4FUWA

Crystal structure of ego3 mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
151
structure length
140
Chain Sequence
b'SKNVKGFLENTLKPYGSLQSSMIITATNGGILSYATSNNSINEINSVNNLKMMSLLIKDKWSEDENDNSCYPVEIDSFKTKIYTYEMEDLHTCVAQIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLGLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein SLM4
molecule tags Protein binding
source organism Saccharomyces cerevisiae
publication title Ego3 functions as a homodimer to mediate the interaction between Gtr1-Gtr2 and Ego1 in the ego complex to activate TORC1.
pubmed doi rcsb
total genus 40
structure length 140
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16818 SLM4 Protein SLM4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4fuwA01
1K0KA 1CQAA 1A0KA 3T1RA 5EVEA 3KYEA 2JKGA 3MS6A 2ZL1A 1Y4OA 1SZVA 3CPTB 1AWIA 1Z09A 5EM0A 1FIKA 1VEUB 1D1JA 2PBDP 1YPRA 1PNEA 3T1QB 3LEQA 3UB5P 2BTFP 3MSHA 1VETB 2V8FA 1CF0A 5FEGA 2PRFA 3L9KA 2ACGA 2ZL1B 2HZ5A 4QWOA 3L7HA 3LGOA 1CJFA 2B95A 1VETA 1PRQA 1VEUA 3CPTA 2PAVP 3DAVA 4FTXA 5EM1A 5FDSA 4D60A 4ESPA 5FEFA 3CHWP 4X1LA 4X25A 1HLUP 2JKFA 3NULA 3T1XA 2VK3A 1FILA 2E8JA 1SKOA 1J3WA 1PFLA 3U4LP 1ACFA 3T12B 5EV0A 4FUWA 4X1MA 3NECA 3D9YA 3T1SA 2V8CA 1F2KA 1SKOB 1G5UA
chains in the Genus database with same CATH superfamily
1ONGA 1PWGA 4BD0A 3SH8A 5TGFA 2R9XA 3IS2A 3WS5A 1SDNA 2M1CA 4R38A 3UB5P 3HLGA 3QP4A 4NXEA 3JVVA 1XKZA 1NRJA 3TRCA 4S2LA 5FQMA 2L1MA 3ZCZA 4KG5A 2QMIA 2WKHA 5D3OA 1GSWA 2JKTI 2VV7A 3B42A 3BY8A 4DE2A 1KGGA 4WZ5C 1HTZA 2C6WB 4ARZB 3D9YA 3D72A 3HLCA 3KYZA 5EVID 4BBUA 2W1TA 4OPYA 1CK3A 4OPQA 4OQ0A 1D7EA 2H28A 4LCMA 4OPRA 3FZCA 1XA7A 5FSRA 2QYBA 4BL3A 5EVIB 5U47A 3W4PA 3EWKA 3T4KA 1ERMA 4L0LA 3UE0A 2Z2LB 4P6BA 4FCFA 4AFIA 4NXGA 5E2FA 2VA0A 4HH3A 1K6RA 3UDIA 4ZJ3A 2WKQA 4Y0TA 4BL2A 5FQJA 4X53A 3D3OA 3IXDA 4ARZA 2DMWA 2ZC3B 2ZC6B 3UMEA 4E3MA 5DKLA 1ONHA 4JGQA 1PI4A 3B47A 3RFBA 1OTDA 2K31A 3HL9A 4GCZA 3N8SA 2EXBA 3NDEA 1S4SA 3CLOA 5EECA 2P04A 1K56D 3UE6A 2E8IA 4KQRA 4C3QA 3CMZA 1AWIA 3IXHA 3VE3A 3BQAA 2W0NA 4BBVA 4FSFA 5HAIA 4KZ5A 3SS5A 1NZOA 3R4KA 3G2ZA 3ZNYA 2Y79A 3UPPA 4KENB 2EWVA 3OPHA 4E3OA 2XFTA 3MXQA 3PBSA 4I5SA 3UO9A 1XP4A 2Y4AA 4R1GA 4ID4A 3VP0A 3G30A 4HH2A 5CECA 3VP3A 1KE0A 4PAUA 1LL9A 2LB9A 1XJ3A 1CI9A 4PM9A 1XJ6A 4OP5A 3KSHA 3DW0A 3A3JA 2PRFA 2W3FA 4FTXA 1YLJA 1DY6A 3MKEA 3A3IA 4MEZA 4EESA 3KX0X 3HVFA 3GRJA 1RGZA 2MJ6A 3UMDA 1JTGA 3ZG5A 2ZL1A 3HJKA 3T1QB 1BT5A 4R3AA 4OQGA 3LICA 4QB8A 5IS1A 1E4DA 1VEUA 1N9NA 4RX2A 3BFDA 1PZPA 3CZDA 4R3JA 1W7FA 3QP1A 2Q9MA 3TE8A 4R6LA 5F6AA 5EVLA 5A92A 4WBGA 5CHUA 2BTFP 1NYYA 1LLBA 2HP6A 4QWOA 2M7UA 2HGVA 1ESUA 1EI5A 2XF3A 2L4RA 5DF8A 5F82A 1IFQA 2H5SA 2WKRA 2VK3A 3E2LA 2OLUA 2Y2PA 3LUQA 1MWRA 2PBYA 3RJUA 4D2OA 4KQQA 3LO7A 3I7JA 1BZAA 2DCFA 3CUEC 4RX3A 1HZOA 3FG8A 4MN6A 4MN5A 2YKFA 3MKFA 3PTEA 1CJFA 4CLCE 1NJ4A 4P6ZS 3G6OA 5FA7A 3MQOA 5FATA 1EWZA 5GLBA 4X1MA 2I72A 2JC7A 4P87A 4Q0HA 1YMSA 3ZYTA 3T4QA 1ES2A 4NETA 1PNEA 3ZG0A 4EERA 4KZ6A 4JGOA 4U0TA 1I2SA 3NCKA 2GNXA 1NRFA 4H6JA 1TDLA 1ACFA 4B4ZA 1XGJA 5HDSA 1IYPA 4BLMA 3TOIA 2WKEA 1TEMA 3VOLA 2AVXA 4P85A 3W2ZA 5EPHA 3A3EA 2QZ6A 1BLSA 3G2YA 4L9GA 1K25A 1YSQA 4HJ6A 1SCWA 4GDNA 4B93A 5F1FA 3U4LP 2A2LA 3B33A 3ITBA 4E3NA 2VLGA 3NOTC 2ZC7A 4NXBA 2W3GA 3EQVA 3OPLA 4WZ5A 4GD8A 3V5MA 3S7NA 4WEKA 1RP5A 3UB6A 1VETA 4HEFA 5DJTA 4KZ7A 4OOMA 5FI7A 2JKFA 3UDFA 4E3IA 2XD1A 3PBRA 1UGUA 3BW6A 3LFVA 1MXOA 3QP5A 5E2GA 2ZM2A 2JKTM 1FCMA 2OWHA 5L8MA 1O07A 3HBRA 4S2PA 3OLOA 3GMWA 4PM7A 1T18A 1SDEA 2IWDA 3UNWA 5KSHA 3E4PA 3K3DA 4R70A 3LR3A 3LYXA 4HNBA 4QJGA 3ICYA 2VGLS 4II7A 4X56A 4OPZA 4GLQA 5L10A 1XJ2A 1BSGA 1CF0A 2QKPA 2WAEA 1CEFA 1PW1A 5I5LA 4JLFA 3C7UA 3MJQA 2W27A 3IX3A 1XGIA 1F98A 4BD1A 4UHUA 4RVAA 3NOUC 3AGDA 3JYIA 4LGWA 5DTKA 2Y91A 4QY5A 3SOIA 3FPWA 2PBDP 2A24A 4IVKA 1F9IA 3F1NA 3IS2B 1XFNA 4HESA 4WEJA 3Q1FA 1TDGA 2PU2A 3OPRA 4OP8A 3IWIA 3OCLA 3B3XA 3SH7A 2V20A 2XDMA 5HPFA 5E43A 2Y8HA 5AVFA 4DXCA 3IX8A 4GS9A 5CGSA 1SHVA 5HFOA 3MR0A 1OJGA 2VZWA 2J9PA 2X02A 1WYCA 2ZL1B 4GKUA 5FDSA 2Y2MA 1P9WA 4UAAA 1YT4A 3R7WA 1JWPA 3RXWA 2P9VA 5F68A 1WYBA 3IF6A 5F5YA 4S2JA 4PM6A 4PKYG 3A0VA 2GDNA 2JCHA 2V1AA 4Y17A 1EROA 4P6ZM 4ZJ1A 2PYPA 2JBFA 4WLAA 3CAXA 4OQHA 4DDSA 2RCXA 3EGDC 3ZG8B 3ITAA 2HP9A 5DFYA 2P74A 3UE3A 3NY4A 1PW8A 5KZHA 3LR4A 1V9ZA 3ZG7B 3RTYA 3EEHA 4CLCD 1IYQA 3BM6A 3BEBA 4H8RA 1DP6A 1P97A 1A0KA 3WS4A 3MFXA 5HZHA 3OPPA 3UPNA 1STZA 4OLDA 1LSXA 2DNSA 2PYRA 2OWJA 3OZHA 2Y2HA 4K0XA 4LCLA 4JF6A 4KG6A 4UEYA 1BLHA 1FSYA 5EE8A 2V0WA 1FSWA 1VB6A 2BG1A 3E4OA 3AGFA 4EETB 2WGIA 4X68A 3TJZC 1TS6A 3KSIA 4MDZA 4N9LA 2Q9NA 3WRZA 3PBOA 1D1JA 5J7EA 1TS0A 2M7VA 5HDDA 2ZM0A 4K91A 5AQAA 2PR5A 2UV0E 1KVMA 4UQIM 5CRFA 2XR0A 2OAP1 5FL3A 1H0MA 4Q0JA 4NXFA 1G6AA 3IF6B 3LR0A 4N1XA 5CGXA 2FH5A 4I3JA 4MBHA 2JKRM 3IXBA 1XPBA 1T1AA 2GJ3A 4Y0OA 3IHAA 2OV5A 1ZKJA 4ZTKA 3DTIA 1LT0A 4HBUA 2ZBBA 3GECA 4LRZE 4NEED 4LFUA 4EBNA 5F69A 3CWFA 1MZUA 2HP5A 1ZC2A 3IX4A 1GA0A 1OTIA 4ZJ2A 2VJWA 2IWCA 2B5RA 4LLOB 4PM8A 5IHVA 3MSHA 2FZ0A 3NI9A 1IELA 5F83A 2PT7A 1IYOA 3Q7ZA 2KLIA 1S0WA 4XUXA 3FPVA 4LRYC 5HD5A 1K57A 4JKTA 3JVUA 1S67L 3W4QA 3BRMA 4OLGA 1PWCA 1FOFA 5HSQA 1QMFA 2ZQ9A 1K0KA 4JF4A 5DF7A 2O0YA 3GDIA 5IT5A 3UB8A 2OAQ1 1I2WA 3MZDA 3MXSA 3IHBA 1K6SA 3C30A 4PHTA 4S2MA 2HDRA 1TS7A 3T4OA 2A3UA 2J80A 5CTNA 1F2KA 5CEBA 5CGWA 1N9LA 3G34A 4QY6A 3F1NB 4GDBA 4R3BA 2Y2QA 1NY0A 3P98A 1N9BA 2Y2OA 1MWUA 3VFFA 1XX2A 1PIOA 4HP4A 4KQDA 4LV0A 1OTEA 3EEAA 3IBRA 5M1AA 1KE3A 4UA6A 1PWDA 1L0DA 3E4QA 1VETB 3G35A 4QD4A 4OOLA 2QPNA 2JKRI 4U3TA 4WUJA 2PD8A 4EBPA 5KSCA 2JE5A 3VP2A 2X71A 2EFUA 5LBRA 4WMCA 4WYYA 5FQKA 4XT2B 5FEFA 1JTDA 2P9VB 3H82A 5DJUA 3G31A 3LIDA 3UN7A 2HF6A 4R4SA 1X0OA 4NG2A 1BUEA 4GHIA 4EV4A 4ZRRA 3O5YA 4X25A 5E2HA 2K7SA 1DJAA 5IU1A 3BFFA 1Q2PA 4BWIA 3HLEA 4EQ1A 1OTBA 3UY6A 1MWTA 4EUZA 1LL8A 1YSPA 2K2NA 5EUAA 1YKDA 1MBLA 4ESPA 3T4JA 1MKIA 4P0MA 5G4YA 2FFFB 1IYSA 4LV1A 3NOPC 5A8BA 5CHJA 3LCEA 2R9WA 4HQAA 3IWQA 4HIAA 3S1YA 2BASA 2J3TC 1S66L 1ZTUA 5GLCA 1E25A 1H8YA 1Z6FA 4EWFA 4M3KA 1IKIA 1XXMA 1FILA 3FV7A 5HD3A 3M2JA 3S4XA 3TG9A 3DWZA 1WE4A 4E04A 1H8MA 5EM0A 3S7OA 4ETZA 2ZQ7A 4I3IA 2ZMFA 4JF5A 3JPUA 2KOIA 1ZG6A 3Q7VA 2QJ5A 1L3LA 4U0XA 1E3UD 2H0TA 1LSWA 5EOOA 3CUEA 4KZ8A 4IBRA 3T1RA 3KYEA 4PMAA 4C75A 2XROA 3FWLA 4Y0UA 2EX2A 2VGLM 4IJGA 1IEMA 3VP4A 4EUVA 1BTLA 3T1XA 2GZAA 3UDXA 1G28A 3Q82A 3F1PB 5AQ7A 2QWSA 4FOFA 3FKWA 3UPOA 3GSGA 1WA9A 4LPZA 1SZVA 1JWVA 4HJ4A 3MXRA 1K38A 3LI9A 5HARA 3CPTA 3V50A 2B02A 3LR5A 2LB5A 1XJ4A 2ZJ9A 1KOUA 4RYEA 4X1LA 1BLPA 3ISGA 1W8YA 1YLTA 3QP8A 4UA9A 4CLCB 1TVFA 1UWPX 4K08A 3BECA 2VX8A 4NK3A 3T50A 1HVBA 3C4PA 4OVDA 5FI6A 4OH0A 4E3LA 2G2WA 1KGFA 3WWXA 4O7DA 1DRMA 2PR6A 4O8GA 2ZQCA 2Z6CA 3AGEA 2QJ7A 1LL5A 4FH4A 3OC2A 5JYPA 2KDKA 3P7NA 2I9VA 5M19A 4XXRA 1LI9A 4BQMA 2Y2NA 5TJJA 2WYXA 1GSXA 3PBNA 3KSFA 3T1SA 1V9YA 4WN5A 3GQZA 3P01A 3K3CA 5TFQA 1P0ZA 4EU0A 2ZQDA 4OKPA 5E2EA 2IWBA 3ZNTA 3PYPA 5TR7A 3VOZA 5HWTA 3KSGA 5I94A 4NKPA 2G2UA 4CLCC 4ZDXA 4DF6A 3PXPA 4G3WA 1VHMA 4WL9A 3A3DA 3DBAA 2HDUA 4Z1WA 1QMEA 4KUKA 2JKGA 4Y2FA 5AVEA 2NUTC 3LGOA 5DTTA 3UB9A 3HCYA 1NWZA 5J4EA 3A0RA 5AQ9A 4DXBA 2XA7M 2W3HA 1OTAA 1KDSA 1DP9A 3FYZA 3ZHHA 2WGWA 4MBFA 2DRWA 4C6YA 2HJEA 1AXBA 5M18A 5FQ9A 3T4SA 3T4LA 4GJ4A 5GHYA 2WADA 2CMNA 5CERA 4L9EA 1U60A 4YWZA 3LIAA 4F3LA 1O7EA 4HY8A 4Q0IA 4E3JA 5TBMB 1KGEA 1J9MA 5DKKA 5G4ZA 1S4RA 2INWA 4WZ4A 5CXWA 4OOYA 1K4EA 5EFWA 5CTMA 3NHQA 4DJ2A 4A5RA 1J3WA 4N92A 4DRTA 3N4IA 1YLZA 2XQZA 2ZMVA 3QP2A 4GB7A 1IOUA 1H8ZA 2V8FA 3U2AA 2Y2GA 2B95A 1W5DA 1NLZA 4MNRA 4KG2A 4PPRA 1FCNA 4S2IA 3VSLA 2R78A 1K4FA 3N6IA 1C3BA 2EFXA 4PM5A 1KDWA 4JGRA 3HREA 1FIKA 1S6RA 5FAPA 3BLSA 4N9KA 2VV6A 1YLWA 2ZM8A 5HWWA 2HZ5A 1XA1A 1IKGA 4HBTA 4B88A 1TF1A 2OOLA 3E98A 2WK0A 3PBTA 4KZAA 4H6JB 3CJMA 2H10A 2C5WB 4R4RA 5EVIA 5A90A 1L0GA 3BFGA 2HV1A 4HHDA 3ULFA 3CG5A 3LIEA 2P08A 4MBKA 3MZEA 2WUQA 5KMWA 2WZZA 4WM9A 4DMZA 1GHIA 3W4OA 4QU3A 1K57C 3LIFA 3IF5A 5MC7A 2J7VA 1H3QA 3HUOA 4IUKA 4RQ9A 5G18A 2J8YA 4FH2A 4G3KA 4QHCA 1K56A 4LENA 3SZTA 2RL3A 2IA2A 2WZXA 4OQIA 1YMXA 4WMCD 2V2FF 5A93A 3NC8A 4DN0A 2FFYA 1FR1A 2OSUA 2XA7S 4Y3IA 3EOIA 3S7PA 4S2NC 2ACGA 4WF0A 3IT9A 5EM1A 4CLCA 1PI5A 3LY3A 4I38A 4F3LB 1M6KA 5FQQA 2B18A 2D01A 4YFMA 2Y2KA 2BLSA 5EVEA 3M2KA 3CPTB 3LY4A 1P9RA 4Q8IA 4MCWA 3MFDA 4IUHA 2XFSA 2Z2MB 3HUMA 2X01A 5DFXA 3HLBA 1MWSA 2XLNA 5DF9A 3VE4A 4GW9A 3FC7A 3WRTA 1NXYA 2NUPC 4LRXC 4XT2A 4PKYA 1YPRA 2PHYA 2HJ9C 3H7WA 3NIAA 4UQIS 5KIZA 1BULA 5C5KA 3GR2A 4JBFA 2YKHA 4MMNA 3QNBA 4KZBA 1FCOA 4FUWA 3DWKA 5HAPA 3PR6A 3LI8A 5CEDA 3Q7VB 2Y2JA 2L0WA 1OPXA 3QNCA 2W3DA 1DJBA 1PYYA 1Y54A 2W1TB 4WELA 1ES4A 3FKVA 3OBFA 2PU4A 4X6TA 2V0UA 2PD7A 2JHEA 2W1RA 2VEAA 1CEGA 3IQAA 3N8LA 4BENA 2XRNA 1VQQA 4KQOA 1L0FA 1YM1A 4YOFA 3V3SA 1HD8A 4IEDA 4R23A 4CJNA 2GX5A 4S2OA 2ZD8A 3GTCA 1MPLA 3MMHA 1LHYA 2ZOIA 2P7JA 5J8XA 1T1CA 4M4XA 4N1HA 5CHMA 3KO6A 3VP1A 3S7QA 4S2KA 4HP9A 5HW3A 1E3UA 4MLLA 1L0EA 5HPIA 1KE4A 4GZBA 3T4TA 2H0YA 4JXGA 3Q07A 1SKOB 4L9FA 1CQAA 2XH9A 4HOIA 5L07A 3BLMA 4FD8A 3IH9A 1I5QA 2VV8A 3C38A 3L7HA 5HL6A 2Y59A 2HDQA 3H9WA 3WS1A 4KZ4A 1PFLA 3C8CA 3E0YA 2ZC5B 3G4PA 5HX9A 2WAFA 1XFQA 1ZHHB 3VFHA 1BLCA 1NZUA 1DJCA 1DP8A 2VGKA 2WKPA 4KZ3A 2HDSA 3ZG9B 2OLVA 2J9OA 5K5BA 1T1BA 1MC0A 4GN2A 3G32A 3MBZA 5F1GA 5GHXA 2EWWA 5EOEA 4YINA 3SS4A 3PAEA 5L09A 4I39A 3UB7A 3MQ0A 4Z9QA 5TBMA 2JN7A 2ZQ8A 4Y15A 2ZQAA 1GSVA 5FI2A 1ES3A 4YNRA 3VSKA 3ZVWA 1GHPA 3N7WA 1G5UA 3O88A 3A0SA 4O0PA 4EW7A 5GLAA 3V39A 1EW0A 3HLFA 1ERQA 3O86A 1N9OA 4RA7A 3PHYA 3V3RA 2XD5A 2Y2LA 3H82B 1L2SA 3M6HA 3ZVTA 4ETXA 3MS6A 3EGXC 1UWNX 3E2KA 5HWVA 2ZC4B 1TD5A 3HLWA 2G7UA 4Y13A 4JGPA 2J3WA 3L9KA 4MN7A 1K55A 4UA7A 3IXGA 2E8JA 3D4FA 1ODVA 4Y5FA 1W63M 3BFCA 5FASA 3C7VA 4Y7PA 4KUOA 1ALQA 3ZGAB 4E6XA 3NDGA 4GHIB 4S2NA 4BBTA 2A49A 4EXOA 1Q2QA 4G3VA 4EBLA 3CHWP 5AQBA 3F1PA 3GVBA 2WGVA 2XEPA 3S22A 4GOGA 2VGJA 5GLDA 3CITA 1YLPA 1YQSA 3ZFZA 2EX8A 3TW8A 1ESIA 1LSVA 3IF6C 1GCEA 3C2WA 4D60A 3H7WB 3VV4A 3TSGA 1JWZA 5JYOA 2EA9A 4XUZA 5EV0A 3NECA 3V67A 3N8RA 1Y28A 1TS8A 2UWXA 1PZOA 4IBXA 5CX7A 1OT9A 1LI0A 4KZ9A 3LEZA 3IH8A 1OMEA 5EVIC 4E3KA 4X55A 2HPBA 3O87A 4OONA 1ES5A 1YLYA 3OOVA 2PDRA 2V1ZA 3MF0A 5DTSA 5BOHA 3BYDA 1K55C 3GV9A 1G6OA 3QHYA 3BWLA 2XGNA 3F1OA 3ZQ5A 2O9CA 4EEPA 1Y4OA 3Q81A 2V9AA 1K54A 2XSSA 2W3EA 1PRQA 3WS0A 2KX6A 2QHKA 5GHZA 3SS3A 4BJPA 4EEUA 4GD6A 1RGYA 3HJIA 1GHMA 3A3FA 3KYQA 4X69A 4EQIA 4ME4A 3EQUA 3WS2A 3CI6A 5FEGA 1FQGA 4DE3A 3DAVA 5J3WA 2EXAA 4IVIA 1ZG4A 1W63Q 3P09A 1N4OA 1SKOA 3W8KA 3T12B 2D02A 4DJ3A 1H5XA 1CI8A 2O9BA 2Z6DA 3O3VA 1G68A 3K2NA 4CQHA 1S1ZA 4JXVA 2Y2IA 3RH8B 1KVLA 4F94A 2EX9A 3PAGA 4HJ3A 1FR6A 5AJGA 4O01A 2ZMAA 3F1OB 2CC1A 4LV3A 1SKFA 1JNUA 3R7WB 3BQ8A 1F5MA 3SH9A 4DE0A 4B9OA 3C4OA 3IWOA 1RCJA 4ZAMA 2ZOHA 1K54C 4JXSA 5DVAA 3NBLA 1MY8A 1MKMA 3LIBA 3M6BA 4ZBEA 4K0WA 3C5AA 4GNUA 1GA9A 3QP6A 3LEQA 1YAXA 2A24B 4IHQA 2Y55A 4HI4A 4QPRA 3BJNA 1NYMA 3MQQA 4GS9B 4I3AA 5HAQA 4LV2A 4E6WA 3ZDJA 1HLUP 3NULA 1OJ5A 5HDCA 4DE1A 5FDHA 1M40A 3VMAA 3RXXA 3BY9A 5FAOA 1W79A 4BMWA 3DTEA 5HL1A 5A91A 3SW1A 2XK1A 4DKIA 1VEUB 3DTKA 1JVJA 4DDYA 4B4XA 2PAVP 1W8QA 2Q0OA 2O99A 2WGWB 3NJAA 3PBQA 3UE1A 5FQIA 1OT6A 4JXWA 1NLYA 4R0QA 2V8CA 5FAQA 3HUNA 2O9AA 2EX6A 3IBJA 1Z09A 3MZFA 3BFEA 1BYWA 3VOYA 3HLDA 2WKIA 4CPKA 2V1BA 3OCNA 1T19A 1D06A 5GL9A 2J3TD 1VM1A 2VKSA 2ZLYA 3DTMA 4JPMA 1S1YA 5L2FA
chains in the Genus database with same CATH topology
1K0KA 1CQAA 1A0KA 3T1RA 5EVEA 3KYEA 2JKGA 3MS6A 2ZL1A 1Y4OA 1SZVA 3CPTB 1AWIA 1Z09A 5EM0A 1FIKA 1VEUB 1D1JA 2PBDP 1YPRA 1PNEA 3T1QB 3LEQA 3UB5P 2BTFP 3MSHA 1VETB 2V8FA 1CF0A 5FEGA 2PRFA 3L9KA 2ACGA 2ZL1B 2HZ5A 4QWOA 3L7HA 3LGOA 1CJFA 2B95A 1VETA 1PRQA 1VEUA 3CPTA 2PAVP 3DAVA 4FTXA 5EM1A 5FDSA 4D60A 4ESPA 5FEFA 3CHWP 4X1LA 4X25A 1HLUP 2JKFA 3NULA 3T1XA 2VK3A 1FILA 2E8JA 1SKOA 1J3WA 1PFLA 3U4LP 1ACFA 3T12B 5EV0A 4FUWA 4X1MA 3NECA 3D9YA 3T1SA 2V8CA 1F2KA 1SKOB 1G5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0K A;  1CQA A;  1A0K A;  3T1R A;  5EVE A;  3KYE A;  2JKG A;  3MS6 A;  2ZL1 A;  1Y4O A;  1SZV A;  3CPT B;  1AWI A;  1Z09 A;  5EM0 A;  1FIK A;  1VEU B;  1D1J A;  2PBD P;  1YPR A;  1PNE A;  3T1Q B;  3LEQ A;  3UB5 P;  2BTF P;  3MSH A;  1VET B;  2V8F A;  1CF0 A;  5FEG A;  2PRF A;  3L9K A;  2ACG A;  2ZL1 B;  2HZ5 A;  4QWO A;  3L7H A;  3LGO A;  1CJF A;  2B95 A;  1VET A;  1PRQ A;  1VEU A;  3CPT A;  2PAV P;  3DAV A;  4FTX A;  5EM1 A;  5FDS A;  4D60 A;  4ESP A;  5FEF A;  3CHW P;  4X1L A;  4X25 A;  1HLU P;  2JKF A;  3NUL A;  3T1X A;  2VK3 A;  1FIL A;  2E8J A;  1SKO A;  1J3W A;  1PFL A;  3U4L P;  1ACF A;  3T12 B;  5EV0 A;  4FUW A;  4X1M A;  3NEC A;  3D9Y A;  3T1S A;  2V8C A;  1F2K A;  1SKO B;  1G5U A; 
#chains in the Genus database with same CATH topology
 1ONG A;  1PWG A;  4BD0 A;  3SH8 A;  5TGF A;  2R9X A;  3IS2 A;  3WS5 A;  1SDN A;  2M1C A;  4R38 A;  3UB5 P;  3HLG A;  3QP4 A;  4NXE A;  3JVV A;  1XKZ A;  1NRJ A;  3TRC A;  4S2L A;  5FQM A;  2L1M A;  3ZCZ A;  4KG5 A;  2QMI A;  2WKH A;  5D3O A;  1GSW A;  2JKT I;  2VV7 A;  3B42 A;  3BY8 A;  4DE2 A;  1KGG A;  4WZ5 C;  1HTZ A;  2C6W B;  4ARZ B;  3D9Y A;  3D72 A;  3HLC A;  3KYZ A;  5EVI D;  4BBU A;  2W1T A;  4OPY A;  1CK3 A;  4OPQ A;  4OQ0 A;  1D7E A;  2H28 A;  4LCM A;  4OPR A;  3FZC A;  1XA7 A;  5FSR A;  2QYB A;  4BL3 A;  5EVI B;  5U47 A;  3W4P A;  3EWK A;  3T4K A;  1ERM A;  4L0L A;  3UE0 A;  2Z2L B;  4P6B A;  4FCF A;  4AFI A;  4NXG A;  5E2F A;  2VA0 A;  4HH3 A;  1K6R A;  3UDI A;  4ZJ3 A;  2WKQ A;  4Y0T A;  4BL2 A;  5FQJ A;  4X53 A;  3D3O A;  3IXD A;  4ARZ A;  2DMW A;  2ZC3 B;  2ZC6 B;  3UME A;  4E3M A;  5DKL A;  1ONH A;  4JGQ A;  1PI4 A;  3B47 A;  3RFB A;  1OTD A;  2K31 A;  3HL9 A;  4GCZ A;  3N8S A;  2EXB A;  3NDE A;  1S4S A;  3CLO A;  5EEC A;  2P04 A;  1K56 D;  3UE6 A;  2E8I A;  4KQR A;  4C3Q A;  3CMZ A;  1AWI A;  3IXH A;  3VE3 A;  3BQA A;  2W0N A;  4BBV A;  4FSF A;  5HAI A;  4KZ5 A;  3SS5 A;  1NZO A;  3R4K A;  3G2Z A;  3ZNY A;  2Y79 A;  3UPP A;  4KEN B;  2EWV A;  3OPH A;  4E3O A;  2XFT A;  3MXQ A;  3PBS A;  4I5S A;  3UO9 A;  1XP4 A;  2Y4A A;  4R1G A;  4ID4 A;  3VP0 A;  3G30 A;  4HH2 A;  5CEC A;  3VP3 A;  1KE0 A;  4PAU A;  1LL9 A;  2LB9 A;  1XJ3 A;  1CI9 A;  4PM9 A;  1XJ6 A;  4OP5 A;  3KSH A;  3DW0 A;  3A3J A;  2PRF A;  2W3F A;  4FTX A;  1YLJ A;  1DY6 A;  3MKE A;  3A3I A;  4MEZ A;  4EES A;  3KX0 X;  3HVF A;  3GRJ A;  1RGZ A;  2MJ6 A;  3UMD A;  1JTG A;  3ZG5 A;  2ZL1 A;  3HJK A;  3T1Q B;  1BT5 A;  4R3A A;  4OQG A;  3LIC A;  4QB8 A;  5IS1 A;  1E4D A;  1VEU A;  1N9N A;  4RX2 A;  3BFD A;  1PZP A;  3CZD A;  4R3J A;  1W7F A;  3QP1 A;  2Q9M A;  3TE8 A;  4R6L A;  5F6A A;  5EVL A;  5A92 A;  4WBG A;  5CHU A;  2BTF P;  1NYY A;  1LLB A;  2HP6 A;  4QWO A;  2M7U A;  2HGV A;  1ESU A;  1EI5 A;  2XF3 A;  2L4R A;  5DF8 A;  5F82 A;  1IFQ A;  2H5S A;  2WKR A;  2VK3 A;  3E2L A;  2OLU A;  2Y2P A;  3LUQ A;  1MWR A;  2PBY A;  3RJU A;  4D2O A;  4KQQ A;  3LO7 A;  3I7J A;  1BZA A;  2DCF A;  3CUE C;  4RX3 A;  1HZO A;  3FG8 A;  4MN6 A;  4MN5 A;  2YKF A;  3MKF A;  3PTE A;  1CJF A;  4CLC E;  1NJ4 A;  4P6Z S;  3G6O A;  5FA7 A;  3MQO A;  5FAT A;  1EWZ A;  5GLB A;  4X1M A;  2I72 A;  2JC7 A;  4P87 A;  4Q0H A;  1YMS A;  3ZYT A;  3T4Q A;  1ES2 A;  4NET A;  1PNE A;  3ZG0 A;  4EER A;  4KZ6 A;  4JGO A;  4U0T A;  1I2S A;  3NCK A;  2GNX A;  1NRF A;  4H6J A;  1TDL A;  1ACF A;  4B4Z A;  1XGJ A;  5HDS A;  1IYP A;  4BLM A;  3TOI A;  2WKE A;  1TEM A;  3VOL A;  2AVX A;  4P85 A;  3W2Z A;  5EPH A;  3A3E A;  2QZ6 A;  1BLS A;  3G2Y A;  4L9G A;  1K25 A;  1YSQ A;  4HJ6 A;  1SCW A;  4GDN A;  4B93 A;  5F1F A;  3U4L P;  2A2L A;  3B33 A;  3ITB A;  4E3N A;  2VLG A;  3NOT C;  2ZC7 A;  4NXB A;  2W3G A;  3EQV A;  3OPL A;  4WZ5 A;  4GD8 A;  3V5M A;  3S7N A;  4WEK A;  1RP5 A;  3UB6 A;  1VET A;  4HEF A;  5DJT A;  4KZ7 A;  4OOM A;  5FI7 A;  2JKF A;  3UDF A;  4E3I A;  2XD1 A;  3PBR A;  1UGU A;  3BW6 A;  3LFV A;  1MXO A;  3QP5 A;  5E2G A;  2ZM2 A;  2JKT M;  1FCM A;  2OWH A;  5L8M A;  1O07 A;  3HBR A;  4S2P A;  3OLO A;  3GMW A;  4PM7 A;  1T18 A;  1SDE A;  2IWD A;  3UNW A;  5KSH A;  3E4P A;  3K3D A;  4R70 A;  3LR3 A;  3LYX A;  4HNB A;  4QJG A;  3ICY A;  2VGL S;  4II7 A;  4X56 A;  4OPZ A;  4GLQ A;  5L10 A;  1XJ2 A;  1BSG A;  1CF0 A;  2QKP A;  2WAE A;  1CEF A;  1PW1 A;  5I5L A;  4JLF A;  3C7U A;  3MJQ A;  2W27 A;  3IX3 A;  1XGI A;  1F98 A;  4BD1 A;  4UHU A;  4RVA A;  3NOU C;  3AGD A;  3JYI A;  4LGW A;  5DTK A;  2Y91 A;  4QY5 A;  3SOI A;  3FPW A;  2PBD P;  2A24 A;  4IVK A;  1F9I A;  3F1N A;  3IS2 B;  1XFN A;  4HES A;  4WEJ A;  3Q1F A;  1TDG A;  2PU2 A;  3OPR A;  4OP8 A;  3IWI A;  3OCL A;  3B3X A;  3SH7 A;  2V20 A;  2XDM A;  5HPF A;  5E43 A;  2Y8H A;  5AVF A;  4DXC A;  3IX8 A;  4GS9 A;  5CGS A;  1SHV A;  5HFO A;  3MR0 A;  1OJG A;  2VZW A;  2J9P A;  2X02 A;  1WYC A;  2ZL1 B;  4GKU A;  5FDS A;  2Y2M A;  1P9W A;  4UAA A;  1YT4 A;  3R7W A;  1JWP A;  3RXW A;  2P9V A;  5F68 A;  1WYB A;  3IF6 A;  5F5Y A;  4S2J A;  4PM6 A;  4PKY G;  3A0V A;  2GDN A;  2JCH A;  2V1A A;  4Y17 A;  1ERO A;  4P6Z M;  4ZJ1 A;  2PYP A;  2JBF A;  4WLA A;  3CAX A;  4OQH A;  4DDS A;  2RCX A;  3EGD C;  3ZG8 B;  3ITA A;  2HP9 A;  5DFY A;  2P74 A;  3UE3 A;  3NY4 A;  1PW8 A;  5KZH A;  3LR4 A;  1V9Z A;  3ZG7 B;  3RTY A;  3EEH A;  4CLC D;  1IYQ A;  3BM6 A;  3BEB A;  4H8R A;  1DP6 A;  1P97 A;  1A0K A;  3WS4 A;  3MFX A;  5HZH A;  3OPP A;  3UPN A;  1STZ A;  4OLD A;  1LSX A;  2DNS A;  2PYR A;  2OWJ A;  3OZH A;  2Y2H A;  4K0X A;  4LCL A;  4JF6 A;  4KG6 A;  4UEY A;  1BLH A;  1FSY A;  5EE8 A;  2V0W A;  1FSW A;  1VB6 A;  2BG1 A;  3E4O A;  3AGF A;  4EET B;  2WGI A;  4X68 A;  3TJZ C;  1TS6 A;  3KSI A;  4MDZ A;  4N9L A;  2Q9N A;  3WRZ A;  3PBO A;  1D1J A;  5J7E A;  1TS0 A;  2M7V A;  5HDD A;  2ZM0 A;  4K91 A;  5AQA A;  2PR5 A;  2UV0 E;  1KVM A;  4UQI M;  5CRF A;  2XR0 A;  2OAP 1;  5FL3 A;  1H0M A;  4Q0J A;  4NXF A;  1G6A A;  3IF6 B;  3LR0 A;  4N1X A;  5CGX A;  2FH5 A;  4I3J A;  4MBH A;  2JKR M;  3IXB A;  1XPB A;  1T1A A;  2GJ3 A;  4Y0O A;  3IHA A;  2OV5 A;  1ZKJ A;  4ZTK A;  3DTI A;  1LT0 A;  4HBU A;  2ZBB A;  3GEC A;  4LRZ E;  4NEE D;  4LFU A;  4EBN A;  5F69 A;  3CWF A;  1MZU A;  2HP5 A;  1ZC2 A;  3IX4 A;  1GA0 A;  1OTI A;  4ZJ2 A;  2VJW A;  2IWC A;  2B5R A;  4LLO B;  4PM8 A;  5IHV A;  3MSH A;  2FZ0 A;  3NI9 A;  1IEL A;  5F83 A;  2PT7 A;  1IYO A;  3Q7Z A;  2KLI A;  1S0W A;  4XUX A;  3FPV A;  4LRY C;  5HD5 A;  1K57 A;  4JKT A;  3JVU A;  1S67 L;  3W4Q A;  3BRM A;  4OLG A;  1PWC A;  1FOF A;  5HSQ A;  1QMF A;  2ZQ9 A;  1K0K A;  4JF4 A;  5DF7 A;  2O0Y A;  3GDI A;  5IT5 A;  3UB8 A;  2OAQ 1;  1I2W A;  3MZD A;  3MXS A;  3IHB A;  1K6S A;  3C30 A;  4PHT A;  4S2M A;  2HDR A;  1TS7 A;  3T4O A;  2A3U A;  2J80 A;  5CTN A;  1F2K A;  5CEB A;  5CGW A;  1N9L A;  3G34 A;  4QY6 A;  3F1N B;  4GDB A;  4R3B A;  2Y2Q A;  1NY0 A;  3P98 A;  1N9B A;  2Y2O A;  1MWU A;  3VFF A;  1XX2 A;  1PIO A;  4HP4 A;  4KQD A;  4LV0 A;  1OTE A;  3EEA A;  3IBR A;  5M1A A;  1KE3 A;  4UA6 A;  1PWD A;  1L0D A;  3E4Q A;  1VET B;  3G35 A;  4QD4 A;  4OOL A;  2QPN A;  2JKR I;  4U3T A;  4WUJ A;  2PD8 A;  4EBP A;  5KSC A;  2JE5 A;  3VP2 A;  2X71 A;  2EFU A;  5LBR A;  4WMC A;  4WYY A;  5FQK A;  4XT2 B;  5FEF A;  1JTD A;  2P9V B;  3H82 A;  5DJU A;  3G31 A;  3LID A;  3UN7 A;  2HF6 A;  4R4S A;  1X0O A;  4NG2 A;  1BUE A;  4GHI A;  4EV4 A;  4ZRR A;  3O5Y A;  4X25 A;  5E2H A;  2K7S A;  1DJA A;  5IU1 A;  3BFF A;  1Q2P A;  4BWI A;  3HLE A;  4EQ1 A;  1OTB A;  3UY6 A;  1MWT A;  4EUZ A;  1LL8 A;  1YSP A;  2K2N A;  5EUA A;  1YKD A;  1MBL A;  4ESP A;  3T4J A;  1MKI A;  4P0M A;  5G4Y A;  2FFF B;  1IYS A;  4LV1 A;  3NOP C;  5A8B A;  5CHJ A;  3LCE A;  2R9W A;  4HQA A;  3IWQ A;  4HIA A;  3S1Y A;  2BAS A;  2J3T C;  1S66 L;  1ZTU A;  5GLC A;  1E25 A;  1H8Y A;  1Z6F A;  4EWF A;  4M3K A;  1IKI A;  1XXM A;  1FIL A;  3FV7 A;  5HD3 A;  3M2J A;  3S4X A;  3TG9 A;  3DWZ A;  1WE4 A;  4E04 A;  1H8M A;  5EM0 A;  3S7O A;  4ETZ A;  2ZQ7 A;  4I3I A;  2ZMF A;  4JF5 A;  3JPU A;  2KOI A;  1ZG6 A;  3Q7V A;  2QJ5 A;  1L3L A;  4U0X A;  1E3U D;  2H0T A;  1LSW A;  5EOO A;  3CUE A;  4KZ8 A;  4IBR A;  3T1R A;  3KYE A;  4PMA A;  4C75 A;  2XRO A;  3FWL A;  4Y0U A;  2EX2 A;  2VGL M;  4IJG A;  1IEM A;  3VP4 A;  4EUV A;  1BTL A;  3T1X A;  2GZA A;  3UDX A;  1G28 A;  3Q82 A;  3F1P B;  5AQ7 A;  2QWS A;  4FOF A;  3FKW A;  3UPO A;  3GSG A;  1WA9 A;  4LPZ A;  1SZV A;  1JWV A;  4HJ4 A;  3MXR A;  1K38 A;  3LI9 A;  5HAR A;  3CPT A;  3V50 A;  2B02 A;  3LR5 A;  2LB5 A;  1XJ4 A;  2ZJ9 A;  1KOU A;  4RYE A;  4X1L A;  1BLP A;  3ISG A;  1W8Y A;  1YLT A;  3QP8 A;  4UA9 A;  4CLC B;  1TVF A;  1UWP X;  4K08 A;  3BEC A;  2VX8 A;  4NK3 A;  3T50 A;  1HVB A;  3C4P A;  4OVD A;  5FI6 A;  4OH0 A;  4E3L A;  2G2W A;  1KGF A;  3WWX A;  4O7D A;  1DRM A;  2PR6 A;  4O8G A;  2ZQC A;  2Z6C A;  3AGE A;  2QJ7 A;  1LL5 A;  4FH4 A;  3OC2 A;  5JYP A;  2KDK A;  3P7N A;  2I9V A;  5M19 A;  4XXR A;  1LI9 A;  4BQM A;  2Y2N A;  5TJJ A;  2WYX A;  1GSX A;  3PBN A;  3KSF A;  3T1S A;  1V9Y A;  4WN5 A;  3GQZ A;  3P01 A;  3K3C A;  5TFQ A;  1P0Z A;  4EU0 A;  2ZQD A;  4OKP A;  5E2E A;  2IWB A;  3ZNT A;  3PYP A;  5TR7 A;  3VOZ A;  5HWT A;  3KSG A;  5I94 A;  4NKP A;  2G2U A;  4CLC C;  4ZDX A;  4DF6 A;  3PXP A;  4G3W A;  1VHM A;  4WL9 A;  3A3D A;  3DBA A;  2HDU A;  4Z1W A;  1QME A;  4KUK A;  2JKG A;  4Y2F A;  5AVE A;  2NUT C;  3LGO A;  5DTT A;  3UB9 A;  3HCY A;  1NWZ A;  5J4E A;  3A0R A;  5AQ9 A;  4DXB A;  2XA7 M;  2W3H A;  1OTA A;  1KDS A;  1DP9 A;  3FYZ A;  3ZHH A;  2WGW A;  4MBF A;  2DRW A;  4C6Y A;  2HJE A;  1AXB A;  5M18 A;  5FQ9 A;  3T4S A;  3T4L A;  4GJ4 A;  5GHY A;  2WAD A;  2CMN A;  5CER A;  4L9E A;  1U60 A;  4YWZ A;  3LIA A;  4F3L A;  1O7E A;  4HY8 A;  4Q0I A;  4E3J A;  5TBM B;  1KGE A;  1J9M A;  5DKK A;  5G4Z A;  1S4R A;  2INW A;  4WZ4 A;  5CXW A;  4OOY A;  1K4E A;  5EFW A;  5CTM A;  3NHQ A;  4DJ2 A;  4A5R A;  1J3W A;  4N92 A;  4DRT A;  3N4I A;  1YLZ A;  2XQZ A;  2ZMV A;  3QP2 A;  4GB7 A;  1IOU A;  1H8Z A;  2V8F A;  3U2A A;  2Y2G A;  2B95 A;  1W5D A;  1NLZ A;  4MNR A;  4KG2 A;  4PPR A;  1FCN A;  4S2I A;  3VSL A;  2R78 A;  1K4F A;  3N6I A;  1C3B A;  2EFX A;  4PM5 A;  1KDW A;  4JGR A;  3HRE A;  1FIK A;  1S6R A;  5FAP A;  3BLS A;  4N9K A;  2VV6 A;  1YLW A;  2ZM8 A;  5HWW A;  2HZ5 A;  1XA1 A;  1IKG A;  4HBT A;  4B88 A;  1TF1 A;  2OOL A;  3E98 A;  2WK0 A;  3PBT A;  4KZA A;  4H6J B;  3CJM A;  2H10 A;  2C5W B;  4R4R A;  5EVI A;  5A90 A;  1L0G A;  3BFG A;  2HV1 A;  4HHD A;  3ULF A;  3CG5 A;  3LIE A;  2P08 A;  4MBK A;  3MZE A;  2WUQ A;  5KMW A;  2WZZ A;  4WM9 A;  4DMZ A;  1GHI A;  3W4O A;  4QU3 A;  1K57 C;  3LIF A;  3IF5 A;  5MC7 A;  2J7V A;  1H3Q A;  3HUO A;  4IUK A;  4RQ9 A;  5G18 A;  2J8Y A;  4FH2 A;  4G3K A;  4QHC A;  1K56 A;  4LEN A;  3SZT A;  2RL3 A;  2IA2 A;  2WZX A;  4OQI A;  1YMX A;  4WMC D;  2V2F F;  5A93 A;  3NC8 A;  4DN0 A;  2FFY A;  1FR1 A;  2OSU A;  2XA7 S;  4Y3I A;  3EOI A;  3S7P A;  4S2N C;  2ACG A;  4WF0 A;  3IT9 A;  5EM1 A;  4CLC A;  1PI5 A;  3LY3 A;  4I38 A;  4F3L B;  1M6K A;  5FQQ A;  2B18 A;  2D01 A;  4YFM A;  2Y2K A;  2BLS A;  5EVE A;  3M2K A;  3CPT B;  3LY4 A;  1P9R A;  4Q8I A;  4MCW A;  3MFD A;  4IUH A;  2XFS A;  2Z2M B;  3HUM A;  2X01 A;  5DFX A;  3HLB A;  1MWS A;  2XLN A;  5DF9 A;  3VE4 A;  4GW9 A;  3FC7 A;  3WRT A;  1NXY A;  2NUP C;  4LRX C;  4XT2 A;  4PKY A;  1YPR A;  2PHY A;  2HJ9 C;  3H7W A;  3NIA A;  4UQI S;  5KIZ A;  1BUL A;  5C5K A;  3GR2 A;  4JBF A;  2YKH A;  4MMN A;  3QNB A;  4KZB A;  1FCO A;  4FUW A;  3DWK A;  5HAP A;  3PR6 A;  3LI8 A;  5CED A;  3Q7V B;  2Y2J A;  2L0W A;  1OPX A;  3QNC A;  2W3D A;  1DJB A;  1PYY A;  1Y54 A;  2W1T B;  4WEL A;  1ES4 A;  3FKV A;  3OBF A;  2PU4 A;  4X6T A;  2V0U A;  2PD7 A;  2JHE A;  2W1R A;  2VEA A;  1CEG A;  3IQA A;  3N8L A;  4BEN A;  2XRN A;  1VQQ A;  4KQO A;  1L0F A;  1YM1 A;  4YOF A;  3V3S A;  1HD8 A;  4IED A;  4R23 A;  4CJN A;  2GX5 A;  4S2O A;  2ZD8 A;  3GTC A;  1MPL A;  3MMH A;  1LHY A;  2ZOI A;  2P7J A;  5J8X A;  1T1C A;  4M4X A;  4N1H A;  5CHM A;  3KO6 A;  3VP1 A;  3S7Q A;  4S2K A;  4HP9 A;  5HW3 A;  1E3U A;  4MLL A;  1L0E A;  5HPI A;  1KE4 A;  4GZB A;  3T4T A;  2H0Y A;  4JXG A;  3Q07 A;  1SKO B;  4L9F A;  1CQA A;  2XH9 A;  4HOI A;  5L07 A;  3BLM A;  4FD8 A;  3IH9 A;  1I5Q A;  2VV8 A;  3C38 A;  3L7H A;  5HL6 A;  2Y59 A;  2HDQ A;  3H9W A;  3WS1 A;  4KZ4 A;  1PFL A;  3C8C A;  3E0Y A;  2ZC5 B;  3G4P A;  5HX9 A;  2WAF A;  1XFQ A;  1ZHH B;  3VFH A;  1BLC A;  1NZU A;  1DJC A;  1DP8 A;  2VGK A;  2WKP A;  4KZ3 A;  2HDS A;  3ZG9 B;  2OLV A;  2J9O A;  5K5B A;  1T1B A;  1MC0 A;  4GN2 A;  3G32 A;  3MBZ A;  5F1G A;  5GHX A;  2EWW A;  5EOE A;  4YIN A;  3SS4 A;  3PAE A;  5L09 A;  4I39 A;  3UB7 A;  3MQ0 A;  4Z9Q A;  5TBM A;  2JN7 A;  2ZQ8 A;  4Y15 A;  2ZQA A;  1GSV A;  5FI2 A;  1ES3 A;  4YNR A;  3VSK A;  3ZVW A;  1GHP A;  3N7W A;  1G5U A;  3O88 A;  3A0S A;  4O0P A;  4EW7 A;  5GLA A;  3V39 A;  1EW0 A;  3HLF A;  1ERQ A;  3O86 A;  1N9O A;  4RA7 A;  3PHY A;  3V3R A;  2XD5 A;  2Y2L A;  3H82 B;  1L2S A;  3M6H A;  3ZVT A;  4ETX A;  3MS6 A;  3EGX C;  1UWN X;  3E2K A;  5HWV A;  2ZC4 B;  1TD5 A;  3HLW A;  2G7U A;  4Y13 A;  4JGP A;  2J3W A;  3L9K A;  4MN7 A;  1K55 A;  4UA7 A;  3IXG A;  2E8J A;  3D4F A;  1ODV A;  4Y5F A;  1W63 M;  3BFC A;  5FAS A;  3C7V A;  4Y7P A;  4KUO A;  1ALQ A;  3ZGA B;  4E6X A;  3NDG A;  4GHI B;  4S2N A;  4BBT A;  2A49 A;  4EXO A;  1Q2Q A;  4G3V A;  4EBL A;  3CHW P;  5AQB A;  3F1P A;  3GVB A;  2WGV A;  2XEP A;  3S22 A;  4GOG A;  2VGJ A;  5GLD A;  3CIT A;  1YLP A;  1YQS A;  3ZFZ A;  2EX8 A;  3TW8 A;  1ESI A;  1LSV A;  3IF6 C;  1GCE A;  3C2W A;  4D60 A;  3H7W B;  3VV4 A;  3TSG A;  1JWZ A;  5JYO A;  2EA9 A;  4XUZ A;  5EV0 A;  3NEC A;  3V67 A;  3N8R A;  1Y28 A;  1TS8 A;  2UWX A;  1PZO A;  4IBX A;  5CX7 A;  1OT9 A;  1LI0 A;  4KZ9 A;  3LEZ A;  3IH8 A;  1OME A;  5EVI C;  4E3K A;  4X55 A;  2HPB A;  3O87 A;  4OON A;  1ES5 A;  1YLY A;  3OOV A;  2PDR A;  2V1Z A;  3MF0 A;  5DTS A;  5BOH A;  3BYD A;  1K55 C;  3GV9 A;  1G6O A;  3QHY A;  3BWL A;  2XGN A;  3F1O A;  3ZQ5 A;  2O9C A;  4EEP A;  1Y4O A;  3Q81 A;  2V9A A;  1K54 A;  2XSS A;  2W3E A;  1PRQ A;  3WS0 A;  2KX6 A;  2QHK A;  5GHZ A;  3SS3 A;  4BJP A;  4EEU A;  4GD6 A;  1RGY A;  3HJI A;  1GHM A;  3A3F A;  3KYQ A;  4X69 A;  4EQI A;  4ME4 A;  3EQU A;  3WS2 A;  3CI6 A;  5FEG A;  1FQG A;  4DE3 A;  3DAV A;  5J3W A;  2EXA A;  4IVI A;  1ZG4 A;  1W63 Q;  3P09 A;  1N4O A;  1SKO A;  3W8K A;  3T12 B;  2D02 A;  4DJ3 A;  1H5X A;  1CI8 A;  2O9B A;  2Z6D A;  3O3V A;  1G68 A;  3K2N A;  4CQH A;  1S1Z A;  4JXV A;  2Y2I A;  3RH8 B;  1KVL A;  4F94 A;  2EX9 A;  3PAG A;  4HJ3 A;  1FR6 A;  5AJG A;  4O01 A;  2ZMA A;  3F1O B;  2CC1 A;  4LV3 A;  1SKF A;  1JNU A;  3R7W B;  3BQ8 A;  1F5M A;  3SH9 A;  4DE0 A;  4B9O A;  3C4O A;  3IWO A;  1RCJ A;  4ZAM A;  2ZOH A;  1K54 C;  4JXS A;  5DVA A;  3NBL A;  1MY8 A;  1MKM A;  3LIB A;  3M6B A;  4ZBE A;  4K0W A;  3C5A A;  4GNU A;  1GA9 A;  3QP6 A;  3LEQ A;  1YAX A;  2A24 B;  4IHQ A;  2Y55 A;  4HI4 A;  4QPR A;  3BJN A;  1NYM A;  3MQQ A;  4GS9 B;  4I3A A;  5HAQ A;  4LV2 A;  4E6W A;  3ZDJ A;  1HLU P;  3NUL A;  1OJ5 A;  5HDC A;  4DE1 A;  5FDH A;  1M40 A;  3VMA A;  3RXX A;  3BY9 A;  5FAO A;  1W79 A;  4BMW A;  3DTE A;  5HL1 A;  5A91 A;  3SW1 A;  2XK1 A;  4DKI A;  1VEU B;  3DTK A;  1JVJ A;  4DDY A;  4B4X A;  2PAV P;  1W8Q A;  2Q0O A;  2O99 A;  2WGW B;  3NJA A;  3PBQ A;  3UE1 A;  5FQI A;  1OT6 A;  4JXW A;  1NLY A;  4R0Q A;  2V8C A;  5FAQ A;  3HUN A;  2O9A A;  2EX6 A;  3IBJ A;  1Z09 A;  3MZF A;  3BFE A;  1BYW A;  3VOY A;  3HLD A;  2WKI A;  4CPK A;  2V1B A;  3OCN A;  1T19 A;  1D06 A;  5GL9 A;  2J3T D;  1VM1 A;  2VKS A;  2ZLY A;  3DTM A;  4JPM A;  1S1Y A;  5L2F A; 
#chains in the Genus database with same CATH homology
 1K0K A;  1CQA A;  1A0K A;  3T1R A;  5EVE A;  3KYE A;  2JKG A;  3MS6 A;  2ZL1 A;  1Y4O A;  1SZV A;  3CPT B;  1AWI A;  1Z09 A;  5EM0 A;  1FIK A;  1VEU B;  1D1J A;  2PBD P;  1YPR A;  1PNE A;  3T1Q B;  3LEQ A;  3UB5 P;  2BTF P;  3MSH A;  1VET B;  2V8F A;  1CF0 A;  5FEG A;  2PRF A;  3L9K A;  2ACG A;  2ZL1 B;  2HZ5 A;  4QWO A;  3L7H A;  3LGO A;  1CJF A;  2B95 A;  1VET A;  1PRQ A;  1VEU A;  3CPT A;  2PAV P;  3DAV A;  4FTX A;  5EM1 A;  5FDS A;  4D60 A;  4ESP A;  5FEF A;  3CHW P;  4X1L A;  4X25 A;  1HLU P;  2JKF A;  3NUL A;  3T1X A;  2VK3 A;  1FIL A;  2E8J A;  1SKO A;  1J3W A;  1PFL A;  3U4L P;  1ACF A;  3T12 B;  5EV0 A;  4FUW A;  4X1M A;  3NEC A;  3D9Y A;  3T1S A;  2V8C A;  1F2K A;  1SKO B;  1G5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...