4OPQA

Room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutations
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
258
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 258
sequence length 263
ec nomenclature
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4opqA00
1ERQA 4K91A 1K56D 4OOLA 2XGNA 3FWLA 3O3VA 5F82A 3I7JA 4X69A 3DWKA 3PAGA 4BQMA 2Y2HA 1IKGA 2EX2A 5CGXA 3ZFZA 3SS4A 4MLLA 5HAPA 3DWZA 2EX8A 2WK0A 5HAIA 4JXGA 4OLGA 4N9KA 3V3SA 5L2FA 1WE4A 4OPRA 5EVIC 4OPZA 1K55A 4FH2A 3BEBA 4KG6A 5EOEA 1LHYA 3OPRA 4IVIA 4S2PA 2EXAA 3IXGA 3HLEA 2FFFB 4S2KA 4WZ5A 4XUXA 1K56A 5U47A 3WS1A 3SH7A 1OMEA 3LY4A 4EWFA 4KZAA 3ZG7B 2X02A 1VM1A 1MWUA 3CMZA 1CEGA 4KZ4A 4B4XA 2R9WA 5E2EA 3G4PA 4DRTA 2XFSA 2OLUA 2XEPA 2J8YA 4GD8A 1JWZA 2XH9A 5AQBA 2ZQAA 5KSCA 3HLWA 5FAPA 1K6RA 1NZUA 1HVBA 2BG1A 4RX3A 4NETA 4S2IA 3BLMA 1W7FA 2Y2KA 5HAQA 1WYCA 4E3OA 1M6KA 2ZQ9A 4YINA 1NXYA 3SH8A 5CEDA 5GLDA 5KZHA 1Y54A 1K54C 2VGJA 1ES5A 2WADA 2Y2PA 2WGIA 3P09A 2ZQDA 4WEJA 3RXXA 3M2JA 1W79A 4OP8A 3UPPA 3IH8A 1I5QA 3GR2A 3O88A 3ZNYA 4JXVA 4ZTKA 1SCWA 1GHPA 3TSGA 4ZJ3A 2WGWB 1JTDA 1E25A 4S2LA 1YMXA 3W8KA 1YLJA 3UPNA 1HTZA 1S6RA 5M19A 3ZNTA 1QMEA 4JPMA 1JVJA 4Z9QA 5EVID 1Q2PA 3W4PA 1SDNA 2IWBA 4JXWA 5FDHA 4LV1A 4KZ7A 5EVLA 4KZ3A 5TFQA 5FSRA 2HP6A 3OPHA 5EECA 1KVMA 4QHCA 1IYSA 1ZKJA 1YLPA 4EBLA 2Q9MA 4R3JA 3NY4A 1BTLA 5FQKA 1W8QA 4HESA 1N9BA 1NYYA 3LY3A 2V20A 4BL2A 4GDBA 2CC1A 3UE1A 3UY6A 1DJBA 3LEZA 3BFFA 3VP3A 5EVIA 1CEFA 4P85A 3OCLA 5F1GA 1QMFA 3SH9A 4JBFA 2I72A 5FAOA 2Y2QA 3FV7A 1NRFA 1MY8A 2ZLYA 2IWCA 1EI5A 3LCEA 4MBKA 4PM5A 1BLSA 2PBYA 2J9PA 1PW1A 4N1HA 5FI2A 1MXOA 5A93A 2HP9A 4QY5A 3HLBA 4ZBEA 5EVIB 4KZ5A 3OZHA 2A3UA 3VOYA 1ERMA 1FOFA 3CZDA 2PU4A 5D3OA 1DY6A 4ZAMA 3A3IA 3PAEA 5DVAA 3WS4A 1S0WA 4NK3A 3DW0A 2RL3A 1DJCA 3NDGA 1O7EA 3O87A 2HDSA 3P98A 4OPYA 4EQIA 4E6XA 3WS2A 4QU3A 3UDXA 1J9MA 5CXWA 2EX6A 3ZHHA 4R0QA 4R4SA 3UO9A 4OLDA 2WAEA 5KSHA 1YLYA 3FKVA 4FD8A 5DTKA 4S2JA 3ZDJA 1PIOA 3D4FA 4D2OA 1XX2A 3PBNA 2RCXA 5EUAA 1K57A 1K38A 1E3UA 4U3TA 2ZJ9A 1CI8A 3MZFA 1XGJA 2Y59A 4WMCA 1RGZA 1LI9A 3OPPA 4DXCA 4RX2A 1XGIA 2WAFA 5A90A 3V5MA 4KQRA 5J8XA 4PMAA 5DTSA 1NYMA 4K0XA 3PBQA 4C75A 2UWXA 1K4EA 3C7VA 4X6TA 2Y2NA 2X01A 1IEMA 2H0YA 2JCHA 4KZ6A 4EV4A 4E6WA 3G30A 3ZG9B 1FR6A 1KE4A 5FI6A 4PM9A 1FSYA 1FCOA 2J9OA 4JF4A 5JYPA 3Q07A 2Y2LA 3VSKA 4R23A 1ALQA 4LCMA 4EBPA 2V2FF 4FH4A 1MBLA 3G35A 3MBZA 4PM7A 4O7DA 1KDSA 4Y0TA 3VFFA 1JWPA 2XD5A 3GRJA 3NIAA 1LLBA 1PI4A 2DNSA 3GMWA 2WGWA 3C4PA 3CG5A 4RYEA 1TDLA 2WKEA 1ES4A 3WS5A 4IBRA 3ZCZA 1MWRA 4LV2A 2ZC3B 1GA9A 4GD6A 4S2MA 1GHIA 3BFEA 3OPLA 2ZQ7A 2P74A 3IT9A 5CGSA 3HLGA 3V39A 1KE0A 5CTNA 2Y2JA 5CHUA 3VMAA 4DDSA 4HBUA 2G2UA 2HDRA 3IF6C 1IYQA 3C5AA 1SDEA 5GHYA 1ES2A 4OH0A 3G2YA 1HZOA 1L0GA 3RJUA 2G2WA 4K0WA 5DTTA 4MEZA 3S4XA 3ZG8B 1IYPA 2ZD8A 5AQAA 1IYOA 1W5DA 4F94A 3WS0A 5BOHA 1Z6FA 1C3BA 1JTGA 3AGEA 1LL9A 3CJMA 1WYBA 4OQIA 3WWXA 3G32A 2E8IA 1ES3A 2QPNA 3UDIA 2Y91A 1SHVA 3IF5A 1I2WA 2ZM0A 3MZDA 1G6AA 4OOMA 2EXBA 5EOOA 4BD0A 4E3NA 1L0FA 5M1AA 3OCNA 1ZG4A 4OP5A 4A5RA 1XA7A 3QHYA 4BD1A 5FQIA 1MWSA 3VOZA 4DE0A 2EFXA 1BLCA 3ITBA 4LV3A 4JF5A 4OONA 5HFOA 3Q7VA 1NZOA 2ZC7A 4ZJ2A 2ZMAA 5E43A 3HUNA 4OPQA 5AQ7A 4CPKA 5CERA 1PZPA 3N8SA 2HPBA 4UAAA 3IXHA 5FI7A 1YLZA 1XA1A 1L2SA 4IBXA 2HP5A 4E3LA 3QNCA 2WUQA 4KG5A 4DF6A 1PWDA 2JC7A 4DKIA 4DXBA 3N8RA 4X68A 5E2HA 4WZ4A 1EWZA 1K55C 2OSUA 2H10A 1JWVA 3Q7VB 4JF6A 4UA6A 1IELA 2IWDA 2PU2A 3Q81A 2WKHA 1BLHA 2Y2GA 4S2NC 4B88A 3IWQA 2XR0A 3C4OA 3G31A 4ID4A 3S1YA 1PWCA 2Y2OA 1TDGA 1VQQA 5GLCA 3UE3A 3DTMA 1MPLA 3VP4A 3IH9A 4KZBA 3MKFA 3G2ZA 4GN2A 4JXSA 1K54A 2XQZA 4KZ8A 5DF8A 3IHBA 4GZBA 2XK1A 3BFDA 5EE8A 1MWTA 3QNBA 4QB8A 4LCLA 1H8YA 2Z2MB 4BLMA 5JYOA 3IQAA 4GDNA 4WM9A 1I2SA 1CK3A 3C7UA 1HD8A 1L0EA 1PI5A 3PBOA 4BJPA 5CECA 2X71A 4GOGA 5FA7A 3LO7A 5A92A 4MBFA 4EBNA 1KVLA 1H8ZA 2V1ZA 3G34A 3M2KA 3IXDA 1Q2QA 3IF6B 4MNRA 4R4RA 4OQGA 4RA7A 5GLBA 3EQVA 3BECA 5IHVA 3O86A 3ZVTA 4H8RA 5FQQA 3VSLA 3N6IA 3N4IA 1PW8A 1YLWA 4R3BA 1KGFA 4E3IA 5HL1A 4Q8IA 2B5RA 1ZC2A 3GTCA 1YM1A 3FKWA 4PPRA 4N9LA 3EQUA 5TGFA 3WRTA 1NJ4A 4RVAA 4WEKA 2WGVA 5CHJA 1GCEA 2ZQ8A 3BM6A 1PYYA 3E2KA 3ISGA 1NY0A 4KENB 1LI0A 3M6HA 1KGEA 1K25A 2DRWA 4QD4A 2ZC5B 2Y2MA 2JE5A 4P0MA 3SS3A 3BYDA 3IXBA 5FQJA 4KQQA 3NDEA 1RCJA 4XXRA 4Y0UA 3TOIA 2OV5A 2EX9A 5CGWA 1BULA 3S22A 5EPHA 2ZC4B 4IVKA 5GLAA 3JYIA 1GHMA 1DJAA 1KE3A 2QMIA 2XDMA 3GQZA 2EFUA 3OC2A 3GVBA 4S2NA 2BLSA 4HBTA 1FCNA 1ESUA 1ZG6A 3HBRA 3UE0A 3ZGAB 3V50A 2QZ6A 2WZZA 1PWGA 1BLPA 5FQMA 5CRFA 4LV0A 3HUMA 4WBGA 3E2LA 4ZDXA 4OKPA 3MFDA 1RP5A 3WRZA 1FCMA 4UA9A 2OLVA 4X55A 3TG9A 2ZM8A 4JLFA 4DE2A 2WKIA 3N7WA 4XUZA 5CTMA 3FZCA 1ESIA 5HW3A 1U60A 4Y0OA 4GNUA 5GHZA 5E2FA 3UDFA 1BUEA 2H0TA 3SS5A 4DE1A 3BFCA 4P6BA 4BL3A 1BZAA 5E2GA 1XPBA 5M18A 2A49A 3NC8A 1YMSA 2Q9NA 4GKUA 5FAQA 1AXBA 4M3KA 3GV9A 1L0DA 4X56A 5CHMA 3NCKA 4BENA 1K57C 2DCFA 4CJNA 4PM6A 4E3KA 5CEBA 4WELA 4DE3A 4U0XA 2ZQCA 3SOIA 2Z2LB 4EUZA 2JBFA 4FSFA 5DF7A 3PBRA 5FATA 3HVFA 1ONGA 1M40A 3NI9A 2C6WB 3RXWA 4E3JA 3W4QA 3HLCA 4OQ0A 3IHAA 2ZM2A 4WYYA 5I94A 1XP4A 3ZG0A 1TEMA 5AQ9A 5FQ9A 4FCFA 1PZOA 3ZG5A 4R1GA 1IKIA 5GHXA 3UPOA 3BLSA 3IWOA 3VP0A 2FFYA 1W8YA 4QY6A 1KDWA 2XLNA 3IWIA 2VGKA 1XXMA 3PBSA 1XKZA 3N8LA 3B3XA 3PBTA 2XFTA 3Q1FA 4C3QA 4N92A 4WZ5C 3HLDA 1TVFA 5G18A 3VP1A 1FR1A 4MBHA 1YLTA 1SKFA 1EROA 1FQGA 1RGYA 1BT5A 2WYXA 3A3EA 3HL9A 5GL9A 2Y2IA 3W4OA 4YFMA 2XF3A 3FYZA 3HLFA 4L0LA 1O07A 3A3JA 4IEDA 4S2OA 3UN7A 1N4OA 3ZVWA 4KZ9A 3BFGA 3A3FA 3M6BA 4OOYA 3IF6A 3Q82A 3AGFA 4KQOA 3NBLA 5HX9A 2J7VA 1FSWA 4C6YA 1LL5A 3ITAA 2Y4AA 4X53A 1BSGA 1ONHA 3MXSA 3UNWA 5KMWA 4OVDA 1E3UD 5F1FA 1YQSA 3GSGA 1MKIA 4ZJ1A 5A91A 3MZEA 1E4DA 5TR7A 2C5WB 3A3DA 4WMCD 2H5SA 5FASA 5HARA 2P9VA 1CI9A 1G68A 4B4ZA 3MKEA 1K4FA 4HEFA 4N1XA 3PTEA 3VP2A 4QJGA 2GDNA 4P87A 4U0TA 3V3RA 1KGGA 1YT4A 4KG2A 4UA7A 3HREA 2XD1A 2HDQA 1K6SA 2WZXA 3MXRA 2HDUA 1H5XA 1GA0A 3AGDA 4DDYA 4OQHA 2Y55A 2ZC6B 3BRMA 4LENA 4PM8A 2R9XA 5DF9A 4GB7A 5F83A 3Q7ZA 4E3MA 4UHUA 3VFHA 3HUOA 4Y7PA 4JKTA 2P9VB
chains in the Genus database with same CATH superfamily
1ERQA 4OOLA 2XGNA 2JKTM 3I7JA 3DWKA 3ZFZA 5G4YA 5L09A 4JXGA 2QJ5A 4WN5A 2ACGA 3V3SA 2AVXA 1LHYA 3OPRA 2EXAA 5HWTA 2FFFB 5LBRA 3SH7A 1P9RA 1T19A 2Z6CA 3ZG7B 3FG8A 1N9LA 1MWUA 3CMZA 4KZ4A 2R9WA 4DRTA 2OLUA 3HCYA 2XEPA 2XH9A 1UWPX 4RX3A 4BBUA 3S7QA 3BLMA 5HD5A 2VGJA 2WGIA 3M2JA 3O88A 2K7SA 1GHPA 3C38A 1YMXA 2V0WA 3B33A 3ZNTA 1JVJA 3W2ZA 3W4PA 1SDNA 1IOUA 3BQAA 5FSRA 4IUKA 1ZKJA 1P97A 2Q9MA 3GECA 4R3JA 3NY4A 1LT0A 1N9BA 3LY3A 4GDBA 1DJBA 1TD5A 3JVUA 3OCLA 4B9OA 4JBFA 3LIAA 3FV7A 2JN7A 1MY8A 2IWCA 4JGRA 2J9PA 5A93A 3HLBA 2A3UA 1FOFA 3CZDA 1DY6A 4ZAMA 3NHQA 5DVAA 1DP9A 1S0WA 4RQ9A 1G5UA 2HDSA 4QU3A 1NRJA 1J9MA 4R0QA 2A24A 4OLDA 2NUTC 1YLYA 3FKVA 5DTKA 3JPUA 4S2JA 1F98A 1XX2A 2RCXA 1K57A 4BWIA 1E3UA 4EERA 2YKHA 3MZFA 1XGJA 2Y59A 4EETB 5A90A 2A24B 1YAXA 4KQRA 3DTIA 5J8XA 4C75A 3C7VA 1J3WA 2H0YA 5CX7A 4EV4A 3MFXA 2V1BA 1FR6A 1KE4A 1G6OA 1FCOA 3KSFA 1W63Q 4LCMA 1CF0A 1PI4A 2DNSA 3T4SA 2WKEA 1MWRA 4S2MA 1KE0A 5CHUA 4DDSA 2HDRA 4M4XA 3RH8B 3C5AA 4CLCD 2GJ3A 3KSHA 3RJUA 2G2WA 1T18A 3S4XA 2B95A 1Y4OA 2HJEA 3D3OA 1W5DA 5BOHA 1IFQA 1EW0A 1WYBA 3WWXA 3G32A 1ES3A 2J3TC 1SHVA 3BWLA 4BD0A 4E3NA 3OOVA 4OP5A 1L3LA 4DE0A 4LV3A 4ZJ2A 2HGVA 3Q7VA 4GLQA 4OPQA 1H0MA 3LR5A 5F5YA 3H9WA 4D60A 1XA1A 5HDDA 3QNCA 4NXGA 1S1YA 1EWZA 3MQ0A 1JWVA 3Q7VB 2KLIA 4EEPA 4I3AA 1DRMA 2IWDA 1NLYA 2ZL1A 3TE8A 3S1YA 3C4OA 1TDGA 3UE3A 5J3WA 2G7UA 4GW9A 2XQZA 3LYXA 4KZ8A 4GZBA 1MKMA 2J3WA 4I3JA 3HJKA 5FDSA 4YWZA 5AVFA 4WM9A 5CECA 4EBNA 2QYBA 1KVLA 2V1ZA 2KOIA 4GHIA 2V8FA 3EEHA 4Y17A 2HF6A 5IHVA 4H8RA 5HDCA 5FQQA 1PW8A 4R3BA 4E3IA 4Q8IA 3T1XA 3GTCA 4NXEA 4PPRA 2B18A 3T1SA 1LSWA 1NJ4A 2JKTI 2WGVA 3T4OA 3BM6A 1TS8A 2DRWA 3NDEA 2OV5A 1BULA 5I5LA 3JYIA 3H82A 2EFUA 5HPIA 1OT6A 1FCNA 3UE0A 2JKFA 3V50A 2M7VA 5HSQA 1T1CA 4G3KA 5FQMA 4LV0A 1FCMA 4JGPA 3H82B 2WKIA 2WKRA 3GDIA 2QWSA 1Z09A 1XJ3A 5E2FA 1BUEA 5M18A 1YMSA 1AXBA 1L0DA 3KX0X 3KYEA 4X56A 5CHMA 3NCKA 3T50A 4KUOA 1K57C 3QP1A 4MN7A 3SOIA 2Z2LB 2VZWA 2JBFA 3NJAA 2PYRA 2V8CA 3RXWA 2JKGA 1ZTUA 3IHAA 4I5SA 4ETZA 4FCFA 4UQIS 1PZOA 1P0ZA 3UMEA 5GHXA 3VP0A 1KDWA 3IWIA 3MJQA 2VGKA 1XXMA 3Q1FA 4C3QA 1FR1A 4GCZA 1RGYA 2Y8HA 2Y2IA 4YFMA 4IEDA 3E4QA 2PD7A 5HWVA 3M6BA 3A0SA 2XRNA 5HX9A 2J7VA 2VJWA 3ITAA 2Y4AA 4X53A 1ONHA 3UNWA 4ZJ1A 2FH5A 3MZEA 3PYPA 2VX8A 4WMCD 3NOTC 4HH3A 3U2AA 3T4LA 5HARA 4LLOB 4N1XA 3PTEA 2EWWA 4PKYG 1V9ZA 4KG2A 3HREA 2XD1A 4R70A 3MXRA 1S4SA 2HDUA 2VV8A 4DDYA 3BRMA 4LENA 1SKOB 4E3MA 3D72A 2JKRM 4Q0JA 4K91A 4X69A 3PAGA 4ZRRA 1IKGA 3SS4A 4MLLA 2WK0A 5HAIA 2NUPC 4KG6A 4ETXA 4IVIA 3BY9A 1MC0A 3IXGA 3HLEA 4S2KA 3LEQA 1NWZA 3LY4A 4KZAA 2X02A 1VM1A 3UB9A 2L0WA 3G4PA 4R6LA 2J8YA 4DN0A 5AQBA 2ZQAA 3HLWA 5FEFA 1NZUA 1HVBA 4E3OA 3ZYTA 5GLDA 1Y54A 3P09A 3ZNYA 1I5QA 5DFXA 4ZJ3A 2WGWB 4S2LA 3LI9A 3W8KA 3D9YA 2W3EA 4GS9A 1HTZA 3B42A 1S6RA 4Z9QA 5EVID 4JXWA 4LV1A 4KZ7A 1V9YA 4KZ3A 5TFQA 1OJGA 1S66L 1IYSA 1YLPA 4EBLA 3QP5A 1PFLA 4GS9B 2V20A 3KYZA 3UY6A 4P6ZS 3LEZA 3BFFA 3VP3A 5EVIA 4WL9A 4P85A 3MR0A 5F1GA 5FAOA 3R7WA 2Y2QA 3TRCA 2ZLYA 2B02A 3VE4A 2O9AA 4PM5A 5DFYA 4N1HA 1MXOA 2HP9A 4QY5A 4ZBEA 3CWFA 5EVIB 3OZHA 3S7PA 3U4LP 2YKFA 2PU4A 4MCWA 5D3OA 3R7WB 5IU1A 3PAEA 4NK3A 4EUVA 1DJCA 2PR5A 3WS2A 4R4SA 3UO9A 3RTYA 3LIDA 3ZDJA 4LRZE 1VETA 4U3TA 2ZJ9A 1CI8A 3LIBA 1OJ5A 2PBDP 1RGZA 1LI9A 2WAFA 4JGQA 4DMZA 4PMAA 2INWA 4K0XA 3PBQA 4X6TA 5IT5A 1VETB 4WUJA 4EU0A 2GNXA 3F1PB 3SZTA 2J9OA 4JF4A 2ZMFA 4R23A 4EBPA 5EM0A 2VGLS 4CLCE 3NECA 3G35A 4PM7A 4EW7A 3NIAA 3GMWA 3C4PA 3CG5A 1TDLA 1ZHHB 2ZC3B 4GD6A 3BFEA 2ZQ7A 5CGSA 3V39A 2Y2JA 2G2UA 5GHYA 1SDEA 4OH0A 3G2YA 5DTTA 4F94A 4LRXC 1C3BA 4KQDA 1LL9A 4OQIA 1OTEA 2E8IA 1D06A 2Y91A 2EWVA 3CUEA 5M1AA 4A5RA 4Q0HA 1MWSA 3ITBA 1N9NA 4JF5A 2ZMAA 5KIZA 5AQ7A 3UMDA 1YKDA 5CERA 1PZPA 3EOIA 2HPBA 3IXHA 4IBXA 4HJ3A 2HP5A 4EESA 4KG5A 4DKIA 2JC7A 3LR3A 3N8RA 3DTKA 3E98A 2H10A 5EM1A 3EGDC 4O8GA 3IX3A 1IELA 3KSIA 3IS2A 3MS6A 1ODVA 4B88A 4HHDA 3IWQA 2XR0A 3G31A 3CI6A 4BBTA 5GLCA 3DTMA 3VP4A 5FEGA 5F68A 1HLUP 4JXSA 1OTDA 2XK1A 3QP4A 4HJ4A 3QNBA 3IS2B 4LCLA 4GDNA 2W1TA 4HIAA 5A92A 4MBFA 3IF6B 4R4RA 3IBRA 4OQGA 4H6JA 5GLBA 3BECA 1F5MA 3VSLA 3N6IA 3N4IA 2W1TB 3OLOA 1KGFA 2B5RA 1F9IA 3FKWA 4N9LA 4X25A 2JKRI 3EQUA 4R38A 3PXPA 3WRTA 4O01A 4H6JB 2JHEA 1PYYA 5IS1A 1DP8A 4KENB 2OAP1 4QPRA 1VHMA 2Y2MA 3IX8A 1XFQA 3NULA 5CGWA 3S22A 4IVKA 1GHMA 1DJAA 2QMIA 4S2NA 2XDMA 3GQZA 3MQOA 2BLSA 3UB5P 1UWNX 1XJ4A 4NXFA 1D1JA 2HJ9C 4OKPA 3MFDA 5L10A 4UA9A 4X55A 2P04A 2ZM8A 4JLFA 3N7WA 4XUZA 3FZCA 1ESIA 3UDFA 2H0TA 4P6BA 1BZAA 1XPBA 4GKUA 2VLGA 3GV9A 4CLCA 2H28A 1XJ6A 4CJNA 2DCFA 2E8JA 4DE3A 4Y13A 2ZQCA 4EUZA 5DF7A 4ESPA 2KX6A 3C8CA 1ONGA 4NKPA 1M40A 2C6WB 4E3JA 3HLCA 4CLCB 4OQ0A 4WYYA 4X1MA 3ZG0A 5AQ9A 3LIEA 4R1GA 2FFYA 1W8YA 3FPVA 5L8MA 4HP4A 1CJFA 3PBSA 3B3XA 3PBTA 4N92A 3HLDA 4MBHA 1JNUA 1TF1A 1EROA 2WYXA 3HL9A 1BT5A 3MQQA 3ULFA 2XF3A 3FYZA 4L0LA 5HDSA 1O07A 2QHKA 2Z6DA 1OTIA 3C2WA 2PD8A 3AGFA 3H7WB 4KQOA 1S4RA 5K5BA 3MXSA 4OVDA 1YQSA 4EQ1A 5A91A 3DBAA 2C5WB 3A3DA 2H5SA 1YSQA 2GX5A 4HEFA 3UB8A 1KGGA 1YT4A 2PT7A 3MSHA 2HDQA 1K6SA 1H5XA 3K2NA 1XJ2A 4OQHA 2ZC6B 4HOIA 1TS0A 5DF9A 3BW6A 5F83A 3VFHA 4JKTA 3SW1A 2GZAA 1K56D 3CUEC 4PAUA 1WA9A 5CGXA 5HAPA 2EX8A 3F1OB 4OLGA 4N9KA 5L2FA 1WE4A 1ACFA 4OPRA 4OPZA 1K55A 4FH2A 3BEBA 5EOEA 3T4QA 3VOLA 4S2PA 4WZ5A 1K56A 5U47A 3WS1A 1OMEA 4EWFA 3JVVA 4R3AA 4B4XA 2XFSA 1N9OA 3LGOA 4AFIA 5J4EA 5KSCA 5FAPA 1K6RA 2D02A 5HL6A 4S2IA 1M6KA 1NXYA 3SH8A 5CEDA 2EA9A 2Y2PA 1OTBA 5DKKA 4WEJA 1W79A 3UPPA 3GR2A 4ZTKA 1SCWA 3TSGA 4E04A 2VA0A 1E25A 4HI4A 1YLJA 3UPNA 1TS7A 4JPMA 5FDHA 5EVLA 4CQHA 1T1BA 1KVMA 4L9FA 5FQKA 1GSXA 1W8QA 4HESA 4BL2A 3UE1A 2OWHA 1CEFA 3SH9A 1NRFA 3BY8A 3T12B 3LCEA 1BLSA 2PBYA 1PW1A 5FI2A 1UGUA 3IX4A 4MN5A 5J7EA 3VOYA 2V1AA 2LB9A 1SKOA 1OT9A 4ME4A 3WS4A 2RL3A 4LGWA 4OPYA 1O7EA 3O87A 3A0VA 4E6XA 4O0PA 2ZBBA 3UDXA 5CXWA 2EX6A 2BTFP 2UV0E 2OWJA 3NOPC 4D2OA 2XSSA 1K38A 3MXQA 4WMCA 1CQAA 4DXCA 4UQIM 4CLCC 2K31A 3VV4A 5DTSA 1NYMA 4Z1WA 4Y15A 2UWXA 1K4EA 2X01A 2Y2NA 4KZ6A 3UB6A 4E6WA 3ZG9B 1DP6A 1FSYA 3A0RA 1KOUA 3EWKA 4HJ6A 4HY8A 4LPZA 5JYPA 2Y2LA 3VSKA 5EVEA 2V2FF 2VV7A 1MBLA 4Y0TA 3VFFA 1JWPA 2XD5A 1LLBA 2VV6A 2WGWA 4RYEA 1ES4A 3ZCZA 4IBRA 4LV2A 5HPFA 4G3WA 1GHIA 3IT9A 3HLGA 5CTNA 4HBUA 3LFVA 1IYQA 1L0GA 4BMWA 4F3LA 4K0WA 4MEZA 4WF0A 1IYPA 5AQAA 5TJJA 1IYOA 1Z6FA 3AGEA 3UDIA 3IF5A 1I2WA 3T1RA 3MZDA 3MMHA 2EXBA 4F3LB 1L0FA 2W27A 1ZG4A 5DJUA 1XA7A 3QHYA 4FUWA 3VOZA 4DJ2A 2W3FA 4IJGA 1BLCA 4OONA 5HFOA 1NZOA 2ZC7A 2V0UA 3HUNA 3N8SA 4UAAA 5EFWA 1YLZA 4YOFA 4Q0IA 4DF6A 4DXBA 4X68A 4WZ4A 1K55C 2OSUA 3LIFA 3LICA 2PU2A 1NLZA 1MZUA 3OBFA 1FILA 2Y2OA 5F69A 1VQQA 4L9GA 2J3TD 1K54A 5TBMB 3IHBA 4MDZA 4QB8A 5DKLA 4II7A 3F1NA 5AVEA 4BLMA 2ZOHA 3IQAA 4LRYC 4DJ3A 1I2SA 1CK3A 1AWIA 1PI5A 3PBOA 4BJPA 4GOGA 5FA7A 3LO7A 3F1PA 1H8ZA 1GSWA 1T1AA 3G34A 1Q2QA 2PDRA 4RA7A 3F1NB 3FPWA 4P6ZM 2PHYA 3ZQ5A 5HL1A 1ZC2A 2OAQ1 1YM1A 3V67A 1A0KA 5TGFA 4UEYA 4RVAA 4WEKA 1H8MA 3VE3A 3T1QB 4GJ4A 3E2KA 5HZHA 4XT2B 3M6HA 5DJTA 1KGEA 1K25A 2ZC5B 5F6AA 5FQJA 4Y0UA 3TOIA 4HP9A 4X1LA 5GLAA 2M1CA 4I39A 3OC2A 2W0NA 3GVBA 3TW8A 2W3GA 3HBRA 3ZGAB 2WZZA 3KSGA 3S7NA 4EEUA 3HUMA 4WBGA 2P7JA 3E0YA 3TG9A 3LI8A 4HQAA 4DE2A 5HW3A 1U60A 3MF0A 4Y0OA 5GHZA 3SS5A 4DE1A 2A49A 4M3KA 4PM6A 4E3KA 3CLOA 3QP6A 3NOUC 3PBRA 4Y3IA 3NI9A 3W4QA 2VGLM 5I94A 1XP4A 3PHYA 5FQ9A 1IKIA 3UPOA 3BLSA 4QY6A 1STZA 2XLNA 2O0YA 1XKZA 3N8LA 2XFTA 4FOFA 4MMNA 5G18A 4WLAA 3PR6A 5GL9A 3W4OA 3L7HA 3G6OA 3DAVA 3A3JA 4S2OA 3UN7A 3ZVWA 3A3FA 4OOYA 3IF6A 3QP8A 3NBLA 1FSWA 4C6YA 1LL5A 3BJNA 4I38A 3LUQA 1E3UD 5F1FA 1MKIA 1E4DA 3CITA 5TR7A 3ICYA 5FASA 3T4KA 1G68A 2XROA 1S1ZA 2V9AA 4P87A 4UA7A 1SZVA 2DMWA 4BBVA 3AGDA 4QWOA 4PM8A 2IA2A 1K0KA 2R9XA 3Q7ZA 4NG2A 4UHUA 3HUOA 4YNRA 1S67L 3FWLA 3O3VA 5F82A 1PRQA 1W63M 4BQMA 1VEUA 2Y2HA 1LSXA 2EX2A 3LR0A 2MJ6A 3DWZA 5EVIC 5FL3A 2L1MA 2HV1A 2VK3A 4XUXA 1VEUB 3E4OA 4K08A 1CEGA 2O99A 4IUHA 5E2EA 1LL8A 1OPXA 3TJZC 3DTEA 4GD8A 4PKYA 1JWZA 2W1RA 2BG1A 2WKQA 4NETA 1W7FA 2Y2KA 3QP2A 5HAQA 1WYCA 2ZQ9A 4YINA 5KZHA 1K54C 2WADA 1ES5A 3RXXA 2ZOIA 2ZQDA 4OP8A 3IH8A 4JXVA 2QJ7A 1JTDA 5M19A 1QMEA 1Q2PA 4IHQA 2IWBA 2HP6A 3OPHA 5EECA 4QHCA 1BYWA 1BTLA 1NYYA 3KYQA 3H7WA 2CC1A 2O9BA 1FIKA 3HJIA 1QMFA 2I72A 3RFBA 1EI5A 4MBKA 3IBJA 2A2LA 2KDKA 3CHWP 4KZ5A 1XFNA 1ERMA 3A3IA 1P9WA 3CPTA 3DW0A 4MN6A 3EEAA 3NDGA 3P98A 4EQIA 2FZ0A 3ZHHA 2W3DA 3BQ8A 2CMNA 2WAEA 5KSHA 4FD8A 2ZL1B 1PIOA 3D4FA 3PBNA 3F1OA 1PNEA 5EUAA 3CPTB 3LR4A 4NEED 4Y5FA 3OPPA 1VB6A 4RX2A 1XGIA 3V5MA 2VEAA 4JGOA 5MC7A 2ZMVA 1IEMA 2JCHA 3G30A 3O5YA 5FI6A 4PM9A 4GHIB 3Q07A 5C5KA 1ALQA 2BASA 1Y28A 4FH4A 2L4RA 3MBZA 4O7DA 1KDSA 4PHTA 4LFUA 3GRJA 5G4ZA 3WS5A 3L9KA 1GA9A 3OPLA 2P74A 3VMAA 3IF6C 1ES2A 1HZOA 1YSPA 3P01A 3ZG8B 2ZD8A 3P7NA 3WS0A 1JTGA 1X0OA 3CJMA 3K3CA 2PR6A 2QPNA 2ZM0A 4OOMA 1G6AA 5EOOA 3T4TA 5HWWA 3OCNA 4G3VA 2I9VA 4BD1A 5FQIA 2EFXA 3S7OA 5E43A 4CPKA 1LSVA 2M7UA 5FI7A 1L2SA 2Y79A 2Q0OA 4E3LA 2WUQA 1PWDA 1GSVA 2LB5A 2J80A 5E2HA 2QKPA 4JF6A 4UA6A 3Q81A 3FC7A 2WKHA 1BLHA 2Y2GA 4S2NC 4L9EA 4ID4A 4FTXA 1PWCA 3UB7A 1F2KA 1MPLA 3IH9A 3EGXC 4KZBA 3CAXA 3MKFA 3G2ZA 4GN2A 5DF8A 3BFDA 5EE8A 1MWTA 1H8YA 2Z2MB 5JYOA 3KO6A 3C7UA 1HD8A 1L0EA 2X71A 3K3DA 4HH2A 3M2KA 3IXDA 5AJGA 4MNRA 2XA7S 3EQVA 3ZVTA 3O86A 1YLWA 2OOLA 1H3QA 4NXBA 2PRFA 2PAVP 3C30A 5HD3A 5CHJA 1GCEA 2ZQ8A 3ISGA 1NY0A 1LI0A 4QD4A 2WKPA 1D7EA 2JE5A 4P0MA 3SS3A 3BYDA 3IXBA 4KQQA 1RCJA 4XXRA 2EX9A 4EXOA 5EPHA 2ZC4B 4I3IA 5A8BA 1TS6A 1KE3A 2W3HA 4HBTA 1ESUA 1ZG6A 2P08A 2QZ6A 1PWGA 1BLPA 5CRFA 3E2LA 4ZDXA 1RP5A 3WRZA 2OLVA 5CTMA 4GNUA 2VKSA 4Y2FA 2XA7M 3BFCA 4BL3A 5E2GA 3NC8A 3B47A 2Q9NA 5FAQA 3UE6A 4BENA 2R78A 5CEBA 4WELA 3E4PA 4U0XA 3T4JA 2PYPA 4FSFA 5FATA 3HVFA 2ZM2A 1TEMA 4HNBA 4KUKA 2HZ5A 3ZG5A 5TBMA 3IWOA 2D01A 4ARZA 4WZ5C 3VP1A 1TVFA 1YLTA 1SKFA 1FQGA 3A3EA 3HLFA 1YPRA 1N4OA 4KZ9A 1OTAA 3BFGA 3Q82A 4ARZB 1BSGA 5KMWA 3GSGA 4B93A 5L07A 2O9CA 2P9VA 1CI9A 4B4ZA 3MKEA 1K4FA 4QJGA 5EV0A 3VP2A 2GDNA 1G28A 4U0TA 3V3RA 3R4KA 4XT2A 2WZXA 1GA0A 2Y55A 2K2NA 4GB7A 4Y7PA 2P9VB
chains in the Genus database with same CATH topology
1ERQA 4K91A 1K56D 4OOLA 2XGNA 3FWLA 3O3VA 5F82A 3I7JA 4X69A 3DWKA 3PAGA 4BQMA 2Y2HA 1IKGA 2EX2A 5CGXA 3ZFZA 3SS4A 4MLLA 5HAPA 3DWZA 2EX8A 2WK0A 5HAIA 4JXGA 4OLGA 4N9KA 3V3SA 5L2FA 1WE4A 4OPRA 5EVIC 4OPZA 1K55A 4FH2A 3BEBA 4KG6A 5EOEA 1LHYA 3OPRA 4IVIA 4S2PA 2EXAA 3IXGA 3HLEA 2FFFB 4S2KA 4WZ5A 4XUXA 1K56A 5U47A 3WS1A 3SH7A 1OMEA 3LY4A 4EWFA 4KZAA 3ZG7B 2X02A 1VM1A 1MWUA 3CMZA 1CEGA 4KZ4A 4B4XA 2R9WA 5E2EA 3G4PA 4DRTA 2XFSA 2OLUA 2XEPA 2J8YA 4GD8A 1JWZA 2XH9A 5AQBA 2ZQAA 5KSCA 3HLWA 5FAPA 1K6RA 1NZUA 1HVBA 2BG1A 4RX3A 4NETA 4S2IA 3BLMA 1W7FA 2Y2KA 5HAQA 1WYCA 4E3OA 1M6KA 2ZQ9A 4YINA 1NXYA 3SH8A 5CEDA 5GLDA 5KZHA 1Y54A 1K54C 2VGJA 1ES5A 2WADA 2Y2PA 2WGIA 3P09A 2ZQDA 4WEJA 3RXXA 3M2JA 1W79A 4OP8A 3UPPA 3IH8A 1I5QA 3GR2A 3O88A 3ZNYA 4JXVA 4ZTKA 1SCWA 1GHPA 3TSGA 4ZJ3A 2WGWB 1JTDA 1E25A 4S2LA 1YMXA 3W8KA 1YLJA 3UPNA 1HTZA 1S6RA 5M19A 3ZNTA 1QMEA 4JPMA 1JVJA 4Z9QA 5EVID 1Q2PA 3W4PA 1SDNA 2IWBA 4JXWA 5FDHA 4LV1A 4KZ7A 5EVLA 4KZ3A 5TFQA 5FSRA 2HP6A 3OPHA 5EECA 1KVMA 4QHCA 1IYSA 1ZKJA 1YLPA 4EBLA 2Q9MA 4R3JA 3NY4A 1BTLA 5FQKA 1W8QA 4HESA 1N9BA 1NYYA 3LY3A 2V20A 4BL2A 4GDBA 2CC1A 3UE1A 3UY6A 1DJBA 3LEZA 3BFFA 3VP3A 5EVIA 1CEFA 4P85A 3OCLA 5F1GA 1QMFA 3SH9A 4JBFA 2I72A 5FAOA 2Y2QA 3FV7A 1NRFA 1MY8A 2ZLYA 2IWCA 1EI5A 3LCEA 4MBKA 4PM5A 1BLSA 2PBYA 2J9PA 1PW1A 4N1HA 5FI2A 1MXOA 5A93A 2HP9A 4QY5A 3HLBA 4ZBEA 5EVIB 4KZ5A 3OZHA 2A3UA 3VOYA 1ERMA 1FOFA 3CZDA 2PU4A 5D3OA 1DY6A 4ZAMA 3A3IA 3PAEA 5DVAA 3WS4A 1S0WA 4NK3A 3DW0A 2RL3A 1DJCA 3NDGA 1O7EA 3O87A 2HDSA 3P98A 4OPYA 4EQIA 4E6XA 3WS2A 4QU3A 3UDXA 1J9MA 5CXWA 2EX6A 3ZHHA 4R0QA 4R4SA 3UO9A 4OLDA 2WAEA 5KSHA 1YLYA 3FKVA 4FD8A 5DTKA 4S2JA 3ZDJA 1PIOA 3D4FA 4D2OA 1XX2A 3PBNA 2RCXA 5EUAA 1K57A 1K38A 1E3UA 4U3TA 2ZJ9A 1CI8A 3MZFA 1XGJA 2Y59A 4WMCA 1RGZA 1LI9A 3OPPA 4DXCA 4RX2A 1XGIA 2WAFA 5A90A 3V5MA 4KQRA 5J8XA 4PMAA 5DTSA 1NYMA 4K0XA 3PBQA 4C75A 2UWXA 1K4EA 3C7VA 4X6TA 2Y2NA 2X01A 1IEMA 2H0YA 2JCHA 4KZ6A 4EV4A 4E6WA 3G30A 3ZG9B 1FR6A 1KE4A 5FI6A 4PM9A 1FSYA 1FCOA 2J9OA 4JF4A 5JYPA 3Q07A 2Y2LA 3VSKA 4R23A 1ALQA 4LCMA 4EBPA 2V2FF 4FH4A 1MBLA 3G35A 3MBZA 4PM7A 4O7DA 1KDSA 4Y0TA 3VFFA 1JWPA 2XD5A 3GRJA 3NIAA 1LLBA 1PI4A 2DNSA 3GMWA 2WGWA 3C4PA 3CG5A 4RYEA 1TDLA 2WKEA 1ES4A 3WS5A 4IBRA 3ZCZA 1MWRA 4LV2A 2ZC3B 1GA9A 4GD6A 4S2MA 1GHIA 3BFEA 3OPLA 2ZQ7A 2P74A 3IT9A 5CGSA 3HLGA 3V39A 1KE0A 5CTNA 2Y2JA 5CHUA 3VMAA 4DDSA 4HBUA 2G2UA 2HDRA 3IF6C 1IYQA 3C5AA 1SDEA 5GHYA 1ES2A 4OH0A 3G2YA 1HZOA 1L0GA 3RJUA 2G2WA 4K0WA 5DTTA 4MEZA 3S4XA 3ZG8B 1IYPA 2ZD8A 5AQAA 1IYOA 1W5DA 4F94A 3WS0A 5BOHA 1Z6FA 1C3BA 1JTGA 3AGEA 1LL9A 3CJMA 1WYBA 4OQIA 3WWXA 3G32A 2E8IA 1ES3A 2QPNA 3UDIA 2Y91A 1SHVA 3IF5A 1I2WA 2ZM0A 3MZDA 1G6AA 4OOMA 2EXBA 5EOOA 4BD0A 4E3NA 1L0FA 5M1AA 3OCNA 1ZG4A 4OP5A 4A5RA 1XA7A 3QHYA 4BD1A 5FQIA 1MWSA 3VOZA 4DE0A 2EFXA 1BLCA 3ITBA 4LV3A 4JF5A 4OONA 5HFOA 3Q7VA 1NZOA 2ZC7A 4ZJ2A 2ZMAA 5E43A 3HUNA 4OPQA 5AQ7A 4CPKA 5CERA 1PZPA 3N8SA 2HPBA 4UAAA 3IXHA 5FI7A 1YLZA 1XA1A 1L2SA 4IBXA 2HP5A 4E3LA 3QNCA 2WUQA 4KG5A 4DF6A 1PWDA 2JC7A 4DKIA 4DXBA 3N8RA 4X68A 5E2HA 4WZ4A 1EWZA 1K55C 2OSUA 2H10A 1JWVA 3Q7VB 4JF6A 4UA6A 1IELA 2IWDA 2PU2A 3Q81A 2WKHA 1BLHA 2Y2GA 4S2NC 4B88A 3IWQA 2XR0A 3C4OA 3G31A 4ID4A 3S1YA 1PWCA 2Y2OA 1TDGA 1VQQA 5GLCA 3UE3A 3DTMA 1MPLA 3VP4A 3IH9A 4KZBA 3MKFA 3G2ZA 4GN2A 4JXSA 1K54A 2XQZA 4KZ8A 5DF8A 3IHBA 4GZBA 2XK1A 3BFDA 5EE8A 1MWTA 3QNBA 4QB8A 4LCLA 1H8YA 2Z2MB 4BLMA 5JYOA 3IQAA 4GDNA 4WM9A 1I2SA 1CK3A 3C7UA 1HD8A 1L0EA 1PI5A 3PBOA 4BJPA 5CECA 2X71A 4GOGA 5FA7A 3LO7A 5A92A 4MBFA 4EBNA 1KVLA 1H8ZA 2V1ZA 3G34A 3M2KA 3IXDA 1Q2QA 3IF6B 4MNRA 4R4RA 4OQGA 4RA7A 5GLBA 3EQVA 3BECA 5IHVA 3O86A 3ZVTA 4H8RA 5FQQA 3VSLA 3N6IA 3N4IA 1PW8A 1YLWA 4R3BA 1KGFA 4E3IA 5HL1A 4Q8IA 2B5RA 1ZC2A 3GTCA 1YM1A 3FKWA 4PPRA 4N9LA 3EQUA 5TGFA 3WRTA 1NJ4A 4RVAA 4WEKA 2WGVA 5CHJA 1GCEA 2ZQ8A 3BM6A 1PYYA 3E2KA 3ISGA 1NY0A 4KENB 1LI0A 3M6HA 1KGEA 1K25A 2DRWA 4QD4A 2ZC5B 2Y2MA 2JE5A 4P0MA 3SS3A 3BYDA 3IXBA 5FQJA 4KQQA 3NDEA 1RCJA 4XXRA 4Y0UA 3TOIA 2OV5A 2EX9A 5CGWA 1BULA 3S22A 5EPHA 2ZC4B 4IVKA 5GLAA 3JYIA 1GHMA 1DJAA 1KE3A 2QMIA 2XDMA 3GQZA 2EFUA 3OC2A 3GVBA 4S2NA 2BLSA 4HBTA 1FCNA 1ESUA 1ZG6A 3HBRA 3UE0A 3ZGAB 3V50A 2QZ6A 2WZZA 1PWGA 1BLPA 5FQMA 5CRFA 4LV0A 3HUMA 4WBGA 3E2LA 4ZDXA 4OKPA 3MFDA 1RP5A 3WRZA 1FCMA 4UA9A 2OLVA 4X55A 3TG9A 2ZM8A 4JLFA 4DE2A 2WKIA 3N7WA 4XUZA 5CTMA 3FZCA 1ESIA 5HW3A 1U60A 4Y0OA 4GNUA 5GHZA 5E2FA 3UDFA 1BUEA 2H0TA 3SS5A 4DE1A 3BFCA 4P6BA 4BL3A 1BZAA 5E2GA 1XPBA 5M18A 2A49A 3NC8A 1YMSA 2Q9NA 4GKUA 5FAQA 1AXBA 4M3KA 3GV9A 1L0DA 4X56A 5CHMA 3NCKA 4BENA 1K57C 2DCFA 4CJNA 4PM6A 4E3KA 5CEBA 4WELA 4DE3A 4U0XA 2ZQCA 3SOIA 2Z2LB 4EUZA 2JBFA 4FSFA 5DF7A 3PBRA 5FATA 3HVFA 1ONGA 1M40A 3NI9A 2C6WB 3RXWA 4E3JA 3W4QA 3HLCA 4OQ0A 3IHAA 2ZM2A 4WYYA 5I94A 1XP4A 3ZG0A 1TEMA 5AQ9A 5FQ9A 4FCFA 1PZOA 3ZG5A 4R1GA 1IKIA 5GHXA 3UPOA 3BLSA 3IWOA 3VP0A 2FFYA 1W8YA 4QY6A 1KDWA 2XLNA 3IWIA 2VGKA 1XXMA 3PBSA 1XKZA 3N8LA 3B3XA 3PBTA 2XFTA 3Q1FA 4C3QA 4N92A 4WZ5C 3HLDA 1TVFA 5G18A 3VP1A 1FR1A 4MBHA 1YLTA 1SKFA 1EROA 1FQGA 1RGYA 1BT5A 2WYXA 3A3EA 3HL9A 5GL9A 2Y2IA 3W4OA 4YFMA 2XF3A 3FYZA 3HLFA 4L0LA 1O07A 3A3JA 4IEDA 4S2OA 3UN7A 1N4OA 3ZVWA 4KZ9A 3BFGA 3A3FA 3M6BA 4OOYA 3IF6A 3Q82A 3AGFA 4KQOA 3NBLA 5HX9A 2J7VA 1FSWA 4C6YA 1LL5A 3ITAA 2Y4AA 4X53A 1BSGA 1ONHA 3MXSA 3UNWA 5KMWA 4OVDA 1E3UD 5F1FA 1YQSA 3GSGA 1MKIA 4ZJ1A 5A91A 3MZEA 1E4DA 5TR7A 2C5WB 3A3DA 4WMCD 2H5SA 5FASA 5HARA 2P9VA 1CI9A 1G68A 4B4ZA 3MKEA 1K4FA 4HEFA 4N1XA 3PTEA 3VP2A 4QJGA 2GDNA 4P87A 4U0TA 3V3RA 1KGGA 1YT4A 4KG2A 4UA7A 3HREA 2XD1A 2HDQA 1K6SA 2WZXA 3MXRA 2HDUA 1H5XA 1GA0A 3AGDA 4DDYA 4OQHA 2Y55A 2ZC6B 3BRMA 4LENA 4PM8A 2R9XA 5DF9A 4GB7A 5F83A 3Q7ZA 4E3MA 4UHUA 3VFHA 3HUOA 4Y7PA 4JKTA 2P9VB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ERQ A;  4K91 A;  1K56 D;  4OOL A;  2XGN A;  3FWL A;  3O3V A;  5F82 A;  3I7J A;  4X69 A;  3DWK A;  3PAG A;  4BQM A;  2Y2H A;  1IKG A;  2EX2 A;  5CGX A;  3ZFZ A;  3SS4 A;  4MLL A;  5HAP A;  3DWZ A;  2EX8 A;  2WK0 A;  5HAI A;  4JXG A;  4OLG A;  4N9K A;  3V3S A;  5L2F A;  1WE4 A;  4OPR A;  5EVI C;  4OPZ A;  1K55 A;  4FH2 A;  3BEB A;  4KG6 A;  5EOE A;  1LHY A;  3OPR A;  4IVI A;  4S2P A;  2EXA A;  3IXG A;  3HLE A;  2FFF B;  4S2K A;  4WZ5 A;  4XUX A;  1K56 A;  5U47 A;  3WS1 A;  3SH7 A;  1OME A;  3LY4 A;  4EWF A;  4KZA A;  3ZG7 B;  2X02 A;  1VM1 A;  1MWU A;  3CMZ A;  1CEG A;  4KZ4 A;  4B4X A;  2R9W A;  5E2E A;  3G4P A;  4DRT A;  2XFS A;  2OLU A;  2XEP A;  2J8Y A;  4GD8 A;  1JWZ A;  2XH9 A;  5AQB A;  2ZQA A;  5KSC A;  3HLW A;  5FAP A;  1K6R A;  1NZU A;  1HVB A;  2BG1 A;  4RX3 A;  4NET A;  4S2I A;  3BLM A;  1W7F A;  2Y2K A;  5HAQ A;  1WYC A;  4E3O A;  1M6K A;  2ZQ9 A;  4YIN A;  1NXY A;  3SH8 A;  5CED A;  5GLD A;  5KZH A;  1Y54 A;  1K54 C;  2VGJ A;  1ES5 A;  2WAD A;  2Y2P A;  2WGI A;  3P09 A;  2ZQD A;  4WEJ A;  3RXX A;  3M2J A;  1W79 A;  4OP8 A;  3UPP A;  3IH8 A;  1I5Q A;  3GR2 A;  3O88 A;  3ZNY A;  4JXV A;  4ZTK A;  1SCW A;  1GHP A;  3TSG A;  4ZJ3 A;  2WGW B;  1JTD A;  1E25 A;  4S2L A;  1YMX A;  3W8K A;  1YLJ A;  3UPN A;  1HTZ A;  1S6R A;  5M19 A;  3ZNT A;  1QME A;  4JPM A;  1JVJ A;  4Z9Q A;  5EVI D;  1Q2P A;  3W4P A;  1SDN A;  2IWB A;  4JXW A;  5FDH A;  4LV1 A;  4KZ7 A;  5EVL A;  4KZ3 A;  5TFQ A;  5FSR A;  2HP6 A;  3OPH A;  5EEC A;  1KVM A;  4QHC A;  1IYS A;  1ZKJ A;  1YLP A;  4EBL A;  2Q9M A;  4R3J A;  3NY4 A;  1BTL A;  5FQK A;  1W8Q A;  4HES A;  1N9B A;  1NYY A;  3LY3 A;  2V20 A;  4BL2 A;  4GDB A;  2CC1 A;  3UE1 A;  3UY6 A;  1DJB A;  3LEZ A;  3BFF A;  3VP3 A;  5EVI A;  1CEF A;  4P85 A;  3OCL A;  5F1G A;  1QMF A;  3SH9 A;  4JBF A;  2I72 A;  5FAO A;  2Y2Q A;  3FV7 A;  1NRF A;  1MY8 A;  2ZLY A;  2IWC A;  1EI5 A;  3LCE A;  4MBK A;  4PM5 A;  1BLS A;  2PBY A;  2J9P A;  1PW1 A;  4N1H A;  5FI2 A;  1MXO A;  5A93 A;  2HP9 A;  4QY5 A;  3HLB A;  4ZBE A;  5EVI B;  4KZ5 A;  3OZH A;  2A3U A;  3VOY A;  1ERM A;  1FOF A;  3CZD A;  2PU4 A;  5D3O A;  1DY6 A;  4ZAM A;  3A3I A;  3PAE A;  5DVA A;  3WS4 A;  1S0W A;  4NK3 A;  3DW0 A;  2RL3 A;  1DJC A;  3NDG A;  1O7E A;  3O87 A;  2HDS A;  3P98 A;  4OPY A;  4EQI A;  4E6X A;  3WS2 A;  4QU3 A;  3UDX A;  1J9M A;  5CXW A;  2EX6 A;  3ZHH A;  4R0Q A;  4R4S A;  3UO9 A;  4OLD A;  2WAE A;  5KSH A;  1YLY A;  3FKV A;  4FD8 A;  5DTK A;  4S2J A;  3ZDJ A;  1PIO A;  3D4F A;  4D2O A;  1XX2 A;  3PBN A;  2RCX A;  5EUA A;  1K57 A;  1K38 A;  1E3U A;  4U3T A;  2ZJ9 A;  1CI8 A;  3MZF A;  1XGJ A;  2Y59 A;  4WMC A;  1RGZ A;  1LI9 A;  3OPP A;  4DXC A;  4RX2 A;  1XGI A;  2WAF A;  5A90 A;  3V5M A;  4KQR A;  5J8X A;  4PMA A;  5DTS A;  1NYM A;  4K0X A;  3PBQ A;  4C75 A;  2UWX A;  1K4E A;  3C7V A;  4X6T A;  2Y2N A;  2X01 A;  1IEM A;  2H0Y A;  2JCH A;  4KZ6 A;  4EV4 A;  4E6W A;  3G30 A;  3ZG9 B;  1FR6 A;  1KE4 A;  5FI6 A;  4PM9 A;  1FSY A;  1FCO A;  2J9O A;  4JF4 A;  5JYP A;  3Q07 A;  2Y2L A;  3VSK A;  4R23 A;  1ALQ A;  4LCM A;  4EBP A;  2V2F F;  4FH4 A;  1MBL A;  3G35 A;  3MBZ A;  4PM7 A;  4O7D A;  1KDS A;  4Y0T A;  3VFF A;  1JWP A;  2XD5 A;  3GRJ A;  3NIA A;  1LLB A;  1PI4 A;  2DNS A;  3GMW A;  2WGW A;  3C4P A;  3CG5 A;  4RYE A;  1TDL A;  2WKE A;  1ES4 A;  3WS5 A;  4IBR A;  3ZCZ A;  1MWR A;  4LV2 A;  2ZC3 B;  1GA9 A;  4GD6 A;  4S2M A;  1GHI A;  3BFE A;  3OPL A;  2ZQ7 A;  2P74 A;  3IT9 A;  5CGS A;  3HLG A;  3V39 A;  1KE0 A;  5CTN A;  2Y2J A;  5CHU A;  3VMA A;  4DDS A;  4HBU A;  2G2U A;  2HDR A;  3IF6 C;  1IYQ A;  3C5A A;  1SDE A;  5GHY A;  1ES2 A;  4OH0 A;  3G2Y A;  1HZO A;  1L0G A;  3RJU A;  2G2W A;  4K0W A;  5DTT A;  4MEZ A;  3S4X A;  3ZG8 B;  1IYP A;  2ZD8 A;  5AQA A;  1IYO A;  1W5D A;  4F94 A;  3WS0 A;  5BOH A;  1Z6F A;  1C3B A;  1JTG A;  3AGE A;  1LL9 A;  3CJM A;  1WYB A;  4OQI A;  3WWX A;  3G32 A;  2E8I A;  1ES3 A;  2QPN A;  3UDI A;  2Y91 A;  1SHV A;  3IF5 A;  1I2W A;  2ZM0 A;  3MZD A;  1G6A A;  4OOM A;  2EXB A;  5EOO A;  4BD0 A;  4E3N A;  1L0F A;  5M1A A;  3OCN A;  1ZG4 A;  4OP5 A;  4A5R A;  1XA7 A;  3QHY A;  4BD1 A;  5FQI A;  1MWS A;  3VOZ A;  4DE0 A;  2EFX A;  1BLC A;  3ITB A;  4LV3 A;  4JF5 A;  4OON A;  5HFO A;  3Q7V A;  1NZO A;  2ZC7 A;  4ZJ2 A;  2ZMA A;  5E43 A;  3HUN A;  4OPQ A;  5AQ7 A;  4CPK A;  5CER A;  1PZP A;  3N8S A;  2HPB A;  4UAA A;  3IXH A;  5FI7 A;  1YLZ A;  1XA1 A;  1L2S A;  4IBX A;  2HP5 A;  4E3L A;  3QNC A;  2WUQ A;  4KG5 A;  4DF6 A;  1PWD A;  2JC7 A;  4DKI A;  4DXB A;  3N8R A;  4X68 A;  5E2H A;  4WZ4 A;  1EWZ A;  1K55 C;  2OSU A;  2H10 A;  1JWV A;  3Q7V B;  4JF6 A;  4UA6 A;  1IEL A;  2IWD A;  2PU2 A;  3Q81 A;  2WKH A;  1BLH A;  2Y2G A;  4S2N C;  4B88 A;  3IWQ A;  2XR0 A;  3C4O A;  3G31 A;  4ID4 A;  3S1Y A;  1PWC A;  2Y2O A;  1TDG A;  1VQQ A;  5GLC A;  3UE3 A;  3DTM A;  1MPL A;  3VP4 A;  3IH9 A;  4KZB A;  3MKF A;  3G2Z A;  4GN2 A;  4JXS A;  1K54 A;  2XQZ A;  4KZ8 A;  5DF8 A;  3IHB A;  4GZB A;  2XK1 A;  3BFD A;  5EE8 A;  1MWT A;  3QNB A;  4QB8 A;  4LCL A;  1H8Y A;  2Z2M B;  4BLM A;  5JYO A;  3IQA A;  4GDN A;  4WM9 A;  1I2S A;  1CK3 A;  3C7U A;  1HD8 A;  1L0E A;  1PI5 A;  3PBO A;  4BJP A;  5CEC A;  2X71 A;  4GOG A;  5FA7 A;  3LO7 A;  5A92 A;  4MBF A;  4EBN A;  1KVL A;  1H8Z A;  2V1Z A;  3G34 A;  3M2K A;  3IXD A;  1Q2Q A;  3IF6 B;  4MNR A;  4R4R A;  4OQG A;  4RA7 A;  5GLB A;  3EQV A;  3BEC A;  5IHV A;  3O86 A;  3ZVT A;  4H8R A;  5FQQ A;  3VSL A;  3N6I A;  3N4I A;  1PW8 A;  1YLW A;  4R3B A;  1KGF A;  4E3I A;  5HL1 A;  4Q8I A;  2B5R A;  1ZC2 A;  3GTC A;  1YM1 A;  3FKW A;  4PPR A;  4N9L A;  3EQU A;  5TGF A;  3WRT A;  1NJ4 A;  4RVA A;  4WEK A;  2WGV A;  5CHJ A;  1GCE A;  2ZQ8 A;  3BM6 A;  1PYY A;  3E2K A;  3ISG A;  1NY0 A;  4KEN B;  1LI0 A;  3M6H A;  1KGE A;  1K25 A;  2DRW A;  4QD4 A;  2ZC5 B;  2Y2M A;  2JE5 A;  4P0M A;  3SS3 A;  3BYD A;  3IXB A;  5FQJ A;  4KQQ A;  3NDE A;  1RCJ A;  4XXR A;  4Y0U A;  3TOI A;  2OV5 A;  2EX9 A;  5CGW A;  1BUL A;  3S22 A;  5EPH A;  2ZC4 B;  4IVK A;  5GLA A;  3JYI A;  1GHM A;  1DJA A;  1KE3 A;  2QMI A;  2XDM A;  3GQZ A;  2EFU A;  3OC2 A;  3GVB A;  4S2N A;  2BLS A;  4HBT A;  1FCN A;  1ESU A;  1ZG6 A;  3HBR A;  3UE0 A;  3ZGA B;  3V50 A;  2QZ6 A;  2WZZ A;  1PWG A;  1BLP A;  5FQM A;  5CRF A;  4LV0 A;  3HUM A;  4WBG A;  3E2L A;  4ZDX A;  4OKP A;  3MFD A;  1RP5 A;  3WRZ A;  1FCM A;  4UA9 A;  2OLV A;  4X55 A;  3TG9 A;  2ZM8 A;  4JLF A;  4DE2 A;  2WKI A;  3N7W A;  4XUZ A;  5CTM A;  3FZC A;  1ESI A;  5HW3 A;  1U60 A;  4Y0O A;  4GNU A;  5GHZ A;  5E2F A;  3UDF A;  1BUE A;  2H0T A;  3SS5 A;  4DE1 A;  3BFC A;  4P6B A;  4BL3 A;  1BZA A;  5E2G A;  1XPB A;  5M18 A;  2A49 A;  3NC8 A;  1YMS A;  2Q9N A;  4GKU A;  5FAQ A;  1AXB A;  4M3K A;  3GV9 A;  1L0D A;  4X56 A;  5CHM A;  3NCK A;  4BEN A;  1K57 C;  2DCF A;  4CJN A;  4PM6 A;  4E3K A;  5CEB A;  4WEL A;  4DE3 A;  4U0X A;  2ZQC A;  3SOI A;  2Z2L B;  4EUZ A;  2JBF A;  4FSF A;  5DF7 A;  3PBR A;  5FAT A;  3HVF A;  1ONG A;  1M40 A;  3NI9 A;  2C6W B;  3RXW A;  4E3J A;  3W4Q A;  3HLC A;  4OQ0 A;  3IHA A;  2ZM2 A;  4WYY A;  5I94 A;  1XP4 A;  3ZG0 A;  1TEM A;  5AQ9 A;  5FQ9 A;  4FCF A;  1PZO A;  3ZG5 A;  4R1G A;  1IKI A;  5GHX A;  3UPO A;  3BLS A;  3IWO A;  3VP0 A;  2FFY A;  1W8Y A;  4QY6 A;  1KDW A;  2XLN A;  3IWI A;  2VGK A;  1XXM A;  3PBS A;  1XKZ A;  3N8L A;  3B3X A;  3PBT A;  2XFT A;  3Q1F A;  4C3Q A;  4N92 A;  4WZ5 C;  3HLD A;  1TVF A;  5G18 A;  3VP1 A;  1FR1 A;  4MBH A;  1YLT A;  1SKF A;  1ERO A;  1FQG A;  1RGY A;  1BT5 A;  2WYX A;  3A3E A;  3HL9 A;  5GL9 A;  2Y2I A;  3W4O A;  4YFM A;  2XF3 A;  3FYZ A;  3HLF A;  4L0L A;  1O07 A;  3A3J A;  4IED A;  4S2O A;  3UN7 A;  1N4O A;  3ZVW A;  4KZ9 A;  3BFG A;  3A3F A;  3M6B A;  4OOY A;  3IF6 A;  3Q82 A;  3AGF A;  4KQO A;  3NBL A;  5HX9 A;  2J7V A;  1FSW A;  4C6Y A;  1LL5 A;  3ITA A;  2Y4A A;  4X53 A;  1BSG A;  1ONH A;  3MXS A;  3UNW A;  5KMW A;  4OVD A;  1E3U D;  5F1F A;  1YQS A;  3GSG A;  1MKI A;  4ZJ1 A;  5A91 A;  3MZE A;  1E4D A;  5TR7 A;  2C5W B;  3A3D A;  4WMC D;  2H5S A;  5FAS A;  5HAR A;  2P9V A;  1CI9 A;  1G68 A;  4B4Z A;  3MKE A;  1K4F A;  4HEF A;  4N1X A;  3PTE A;  3VP2 A;  4QJG A;  2GDN A;  4P87 A;  4U0T A;  3V3R A;  1KGG A;  1YT4 A;  4KG2 A;  4UA7 A;  3HRE A;  2XD1 A;  2HDQ A;  1K6S A;  2WZX A;  3MXR A;  2HDU A;  1H5X A;  1GA0 A;  3AGD A;  4DDY A;  4OQH A;  2Y55 A;  2ZC6 B;  3BRM A;  4LEN A;  4PM8 A;  2R9X A;  5DF9 A;  4GB7 A;  5F83 A;  3Q7Z A;  4E3M A;  4UHU A;  3VFH A;  3HUO A;  4Y7P A;  4JKT A;  2P9V B; 
#chains in the Genus database with same CATH topology
 1ERQ A;  4OOL A;  2XGN A;  2JKT M;  3I7J A;  3DWK A;  3ZFZ A;  5G4Y A;  5L09 A;  4JXG A;  2QJ5 A;  4WN5 A;  2ACG A;  3V3S A;  2AVX A;  1LHY A;  3OPR A;  2EXA A;  5HWT A;  2FFF B;  5LBR A;  3SH7 A;  1P9R A;  1T19 A;  2Z6C A;  3ZG7 B;  3FG8 A;  1N9L A;  1MWU A;  3CMZ A;  4KZ4 A;  2R9W A;  4DRT A;  2OLU A;  3HCY A;  2XEP A;  2XH9 A;  1UWP X;  4RX3 A;  4BBU A;  3S7Q A;  3BLM A;  5HD5 A;  2VGJ A;  2WGI A;  3M2J A;  3O88 A;  2K7S A;  1GHP A;  3C38 A;  1YMX A;  2V0W A;  3B33 A;  3ZNT A;  1JVJ A;  3W2Z A;  3W4P A;  1SDN A;  1IOU A;  3BQA A;  5FSR A;  4IUK A;  1ZKJ A;  1P97 A;  2Q9M A;  3GEC A;  4R3J A;  3NY4 A;  1LT0 A;  1N9B A;  3LY3 A;  4GDB A;  1DJB A;  1TD5 A;  3JVU A;  3OCL A;  4B9O A;  4JBF A;  3LIA A;  3FV7 A;  2JN7 A;  1MY8 A;  2IWC A;  4JGR A;  2J9P A;  5A93 A;  3HLB A;  2A3U A;  1FOF A;  3CZD A;  1DY6 A;  4ZAM A;  3NHQ A;  5DVA A;  1DP9 A;  1S0W A;  4RQ9 A;  1G5U A;  2HDS A;  4QU3 A;  1NRJ A;  1J9M A;  4R0Q A;  2A24 A;  4OLD A;  2NUT C;  1YLY A;  3FKV A;  5DTK A;  3JPU A;  4S2J A;  1F98 A;  1XX2 A;  2RCX A;  1K57 A;  4BWI A;  1E3U A;  4EER A;  2YKH A;  3MZF A;  1XGJ A;  2Y59 A;  4EET B;  5A90 A;  2A24 B;  1YAX A;  4KQR A;  3DTI A;  5J8X A;  4C75 A;  3C7V A;  1J3W A;  2H0Y A;  5CX7 A;  4EV4 A;  3MFX A;  2V1B A;  1FR6 A;  1KE4 A;  1G6O A;  1FCO A;  3KSF A;  1W63 Q;  4LCM A;  1CF0 A;  1PI4 A;  2DNS A;  3T4S A;  2WKE A;  1MWR A;  4S2M A;  1KE0 A;  5CHU A;  4DDS A;  2HDR A;  4M4X A;  3RH8 B;  3C5A A;  4CLC D;  2GJ3 A;  3KSH A;  3RJU A;  2G2W A;  1T18 A;  3S4X A;  2B95 A;  1Y4O A;  2HJE A;  3D3O A;  1W5D A;  5BOH A;  1IFQ A;  1EW0 A;  1WYB A;  3WWX A;  3G32 A;  1ES3 A;  2J3T C;  1SHV A;  3BWL A;  4BD0 A;  4E3N A;  3OOV A;  4OP5 A;  1L3L A;  4DE0 A;  4LV3 A;  4ZJ2 A;  2HGV A;  3Q7V A;  4GLQ A;  4OPQ A;  1H0M A;  3LR5 A;  5F5Y A;  3H9W A;  4D60 A;  1XA1 A;  5HDD A;  3QNC A;  4NXG A;  1S1Y A;  1EWZ A;  3MQ0 A;  1JWV A;  3Q7V B;  2KLI A;  4EEP A;  4I3A A;  1DRM A;  2IWD A;  1NLY A;  2ZL1 A;  3TE8 A;  3S1Y A;  3C4O A;  1TDG A;  3UE3 A;  5J3W A;  2G7U A;  4GW9 A;  2XQZ A;  3LYX A;  4KZ8 A;  4GZB A;  1MKM A;  2J3W A;  4I3J A;  3HJK A;  5FDS A;  4YWZ A;  5AVF A;  4WM9 A;  5CEC A;  4EBN A;  2QYB A;  1KVL A;  2V1Z A;  2KOI A;  4GHI A;  2V8F A;  3EEH A;  4Y17 A;  2HF6 A;  5IHV A;  4H8R A;  5HDC A;  5FQQ A;  1PW8 A;  4R3B A;  4E3I A;  4Q8I A;  3T1X A;  3GTC A;  4NXE A;  4PPR A;  2B18 A;  3T1S A;  1LSW A;  1NJ4 A;  2JKT I;  2WGV A;  3T4O A;  3BM6 A;  1TS8 A;  2DRW A;  3NDE A;  2OV5 A;  1BUL A;  5I5L A;  3JYI A;  3H82 A;  2EFU A;  5HPI A;  1OT6 A;  1FCN A;  3UE0 A;  2JKF A;  3V50 A;  2M7V A;  5HSQ A;  1T1C A;  4G3K A;  5FQM A;  4LV0 A;  1FCM A;  4JGP A;  3H82 B;  2WKI A;  2WKR A;  3GDI A;  2QWS A;  1Z09 A;  1XJ3 A;  5E2F A;  1BUE A;  5M18 A;  1YMS A;  1AXB A;  1L0D A;  3KX0 X;  3KYE A;  4X56 A;  5CHM A;  3NCK A;  3T50 A;  4KUO A;  1K57 C;  3QP1 A;  4MN7 A;  3SOI A;  2Z2L B;  2VZW A;  2JBF A;  3NJA A;  2PYR A;  2V8C A;  3RXW A;  2JKG A;  1ZTU A;  3IHA A;  4I5S A;  4ETZ A;  4FCF A;  4UQI S;  1PZO A;  1P0Z A;  3UME A;  5GHX A;  3VP0 A;  1KDW A;  3IWI A;  3MJQ A;  2VGK A;  1XXM A;  3Q1F A;  4C3Q A;  1FR1 A;  4GCZ A;  1RGY A;  2Y8H A;  2Y2I A;  4YFM A;  4IED A;  3E4Q A;  2PD7 A;  5HWV A;  3M6B A;  3A0S A;  2XRN A;  5HX9 A;  2J7V A;  2VJW A;  3ITA A;  2Y4A A;  4X53 A;  1ONH A;  3UNW A;  4ZJ1 A;  2FH5 A;  3MZE A;  3PYP A;  2VX8 A;  4WMC D;  3NOT C;  4HH3 A;  3U2A A;  3T4L A;  5HAR A;  4LLO B;  4N1X A;  3PTE A;  2EWW A;  4PKY G;  1V9Z A;  4KG2 A;  3HRE A;  2XD1 A;  4R70 A;  3MXR A;  1S4S A;  2HDU A;  2VV8 A;  4DDY A;  3BRM A;  4LEN A;  1SKO B;  4E3M A;  3D72 A;  2JKR M;  4Q0J A;  4K91 A;  4X69 A;  3PAG A;  4ZRR A;  1IKG A;  3SS4 A;  4MLL A;  2WK0 A;  5HAI A;  2NUP C;  4KG6 A;  4ETX A;  4IVI A;  3BY9 A;  1MC0 A;  3IXG A;  3HLE A;  4S2K A;  3LEQ A;  1NWZ A;  3LY4 A;  4KZA A;  2X02 A;  1VM1 A;  3UB9 A;  2L0W A;  3G4P A;  4R6L A;  2J8Y A;  4DN0 A;  5AQB A;  2ZQA A;  3HLW A;  5FEF A;  1NZU A;  1HVB A;  4E3O A;  3ZYT A;  5GLD A;  1Y54 A;  3P09 A;  3ZNY A;  1I5Q A;  5DFX A;  4ZJ3 A;  2WGW B;  4S2L A;  3LI9 A;  3W8K A;  3D9Y A;  2W3E A;  4GS9 A;  1HTZ A;  3B42 A;  1S6R A;  4Z9Q A;  5EVI D;  4JXW A;  4LV1 A;  4KZ7 A;  1V9Y A;  4KZ3 A;  5TFQ A;  1OJG A;  1S66 L;  1IYS A;  1YLP A;  4EBL A;  3QP5 A;  1PFL A;  4GS9 B;  2V20 A;  3KYZ A;  3UY6 A;  4P6Z S;  3LEZ A;  3BFF A;  3VP3 A;  5EVI A;  4WL9 A;  4P85 A;  3MR0 A;  5F1G A;  5FAO A;  3R7W A;  2Y2Q A;  3TRC A;  2ZLY A;  2B02 A;  3VE4 A;  2O9A A;  4PM5 A;  5DFY A;  4N1H A;  1MXO A;  2HP9 A;  4QY5 A;  4ZBE A;  3CWF A;  5EVI B;  3OZH A;  3S7P A;  3U4L P;  2YKF A;  2PU4 A;  4MCW A;  5D3O A;  3R7W B;  5IU1 A;  3PAE A;  4NK3 A;  4EUV A;  1DJC A;  2PR5 A;  3WS2 A;  4R4S A;  3UO9 A;  3RTY A;  3LID A;  3ZDJ A;  4LRZ E;  1VET A;  4U3T A;  2ZJ9 A;  1CI8 A;  3LIB A;  1OJ5 A;  2PBD P;  1RGZ A;  1LI9 A;  2WAF A;  4JGQ A;  4DMZ A;  4PMA A;  2INW A;  4K0X A;  3PBQ A;  4X6T A;  5IT5 A;  1VET B;  4WUJ A;  4EU0 A;  2GNX A;  3F1P B;  3SZT A;  2J9O A;  4JF4 A;  2ZMF A;  4R23 A;  4EBP A;  5EM0 A;  2VGL S;  4CLC E;  3NEC A;  3G35 A;  4PM7 A;  4EW7 A;  3NIA A;  3GMW A;  3C4P A;  3CG5 A;  1TDL A;  1ZHH B;  2ZC3 B;  4GD6 A;  3BFE A;  2ZQ7 A;  5CGS A;  3V39 A;  2Y2J A;  2G2U A;  5GHY A;  1SDE A;  4OH0 A;  3G2Y A;  5DTT A;  4F94 A;  4LRX C;  1C3B A;  4KQD A;  1LL9 A;  4OQI A;  1OTE A;  2E8I A;  1D06 A;  2Y91 A;  2EWV A;  3CUE A;  5M1A A;  4A5R A;  4Q0H A;  1MWS A;  3ITB A;  1N9N A;  4JF5 A;  2ZMA A;  5KIZ A;  5AQ7 A;  3UMD A;  1YKD A;  5CER A;  1PZP A;  3EOI A;  2HPB A;  3IXH A;  4IBX A;  4HJ3 A;  2HP5 A;  4EES A;  4KG5 A;  4DKI A;  2JC7 A;  3LR3 A;  3N8R A;  3DTK A;  3E98 A;  2H10 A;  5EM1 A;  3EGD C;  4O8G A;  3IX3 A;  1IEL A;  3KSI A;  3IS2 A;  3MS6 A;  1ODV A;  4B88 A;  4HHD A;  3IWQ A;  2XR0 A;  3G31 A;  3CI6 A;  4BBT A;  5GLC A;  3DTM A;  3VP4 A;  5FEG A;  5F68 A;  1HLU P;  4JXS A;  1OTD A;  2XK1 A;  3QP4 A;  4HJ4 A;  3QNB A;  3IS2 B;  4LCL A;  4GDN A;  2W1T A;  4HIA A;  5A92 A;  4MBF A;  3IF6 B;  4R4R A;  3IBR A;  4OQG A;  4H6J A;  5GLB A;  3BEC A;  1F5M A;  3VSL A;  3N6I A;  3N4I A;  2W1T B;  3OLO A;  1KGF A;  2B5R A;  1F9I A;  3FKW A;  4N9L A;  4X25 A;  2JKR I;  3EQU A;  4R38 A;  3PXP A;  3WRT A;  4O01 A;  4H6J B;  2JHE A;  1PYY A;  5IS1 A;  1DP8 A;  4KEN B;  2OAP 1;  4QPR A;  1VHM A;  2Y2M A;  3IX8 A;  1XFQ A;  3NUL A;  5CGW A;  3S22 A;  4IVK A;  1GHM A;  1DJA A;  2QMI A;  4S2N A;  2XDM A;  3GQZ A;  3MQO A;  2BLS A;  3UB5 P;  1UWN X;  1XJ4 A;  4NXF A;  1D1J A;  2HJ9 C;  4OKP A;  3MFD A;  5L10 A;  4UA9 A;  4X55 A;  2P04 A;  2ZM8 A;  4JLF A;  3N7W A;  4XUZ A;  3FZC A;  1ESI A;  3UDF A;  2H0T A;  4P6B A;  1BZA A;  1XPB A;  4GKU A;  2VLG A;  3GV9 A;  4CLC A;  2H28 A;  1XJ6 A;  4CJN A;  2DCF A;  2E8J A;  4DE3 A;  4Y13 A;  2ZQC A;  4EUZ A;  5DF7 A;  4ESP A;  2KX6 A;  3C8C A;  1ONG A;  4NKP A;  1M40 A;  2C6W B;  4E3J A;  3HLC A;  4CLC B;  4OQ0 A;  4WYY A;  4X1M A;  3ZG0 A;  5AQ9 A;  3LIE A;  4R1G A;  2FFY A;  1W8Y A;  3FPV A;  5L8M A;  4HP4 A;  1CJF A;  3PBS A;  3B3X A;  3PBT A;  4N92 A;  3HLD A;  4MBH A;  1JNU A;  1TF1 A;  1ERO A;  2WYX A;  3HL9 A;  1BT5 A;  3MQQ A;  3ULF A;  2XF3 A;  3FYZ A;  4L0L A;  5HDS A;  1O07 A;  2QHK A;  2Z6D A;  1OTI A;  3C2W A;  2PD8 A;  3AGF A;  3H7W B;  4KQO A;  1S4R A;  5K5B A;  3MXS A;  4OVD A;  1YQS A;  4EQ1 A;  5A91 A;  3DBA A;  2C5W B;  3A3D A;  2H5S A;  1YSQ A;  2GX5 A;  4HEF A;  3UB8 A;  1KGG A;  1YT4 A;  2PT7 A;  3MSH A;  2HDQ A;  1K6S A;  1H5X A;  3K2N A;  1XJ2 A;  4OQH A;  2ZC6 B;  4HOI A;  1TS0 A;  5DF9 A;  3BW6 A;  5F83 A;  3VFH A;  4JKT A;  3SW1 A;  2GZA A;  1K56 D;  3CUE C;  4PAU A;  1WA9 A;  5CGX A;  5HAP A;  2EX8 A;  3F1O B;  4OLG A;  4N9K A;  5L2F A;  1WE4 A;  1ACF A;  4OPR A;  4OPZ A;  1K55 A;  4FH2 A;  3BEB A;  5EOE A;  3T4Q A;  3VOL A;  4S2P A;  4WZ5 A;  1K56 A;  5U47 A;  3WS1 A;  1OME A;  4EWF A;  3JVV A;  4R3A A;  4B4X A;  2XFS A;  1N9O A;  3LGO A;  4AFI A;  5J4E A;  5KSC A;  5FAP A;  1K6R A;  2D02 A;  5HL6 A;  4S2I A;  1M6K A;  1NXY A;  3SH8 A;  5CED A;  2EA9 A;  2Y2P A;  1OTB A;  5DKK A;  4WEJ A;  1W79 A;  3UPP A;  3GR2 A;  4ZTK A;  1SCW A;  3TSG A;  4E04 A;  2VA0 A;  1E25 A;  4HI4 A;  1YLJ A;  3UPN A;  1TS7 A;  4JPM A;  5FDH A;  5EVL A;  4CQH A;  1T1B A;  1KVM A;  4L9F A;  5FQK A;  1GSX A;  1W8Q A;  4HES A;  4BL2 A;  3UE1 A;  2OWH A;  1CEF A;  3SH9 A;  1NRF A;  3BY8 A;  3T12 B;  3LCE A;  1BLS A;  2PBY A;  1PW1 A;  5FI2 A;  1UGU A;  3IX4 A;  4MN5 A;  5J7E A;  3VOY A;  2V1A A;  2LB9 A;  1SKO A;  1OT9 A;  4ME4 A;  3WS4 A;  2RL3 A;  4LGW A;  4OPY A;  1O7E A;  3O87 A;  3A0V A;  4E6X A;  4O0P A;  2ZBB A;  3UDX A;  5CXW A;  2EX6 A;  2BTF P;  2UV0 E;  2OWJ A;  3NOP C;  4D2O A;  2XSS A;  1K38 A;  3MXQ A;  4WMC A;  1CQA A;  4DXC A;  4UQI M;  4CLC C;  2K31 A;  3VV4 A;  5DTS A;  1NYM A;  4Z1W A;  4Y15 A;  2UWX A;  1K4E A;  2X01 A;  2Y2N A;  4KZ6 A;  3UB6 A;  4E6W A;  3ZG9 B;  1DP6 A;  1FSY A;  3A0R A;  1KOU A;  3EWK A;  4HJ6 A;  4HY8 A;  4LPZ A;  5JYP A;  2Y2L A;  3VSK A;  5EVE A;  2V2F F;  2VV7 A;  1MBL A;  4Y0T A;  3VFF A;  1JWP A;  2XD5 A;  1LLB A;  2VV6 A;  2WGW A;  4RYE A;  1ES4 A;  3ZCZ A;  4IBR A;  4LV2 A;  5HPF A;  4G3W A;  1GHI A;  3IT9 A;  3HLG A;  5CTN A;  4HBU A;  3LFV A;  1IYQ A;  1L0G A;  4BMW A;  4F3L A;  4K0W A;  4MEZ A;  4WF0 A;  1IYP A;  5AQA A;  5TJJ A;  1IYO A;  1Z6F A;  3AGE A;  3UDI A;  3IF5 A;  1I2W A;  3T1R A;  3MZD A;  3MMH A;  2EXB A;  4F3L B;  1L0F A;  2W27 A;  1ZG4 A;  5DJU A;  1XA7 A;  3QHY A;  4FUW A;  3VOZ A;  4DJ2 A;  2W3F A;  4IJG A;  1BLC A;  4OON A;  5HFO A;  1NZO A;  2ZC7 A;  2V0U A;  3HUN A;  3N8S A;  4UAA A;  5EFW A;  1YLZ A;  4YOF A;  4Q0I A;  4DF6 A;  4DXB A;  4X68 A;  4WZ4 A;  1K55 C;  2OSU A;  3LIF A;  3LIC A;  2PU2 A;  1NLZ A;  1MZU A;  3OBF A;  1FIL A;  2Y2O A;  5F69 A;  1VQQ A;  4L9G A;  2J3T D;  1K54 A;  5TBM B;  3IHB A;  4MDZ A;  4QB8 A;  5DKL A;  4II7 A;  3F1N A;  5AVE A;  4BLM A;  2ZOH A;  3IQA A;  4LRY C;  4DJ3 A;  1I2S A;  1CK3 A;  1AWI A;  1PI5 A;  3PBO A;  4BJP A;  4GOG A;  5FA7 A;  3LO7 A;  3F1P A;  1H8Z A;  1GSW A;  1T1A A;  3G34 A;  1Q2Q A;  2PDR A;  4RA7 A;  3F1N B;  3FPW A;  4P6Z M;  2PHY A;  3ZQ5 A;  5HL1 A;  1ZC2 A;  2OAQ 1;  1YM1 A;  3V67 A;  1A0K A;  5TGF A;  4UEY A;  4RVA A;  4WEK A;  1H8M A;  3VE3 A;  3T1Q B;  4GJ4 A;  3E2K A;  5HZH A;  4XT2 B;  3M6H A;  5DJT A;  1KGE A;  1K25 A;  2ZC5 B;  5F6A A;  5FQJ A;  4Y0U A;  3TOI A;  4HP9 A;  4X1L A;  5GLA A;  2M1C A;  4I39 A;  3OC2 A;  2W0N A;  3GVB A;  3TW8 A;  2W3G A;  3HBR A;  3ZGA B;  2WZZ A;  3KSG A;  3S7N A;  4EEU A;  3HUM A;  4WBG A;  2P7J A;  3E0Y A;  3TG9 A;  3LI8 A;  4HQA A;  4DE2 A;  5HW3 A;  1U60 A;  3MF0 A;  4Y0O A;  5GHZ A;  3SS5 A;  4DE1 A;  2A49 A;  4M3K A;  4PM6 A;  4E3K A;  3CLO A;  3QP6 A;  3NOU C;  3PBR A;  4Y3I A;  3NI9 A;  3W4Q A;  2VGL M;  5I94 A;  1XP4 A;  3PHY A;  5FQ9 A;  1IKI A;  3UPO A;  3BLS A;  4QY6 A;  1STZ A;  2XLN A;  2O0Y A;  1XKZ A;  3N8L A;  2XFT A;  4FOF A;  4MMN A;  5G18 A;  4WLA A;  3PR6 A;  5GL9 A;  3W4O A;  3L7H A;  3G6O A;  3DAV A;  3A3J A;  4S2O A;  3UN7 A;  3ZVW A;  3A3F A;  4OOY A;  3IF6 A;  3QP8 A;  3NBL A;  1FSW A;  4C6Y A;  1LL5 A;  3BJN A;  4I38 A;  3LUQ A;  1E3U D;  5F1F A;  1MKI A;  1E4D A;  3CIT A;  5TR7 A;  3ICY A;  5FAS A;  3T4K A;  1G68 A;  2XRO A;  1S1Z A;  2V9A A;  4P87 A;  4UA7 A;  1SZV A;  2DMW A;  4BBV A;  3AGD A;  4QWO A;  4PM8 A;  2IA2 A;  1K0K A;  2R9X A;  3Q7Z A;  4NG2 A;  4UHU A;  3HUO A;  4YNR A;  1S67 L;  3FWL A;  3O3V A;  5F82 A;  1PRQ A;  1W63 M;  4BQM A;  1VEU A;  2Y2H A;  1LSX A;  2EX2 A;  3LR0 A;  2MJ6 A;  3DWZ A;  5EVI C;  5FL3 A;  2L1M A;  2HV1 A;  2VK3 A;  4XUX A;  1VEU B;  3E4O A;  4K08 A;  1CEG A;  2O99 A;  4IUH A;  5E2E A;  1LL8 A;  1OPX A;  3TJZ C;  3DTE A;  4GD8 A;  4PKY A;  1JWZ A;  2W1R A;  2BG1 A;  2WKQ A;  4NET A;  1W7F A;  2Y2K A;  3QP2 A;  5HAQ A;  1WYC A;  2ZQ9 A;  4YIN A;  5KZH A;  1K54 C;  2WAD A;  1ES5 A;  3RXX A;  2ZOI A;  2ZQD A;  4OP8 A;  3IH8 A;  4JXV A;  2QJ7 A;  1JTD A;  5M19 A;  1QME A;  1Q2P A;  4IHQ A;  2IWB A;  2HP6 A;  3OPH A;  5EEC A;  4QHC A;  1BYW A;  1BTL A;  1NYY A;  3KYQ A;  3H7W A;  2CC1 A;  2O9B A;  1FIK A;  3HJI A;  1QMF A;  2I72 A;  3RFB A;  1EI5 A;  4MBK A;  3IBJ A;  2A2L A;  2KDK A;  3CHW P;  4KZ5 A;  1XFN A;  1ERM A;  3A3I A;  1P9W A;  3CPT A;  3DW0 A;  4MN6 A;  3EEA A;  3NDG A;  3P98 A;  4EQI A;  2FZ0 A;  3ZHH A;  2W3D A;  3BQ8 A;  2CMN A;  2WAE A;  5KSH A;  4FD8 A;  2ZL1 B;  1PIO A;  3D4F A;  3PBN A;  3F1O A;  1PNE A;  5EUA A;  3CPT B;  3LR4 A;  4NEE D;  4Y5F A;  3OPP A;  1VB6 A;  4RX2 A;  1XGI A;  3V5M A;  2VEA A;  4JGO A;  5MC7 A;  2ZMV A;  1IEM A;  2JCH A;  3G30 A;  3O5Y A;  5FI6 A;  4PM9 A;  4GHI B;  3Q07 A;  5C5K A;  1ALQ A;  2BAS A;  1Y28 A;  4FH4 A;  2L4R A;  3MBZ A;  4O7D A;  1KDS A;  4PHT A;  4LFU A;  3GRJ A;  5G4Z A;  3WS5 A;  3L9K A;  1GA9 A;  3OPL A;  2P74 A;  3VMA A;  3IF6 C;  1ES2 A;  1HZO A;  1YSP A;  3P01 A;  3ZG8 B;  2ZD8 A;  3P7N A;  3WS0 A;  1JTG A;  1X0O A;  3CJM A;  3K3C A;  2PR6 A;  2QPN A;  2ZM0 A;  4OOM A;  1G6A A;  5EOO A;  3T4T A;  5HWW A;  3OCN A;  4G3V A;  2I9V A;  4BD1 A;  5FQI A;  2EFX A;  3S7O A;  5E43 A;  4CPK A;  1LSV A;  2M7U A;  5FI7 A;  1L2S A;  2Y79 A;  2Q0O A;  4E3L A;  2WUQ A;  1PWD A;  1GSV A;  2LB5 A;  2J80 A;  5E2H A;  2QKP A;  4JF6 A;  4UA6 A;  3Q81 A;  3FC7 A;  2WKH A;  1BLH A;  2Y2G A;  4S2N C;  4L9E A;  4ID4 A;  4FTX A;  1PWC A;  3UB7 A;  1F2K A;  1MPL A;  3IH9 A;  3EGX C;  4KZB A;  3CAX A;  3MKF A;  3G2Z A;  4GN2 A;  5DF8 A;  3BFD A;  5EE8 A;  1MWT A;  1H8Y A;  2Z2M B;  5JYO A;  3KO6 A;  3C7U A;  1HD8 A;  1L0E A;  2X71 A;  3K3D A;  4HH2 A;  3M2K A;  3IXD A;  5AJG A;  4MNR A;  2XA7 S;  3EQV A;  3ZVT A;  3O86 A;  1YLW A;  2OOL A;  1H3Q A;  4NXB A;  2PRF A;  2PAV P;  3C30 A;  5HD3 A;  5CHJ A;  1GCE A;  2ZQ8 A;  3ISG A;  1NY0 A;  1LI0 A;  4QD4 A;  2WKP A;  1D7E A;  2JE5 A;  4P0M A;  3SS3 A;  3BYD A;  3IXB A;  4KQQ A;  1RCJ A;  4XXR A;  2EX9 A;  4EXO A;  5EPH A;  2ZC4 B;  4I3I A;  5A8B A;  1TS6 A;  1KE3 A;  2W3H A;  4HBT A;  1ESU A;  1ZG6 A;  2P08 A;  2QZ6 A;  1PWG A;  1BLP A;  5CRF A;  3E2L A;  4ZDX A;  1RP5 A;  3WRZ A;  2OLV A;  5CTM A;  4GNU A;  2VKS A;  4Y2F A;  2XA7 M;  3BFC A;  4BL3 A;  5E2G A;  3NC8 A;  3B47 A;  2Q9N A;  5FAQ A;  3UE6 A;  4BEN A;  2R78 A;  5CEB A;  4WEL A;  3E4P A;  4U0X A;  3T4J A;  2PYP A;  4FSF A;  5FAT A;  3HVF A;  2ZM2 A;  1TEM A;  4HNB A;  4KUK A;  2HZ5 A;  3ZG5 A;  5TBM A;  3IWO A;  2D01 A;  4ARZ A;  4WZ5 C;  3VP1 A;  1TVF A;  1YLT A;  1SKF A;  1FQG A;  3A3E A;  3HLF A;  1YPR A;  1N4O A;  4KZ9 A;  1OTA A;  3BFG A;  3Q82 A;  4ARZ B;  1BSG A;  5KMW A;  3GSG A;  4B93 A;  5L07 A;  2O9C A;  2P9V A;  1CI9 A;  4B4Z A;  3MKE A;  1K4F A;  4QJG A;  5EV0 A;  3VP2 A;  2GDN A;  1G28 A;  4U0T A;  3V3R A;  3R4K A;  4XT2 A;  2WZX A;  1GA0 A;  2Y55 A;  2K2N A;  4GB7 A;  4Y7P A;  2P9V B; 
#chains in the Genus database with same CATH homology
 1ERQ A;  4K91 A;  1K56 D;  4OOL A;  2XGN A;  3FWL A;  3O3V A;  5F82 A;  3I7J A;  4X69 A;  3DWK A;  3PAG A;  4BQM A;  2Y2H A;  1IKG A;  2EX2 A;  5CGX A;  3ZFZ A;  3SS4 A;  4MLL A;  5HAP A;  3DWZ A;  2EX8 A;  2WK0 A;  5HAI A;  4JXG A;  4OLG A;  4N9K A;  3V3S A;  5L2F A;  1WE4 A;  4OPR A;  5EVI C;  4OPZ A;  1K55 A;  4FH2 A;  3BEB A;  4KG6 A;  5EOE A;  1LHY A;  3OPR A;  4IVI A;  4S2P A;  2EXA A;  3IXG A;  3HLE A;  2FFF B;  4S2K A;  4WZ5 A;  4XUX A;  1K56 A;  5U47 A;  3WS1 A;  3SH7 A;  1OME A;  3LY4 A;  4EWF A;  4KZA A;  3ZG7 B;  2X02 A;  1VM1 A;  1MWU A;  3CMZ A;  1CEG A;  4KZ4 A;  4B4X A;  2R9W A;  5E2E A;  3G4P A;  4DRT A;  2XFS A;  2OLU A;  2XEP A;  2J8Y A;  4GD8 A;  1JWZ A;  2XH9 A;  5AQB A;  2ZQA A;  5KSC A;  3HLW A;  5FAP A;  1K6R A;  1NZU A;  1HVB A;  2BG1 A;  4RX3 A;  4NET A;  4S2I A;  3BLM A;  1W7F A;  2Y2K A;  5HAQ A;  1WYC A;  4E3O A;  1M6K A;  2ZQ9 A;  4YIN A;  1NXY A;  3SH8 A;  5CED A;  5GLD A;  5KZH A;  1Y54 A;  1K54 C;  2VGJ A;  1ES5 A;  2WAD A;  2Y2P A;  2WGI A;  3P09 A;  2ZQD A;  4WEJ A;  3RXX A;  3M2J A;  1W79 A;  4OP8 A;  3UPP A;  3IH8 A;  1I5Q A;  3GR2 A;  3O88 A;  3ZNY A;  4JXV A;  4ZTK A;  1SCW A;  1GHP A;  3TSG A;  4ZJ3 A;  2WGW B;  1JTD A;  1E25 A;  4S2L A;  1YMX A;  3W8K A;  1YLJ A;  3UPN A;  1HTZ A;  1S6R A;  5M19 A;  3ZNT A;  1QME A;  4JPM A;  1JVJ A;  4Z9Q A;  5EVI D;  1Q2P A;  3W4P A;  1SDN A;  2IWB A;  4JXW A;  5FDH A;  4LV1 A;  4KZ7 A;  5EVL A;  4KZ3 A;  5TFQ A;  5FSR A;  2HP6 A;  3OPH A;  5EEC A;  1KVM A;  4QHC A;  1IYS A;  1ZKJ A;  1YLP A;  4EBL A;  2Q9M A;  4R3J A;  3NY4 A;  1BTL A;  5FQK A;  1W8Q A;  4HES A;  1N9B A;  1NYY A;  3LY3 A;  2V20 A;  4BL2 A;  4GDB A;  2CC1 A;  3UE1 A;  3UY6 A;  1DJB A;  3LEZ A;  3BFF A;  3VP3 A;  5EVI A;  1CEF A;  4P85 A;  3OCL A;  5F1G A;  1QMF A;  3SH9 A;  4JBF A;  2I72 A;  5FAO A;  2Y2Q A;  3FV7 A;  1NRF A;  1MY8 A;  2ZLY A;  2IWC A;  1EI5 A;  3LCE A;  4MBK A;  4PM5 A;  1BLS A;  2PBY A;  2J9P A;  1PW1 A;  4N1H A;  5FI2 A;  1MXO A;  5A93 A;  2HP9 A;  4QY5 A;  3HLB A;  4ZBE A;  5EVI B;  4KZ5 A;  3OZH A;  2A3U A;  3VOY A;  1ERM A;  1FOF A;  3CZD A;  2PU4 A;  5D3O A;  1DY6 A;  4ZAM A;  3A3I A;  3PAE A;  5DVA A;  3WS4 A;  1S0W A;  4NK3 A;  3DW0 A;  2RL3 A;  1DJC A;  3NDG A;  1O7E A;  3O87 A;  2HDS A;  3P98 A;  4OPY A;  4EQI A;  4E6X A;  3WS2 A;  4QU3 A;  3UDX A;  1J9M A;  5CXW A;  2EX6 A;  3ZHH A;  4R0Q A;  4R4S A;  3UO9 A;  4OLD A;  2WAE A;  5KSH A;  1YLY A;  3FKV A;  4FD8 A;  5DTK A;  4S2J A;  3ZDJ A;  1PIO A;  3D4F A;  4D2O A;  1XX2 A;  3PBN A;  2RCX A;  5EUA A;  1K57 A;  1K38 A;  1E3U A;  4U3T A;  2ZJ9 A;  1CI8 A;  3MZF A;  1XGJ A;  2Y59 A;  4WMC A;  1RGZ A;  1LI9 A;  3OPP A;  4DXC A;  4RX2 A;  1XGI A;  2WAF A;  5A90 A;  3V5M A;  4KQR A;  5J8X A;  4PMA A;  5DTS A;  1NYM A;  4K0X A;  3PBQ A;  4C75 A;  2UWX A;  1K4E A;  3C7V A;  4X6T A;  2Y2N A;  2X01 A;  1IEM A;  2H0Y A;  2JCH A;  4KZ6 A;  4EV4 A;  4E6W A;  3G30 A;  3ZG9 B;  1FR6 A;  1KE4 A;  5FI6 A;  4PM9 A;  1FSY A;  1FCO A;  2J9O A;  4JF4 A;  5JYP A;  3Q07 A;  2Y2L A;  3VSK A;  4R23 A;  1ALQ A;  4LCM A;  4EBP A;  2V2F F;  4FH4 A;  1MBL A;  3G35 A;  3MBZ A;  4PM7 A;  4O7D A;  1KDS A;  4Y0T A;  3VFF A;  1JWP A;  2XD5 A;  3GRJ A;  3NIA A;  1LLB A;  1PI4 A;  2DNS A;  3GMW A;  2WGW A;  3C4P A;  3CG5 A;  4RYE A;  1TDL A;  2WKE A;  1ES4 A;  3WS5 A;  4IBR A;  3ZCZ A;  1MWR A;  4LV2 A;  2ZC3 B;  1GA9 A;  4GD6 A;  4S2M A;  1GHI A;  3BFE A;  3OPL A;  2ZQ7 A;  2P74 A;  3IT9 A;  5CGS A;  3HLG A;  3V39 A;  1KE0 A;  5CTN A;  2Y2J A;  5CHU A;  3VMA A;  4DDS A;  4HBU A;  2G2U A;  2HDR A;  3IF6 C;  1IYQ A;  3C5A A;  1SDE A;  5GHY A;  1ES2 A;  4OH0 A;  3G2Y A;  1HZO A;  1L0G A;  3RJU A;  2G2W A;  4K0W A;  5DTT A;  4MEZ A;  3S4X A;  3ZG8 B;  1IYP A;  2ZD8 A;  5AQA A;  1IYO A;  1W5D A;  4F94 A;  3WS0 A;  5BOH A;  1Z6F A;  1C3B A;  1JTG A;  3AGE A;  1LL9 A;  3CJM A;  1WYB A;  4OQI A;  3WWX A;  3G32 A;  2E8I A;  1ES3 A;  2QPN A;  3UDI A;  2Y91 A;  1SHV A;  3IF5 A;  1I2W A;  2ZM0 A;  3MZD A;  1G6A A;  4OOM A;  2EXB A;  5EOO A;  4BD0 A;  4E3N A;  1L0F A;  5M1A A;  3OCN A;  1ZG4 A;  4OP5 A;  4A5R A;  1XA7 A;  3QHY A;  4BD1 A;  5FQI A;  1MWS A;  3VOZ A;  4DE0 A;  2EFX A;  1BLC A;  3ITB A;  4LV3 A;  4JF5 A;  4OON A;  5HFO A;  3Q7V A;  1NZO A;  2ZC7 A;  4ZJ2 A;  2ZMA A;  5E43 A;  3HUN A;  4OPQ A;  5AQ7 A;  4CPK A;  5CER A;  1PZP A;  3N8S A;  2HPB A;  4UAA A;  3IXH A;  5FI7 A;  1YLZ A;  1XA1 A;  1L2S A;  4IBX A;  2HP5 A;  4E3L A;  3QNC A;  2WUQ A;  4KG5 A;  4DF6 A;  1PWD A;  2JC7 A;  4DKI A;  4DXB A;  3N8R A;  4X68 A;  5E2H A;  4WZ4 A;  1EWZ A;  1K55 C;  2OSU A;  2H10 A;  1JWV A;  3Q7V B;  4JF6 A;  4UA6 A;  1IEL A;  2IWD A;  2PU2 A;  3Q81 A;  2WKH A;  1BLH A;  2Y2G A;  4S2N C;  4B88 A;  3IWQ A;  2XR0 A;  3C4O A;  3G31 A;  4ID4 A;  3S1Y A;  1PWC A;  2Y2O A;  1TDG A;  1VQQ A;  5GLC A;  3UE3 A;  3DTM A;  1MPL A;  3VP4 A;  3IH9 A;  4KZB A;  3MKF A;  3G2Z A;  4GN2 A;  4JXS A;  1K54 A;  2XQZ A;  4KZ8 A;  5DF8 A;  3IHB A;  4GZB A;  2XK1 A;  3BFD A;  5EE8 A;  1MWT A;  3QNB A;  4QB8 A;  4LCL A;  1H8Y A;  2Z2M B;  4BLM A;  5JYO A;  3IQA A;  4GDN A;  4WM9 A;  1I2S A;  1CK3 A;  3C7U A;  1HD8 A;  1L0E A;  1PI5 A;  3PBO A;  4BJP A;  5CEC A;  2X71 A;  4GOG A;  5FA7 A;  3LO7 A;  5A92 A;  4MBF A;  4EBN A;  1KVL A;  1H8Z A;  2V1Z A;  3G34 A;  3M2K A;  3IXD A;  1Q2Q A;  3IF6 B;  4MNR A;  4R4R A;  4OQG A;  4RA7 A;  5GLB A;  3EQV A;  3BEC A;  5IHV A;  3O86 A;  3ZVT A;  4H8R A;  5FQQ A;  3VSL A;  3N6I A;  3N4I A;  1PW8 A;  1YLW A;  4R3B A;  1KGF A;  4E3I A;  5HL1 A;  4Q8I A;  2B5R A;  1ZC2 A;  3GTC A;  1YM1 A;  3FKW A;  4PPR A;  4N9L A;  3EQU A;  5TGF A;  3WRT A;  1NJ4 A;  4RVA A;  4WEK A;  2WGV A;  5CHJ A;  1GCE A;  2ZQ8 A;  3BM6 A;  1PYY A;  3E2K A;  3ISG A;  1NY0 A;  4KEN B;  1LI0 A;  3M6H A;  1KGE A;  1K25 A;  2DRW A;  4QD4 A;  2ZC5 B;  2Y2M A;  2JE5 A;  4P0M A;  3SS3 A;  3BYD A;  3IXB A;  5FQJ A;  4KQQ A;  3NDE A;  1RCJ A;  4XXR A;  4Y0U A;  3TOI A;  2OV5 A;  2EX9 A;  5CGW A;  1BUL A;  3S22 A;  5EPH A;  2ZC4 B;  4IVK A;  5GLA A;  3JYI A;  1GHM A;  1DJA A;  1KE3 A;  2QMI A;  2XDM A;  3GQZ A;  2EFU A;  3OC2 A;  3GVB A;  4S2N A;  2BLS A;  4HBT A;  1FCN A;  1ESU A;  1ZG6 A;  3HBR A;  3UE0 A;  3ZGA B;  3V50 A;  2QZ6 A;  2WZZ A;  1PWG A;  1BLP A;  5FQM A;  5CRF A;  4LV0 A;  3HUM A;  4WBG A;  3E2L A;  4ZDX A;  4OKP A;  3MFD A;  1RP5 A;  3WRZ A;  1FCM A;  4UA9 A;  2OLV A;  4X55 A;  3TG9 A;  2ZM8 A;  4JLF A;  4DE2 A;  2WKI A;  3N7W A;  4XUZ A;  5CTM A;  3FZC A;  1ESI A;  5HW3 A;  1U60 A;  4Y0O A;  4GNU A;  5GHZ A;  5E2F A;  3UDF A;  1BUE A;  2H0T A;  3SS5 A;  4DE1 A;  3BFC A;  4P6B A;  4BL3 A;  1BZA A;  5E2G A;  1XPB A;  5M18 A;  2A49 A;  3NC8 A;  1YMS A;  2Q9N A;  4GKU A;  5FAQ A;  1AXB A;  4M3K A;  3GV9 A;  1L0D A;  4X56 A;  5CHM A;  3NCK A;  4BEN A;  1K57 C;  2DCF A;  4CJN A;  4PM6 A;  4E3K A;  5CEB A;  4WEL A;  4DE3 A;  4U0X A;  2ZQC A;  3SOI A;  2Z2L B;  4EUZ A;  2JBF A;  4FSF A;  5DF7 A;  3PBR A;  5FAT A;  3HVF A;  1ONG A;  1M40 A;  3NI9 A;  2C6W B;  3RXW A;  4E3J A;  3W4Q A;  3HLC A;  4OQ0 A;  3IHA A;  2ZM2 A;  4WYY A;  5I94 A;  1XP4 A;  3ZG0 A;  1TEM A;  5AQ9 A;  5FQ9 A;  4FCF A;  1PZO A;  3ZG5 A;  4R1G A;  1IKI A;  5GHX A;  3UPO A;  3BLS A;  3IWO A;  3VP0 A;  2FFY A;  1W8Y A;  4QY6 A;  1KDW A;  2XLN A;  3IWI A;  2VGK A;  1XXM A;  3PBS A;  1XKZ A;  3N8L A;  3B3X A;  3PBT A;  2XFT A;  3Q1F A;  4C3Q A;  4N92 A;  4WZ5 C;  3HLD A;  1TVF A;  5G18 A;  3VP1 A;  1FR1 A;  4MBH A;  1YLT A;  1SKF A;  1ERO A;  1FQG A;  1RGY A;  1BT5 A;  2WYX A;  3A3E A;  3HL9 A;  5GL9 A;  2Y2I A;  3W4O A;  4YFM A;  2XF3 A;  3FYZ A;  3HLF A;  4L0L A;  1O07 A;  3A3J A;  4IED A;  4S2O A;  3UN7 A;  1N4O A;  3ZVW A;  4KZ9 A;  3BFG A;  3A3F A;  3M6B A;  4OOY A;  3IF6 A;  3Q82 A;  3AGF A;  4KQO A;  3NBL A;  5HX9 A;  2J7V A;  1FSW A;  4C6Y A;  1LL5 A;  3ITA A;  2Y4A A;  4X53 A;  1BSG A;  1ONH A;  3MXS A;  3UNW A;  5KMW A;  4OVD A;  1E3U D;  5F1F A;  1YQS A;  3GSG A;  1MKI A;  4ZJ1 A;  5A91 A;  3MZE A;  1E4D A;  5TR7 A;  2C5W B;  3A3D A;  4WMC D;  2H5S A;  5FAS A;  5HAR A;  2P9V A;  1CI9 A;  1G68 A;  4B4Z A;  3MKE A;  1K4F A;  4HEF A;  4N1X A;  3PTE A;  3VP2 A;  4QJG A;  2GDN A;  4P87 A;  4U0T A;  3V3R A;  1KGG A;  1YT4 A;  4KG2 A;  4UA7 A;  3HRE A;  2XD1 A;  2HDQ A;  1K6S A;  2WZX A;  3MXR A;  2HDU A;  1H5X A;  1GA0 A;  3AGD A;  4DDY A;  4OQH A;  2Y55 A;  2ZC6 B;  3BRM A;  4LEN A;  4PM8 A;  2R9X A;  5DF9 A;  4GB7 A;  5F83 A;  3Q7Z A;  4E3M A;  4UHU A;  3VFH A;  3HUO A;  4Y7P A;  4JKT A;  2P9V B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...