4OPQA

Room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutations
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
258
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 258
sequence length 263
ec nomenclature
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4opqA00
3MKFA 4WMCD 4LV3A 1ES2A 5A93A 4BL3A 3Q7VA 4OONA 3UE0A 2R9XA 4K0XA 3E2KA 1BSGA 2H0TA 3NY4A 1SHVA 5A90A 1I5QA 4JPMA 5G18A 2V20A 2ZQCA 3ZDJA 4QJGA 3CMZA 1U60A 1Q2PA 4N1HA 3GTCA 4E6WA 3LEZA 4DE0A 4EQIA 1PI5A 4E3IA 4MNRA 1CK3A 1DJCA 1EI5A 2Z2MB 3M2JA 3MFDA 3BYDA 1H5XA 4JXWA 4PM6A 4N9KA 4OKPA 3IHBA 1GHPA 3Q7ZA 3UPPA 4JKTA 5FATA 4FSFA 4WMCA 1FSWA 4OVDA 3WWXA 3IWQA 3PBSA 1ZC2A 3AGEA 5HAIA 5FI2A 5IHVA 1FR6A 1FR1A 4UA9A 3G2ZA 1FCOA 2PU4A 4UAAA 4GDNA 1W8YA 3ZG5A 3OPRA 1DJAA 3G30A 3OZHA 3IXHA 1JTGA 4QHCA 4XUXA 3N6IA 2WAEA 5HFOA 4B88A 1IELA 3IF6C 2ZM8A 4EBPA 4KQOA 1MWSA 1HVBA 4M3KA 2WUQA 2Y55A 2ZC4B 1NYMA 2DRWA 1YLJA 3AGDA 2HP9A 4Y0OA 3IXBA 5CHUA 3WRZA 1FSYA 4MLLA 1RCJA 4GDBA 1BZAA 5FQ9A 4KZAA 4Z9QA 1J9MA 1BULA 1XP4A 3WS1A 4E3LA 3VP1A 4ZAMA 3QNCA 1TDLA 3ZG8B 4JXGA 5EOEA 4CJNA 2EX8A 3C4PA 3C7VA 1KE4A 4RX2A 3BFDA 3OPPA 1XXMA 1VQQA 3WS4A 3IHAA 3UNWA 4YFMA 1GCEA 1XPBA 3BECA 5AQ9A 2ZQDA 3O86A 1KDWA 5KZHA 1MWRA 2ZQ7A 4OOYA 3S22A 2ZD8A 5M1AA 1PWDA 1H8ZA 2JE5A 5E2FA 4D2OA 2E8IA 3BLMA 4DXBA 1QMEA 1L0GA 5FQMA 2XFTA 3UPOA 3HUNA 4BL2A 3GRJA 4NK3A 4WBGA 4FH4A 1K54A 4HBTA 5GLDA 3PAEA 3WS2A 4XXRA 1Q2QA 4NETA 2WGWB 3PAGA 4QY6A 1ERQA 4U3TA 4OQIA 3WS0A 1KGFA 1YMXA 4R3BA 4YINA 4HEFA 2Q9NA 4ZDXA 5F82A 1MKIA 4MEZA 3OPLA 5HARA 1NXYA 1XA1A 2Z2LB 4S2PA 3ITBA 2XD5A 3LO7A 1EWZA 3C4OA 3QHYA 3BEBA 4IEDA 3NDEA 3ZG7B 2Y2QA 2HDQA 3IF6B 2WKEA 2HPBA 1SDNA 4DXCA 1TVFA 2EFXA 3Q7VB 4KZBA 3V39A 5DF7A 5EUAA 1K6RA 3N8LA 3EQVA 3A3DA 1YM1A 2WADA 2GDNA 4EBNA 1ES5A 3DW0A 1ZG4A 3SS4A 4DF6A 1YQSA 2B5RA 3UN7A 4WM9A 3IWIA 4PMAA 2Y59A 2HP5A 3WS5A 1BLHA 2Y2MA 4U0XA 5A92A 4PM7A 1K54C 4L0LA 3E2LA 5GHYA 5HAPA 1L0FA 3FWLA 5FQQA 3HLDA 3IT9A 1MXOA 3S1YA 4E3JA 5JYOA 4X6TA 1ZKJA 1PYYA 4N9LA 1WYBA 1M6KA 2XGNA 5HL1A 3LY3A 5GLCA 3SH8A 3M2KA 2XLNA 1K56A 3O87A 3V3SA 1MPLA 4JBFA 5FQJA 4P6BA 4DDYA 4X55A 3FKWA 3M6HA 5E43A 4BENA 4X53A 3G32A 5FQIA 1CI9A 3UPNA 1HD8A 1LI0A 4LCLA 2IWDA 2VGKA 2Q9MA 5EECA 5GHZA 5AQAA 4R23A 5CHJA 4OQHA 4C6YA 1NZOA 2UWXA 4RYEA 2EFUA 5GHXA 3IH9A 3N8RA 1PW8A 5CHMA 1XGIA 1ES4A 4ZJ2A 3FKVA 3B3XA 2J7VA 3ISGA 2WZZA 1GA9A 1C3BA 3I7JA 2ZMAA 4R0QA 3PBRA 4EWFA 1ESUA 2HDSA 4Y0TA 5CGXA 1W7FA 3DWZA 2FFYA 4JF5A 5KSCA 3P98A 3SOIA 3FZCA 4DE2A 2R9WA 1BLPA 3MZFA 3RJUA 3VP4A 1XX2A 3UO9A 5GLAA 5FI6A 1SDEA 1FOFA 3DTMA 1YLWA 3VP0A 4S2NA 2Y2KA 4ZTKA 4DRTA 1E3UD 1XKZA 4OLGA 3ZG9B 5CGWA 3PBTA 4OPYA 4JXSA 2DCFA 3IQAA 1KE0A 3G2YA 3MZDA 2QPNA 5EPHA 1W8QA 4JF4A 4ZJ3A 1K55A 3PBNA 4E3KA 4HBUA 1CI8A 2G2UA 1NJ4A 4GD6A 4RVAA 1BUEA 1KE3A 3M6BA 2EX6A 1NZUA 2H5SA 2XQZA 3IXGA 4X68A 2WK0A 4WYYA 3HUMA 2Y2JA 4FH2A 5L2FA 3BRMA 2WAFA 3HLBA 4QB8A 3CJMA 2EX9A 1E3UA 1SCWA 2PU2A 3G35A 3ZNYA 3HLEA 1W5DA 5CERA 3BM6A 4HESA 3W8KA 4QU3A 2Y2IA 3MXSA 4O7DA 2ZC3B 4OPRA 3GR2A 4KZ4A 1GA0A 1ALQA 1BLCA 2Y2GA 4B4ZA 4E3MA 4Y7PA 3NI9A 4S2NC 3NCKA 5EVIA 2J9OA 3GSGA 1YT4A 1TDGA 3C7UA 3Q82A 1RP5A 4LV1A 3CG5A 4R3JA 5HAQA 4B4XA 4KG6A 4KZ9A 3ZG0A 4OPZA 3A3EA 1FQGA 1LHYA 4KZ8A 5FDHA 4ZJ1A 3RXXA 1MWUA 1LL5A 5TGFA 3V3RA 5E2GA 3HLFA 2EXAA 2WKHA 4OLDA 1K55C 4H8RA 2BG1A 4K0WA 3Q07A 1G68A 1NYYA 3UDIA 1YLYA 4R1GA 4IVKA 2X02A 3TOIA 3MZEA 1L2SA 3C5AA 2QMIA 1KDSA 1TEMA 2XD1A 1PZPA 4LV0A 5FA7A 3VOZA 2CC1A 1GHIA 4ID4A 3VMAA 1XA7A 4JF6A 3WRTA 2HP6A 3SH9A 3GVBA 3ZVTA 2G2WA 1NRFA 4JLFA 4S2IA 4ZBEA 4MBHA 1ONHA 1K56D 5F83A 4R4SA 4EUZA 3GV9A 2HDUA 3N7WA 3VOYA 3P09A 2A3UA 3CZDA 3HLWA 2H10A 2WYXA 4OOMA 4OP8A 4X69A 1JTDA 1GHMA 3MBZA 1K57A 3G4PA 5EVIC 4N1XA 1BLSA 4KQRA 3G31A 2EXBA 3G34A 5GLBA 5CGSA 4K91A 4C75A 2JCHA 5FASA 1M40A 4RX3A 2C6WB 1QMFA 3OCLA 5D3OA 4N92A 2OV5A 1IKIA 4GOGA 4RA7A 3W4PA 1ERMA 1KGGA 4GN2A 5CTNA 1L0DA 3PBQA 4PM5A 1ONGA 4XUZA 4WEKA 4QD4A 1ESIA 2Y2OA 4BD1A 3O88A 3NDGA 4LV2A 4WZ5A 5CXWA 4BJPA 1E25A 1N4OA 1SKFA 5AQBA 2IWBA 2J9PA 1IKGA 4WELA 2OLVA 1S0WA 2XEPA 1PIOA 2ZC6B 3D4FA 3PTEA 5EOOA 3QNBA 2ZQAA 4Y0UA 5DTTA 4BLMA 4WEJA 4CPKA 2RCXA 3MKEA 4QY5A 2OLUA 3ZCZA 4P85A 4E3NA 3N8SA 3NBLA 3EQUA 2ZQ8A 3HLGA 4LENA 2Y2PA 3A3JA 2HDRA 5CRFA 5FQKA 3SS5A 3LCEA 2XH9A 1K57C 3ZNTA 4BQMA 1IEMA 2PBYA 4S2JA 2V1ZA 3VP2A 2VGJA 1L0EA 4OOLA 4X56A 3A3FA 3FV7A 1CEGA 2WZXA 2X01A 3ZVWA 3UY6A 2ZM2A 3LY4A 5DTKA 5I94A 1EROA 2Y2NA 1FCMA 1K38A 4KZ3A 1KGEA 2XR0A 3HREA 3HL9A 3HLCA 5DF9A 5F1GA 5EE8A 2J8YA 1O07A 2C5WB 2ZC7A 4WZ5C 3HUOA 4GZBA 5EVIB 1YLTA 2XDMA 2I72A 4PM8A 1DY6A 1YLPA 3UE1A 5F1FA 1BT5A 3AGFA 1H8YA 2JC7A 4PPRA 5KSHA 1MWTA 1LL9A 3V5MA 3IH8A 1IYOA 1Z6FA 2Y2HA 5DTSA 5FAQA 2ZJ9A 2FFFB 5EVID 3W4OA 4E6XA 1K4EA 1LLBA 4OQ0A 2XK1A 1PZOA 5J8XA 4S2OA 2BLSA 4KG5A 2Y91A 5U47A 4A5RA 3BFCA 5CTMA 5GL9A 2ZC5B 3OCNA 5BOHA 3Q81A 2A49A 2ZM0A 4S2MA 2V2FF 4UHUA 3Q1FA 5DVAA 5E2HA 3IXDA 4S2KA 5JYPA 4UA6A 2X71A 3BFGA 1DJBA 1KVMA 5A91A 4DE3A 2JBFA 4F94A 1NY0A 3IF5A 2P74A 1LI9A 3VFFA 4E3OA 1VM1A 3A3IA 5CEDA 3UDXA 2WGIA 5FI7A 4FD8A 3VSKA 4R4RA 4DKIA 3GMWA 4WZ4A 3S4XA 2ZLYA 5FAPA 3OPHA 3SH7A 1IYSA 4IBRA 3DWKA 3OC2A 1AXBA 4DDSA 5AQ7A 4MBKA 5CEBA 3IWOA 3BLSA 1JWZA 2OSUA 3N4IA 1OMEA 1K4FA 1JWVA 1WE4A 1KVLA 1YMSA 4KZ7A 4P0MA 1RGYA 1I2WA 1PWCA 3VP3A 2Y4AA 3JYIA 4Q8IA 3NIAA 3NC8A 4GKUA 2P9VB 2XF3A 4EV4A 1PWGA 2WKIA 3TSGA 2XFSA 4PM9A 4DE1A 1MY8A 1JVJA 1S6RA 3VSLA 4C3QA 1W79A 4S2LA 2RL3A 4U0TA 3RXWA 3VFHA 2QZ6A 2DNSA 1ES3A 1WYCA 4IVIA 4KZ5A 2EX2A 3FYZA 1HTZA 1O7EA 5CECA 1HZOA 3GQZA 4KZ6A 4LCMA 1RGZA 1ZG6A 4MBFA 1PI4A 1PW1A 3BFFA 1G6AA 3HBRA 1IYQA 1E4DA 3MXRA 4OQGA 5TR7A 5EVLA 1YLZA 3UE3A 1K25A 1BTLA 4GB7A 4GD8A 5E2EA 5FAOA 5HW3A 3UDFA 5M18A 4BD0A 4JXVA 4UA7A 1FCNA 4OPQA 1XGJA 4OH0A 2WGVA 1I2SA 4P87A 3ZHHA 3W4QA 1CEFA 1K6SA 5KMWA 3SS3A 2WGWA 2P9VA 4IBXA 3HVFA 3O3VA 4KENB 4GNUA 5FSRA 5HX9A 2ZQ9A 1IYPA 1MBLA 3PBOA 3ZFZA 2H0YA 3TG9A 4FCFA 4EBLA 3BFEA 4KQQA 2Y2LA 1JWPA 1N9BA 1Y54A 3ITAA 3V50A 3ZGAB 4KG2A 5M19A 5DF8A 5TFQA 2IWCA 4OP5A 3IF6A
chains in the Genus database with same CATH superfamily
3LIEA 4LV3A 5IT5A 2PD7A 4X1MA 2R9XA 2JKTM 4M4XA 3E2KA 3F1NA 2H0TA 3NY4A 3S7PA 2V8FA 3E0YA 1S67L 5HDCA 1Q2PA 2QHKA 4E6WA 3LEZA 4EQIA 4E3IA 2Z2MB 1EI5A 4PM6A 4JXWA 4N9KA 4OKPA 1D7EA 3VOLA 4JKTA 5FATA 3VE4A 4WMCA 3WWXA 3PBSA 4NXGA 4P6ZS 5IHVA 1FR6A 4UA9A 4R3AA 2PU4A 2PYPA 3PHYA 1W8YA 1DJAA 3OZHA 3OLOA 1JTGA 4QHCA 3N6IA 4B88A 3IF6C 1HVBA 4HJ3A 3MR0A 2ZC4B 4Y0OA 4GJ4A 3IXBA 4GHIB 1FSYA 1RCJA 4GDBA 1EW0A 3QNCA 1VETA 5EOEA 2EX8A 4RX2A 4YFMA 5AQ9A 2BASA 3T1XA 1H8ZA 2YKHA 1QMEA 4F3LA 1TS7A 2XFTA 4BL2A 4NK3A 4FH4A 1K54A 4HBTA 4LRZE 2PAVP 5EVEA 4QY6A 3PAGA 3H82B 1KGFA 1F98A 1N9NA 2JN7A 4Y15A 4HEFA 4ZDXA 1MKIA 3C2WA 3ITBA 2XD5A 1H0MA 3C4OA 3QHYA 3BEBA 4IEDA 3ZG7B 1SDNA 3Q7VB 3LGOA 5EUAA 5EV0A 1ES5A 3CPTB 4FUWA 4ESPA 2HP5A 1BLHA 3QP8A 1UGUA 4PKYG 2XA7S 5L09A 5GHYA 5HAPA 3B47A 3S1YA 4E3JA 4X6TA 1ZKJA 4ETXA 1WYBA 5HL1A 5HD5A 2JHEA 5GLCA 3SH8A 3O87A 4DDYA 4EESA 4X55A 3M6HA 5E43A 2HJEA 5J3WA 5FQIA 1CI9A 3UPNA 1HD8A 5GHZA 5L07A 3BWLA 1VB6A 4XT2A 3NOUC 1VEUB 3FKVA 2I9VA 2J7VA 3ISGA 1GA9A 4O01A 1C3BA 4UQIM 4R0QA 4EWFA 3KYEA 1W7FA 5KSCA 1MKMA 3MZFA 3T4LA 3RJUA 1XX2A 1YKDA 1FOFA 1YLWA 4ZTKA 4DRTA 1E3UD 2B95A 2Y79A 3FC7A 3CAXA 1KE0A 3G2YA 3MZDA 4RQ9A 4GS9A 2HZ5A 1W8QA 4HIAA 3PBNA 5TJJA 4GD6A 2XQZA 4WYYA 3HUMA 2Y2JA 5L2FA 2KOIA 1YSPA 3G35A 2WKQA 3BM6A 3W8KA 4O7DA 3GR2A 4KZ4A 4CLCD 5DJUA 3T4TA 4E04A 1P9WA 2V1BA 5HWTA 3RTYA 2J9OA 1T1BA 3KX0X 2A24B 3Q82A 5TBMA 2V0WA 4KZ8A 3V67A 3C38A 3T4KA 4H8RA 4JGQA 4K0WA 3S7QA 2JKRI 1L2SA 3LR0A 3TOIA 1G6OA 2QMIA 3VOZA 2G2WA 1NRFA 5AVEA 4JLFA 4S2IA 4ZBEA 4L9FA 4EUZA 1LSVA 3VOYA 3IX8A 3HLWA 3A0RA 1JTDA 1GHMA 3MBZA 1K57A 2VGLM 5EVIC 4N1XA 3KO6A 4KQRA 5DFXA 4L9GA 5AVFA 4FOFA 4C75A 2JCHA 3IX3A 1XFQA 1M40A 3NULA 2LB5A 4RX3A 5D3OA 1IKIA 1ERMA 1KGGA 1L0DA 1ESIA 2Y2OA 4BD1A 2KDKA 3NOPC 1E25A 1N4OA 1SKFA 5AQBA 1IKGA 1S0WA 2Q0OA 3D4FA 3PTEA 5DTTA 4WEJA 3R7WB 2RCXA 2OLUA 4P85A 4NEED 5HWWA 5C5KA 3ZNTA 4BQMA 4S2JA 3RFBA 1NWZA 2EWWA 3A3FA 1CEGA 3LI9A 3ZVWA 3LY4A 5KIZA 3R4KA 4KZ3A 2XR0A 3HL9A 5DF9A 4NXFA 2J8YA 4WZ5C 2W1TA 2ZL1A 2XDMA 3UE1A 1BT5A 3AGFA 1Y28A 2JC7A 5HSQA 1D06A 5DTSA 2ZMFA 2XK1A 3F1OA 5J8XA 3BQ8A 4KG5A 2Y91A 5CTMA 1SKOA 5F69A 3Q81A 3Q1FA 3IXDA 3U2AA 3ZYTA 1NY0A 3IF5A 3NJAA 4X1LA 1VM1A 3B33A 3GMWA 3S4XA 3OPHA 4IBRA 4IUHA 1JWZA 4D60A 2HF6A 1YMSA 1BYWA 2M7UA 3VP3A 2Y4AA 3JYIA 3VV4A 3NC8A 4GKUA 2XF3A 4L9EA 1G28A 3TSGA 1MY8A 1JVJA 1S6RA 1W79A 3VFHA 4CQHA 1WYCA 4IVIA 1HTZA 3T4QA 1HZOA 3UMEA 1RGZA 1ZG6A 4HY8A 2D01A 1LT0A 1K25A 4GCZA 1BTLA 5E2EA 5FAOA 5M18A 4MMNA 3UDFA 1T18A 4BD0A 4JXVA 2WKPA 1FCNA 4P87A 2W3GA 3LR3A 3ZHHA 4HJ6A 3MXQA 5KMWA 2P9VA 4NKPA 1WA9A 4GNUA 4Y3IA 5HX9A 3ZFZA 2H0YA 3TG9A 3BFEA 3ITAA 3HJKA 3ZGAB 1OTAA 2IWCA 4OP5A 3EEAA 3TRCA 5A90A 1SHVA 1I5QA 4JPMA 2VEAA 2V20A 2W3EA 4QJGA 1U60A 1LSWA 3GTCA 3LFVA 1PI5A 4MNRA 5F1FA 1DJCA 3MFDA 3T12B 1FSWA 4OVDA 3IWQA 5HAIA 5FI2A 2VZWA 3G2ZA 3DTEA 4UAAA 3EOIA 3ZG5A 5FDSA 2WAEA 4EBPA 3QP1A 1MWSA 2Y55A 1NYMA 2J3WA 1LSXA 1BZAA 4KZAA 3VP1A 1TDLA 3ZG8B 4CJNA 3C4PA 4YWZA 3OPPA 2BTFP 2W3FA 2KLIA 1GCEA 3A0SA 3FPVA 4WF0A 3S22A 3BW6A 4LLOB 2JE5A 4D2OA 1K0KA 3TE8A 5FL3A 5FQMA 3T4SA 1TS6A 2PYRA 2HV1A 2JKRM 3GECA 3PAEA 1Q2QA 5HL6A 1ERQA 3WS0A 4OQIA 4MCWA 1YMXA 2PDRA 4R3BA 3OPLA 1NXYA 1XA1A 4IUKA 4S2PA 3LO7A 3PR6A 2Y8HA 2HDQA 3IF6B 2PR6A 1TVFA 1LL8A 5DF7A 5DKLA 3EQVA 3DW0A 3SS4A 2W27A 3H7WB 1OTIA 3IWIA 1MC0A 4LPZA 3WS5A 4I39A 4XT2B 1K54C 2KX6A 1L0FA 3PYPA 3IT9A 2G7UA 1M6KA 4Y5FA 1N9LA 5FEFA 3IBJA 1K56A 4AFIA 3V3SA 1MPLA 3FKWA 4BENA 4X53A 5HZHA 2VGKA 5EECA 5AQAA 2NUTC 4RYEA 5CHMA 2VX8A 1ES4A 2WZZA 2ZMAA 1ESUA 3MJQA 2FFYA 3FZCA 4DE2A 2R9WA 3MFXA 2XRNA 5GLAA 5FI6A 1SDEA 4S2NA 5DFYA 4GLQA 1HLUP 3DAVA 1XKZA 2O9AA 5CGWA 3PBTA 4OPYA 4IHQA 4JXSA 5J7EA 1W63M 5EPHA 4JF4A 4MN7A 1CI8A 1NJ4A 3M6BA 2EX6A 2H5SA 2WK0A 4QB8A 3TJZC 2EX9A 1OTDA 1E3UA 2PU2A 2Y2IA 1GA0A 5HPIA 1BLCA 1NLYA 4B4ZA 2W0NA 3NI9A 3UB5P 3NCKA 2AVXA 3GSGA 1TDGA 3C7UA 1RP5A 3CG5A 4KZ9A 3LIAA 4OPZA 2J3TD 4DJ2A 4I3JA 4ZJ1A 3RXXA 5L10A 3H9WA 3V3RA 5E2GA 3FG8A 3HLFA 2WKHA 1S4RA 3NOTC 4R1GA 2X02A 3MZEA 3C5AA 4MN5A 5FA7A 4CLCA 2CC1A 1XA7A 1ONHA 1K56D 4QPRA 2XA7M 4R4SA 2INWA 4WLAA 5F68A 4WUJA 3N7WA 3CZDA 4OOMA 2H10A 4HH3A 3BY8A 4BBUA 2EXBA 1P9RA 4EQ1A 5GLBA 2K31A 2C6WB 1QMFA 3OCLA 4N92A 2OV5A 2E8JA 3W4PA 5G4YA 5CTNA 1VHMA 4R70A 5F5YA 3UB7A 5AJGA 4LV2A 2IWBA 1TD5A 2J9PA 4O8GA 1IFQA 3D9YA 2XEPA 3QP2A 1PIOA 5EOOA 2ZQAA 3MKEA 4QY5A 3ZCZA 3N8SA 3HLGA 4LENA 2HDRA 5FQKA 1NRJA 1K57C 3DTIA 2VGJA 1L0EA 1NLZA 4OOLA 4I38A 2B02A 2X01A 2K7SA 5DTKA 5I94A 2Y2NA 1FCMA 1ACFA 5F1GA 4JGOA 2ZC7A 2C5WB 3HUOA 4GZBA 5EVIB 1YLTA 2QYBA 4PM8A 1YLPA 3C8CA 4PPRA 4UQIS 1Z6FA 3E4QA 4LGWA 2WKRA 4S2OA 2YKFA 2VK3A 3BFCA 2GNXA 2ZC5B 3JVUA 2V2FF 4UHUA 5DVAA 2X71A 5A91A 2JBFA 4HP9A 4LFUA 2MJ6A 2P74A 1LI9A 3U4LP 2ACGA 3VSKA 4R4RA 2K2NA 4H6JB 2ZLYA 3SH7A 1IYSA 3UB8A 5AQ7A 5CEBA 1A0KA 2OSUA 5IS1A 1V9ZA 2GX5A 1K4FA 1WE4A 4KZ7A 3MF0A 3C30A 5I5LA 2OWHA 1T1CA 2V8CA 1P0ZA 1T19A 4GHIA 4WN5A 3NIAA 2P9VB 4EV4A 3ULFA 4PM9A 3S7NA 3VSLA 1FILA 4C3QA 2RL3A 3RXWA 3E4PA 3LIBA 2OOLA 2EX2A 3FYZA 1PI4A 1TS0A 1PW1A 1S66L 3KSIA 1G6AA 3IX4A 1IYQA 1E4DA 5EVLA 4GB7A 3K3CA 3F1PB 4OH0A 3ZQ5A 3T4OA 2XROA 4Y13A 4G3WA 3H82A 3KSFA 3O3VA 1IYPA 4FTXA 2W3HA 3V50A 4ETZA 4KG2A 3CITA 5DF8A 4WL9A 4CPKA 3MKFA 1MZUA 4BL3A 3Q7VA 4OONA 3K3DA 4K0XA 2P04A 1BSGA 2VA0A 3MQ0A 4EEPA 5G18A 2ZQCA 4EUVA 1OPXA 4YOFA 4DE0A 1T1AA 1GSWA 1OTEA 3JVVA 3M2JA 3BYDA 1H5XA 5EM0A 3IHBA 1GHPA 3UPPA 4FSFA 1ZC2A 3AGEA 2M7VA 2DMWA 1TS8A 4GDNA 3IXHA 2PT7A 2ZM8A 4ARZB 4M3KA 2WUQA 3AGDA 2HP9A 1L3LA 1XP4A 1BULA 4G3VA 4ZAMA 1F9IA 2JKGA 3C7VA 1G5UA 1VEUA 3BFDA 1XXMA 1VQQA 3FPWA 1XPBA 2ZQDA 3O86A 1KDWA 5KZHA 4NXEA 3IBRA 5M1AA 1PWDA 3E98A 5E2FA 1DP9A 3BLMA 4DXBA 1CQAA 4WBGA 2OAQ1 2VLGA 3HJIA 5IU1A 4NETA 2WGWB 1UWPX 3GDIA 4U3TA 3CHWP 4YINA 3LIFA 5F82A 4MEZA 4NXBA 3LR5A 4KQDA 2VKSA 2Z2LB 1H3QA 1UWNX 2Y2QA 4HQAA 2HPBA 2HJ9C 4II7A 3V39A 3UE6A 3N8LA 3F1NB 2GDNA 4ZRRA 1ZG4A 4DF6A 2B5RA 4WM9A 1X0OA 3D72A 2UV0E 2Y59A 2Y2MA 4U0XA 4PM7A 4L0LA 3E2LA 3O5YA 3FWLA 1OJ5A 3HLDA 5HDSA 4N9LA 2W1RA 2XGNA 3LY3A 4HP4A 2XLNA 1J3WA 3G32A 1Y4OA 2H28A 3UMDA 4LCLA 1PRQA 2Q9MA 3D3OA 4R23A 5CHJA 4OQHA 3TW8A 4C6YA 1VETB 2V1AA 5GHXA 3IH9A 3T1RA 2OAP1 4MN6A 5HPFA 2QKPA 3B3XA 1CJFA 4Y0TA 5CGXA 4JF5A 3P98A 3SOIA 1BLPA 2JKFA 4Q0JA 1F2KA 4F3LB 3DTMA 2Y2KA 3K2NA 3ZG9B 3IS2A 1ZHHB 2VV8A 3R7WA 2DCFA 3IQAA 2V9AA 2QJ7A 1ODVA 2FZ0A 2P08A 4ZJ3A 2O99A 1K55A 2R78A 4HBUA 2G2UA 1NZUA 3IXGA 2NUPC 3HLBA 3CJMA 4CLCB 1W5DA 3BY9A 3QP6A 4HESA 3LUQA 4Q0IA 3MXSA 2ZC3B 1S1ZA 1ALQA 2Y2GA 4E3MA 4Y7PA 4DN0A 4S2NC 1YT4A 4LV1A 4B4XA 3ZG0A 3A3EA 1FQGA 1XJ3A 5FDHA 3LR4A 1LL5A 4DMZA 4OLDA 2ZOHA 2PR5A 2BG1A 1S1YA 1G68A 5EFWA 1YLYA 4HOIA 1TEMA 1PZPA 4LV0A 3VMAA 1GHIA 1GSVA 4X25A 4JF6A 3CUEA 3SH9A 2D02A 3P09A 2WYXA 4OP8A 2ZBBA 3G4PA 3JPUA 3L7HA 1H8MA 3G34A 4K91A 2P7JA 4GOGA 1FIKA 4RA7A 4GN2A 3PBQA 4XUZA 4QD4A 3O88A 3NDGA 5CXWA 4CLCC 2EWVA 4WELA 2OLVA 2ZC6B 4Y0UA 2IA2A 2O0YA 3EQUA 2ZQ8A 4GS9B 4P6ZM 3EGXC 5CRFA 3SS5A 3LI8A 1OTBA 3LCEA 4G3KA 1DP6A 1IEMA 2PBYA 3VP2A 1N9OA 4DJ3A 4X56A 4ME4A 2WZXA 3UY6A 2FH5A 4KUOA 1EROA 1AWIA 1K38A 1PFLA 3HREA 3NHQA 3HLCA 3UB9A 2O9CA 3MQOA 4B93A 3BJNA 3OOVA 2I72A 1DY6A 1YAXA 1H8YA 5TBMB 5KSHA 1MWTA 5LBRA 3V5MA 3IH8A 2Y2HA 2ZJ9A 2FFFB 4E6XA 3A0VA 1V9YA 1LLBA 3T50A 1PZOA 2BLSA 5U47A 3LIDA 4A5RA 5GL9A 2A49A 4S2MA 5E2HA 2VJWA 4DE3A 4F94A 3VFFA 3A3IA 4O0PA 3UDXA 4FD8A 4DKIA 3SZTA 5FAPA 3DWKA 1AXBA 4DDSA 4MBKA 1Z09A 3IWOA 3OBFA 1KVLA 4CLCE 3KYZA 4EETB 3B42A 2WKIA 2ZMVA 4HI4A 2QZ6A 2DNSA 1ES3A 4KZ5A 1O7EA 5CX7A 5CECA 3GQZA 3PXPA 4HH2A 4KZ6A 3MMHA 3BFFA 3T4JA 4OQGA 5TR7A 5HW3A 4GD8A 3KSHA 2XSSA 4UA7A 1YSQA 1XGJA 1CEFA 3SS3A 1OJGA 4QWOA 4IBXA 3HVFA 4KENB 4I3IA 2W1TB 2GJ3A 3EGDC 2ZL1B 4I5SA 4KQQA 1DRMA 1JWPA 1N9BA 3HCYA 1XJ2A 1IOUA 5M19A 5TFQA 2PD8A 3IF6A 1D1JA 4WMCD 1ES2A 3S7OA 5A93A 3UE0A 3F1OB 1SKOB 4EXOA 3H7WA 3ZDJA 3CMZA 4N1HA 1CK3A 3Q7ZA 3MS6A 1FR1A 1FCOA 2OWJA 3OPRA 3G30A 4XUXA 5HFOA 1IELA 4KQOA 4NG2A 2DRWA 1YLJA 3WRZA 5CHUA 4EU0A 4MLLA 5FQ9A 4Z9QA 3EWKA 1J9MA 3WS1A 4E3LA 4I3AA 3T1QB 4JXGA 1KE4A 4YNRA 4HNBA 3WS4A 2W3DA 3IHAA 3UNWA 4Q0HA 3BQAA 1S4SA 3BECA 1MWRA 2ZQ7A 4OOYA 2ZD8A 4JGPA 2E8IA 3L9KA 1GSXA 2GZAA 1L0GA 2VV6A 3UPOA 3HUNA 3GRJA 5K5BA 4BBTA 5GLDA 3WS2A 3NECA 4XXRA 1SZVA 3LEQA 4LRXC 3E4OA 2Q9NA 5A8BA 5EM1A 5HARA 2QWSA 4Y2FA 2EA9A 1EWZA 3NDEA 2VV7A 2WKEA 2EFXA 4KZBA 3ICYA 1K6RA 3A3DA 1YM1A 2WADA 4EBNA 5J4EA 1XJ4A 1YQSA 3UN7A 4PMAA 2Z6DA 5A92A 4BMWA 4EERA 2PRFA 4Y17A 5FQQA 1MXOA 3UB6A 5JYOA 1PYYA 2VGLS 4R38A 3KYQA 3M2KA 4JBFA 5FQJA 4P6BA 5HWVA 1LI0A 2IWDA 3RH8B 3CPTA 1NZOA 2PHYA 2UWXA 3IS2B 2EFUA 3N8RA 5DKKA 1PW8A 4UEYA 1XGIA 4ZJ2A 2JKTI 3I7JA 3PBRA 2B18A 2HDSA 3DWZA 1CF0A 2LB9A 3VP4A 3UO9A 3VP0A 3T1SA 3W2ZA 4OLGA 2O9BA 1DP8A 1P97A 1W63Q 2QPNA 4E3KA 4RVAA 1BUEA 1KE3A 3CLOA 3DTKA 4X68A 4FH2A 3BRMA 2WAFA 3MQQA 1SCWA 3ZNYA 3HLEA 5CERA 1XJ6A 4QU3A 4OPRA 4HJ4A 4KUKA 5EVIA 4R3JA 5HAQA 2M1CA 4KG6A 5L8MA 1LHYA 1MWUA 5TGFA 2EXAA 2L4RA 1K55C 3Q07A 1NYYA 3UDIA 1STZA 4IVKA 2A2LA 1KDSA 2XD1A 4ID4A 1OT6A 3WRTA 4Z1WA 2HP6A 2L0WA 3GVBA 3ZVTA 1JNUA 4MBHA 5F83A 2J80A 3GV9A 2HDUA 4PKYA 2A3UA 3KSGA 4X69A 2A24A 4H6JA 1YPRA 1BLSA 4R6LA 3G31A 5CGSA 4PHTA 5FASA 4BBVA 4PM5A 1ONGA 4WEKA 4LRYC 4WZ5A 4BJPA 3CUEC 4HHDA 2Z6CA 3QNBA 4BLMA 3SW1A 2J3TC 4E3NA 2V0UA 3NBLA 2Y2PA 3A3JA 2XH9A 3MSHA 4B9OA 2V1ZA 3LYXA 3F1PA 3QP4A 3FV7A 2ZM2A 3CWFA 1KGEA 1KOUA 2QJ5A 4K08A 5EE8A 2PBDP 1O07A 1OT9A 1F5MA 3DBAA 1LL9A 1IYOA 1PNEA 5FAQA 5EVID 3W4OA 1K4EA 4OQ0A 2CMNA 3G6OA 5MC7A 4BWIA 3EEHA 4EEUA 3OCNA 5BOHA 2ZM0A 5HD3A 5JYPA 4S2KA 4UA6A 3BFGA 1DJBA 1KVMA 5HDDA 4E3OA 5CEDA 2WGIA 5FI7A 4WZ4A 4PAUA 3P7NA 3OC2A 3LICA 3BLSA 3N4IA 1OMEA 1XFNA 1JWVA 4ARZA 4P0MA 1RGYA 1I2WA 1PWCA 2L1MA 4JGRA 4IJGA 4Q8IA 3P01A 1PWGA 5FEGA 2XFSA 4DE1A 4MDZA 1TF1A 4U0TA 4S2LA 3QP5A 1ZTUA 3CI6A 4LCMA 4MBFA 4EW7A 3HBRA 4GW9A 3MXRA 3UE3A 1YLZA 2ZOIA 4OPQA 5DJTA 2WGVA 1I2SA 3W4QA 1K6SA 5G4ZA 3VE3A 2WGWA 5FSRA 5F6AA 2ZQ9A 1MBLA 3PBOA 2HGVA 4FCFA 4EBLA 2Y2LA 1Y54A 4DXCA
chains in the Genus database with same CATH topology
3MKFA 4WMCD 4LV3A 1ES2A 5A93A 4BL3A 3Q7VA 4OONA 3UE0A 2R9XA 4K0XA 3E2KA 1BSGA 2H0TA 3NY4A 1SHVA 5A90A 1I5QA 4JPMA 5G18A 2V20A 2ZQCA 3ZDJA 4QJGA 3CMZA 1U60A 1Q2PA 4N1HA 3GTCA 4E6WA 3LEZA 4DE0A 4EQIA 1PI5A 4E3IA 4MNRA 1CK3A 1DJCA 1EI5A 2Z2MB 3M2JA 3MFDA 3BYDA 1H5XA 4JXWA 4PM6A 4N9KA 4OKPA 3IHBA 1GHPA 3Q7ZA 3UPPA 4JKTA 5FATA 4FSFA 4WMCA 1FSWA 4OVDA 3WWXA 3IWQA 3PBSA 1ZC2A 3AGEA 5HAIA 5FI2A 5IHVA 1FR6A 1FR1A 4UA9A 3G2ZA 1FCOA 2PU4A 4UAAA 4GDNA 1W8YA 3ZG5A 3OPRA 1DJAA 3G30A 3OZHA 3IXHA 1JTGA 4QHCA 4XUXA 3N6IA 2WAEA 5HFOA 4B88A 1IELA 3IF6C 2ZM8A 4EBPA 4KQOA 1MWSA 1HVBA 4M3KA 2WUQA 2Y55A 2ZC4B 1NYMA 2DRWA 1YLJA 3AGDA 2HP9A 4Y0OA 3IXBA 5CHUA 3WRZA 1FSYA 4MLLA 1RCJA 4GDBA 1BZAA 5FQ9A 4KZAA 4Z9QA 1J9MA 1BULA 1XP4A 3WS1A 4E3LA 3VP1A 4ZAMA 3QNCA 1TDLA 3ZG8B 4JXGA 5EOEA 4CJNA 2EX8A 3C4PA 3C7VA 1KE4A 4RX2A 3BFDA 3OPPA 1XXMA 1VQQA 3WS4A 3IHAA 3UNWA 4YFMA 1GCEA 1XPBA 3BECA 5AQ9A 2ZQDA 3O86A 1KDWA 5KZHA 1MWRA 2ZQ7A 4OOYA 3S22A 2ZD8A 5M1AA 1PWDA 1H8ZA 2JE5A 5E2FA 4D2OA 2E8IA 3BLMA 4DXBA 1QMEA 1L0GA 5FQMA 2XFTA 3UPOA 3HUNA 4BL2A 3GRJA 4NK3A 4WBGA 4FH4A 1K54A 4HBTA 5GLDA 3PAEA 3WS2A 4XXRA 1Q2QA 4NETA 2WGWB 3PAGA 4QY6A 1ERQA 4U3TA 4OQIA 3WS0A 1KGFA 1YMXA 4R3BA 4YINA 4HEFA 2Q9NA 4ZDXA 5F82A 1MKIA 4MEZA 3OPLA 5HARA 1NXYA 1XA1A 2Z2LB 4S2PA 3ITBA 2XD5A 3LO7A 1EWZA 3C4OA 3QHYA 3BEBA 4IEDA 3NDEA 3ZG7B 2Y2QA 2HDQA 3IF6B 2WKEA 2HPBA 1SDNA 4DXCA 1TVFA 2EFXA 3Q7VB 4KZBA 3V39A 5DF7A 5EUAA 1K6RA 3N8LA 3EQVA 3A3DA 1YM1A 2WADA 2GDNA 4EBNA 1ES5A 3DW0A 1ZG4A 3SS4A 4DF6A 1YQSA 2B5RA 3UN7A 4WM9A 3IWIA 4PMAA 2Y59A 2HP5A 3WS5A 1BLHA 2Y2MA 4U0XA 5A92A 4PM7A 1K54C 4L0LA 3E2LA 5GHYA 5HAPA 1L0FA 3FWLA 5FQQA 3HLDA 3IT9A 1MXOA 3S1YA 4E3JA 5JYOA 4X6TA 1ZKJA 1PYYA 4N9LA 1WYBA 1M6KA 2XGNA 5HL1A 3LY3A 5GLCA 3SH8A 3M2KA 2XLNA 1K56A 3O87A 3V3SA 1MPLA 4JBFA 5FQJA 4P6BA 4DDYA 4X55A 3FKWA 3M6HA 5E43A 4BENA 4X53A 3G32A 5FQIA 1CI9A 3UPNA 1HD8A 1LI0A 4LCLA 2IWDA 2VGKA 2Q9MA 5EECA 5GHZA 5AQAA 4R23A 5CHJA 4OQHA 4C6YA 1NZOA 2UWXA 4RYEA 2EFUA 5GHXA 3IH9A 3N8RA 1PW8A 5CHMA 1XGIA 1ES4A 4ZJ2A 3FKVA 3B3XA 2J7VA 3ISGA 2WZZA 1GA9A 1C3BA 3I7JA 2ZMAA 4R0QA 3PBRA 4EWFA 1ESUA 2HDSA 4Y0TA 5CGXA 1W7FA 3DWZA 2FFYA 4JF5A 5KSCA 3P98A 3SOIA 3FZCA 4DE2A 2R9WA 1BLPA 3MZFA 3RJUA 3VP4A 1XX2A 3UO9A 5GLAA 5FI6A 1SDEA 1FOFA 3DTMA 1YLWA 3VP0A 4S2NA 2Y2KA 4ZTKA 4DRTA 1E3UD 1XKZA 4OLGA 3ZG9B 5CGWA 3PBTA 4OPYA 4JXSA 2DCFA 3IQAA 1KE0A 3G2YA 3MZDA 2QPNA 5EPHA 1W8QA 4JF4A 4ZJ3A 1K55A 3PBNA 4E3KA 4HBUA 1CI8A 2G2UA 1NJ4A 4GD6A 4RVAA 1BUEA 1KE3A 3M6BA 2EX6A 1NZUA 2H5SA 2XQZA 3IXGA 4X68A 2WK0A 4WYYA 3HUMA 2Y2JA 4FH2A 5L2FA 3BRMA 2WAFA 3HLBA 4QB8A 3CJMA 2EX9A 1E3UA 1SCWA 2PU2A 3G35A 3ZNYA 3HLEA 1W5DA 5CERA 3BM6A 4HESA 3W8KA 4QU3A 2Y2IA 3MXSA 4O7DA 2ZC3B 4OPRA 3GR2A 4KZ4A 1GA0A 1ALQA 1BLCA 2Y2GA 4B4ZA 4E3MA 4Y7PA 3NI9A 4S2NC 3NCKA 5EVIA 2J9OA 3GSGA 1YT4A 1TDGA 3C7UA 3Q82A 1RP5A 4LV1A 3CG5A 4R3JA 5HAQA 4B4XA 4KG6A 4KZ9A 3ZG0A 4OPZA 3A3EA 1FQGA 1LHYA 4KZ8A 5FDHA 4ZJ1A 3RXXA 1MWUA 1LL5A 5TGFA 3V3RA 5E2GA 3HLFA 2EXAA 2WKHA 4OLDA 1K55C 4H8RA 2BG1A 4K0WA 3Q07A 1G68A 1NYYA 3UDIA 1YLYA 4R1GA 4IVKA 2X02A 3TOIA 3MZEA 1L2SA 3C5AA 2QMIA 1KDSA 1TEMA 2XD1A 1PZPA 4LV0A 5FA7A 3VOZA 2CC1A 1GHIA 4ID4A 3VMAA 1XA7A 4JF6A 3WRTA 2HP6A 3SH9A 3GVBA 3ZVTA 2G2WA 1NRFA 4JLFA 4S2IA 4ZBEA 4MBHA 1ONHA 1K56D 5F83A 4R4SA 4EUZA 3GV9A 2HDUA 3N7WA 3VOYA 3P09A 2A3UA 3CZDA 3HLWA 2H10A 2WYXA 4OOMA 4OP8A 4X69A 1JTDA 1GHMA 3MBZA 1K57A 3G4PA 5EVIC 4N1XA 1BLSA 4KQRA 3G31A 2EXBA 3G34A 5GLBA 5CGSA 4K91A 4C75A 2JCHA 5FASA 1M40A 4RX3A 2C6WB 1QMFA 3OCLA 5D3OA 4N92A 2OV5A 1IKIA 4GOGA 4RA7A 3W4PA 1ERMA 1KGGA 4GN2A 5CTNA 1L0DA 3PBQA 4PM5A 1ONGA 4XUZA 4WEKA 4QD4A 1ESIA 2Y2OA 4BD1A 3O88A 3NDGA 4LV2A 4WZ5A 5CXWA 4BJPA 1E25A 1N4OA 1SKFA 5AQBA 2IWBA 2J9PA 1IKGA 4WELA 2OLVA 1S0WA 2XEPA 1PIOA 2ZC6B 3D4FA 3PTEA 5EOOA 3QNBA 2ZQAA 4Y0UA 5DTTA 4BLMA 4WEJA 4CPKA 2RCXA 3MKEA 4QY5A 2OLUA 3ZCZA 4P85A 4E3NA 3N8SA 3NBLA 3EQUA 2ZQ8A 3HLGA 4LENA 2Y2PA 3A3JA 2HDRA 5CRFA 5FQKA 3SS5A 3LCEA 2XH9A 1K57C 3ZNTA 4BQMA 1IEMA 2PBYA 4S2JA 2V1ZA 3VP2A 2VGJA 1L0EA 4OOLA 4X56A 3A3FA 3FV7A 1CEGA 2WZXA 2X01A 3ZVWA 3UY6A 2ZM2A 3LY4A 5DTKA 5I94A 1EROA 2Y2NA 1FCMA 1K38A 4KZ3A 1KGEA 2XR0A 3HREA 3HL9A 3HLCA 5DF9A 5F1GA 5EE8A 2J8YA 1O07A 2C5WB 2ZC7A 4WZ5C 3HUOA 4GZBA 5EVIB 1YLTA 2XDMA 2I72A 4PM8A 1DY6A 1YLPA 3UE1A 5F1FA 1BT5A 3AGFA 1H8YA 2JC7A 4PPRA 5KSHA 1MWTA 1LL9A 3V5MA 3IH8A 1IYOA 1Z6FA 2Y2HA 5DTSA 5FAQA 2ZJ9A 2FFFB 5EVID 3W4OA 4E6XA 1K4EA 1LLBA 4OQ0A 2XK1A 1PZOA 5J8XA 4S2OA 2BLSA 4KG5A 2Y91A 5U47A 4A5RA 3BFCA 5CTMA 5GL9A 2ZC5B 3OCNA 5BOHA 3Q81A 2A49A 2ZM0A 4S2MA 2V2FF 4UHUA 3Q1FA 5DVAA 5E2HA 3IXDA 4S2KA 5JYPA 4UA6A 2X71A 3BFGA 1DJBA 1KVMA 5A91A 4DE3A 2JBFA 4F94A 1NY0A 3IF5A 2P74A 1LI9A 3VFFA 4E3OA 1VM1A 3A3IA 5CEDA 3UDXA 2WGIA 5FI7A 4FD8A 3VSKA 4R4RA 4DKIA 3GMWA 4WZ4A 3S4XA 2ZLYA 5FAPA 3OPHA 3SH7A 1IYSA 4IBRA 3DWKA 3OC2A 1AXBA 4DDSA 5AQ7A 4MBKA 5CEBA 3IWOA 3BLSA 1JWZA 2OSUA 3N4IA 1OMEA 1K4FA 1JWVA 1WE4A 1KVLA 1YMSA 4KZ7A 4P0MA 1RGYA 1I2WA 1PWCA 3VP3A 2Y4AA 3JYIA 4Q8IA 3NIAA 3NC8A 4GKUA 2P9VB 2XF3A 4EV4A 1PWGA 2WKIA 3TSGA 2XFSA 4PM9A 4DE1A 1MY8A 1JVJA 1S6RA 3VSLA 4C3QA 1W79A 4S2LA 2RL3A 4U0TA 3RXWA 3VFHA 2QZ6A 2DNSA 1ES3A 1WYCA 4IVIA 4KZ5A 2EX2A 3FYZA 1HTZA 1O7EA 5CECA 1HZOA 3GQZA 4KZ6A 4LCMA 1RGZA 1ZG6A 4MBFA 1PI4A 1PW1A 3BFFA 1G6AA 3HBRA 1IYQA 1E4DA 3MXRA 4OQGA 5TR7A 5EVLA 1YLZA 3UE3A 1K25A 1BTLA 4GB7A 4GD8A 5E2EA 5FAOA 5HW3A 3UDFA 5M18A 4BD0A 4JXVA 4UA7A 1FCNA 4OPQA 1XGJA 4OH0A 2WGVA 1I2SA 4P87A 3ZHHA 3W4QA 1CEFA 1K6SA 5KMWA 3SS3A 2WGWA 2P9VA 4IBXA 3HVFA 3O3VA 4KENB 4GNUA 5FSRA 5HX9A 2ZQ9A 1IYPA 1MBLA 3PBOA 3ZFZA 2H0YA 3TG9A 4FCFA 4EBLA 3BFEA 4KQQA 2Y2LA 1JWPA 1N9BA 1Y54A 3ITAA 3V50A 3ZGAB 4KG2A 5M19A 5DF8A 5TFQA 2IWCA 4OP5A 3IF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MKF A;  4WMC D;  4LV3 A;  1ES2 A;  5A93 A;  4BL3 A;  3Q7V A;  4OON A;  3UE0 A;  2R9X A;  4K0X A;  3E2K A;  1BSG A;  2H0T A;  3NY4 A;  1SHV A;  5A90 A;  1I5Q A;  4JPM A;  5G18 A;  2V20 A;  2ZQC A;  3ZDJ A;  4QJG A;  3CMZ A;  1U60 A;  1Q2P A;  4N1H A;  3GTC A;  4E6W A;  3LEZ A;  4DE0 A;  4EQI A;  1PI5 A;  4E3I A;  4MNR A;  1CK3 A;  1DJC A;  1EI5 A;  2Z2M B;  3M2J A;  3MFD A;  3BYD A;  1H5X A;  4JXW A;  4PM6 A;  4N9K A;  4OKP A;  3IHB A;  1GHP A;  3Q7Z A;  3UPP A;  4JKT A;  5FAT A;  4FSF A;  4WMC A;  1FSW A;  4OVD A;  3WWX A;  3IWQ A;  3PBS A;  1ZC2 A;  3AGE A;  5HAI A;  5FI2 A;  5IHV A;  1FR6 A;  1FR1 A;  4UA9 A;  3G2Z A;  1FCO A;  2PU4 A;  4UAA A;  4GDN A;  1W8Y A;  3ZG5 A;  3OPR A;  1DJA A;  3G30 A;  3OZH A;  3IXH A;  1JTG A;  4QHC A;  4XUX A;  3N6I A;  2WAE A;  5HFO A;  4B88 A;  1IEL A;  3IF6 C;  2ZM8 A;  4EBP A;  4KQO A;  1MWS A;  1HVB A;  4M3K A;  2WUQ A;  2Y55 A;  2ZC4 B;  1NYM A;  2DRW A;  1YLJ A;  3AGD A;  2HP9 A;  4Y0O A;  3IXB A;  5CHU A;  3WRZ A;  1FSY A;  4MLL A;  1RCJ A;  4GDB A;  1BZA A;  5FQ9 A;  4KZA A;  4Z9Q A;  1J9M A;  1BUL A;  1XP4 A;  3WS1 A;  4E3L A;  3VP1 A;  4ZAM A;  3QNC A;  1TDL A;  3ZG8 B;  4JXG A;  5EOE A;  4CJN A;  2EX8 A;  3C4P A;  3C7V A;  1KE4 A;  4RX2 A;  3BFD A;  3OPP A;  1XXM A;  1VQQ A;  3WS4 A;  3IHA A;  3UNW A;  4YFM A;  1GCE A;  1XPB A;  3BEC A;  5AQ9 A;  2ZQD A;  3O86 A;  1KDW A;  5KZH A;  1MWR A;  2ZQ7 A;  4OOY A;  3S22 A;  2ZD8 A;  5M1A A;  1PWD A;  1H8Z A;  2JE5 A;  5E2F A;  4D2O A;  2E8I A;  3BLM A;  4DXB A;  1QME A;  1L0G A;  5FQM A;  2XFT A;  3UPO A;  3HUN A;  4BL2 A;  3GRJ A;  4NK3 A;  4WBG A;  4FH4 A;  1K54 A;  4HBT A;  5GLD A;  3PAE A;  3WS2 A;  4XXR A;  1Q2Q A;  4NET A;  2WGW B;  3PAG A;  4QY6 A;  1ERQ A;  4U3T A;  4OQI A;  3WS0 A;  1KGF A;  1YMX A;  4R3B A;  4YIN A;  4HEF A;  2Q9N A;  4ZDX A;  5F82 A;  1MKI A;  4MEZ A;  3OPL A;  5HAR A;  1NXY A;  1XA1 A;  2Z2L B;  4S2P A;  3ITB A;  2XD5 A;  3LO7 A;  1EWZ A;  3C4O A;  3QHY A;  3BEB A;  4IED A;  3NDE A;  3ZG7 B;  2Y2Q A;  2HDQ A;  3IF6 B;  2WKE A;  2HPB A;  1SDN A;  4DXC A;  1TVF A;  2EFX A;  3Q7V B;  4KZB A;  3V39 A;  5DF7 A;  5EUA A;  1K6R A;  3N8L A;  3EQV A;  3A3D A;  1YM1 A;  2WAD A;  2GDN A;  4EBN A;  1ES5 A;  3DW0 A;  1ZG4 A;  3SS4 A;  4DF6 A;  1YQS A;  2B5R A;  3UN7 A;  4WM9 A;  3IWI A;  4PMA A;  2Y59 A;  2HP5 A;  3WS5 A;  1BLH A;  2Y2M A;  4U0X A;  5A92 A;  4PM7 A;  1K54 C;  4L0L A;  3E2L A;  5GHY A;  5HAP A;  1L0F A;  3FWL A;  5FQQ A;  3HLD A;  3IT9 A;  1MXO A;  3S1Y A;  4E3J A;  5JYO A;  4X6T A;  1ZKJ A;  1PYY A;  4N9L A;  1WYB A;  1M6K A;  2XGN A;  5HL1 A;  3LY3 A;  5GLC A;  3SH8 A;  3M2K A;  2XLN A;  1K56 A;  3O87 A;  3V3S A;  1MPL A;  4JBF A;  5FQJ A;  4P6B A;  4DDY A;  4X55 A;  3FKW A;  3M6H A;  5E43 A;  4BEN A;  4X53 A;  3G32 A;  5FQI A;  1CI9 A;  3UPN A;  1HD8 A;  1LI0 A;  4LCL A;  2IWD A;  2VGK A;  2Q9M A;  5EEC A;  5GHZ A;  5AQA A;  4R23 A;  5CHJ A;  4OQH A;  4C6Y A;  1NZO A;  2UWX A;  4RYE A;  2EFU A;  5GHX A;  3IH9 A;  3N8R A;  1PW8 A;  5CHM A;  1XGI A;  1ES4 A;  4ZJ2 A;  3FKV A;  3B3X A;  2J7V A;  3ISG A;  2WZZ A;  1GA9 A;  1C3B A;  3I7J A;  2ZMA A;  4R0Q A;  3PBR A;  4EWF A;  1ESU A;  2HDS A;  4Y0T A;  5CGX A;  1W7F A;  3DWZ A;  2FFY A;  4JF5 A;  5KSC A;  3P98 A;  3SOI A;  3FZC A;  4DE2 A;  2R9W A;  1BLP A;  3MZF A;  3RJU A;  3VP4 A;  1XX2 A;  3UO9 A;  5GLA A;  5FI6 A;  1SDE A;  1FOF A;  3DTM A;  1YLW A;  3VP0 A;  4S2N A;  2Y2K A;  4ZTK A;  4DRT A;  1E3U D;  1XKZ A;  4OLG A;  3ZG9 B;  5CGW A;  3PBT A;  4OPY A;  4JXS A;  2DCF A;  3IQA A;  1KE0 A;  3G2Y A;  3MZD A;  2QPN A;  5EPH A;  1W8Q A;  4JF4 A;  4ZJ3 A;  1K55 A;  3PBN A;  4E3K A;  4HBU A;  1CI8 A;  2G2U A;  1NJ4 A;  4GD6 A;  4RVA A;  1BUE A;  1KE3 A;  3M6B A;  2EX6 A;  1NZU A;  2H5S A;  2XQZ A;  3IXG A;  4X68 A;  2WK0 A;  4WYY A;  3HUM A;  2Y2J A;  4FH2 A;  5L2F A;  3BRM A;  2WAF A;  3HLB A;  4QB8 A;  3CJM A;  2EX9 A;  1E3U A;  1SCW A;  2PU2 A;  3G35 A;  3ZNY A;  3HLE A;  1W5D A;  5CER A;  3BM6 A;  4HES A;  3W8K A;  4QU3 A;  2Y2I A;  3MXS A;  4O7D A;  2ZC3 B;  4OPR A;  3GR2 A;  4KZ4 A;  1GA0 A;  1ALQ A;  1BLC A;  2Y2G A;  4B4Z A;  4E3M A;  4Y7P A;  3NI9 A;  4S2N C;  3NCK A;  5EVI A;  2J9O A;  3GSG A;  1YT4 A;  1TDG A;  3C7U A;  3Q82 A;  1RP5 A;  4LV1 A;  3CG5 A;  4R3J A;  5HAQ A;  4B4X A;  4KG6 A;  4KZ9 A;  3ZG0 A;  4OPZ A;  3A3E A;  1FQG A;  1LHY A;  4KZ8 A;  5FDH A;  4ZJ1 A;  3RXX A;  1MWU A;  1LL5 A;  5TGF A;  3V3R A;  5E2G A;  3HLF A;  2EXA A;  2WKH A;  4OLD A;  1K55 C;  4H8R A;  2BG1 A;  4K0W A;  3Q07 A;  1G68 A;  1NYY A;  3UDI A;  1YLY A;  4R1G A;  4IVK A;  2X02 A;  3TOI A;  3MZE A;  1L2S A;  3C5A A;  2QMI A;  1KDS A;  1TEM A;  2XD1 A;  1PZP A;  4LV0 A;  5FA7 A;  3VOZ A;  2CC1 A;  1GHI A;  4ID4 A;  3VMA A;  1XA7 A;  4JF6 A;  3WRT A;  2HP6 A;  3SH9 A;  3GVB A;  3ZVT A;  2G2W A;  1NRF A;  4JLF A;  4S2I A;  4ZBE A;  4MBH A;  1ONH A;  1K56 D;  5F83 A;  4R4S A;  4EUZ A;  3GV9 A;  2HDU A;  3N7W A;  3VOY A;  3P09 A;  2A3U A;  3CZD A;  3HLW A;  2H10 A;  2WYX A;  4OOM A;  4OP8 A;  4X69 A;  1JTD A;  1GHM A;  3MBZ A;  1K57 A;  3G4P A;  5EVI C;  4N1X A;  1BLS A;  4KQR A;  3G31 A;  2EXB A;  3G34 A;  5GLB A;  5CGS A;  4K91 A;  4C75 A;  2JCH A;  5FAS A;  1M40 A;  4RX3 A;  2C6W B;  1QMF A;  3OCL A;  5D3O A;  4N92 A;  2OV5 A;  1IKI A;  4GOG A;  4RA7 A;  3W4P A;  1ERM A;  1KGG A;  4GN2 A;  5CTN A;  1L0D A;  3PBQ A;  4PM5 A;  1ONG A;  4XUZ A;  4WEK A;  4QD4 A;  1ESI A;  2Y2O A;  4BD1 A;  3O88 A;  3NDG A;  4LV2 A;  4WZ5 A;  5CXW A;  4BJP A;  1E25 A;  1N4O A;  1SKF A;  5AQB A;  2IWB A;  2J9P A;  1IKG A;  4WEL A;  2OLV A;  1S0W A;  2XEP A;  1PIO A;  2ZC6 B;  3D4F A;  3PTE A;  5EOO A;  3QNB A;  2ZQA A;  4Y0U A;  5DTT A;  4BLM A;  4WEJ A;  4CPK A;  2RCX A;  3MKE A;  4QY5 A;  2OLU A;  3ZCZ A;  4P85 A;  4E3N A;  3N8S A;  3NBL A;  3EQU A;  2ZQ8 A;  3HLG A;  4LEN A;  2Y2P A;  3A3J A;  2HDR A;  5CRF A;  5FQK A;  3SS5 A;  3LCE A;  2XH9 A;  1K57 C;  3ZNT A;  4BQM A;  1IEM A;  2PBY A;  4S2J A;  2V1Z A;  3VP2 A;  2VGJ A;  1L0E A;  4OOL A;  4X56 A;  3A3F A;  3FV7 A;  1CEG A;  2WZX A;  2X01 A;  3ZVW A;  3UY6 A;  2ZM2 A;  3LY4 A;  5DTK A;  5I94 A;  1ERO A;  2Y2N A;  1FCM A;  1K38 A;  4KZ3 A;  1KGE A;  2XR0 A;  3HRE A;  3HL9 A;  3HLC A;  5DF9 A;  5F1G A;  5EE8 A;  2J8Y A;  1O07 A;  2C5W B;  2ZC7 A;  4WZ5 C;  3HUO A;  4GZB A;  5EVI B;  1YLT A;  2XDM A;  2I72 A;  4PM8 A;  1DY6 A;  1YLP A;  3UE1 A;  5F1F A;  1BT5 A;  3AGF A;  1H8Y A;  2JC7 A;  4PPR A;  5KSH A;  1MWT A;  1LL9 A;  3V5M A;  3IH8 A;  1IYO A;  1Z6F A;  2Y2H A;  5DTS A;  5FAQ A;  2ZJ9 A;  2FFF B;  5EVI D;  3W4O A;  4E6X A;  1K4E A;  1LLB A;  4OQ0 A;  2XK1 A;  1PZO A;  5J8X A;  4S2O A;  2BLS A;  4KG5 A;  2Y91 A;  5U47 A;  4A5R A;  3BFC A;  5CTM A;  5GL9 A;  2ZC5 B;  3OCN A;  5BOH A;  3Q81 A;  2A49 A;  2ZM0 A;  4S2M A;  2V2F F;  4UHU A;  3Q1F A;  5DVA A;  5E2H A;  3IXD A;  4S2K A;  5JYP A;  4UA6 A;  2X71 A;  3BFG A;  1DJB A;  1KVM A;  5A91 A;  4DE3 A;  2JBF A;  4F94 A;  1NY0 A;  3IF5 A;  2P74 A;  1LI9 A;  3VFF A;  4E3O A;  1VM1 A;  3A3I A;  5CED A;  3UDX A;  2WGI A;  5FI7 A;  4FD8 A;  3VSK A;  4R4R A;  4DKI A;  3GMW A;  4WZ4 A;  3S4X A;  2ZLY A;  5FAP A;  3OPH A;  3SH7 A;  1IYS A;  4IBR A;  3DWK A;  3OC2 A;  1AXB A;  4DDS A;  5AQ7 A;  4MBK A;  5CEB A;  3IWO A;  3BLS A;  1JWZ A;  2OSU A;  3N4I A;  1OME A;  1K4F A;  1JWV A;  1WE4 A;  1KVL A;  1YMS A;  4KZ7 A;  4P0M A;  1RGY A;  1I2W A;  1PWC A;  3VP3 A;  2Y4A A;  3JYI A;  4Q8I A;  3NIA A;  3NC8 A;  4GKU A;  2P9V B;  2XF3 A;  4EV4 A;  1PWG A;  2WKI A;  3TSG A;  2XFS A;  4PM9 A;  4DE1 A;  1MY8 A;  1JVJ A;  1S6R A;  3VSL A;  4C3Q A;  1W79 A;  4S2L A;  2RL3 A;  4U0T A;  3RXW A;  3VFH A;  2QZ6 A;  2DNS A;  1ES3 A;  1WYC A;  4IVI A;  4KZ5 A;  2EX2 A;  3FYZ A;  1HTZ A;  1O7E A;  5CEC A;  1HZO A;  3GQZ A;  4KZ6 A;  4LCM A;  1RGZ A;  1ZG6 A;  4MBF A;  1PI4 A;  1PW1 A;  3BFF A;  1G6A A;  3HBR A;  1IYQ A;  1E4D A;  3MXR A;  4OQG A;  5TR7 A;  5EVL A;  1YLZ A;  3UE3 A;  1K25 A;  1BTL A;  4GB7 A;  4GD8 A;  5E2E A;  5FAO A;  5HW3 A;  3UDF A;  5M18 A;  4BD0 A;  4JXV A;  4UA7 A;  1FCN A;  4OPQ A;  1XGJ A;  4OH0 A;  2WGV A;  1I2S A;  4P87 A;  3ZHH A;  3W4Q A;  1CEF A;  1K6S A;  5KMW A;  3SS3 A;  2WGW A;  2P9V A;  4IBX A;  3HVF A;  3O3V A;  4KEN B;  4GNU A;  5FSR A;  5HX9 A;  2ZQ9 A;  1IYP A;  1MBL A;  3PBO A;  3ZFZ A;  2H0Y A;  3TG9 A;  4FCF A;  4EBL A;  3BFE A;  4KQQ A;  2Y2L A;  1JWP A;  1N9B A;  1Y54 A;  3ITA A;  3V50 A;  3ZGA B;  4KG2 A;  5M19 A;  5DF8 A;  5TFQ A;  2IWC A;  4OP5 A;  3IF6 A; 
#chains in the Genus database with same CATH topology
 3LIE A;  4LV3 A;  5IT5 A;  2PD7 A;  4X1M A;  2R9X A;  2JKT M;  4M4X A;  3E2K A;  3F1N A;  2H0T A;  3NY4 A;  3S7P A;  2V8F A;  3E0Y A;  1S67 L;  5HDC A;  1Q2P A;  2QHK A;  4E6W A;  3LEZ A;  4EQI A;  4E3I A;  2Z2M B;  1EI5 A;  4PM6 A;  4JXW A;  4N9K A;  4OKP A;  1D7E A;  3VOL A;  4JKT A;  5FAT A;  3VE4 A;  4WMC A;  3WWX A;  3PBS A;  4NXG A;  4P6Z S;  5IHV A;  1FR6 A;  4UA9 A;  4R3A A;  2PU4 A;  2PYP A;  3PHY A;  1W8Y A;  1DJA A;  3OZH A;  3OLO A;  1JTG A;  4QHC A;  3N6I A;  4B88 A;  3IF6 C;  1HVB A;  4HJ3 A;  3MR0 A;  2ZC4 B;  4Y0O A;  4GJ4 A;  3IXB A;  4GHI B;  1FSY A;  1RCJ A;  4GDB A;  1EW0 A;  3QNC A;  1VET A;  5EOE A;  2EX8 A;  4RX2 A;  4YFM A;  5AQ9 A;  2BAS A;  3T1X A;  1H8Z A;  2YKH A;  1QME A;  4F3L A;  1TS7 A;  2XFT A;  4BL2 A;  4NK3 A;  4FH4 A;  1K54 A;  4HBT A;  4LRZ E;  2PAV P;  5EVE A;  4QY6 A;  3PAG A;  3H82 B;  1KGF A;  1F98 A;  1N9N A;  2JN7 A;  4Y15 A;  4HEF A;  4ZDX A;  1MKI A;  3C2W A;  3ITB A;  2XD5 A;  1H0M A;  3C4O A;  3QHY A;  3BEB A;  4IED A;  3ZG7 B;  1SDN A;  3Q7V B;  3LGO A;  5EUA A;  5EV0 A;  1ES5 A;  3CPT B;  4FUW A;  4ESP A;  2HP5 A;  1BLH A;  3QP8 A;  1UGU A;  4PKY G;  2XA7 S;  5L09 A;  5GHY A;  5HAP A;  3B47 A;  3S1Y A;  4E3J A;  4X6T A;  1ZKJ A;  4ETX A;  1WYB A;  5HL1 A;  5HD5 A;  2JHE A;  5GLC A;  3SH8 A;  3O87 A;  4DDY A;  4EES A;  4X55 A;  3M6H A;  5E43 A;  2HJE A;  5J3W A;  5FQI A;  1CI9 A;  3UPN A;  1HD8 A;  5GHZ A;  5L07 A;  3BWL A;  1VB6 A;  4XT2 A;  3NOU C;  1VEU B;  3FKV A;  2I9V A;  2J7V A;  3ISG A;  1GA9 A;  4O01 A;  1C3B A;  4UQI M;  4R0Q A;  4EWF A;  3KYE A;  1W7F A;  5KSC A;  1MKM A;  3MZF A;  3T4L A;  3RJU A;  1XX2 A;  1YKD A;  1FOF A;  1YLW A;  4ZTK A;  4DRT A;  1E3U D;  2B95 A;  2Y79 A;  3FC7 A;  3CAX A;  1KE0 A;  3G2Y A;  3MZD A;  4RQ9 A;  4GS9 A;  2HZ5 A;  1W8Q A;  4HIA A;  3PBN A;  5TJJ A;  4GD6 A;  2XQZ A;  4WYY A;  3HUM A;  2Y2J A;  5L2F A;  2KOI A;  1YSP A;  3G35 A;  2WKQ A;  3BM6 A;  3W8K A;  4O7D A;  3GR2 A;  4KZ4 A;  4CLC D;  5DJU A;  3T4T A;  4E04 A;  1P9W A;  2V1B A;  5HWT A;  3RTY A;  2J9O A;  1T1B A;  3KX0 X;  2A24 B;  3Q82 A;  5TBM A;  2V0W A;  4KZ8 A;  3V67 A;  3C38 A;  3T4K A;  4H8R A;  4JGQ A;  4K0W A;  3S7Q A;  2JKR I;  1L2S A;  3LR0 A;  3TOI A;  1G6O A;  2QMI A;  3VOZ A;  2G2W A;  1NRF A;  5AVE A;  4JLF A;  4S2I A;  4ZBE A;  4L9F A;  4EUZ A;  1LSV A;  3VOY A;  3IX8 A;  3HLW A;  3A0R A;  1JTD A;  1GHM A;  3MBZ A;  1K57 A;  2VGL M;  5EVI C;  4N1X A;  3KO6 A;  4KQR A;  5DFX A;  4L9G A;  5AVF A;  4FOF A;  4C75 A;  2JCH A;  3IX3 A;  1XFQ A;  1M40 A;  3NUL A;  2LB5 A;  4RX3 A;  5D3O A;  1IKI A;  1ERM A;  1KGG A;  1L0D A;  1ESI A;  2Y2O A;  4BD1 A;  2KDK A;  3NOP C;  1E25 A;  1N4O A;  1SKF A;  5AQB A;  1IKG A;  1S0W A;  2Q0O A;  3D4F A;  3PTE A;  5DTT A;  4WEJ A;  3R7W B;  2RCX A;  2OLU A;  4P85 A;  4NEE D;  5HWW A;  5C5K A;  3ZNT A;  4BQM A;  4S2J A;  3RFB A;  1NWZ A;  2EWW A;  3A3F A;  1CEG A;  3LI9 A;  3ZVW A;  3LY4 A;  5KIZ A;  3R4K A;  4KZ3 A;  2XR0 A;  3HL9 A;  5DF9 A;  4NXF A;  2J8Y A;  4WZ5 C;  2W1T A;  2ZL1 A;  2XDM A;  3UE1 A;  1BT5 A;  3AGF A;  1Y28 A;  2JC7 A;  5HSQ A;  1D06 A;  5DTS A;  2ZMF A;  2XK1 A;  3F1O A;  5J8X A;  3BQ8 A;  4KG5 A;  2Y91 A;  5CTM A;  1SKO A;  5F69 A;  3Q81 A;  3Q1F A;  3IXD A;  3U2A A;  3ZYT A;  1NY0 A;  3IF5 A;  3NJA A;  4X1L A;  1VM1 A;  3B33 A;  3GMW A;  3S4X A;  3OPH A;  4IBR A;  4IUH A;  1JWZ A;  4D60 A;  2HF6 A;  1YMS A;  1BYW A;  2M7U A;  3VP3 A;  2Y4A A;  3JYI A;  3VV4 A;  3NC8 A;  4GKU A;  2XF3 A;  4L9E A;  1G28 A;  3TSG A;  1MY8 A;  1JVJ A;  1S6R A;  1W79 A;  3VFH A;  4CQH A;  1WYC A;  4IVI A;  1HTZ A;  3T4Q A;  1HZO A;  3UME A;  1RGZ A;  1ZG6 A;  4HY8 A;  2D01 A;  1LT0 A;  1K25 A;  4GCZ A;  1BTL A;  5E2E A;  5FAO A;  5M18 A;  4MMN A;  3UDF A;  1T18 A;  4BD0 A;  4JXV A;  2WKP A;  1FCN A;  4P87 A;  2W3G A;  3LR3 A;  3ZHH A;  4HJ6 A;  3MXQ A;  5KMW A;  2P9V A;  4NKP A;  1WA9 A;  4GNU A;  4Y3I A;  5HX9 A;  3ZFZ A;  2H0Y A;  3TG9 A;  3BFE A;  3ITA A;  3HJK A;  3ZGA B;  1OTA A;  2IWC A;  4OP5 A;  3EEA A;  3TRC A;  5A90 A;  1SHV A;  1I5Q A;  4JPM A;  2VEA A;  2V20 A;  2W3E A;  4QJG A;  1U60 A;  1LSW A;  3GTC A;  3LFV A;  1PI5 A;  4MNR A;  5F1F A;  1DJC A;  3MFD A;  3T12 B;  1FSW A;  4OVD A;  3IWQ A;  5HAI A;  5FI2 A;  2VZW A;  3G2Z A;  3DTE A;  4UAA A;  3EOI A;  3ZG5 A;  5FDS A;  2WAE A;  4EBP A;  3QP1 A;  1MWS A;  2Y55 A;  1NYM A;  2J3W A;  1LSX A;  1BZA A;  4KZA A;  3VP1 A;  1TDL A;  3ZG8 B;  4CJN A;  3C4P A;  4YWZ A;  3OPP A;  2BTF P;  2W3F A;  2KLI A;  1GCE A;  3A0S A;  3FPV A;  4WF0 A;  3S22 A;  3BW6 A;  4LLO B;  2JE5 A;  4D2O A;  1K0K A;  3TE8 A;  5FL3 A;  5FQM A;  3T4S A;  1TS6 A;  2PYR A;  2HV1 A;  2JKR M;  3GEC A;  3PAE A;  1Q2Q A;  5HL6 A;  1ERQ A;  3WS0 A;  4OQI A;  4MCW A;  1YMX A;  2PDR A;  4R3B A;  3OPL A;  1NXY A;  1XA1 A;  4IUK A;  4S2P A;  3LO7 A;  3PR6 A;  2Y8H A;  2HDQ A;  3IF6 B;  2PR6 A;  1TVF A;  1LL8 A;  5DF7 A;  5DKL A;  3EQV A;  3DW0 A;  3SS4 A;  2W27 A;  3H7W B;  1OTI A;  3IWI A;  1MC0 A;  4LPZ A;  3WS5 A;  4I39 A;  4XT2 B;  1K54 C;  2KX6 A;  1L0F A;  3PYP A;  3IT9 A;  2G7U A;  1M6K A;  4Y5F A;  1N9L A;  5FEF A;  3IBJ A;  1K56 A;  4AFI A;  3V3S A;  1MPL A;  3FKW A;  4BEN A;  4X53 A;  5HZH A;  2VGK A;  5EEC A;  5AQA A;  2NUT C;  4RYE A;  5CHM A;  2VX8 A;  1ES4 A;  2WZZ A;  2ZMA A;  1ESU A;  3MJQ A;  2FFY A;  3FZC A;  4DE2 A;  2R9W A;  3MFX A;  2XRN A;  5GLA A;  5FI6 A;  1SDE A;  4S2N A;  5DFY A;  4GLQ A;  1HLU P;  3DAV A;  1XKZ A;  2O9A A;  5CGW A;  3PBT A;  4OPY A;  4IHQ A;  4JXS A;  5J7E A;  1W63 M;  5EPH A;  4JF4 A;  4MN7 A;  1CI8 A;  1NJ4 A;  3M6B A;  2EX6 A;  2H5S A;  2WK0 A;  4QB8 A;  3TJZ C;  2EX9 A;  1OTD A;  1E3U A;  2PU2 A;  2Y2I A;  1GA0 A;  5HPI A;  1BLC A;  1NLY A;  4B4Z A;  2W0N A;  3NI9 A;  3UB5 P;  3NCK A;  2AVX A;  3GSG A;  1TDG A;  3C7U A;  1RP5 A;  3CG5 A;  4KZ9 A;  3LIA A;  4OPZ A;  2J3T D;  4DJ2 A;  4I3J A;  4ZJ1 A;  3RXX A;  5L10 A;  3H9W A;  3V3R A;  5E2G A;  3FG8 A;  3HLF A;  2WKH A;  1S4R A;  3NOT C;  4R1G A;  2X02 A;  3MZE A;  3C5A A;  4MN5 A;  5FA7 A;  4CLC A;  2CC1 A;  1XA7 A;  1ONH A;  1K56 D;  4QPR A;  2XA7 M;  4R4S A;  2INW A;  4WLA A;  5F68 A;  4WUJ A;  3N7W A;  3CZD A;  4OOM A;  2H10 A;  4HH3 A;  3BY8 A;  4BBU A;  2EXB A;  1P9R A;  4EQ1 A;  5GLB A;  2K31 A;  2C6W B;  1QMF A;  3OCL A;  4N92 A;  2OV5 A;  2E8J A;  3W4P A;  5G4Y A;  5CTN A;  1VHM A;  4R70 A;  5F5Y A;  3UB7 A;  5AJG A;  4LV2 A;  2IWB A;  1TD5 A;  2J9P A;  4O8G A;  1IFQ A;  3D9Y A;  2XEP A;  3QP2 A;  1PIO A;  5EOO A;  2ZQA A;  3MKE A;  4QY5 A;  3ZCZ A;  3N8S A;  3HLG A;  4LEN A;  2HDR A;  5FQK A;  1NRJ A;  1K57 C;  3DTI A;  2VGJ A;  1L0E A;  1NLZ A;  4OOL A;  4I38 A;  2B02 A;  2X01 A;  2K7S A;  5DTK A;  5I94 A;  2Y2N A;  1FCM A;  1ACF A;  5F1G A;  4JGO A;  2ZC7 A;  2C5W B;  3HUO A;  4GZB A;  5EVI B;  1YLT A;  2QYB A;  4PM8 A;  1YLP A;  3C8C A;  4PPR A;  4UQI S;  1Z6F A;  3E4Q A;  4LGW A;  2WKR A;  4S2O A;  2YKF A;  2VK3 A;  3BFC A;  2GNX A;  2ZC5 B;  3JVU A;  2V2F F;  4UHU A;  5DVA A;  2X71 A;  5A91 A;  2JBF A;  4HP9 A;  4LFU A;  2MJ6 A;  2P74 A;  1LI9 A;  3U4L P;  2ACG A;  3VSK A;  4R4R A;  2K2N A;  4H6J B;  2ZLY A;  3SH7 A;  1IYS A;  3UB8 A;  5AQ7 A;  5CEB A;  1A0K A;  2OSU A;  5IS1 A;  1V9Z A;  2GX5 A;  1K4F A;  1WE4 A;  4KZ7 A;  3MF0 A;  3C30 A;  5I5L A;  2OWH A;  1T1C A;  2V8C A;  1P0Z A;  1T19 A;  4GHI A;  4WN5 A;  3NIA A;  2P9V B;  4EV4 A;  3ULF A;  4PM9 A;  3S7N A;  3VSL A;  1FIL A;  4C3Q A;  2RL3 A;  3RXW A;  3E4P A;  3LIB A;  2OOL A;  2EX2 A;  3FYZ A;  1PI4 A;  1TS0 A;  1PW1 A;  1S66 L;  3KSI A;  1G6A A;  3IX4 A;  1IYQ A;  1E4D A;  5EVL A;  4GB7 A;  3K3C A;  3F1P B;  4OH0 A;  3ZQ5 A;  3T4O A;  2XRO A;  4Y13 A;  4G3W A;  3H82 A;  3KSF A;  3O3V A;  1IYP A;  4FTX A;  2W3H A;  3V50 A;  4ETZ A;  4KG2 A;  3CIT A;  5DF8 A;  4WL9 A;  4CPK A;  3MKF A;  1MZU A;  4BL3 A;  3Q7V A;  4OON A;  3K3D A;  4K0X A;  2P04 A;  1BSG A;  2VA0 A;  3MQ0 A;  4EEP A;  5G18 A;  2ZQC A;  4EUV A;  1OPX A;  4YOF A;  4DE0 A;  1T1A A;  1GSW A;  1OTE A;  3JVV A;  3M2J A;  3BYD A;  1H5X A;  5EM0 A;  3IHB A;  1GHP A;  3UPP A;  4FSF A;  1ZC2 A;  3AGE A;  2M7V A;  2DMW A;  1TS8 A;  4GDN A;  3IXH A;  2PT7 A;  2ZM8 A;  4ARZ B;  4M3K A;  2WUQ A;  3AGD A;  2HP9 A;  1L3L A;  1XP4 A;  1BUL A;  4G3V A;  4ZAM A;  1F9I A;  2JKG A;  3C7V A;  1G5U A;  1VEU A;  3BFD A;  1XXM A;  1VQQ A;  3FPW A;  1XPB A;  2ZQD A;  3O86 A;  1KDW A;  5KZH A;  4NXE A;  3IBR A;  5M1A A;  1PWD A;  3E98 A;  5E2F A;  1DP9 A;  3BLM A;  4DXB A;  1CQA A;  4WBG A;  2OAQ 1;  2VLG A;  3HJI A;  5IU1 A;  4NET A;  2WGW B;  1UWP X;  3GDI A;  4U3T A;  3CHW P;  4YIN A;  3LIF A;  5F82 A;  4MEZ A;  4NXB A;  3LR5 A;  4KQD A;  2VKS A;  2Z2L B;  1H3Q A;  1UWN X;  2Y2Q A;  4HQA A;  2HPB A;  2HJ9 C;  4II7 A;  3V39 A;  3UE6 A;  3N8L A;  3F1N B;  2GDN A;  4ZRR A;  1ZG4 A;  4DF6 A;  2B5R A;  4WM9 A;  1X0O A;  3D72 A;  2UV0 E;  2Y59 A;  2Y2M A;  4U0X A;  4PM7 A;  4L0L A;  3E2L A;  3O5Y A;  3FWL A;  1OJ5 A;  3HLD A;  5HDS A;  4N9L A;  2W1R A;  2XGN A;  3LY3 A;  4HP4 A;  2XLN A;  1J3W A;  3G32 A;  1Y4O A;  2H28 A;  3UMD A;  4LCL A;  1PRQ A;  2Q9M A;  3D3O A;  4R23 A;  5CHJ A;  4OQH A;  3TW8 A;  4C6Y A;  1VET B;  2V1A A;  5GHX A;  3IH9 A;  3T1R A;  2OAP 1;  4MN6 A;  5HPF A;  2QKP A;  3B3X A;  1CJF A;  4Y0T A;  5CGX A;  4JF5 A;  3P98 A;  3SOI A;  1BLP A;  2JKF A;  4Q0J A;  1F2K A;  4F3L B;  3DTM A;  2Y2K A;  3K2N A;  3ZG9 B;  3IS2 A;  1ZHH B;  2VV8 A;  3R7W A;  2DCF A;  3IQA A;  2V9A A;  2QJ7 A;  1ODV A;  2FZ0 A;  2P08 A;  4ZJ3 A;  2O99 A;  1K55 A;  2R78 A;  4HBU A;  2G2U A;  1NZU A;  3IXG A;  2NUP C;  3HLB A;  3CJM A;  4CLC B;  1W5D A;  3BY9 A;  3QP6 A;  4HES A;  3LUQ A;  4Q0I A;  3MXS A;  2ZC3 B;  1S1Z A;  1ALQ A;  2Y2G A;  4E3M A;  4Y7P A;  4DN0 A;  4S2N C;  1YT4 A;  4LV1 A;  4B4X A;  3ZG0 A;  3A3E A;  1FQG A;  1XJ3 A;  5FDH A;  3LR4 A;  1LL5 A;  4DMZ A;  4OLD A;  2ZOH A;  2PR5 A;  2BG1 A;  1S1Y A;  1G68 A;  5EFW A;  1YLY A;  4HOI A;  1TEM A;  1PZP A;  4LV0 A;  3VMA A;  1GHI A;  1GSV A;  4X25 A;  4JF6 A;  3CUE A;  3SH9 A;  2D02 A;  3P09 A;  2WYX A;  4OP8 A;  2ZBB A;  3G4P A;  3JPU A;  3L7H A;  1H8M A;  3G34 A;  4K91 A;  2P7J A;  4GOG A;  1FIK A;  4RA7 A;  4GN2 A;  3PBQ A;  4XUZ A;  4QD4 A;  3O88 A;  3NDG A;  5CXW A;  4CLC C;  2EWV A;  4WEL A;  2OLV A;  2ZC6 B;  4Y0U A;  2IA2 A;  2O0Y A;  3EQU A;  2ZQ8 A;  4GS9 B;  4P6Z M;  3EGX C;  5CRF A;  3SS5 A;  3LI8 A;  1OTB A;  3LCE A;  4G3K A;  1DP6 A;  1IEM A;  2PBY A;  3VP2 A;  1N9O A;  4DJ3 A;  4X56 A;  4ME4 A;  2WZX A;  3UY6 A;  2FH5 A;  4KUO A;  1ERO A;  1AWI A;  1K38 A;  1PFL A;  3HRE A;  3NHQ A;  3HLC A;  3UB9 A;  2O9C A;  3MQO A;  4B93 A;  3BJN A;  3OOV A;  2I72 A;  1DY6 A;  1YAX A;  1H8Y A;  5TBM B;  5KSH A;  1MWT A;  5LBR A;  3V5M A;  3IH8 A;  2Y2H A;  2ZJ9 A;  2FFF B;  4E6X A;  3A0V A;  1V9Y A;  1LLB A;  3T50 A;  1PZO A;  2BLS A;  5U47 A;  3LID A;  4A5R A;  5GL9 A;  2A49 A;  4S2M A;  5E2H A;  2VJW A;  4DE3 A;  4F94 A;  3VFF A;  3A3I A;  4O0P A;  3UDX A;  4FD8 A;  4DKI A;  3SZT A;  5FAP A;  3DWK A;  1AXB A;  4DDS A;  4MBK A;  1Z09 A;  3IWO A;  3OBF A;  1KVL A;  4CLC E;  3KYZ A;  4EET B;  3B42 A;  2WKI A;  2ZMV A;  4HI4 A;  2QZ6 A;  2DNS A;  1ES3 A;  4KZ5 A;  1O7E A;  5CX7 A;  5CEC A;  3GQZ A;  3PXP A;  4HH2 A;  4KZ6 A;  3MMH A;  3BFF A;  3T4J A;  4OQG A;  5TR7 A;  5HW3 A;  4GD8 A;  3KSH A;  2XSS A;  4UA7 A;  1YSQ A;  1XGJ A;  1CEF A;  3SS3 A;  1OJG A;  4QWO A;  4IBX A;  3HVF A;  4KEN B;  4I3I A;  2W1T B;  2GJ3 A;  3EGD C;  2ZL1 B;  4I5S A;  4KQQ A;  1DRM A;  1JWP A;  1N9B A;  3HCY A;  1XJ2 A;  1IOU A;  5M19 A;  5TFQ A;  2PD8 A;  3IF6 A;  1D1J A;  4WMC D;  1ES2 A;  3S7O A;  5A93 A;  3UE0 A;  3F1O B;  1SKO B;  4EXO A;  3H7W A;  3ZDJ A;  3CMZ A;  4N1H A;  1CK3 A;  3Q7Z A;  3MS6 A;  1FR1 A;  1FCO A;  2OWJ A;  3OPR A;  3G30 A;  4XUX A;  5HFO A;  1IEL A;  4KQO A;  4NG2 A;  2DRW A;  1YLJ A;  3WRZ A;  5CHU A;  4EU0 A;  4MLL A;  5FQ9 A;  4Z9Q A;  3EWK A;  1J9M A;  3WS1 A;  4E3L A;  4I3A A;  3T1Q B;  4JXG A;  1KE4 A;  4YNR A;  4HNB A;  3WS4 A;  2W3D A;  3IHA A;  3UNW A;  4Q0H A;  3BQA A;  1S4S A;  3BEC A;  1MWR A;  2ZQ7 A;  4OOY A;  2ZD8 A;  4JGP A;  2E8I A;  3L9K A;  1GSX A;  2GZA A;  1L0G A;  2VV6 A;  3UPO A;  3HUN A;  3GRJ A;  5K5B A;  4BBT A;  5GLD A;  3WS2 A;  3NEC A;  4XXR A;  1SZV A;  3LEQ A;  4LRX C;  3E4O A;  2Q9N A;  5A8B A;  5EM1 A;  5HAR A;  2QWS A;  4Y2F A;  2EA9 A;  1EWZ A;  3NDE A;  2VV7 A;  2WKE A;  2EFX A;  4KZB A;  3ICY A;  1K6R A;  3A3D A;  1YM1 A;  2WAD A;  4EBN A;  5J4E A;  1XJ4 A;  1YQS A;  3UN7 A;  4PMA A;  2Z6D A;  5A92 A;  4BMW A;  4EER A;  2PRF A;  4Y17 A;  5FQQ A;  1MXO A;  3UB6 A;  5JYO A;  1PYY A;  2VGL S;  4R38 A;  3KYQ A;  3M2K A;  4JBF A;  5FQJ A;  4P6B A;  5HWV A;  1LI0 A;  2IWD A;  3RH8 B;  3CPT A;  1NZO A;  2PHY A;  2UWX A;  3IS2 B;  2EFU A;  3N8R A;  5DKK A;  1PW8 A;  4UEY A;  1XGI A;  4ZJ2 A;  2JKT I;  3I7J A;  3PBR A;  2B18 A;  2HDS A;  3DWZ A;  1CF0 A;  2LB9 A;  3VP4 A;  3UO9 A;  3VP0 A;  3T1S A;  3W2Z A;  4OLG A;  2O9B A;  1DP8 A;  1P97 A;  1W63 Q;  2QPN A;  4E3K A;  4RVA A;  1BUE A;  1KE3 A;  3CLO A;  3DTK A;  4X68 A;  4FH2 A;  3BRM A;  2WAF A;  3MQQ A;  1SCW A;  3ZNY A;  3HLE A;  5CER A;  1XJ6 A;  4QU3 A;  4OPR A;  4HJ4 A;  4KUK A;  5EVI A;  4R3J A;  5HAQ A;  2M1C A;  4KG6 A;  5L8M A;  1LHY A;  1MWU A;  5TGF A;  2EXA A;  2L4R A;  1K55 C;  3Q07 A;  1NYY A;  3UDI A;  1STZ A;  4IVK A;  2A2L A;  1KDS A;  2XD1 A;  4ID4 A;  1OT6 A;  3WRT A;  4Z1W A;  2HP6 A;  2L0W A;  3GVB A;  3ZVT A;  1JNU A;  4MBH A;  5F83 A;  2J80 A;  3GV9 A;  2HDU A;  4PKY A;  2A3U A;  3KSG A;  4X69 A;  2A24 A;  4H6J A;  1YPR A;  1BLS A;  4R6L A;  3G31 A;  5CGS A;  4PHT A;  5FAS A;  4BBV A;  4PM5 A;  1ONG A;  4WEK A;  4LRY C;  4WZ5 A;  4BJP A;  3CUE C;  4HHD A;  2Z6C A;  3QNB A;  4BLM A;  3SW1 A;  2J3T C;  4E3N A;  2V0U A;  3NBL A;  2Y2P A;  3A3J A;  2XH9 A;  3MSH A;  4B9O A;  2V1Z A;  3LYX A;  3F1P A;  3QP4 A;  3FV7 A;  2ZM2 A;  3CWF A;  1KGE A;  1KOU A;  2QJ5 A;  4K08 A;  5EE8 A;  2PBD P;  1O07 A;  1OT9 A;  1F5M A;  3DBA A;  1LL9 A;  1IYO A;  1PNE A;  5FAQ A;  5EVI D;  3W4O A;  1K4E A;  4OQ0 A;  2CMN A;  3G6O A;  5MC7 A;  4BWI A;  3EEH A;  4EEU A;  3OCN A;  5BOH A;  2ZM0 A;  5HD3 A;  5JYP A;  4S2K A;  4UA6 A;  3BFG A;  1DJB A;  1KVM A;  5HDD A;  4E3O A;  5CED A;  2WGI A;  5FI7 A;  4WZ4 A;  4PAU A;  3P7N A;  3OC2 A;  3LIC A;  3BLS A;  3N4I A;  1OME A;  1XFN A;  1JWV A;  4ARZ A;  4P0M A;  1RGY A;  1I2W A;  1PWC A;  2L1M A;  4JGR A;  4IJG A;  4Q8I A;  3P01 A;  1PWG A;  5FEG A;  2XFS A;  4DE1 A;  4MDZ A;  1TF1 A;  4U0T A;  4S2L A;  3QP5 A;  1ZTU A;  3CI6 A;  4LCM A;  4MBF A;  4EW7 A;  3HBR A;  4GW9 A;  3MXR A;  3UE3 A;  1YLZ A;  2ZOI A;  4OPQ A;  5DJT A;  2WGV A;  1I2S A;  3W4Q A;  1K6S A;  5G4Z A;  3VE3 A;  2WGW A;  5FSR A;  5F6A A;  2ZQ9 A;  1MBL A;  3PBO A;  2HGV A;  4FCF A;  4EBL A;  2Y2L A;  1Y54 A;  4DXC A; 
#chains in the Genus database with same CATH homology
 3MKF A;  4WMC D;  4LV3 A;  1ES2 A;  5A93 A;  4BL3 A;  3Q7V A;  4OON A;  3UE0 A;  2R9X A;  4K0X A;  3E2K A;  1BSG A;  2H0T A;  3NY4 A;  1SHV A;  5A90 A;  1I5Q A;  4JPM A;  5G18 A;  2V20 A;  2ZQC A;  3ZDJ A;  4QJG A;  3CMZ A;  1U60 A;  1Q2P A;  4N1H A;  3GTC A;  4E6W A;  3LEZ A;  4DE0 A;  4EQI A;  1PI5 A;  4E3I A;  4MNR A;  1CK3 A;  1DJC A;  1EI5 A;  2Z2M B;  3M2J A;  3MFD A;  3BYD A;  1H5X A;  4JXW A;  4PM6 A;  4N9K A;  4OKP A;  3IHB A;  1GHP A;  3Q7Z A;  3UPP A;  4JKT A;  5FAT A;  4FSF A;  4WMC A;  1FSW A;  4OVD A;  3WWX A;  3IWQ A;  3PBS A;  1ZC2 A;  3AGE A;  5HAI A;  5FI2 A;  5IHV A;  1FR6 A;  1FR1 A;  4UA9 A;  3G2Z A;  1FCO A;  2PU4 A;  4UAA A;  4GDN A;  1W8Y A;  3ZG5 A;  3OPR A;  1DJA A;  3G30 A;  3OZH A;  3IXH A;  1JTG A;  4QHC A;  4XUX A;  3N6I A;  2WAE A;  5HFO A;  4B88 A;  1IEL A;  3IF6 C;  2ZM8 A;  4EBP A;  4KQO A;  1MWS A;  1HVB A;  4M3K A;  2WUQ A;  2Y55 A;  2ZC4 B;  1NYM A;  2DRW A;  1YLJ A;  3AGD A;  2HP9 A;  4Y0O A;  3IXB A;  5CHU A;  3WRZ A;  1FSY A;  4MLL A;  1RCJ A;  4GDB A;  1BZA A;  5FQ9 A;  4KZA A;  4Z9Q A;  1J9M A;  1BUL A;  1XP4 A;  3WS1 A;  4E3L A;  3VP1 A;  4ZAM A;  3QNC A;  1TDL A;  3ZG8 B;  4JXG A;  5EOE A;  4CJN A;  2EX8 A;  3C4P A;  3C7V A;  1KE4 A;  4RX2 A;  3BFD A;  3OPP A;  1XXM A;  1VQQ A;  3WS4 A;  3IHA A;  3UNW A;  4YFM A;  1GCE A;  1XPB A;  3BEC A;  5AQ9 A;  2ZQD A;  3O86 A;  1KDW A;  5KZH A;  1MWR A;  2ZQ7 A;  4OOY A;  3S22 A;  2ZD8 A;  5M1A A;  1PWD A;  1H8Z A;  2JE5 A;  5E2F A;  4D2O A;  2E8I A;  3BLM A;  4DXB A;  1QME A;  1L0G A;  5FQM A;  2XFT A;  3UPO A;  3HUN A;  4BL2 A;  3GRJ A;  4NK3 A;  4WBG A;  4FH4 A;  1K54 A;  4HBT A;  5GLD A;  3PAE A;  3WS2 A;  4XXR A;  1Q2Q A;  4NET A;  2WGW B;  3PAG A;  4QY6 A;  1ERQ A;  4U3T A;  4OQI A;  3WS0 A;  1KGF A;  1YMX A;  4R3B A;  4YIN A;  4HEF A;  2Q9N A;  4ZDX A;  5F82 A;  1MKI A;  4MEZ A;  3OPL A;  5HAR A;  1NXY A;  1XA1 A;  2Z2L B;  4S2P A;  3ITB A;  2XD5 A;  3LO7 A;  1EWZ A;  3C4O A;  3QHY A;  3BEB A;  4IED A;  3NDE A;  3ZG7 B;  2Y2Q A;  2HDQ A;  3IF6 B;  2WKE A;  2HPB A;  1SDN A;  4DXC A;  1TVF A;  2EFX A;  3Q7V B;  4KZB A;  3V39 A;  5DF7 A;  5EUA A;  1K6R A;  3N8L A;  3EQV A;  3A3D A;  1YM1 A;  2WAD A;  2GDN A;  4EBN A;  1ES5 A;  3DW0 A;  1ZG4 A;  3SS4 A;  4DF6 A;  1YQS A;  2B5R A;  3UN7 A;  4WM9 A;  3IWI A;  4PMA A;  2Y59 A;  2HP5 A;  3WS5 A;  1BLH A;  2Y2M A;  4U0X A;  5A92 A;  4PM7 A;  1K54 C;  4L0L A;  3E2L A;  5GHY A;  5HAP A;  1L0F A;  3FWL A;  5FQQ A;  3HLD A;  3IT9 A;  1MXO A;  3S1Y A;  4E3J A;  5JYO A;  4X6T A;  1ZKJ A;  1PYY A;  4N9L A;  1WYB A;  1M6K A;  2XGN A;  5HL1 A;  3LY3 A;  5GLC A;  3SH8 A;  3M2K A;  2XLN A;  1K56 A;  3O87 A;  3V3S A;  1MPL A;  4JBF A;  5FQJ A;  4P6B A;  4DDY A;  4X55 A;  3FKW A;  3M6H A;  5E43 A;  4BEN A;  4X53 A;  3G32 A;  5FQI A;  1CI9 A;  3UPN A;  1HD8 A;  1LI0 A;  4LCL A;  2IWD A;  2VGK A;  2Q9M A;  5EEC A;  5GHZ A;  5AQA A;  4R23 A;  5CHJ A;  4OQH A;  4C6Y A;  1NZO A;  2UWX A;  4RYE A;  2EFU A;  5GHX A;  3IH9 A;  3N8R A;  1PW8 A;  5CHM A;  1XGI A;  1ES4 A;  4ZJ2 A;  3FKV A;  3B3X A;  2J7V A;  3ISG A;  2WZZ A;  1GA9 A;  1C3B A;  3I7J A;  2ZMA A;  4R0Q A;  3PBR A;  4EWF A;  1ESU A;  2HDS A;  4Y0T A;  5CGX A;  1W7F A;  3DWZ A;  2FFY A;  4JF5 A;  5KSC A;  3P98 A;  3SOI A;  3FZC A;  4DE2 A;  2R9W A;  1BLP A;  3MZF A;  3RJU A;  3VP4 A;  1XX2 A;  3UO9 A;  5GLA A;  5FI6 A;  1SDE A;  1FOF A;  3DTM A;  1YLW A;  3VP0 A;  4S2N A;  2Y2K A;  4ZTK A;  4DRT A;  1E3U D;  1XKZ A;  4OLG A;  3ZG9 B;  5CGW A;  3PBT A;  4OPY A;  4JXS A;  2DCF A;  3IQA A;  1KE0 A;  3G2Y A;  3MZD A;  2QPN A;  5EPH A;  1W8Q A;  4JF4 A;  4ZJ3 A;  1K55 A;  3PBN A;  4E3K A;  4HBU A;  1CI8 A;  2G2U A;  1NJ4 A;  4GD6 A;  4RVA A;  1BUE A;  1KE3 A;  3M6B A;  2EX6 A;  1NZU A;  2H5S A;  2XQZ A;  3IXG A;  4X68 A;  2WK0 A;  4WYY A;  3HUM A;  2Y2J A;  4FH2 A;  5L2F A;  3BRM A;  2WAF A;  3HLB A;  4QB8 A;  3CJM A;  2EX9 A;  1E3U A;  1SCW A;  2PU2 A;  3G35 A;  3ZNY A;  3HLE A;  1W5D A;  5CER A;  3BM6 A;  4HES A;  3W8K A;  4QU3 A;  2Y2I A;  3MXS A;  4O7D A;  2ZC3 B;  4OPR A;  3GR2 A;  4KZ4 A;  1GA0 A;  1ALQ A;  1BLC A;  2Y2G A;  4B4Z A;  4E3M A;  4Y7P A;  3NI9 A;  4S2N C;  3NCK A;  5EVI A;  2J9O A;  3GSG A;  1YT4 A;  1TDG A;  3C7U A;  3Q82 A;  1RP5 A;  4LV1 A;  3CG5 A;  4R3J A;  5HAQ A;  4B4X A;  4KG6 A;  4KZ9 A;  3ZG0 A;  4OPZ A;  3A3E A;  1FQG A;  1LHY A;  4KZ8 A;  5FDH A;  4ZJ1 A;  3RXX A;  1MWU A;  1LL5 A;  5TGF A;  3V3R A;  5E2G A;  3HLF A;  2EXA A;  2WKH A;  4OLD A;  1K55 C;  4H8R A;  2BG1 A;  4K0W A;  3Q07 A;  1G68 A;  1NYY A;  3UDI A;  1YLY A;  4R1G A;  4IVK A;  2X02 A;  3TOI A;  3MZE A;  1L2S A;  3C5A A;  2QMI A;  1KDS A;  1TEM A;  2XD1 A;  1PZP A;  4LV0 A;  5FA7 A;  3VOZ A;  2CC1 A;  1GHI A;  4ID4 A;  3VMA A;  1XA7 A;  4JF6 A;  3WRT A;  2HP6 A;  3SH9 A;  3GVB A;  3ZVT A;  2G2W A;  1NRF A;  4JLF A;  4S2I A;  4ZBE A;  4MBH A;  1ONH A;  1K56 D;  5F83 A;  4R4S A;  4EUZ A;  3GV9 A;  2HDU A;  3N7W A;  3VOY A;  3P09 A;  2A3U A;  3CZD A;  3HLW A;  2H10 A;  2WYX A;  4OOM A;  4OP8 A;  4X69 A;  1JTD A;  1GHM A;  3MBZ A;  1K57 A;  3G4P A;  5EVI C;  4N1X A;  1BLS A;  4KQR A;  3G31 A;  2EXB A;  3G34 A;  5GLB A;  5CGS A;  4K91 A;  4C75 A;  2JCH A;  5FAS A;  1M40 A;  4RX3 A;  2C6W B;  1QMF A;  3OCL A;  5D3O A;  4N92 A;  2OV5 A;  1IKI A;  4GOG A;  4RA7 A;  3W4P A;  1ERM A;  1KGG A;  4GN2 A;  5CTN A;  1L0D A;  3PBQ A;  4PM5 A;  1ONG A;  4XUZ A;  4WEK A;  4QD4 A;  1ESI A;  2Y2O A;  4BD1 A;  3O88 A;  3NDG A;  4LV2 A;  4WZ5 A;  5CXW A;  4BJP A;  1E25 A;  1N4O A;  1SKF A;  5AQB A;  2IWB A;  2J9P A;  1IKG A;  4WEL A;  2OLV A;  1S0W A;  2XEP A;  1PIO A;  2ZC6 B;  3D4F A;  3PTE A;  5EOO A;  3QNB A;  2ZQA A;  4Y0U A;  5DTT A;  4BLM A;  4WEJ A;  4CPK A;  2RCX A;  3MKE A;  4QY5 A;  2OLU A;  3ZCZ A;  4P85 A;  4E3N A;  3N8S A;  3NBL A;  3EQU A;  2ZQ8 A;  3HLG A;  4LEN A;  2Y2P A;  3A3J A;  2HDR A;  5CRF A;  5FQK A;  3SS5 A;  3LCE A;  2XH9 A;  1K57 C;  3ZNT A;  4BQM A;  1IEM A;  2PBY A;  4S2J A;  2V1Z A;  3VP2 A;  2VGJ A;  1L0E A;  4OOL A;  4X56 A;  3A3F A;  3FV7 A;  1CEG A;  2WZX A;  2X01 A;  3ZVW A;  3UY6 A;  2ZM2 A;  3LY4 A;  5DTK A;  5I94 A;  1ERO A;  2Y2N A;  1FCM A;  1K38 A;  4KZ3 A;  1KGE A;  2XR0 A;  3HRE A;  3HL9 A;  3HLC A;  5DF9 A;  5F1G A;  5EE8 A;  2J8Y A;  1O07 A;  2C5W B;  2ZC7 A;  4WZ5 C;  3HUO A;  4GZB A;  5EVI B;  1YLT A;  2XDM A;  2I72 A;  4PM8 A;  1DY6 A;  1YLP A;  3UE1 A;  5F1F A;  1BT5 A;  3AGF A;  1H8Y A;  2JC7 A;  4PPR A;  5KSH A;  1MWT A;  1LL9 A;  3V5M A;  3IH8 A;  1IYO A;  1Z6F A;  2Y2H A;  5DTS A;  5FAQ A;  2ZJ9 A;  2FFF B;  5EVI D;  3W4O A;  4E6X A;  1K4E A;  1LLB A;  4OQ0 A;  2XK1 A;  1PZO A;  5J8X A;  4S2O A;  2BLS A;  4KG5 A;  2Y91 A;  5U47 A;  4A5R A;  3BFC A;  5CTM A;  5GL9 A;  2ZC5 B;  3OCN A;  5BOH A;  3Q81 A;  2A49 A;  2ZM0 A;  4S2M A;  2V2F F;  4UHU A;  3Q1F A;  5DVA A;  5E2H A;  3IXD A;  4S2K A;  5JYP A;  4UA6 A;  2X71 A;  3BFG A;  1DJB A;  1KVM A;  5A91 A;  4DE3 A;  2JBF A;  4F94 A;  1NY0 A;  3IF5 A;  2P74 A;  1LI9 A;  3VFF A;  4E3O A;  1VM1 A;  3A3I A;  5CED A;  3UDX A;  2WGI A;  5FI7 A;  4FD8 A;  3VSK A;  4R4R A;  4DKI A;  3GMW A;  4WZ4 A;  3S4X A;  2ZLY A;  5FAP A;  3OPH A;  3SH7 A;  1IYS A;  4IBR A;  3DWK A;  3OC2 A;  1AXB A;  4DDS A;  5AQ7 A;  4MBK A;  5CEB A;  3IWO A;  3BLS A;  1JWZ A;  2OSU A;  3N4I A;  1OME A;  1K4F A;  1JWV A;  1WE4 A;  1KVL A;  1YMS A;  4KZ7 A;  4P0M A;  1RGY A;  1I2W A;  1PWC A;  3VP3 A;  2Y4A A;  3JYI A;  4Q8I A;  3NIA A;  3NC8 A;  4GKU A;  2P9V B;  2XF3 A;  4EV4 A;  1PWG A;  2WKI A;  3TSG A;  2XFS A;  4PM9 A;  4DE1 A;  1MY8 A;  1JVJ A;  1S6R A;  3VSL A;  4C3Q A;  1W79 A;  4S2L A;  2RL3 A;  4U0T A;  3RXW A;  3VFH A;  2QZ6 A;  2DNS A;  1ES3 A;  1WYC A;  4IVI A;  4KZ5 A;  2EX2 A;  3FYZ A;  1HTZ A;  1O7E A;  5CEC A;  1HZO A;  3GQZ A;  4KZ6 A;  4LCM A;  1RGZ A;  1ZG6 A;  4MBF A;  1PI4 A;  1PW1 A;  3BFF A;  1G6A A;  3HBR A;  1IYQ A;  1E4D A;  3MXR A;  4OQG A;  5TR7 A;  5EVL A;  1YLZ A;  3UE3 A;  1K25 A;  1BTL A;  4GB7 A;  4GD8 A;  5E2E A;  5FAO A;  5HW3 A;  3UDF A;  5M18 A;  4BD0 A;  4JXV A;  4UA7 A;  1FCN A;  4OPQ A;  1XGJ A;  4OH0 A;  2WGV A;  1I2S A;  4P87 A;  3ZHH A;  3W4Q A;  1CEF A;  1K6S A;  5KMW A;  3SS3 A;  2WGW A;  2P9V A;  4IBX A;  3HVF A;  3O3V A;  4KEN B;  4GNU A;  5FSR A;  5HX9 A;  2ZQ9 A;  1IYP A;  1MBL A;  3PBO A;  3ZFZ A;  2H0Y A;  3TG9 A;  4FCF A;  4EBL A;  3BFE A;  4KQQ A;  2Y2L A;  1JWP A;  1N9B A;  1Y54 A;  3ITA A;  3V50 A;  3ZGA B;  4KG2 A;  5M19 A;  5DF8 A;  5TFQ A;  2IWC A;  4OP5 A;  3IF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...