 5DJUA 3UNWA 3H82A 4C6YA 1DP6A 2QMIA 5A93A 2Y2GA 4QD4A 4NXFA 4WUJA 3UMEA 3TRCA 4ME4A 1P9WA 4OVDA 1PFLA 4Y0OA 1KGEA 3IH8A 4OOYA 4Z9QA 4P0MA 3ZYTA 2M1CA 4HESA 2V1BA 5FEGA 4ZTKA 4MN7A 5M19A 5TFQA 2VEAA 2Y91A 3VSLA 2PR6A 3UPOA 3Q82A 4Y7PA 2V20A 2WKHA 4CLCA 2FZ0A 4X68A 1ERQA 1FQGA 3GVBA 4PM7A 1XX2A 4ZDXA 4PAUA 5AVFA 3QP8A 5EPHA 1YLTA 1RGYA 1OTAA 4UQIS 4B4ZA 5TR7A 2VGKA 5FQJA 3T1XA 3VSKA 3CITA 3HREA 3K3DA 1EWZA 1WA9A 5FDHA 3PBQA 5CRFA 1HD8A 5F68A 2A49A 4LV2A 5FI6A 1SHVA 4HOIA 1GSWA 5HFOA 4HNBA 3T4TA 4WF0A 5L2FA 3LY3A 1H8ZA 1A0KA 5DJTA 3G34A 5FQIA 3TJZC 4OQHA 4NK3A 5DTSA 2VGLM 1I5QA 1BULA 3F1OA 1IYOA 5CEBA 4Y0UA 1LL8A 3FWLA 5CERA 2PD7A 3VV4A 2PT7A 1N4OA 2JKRM 3LEQA 1ES2A 4LENA 1LHYA 5L8MA 4LRYC 3MZDA 3EEHA 2Q9MA 3LEZA 1VHMA 3RXWA 3CPTB 2ZC5B 4M3KA 5AQ9A 3NHQA 4Y5FA 4HQAA 3ZVWA 2J3WA 2MJ6A 4GLQA 2O9BA 4R3BA 3B33A 4BL2A 5JYOA 2K2NA 1K6SA 4CQHA 4GCZA 1YLPA 3T4JA 3P01A 4O7DA 4BL3A 3V5MA 3LI8A 1T18A 3L7HA 2Z2LB 5GHYA 3TW8A 3C4PA 2QWSA 1N9NA 4NG2A 5FI7A 4JXGA 2YKFA 1UGUA 2O99A 3UB6A 3A3IA 4FCFA 3DBAA 1PNEA 3BFEA 5EM0A 5M18A 1GHPA 2V2FF 3HUOA 4IVIA 4B9OA 2WZXA 4NXGA 4YINA 1XXMA 4PHTA 4RX2A 5CGWA 3NECA 2H5SA 4ZJ2A 5J4EA 1V9YA 2QKPA 3ZDJA 3C4OA 2HDUA 5FSRA 4NXEA 1MBLA 1YMXA 1K57A 5HARA 4E3NA 4OPRA 4X55A 4UA7A 1IFQA 3UPPA 5K5BA 3VE3A 2HF6A 1MKMA 2XEPA 4E6XA 2Y2OA 2D02A 2HJ9C 4FH2A 3U2AA 1BLCA 1P97A 4QY6A 3VOYA 3C2WA 3MMHA 2JE5A 2ZC6B 5GLAA 3QNCA 1LSWA 4KQRA 1BLSA 3UY6A 4EEPA 1LI0A 4L0LA 4DDYA 5FAQA 2C6WB 3AGEA 3D4FA 2Y2JA 5IU1A 1ES4A 5EUAA 4OPQA 3R7WB 4GW9A 1BZAA 2V8FA 3RTYA 1S1ZA 1K55A 1OMEA 1GA9A 3F1OB 2PBYA 1W5DA 2ZM0A 1T1AA 4R6LA 1JWZA 4KENB 4JXVA 3V3SA 3K3CA 2Z2MB 4X69A 4MCWA 5FASA 3W2ZA 1H8MA 1OT6A 5DVAA 3ICYA 3SS4A 4BLMA 4JGPA 5AQ7A 3IF6C 2JKGA 1TS8A 3HLCA 1QMFA 3EGXC 3SS5A 1M40A 3O5YA 5DTKA 4EESA 3B47A 3UB7A 3PHYA 3WRZA 3WS1A 1YKDA 4E3IA 2QHKA 3I7JA 4WM9A 3MFDA 2V0UA 4NXBA 4IBRA 3EQUA 3P7NA 1PWDA 2W1TB 3B3XA 1SKOA 2P7JA 4OP8A 2XR0A 3S7QA 3LGOA 4KZ7A 4IEDA 2EWWA 3HJKA 4BWIA 3G2ZA 4JXWA 2UWXA 3VE4A 5DF8A 1S4SA 2Y2NA 1W7FA 3MZFA 1FR6A 2ZM2A 1DJBA 5D3OA 3MJQA 3PYPA 2V8CA 3FPWA 2O0YA 4FD8A 4JBFA 3UO9A 3GTCA 2GX5A 4QWOA 4R3AA 2HPBA 2Y55A 1YLWA 1W79A 3C7VA 3A3JA 1DRMA 1XJ2A 2B18A 2X02A 2W3FA 1EW0A 1XA1A 5KSHA 2ZC3B 5DKLA 4UAAA 3RH8B 3AGDA 4PM6A 3MBZA 2HJEA 3MXRA 3SOIA 5FQMA 1H5XA 1FCOA 4GJ4A 3E0YA 3MZEA 2Y79A 5HAPA 4HP9A 3DW0A 4UQIM 3QP5A 2W1TA 3UE6A 2OAQ1 5EV0A 4N92A 1FR1A 1IYPA 5HAIA 4LRXC 1YLYA 4EERA 1Z09A 1S0WA 3T4LA 3BW6A 1F98A 2LB5A 2QJ5A 3LICA 1PWGA 3DTKA 5GLDA 2ZJ9A 4KG5A 5TJJA 1XP4A 4LGWA 3WS0A 3CHWP 1KGFA 2Z6CA 1MWUA 3IF6B 5EVIA 3PAEA 5F83A 3E4OA 4HEFA 4BJPA 4IJGA 1LSXA 1NZUA 1Q2QA 1K55C 3OZHA 4KZ3A 2ZOHA 1YLZA 3LI9A 5F5YA 1VETA 4HH2A 5G18A 2ZQDA 5HWVA 3VOLA 2HP5A 1IKIA 2WADA 2O9AA 2WKPA 1KOUA 5I94A 4GD8A 3BRMA 3C8CA 4PM8A 2A2LA 4OPZA 1W8YA 2DRWA 2R9WA 4EBPA 4FOFA 1T1BA 4OH0A 4EUVA 4O01A 5C5KA 2QPNA 3LUQA 5EOEA 3S22A 2M7VA 2PRFA 4JGOA 2KX6A 2V9AA 4GZBA 1TDGA 3CZDA 3LIFA 4XUZA 1K25A 3G32A 3SW1A 1S67L 1CF0A 1MPLA 3H82B 2ZMFA 2XGNA 3VOZA 3MKFA 5FA7A 3F1PA 3LY4A 2HDSA 5GLBA 3CI6A 2ZMAA 1J9MA 4IBXA 5GL9A 3ZFZA 2ZC7A 4EWFA 1AXBA 4L9FA 1N9BA 2PYRA 3UMDA 3FG8A 3UDFA 1E3UA 1K4EA 2FFYA 3C30A 4U3TA 4G3VA 1ESUA 4FH4A 4UA6A 2L4RA 2Y2LA 2XA7M 2ZL1A 4BBUA 1PI5A 4XT2B 3W8KA 3N8RA 5DF7A 2P74A 4XXRA 3UB5P 3SH7A 1DJCA 4B93A 1Z6FA 1PZOA 2UV0E 2JHEA 2DCFA 4H6JA 4GS9A 4E6WA 4FTXA 4K0XA 2EFXA 4D60A 1NLYA 5EFWA 3L9KA 2PYPA 4LPZA 3VP1A 3S1YA 2XH9A 5HL1A 4LV0A 4KQDA 2P04A 2NUPC 3IXHA 3KYZA 4EUZA 1TS6A 3SZTA 1ZHHB 4KQOA 1KE0A 5FL3A 2P08A 3OPLA 4OOMA 4N1HA 5CTMA 5A92A 3MSHA 4I3IA 4Y2FA 2O9CA 1K6RA 3E4QA 3UE3A 3MF0A 4Y0TA 3IXBA 2J7VA 3T4SA 4II7A 4R23A 4HJ3A 2XSSA 5DFYA 2WKEA 5DKKA 1XJ3A 4KZ9A 3CLOA 4KZBA 3F1NB 4B4XA 5AJGA 3ZG7B 1LL9A 3E4PA 5M1AA 1GSXA 1Y54A 1JTDA 1G6AA 3ZGAB 1MC0A 2EA9A 1K56A 3OPRA 4JXSA 4P87A 4WLAA 3KX0X 2PHYA 3S4XA 2W3HA 4UHUA 3OCNA 4QJGA 3V39A 5CX7A 3IXGA 3DAVA 2Y2IA 2J9OA 2XFSA 1FSWA 4KQQA 4JLFA 3CMZA 3G6OA 2R78A 1L3LA 3GECA 4S2NC 3BECA 3BFFA 4JF5A 2J9PA 4WZ4A 4QPRA 1UWNX 2G7UA 1O07A 1G68A 3EQVA 3CJMA 3GMWA 2B02A 5CTNA 4LRZE 4PPRA 5E2EA 2Q0OA 4L9GA 1VEUB 3DTMA 5J8XA 1Y4OA 2HDRA 1ONGA 4EU0A 1S66L 1HVBA 4N1XA 1K4FA 1KVLA 3VP4A 1SCWA 1XJ4A 2XQZA 1NRJA 3Q7VB 3QP6A 3BFCA 3S7NA 1TEMA 1ALQA 4Z1WA 4WZ5C 4X56A 4QB8A 5AQAA 3ZCZA 4KUOA 3LIAA 3IX8A 2QYBA 1UWPX 3N6IA 3PAGA 3IX3A 3Q07A 4P6BA 2L0WA 2Y2HA 3ZNTA 1K57C 1OTDA 4OOLA 4A5RA 4OP5A 5FQQA 1SDEA 2ZL1B 1NZOA 3PTEA 3FZCA 3WS4A 1TF1A 4OKPA 1GSVA 2J80A 2P9VB 2ZOIA 3LIDA 4PKYG 4DXCA 1RGZA 3GR2A 1F9IA 2OAP1 2Z6DA 3TOIA 1TD5A 4GDNA 1W63M 4Q0IA 3IH9A 2EFUA 4JKTA 5HW3A 3JVVA 1L2SA 2Y4AA 3T4QA 1FOFA 3QNBA 2JCHA 3T1QB 2Y2QA 1D1JA 1YMSA 5TBMA 5FDSA 4EQIA 4EV4A 5EM1A 3G35A 4RA7A 2OWJA 3M2JA 4DE0A 1LSVA 4UA9A 5TGFA 3T1RA 2P9VA 1RCJA 4KG6A 2I9VA 3C5AA 3O88A 1M6KA 1YPRA 1QMEA 1ESIA 4KG2A 4S2PA 1PRQA 3VMAA 4K91A 3OC2A 1ZTUA 3IXDA 4MLLA 4CPKA 3P09A 4QU3A 2X01A 4IUKA 1XGJA 3FKVA 4M4XA 3MXQA 2VGLS 5HPFA 1VETB 3C38A 4KZ5A 2C5WB 3A3FA 1BSGA 2HZ5A 4Y13A 1IOUA 4OQGA 3H9WA 4LCMA 3MKEA 2VV6A 2LB9A 4HBUA 3A0SA
chains in the Genus database with same CATH topology
2JKFA 2ZL1A 3L9KA 3NULA 1FILA 4FUWA 1F2KA 3LEQA 1G5UA 2PAVP 1VEUB 3L7HA 1SZVA 4X25A 1FIKA 1Y4OA 2V8FA 3D9YA 3T1RA 3T1SA 1VEUA 4QWOA 2E8JA 3T1QB 1AWIA 1J3WA 5FEFA 5EV0A 5FEGA 4D60A 3U4LP 3MS6A 3UB5P 1SKOB 1K0KA 1ACFA 1VETB 2B95A 2ACGA 1VETA 1YPRA 1CF0A 3T12B 1D1JA 2HZ5A 3CHWP 3NECA 2BTFP 5FDSA 4X1LA 3KYEA 2PRFA 1SKOA 3T1XA 1PRQA 4FTXA 1HLUP 2PBDP 1CQAA 2JKGA 2V8CA 3CPTB 1Z09A 1PNEA 5EM1A 5EVEA 2ZL1B 3CPTA 3DAVA 3LGOA 5EM0A 1A0KA 2VK3A 4ESPA 4X1MA 1PFLA 1CJFA 3MSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JKF A;  2ZL1 A;  3L9K A;  3NUL A;  1FIL A;  4FUW A;  1F2K A;  3LEQ A;  1G5U A;  2PAV P;  1VEU B;  3L7H A;  1SZV A;  4X25 A;  1FIK A;  1Y4O A;  2V8F A;  3D9Y A;  3T1R A;  3T1S A;  1VEU A;  4QWO A;  2E8J A;  3T1Q B;  1AWI A;  1J3W A;  5FEF A;  5EV0 A;  5FEG A;  4D60 A;  3U4L P;  3MS6 A;  3UB5 P;  1SKO B;  1K0K A;  1ACF A;  1VET B;  2B95 A;  2ACG A;  1VET A;  1YPR A;  1CF0 A;  3T12 B;  1D1J A;  2HZ5 A;  3CHW P;  3NEC A;  2BTF P;  5FDS A;  4X1L A;  3KYE A;  2PRF A;  1SKO A;  3T1X A;  1PRQ A;  4FTX A;  1HLU P;  2PBD P;  1CQA A;  2JKG A;  2V8C A;  3CPT B;  1Z09 A;  1PNE A;  5EM1 A;  5EVE A;  2ZL1 B;  3CPT A;  3DAV A;  3LGO A;  5EM0 A;  1A0K A;  2VK3 A;  4ESP A;  4X1M A;  1PFL A;  1CJF A;  3MSH A; 
#chains in the Genus database with same CATH topology
 3B42 A;  2EXB A;  5HZH A;  4ID4 A;  3F1N A;  4UEY A;  1NWZ A;  5DFX A;  2VLG A;  2HP6 A;  2GJ3 A;  5FI2 A;  1T1C A;  4KZ8 A;  5HDS A;  5E2F A;  2ZQA A;  1K54 C;  4ZJ1 A;  3E2L A;  2WGW B;  4JF4 A;  4C75 A;  2JKF A;  4B88 A;  2K31 A;  3CUE A;  4RVA A;  1W63 Q;  3QP4 A;  5CHM A;  1TS7 A;  3ULF A;  3H7W B;  1CI8 A;  4DDS A;  2EWV A;  3PXP A;  1N9O A;  4DF6 A;  4WBG A;  4DE1 A;  1YM1 A;  3F1P B;  2EX6 A;  1XA7 A;  4BBV A;  4NEE D;  4S2K A;  4GD6 A;  1ZKJ A;  4FUW A;  2KDK A;  2EX9 A;  1WYC A;  3NOT C;  1MY8 A;  2W3E A;  2W3D A;  3C7U A;  1ERM A;  1NY0 A;  3N7W A;  4GHI B;  2R9X A;  5HD3 A;  1OTE A;  3KSG A;  2VK3 A;  2Y59 A;  4S2O A;  3ZG8 B;  1VQQ A;  3D9Y A;  1ONH A;  3NDE A;  4P6Z M;  1V9Z A;  3PBT A;  5HDC A;  1IEM A;  3IF6 A;  2HV1 A;  3R4K A;  5JYP A;  5KMW A;  1E4D A;  5CGX A;  3IWI A;  2OV5 A;  3CWF A;  2IWC A;  4U0X A;  3HUN A;  1OT9 A;  3K2N A;  1PZP A;  4X25 A;  2VV8 A;  4DKI A;  5EVI D;  1KDS A;  2Y2K A;  4S2M A;  1JNU A;  3GRJ A;  3NIA A;  2CMN A;  2WKR A;  1DJA A;  5CXW A;  3IQA A;  1NJ4 A;  3UN7 A;  3ITA A;  5CEC A;  2ZQC A;  4WL9 A;  1O7E A;  3OLO A;  3WS5 A;  3CUE C;  1IKG A;  1JTG A;  4E04 A;  4ZRR A;  4Q8I A;  2VJW A;  2XA7 S;  3HBR A;  1S6R A;  3HLE A;  2IA2 A;  4ZJ3 A;  4PKY A;  2B5R A;  4O0P A;  1JWV A;  5IT5 A;  2H0T A;  1T19 A;  2IWD A;  3M6B A;  3UDI A;  1BLP A;  3ZVT A;  3TE8 A;  4R4S A;  2H0Y A;  2XD1 A;  3OOV A;  2BAS A;  3NY4 A;  4ARZ A;  3ITB A;  3A3E A;  2ZC4 B;  2DMW A;  4MEZ A;  3OPH A;  2Y2M A;  3G4P A;  1VB6 A;  1G5U A;  5HL6 A;  2WKI A;  3UDX A;  2WZZ A;  2M7U A;  4QY5 A;  4IUH A;  1C3B A;  1MXO A;  2OOL A;  3NI9 A;  2YKH A;  3BY8 A;  4Y15 A;  1EI5 A;  2W27 A;  4R0Q A;  5A91 A;  4RX3 A;  3FKW A;  2HDQ A;  3H7W A;  3LR3 A;  5FAP A;  3VFF A;  5FQK A;  3S7P A;  4R4R A;  3LFV A;  3IWQ A;  3Q7V A;  5GHZ A;  3ZNY A;  2WKQ A;  2WGV A;  1LLB A;  2XFT A;  3ZQ5 A;  4P85 A;  3WS2 A;  5F1G A;  3NUL A;  2ZMV A;  1ES3 A;  1KVM A;  2AVX A;  1FCM A;  4JF6 A;  1J3W A;  4DJ2 A;  2H28 A;  5F1F A;  3EOI A;  4GHI A;  4EQ1 A;  2V1Z A;  1E25 A;  3EGD C;  1G6O A;  2XD5 A;  1OPX A;  3W4P A;  2INW A;  2J3T C;  4NKP A;  1FIL A;  4GS9 B;  3BWL A;  4S2J A;  1MWT A;  4ARZ B;  3BQ8 A;  3HLW A;  4XT2 A;  3ZG5 A;  3OCL A;  1K38 A;  1SKF A;  3U4L P;  1CK3 A;  2W1R A;  5HDD A;  3JYI A;  2BLS A;  4WEJ A;  4GN2 A;  1LT0 A;  1BTL A;  3KSF A;  1BT5 A;  1HLU P;  3FYZ A;  2DNS A;  3HLD A;  1D06 A;  3HLB A;  1MWR A;  3LIB A;  5HWW A;  3Q7Z A;  4D2O A;  4N9L A;  1PYY A;  5F82 A;  4PMA A;  1FIK A;  5IHV A;  2NUT C;  3WWX A;  1SKO B;  1K0K A;  1RP5 A;  4H8R A;  1CEF A;  1L0F A;  4BMW A;  3DTE A;  1I2S A;  3P98 A;  3PBN A;  5AVE A;  1GCE A;  3E98 A;  3M2K A;  2A24 B;  4GB7 A;  3TSG A;  1PIO A;  3TG9 A;  4OPY A;  3T1S A;  2WGI A;  2E8J A;  3PBO A;  5GLC A;  2W3G A;  4NET A;  2RL3 A;  3VP3 A;  1DP9 A;  4EEU A;  4DJ3 A;  1ES5 A;  4LV3 A;  3W4Q A;  4S2N A;  3KSI A;  3BFG A;  4EET B;  4KZA A;  3W4O A;  4DXB A;  4P6Z S;  2I72 A;  1ZG6 A;  2OLU A;  2ZBB A;  3IF5 A;  3V50 A;  5BOH A;  5FQ9 A;  2ZM8 A;  4PM5 A;  4S2I A;  1JVJ A;  4MBF A;  1XFQ A;  5E43 A;  1L0E A;  3FC7 A;  3MFX A;  4X6T A;  2BG1 A;  1MKI A;  2XRO A;  2A24 A;  2VA0 A;  2PBD P;  3NOP C;  4HIA A;  3IHA A;  1TS0 A;  1KGG A;  3NOU C;  4R38 A;  3GSG A;  4DN0 A;  3BY9 A;  1X0O A;  4WEK A;  4MBK A;  1YAX A;  5A90 A;  4E3O A;  3MS6 A;  1HTZ A;  2QJ7 A;  3MR0 A;  4L9E A;  2WUQ A;  1PW1 A;  5HPI A;  2WGW A;  4F94 A;  4BEN A;  3JVU A;  3NDG A;  5G4Z A;  2ZD8 A;  4H6J B;  4YWZ A;  1FCN A;  4F3L B;  2HP9 A;  1LL5 A;  2Y2P A;  3HCY A;  1YT4 A;  2VV7 A;  2J8Y A;  3BLS A;  3QP2 A;  4LLO B;  3UE0 A;  1VEU A;  1K56 D;  4EXO A;  3IS2 A;  4I3J A;  3DWZ A;  2G2U A;  4YOF A;  5EE8 A;  4HJ6 A;  3MXS A;  3KYE A;  1L0D A;  1NYY A;  3IHB A;  4OON A;  1PI4 A;  4E3J A;  2XK1 A;  5G4Y A;  4BBT A;  4GNU A;  1XGI A;  3EWK A;  4YNR A;  5J3W A;  5EVL A;  3BYD A;  2XRN A;  4R1G A;  2EXA A;  3BFD A;  2X71 A;  2JKT I;  3OBF A;  5EVI B;  3ZHH A;  4R3J A;  2GZA A;  4HY8 A;  2OSU A;  1ZG4 A;  2OWH A;  3NJA A;  1OTB A;  5HAQ A;  1XJ6 A;  3MQO A;  2H10 A;  3LR0 A;  3CPT A;  1H0M A;  2GNX A;  1KE4 A;  4ETX A;  4G3K A;  4MN5 A;  1VM1 A;  3BJN A;  1DY6 A;  3RJU A;  3KSH A;  5DTT A;  2B95 A;  4LFU A;  2CC1 A;  2KOI A;  3T12 B;  1ZC2 A;  4ETZ A;  1NLZ A;  3CG5 A;  2PU4 A;  4E3M A;  3HJI A;  3LCE A;  1CEG A;  1YSQ A;  3EEA A;  1MZU A;  2JKR I;  3PBS A;  3MQ0 A;  5CED A;  4HH3 A;  1LI9 A;  4HBT A;  4I38 A;  3UPN A;  4MMN A;  3UE1 A;  2XF3 A;  2PR5 A;  3CAX A;  3V67 A;  4CLC C;  4E3L A;  5FAO A;  4ESP A;  1E3U D;  1H8Y A;  4LCL A;  1OTI A;  1SDN A;  3LR4 A;  3Q81 A;  2VKS A;  1IYS A;  2JBF A;  5FAT A;  5A8B A;  4HP4 A;  3LIE A;  2WK0 A;  3HLG A;  2XLN A;  1WYB A;  5HX9 A;  5CHU A;  1CQA A;  3D3O A;  2G2W A;  4HHD A;  4G3W A;  5LBR A;  2Y8H A;  3R7W A;  3BM6 A;  3BLM A;  1IYQ A;  3BEB A;  3DTI A;  4I5S A;  3O86 A;  4KZ4 A;  4OLG A;  3O87 A;  4MN6 A;  1DP8 A;  5HD5 A;  3LYX A;  3IT9 A;  2ZQ9 A;  2L1M A;  1ERO A;  1CJF A;  2Q9N A;  4DE2 A;  1SZV A;  3ZG0 A;  4LV1 A;  4RYE A;  4DE3 A;  3AGF A;  1N9L A;  3MQQ A;  1S1Y A;  3FV7 A;  1CI9 A;  4MBH A;  3D72 A;  3BQA A;  1YQS A;  2PDR A;  2K7S A;  3RFB A;  2V1A A;  2VX8 A;  3LO7 A;  4OQ0 A;  1WE4 A;  4GDB A;  4K08 A;  5L09 A;  5E2H A;  4GKU A;  1F5M A;  1P0Z A;  2V0W A;  4ZAM A;  1YLJ A;  5J7E A;  3A3D A;  5EVI C;  1NRF A;  5AQB A;  4Q0J A;  2JN7 A;  3S7O A;  4PM9 A;  3UB9 A;  4I3A A;  3HL9 A;  2J3T D;  3T4O A;  1BLH A;  4GOG A;  3RXX A;  4X1M A;  4IHQ A;  2ZLY A;  1P9R A;  3HLF A;  1KDW A;  1NYM A;  1OJG A;  3IBJ A;  5HSQ A;  4JGQ A;  3HVF A;  2ZQ8 A;  1GHM A;  2WYX A;  3IS2 B;  3A0R A;  1G28 A;  4WZ5 A;  1PW8 A;  4Y3I A;  4EBL A;  1GHI A;  5F6A A;  3JPU A;  2GDN A;  3QHY A;  5KIZ A;  3GQZ A;  2FH5 A;  2JC7 A;  2FFF B;  1STZ A;  2EX2 A;  1FSY A;  3WRT A;  1D7E A;  1L0G A;  5I5L A;  2ZQ7 A;  3SH9 A;  4CJN A;  3ZG9 B;  2WAF A;  2ACG A;  4WEL A;  2BTF P;  3HUM A;  1U60 A;  3NCK A;  5E2G A;  4N9K A;  5L07 A;  1XKZ A;  2JKT M;  1ACF A;  3NBL A;  4C3Q A;  4DRT A;  5KZH A;  4WMC A;  3VP0 A;  4YFM A;  4K0W A;  1PWC A;  3SS3 A;  5GHX A;  2OLV A;  3VFH A;  3VP2 A;  4O8G A;  1K54 A;  1W8Q A;  1HZO A;  3KO6 A;  1AWI A;  4S2L A;  5EOO A;  4X53 A;  4OQI A;  4WYY A;  3PR6 A;  1KE3 A;  2IWB A;  4FSF A;  5CHJ A;  3E2K A;  1S4R A;  4X1L A;  3IWO A;  4OLD A;  4BD1 A;  1JWP A;  5HWT A;  4JGR A;  2XDM A;  3IBR A;  3V3R A;  3LR5 A;  4R70 A;  5EEC A;  2EX8 A;  1F2K A;  1Q2P A;  3ISG A;  3IX4 A;  2D01 A;  3SH8 A;  1TDL A;  3M6H A;  5MC7 A;  5DF9 A;  4WMC D;  1XFN A;  4MNR A;  2PD8 A;  4EBN A;  4CLC D;  4EW7 A;  2RCX A;  4MDZ A;  5F69 A;  5IS1 A;  3N8S A;  3O3V A;  4CLC B;  3KYQ A;  4BD0 A;  4XUX A;  2PAV P;  3Q1F A;  4AFI A;  1H3Q A;  1YSP A;  3GDI A;  2QZ6 A;  4IVK A;  1IEL A;  3A0V A;  3G31 A;  4DMZ A;  4KUK A;  2HGV A;  1BUE A;  2KLI A;  5L10 A;  4Y17 A;  3FPV A;  1NXY A;  1MWS A;  4JPM A;  3QP1 A;  4KZ6 A;  4F3L A;  4Q0H A;  4U0T A;  1OJ5 A;  3DWK A;  4I39 A;  4QHC A;  4HI4 A;  1ODV A;  3N4I A;  2A3U A;  2W0N A;  5TBM B;  2VGJ A;  5FEF A;  4RQ9 A;  5KSC A;  3N8L A;  4E3K A;  1XPB A;  1I2W A;  3OPP A;  3PBR A;  3GV9 A;  4WN5 A;  4CLC E;  4ZBE A;  2E8I A;  1TVF A;  1Y28 A;  5EVE A;  2PU2 A;  1BYW A;  3T50 A;  1GA0 A;  5U47 A;  4BQM A;  5CGS A;  2VZW A;  3UB8 A;  3NC8 A;  3G30 A;  4HJ4 A;  3G2Y A;  2WAE A;  3T4K A;  5DJU A;  3UNW A;  3H82 A;  4C6Y A;  1DP6 A;  2QMI A;  5A93 A;  2Y2G A;  4QD4 A;  4NXF A;  4WUJ A;  3UME A;  3TRC A;  4ME4 A;  1P9W A;  4OVD A;  1PFL A;  4Y0O A;  1KGE A;  3IH8 A;  4OOY A;  4Z9Q A;  4P0M A;  3ZYT A;  2M1C A;  4HES A;  2V1B A;  5FEG A;  4ZTK A;  4MN7 A;  5M19 A;  5TFQ A;  2VEA A;  2Y91 A;  3VSL A;  2PR6 A;  3UPO A;  3Q82 A;  4Y7P A;  2V20 A;  2WKH A;  4CLC A;  2FZ0 A;  4X68 A;  1ERQ A;  1FQG A;  3GVB A;  4PM7 A;  1XX2 A;  4ZDX A;  4PAU A;  5AVF A;  3QP8 A;  5EPH A;  1YLT A;  1RGY A;  1OTA A;  4UQI S;  4B4Z A;  5TR7 A;  2VGK A;  5FQJ A;  3T1X A;  3VSK A;  3CIT A;  3HRE A;  3K3D A;  1EWZ A;  1WA9 A;  5FDH A;  3PBQ A;  5CRF A;  1HD8 A;  5F68 A;  2A49 A;  4LV2 A;  5FI6 A;  1SHV A;  4HOI A;  1GSW A;  5HFO A;  4HNB A;  3T4T A;  4WF0 A;  5L2F A;  3LY3 A;  1H8Z A;  1A0K A;  5DJT A;  3G34 A;  5FQI A;  3TJZ C;  4OQH A;  4NK3 A;  5DTS A;  2VGL M;  1I5Q A;  1BUL A;  3F1O A;  1IYO A;  5CEB A;  4Y0U A;  1LL8 A;  3FWL A;  5CER A;  2PD7 A;  3VV4 A;  2PT7 A;  1N4O A;  2JKR M;  3LEQ A;  1ES2 A;  4LEN A;  1LHY A;  5L8M A;  4LRY C;  3MZD A;  3EEH A;  2Q9M A;  3LEZ A;  1VHM A;  3RXW A;  3CPT B;  2ZC5 B;  4M3K A;  5AQ9 A;  3NHQ A;  4Y5F A;  4HQA A;  3ZVW A;  2J3W A;  2MJ6 A;  4GLQ A;  2O9B A;  4R3B A;  3B33 A;  4BL2 A;  5JYO A;  2K2N A;  1K6S A;  4CQH A;  4GCZ A;  1YLP A;  3T4J A;  3P01 A;  4O7D A;  4BL3 A;  3V5M A;  3LI8 A;  1T18 A;  3L7H A;  2Z2L B;  5GHY A;  3TW8 A;  3C4P A;  2QWS A;  1N9N A;  4NG2 A;  5FI7 A;  4JXG A;  2YKF A;  1UGU A;  2O99 A;  3UB6 A;  3A3I A;  4FCF A;  3DBA A;  1PNE A;  3BFE A;  5EM0 A;  5M18 A;  1GHP A;  2V2F F;  3HUO A;  4IVI A;  4B9O A;  2WZX A;  4NXG A;  4YIN A;  1XXM A;  4PHT A;  4RX2 A;  5CGW A;  3NEC A;  2H5S A;  4ZJ2 A;  5J4E A;  1V9Y A;  2QKP A;  3ZDJ A;  3C4O A;  2HDU A;  5FSR A;  4NXE A;  1MBL A;  1YMX A;  1K57 A;  5HAR A;  4E3N A;  4OPR A;  4X55 A;  4UA7 A;  1IFQ A;  3UPP A;  5K5B A;  3VE3 A;  2HF6 A;  1MKM A;  2XEP A;  4E6X A;  2Y2O A;  2D02 A;  2HJ9 C;  4FH2 A;  3U2A A;  1BLC A;  1P97 A;  4QY6 A;  3VOY A;  3C2W A;  3MMH A;  2JE5 A;  2ZC6 B;  5GLA A;  3QNC A;  1LSW A;  4KQR A;  1BLS A;  3UY6 A;  4EEP A;  1LI0 A;  4L0L A;  4DDY A;  5FAQ A;  2C6W B;  3AGE A;  3D4F A;  2Y2J A;  5IU1 A;  1ES4 A;  5EUA A;  4OPQ A;  3R7W B;  4GW9 A;  1BZA A;  2V8F A;  3RTY A;  1S1Z A;  1K55 A;  1OME A;  1GA9 A;  3F1O B;  2PBY A;  1W5D A;  2ZM0 A;  1T1A A;  4R6L A;  1JWZ A;  4KEN B;  4JXV A;  3V3S A;  3K3C A;  2Z2M B;  4X69 A;  4MCW A;  5FAS A;  3W2Z A;  1H8M A;  1OT6 A;  5DVA A;  3ICY A;  3SS4 A;  4BLM A;  4JGP A;  5AQ7 A;  3IF6 C;  2JKG A;  1TS8 A;  3HLC A;  1QMF A;  3EGX C;  3SS5 A;  1M40 A;  3O5Y A;  5DTK A;  4EES A;  3B47 A;  3UB7 A;  3PHY A;  3WRZ A;  3WS1 A;  1YKD A;  4E3I A;  2QHK A;  3I7J A;  4WM9 A;  3MFD A;  2V0U A;  4NXB A;  4IBR A;  3EQU A;  3P7N A;  1PWD A;  2W1T B;  3B3X A;  1SKO A;  2P7J A;  4OP8 A;  2XR0 A;  3S7Q A;  3LGO A;  4KZ7 A;  4IED A;  2EWW A;  3HJK A;  4BWI A;  3G2Z A;  4JXW A;  2UWX A;  3VE4 A;  5DF8 A;  1S4S A;  2Y2N A;  1W7F A;  3MZF A;  1FR6 A;  2ZM2 A;  1DJB A;  5D3O A;  3MJQ A;  3PYP A;  2V8C A;  3FPW A;  2O0Y A;  4FD8 A;  4JBF A;  3UO9 A;  3GTC A;  2GX5 A;  4QWO A;  4R3A A;  2HPB A;  2Y55 A;  1YLW A;  1W79 A;  3C7V A;  3A3J A;  1DRM A;  1XJ2 A;  2B18 A;  2X02 A;  2W3F A;  1EW0 A;  1XA1 A;  5KSH A;  2ZC3 B;  5DKL A;  4UAA A;  3RH8 B;  3AGD A;  4PM6 A;  3MBZ A;  2HJE A;  3MXR A;  3SOI A;  5FQM A;  1H5X A;  1FCO A;  4GJ4 A;  3E0Y A;  3MZE A;  2Y79 A;  5HAP A;  4HP9 A;  3DW0 A;  4UQI M;  3QP5 A;  2W1T A;  3UE6 A;  2OAQ 1;  5EV0 A;  4N92 A;  1FR1 A;  1IYP A;  5HAI A;  4LRX C;  1YLY A;  4EER A;  1Z09 A;  1S0W A;  3T4L A;  3BW6 A;  1F98 A;  2LB5 A;  2QJ5 A;  3LIC A;  1PWG A;  3DTK A;  5GLD A;  2ZJ9 A;  4KG5 A;  5TJJ A;  1XP4 A;  4LGW A;  3WS0 A;  3CHW P;  1KGF A;  2Z6C A;  1MWU A;  3IF6 B;  5EVI A;  3PAE A;  5F83 A;  3E4O A;  4HEF A;  4BJP A;  4IJG A;  1LSX A;  1NZU A;  1Q2Q A;  1K55 C;  3OZH A;  4KZ3 A;  2ZOH A;  1YLZ A;  3LI9 A;  5F5Y A;  1VET A;  4HH2 A;  5G18 A;  2ZQD A;  5HWV A;  3VOL A;  2HP5 A;  1IKI A;  2WAD A;  2O9A A;  2WKP A;  1KOU A;  5I94 A;  4GD8 A;  3BRM A;  3C8C A;  4PM8 A;  2A2L A;  4OPZ A;  1W8Y A;  2DRW A;  2R9W A;  4EBP A;  4FOF A;  1T1B A;  4OH0 A;  4EUV A;  4O01 A;  5C5K A;  2QPN A;  3LUQ A;  5EOE A;  3S22 A;  2M7V A;  2PRF A;  4JGO A;  2KX6 A;  2V9A A;  4GZB A;  1TDG A;  3CZD A;  3LIF A;  4XUZ A;  1K25 A;  3G32 A;  3SW1 A;  1S67 L;  1CF0 A;  1MPL A;  3H82 B;  2ZMF A;  2XGN A;  3VOZ A;  3MKF A;  5FA7 A;  3F1P A;  3LY4 A;  2HDS A;  5GLB A;  3CI6 A;  2ZMA A;  1J9M A;  4IBX A;  5GL9 A;  3ZFZ A;  2ZC7 A;  4EWF A;  1AXB A;  4L9F A;  1N9B A;  2PYR A;  3UMD A;  3FG8 A;  3UDF A;  1E3U A;  1K4E A;  2FFY A;  3C30 A;  4U3T A;  4G3V A;  1ESU A;  4FH4 A;  4UA6 A;  2L4R A;  2Y2L A;  2XA7 M;  2ZL1 A;  4BBU A;  1PI5 A;  4XT2 B;  3W8K A;  3N8R A;  5DF7 A;  2P74 A;  4XXR A;  3UB5 P;  3SH7 A;  1DJC A;  4B93 A;  1Z6F A;  1PZO A;  2UV0 E;  2JHE A;  2DCF A;  4H6J A;  4GS9 A;  4E6W A;  4FTX A;  4K0X A;  2EFX A;  4D60 A;  1NLY A;  5EFW A;  3L9K A;  2PYP A;  4LPZ A;  3VP1 A;  3S1Y A;  2XH9 A;  5HL1 A;  4LV0 A;  4KQD A;  2P04 A;  2NUP C;  3IXH A;  3KYZ A;  4EUZ A;  1TS6 A;  3SZT A;  1ZHH B;  4KQO A;  1KE0 A;  5FL3 A;  2P08 A;  3OPL A;  4OOM A;  4N1H A;  5CTM A;  5A92 A;  3MSH A;  4I3I A;  4Y2F A;  2O9C A;  1K6R A;  3E4Q A;  3UE3 A;  3MF0 A;  4Y0T A;  3IXB A;  2J7V A;  3T4S A;  4II7 A;  4R23 A;  4HJ3 A;  2XSS A;  5DFY A;  2WKE A;  5DKK A;  1XJ3 A;  4KZ9 A;  3CLO A;  4KZB A;  3F1N B;  4B4X A;  5AJG A;  3ZG7 B;  1LL9 A;  3E4P A;  5M1A A;  1GSX A;  1Y54 A;  1JTD A;  1G6A A;  3ZGA B;  1MC0 A;  2EA9 A;  1K56 A;  3OPR A;  4JXS A;  4P87 A;  4WLA A;  3KX0 X;  2PHY A;  3S4X A;  2W3H A;  4UHU A;  3OCN A;  4QJG A;  3V39 A;  5CX7 A;  3IXG A;  3DAV A;  2Y2I A;  2J9O A;  2XFS A;  1FSW A;  4KQQ A;  4JLF A;  3CMZ A;  3G6O A;  2R78 A;  1L3L A;  3GEC A;  4S2N C;  3BEC A;  3BFF A;  4JF5 A;  2J9P A;  4WZ4 A;  4QPR A;  1UWN X;  2G7U A;  1O07 A;  1G68 A;  3EQV A;  3CJM A;  3GMW A;  2B02 A;  5CTN A;  4LRZ E;  4PPR A;  5E2E A;  2Q0O A;  4L9G A;  1VEU B;  3DTM A;  5J8X A;  1Y4O A;  2HDR A;  1ONG A;  4EU0 A;  1S66 L;  1HVB A;  4N1X A;  1K4F A;  1KVL A;  3VP4 A;  1SCW A;  1XJ4 A;  2XQZ A;  1NRJ A;  3Q7V B;  3QP6 A;  3BFC A;  3S7N A;  1TEM A;  1ALQ A;  4Z1W A;  4WZ5 C;  4X56 A;  4QB8 A;  5AQA A;  3ZCZ A;  4KUO A;  3LIA A;  3IX8 A;  2QYB A;  1UWP X;  3N6I A;  3PAG A;  3IX3 A;  3Q07 A;  4P6B A;  2L0W A;  2Y2H A;  3ZNT A;  1K57 C;  1OTD A;  4OOL A;  4A5R A;  4OP5 A;  5FQQ A;  1SDE A;  2ZL1 B;  1NZO A;  3PTE A;  3FZC A;  3WS4 A;  1TF1 A;  4OKP A;  1GSV A;  2J80 A;  2P9V B;  2ZOI A;  3LID A;  4PKY G;  4DXC A;  1RGZ A;  3GR2 A;  1F9I A;  2OAP 1;  2Z6D A;  3TOI A;  1TD5 A;  4GDN A;  1W63 M;  4Q0I A;  3IH9 A;  2EFU A;  4JKT A;  5HW3 A;  3JVV A;  1L2S A;  2Y4A A;  3T4Q A;  1FOF A;  3QNB A;  2JCH A;  3T1Q B;  2Y2Q A;  1D1J A;  1YMS A;  5TBM A;  5FDS A;  4EQI A;  4EV4 A;  5EM1 A;  3G35 A;  4RA7 A;  2OWJ A;  3M2J A;  4DE0 A;  1LSV A;  4UA9 A;  5TGF A;  3T1R A;  2P9V A;  1RCJ A;  4KG6 A;  2I9V A;  3C5A A;  3O88 A;  1M6K A;  1YPR A;  1QME A;  1ESI A;  4KG2 A;  4S2P A;  1PRQ A;  3VMA A;  4K91 A;  3OC2 A;  1ZTU A;  3IXD A;  4MLL A;  4CPK A;  3P09 A;  4QU3 A;  2X01 A;  4IUK A;  1XGJ A;  3FKV A;  4M4X A;  3MXQ A;  2VGL S;  5HPF A;  1VET B;  3C38 A;  4KZ5 A;  2C5W B;  3A3F A;  1BSG A;  2HZ5 A;  4Y13 A;  1IOU A;  4OQG A;  3H9W A;  4LCM A;  3MKE A;  2VV6 A;  2LB9 A;  4HBU A;  3A0S A; 
#chains in the Genus database with same CATH homology
 2JKF A;  2ZL1 A;  3L9K A;  3NUL A;  1FIL A;  4FUW A;  1F2K A;  3LEQ A;  1G5U A;  2PAV P;  1VEU B;  3L7H A;  1SZV A;  4X25 A;  1FIK A;  1Y4O A;  2V8F A;  3D9Y A;  3T1R A;  3T1S A;  1VEU A;  4QWO A;  2E8J A;  3T1Q B;  1AWI A;  1J3W A;  5FEF A;  5EV0 A;  5FEG A;  4D60 A;  3U4L P;  3MS6 A;  3UB5 P;  1SKO B;  1K0K A;  1ACF A;  1VET B;  2B95 A;  2ACG A;  1VET A;  1YPR A;  1CF0 A;  3T12 B;  1D1J A;  2HZ5 A;  3CHW P;  3NEC A;  2BTF P;  5FDS A;  4X1L A;  3KYE A;  2PRF A;  1SKO A;  3T1X A;  1PRQ A;  4FTX A;  1HLU P;  2PBD P;  1CQA A;  2JKG A;  2V8C A;  3CPT B;  1Z09 A;  1PNE A;  5EM1 A;  5EVE A;  2ZL1 B;  3CPT A;  3DAV A;  3LGO A;  5EM0 A;  1A0K A;  2VK3 A;  4ESP A;  4X1M A;  1PFL A;  1CJF A;  3MSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...