4FUWA

Crystal structure of ego3 mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
151
structure length
140
Chain Sequence
SKNVKGFLENTLKPYGSLQSSMIITATNGGILSYATSNNSINEINSVNNLKMMSLLIKDKWSEDENDNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLGLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein SLM4
publication title Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 40
structure length 140
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16818 SLM4 Protein SLM4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4fuwA01
3LGOA 2JKFA 5EVEA 2PAVP 1FILA 3T12B 1Y4OA 3T1XA 2PBDP 1J3WA 2E8JA 5FEFA 1VETB 3MS6A 3MSHA 3U4LP 3T1RA 5EM1A 3CHWP 3D9YA 5FEGA 4D60A 2HZ5A 5FDSA 2ZL1B 3CPTA 3L9KA 2V8CA 3DAVA 2ACGA 1CJFA 3NECA 1PNEA 1VEUB 2VK3A 1PRQA 3LEQA 5EM0A 4X1MA 1SKOB 4X25A 2JKGA 1AWIA 3L7HA 3T1SA 1CQAA 3T1QB 2ZL1A 4X1LA 1D1JA 3KYEA 1FIKA 4QWOA 1PFLA 4FUWA 1VEUA 4FTXA 2B95A 1G5UA 1HLUP 1ACFA 1VETA 2V8FA 3NULA 1SKOA 5EV0A 1A0KA 1CF0A 1K0KA 3UB5P 2PRFA 2BTFP 1YPRA 1Z09A 3CPTB 1SZVA 4ESPA 1F2KA
chains in the Genus database with same CATH superfamily
4HY8A 4WELA 4AFIA 4GS9A 1H3QA 1TS7A 4WZ5C 3GQZA 1YKDA 1IYPA 1E3UD 1WA9A 2DMWA 3HL9A 5CEDA 3TG9A 4WBGA 4HJ3A 3Q7VB 2PBDP 4IEDA 5FQJA 4E6XA 5GLBA 1U60A 4QPRA 4YFMA 1GSVA 3M2JA 4C6YA 2KDKA 1BZAA 4ETXA 3NY4A 3C7VA 1E25A 3L9KA 2V8CA 4KUOA 3W2ZA 3NOUC 4N9LA 1YLPA 4OLDA 2ZC5B 3CI6A 4Y13A 3SW1A 4JXVA 1EI5A 4GD8A 4IVKA 1S67L 4HOIA 4CJNA 1BYWA 2GDNA 1QMEA 5E2HA 2Y4AA 3T4SA 1FIKA 4DE0A 2ZLYA 3UE0A 4EEPA 3UB8A 4RVAA 4WZ5A 5I94A 1MPLA 3PAEA 2G7UA 1ACFA 1K4EA 5AQ9A 3BLSA 3OZHA 1XX2A 1W8YA 5HZHA 3IWIA 4EV4A 3HLEA 2P74A 1CEFA 3QP2A 3DBAA 5EFWA 4Y7PA 2L4RA 5KMWA 1BTLA 3NI9A 2Q9MA 1N9LA 2C6WB 1YLYA 1LLBA 4HQAA 1F2KA 4X68A 3IS2B 2ZQ8A 3V5MA 5M18A 2JKFA 2LB9A 5L09A 1OPXA 4O7DA 2QPNA 5HWVA 2E8IA 5HPFA 3BFGA 5FEFA 3RH8B 1PWGA 2PD7A 1RCJA 3ZDJA 4HP9A 1PZOA 4S2LA 5IU1A 1XKZA 4HESA 1XA1A 1PNEA 4M3KA 1Z6FA 3LI8A 3OPHA 4NXEA 3MJQA 2VGLS 5FQIA 5EM0A 4EESA 5FAQA 1WYBA 5TBMA 1S6RA 1KVMA 3IWOA 2ZC7A 5JYPA 3D72A 1L3LA 4JLFA 4O01A 3N8SA 3ZVWA 2QKPA 4OQIA 4OQGA 4GHIB 3JVUA 4ZTKA 2ZL1A 2WKPA 1P9RA 1LL9A 4S2KA 2G2UA 1OTEA 1PWCA 4LENA 3T4OA 4GD6A 3SH9A 2OWHA 3DWZA 3KSIA 3UDXA 4FCFA 5DKLA 3MQOA 1MY8A 2AVXA 3IT9A 1ERMA 1TS0A 2Y91A 3H9WA 2Z2MB 4K0WA 4LRZE 5TBMB 1VB6A 4B4XA 4BD1A 3BJNA 3GECA 4OP5A 3IXHA 5DVAA 1LI9A 2EWVA 1Z09A 5F5YA 3O5YA 1T1BA 3GDIA 2VX8A 2W1TA 4KZBA 4BQMA 5F6AA 4B9OA 2IA2A 1YM1A 1HD8A 4FH4A 2QWSA 1Y4OA 2W1RA 4WEJA 1HVBA 3D9YA 1OT9A 3RJUA 4R4SA 4N1HA 5KIZA 2QYBA 5GL9A 3CAXA 2J3WA 1FOFA 1EWZA 2K7SA 2XH9A 2J80A 5HFOA 2L0WA 3ZG8B 3MZEA 1JVJA 2ZC4B 4I39A 1IKGA 5FAPA 3SS4A 4ZRRA 4KG6A 3D4FA 2JKGA 5FI2A 1ZG6A 4F94A 1OTAA 5G18A 1L0GA 1OTIA 3P7NA 1K54A 1K6RA 3H7WB 4JXGA 5IT5A 5TFQA 4ZBEA 3IH9A 1VEUA 4HH2A 3WRTA 1NJ4A 4S2IA 4EQIA 4HHDA 5J4EA 2WGIA 1MWRA 3NIAA 5EPHA 3UPNA 2V2FF 3GTCA 4N9KA 4RA7A 1TVFA 3PTEA 2JHEA 5HD3A 2ZQCA 4KQOA 5EECA 2A24B 2H0TA 1NZUA 1SDNA 3VE3A 4OQ0A 2Y2KA 4OKPA 4Y0UA 3UB9A 4YOFA 5MC7A 2PBYA 2OAQ1 2WYXA 1NXYA 2EXAA 3LGOA 1GA9A 1PWDA 2PAVP 1K56A 3AGFA 4NXFA 5IHVA 2Q0OA 1LHYA 2HPBA 2OLVA 4D60A 2GJ3A 1H8YA 1ONHA 1OTBA 2J9OA 5FDSA 1PZPA 5TJJA 1YMXA 5GHXA 3PAGA 1K56D 4KG5A 3FZCA 4DF6A 2EA9A 5EUAA 1W7FA 3A0VA 1J9MA 5FI7A 1ES3A 4GNUA 5M1AA 1LL8A 1K38A 4X25A 4S2MA 4OOYA 3PBNA 3C8CA 5FI6A 5CTNA 4UAAA 1NWZA 4Q0IA 3UB6A 2JCHA 4K08A 3HJIA 3T1SA 1GHPA 2EXBA 3FKWA 4NEED 4H6JB 2V0UA 1YLWA 4I38A 2Z6CA 5CHMA 2A3UA 3EGXC 3QNBA 3N4IA 1BLPA 4LCMA 5EVIA 1G5UA 4ID4A 4PPRA 3VFFA 3ZG9B 1N4OA 4LRXC 3S22A 4EW7A 4HP4A 3EGDC 1RP5A 3IX3A 3ZYTA 3F1PA 4PM9A 3UB5P 4IBRA 4C3QA 5HDDA 4WUJA 5FAOA 3CWFA 3M6BA 1CK3A 4OQHA 3JPUA 4Q0JA 4NKPA 5EVID 2V1BA 4CLCC 2HDSA 2H0YA 4X53A 5JYOA 3VP2A 1OTDA 4NETA 4EBPA 4DE2A 1UWNX 4KZ4A 2LB5A 3O3VA 4S2PA 5EOOA 2CC1A 2O99A 1J3WA 1K4FA 3HUNA 1ONGA 1K57C 1P9WA 4EWFA 2Y2QA 3CHWP 3DTKA 3NDGA 2PR5A 2D01A 3CPTA 1TS8A 2XA7S 3MBZA 5DFXA 3MFDA 1ES5A 1YMSA 4JXSA 2Y2JA 3SH8A 3Q07A 3BEBA 4OVDA 4JF5A 3MKEA 1MKMA 1GSWA 1SHVA 4E3IA 2JKRI 2NUTC 5G4ZA 4KG2A 1AWIA 2J7VA 3VMAA 3SH7A 4X6TA 5FQMA 4C75A 3E2KA 1D1JA 3IBRA 1IYQA 2EFUA 2XEPA 5CHJA 4DJ2A 2V1ZA 4CLCA 3ZGAB 2XF3A 3VP4A 5TGFA 3KO6A 2XFTA 4FTXA 4IBXA 1S4SA 3GV9A 5CTMA 3T4TA 3ZNYA 4KZ8A 3ZFZA 3VSLA 4Y2FA 3MKFA 4MBKA 1VETA 1UGUA 4L0LA 3IF6C 3GRJA 2FFFB 1K57A 4HJ6A 1JWPA 4CLCD 3HBRA 4OLGA 3PBOA 2INWA 3MQQA 3UE1A 3RFBA 1YT4A 2VZWA 3C2WA 5HAQA 4RQ9A 2RL3A 4EERA 5DTSA 3UO9A 4GDBA 2X02A 2Y8HA 4JBFA 1XP4A 2Y79A 1K25A 3S1YA 4G3KA 4DJ3A 3PBQA 1G68A 2B02A 1VETB 3NOTC 4CQHA 4XT2B 4R4RA 4FSFA 3U2AA 3ZNTA 1W8QA 2HDRA 1FQGA 2W3EA 1W79A 4QY6A 3PXPA 4P85A 4MCWA 1T1CA 1ZC2A 1LL5A 2WGWA 2YKHA 3OPLA 5I5LA 3MXRA 1KE0A 2Y2LA 2W3FA 3C4PA 4FD8A 4Q0HA 1MC0A 4LFUA 4EQ1A 3G31A 4Q8IA 4N1XA 1DP9A 3VP3A 1FCMA 3V3SA 5E2EA 1I2WA 4S2OA 1KDSA 4XUZA 4E3NA 4O8GA 3NJAA 2X01A 2PU4A 4GS9B 1ESIA 1OJGA 3A3FA 4JGQA 3Q81A 1A0KA 3CITA 4IHQA 1GA0A 2A2LA 4JF6A 3VOZA 3MZDA 2PRFA 1MWUA 3CMZA 2W27A 5L8MA 3HJKA 4ESPA 5FL3A 1T18A 1GHMA 3ICYA 3A3JA 2RCXA 3OBFA 4II7A 1F5MA 3TE8A 5TR7A 1RGZA 3DW0A 3R7WA 4P0MA 3VSKA 1DRMA 5DF7A 2WUQA 1K6SA 4RX2A 3NHQA 3VOLA 5DTKA 3N8LA 3O86A 3UNWA 1Y54A 3T4JA 1L2SA 4R1GA 4NXGA 1Y28A 4KQRA 3FC7A 3JVVA 2R9WA 2I9VA 3QP4A 3FV7A 4XUXA 4DDYA 2VV7A 1SKFA 4BBTA 3VP1A 4OP8A 1XA7A 3E4QA 1ESUA 4WYYA 3LEQA 4D2OA 4NK3A 3LFVA 3S7PA 1TDLA 3BFDA 5DKKA 3O87A 1IYOA 5KZHA 4QY5A 1FR6A 4LLOB 5HX9A 3NC8A 3R7WB 3QP5A 1V9ZA 2ZMFA 2Q9NA 3LYXA 1BLCA 3VFHA 3EOIA 2FZ0A 1YLZA 1XJ2A 3S4XA 1V9YA 3B33A 4OPYA 4ZJ3A 4F3LA 2XLNA 2A49A 3OPRA 3LR4A 3WS2A 4HNBA 4L9EA 3ULFA 2BASA 2XR0A 3NULA 1SKOA 2PYRA 3A0RA 3IXDA 4MNRA 4EU0A 2X71A 4DXCA 5FATA 4H8RA 3TOIA 1P0ZA 5E2FA 4I3JA 1ZG4A 4LPZA 4WZ4A 2V1AA 4Z9QA 3MXSA 2BLSA 1DJBA 2BG1A 5HARA 5EE8A 4QJGA 3VP0A 1XGIA 3LIDA 1EW0A 3WS4A 1JNUA 2FH5A 1ZKJA 5HW3A 5AQ7A 3GMWA 3MMHA 4OPZA 5J3WA 3ITAA 4MLLA 1D06A 1VM1A 3A3DA 2XDMA 1NY0A 4ZJ1A 3M2KA 5G4YA 2OWJA 3G35A 2ZL1B 2FFYA 2ZM0A 4E3KA 5HL1A 1DJCA 4QHCA 3NECA 3QP8A 5HWTA 3F1NA 3IH8A 5HD5A 4PHTA 3W4PA 3S7QA 1TEMA 1L0EA 2QZ6A 1KDWA 5HAIA 3C38A 5AJGA 3CUEC 1XPBA 4WN5A 2ZQAA 3QP1A 3LIBA 4UA7A 4Y15A 3KX0X 3WS1A 2ZM2A 3A3EA 3P09A 4ZJ2A 4S2NC 3T4LA 2V9AA 2W1TB 1LSWA 3HLWA 4BENA 2IWCA 2PDRA 4UA6A 2PYPA 3G4PA 4OOMA 2DRWA 3HUOA 1GSXA 4DN0A 1JWVA 4BWIA 4BBUA 4R70A 2XQZA 4R6LA 3DWKA 2O0YA 2XRNA 3KYZA 2PR6A 3BRMA 4PAUA 4MN5A 4GOGA 1KGFA 2I72A 5F1FA 1H8MA 2QHKA 2ZQDA 3RXXA 1PI4A 1LSXA 3UE3A 2HP6A 2J8YA 5A92A 2GZAA 1K55C 3Q82A 1ODVA 3C30A 4B88A 5GHZA 2HJ9C 2JBFA 1FSWA 4JGRA 3KSGA 3MZFA 5A91A 4X56A 1IELA 4S2NA 3ISGA 1VEUB 3IQAA 4MN6A 5HSQA 4FOFA 4UQIM 1BUEA 1MBLA 2UV0E 3CG5A 2WKHA 3ZHHA 2HDQA 3HLBA 3CJMA 1C3BA 2ZBBA 2OAP1 1FCNA 3OCLA 1IYSA 4R3BA 2Y55A 3EQVA 2EWWA 3W8KA 1YLJA 1PFLA 3HVFA 1TS6A 1M6KA 3LUQA 3UPOA 1DP6A 2K2NA 1HLUP 5LBRA 1IKIA 3BFEA 4E6WA 2JKTM 3D3OA 5EV0A 1TF1A 4GLQA 2QJ7A 1HTZA 3S7NA 1K55A 2W0NA 1NYMA 5DJUA 1FR1A 3IWQA 2PD8A 3ITBA 3OC2A 5GLDA 1PW8A 1MZUA 2R9XA 1H5XA 3IX8A 5DF9A 3LO7A 4GDNA 4IUHA 5E2GA 1FILA 5FA7A 3T12B 4GJ4A 2Y2OA 4QU3A 3G2ZA 4PM5A 3MSHA 3WRZA 3I7JA 4WEKA 3PBTA 3TJZC 2VGLM 2O9AA 4DXBA 3SS3A 1F9IA 1XXMA 3MXQA 5AQAA 2P04A 3V39A 2WAFA 2P9VA 4X1MA 5EVIB 4EETB 1S1YA 4MBFA 4I5SA 3IBJA 3PBRA 5DTTA 3F1PB 1T1AA 3G2YA 3WWXA 1DJAA 4EEUA 1MXOA 3HREA 2VV6A 1I5QA 3HLGA 2OOLA 3BY8A 3R4KA 3PHYA 2HDUA 2B95A 3RTYA 3FG8A 4MN7A 1AXBA 4GN2A 1CF0A 2WKRA 2P9VB 3UDIA 2W3DA 3UMEA 2CMNA 3PYPA 3VE4A 1EROA 4QD4A 4HEFA 2VJWA 2XSSA 3FPVA 4Y17A 1TDGA 3LR3A 4X55A 3CPTB 1OJ5A 2O9BA 4E3MA 3CLOA 4B93A 4K0XA 3QNCA 3LY3A 4KUKA 4HIAA 2P08A 5BOHA 5EVEA 1N9OA 3NBLA 4R23A 1G28A 4KZ9A 1PIOA 4WM9A 4EUVA 1PYYA 1MWSA 3C7UA 5C5KA 3HLFA 2PHYA 1IOUA 3BWLA 2MJ6A 3G6OA 3T50A 2WZZA 4WF0A 4JF4A 1KVLA 4IJGA 4YINA 4N92A 1BLHA 1H8ZA 3WS0A 4CLCB 3IHBA 5FQKA 5DFYA 3UMDA 1F98A 4A5RA 2M7UA 2Y2IA 3QHYA 3ZQ5A 4LRYC 1VHMA 4ZDXA 5FSRA 3EEHA 2UWXA 1W63M 4JXWA 4KZ7A 4MEZA 1WE4A 2WAEA 1LSVA 1N9BA 2XD1A 5CXWA 4LGWA 4QWOA 1IFQA 4GB7A 1BULA 3N8RA 2H10A 3BY9A 1G6OA 2V20A 3IF6A 5M19A 3HUMA 1N9NA 4MDZA 3BQ8A 2Y2NA 2Z6DA 5EOEA 3VOYA 3HLCA 1K0KA 1BT5A 4KENB 3P01A 1ZTUA 2K31A 5A8BA 4L9GA 1LI0A 3BFCA 4E3JA 3V3RA 2ZMVA 3OOVA 4PM8A 4ZAMA 4RYEA 2WGWB 3JYIA 3IF6B 2E8JA 1TD5A 3DTEA 4LV3A 3UY6A 2YKFA 2C5WB 5U47A 4PM7A 5K5BA 1FSYA 5GLCA 2KOIA 2O9CA 4ARZA 4UQIS 2EX6A 3K3CA 4JGPA 1MWTA 4G3WA 1NRFA 3IS2A 2ZOIA 3BLMA 1XFQA 1PRQA 4DE1A 4MBHA 5HPIA 3E98A 5CECA 4EBNA 4BL2A 1YAXA 1IEMA 1MKIA 3L7HA 2KX6A 3T1QB 1CI8A 2Y2GA 2D02A 4GCZA 4PM6A 4Y3IA 5HDSA 1S66L 3BW6A 3UN7A 3NDEA 1X0OA 4FUWA 3LICA 2XK1A 3RXWA 5DF8A 4BJPA 4ARZB 5A93A 3E0YA 3K2NA 2ZJ9A 3MR0A 4DKIA 4PKYG 1KGGA 5CHUA 3T4QA 2EX8A 4M4XA 5HAPA 4PMAA 4GHIA 1L0DA 5J7EA 3LR0A 3BFFA 3AGDA 2WADA 3FPWA 3N7WA 1UWPX 5F69A 4JPMA 2PU2A 1S1ZA 3E4PA 4LV0A 1DY6A 3FWLA 4DMZA 4HBTA 4U0TA 3ZVTA 2JE5A 5DJTA 4EBLA 4WL9A 1O07A 3UPPA 2XA7M 2Y2MA 5AQBA 1ZHHB 5AVFA 3LR5A 3V67A 4OH0A 3LIFA 1YSQA 5F68A 5HDCA 3W4QA 2VLGA 1M40A 3FKVA 4EXOA 1KE3A 5CGSA 3UE6A 3C4OA 2ACGA 2DNSA 4F3LB 4BL3A 5J8XA 4JKTA 1SDEA 4R3AA 4KZ6A 1SKOB 1L0FA 2VA0A 1ALQA 1HZOA 4KZ5A 1LT0A 4YNRA 4G3VA 4Y0OA 1GCEA 3E4OA 3MFXA 5FQ9A 2ZMAA 3IX4A 4I3AA 1JTDA 4XXRA 2DCFA 3WS5A 1ES2A 1K54C 1Q2PA 4BD0A 2ZQ7A 2PT7A 3M6HA 3N6IA 1XJ6A 5L10A 5CERA 2Y2PA 4GW9A 3FYZA 2EFXA 4DRTA 2HV1A 2EX9A 4MMNA 2HGVA 5CX7A 2H28A 4X69A 2XD5A 4LV2A 1NYYA 2GNXA 4KZ3A 1XGJA 2ZC3B 1KGEA 3H7WA 2VGKA 3SZTA 2KLIA 4P6ZM 2Y59A 4KQDA 5KSHA 4LV1A 1NLZA 2WGVA 2Y2HA 3F1NB 3EEAA 3AGEA 3B47A 3G34A 2WZXA 4BMWA 1BSGA 4UEYA 2A24A 1NLYA 1XJ4A 2B18A 3S7OA 2IWDA 5L2FA 3G30A 1XFNA 3Q1FA 2WKIA 3MF0A 3O88A 1FCOA 1CJFA 1E4DA 3LEZA 3ZCZA 4LCLA 4UHUA 2JC7A 4U0XA 3P98A 3CUEA 5GHYA 4S2JA 3GR2A 2ZOHA 1S0WA 2M1CA 3A3IA 5GLAA 1WYCA 2H5SA 1PI5A 3HLDA 2JKTI 3H82A 5FASA 4X1LA 5FQQA 4NG2A 3KYEA 5HL6A 3VV4A 1PW1A 1OT6A 3LI9A 5CRFA 1H0MA 2W3HA 4WMCA 2VEAA 1I2SA 2WKQA 3EWKA 3V50A 5EVLA 3A0SA 4WLAA 5EVIC 4HBUA 3BECA 2OLUA 4CLCE 3LY4A 2EX2A 2J3TC 1NRJA 1YQSA 5CEBA 1RGYA 2ZQ9A 1G6AA 4H6JA 4WMCD 4OPQA 1SZVA 4R38A 3Q7ZA 1ES4A 4P6BA 3H82B 4P87A 3IF5A 5HWWA 3LIEA 3B3XA 5AVEA 2QMIA 3T1XA 2M7VA 3BYDA 3KSFA 3LIAA 3T4KA 4UA9A 4OOLA 3ZG0A 2JN7A 3E2LA 3T1RA 2WK0A 5A90A 3MQ0A 1QMFA 2VGJA 5FDHA 2HZ5A 3LCEA 3PR6A 5CGXA 2P7JA 3NOPC 2R78A 1BLSA 3KSHA 3IXBA 5L07A 1T19A 2VK3A 1STZA 4Y0TA 4OONA 3TSGA 4ME4A 4BLMA 1YLTA 3NCKA 3GSGA 5E43A 2XFSA 4O0PA 2V0WA 3IHAA 1SCWA 1CQAA 3K3DA 4I3IA 1YSPA 1OMEA 1XJ3A 3SOIA 4HJ4A 5IS1A 3G32A 4PKYA 4DDSA 4E3OA 3TW8A 2J3TD 4KZAA 4Z1WA 5KSCA 2G2WA 3OPPA 2BTFP 3EQUA 5CGWA 1YPRA 4BBVA 2XGNA 2XROA 2HP5A 1CEGA 4ETZA 1DP8A 1Q2QA 4NXBA 2NUPC 1ERQA 1JTGA 4E04A 4HH3A 3C5AA 2HJEA 1CI9A 1P97A 2HP9A 2QJ5A 3MS6A 3TRCA 3U4LP 5EM1A 4U3TA 5FEGA 1NZOA 2ZD8A 2B5RA 3KYQA 3DAVA 2VV8A 3W4OA 1D7EA 3UB7A 4OPRA 2ZM8A 3ZG5A 4FH2A 4JGOA 3B42A 1W5DA 3IXGA 3PBSA 4QB8A 2J9PA 3F1OA 4Y5FA 4L9FA 5F83A 2GX5A 2IWBA 1GHIA 3BM6A 2VKSA 5D3OA 1JWZA 4R3JA 4GKUA 1S4RA 4R0QA 4RX3A 3QP6A 4XT2A 3GVBA 2WKEA 3OCNA 1W63Q 3DTIA 4KQQA 4IVIA 4IUKA 3CZDA 4B4ZA 4CPKA 2JKRM 2OV5A 2HF6A 3Q7VA 1KOUA 2Z2LB 2OSUA 4GZBA 2V8FA 3SS5A 5F1GA 4HI4A 1KE4A 4K91A 3ZG7B 4E3LA 3HCYA 5F82A 4P6ZS 1E3UA 4EUZA 3OLOA 4DE3A 2L1MA 1VQQA 3F1OB 3BQAA 3UDFA 2ZC6B 2W3GA 1O7EA 3DTMA 4YWZA
chains in the Genus database with same CATH topology
3LGOA 2JKFA 5EVEA 2PAVP 1FILA 3T12B 1Y4OA 3T1XA 2PBDP 1J3WA 2E8JA 5FEFA 1VETB 3MS6A 3MSHA 3U4LP 3T1RA 5EM1A 3CHWP 3D9YA 5FEGA 4D60A 2HZ5A 5FDSA 2ZL1B 3CPTA 3L9KA 2V8CA 3DAVA 2ACGA 1CJFA 3NECA 1PNEA 1VEUB 2VK3A 1PRQA 3LEQA 5EM0A 4X1MA 1SKOB 4X25A 2JKGA 1AWIA 3L7HA 3T1SA 1CQAA 3T1QB 2ZL1A 4X1LA 1D1JA 3KYEA 1FIKA 4QWOA 1PFLA 4FUWA 1VEUA 4FTXA 2B95A 1G5UA 1HLUP 1ACFA 1VETA 2V8FA 3NULA 1SKOA 5EV0A 1A0KA 1CF0A 1K0KA 3UB5P 2PRFA 2BTFP 1YPRA 1Z09A 3CPTB 1SZVA 4ESPA 1F2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGO A;  2JKF A;  5EVE A;  2PAV P;  1FIL A;  3T12 B;  1Y4O A;  3T1X A;  2PBD P;  1J3W A;  2E8J A;  5FEF A;  1VET B;  3MS6 A;  3MSH A;  3U4L P;  3T1R A;  5EM1 A;  3CHW P;  3D9Y A;  5FEG A;  4D60 A;  2HZ5 A;  5FDS A;  2ZL1 B;  3CPT A;  3L9K A;  2V8C A;  3DAV A;  2ACG A;  1CJF A;  3NEC A;  1PNE A;  1VEU B;  2VK3 A;  1PRQ A;  3LEQ A;  5EM0 A;  4X1M A;  1SKO B;  4X25 A;  2JKG A;  1AWI A;  3L7H A;  3T1S A;  1CQA A;  3T1Q B;  2ZL1 A;  4X1L A;  1D1J A;  3KYE A;  1FIK A;  4QWO A;  1PFL A;  4FUW A;  1VEU A;  4FTX A;  2B95 A;  1G5U A;  1HLU P;  1ACF A;  1VET A;  2V8F A;  3NUL A;  1SKO A;  5EV0 A;  1A0K A;  1CF0 A;  1K0K A;  3UB5 P;  2PRF A;  2BTF P;  1YPR A;  1Z09 A;  3CPT B;  1SZV A;  4ESP A;  1F2K A; 
#chains in the Genus database with same CATH topology
 4HY8 A;  4WEL A;  4AFI A;  4GS9 A;  1H3Q A;  1TS7 A;  4WZ5 C;  3GQZ A;  1YKD A;  1IYP A;  1E3U D;  1WA9 A;  2DMW A;  3HL9 A;  5CED A;  3TG9 A;  4WBG A;  4HJ3 A;  3Q7V B;  2PBD P;  4IED A;  5FQJ A;  4E6X A;  5GLB A;  1U60 A;  4QPR A;  4YFM A;  1GSV A;  3M2J A;  4C6Y A;  2KDK A;  1BZA A;  4ETX A;  3NY4 A;  3C7V A;  1E25 A;  3L9K A;  2V8C A;  4KUO A;  3W2Z A;  3NOU C;  4N9L A;  1YLP A;  4OLD A;  2ZC5 B;  3CI6 A;  4Y13 A;  3SW1 A;  4JXV A;  1EI5 A;  4GD8 A;  4IVK A;  1S67 L;  4HOI A;  4CJN A;  1BYW A;  2GDN A;  1QME A;  5E2H A;  2Y4A A;  3T4S A;  1FIK A;  4DE0 A;  2ZLY A;  3UE0 A;  4EEP A;  3UB8 A;  4RVA A;  4WZ5 A;  5I94 A;  1MPL A;  3PAE A;  2G7U A;  1ACF A;  1K4E A;  5AQ9 A;  3BLS A;  3OZH A;  1XX2 A;  1W8Y A;  5HZH A;  3IWI A;  4EV4 A;  3HLE A;  2P74 A;  1CEF A;  3QP2 A;  3DBA A;  5EFW A;  4Y7P A;  2L4R A;  5KMW A;  1BTL A;  3NI9 A;  2Q9M A;  1N9L A;  2C6W B;  1YLY A;  1LLB A;  4HQA A;  1F2K A;  4X68 A;  3IS2 B;  2ZQ8 A;  3V5M A;  5M18 A;  2JKF A;  2LB9 A;  5L09 A;  1OPX A;  4O7D A;  2QPN A;  5HWV A;  2E8I A;  5HPF A;  3BFG A;  5FEF A;  3RH8 B;  1PWG A;  2PD7 A;  1RCJ A;  3ZDJ A;  4HP9 A;  1PZO A;  4S2L A;  5IU1 A;  1XKZ A;  4HES A;  1XA1 A;  1PNE A;  4M3K A;  1Z6F A;  3LI8 A;  3OPH A;  4NXE A;  3MJQ A;  2VGL S;  5FQI A;  5EM0 A;  4EES A;  5FAQ A;  1WYB A;  5TBM A;  1S6R A;  1KVM A;  3IWO A;  2ZC7 A;  5JYP A;  3D72 A;  1L3L A;  4JLF A;  4O01 A;  3N8S A;  3ZVW A;  2QKP A;  4OQI A;  4OQG A;  4GHI B;  3JVU A;  4ZTK A;  2ZL1 A;  2WKP A;  1P9R A;  1LL9 A;  4S2K A;  2G2U A;  1OTE A;  1PWC A;  4LEN A;  3T4O A;  4GD6 A;  3SH9 A;  2OWH A;  3DWZ A;  3KSI A;  3UDX A;  4FCF A;  5DKL A;  3MQO A;  1MY8 A;  2AVX A;  3IT9 A;  1ERM A;  1TS0 A;  2Y91 A;  3H9W A;  2Z2M B;  4K0W A;  4LRZ E;  5TBM B;  1VB6 A;  4B4X A;  4BD1 A;  3BJN A;  3GEC A;  4OP5 A;  3IXH A;  5DVA A;  1LI9 A;  2EWV A;  1Z09 A;  5F5Y A;  3O5Y A;  1T1B A;  3GDI A;  2VX8 A;  2W1T A;  4KZB A;  4BQM A;  5F6A A;  4B9O A;  2IA2 A;  1YM1 A;  1HD8 A;  4FH4 A;  2QWS A;  1Y4O A;  2W1R A;  4WEJ A;  1HVB A;  3D9Y A;  1OT9 A;  3RJU A;  4R4S A;  4N1H A;  5KIZ A;  2QYB A;  5GL9 A;  3CAX A;  2J3W A;  1FOF A;  1EWZ A;  2K7S A;  2XH9 A;  2J80 A;  5HFO A;  2L0W A;  3ZG8 B;  3MZE A;  1JVJ A;  2ZC4 B;  4I39 A;  1IKG A;  5FAP A;  3SS4 A;  4ZRR A;  4KG6 A;  3D4F A;  2JKG A;  5FI2 A;  1ZG6 A;  4F94 A;  1OTA A;  5G18 A;  1L0G A;  1OTI A;  3P7N A;  1K54 A;  1K6R A;  3H7W B;  4JXG A;  5IT5 A;  5TFQ A;  4ZBE A;  3IH9 A;  1VEU A;  4HH2 A;  3WRT A;  1NJ4 A;  4S2I A;  4EQI A;  4HHD A;  5J4E A;  2WGI A;  1MWR A;  3NIA A;  5EPH A;  3UPN A;  2V2F F;  3GTC A;  4N9K A;  4RA7 A;  1TVF A;  3PTE A;  2JHE A;  5HD3 A;  2ZQC A;  4KQO A;  5EEC A;  2A24 B;  2H0T A;  1NZU A;  1SDN A;  3VE3 A;  4OQ0 A;  2Y2K A;  4OKP A;  4Y0U A;  3UB9 A;  4YOF A;  5MC7 A;  2PBY A;  2OAQ 1;  2WYX A;  1NXY A;  2EXA A;  3LGO A;  1GA9 A;  1PWD A;  2PAV P;  1K56 A;  3AGF A;  4NXF A;  5IHV A;  2Q0O A;  1LHY A;  2HPB A;  2OLV A;  4D60 A;  2GJ3 A;  1H8Y A;  1ONH A;  1OTB A;  2J9O A;  5FDS A;  1PZP A;  5TJJ A;  1YMX A;  5GHX A;  3PAG A;  1K56 D;  4KG5 A;  3FZC A;  4DF6 A;  2EA9 A;  5EUA A;  1W7F A;  3A0V A;  1J9M A;  5FI7 A;  1ES3 A;  4GNU A;  5M1A A;  1LL8 A;  1K38 A;  4X25 A;  4S2M A;  4OOY A;  3PBN A;  3C8C A;  5FI6 A;  5CTN A;  4UAA A;  1NWZ A;  4Q0I A;  3UB6 A;  2JCH A;  4K08 A;  3HJI A;  3T1S A;  1GHP A;  2EXB A;  3FKW A;  4NEE D;  4H6J B;  2V0U A;  1YLW A;  4I38 A;  2Z6C A;  5CHM A;  2A3U A;  3EGX C;  3QNB A;  3N4I A;  1BLP A;  4LCM A;  5EVI A;  1G5U A;  4ID4 A;  4PPR A;  3VFF A;  3ZG9 B;  1N4O A;  4LRX C;  3S22 A;  4EW7 A;  4HP4 A;  3EGD C;  1RP5 A;  3IX3 A;  3ZYT A;  3F1P A;  4PM9 A;  3UB5 P;  4IBR A;  4C3Q A;  5HDD A;  4WUJ A;  5FAO A;  3CWF A;  3M6B A;  1CK3 A;  4OQH A;  3JPU A;  4Q0J A;  4NKP A;  5EVI D;  2V1B A;  4CLC C;  2HDS A;  2H0Y A;  4X53 A;  5JYO A;  3VP2 A;  1OTD A;  4NET A;  4EBP A;  4DE2 A;  1UWN X;  4KZ4 A;  2LB5 A;  3O3V A;  4S2P A;  5EOO A;  2CC1 A;  2O99 A;  1J3W A;  1K4F A;  3HUN A;  1ONG A;  1K57 C;  1P9W A;  4EWF A;  2Y2Q A;  3CHW P;  3DTK A;  3NDG A;  2PR5 A;  2D01 A;  3CPT A;  1TS8 A;  2XA7 S;  3MBZ A;  5DFX A;  3MFD A;  1ES5 A;  1YMS A;  4JXS A;  2Y2J A;  3SH8 A;  3Q07 A;  3BEB A;  4OVD A;  4JF5 A;  3MKE A;  1MKM A;  1GSW A;  1SHV A;  4E3I A;  2JKR I;  2NUT C;  5G4Z A;  4KG2 A;  1AWI A;  2J7V A;  3VMA A;  3SH7 A;  4X6T A;  5FQM A;  4C75 A;  3E2K A;  1D1J A;  3IBR A;  1IYQ A;  2EFU A;  2XEP A;  5CHJ A;  4DJ2 A;  2V1Z A;  4CLC A;  3ZGA B;  2XF3 A;  3VP4 A;  5TGF A;  3KO6 A;  2XFT A;  4FTX A;  4IBX A;  1S4S A;  3GV9 A;  5CTM A;  3T4T A;  3ZNY A;  4KZ8 A;  3ZFZ A;  3VSL A;  4Y2F A;  3MKF A;  4MBK A;  1VET A;  1UGU A;  4L0L A;  3IF6 C;  3GRJ A;  2FFF B;  1K57 A;  4HJ6 A;  1JWP A;  4CLC D;  3HBR A;  4OLG A;  3PBO A;  2INW A;  3MQQ A;  3UE1 A;  3RFB A;  1YT4 A;  2VZW A;  3C2W A;  5HAQ A;  4RQ9 A;  2RL3 A;  4EER A;  5DTS A;  3UO9 A;  4GDB A;  2X02 A;  2Y8H A;  4JBF A;  1XP4 A;  2Y79 A;  1K25 A;  3S1Y A;  4G3K A;  4DJ3 A;  3PBQ A;  1G68 A;  2B02 A;  1VET B;  3NOT C;  4CQH A;  4XT2 B;  4R4R A;  4FSF A;  3U2A A;  3ZNT A;  1W8Q A;  2HDR A;  1FQG A;  2W3E A;  1W79 A;  4QY6 A;  3PXP A;  4P85 A;  4MCW A;  1T1C A;  1ZC2 A;  1LL5 A;  2WGW A;  2YKH A;  3OPL A;  5I5L A;  3MXR A;  1KE0 A;  2Y2L A;  2W3F A;  3C4P A;  4FD8 A;  4Q0H A;  1MC0 A;  4LFU A;  4EQ1 A;  3G31 A;  4Q8I A;  4N1X A;  1DP9 A;  3VP3 A;  1FCM A;  3V3S A;  5E2E A;  1I2W A;  4S2O A;  1KDS A;  4XUZ A;  4E3N A;  4O8G A;  3NJA A;  2X01 A;  2PU4 A;  4GS9 B;  1ESI A;  1OJG A;  3A3F A;  4JGQ A;  3Q81 A;  1A0K A;  3CIT A;  4IHQ A;  1GA0 A;  2A2L A;  4JF6 A;  3VOZ A;  3MZD A;  2PRF A;  1MWU A;  3CMZ A;  2W27 A;  5L8M A;  3HJK A;  4ESP A;  5FL3 A;  1T18 A;  1GHM A;  3ICY A;  3A3J A;  2RCX A;  3OBF A;  4II7 A;  1F5M A;  3TE8 A;  5TR7 A;  1RGZ A;  3DW0 A;  3R7W A;  4P0M A;  3VSK A;  1DRM A;  5DF7 A;  2WUQ A;  1K6S A;  4RX2 A;  3NHQ A;  3VOL A;  5DTK A;  3N8L A;  3O86 A;  3UNW A;  1Y54 A;  3T4J A;  1L2S A;  4R1G A;  4NXG A;  1Y28 A;  4KQR A;  3FC7 A;  3JVV A;  2R9W A;  2I9V A;  3QP4 A;  3FV7 A;  4XUX A;  4DDY A;  2VV7 A;  1SKF A;  4BBT A;  3VP1 A;  4OP8 A;  1XA7 A;  3E4Q A;  1ESU A;  4WYY A;  3LEQ A;  4D2O A;  4NK3 A;  3LFV A;  3S7P A;  1TDL A;  3BFD A;  5DKK A;  3O87 A;  1IYO A;  5KZH A;  4QY5 A;  1FR6 A;  4LLO B;  5HX9 A;  3NC8 A;  3R7W B;  3QP5 A;  1V9Z A;  2ZMF A;  2Q9N A;  3LYX A;  1BLC A;  3VFH A;  3EOI A;  2FZ0 A;  1YLZ A;  1XJ2 A;  3S4X A;  1V9Y A;  3B33 A;  4OPY A;  4ZJ3 A;  4F3L A;  2XLN A;  2A49 A;  3OPR A;  3LR4 A;  3WS2 A;  4HNB A;  4L9E A;  3ULF A;  2BAS A;  2XR0 A;  3NUL A;  1SKO A;  2PYR A;  3A0R A;  3IXD A;  4MNR A;  4EU0 A;  2X71 A;  4DXC A;  5FAT A;  4H8R A;  3TOI A;  1P0Z A;  5E2F A;  4I3J A;  1ZG4 A;  4LPZ A;  4WZ4 A;  2V1A A;  4Z9Q A;  3MXS A;  2BLS A;  1DJB A;  2BG1 A;  5HAR A;  5EE8 A;  4QJG A;  3VP0 A;  1XGI A;  3LID A;  1EW0 A;  3WS4 A;  1JNU A;  2FH5 A;  1ZKJ A;  5HW3 A;  5AQ7 A;  3GMW A;  3MMH A;  4OPZ A;  5J3W A;  3ITA A;  4MLL A;  1D06 A;  1VM1 A;  3A3D A;  2XDM A;  1NY0 A;  4ZJ1 A;  3M2K A;  5G4Y A;  2OWJ A;  3G35 A;  2ZL1 B;  2FFY A;  2ZM0 A;  4E3K A;  5HL1 A;  1DJC A;  4QHC A;  3NEC A;  3QP8 A;  5HWT A;  3F1N A;  3IH8 A;  5HD5 A;  4PHT A;  3W4P A;  3S7Q A;  1TEM A;  1L0E A;  2QZ6 A;  1KDW A;  5HAI A;  3C38 A;  5AJG A;  3CUE C;  1XPB A;  4WN5 A;  2ZQA A;  3QP1 A;  3LIB A;  4UA7 A;  4Y15 A;  3KX0 X;  3WS1 A;  2ZM2 A;  3A3E A;  3P09 A;  4ZJ2 A;  4S2N C;  3T4L A;  2V9A A;  2W1T B;  1LSW A;  3HLW A;  4BEN A;  2IWC A;  2PDR A;  4UA6 A;  2PYP A;  3G4P A;  4OOM A;  2DRW A;  3HUO A;  1GSX A;  4DN0 A;  1JWV A;  4BWI A;  4BBU A;  4R70 A;  2XQZ A;  4R6L A;  3DWK A;  2O0Y A;  2XRN A;  3KYZ A;  2PR6 A;  3BRM A;  4PAU A;  4MN5 A;  4GOG A;  1KGF A;  2I72 A;  5F1F A;  1H8M A;  2QHK A;  2ZQD A;  3RXX A;  1PI4 A;  1LSX A;  3UE3 A;  2HP6 A;  2J8Y A;  5A92 A;  2GZA A;  1K55 C;  3Q82 A;  1ODV A;  3C30 A;  4B88 A;  5GHZ A;  2HJ9 C;  2JBF A;  1FSW A;  4JGR A;  3KSG A;  3MZF A;  5A91 A;  4X56 A;  1IEL A;  4S2N A;  3ISG A;  1VEU B;  3IQA A;  4MN6 A;  5HSQ A;  4FOF A;  4UQI M;  1BUE A;  1MBL A;  2UV0 E;  3CG5 A;  2WKH A;  3ZHH A;  2HDQ A;  3HLB A;  3CJM A;  1C3B A;  2ZBB A;  2OAP 1;  1FCN A;  3OCL A;  1IYS A;  4R3B A;  2Y55 A;  3EQV A;  2EWW A;  3W8K A;  1YLJ A;  1PFL A;  3HVF A;  1TS6 A;  1M6K A;  3LUQ A;  3UPO A;  1DP6 A;  2K2N A;  1HLU P;  5LBR A;  1IKI A;  3BFE A;  4E6W A;  2JKT M;  3D3O A;  5EV0 A;  1TF1 A;  4GLQ A;  2QJ7 A;  1HTZ A;  3S7N A;  1K55 A;  2W0N A;  1NYM A;  5DJU A;  1FR1 A;  3IWQ A;  2PD8 A;  3ITB A;  3OC2 A;  5GLD A;  1PW8 A;  1MZU A;  2R9X A;  1H5X A;  3IX8 A;  5DF9 A;  3LO7 A;  4GDN A;  4IUH A;  5E2G A;  1FIL A;  5FA7 A;  3T12 B;  4GJ4 A;  2Y2O A;  4QU3 A;  3G2Z A;  4PM5 A;  3MSH A;  3WRZ A;  3I7J A;  4WEK A;  3PBT A;  3TJZ C;  2VGL M;  2O9A A;  4DXB A;  3SS3 A;  1F9I A;  1XXM A;  3MXQ A;  5AQA A;  2P04 A;  3V39 A;  2WAF A;  2P9V A;  4X1M A;  5EVI B;  4EET B;  1S1Y A;  4MBF A;  4I5S A;  3IBJ A;  3PBR A;  5DTT A;  3F1P B;  1T1A A;  3G2Y A;  3WWX A;  1DJA A;  4EEU A;  1MXO A;  3HRE A;  2VV6 A;  1I5Q A;  3HLG A;  2OOL A;  3BY8 A;  3R4K A;  3PHY A;  2HDU A;  2B95 A;  3RTY A;  3FG8 A;  4MN7 A;  1AXB A;  4GN2 A;  1CF0 A;  2WKR A;  2P9V B;  3UDI A;  2W3D A;  3UME A;  2CMN A;  3PYP A;  3VE4 A;  1ERO A;  4QD4 A;  4HEF A;  2VJW A;  2XSS A;  3FPV A;  4Y17 A;  1TDG A;  3LR3 A;  4X55 A;  3CPT B;  1OJ5 A;  2O9B A;  4E3M A;  3CLO A;  4B93 A;  4K0X A;  3QNC A;  3LY3 A;  4KUK A;  4HIA A;  2P08 A;  5BOH A;  5EVE A;  1N9O A;  3NBL A;  4R23 A;  1G28 A;  4KZ9 A;  1PIO A;  4WM9 A;  4EUV A;  1PYY A;  1MWS A;  3C7U A;  5C5K A;  3HLF A;  2PHY A;  1IOU A;  3BWL A;  2MJ6 A;  3G6O A;  3T50 A;  2WZZ A;  4WF0 A;  4JF4 A;  1KVL A;  4IJG A;  4YIN A;  4N92 A;  1BLH A;  1H8Z A;  3WS0 A;  4CLC B;  3IHB A;  5FQK A;  5DFY A;  3UMD A;  1F98 A;  4A5R A;  2M7U A;  2Y2I A;  3QHY A;  3ZQ5 A;  4LRY C;  1VHM A;  4ZDX A;  5FSR A;  3EEH A;  2UWX A;  1W63 M;  4JXW A;  4KZ7 A;  4MEZ A;  1WE4 A;  2WAE A;  1LSV A;  1N9B A;  2XD1 A;  5CXW A;  4LGW A;  4QWO A;  1IFQ A;  4GB7 A;  1BUL A;  3N8R A;  2H10 A;  3BY9 A;  1G6O A;  2V20 A;  3IF6 A;  5M19 A;  3HUM A;  1N9N A;  4MDZ A;  3BQ8 A;  2Y2N A;  2Z6D A;  5EOE A;  3VOY A;  3HLC A;  1K0K A;  1BT5 A;  4KEN B;  3P01 A;  1ZTU A;  2K31 A;  5A8B A;  4L9G A;  1LI0 A;  3BFC A;  4E3J A;  3V3R A;  2ZMV A;  3OOV A;  4PM8 A;  4ZAM A;  4RYE A;  2WGW B;  3JYI A;  3IF6 B;  2E8J A;  1TD5 A;  3DTE A;  4LV3 A;  3UY6 A;  2YKF A;  2C5W B;  5U47 A;  4PM7 A;  5K5B A;  1FSY A;  5GLC A;  2KOI A;  2O9C A;  4ARZ A;  4UQI S;  2EX6 A;  3K3C A;  4JGP A;  1MWT A;  4G3W A;  1NRF A;  3IS2 A;  2ZOI A;  3BLM A;  1XFQ A;  1PRQ A;  4DE1 A;  4MBH A;  5HPI A;  3E98 A;  5CEC A;  4EBN A;  4BL2 A;  1YAX A;  1IEM A;  1MKI A;  3L7H A;  2KX6 A;  3T1Q B;  1CI8 A;  2Y2G A;  2D02 A;  4GCZ A;  4PM6 A;  4Y3I A;  5HDS A;  1S66 L;  3BW6 A;  3UN7 A;  3NDE A;  1X0O A;  4FUW A;  3LIC A;  2XK1 A;  3RXW A;  5DF8 A;  4BJP A;  4ARZ B;  5A93 A;  3E0Y A;  3K2N A;  2ZJ9 A;  3MR0 A;  4DKI A;  4PKY G;  1KGG A;  5CHU A;  3T4Q A;  2EX8 A;  4M4X A;  5HAP A;  4PMA A;  4GHI A;  1L0D A;  5J7E A;  3LR0 A;  3BFF A;  3AGD A;  2WAD A;  3FPW A;  3N7W A;  1UWP X;  5F69 A;  4JPM A;  2PU2 A;  1S1Z A;  3E4P A;  4LV0 A;  1DY6 A;  3FWL A;  4DMZ A;  4HBT A;  4U0T A;  3ZVT A;  2JE5 A;  5DJT A;  4EBL A;  4WL9 A;  1O07 A;  3UPP A;  2XA7 M;  2Y2M A;  5AQB A;  1ZHH B;  5AVF A;  3LR5 A;  3V67 A;  4OH0 A;  3LIF A;  1YSQ A;  5F68 A;  5HDC A;  3W4Q A;  2VLG A;  1M40 A;  3FKV A;  4EXO A;  1KE3 A;  5CGS A;  3UE6 A;  3C4O A;  2ACG A;  2DNS A;  4F3L B;  4BL3 A;  5J8X A;  4JKT A;  1SDE A;  4R3A A;  4KZ6 A;  1SKO B;  1L0F A;  2VA0 A;  1ALQ A;  1HZO A;  4KZ5 A;  1LT0 A;  4YNR A;  4G3V A;  4Y0O A;  1GCE A;  3E4O A;  3MFX A;  5FQ9 A;  2ZMA A;  3IX4 A;  4I3A A;  1JTD A;  4XXR A;  2DCF A;  3WS5 A;  1ES2 A;  1K54 C;  1Q2P A;  4BD0 A;  2ZQ7 A;  2PT7 A;  3M6H A;  3N6I A;  1XJ6 A;  5L10 A;  5CER A;  2Y2P A;  4GW9 A;  3FYZ A;  2EFX A;  4DRT A;  2HV1 A;  2EX9 A;  4MMN A;  2HGV A;  5CX7 A;  2H28 A;  4X69 A;  2XD5 A;  4LV2 A;  1NYY A;  2GNX A;  4KZ3 A;  1XGJ A;  2ZC3 B;  1KGE A;  3H7W A;  2VGK A;  3SZT A;  2KLI A;  4P6Z M;  2Y59 A;  4KQD A;  5KSH A;  4LV1 A;  1NLZ A;  2WGV A;  2Y2H A;  3F1N B;  3EEA A;  3AGE A;  3B47 A;  3G34 A;  2WZX A;  4BMW A;  1BSG A;  4UEY A;  2A24 A;  1NLY A;  1XJ4 A;  2B18 A;  3S7O A;  2IWD A;  5L2F A;  3G30 A;  1XFN A;  3Q1F A;  2WKI A;  3MF0 A;  3O88 A;  1FCO A;  1CJF A;  1E4D A;  3LEZ A;  3ZCZ A;  4LCL A;  4UHU A;  2JC7 A;  4U0X A;  3P98 A;  3CUE A;  5GHY A;  4S2J A;  3GR2 A;  2ZOH A;  1S0W A;  2M1C A;  3A3I A;  5GLA A;  1WYC A;  2H5S A;  1PI5 A;  3HLD A;  2JKT I;  3H82 A;  5FAS A;  4X1L A;  5FQQ A;  4NG2 A;  3KYE A;  5HL6 A;  3VV4 A;  1PW1 A;  1OT6 A;  3LI9 A;  5CRF A;  1H0M A;  2W3H A;  4WMC A;  2VEA A;  1I2S A;  2WKQ A;  3EWK A;  3V50 A;  5EVL A;  3A0S A;  4WLA A;  5EVI C;  4HBU A;  3BEC A;  2OLU A;  4CLC E;  3LY4 A;  2EX2 A;  2J3T C;  1NRJ A;  1YQS A;  5CEB A;  1RGY A;  2ZQ9 A;  1G6A A;  4H6J A;  4WMC D;  4OPQ A;  1SZV A;  4R38 A;  3Q7Z A;  1ES4 A;  4P6B A;  3H82 B;  4P87 A;  3IF5 A;  5HWW A;  3LIE A;  3B3X A;  5AVE A;  2QMI A;  3T1X A;  2M7V A;  3BYD A;  3KSF A;  3LIA A;  3T4K A;  4UA9 A;  4OOL A;  3ZG0 A;  2JN7 A;  3E2L A;  3T1R A;  2WK0 A;  5A90 A;  3MQ0 A;  1QMF A;  2VGJ A;  5FDH A;  2HZ5 A;  3LCE A;  3PR6 A;  5CGX A;  2P7J A;  3NOP C;  2R78 A;  1BLS A;  3KSH A;  3IXB A;  5L07 A;  1T19 A;  2VK3 A;  1STZ A;  4Y0T A;  4OON A;  3TSG A;  4ME4 A;  4BLM A;  1YLT A;  3NCK A;  3GSG A;  5E43 A;  2XFS A;  4O0P A;  2V0W A;  3IHA A;  1SCW A;  1CQA A;  3K3D A;  4I3I A;  1YSP A;  1OME A;  1XJ3 A;  3SOI A;  4HJ4 A;  5IS1 A;  3G32 A;  4PKY A;  4DDS A;  4E3O A;  3TW8 A;  2J3T D;  4KZA A;  4Z1W A;  5KSC A;  2G2W A;  3OPP A;  2BTF P;  3EQU A;  5CGW A;  1YPR A;  4BBV A;  2XGN A;  2XRO A;  2HP5 A;  1CEG A;  4ETZ A;  1DP8 A;  1Q2Q A;  4NXB A;  2NUP C;  1ERQ A;  1JTG A;  4E04 A;  4HH3 A;  3C5A A;  2HJE A;  1CI9 A;  1P97 A;  2HP9 A;  2QJ5 A;  3MS6 A;  3TRC A;  3U4L P;  5EM1 A;  4U3T A;  5FEG A;  1NZO A;  2ZD8 A;  2B5R A;  3KYQ A;  3DAV A;  2VV8 A;  3W4O A;  1D7E A;  3UB7 A;  4OPR A;  2ZM8 A;  3ZG5 A;  4FH2 A;  4JGO A;  3B42 A;  1W5D A;  3IXG A;  3PBS A;  4QB8 A;  2J9P A;  3F1O A;  4Y5F A;  4L9F A;  5F83 A;  2GX5 A;  2IWB A;  1GHI A;  3BM6 A;  2VKS A;  5D3O A;  1JWZ A;  4R3J A;  4GKU A;  1S4R A;  4R0Q A;  4RX3 A;  3QP6 A;  4XT2 A;  3GVB A;  2WKE A;  3OCN A;  1W63 Q;  3DTI A;  4KQQ A;  4IVI A;  4IUK A;  3CZD A;  4B4Z A;  4CPK A;  2JKR M;  2OV5 A;  2HF6 A;  3Q7V A;  1KOU A;  2Z2L B;  2OSU A;  4GZB A;  2V8F A;  3SS5 A;  5F1G A;  4HI4 A;  1KE4 A;  4K91 A;  3ZG7 B;  4E3L A;  3HCY A;  5F82 A;  4P6Z S;  1E3U A;  4EUZ A;  3OLO A;  4DE3 A;  2L1M A;  1VQQ A;  3F1O B;  3BQA A;  3UDF A;  2ZC6 B;  2W3G A;  1O7E A;  3DTM A;  4YWZ A; 
#chains in the Genus database with same CATH homology
 3LGO A;  2JKF A;  5EVE A;  2PAV P;  1FIL A;  3T12 B;  1Y4O A;  3T1X A;  2PBD P;  1J3W A;  2E8J A;  5FEF A;  1VET B;  3MS6 A;  3MSH A;  3U4L P;  3T1R A;  5EM1 A;  3CHW P;  3D9Y A;  5FEG A;  4D60 A;  2HZ5 A;  5FDS A;  2ZL1 B;  3CPT A;  3L9K A;  2V8C A;  3DAV A;  2ACG A;  1CJF A;  3NEC A;  1PNE A;  1VEU B;  2VK3 A;  1PRQ A;  3LEQ A;  5EM0 A;  4X1M A;  1SKO B;  4X25 A;  2JKG A;  1AWI A;  3L7H A;  3T1S A;  1CQA A;  3T1Q B;  2ZL1 A;  4X1L A;  1D1J A;  3KYE A;  1FIK A;  4QWO A;  1PFL A;  4FUW A;  1VEU A;  4FTX A;  2B95 A;  1G5U A;  1HLU P;  1ACF A;  1VET A;  2V8F A;  3NUL A;  1SKO A;  5EV0 A;  1A0K A;  1CF0 A;  1K0K A;  3UB5 P;  2PRF A;  2BTF P;  1YPR A;  1Z09 A;  3CPT B;  1SZV A;  4ESP A;  1F2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...