4OPQA

Room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutations
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
258
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TEM-94 ES-beta-lactamase
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 258
sequence length 263
ec nomenclature
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4opqA00
2X02A 1FSYA 1YLZA 3E2LA 1BTLA 4C75A 3ISGA 4KZ3A 5FI6A 5FQIA 3G35A 4Y0OA 3VP1A 1XP4A 4S2LA 1JWZA 1NYMA 3ZG9B 3CJMA 3QNCA 5F83A 3MZFA 4WZ5C 1IYSA 4GB7A 1ES3A 4OVDA 3BFFA 4YINA 2Y2LA 2GDNA 1PZPA 2EX8A 1MWTA 4X56A 3SOIA 3WS5A 1YLWA 3OPPA 3IWQA 5GLDA 5E43A 5F82A 3V5MA 3WWXA 4BLMA 5GLCA 5CEBA 4LV3A 2PBYA 3Q7VB 1K55A 2DCFA 3P98A 4E6XA 3JYIA 4GN2A 2ZC7A 4XUZA 1XPBA 4QHCA 1ONGA 1K6SA 1WYCA 3S1YA 2J9PA 5DVAA 1BLHA 1W5DA 2EFUA 4C6YA 1IKGA 2WGWB 4P85A 3UN7A 4IBRA 4XXRA 4QY6A 4WEJA 4JXGA 4DXCA 1NZUA 4M3KA 2ZQDA 3IXBA 3ZG5A 2V20A 5EPHA 5HW3A 3VP0A 1XGIA 2HP9A 3UPOA 1ZG6A 5CEDA 5DF7A 1MWRA 1PYYA 1QMFA 5FAQA 2HPBA 2C6WB 2X01A 3ZHHA 3ZVWA 2C5WB 2XLNA 3HL9A 1DJCA 4B4XA 3VP3A 4UAAA 1C3BA 1ONHA 1NXYA 5G18A 4OOLA 4LV2A 1XX2A 5FQKA 2XEPA 3BECA 5E2GA 1AXBA 4RX2A 1OMEA 1BUEA 3UPPA 4DKIA 1HZOA 1MWUA 1W79A 4Y7PA 4CPKA 4N1XA 4QD4A 5DTKA 4A5RA 2ZQCA 3E2KA 1Q2QA 3G34A 1BZAA 2WGVA 3ITBA 5EVIA 1SKFA 3TG9A 4X6TA 1FR1A 3W4PA 4KQOA 1M40A 2X71A 3N8RA 1NYYA 4KZAA 3WS1A 2CC1A 2IWDA 2Q9MA 5DTTA 3VSLA 5HL1A 4DE0A 2A3UA 3HBRA 3Q82A 5DF9A 3VOYA 1FQGA 4O7DA 4X69A 1IELA 4S2MA 1FOFA 1YLJA 2P74A 3BFGA 4FSFA 3A3IA 3DW0A 2FFFB 3MKFA 3GQZA 1VQQA 3GR2A 1LI0A 4L0LA 5D3OA 5A92A 4FH4A 2V2FF 4QY5A 4PM8A 3S22A 1JTDA 3CMZA 4OP8A 4DE3A 4K0WA 4RA7A 3BFCA 1PZOA 1SDEA 3IT9A 3Q81A 5FQQA 3ZDJA 3ZNYA 4B4ZA 3LO7A 1O07A 3DWZA 3SH8A 4PMAA 3V39A 1KDSA 3LCEA 1K25A 3VSKA 4E3JA 3MKEA 4ZAMA 1G6AA 2B5RA 3IXHA 4MEZA 1JWPA 3HREA 1FSWA 3GTCA 5GLBA 5J8XA 1ALQA 1W8QA 3A3EA 1O7EA 4OH0A 3FYZA 3HLEA 4R3BA 3O86A 4NK3A 4S2OA 3SH7A 2P9VA 3OPLA 4R0QA 3G31A 4EBNA 4N9LA 3NCKA 5CTNA 2Y2OA 4UA9A 1NY0A 1FR6A 3Q07A 4BD1A 1WE4A 1TEMA 1L0EA 4HBTA 2ZC6B 3PBTA 3O3VA 4S2KA 4E3KA 3Q1FA 1RCJA 2J9OA 2OLVA 1BLSA 1LL9A 1GHMA 3IWOA 3C7VA 1TDLA 1CI8A 5FI2A 4BL3A 2JCHA 3PAEA 2QZ6A 3UE0A 2WKIA 2RCXA 3NBLA 4MBKA 3BEBA 4JF4A 5FQ9A 1IEMA 4R23A 3WRTA 1U60A 4IEDA 4K0XA 3A3JA 2ZC3B 3OPRA 1MXOA 4LV0A 5KMWA 4BQMA 4P0MA 4X55A 5TFQA 1LHYA 1HTZA 4OQGA 3PBNA 5HAQA 3TOIA 2HDRA 1ERQA 3EQVA 4KZ5A 3TSGA 5AQ7A 4ZTKA 4X68A 3MXSA 3OC2A 1E3UA 1KE4A 1EROA 3IHBA 4XUXA 2Y2PA 3WRZA 3MZEA 2ZM8A 2XD1A 2WKHA 1PWDA 4OONA 2EX9A 3OCNA 2JBFA 4WMCA 4HEFA 1KE3A 2EXBA 4KG6A 5A93A 2Y2KA 2WKEA 5FDHA 3HLFA 1Y54A 5EVIC 2UWXA 5GHZA 3HLBA 5EE8A 5FATA 4OPZA 5CHMA 2V1ZA 3ITAA 3M2KA 2WUQA 4DE2A 2DRWA 3C4PA 5IHVA 4GKUA 1ES2A 2XQZA 2ZJ9A 4JLFA 4KZ4A 2ZM2A 4KQQA 5EUAA 3RJUA 3HLDA 3OPHA 4PM9A 5DTSA 3IWIA 2ZC5B 3I7JA 3DTMA 3PBOA 2FFYA 3Q7VA 2H0TA 1HD8A 3C5AA 3PBQA 2HDQA 2Q9NA 4OPRA 4DE1A 5GHYA 4KZ7A 5CHJA 3UDFA 1YMSA 1YLTA 1ZC2A 1CK3A 1TDGA 1GA9A 2XFTA 3HLWA 2WGWA 1GCEA 4MBHA 1ES4A 1NRFA 3IQAA 2Y2QA 1NJ4A 4ZBEA 2ZQAA 4ZJ1A 3GRJA 4WYYA 3FV7A 1KGEA 1N9BA 4HBUA 2ZM0A 1K57A 5CGWA 4OLDA 1K56A 1ESIA 2WGIA 1RGYA 4GD6A 1EI5A 4BJPA 3ZG8B 1SCWA 2Y59A 2R9XA 2ZD8A 1KDWA 1QMEA 2A49A 3IXGA 3GMWA 1PI5A 1BSGA 3SS4A 1XA1A 4LV1A 3NY4A 2QMIA 2G2UA 1JVJA 2Z2LB 1HVBA 5E2FA 5E2HA 2I72A 5L2FA 3S4XA 5TGFA 3NC8A 1CEGA 4P6BA 3A3FA 4U3TA 1TVFA 4QU3A 3BFEA 2WZZA 2J7VA 1EWZA 5KZHA 2VGJA 4MLLA 1W7FA 2PU2A 3PTEA 4E3MA 3NDGA 4Z9QA 1MBLA 2EX6A 1ZKJA 4LCMA 4OPYA 3W4OA 3QNBA 4DF6A 4EV4A 2ZQ9A 3IH8A 4OKPA 1YLPA 2R9WA 5CECA 5EOOA 2OSUA 5EVID 3IF6B 4N92A 1H8ZA 4JF5A 3LY3A 1SDNA 2BG1A 3G30A 5GHXA 5JYPA 1J9MA 4RX3A 3NDEA 1E25A 1PWCA 4R4SA 4BENA 2EFXA 5HX9A 4IVKA 1W8YA 4S2NA 4F94A 3EQUA 3OCLA 1H8YA 4OLGA 4PM5A 1I2SA 3V3RA 3VFHA 4E3IA 1DJBA 1GHPA 1Z6FA 5AQAA 1FCOA 4GD8A 3BM6A 4U0TA 3SS5A 1XGJA 2VGKA 2Y4AA 2WYXA 3G2ZA 5FAPA 1K54C 2ZQ8A 4MBFA 1IYPA 4E6WA 1XKZA 3VOZA 1G68A 4PM7A 5FQJA 3D4FA 4JPMA 1ERMA 2Y2GA 1PWGA 4PPRA 2ZLYA 3CZDA 4JXWA 4MNRA 5DF8A 1GHIA 4KQRA 4UA6A 4WM9A 5FA7A 3UPNA 5JYOA 2PU4A 1XA7A 2XK1A 4KZ8A 3IF5A 4X53A 3UE1A 3MXRA 4E3OA 1K4FA 4HESA 4RVAA 4YFMA 2DNSA 3W8KA 1PW8A 3AGFA 2OLUA 3ZNTA 2WAEA 5F1FA 3UNWA 3FWLA 4ZJ3A 2H10A 4R3JA 5CRFA 2XFSA 4GZBA 3GVBA 5HAPA 5A91A 2Z2MB 2EX2A 2JC7A 5M18A 4E3NA 3RXWA 2ZMAA 1K54A 3MFDA 3N4IA 1H5XA 3G2YA 4UHUA 4UA7A 4R1GA 1JTGA 2XGNA 3FZCA 4K91A 5M1AA 4EWFA 4N1HA 3C4OA 4H8RA 2HDUA 5AQBA 3PAGA 4JKTA 2Y55A 1ESUA 1YT4A 2Y2MA 2WK0A 4OQIA 5F1GA 1K57C 4LCLA 4S2IA 3GV9A 3M6BA 3IXDA 3WS2A 4DXBA 1L2SA 3IH9A 4Y0TA 3BFDA 4IBXA 4KZBA 4D2OA 4WELA 3VP2A 1IYQA 1MPLA 3HLCA 4JXSA 1KVLA 4WEKA 4KZ6A 3WS4A 4DDSA 5A90A 2WADA 3V3SA 1IYOA 1CEFA 5EECA 5FASA 4R4RA 1XXMA 4P87A 1K38A 3HUMA 1Q2PA 5CGSA 2IWCA 3PBSA 3UE3A 5I94A 4Q8IA 4ZDXA 5HARA 4C3QA 3VFFA 1ES5A 4WZ4A 1NZOA 5GLAA 4WZ5A 5EVIB 2Y2JA 1RGZA 3QHYA 4LENA 2WAFA 1CI9A 5FAOA 4QB8A 1MWSA 3BRMA 1E3UD 4S2JA 2XDMA 5TR7A 2JE5A 4S2PA 2IWBA 4DDYA 1KE0A 2Y2NA 1FCNA 4GDNA 1M6KA 1S6RA 3UDXA 5CTMA 3VMAA 4N9KA 5FSRA 1IKIA 4WBGA 4KG5A 3SS3A 1FCMA 4OQ0A 4WMCD 3RXXA 5KSCA 3FKWA 4FD8A 1I5QA 3UO9A 1E4DA 4FH2A 5EOEA 3ZG0A 1L0GA 1K4EA 1GA0A 4KZ9A 4RYEA 5CXWA 4EBLA 1S0WA 1ZG4A 2Y2HA 1JWVA 1BLCA 3VP4A 3HUNA 4CJNA 4E3LA 4EQIA 2WZXA 3Q7ZA 4DRTA 3BLMA 3ZCZA 4OPQA 1WYBA 2ZQ7A 3DWKA 3UDIA 5FQMA 1N4OA 1SHVA 4KG2A 2HP6A 4S2NC 2G2WA 5U47A 1PW1A 3W4QA 3AGEA 5E2EA 1PI4A 3BLSA 4EBPA 1KGGA 3C7UA 3N6IA 1RP5A 3G32A 3N8SA 3GSGA 3ZFZA 3G4PA 2EXAA 4JF6A 5HAIA 3WS0A 4FCFA 5M19A 5EVLA 2E8IA 2XD5A 1LLBA 4JXVA 3NIAA 2P9VB 2QPNA 5CGXA 1MY8A 3MZDA 3IF6C 3M6HA 3ZVTA 2J8YA 3LY4A 3A3DA 1L0FA 4QJGA 2XH9A 1K56D 2ZC4B 1YM1A 1KVMA 1BT5A 3V50A 4GDBA 4EUZA 3B3XA 3M2JA 4GNUA 3NI9A 3HUOA 1L0DA 1BULA 3ZGAB 4OOMA 3N8LA 5FI7A 4ZJ2A 5KSHA 1K6RA 1YQSA 3PBRA 3FKVA 3P09A 4JBFA 4OQHA 1KGFA 5HFOA 1LI9A 4KENB 2XF3A 1PIOA 3BYDA 3CG5A 1DJAA 1DY6A 4OP5A 1I2WA 2RL3A 5AQ9A 5BOHA 3LEZA 3O88A 1BLPA 2HDSA 4NETA 1MKIA 2H5SA 5CHUA 4IVIA 3N7WA 3ZG7B 2Y91A 2H0YA 4B88A 3SH9A 4BD0A 4PM6A 1YLYA 1YMXA 3IF6A 3UY6A 2HP5A 4Y0UA 4OOYA 3MBZA 4ID4A 2XR0A 1VM1A 4GOGA 1LL5A 5GL9A 3IHAA 4BL2A 2BLSA 2Y2IA 3OZHA 1K55C 5CERA 3O87A 4U0XA 3HVFA 2OV5A 3AGDA 3HLGA
chains in the Genus database with same CATH superfamily
1TS7A 1FSYA 1BTLA 5FI6A 5FQIA 3G35A 3K3CA 4Y0OA 3VP1A 3CJMA 3QNCA 5F83A 1ES3A 4YINA 5TBMB 3V67A 3CI6A 1OTIA 3WS5A 5F82A 4BLMA 2O9CA 5C5KA 5GLCA 4LV3A 3Q7VB 2DCFA 2GX5A 2O9AA 4MN7A 3P98A 3JYIA 4M4XA 1K6SA 5DVAA 2EFUA 1ACFA 1VETB 1F9IA 3TW8A 2ZQDA 3ZG5A 4Q0JA 4Y17A 5EPHA 3VP0A 2HP9A 3E4PA 5CEDA 5DF7A 1MWRA 4HOIA 3T4SA 2HPBA 3MQOA 3ZVWA 2C5WB 1DJCA 3VOLA 4HHDA 2XEPA 4HH2A 1OMEA 1HZOA 1D06A 1AWIA 4N1XA 5DTKA 4A5RA 3ITBA 2X71A 1NYYA 5HL1A 2CC1A 5DTTA 4DE0A 3HBRA 3B47A 1LSXA 5I5LA 1YLJA 2P74A 3QP6A 3BFGA 4FSFA 3A3IA 3GQZA 4BBVA 3S22A 4DE3A 3BFCA 3Q81A 3ZNYA 3LO7A 4H6JA 4PMAA 5TJJA 3PHYA 3C38A 1JWPA 1FSWA 3GTCA 5J8XA 1ALQA 3EWKA 5G4YA 3HLEA 1D7EA 4NK3A 4S2OA 3SH7A 4R0QA 3OPLA 4Q0HA 4L9FA 4R6LA 3ZQ5A 4DMZA 2YKHA 1WE4A 1L0EA 3HJIA 1VEUA 1RCJA 1BLSA 5J3WA 3BEBA 1IEMA 1U60A 3IS2A 1FIKA 2ZC3B 1MXOA 4LV0A 3ULFA 5EFWA 4X55A 3T1QB 4JGQA 1HTZA 4OQGA 1ERQA 1H3QA 3MXSA 3OC2A 4II7A 4OONA 3JVVA 4KG6A 3L9KA 2Y2KA 3HLFA 5TBMA 2V1ZA 2DRWA 4GKUA 1ES2A 2ZJ9A 3OPHA 1UGUA 3TE8A 3Q7VA 3C5AA 4DE1A 2HDQA 2Q9NA 5CHJA 1YMSA 1CK3A 1Y4OA 3MQ0A 1GCEA 1NRFA 1VETA 1TD5A 2Y2QA 4ZBEA 3GRJA 4QPRA 4CLCB 4WYYA 3FV7A 1XJ4A 4HBUA 1F98A 4WF0A 4DJ3A 4OLDA 1ESIA 2WGIA 4GW9A 5F6AA 2V8FA 1QMEA 2VLGA 2A49A 3IXGA 3GMWA 2QYBA 4I3JA 1BSGA 4HJ6A 2QMIA 3FPWA 4JGOA 4QU3A 3KSFA 2WZZA 2J7VA 3BY9A 2HGVA 3W4OA 1IOUA 2INWA 4DF6A 5IS1A 2R9WA 3DTIA 2OSUA 4HH3A 5EVID 3IF6B 5HDDA 1SDNA 4CLCD 3G30A 5HZHA 4BENA 3PR6A 1ZHHB 3EQUA 3MR0A 3OCLA 1H8YA 4PM5A 1LT0A 3VFHA 2W1RA 4GD8A 1XGJA 2Y4AA 1K54C 1SZVA 4HNBA 4MBFA 4E6WA 1XKZA 1G68A 3GDIA 4JXWA 3CZDA 4MNRA 3LIDA 3D9YA 1GHIA 2PU4A 1XA7A 4PKYA 3UE1A 3H9WA 3MFXA 3T4QA 2DNSA 3W8KA 1PW8A 3AGFA 2K2NA 2XFSA 3DTEA 5A91A 2JC7A 4LLOB 4DJ2A 1K54A 4UA7A 1DP6A 4Y15A 4EWFA 3C4OA 2M1CA 3PAGA 1WA9A 1GSVA 4JKTA 1ESUA 1YT4A 4OQIA 1TF1A 4LCLA 3BW6A 5F5YA 1YKDA 4WEKA 4JXSA 1KVLA 4HJ3A 1CEFA 1XXMA 2IWCA 3CWFA 4WZ4A 1DP8A 3QP1A 2Y2JA 1RGZA 4JGRA 1MWSA 5TR7A 2JE5A 1FCNA 5CTMA 3VMAA 5IT5A 1LSVA 3U4LP 3K2NA 1IKIA 4OQ0A 3RXXA 3NOPC 4FH2A 5EOEA 3ZG0A 1K4EA 3T1SA 4EBLA 1S0WA 1ZG4A 2WZXA 2LB9A 3IX3A 3DWKA 3UDIA 1N4OA 2HP6A 4S2NC 2XA7M 3AGEA 1PI4A 3BLSA 3KYQA 4EBPA 2V8CA 3EEHA 1KGGA 3C7UA 1RP5A 3ZFZA 3G4PA 2J3TD 3F1PB 3PXPA 5M19A 2E8IA 3IF6C 2XSSA 2XH9A 4HI4A 2XA7S 3V50A 4GDBA 1BULA 3IX8A 4ZJ2A 3EGDC 5KSHA 1J3WA 2W3EA 1K6RA 1PFLA 4R3AA 1LI9A 4KENB 3CG5A 1I2WA 2RL3A 5BOHA 1BLPA 3N7WA 1T19A 3ZG7B 2H0YA 1S1YA 3IF6A 3UY6A 1VM1A 5GL9A 2BLSA 5FEGA 1K55C 1N9NA 4MDZA 3CLOA 2OV5A 3H7WB 2V1AA 5HWTA 3T1XA 1XP4A 4S2LA 3ZG9B 3JPUA 5L8MA 3MZFA 1IYSA 4GB7A 4B9OA 2Y2LA 1MWTA 4X56A 2E8JA 1YLWA 5GLDA 2JN7A 2PT7A 1K55A 2PD7A 2VGLM 4E04A 4E6XA 3VE4A 4GN2A 1XPBA 4QHCA 1T1CA 2J9PA 4HP4A 1W5DA 1IKGA 2WGWB 4XXRA 1OTEA 4QY6A 1H8MA 1NZUA 3IXBA 2V20A 2BASA 1XGIA 3UPOA 3MXQA 1QMFA 2VGLS 4B4XA 5G18A 3LFVA 5E2GA 1AXBA 4RX2A 4L9EA 4DKIA 3E2KA 1BZAA 4X6TA 4KQOA 1M40A 3N8RA 4KZAA 2IWDA 2Q9MA 3VOYA 3Q82A 1F2KA 4O7DA 4LPZA 2J80A 2M7VA 3DW0A 2FFFB 3MKFA 3GR2A 2A24B 3T4TA 4OP8A 1TS6A 4K0WA 4RA7A 3IT9A 1O07A 3SH8A 4Y5FA 4FUWA 3LR4A 1V9YA 1K25A 4E3JA 3MKEA 2B5RA 1EW0A 2PBDP 3IXHA 2ACGA 1KOUA 4XT2B 3LI8A 3F1PA 5DJUA 1O7EA 3LIAA 3FYZA 4R3BA 2M7UA 3S7OA 1V9ZA 3G31A 5CTNA 2Y2OA 2HJ9C 3CPTB 4FTXA 3C7VA 1NLZA 2QHKA 4BL3A 2QZ6A 3NBLA 4R23A 3KSGA 3WRTA 1SKOB 2ZOHA 1MZUA 4K0XA 4EQ1A 2UV0E 5KMWA 5HDSA 4P0MA 3TJZC 5HD3A 2KOIA 4ZRRA 5HAQA 2HDRA 3EQVA 5AQ7A 1KE4A 1EROA 3IHBA 2OAP1 3MZEA 4EEUA 1PWDA 2PR6A 2EX9A 2JBFA 4WMCA 1KE3A 2EXBA 3MMHA 2UWXA 3ITAA 2V9AA 2WUQA 4JLFA 2ZM2A 4PM9A 5DTSA 3DTMA 2FFYA 3T1RA 1HD8A 4KZ7A 1GA9A 3HLWA 2WGWA 1ES4A 3IQAA 2ZQAA 3UE6A 1CJFA 2B95A 4UQIM 1PRQA 1S67L 4BJPA 3ZG8B 2R9XA 1KDWA 3RTYA 4ARZB 1W63Q 2L4RA 3OLOA 5E2FA 5L2FA 1CEGA 4P6BA 2O99A 3A0VA 3UB7A 4UQIS 1W7FA 2PU2A 4DN0A 1D1JA 4Z9QA 1MBLA 4LCMA 4HP9A 4O8GA 2K31A 3NJAA 2ZQ9A 5CECA 2W0NA 1H8ZA 2PDRA 2VJWA 4I38A 2ZMFA 4R38A 5JYPA 1J9MA 4RX3A 2JKRM 3NDEA 1E25A 3CHWP 2PHYA 1OTAA 2A24A 4OLGA 1I2SA 3V3RA 2W27A 1S4RA 1LL8A 3SS5A 1FCOA 2VV7A 2VGKA 5F69A 1MKMA 2WYXA 3G2ZA 4BBUA 1IYPA 5FQJA 3D4FA 4JPMA 2O9BA 2Y2GA 2ZLYA 3K3DA 4XT2A 3FPVA 5DF8A 4KQRA 5JYOA 4EU0A 3IF5A 4X53A 3LGOA 3MXRA 1K4FA 4EERA 3DTKA 2KX6A 3LR5A 2OLUA 3CPTA 2WAEA 5F1FA 5EM0A 3FWLA 1TS0A 4ZJ3A 3GVBA 1L3LA 2JKTM 2GNXA 4E3NA 1A0KA 2JKGA 3MFDA 3N4IA 1H5XA 4UHUA 1Y28A 4R1GA 1JTGA 2P7JA 2L1MA 4N1HA 2WKQA 2W3DA 2Y55A 3GECA 1SKOA 2WK0A 4DXBA 3M6BA 2J3WA 4Y0TA 3BFDA 4IBXA 3F1OB 4KZBA 4R70A 3RH8B 1IYQA 4KZ6A 3EEAA 4DDSA 2WADA 1OJ5A 3V3SA 3QP5A 3E98A 1YPRA 3HUMA 3UE3A 5I94A 4Q8IA 4ZDXA 5KIZA 2W1TB 5GLAA 4WZ5A 5EVIB 4LENA 2ZMVA 5FAOA 4QB8A 4S2JA 4DDYA 1E3UD 2XDMA 4S2PA 1W63M 1KE0A 2Y2NA 4GDNA 3UDXA 3LIBA 3LR3A 3SS3A 4G3KA 5KSCA 2H28A 1I5QA 3UO9A 2PRFA 3S7PA 3EGXC 3UB6A 3LIFA 3U2AA 1GA0A 4RYEA 5CXWA 1BLCA 3VP4A 4OPQA 1WYBA 5FQMA 1SHVA 1T18A 4KG2A 3G6OA 5U47A 2G2WA 5HWWA 3N6IA 5J4EA 3G32A 2EXAA 5HAIA 3WS0A 1LLBA 4QWOA 3R7WB 3LY4A 3B33A 1K56D 4ARZA 2ZC4B 1KVMA 1S4SA 4GNUA 2GJ3A 3ZGAB 3BWLA 4OOMA 5FI7A 3NHQA 1YQSA 3P09A 1OJGA 4OQHA 2XF3A 3BYDA 1DY6A 4IUKA 1H0MA 2KLIA 4KUOA 1T1BA 2H5SA 2QWSA 3SZTA 4BD0A 1XFQA 5LBRA 3MSHA 2P04A 4Y0UA 4ID4A 4DRTA 4U0XA 3C2WA 5EM1A 3HLGA 3P7NA 2X02A 1YLZA 4C75A 5EVEA 2R78A 1NYMA 2NUPC 4OVDA 3BFFA 4MMNA 5E43A 3V5MA 5L07A 3WWXA 2PBYA 4NEED 4XUZA 2CMNA 4MN5A 1OT9A 1WYCA 4C6YA 1VHMA 4P85A 4WLAA 3UN7A 5HPIA 1TS8A 4WEJA 4JXGA 4M3KA 5HW3A 5FEFA 1YAXA 1MC0A 1ZG6A 3KSHA 3BQ8A 1PYYA 5FAQA 3UB9A 4CLCC 2C6WB 2X01A 3R4KA 2XLNA 3VP3A 4UAAA 1C3BA 1ONHA 1NXYA 3F1OA 2JKRI 4OOLA 4LV2A 1XX2A 5FQKA 5L09A 2V0WA 1BUEA 4EEPA 3UPPA 4HQAA 1W79A 2QKPA 4CPKA 2ZQCA 4NXGA 1Q2QA 2WGVA 2W1TA 4UEYA 2JKFA 5EVIA 1FR1A 3W4PA 4YWZA 3W2ZA 4NXFA 4CLCA 3OOVA 5DFYA 4X69A 1IELA 4S2MA 4LRZE 2QJ5A 1FOFA 5FL3A 3JVUA 3UB8A 1N9OA 4L0LA 5A92A 4FH4A 2V2FF 3CMZA 1PZOA 2JKTI 5FQQA 3ZDJA 4LFUA 2BTFP 3DWZA 3V39A 4BBTA 2VK3A 2W3HA 3ZYTA 1G6AA 1PNEA 4MEZA 3HREA 5GLBA 1W8QA 4OH0A 2PR5A 3NULA 4N9LA 3NCKA 1UWNX 2ZBBA 3R7WA 4UA9A 1NY0A 3BY8A 3O3VA 4S2KA 2PD8A 4E3KA 3LI9A 3Q1FA 3TRCA 4GCZA 2J9OA 2OLVA 1LL9A 4WL9A 1CI8A 5FI2A 4GLQA 3PAEA 2EA9A 4Z1WA 2RCXA 4MBKA 5FQ9A 3KYZA 1YSPA 5HPFA 3UMDA 2DMWA 5TFQA 2EWVA 1LHYA 5IU1A 1NWZA 3TSGA 2XROA 1YSQA 2W3FA 4ZTKA 2Y2PA 2XD1A 2PYPA 4HEFA 3PYPA 1Y54A 5GHZA 5FATA 4OPZA 5CHMA 3M2KA 2HJEA 5IHVA 4KZ4A 5EUAA 4KQQA 3VV4A 4KUKA 2ZC5B 2Y8HA 3PBOA 4OPRA 3PBQA 2VV6A 5GHYA 3UDFA 1YLTA 4L9GA 4MBHA 5HD5A 2Z6DA 4ZJ1A 4GS9B 5AVEA 3L7HA 4LRXC 2VV8A 4WUJA 1K57A 5CGWA 3P01A 4GD6A 1EI5A 1P9WA 2ZD8A 2V1BA 4X1MA 3KYEA 1PI5A 5HWVA 3SS4A 1XA1A 1T1AA 2Z2LB 2G2UA 1JVJA 4IJGA 1HVBA 5DKLA 3S4XA 3A3FA 1TVFA 3BFEA 1EWZA 3PTEA 4E3MA 3NDGA 1CF0A 2EX6A 4OPYA 2V0UA 3QNBA 4ETXA 3IH8A 4OKPA 1XJ3A 4N92A 4JF5A 3QP2A 3HJKA 4MCWA 3UMEA 1VEUB 4YNRA 1PWCA 5HX9A 4IVKA 1W8YA 2XRNA 5A8BA 1Z6FA 2KDKA 5AQAA 3BM6A 2ZQ8A 3NOTC 3MS6A 4PM7A 4LRYC 2LB5A 4F3LB 2FH5A 1PWGA 4PPRA 5HSQA 4UA6A 4WM9A 3UPNA 3MF0A 2XK1A 4E3OA 4HESA 3ZNTA 1XFNA 2H10A 4R3JA 5CRFA 1OTDA 4I3IA 4GZBA 4WN5A 2Z2MB 3H7WA 4EUVA 3RXWA 2ZMAA 3FZCA 2Z6CA 4JGPA 5M1AA 4H8RA 5AQBA 3LIEA 2D02A 1K0KA 4PHTA 5F1GA 3GV9A 1L2SA 4K08A 4D2OA 2PAVP 4WELA 1GSWA 5MC7A 1HLUP 2VX8A 3WS4A 1IYOA 5FASA 3E4QA 4P87A 1Q2PA 2JHEA 5CGSA 5HARA 4C3QA 4ESPA 2YKFA 2WAFA 1CI9A 3A0RA 2IWBA 2D01A 2IA2A 1M6KA 2OWJA 4N9KA 4IHQA 4WBGA 4KG5A 2HZ5A 3T50A 3FKWA 2PYRA 4O0PA 1E4DA 1L0GA 3LEQA 2OAQ1 3KX0X 4CJNA 4EQIA 1G28A 3CUEC 2ZQ7A 3H82B 4NG2A 3W4QA 5E2EA 2HV1A 4GS9A 3N8SA 3GSGA 1OPXA 5EVLA 3SW1A 3NIAA 2P9VB 5AVFA 2QPNA 3HCYA 4Y3IA 1MY8A 3MZDA 3ZVTA 1XJ2A 2J8YA 1BT5A 1P0ZA 3CUEA 3NI9A 3HUOA 1L0DA 3PBRA 4JBFA 4P6ZM 5HFOA 5DJTA 1PIOA 1DJAA 1JNUA 5AQ9A 3LEZA 3LR0A 2HDSA 5CHUA 4IVIA 4B88A 2Y91A 3UB5P 4Q0IA 4IUHA 4FOFA 4GOGA 1LL5A 2A2LA 4P6ZS 3D3OA 3C30A 3E2LA 3DAVA 3ISGA 4KZ3A 1JWZA 1S66L 2HF6A 4MN6A 4WZ5C 2GDNA 1PZPA 2EX8A 3SOIA 4F3LA 3OPPA 3IWQA 5CEBA 4KQDA 3F1NB 2ZC7A 1ONGA 4EW7A 3IX4A 3S1YA 1BLHA 3T12B 4IBRA 4DXCA 4NKPA 3ZHHA 3KSIA 3HL9A 4HY8A 3BECA 2AVXA 4Y13A 1MWUA 4CLCE 5DFXA 4Y7PA 4QD4A 2B02A 3EOIA 3G34A 1G6OA 1SKFA 3TG9A 2OOLA 3VE3A 3T4OA 3WS1A 3VSLA 4EETB 4GHIB 1OT6A 3FC7A 2A3UA 1XJ6A 5DF9A 2K7SA 1FQGA 3IBJA 1S1ZA 5FDSA 3B42A 4G3WA 1IFQA 1VQQA 1LI0A 5D3OA 2GZAA 4QY5A 4PM8A 4NXEA 1JTDA 4B4ZA 1SDEA 3H82A 1KDSA 3RFBA 3LCEA 3VSKA 4BWIA 4ZAMA 1N9LA 2WKRA 3LYXA 3A3EA 3O86A 3LUQA 2P9VA 4EBNA 4I3AA 4X25A 4HJ4A 1FR6A 3NECA 3Q07A 5F68A 4BD1A 1TEMA 4HBTA 2ZC6B 3PBTA 4Y2FA 4CQHA 4ETZA 4I5SA 1GHMA 2FZ0A 3IWOA 1TDLA 5K5BA 1F5MA 2JCHA 3UE0A 2WKIA 4JF4A 3BJNA 1X0OA 4IEDA 3NOUC 2WKPA 3A3JA 3OPRA 2NUTC 4BQMA 4YOFA 4PAUA 1DRMA 3PBNA 3TOIA 4KZ5A 4X68A 1E3UA 1OTBA 4XUXA 3WRZA 2ZM8A 2WKHA 3OCNA 5EV0A 5A93A 2WKEA 5FDHA 5EVIC 3HLBA 5EE8A 4DE2A 3E4OA 3C4PA 3A0SA 2XQZA 3C8CA 3RJUA 3HLDA 3KO6A 3IWIA 3I7JA 2ZL1B 4HIAA 2H0TA 3F1NA 5HL6A 4LGWA 1ZC2A 1TDGA 2XFTA 4B93A 1BYWA 5G4ZA 1NJ4A 1KGEA 1N9BA 2ZM0A 2L0WA 1K56A 1RGYA 3BQAA 1SCWA 2Y59A 2B18A 2W3GA 4LV1A 3NY4A 5E2HA 2I72A 5TGFA 3NC8A 4BMWA 3FG8A 4U3TA 1ZTUA 5CX7A 5KZHA 2VGJA 4MLLA 2VZWA 2P08A 1ZKJA 3T4JA 4GHIA 4EV4A 1YLPA 5EOOA 4GJ4A 3LY3A 1ODVA 1GSXA 4I39A 2BG1A 5GHXA 5DKKA 3CAXA 4R4SA 2EFXA 4S2NA 4F94A 4E3IA 5AJGA 3E0YA 3CITA 1DJBA 1GHPA 4U0TA 3DBAA 4AFIA 5FAPA 2VKSA 1P9RA 3VOZA 4NXBA 4D60A 3T4LA 1ERMA 5FA7A 4KZ8A 1DP9A 4RVAA 4YFMA 1FILA 3UNWA 3IBRA 1UWPX 5HAPA 5L10A 2EX2A 5M18A 1Z09A 2QJ7A 2J3TC 3G2YA 4G3VA 2XGNA 3ICYA 4K91A 2HDUA 4EESA 2MJ6A 2Y2MA 3WS2A 1K57C 4S2IA 3IXDA 3IH9A 2O0YA 2OWHA 3VP2A 1MPLA 3HLCA 2Y79A 2EWWA 5A90A 5EECA 4R4RA 5HDCA 3T4KA 1K38A 3PBSA 3VFFA 1ES5A 3LICA 1NZOA 3QHYA 3BRMA 4EXOA 1P97A 3MQQA 3S7NA 1S6RA 5J7EA 4X1LA 3S7QA 5FSRA 1NLYA 1FCMA 4WMCD 2VA0A 4FD8A 4PKYG 1VB6A 2ZL1A 4KZ9A 2Y2HA 1JWVA 3HUNA 4E3LA 3Q7ZA 3BLMA 3ZCZA 4H6JB 1PW1A 3O5YA 3OBFA 1G5UA 4JF6A 4FCFA 1NRJA 2XD5A 4JXVA 5CGXA 3M6HA 2VEAA 3A3DA 1L0FA 4QJGA 2I9VA 1LSWA 1YM1A 2ZOIA 4ME4A 4EUZA 3D72A 3B3XA 3M2JA 3N8LA 4O01A 3FKVA 1KGFA 2G7UA 3QP8A 4OP5A 3QP4A 3IS2B 3O88A 4NETA 1MKIA 1STZA 1CQAA 3SH9A 4PM6A 1YLYA 1YMXA 2Q0OA 2HP5A 4OOYA 3MBZA 2XR0A 4RQ9A 4BL2A 3IHAA 2Y2IA 3OZHA 3MJQA 5CERA 3O87A 3HVFA 3AGDA
chains in the Genus database with same CATH topology
2X02A 1FSYA 1YLZA 3E2LA 1BTLA 4C75A 3ISGA 4KZ3A 5FI6A 5FQIA 3G35A 4Y0OA 3VP1A 1XP4A 4S2LA 1JWZA 1NYMA 3ZG9B 3CJMA 3QNCA 5F83A 3MZFA 4WZ5C 1IYSA 4GB7A 1ES3A 4OVDA 3BFFA 4YINA 2Y2LA 2GDNA 1PZPA 2EX8A 1MWTA 4X56A 3SOIA 3WS5A 1YLWA 3OPPA 3IWQA 5GLDA 5E43A 5F82A 3V5MA 3WWXA 4BLMA 5GLCA 5CEBA 4LV3A 2PBYA 3Q7VB 1K55A 2DCFA 3P98A 4E6XA 3JYIA 4GN2A 2ZC7A 4XUZA 1XPBA 4QHCA 1ONGA 1K6SA 1WYCA 3S1YA 2J9PA 5DVAA 1BLHA 1W5DA 2EFUA 4C6YA 1IKGA 2WGWB 4P85A 3UN7A 4IBRA 4XXRA 4QY6A 4WEJA 4JXGA 4DXCA 1NZUA 4M3KA 2ZQDA 3IXBA 3ZG5A 2V20A 5EPHA 5HW3A 3VP0A 1XGIA 2HP9A 3UPOA 1ZG6A 5CEDA 5DF7A 1MWRA 1PYYA 1QMFA 5FAQA 2HPBA 2C6WB 2X01A 3ZHHA 3ZVWA 2C5WB 2XLNA 3HL9A 1DJCA 4B4XA 3VP3A 4UAAA 1C3BA 1ONHA 1NXYA 5G18A 4OOLA 4LV2A 1XX2A 5FQKA 2XEPA 3BECA 5E2GA 1AXBA 4RX2A 1OMEA 1BUEA 3UPPA 4DKIA 1HZOA 1MWUA 1W79A 4Y7PA 4CPKA 4N1XA 4QD4A 5DTKA 4A5RA 2ZQCA 3E2KA 1Q2QA 3G34A 1BZAA 2WGVA 3ITBA 5EVIA 1SKFA 3TG9A 4X6TA 1FR1A 3W4PA 4KQOA 1M40A 2X71A 3N8RA 1NYYA 4KZAA 3WS1A 2CC1A 2IWDA 2Q9MA 5DTTA 3VSLA 5HL1A 4DE0A 2A3UA 3HBRA 3Q82A 5DF9A 3VOYA 1FQGA 4O7DA 4X69A 1IELA 4S2MA 1FOFA 1YLJA 2P74A 3BFGA 4FSFA 3A3IA 3DW0A 2FFFB 3MKFA 3GQZA 1VQQA 3GR2A 1LI0A 4L0LA 5D3OA 5A92A 4FH4A 2V2FF 4QY5A 4PM8A 3S22A 1JTDA 3CMZA 4OP8A 4DE3A 4K0WA 4RA7A 3BFCA 1PZOA 1SDEA 3IT9A 3Q81A 5FQQA 3ZDJA 3ZNYA 4B4ZA 3LO7A 1O07A 3DWZA 3SH8A 4PMAA 3V39A 1KDSA 3LCEA 1K25A 3VSKA 4E3JA 3MKEA 4ZAMA 1G6AA 2B5RA 3IXHA 4MEZA 1JWPA 3HREA 1FSWA 3GTCA 5GLBA 5J8XA 1ALQA 1W8QA 3A3EA 1O7EA 4OH0A 3FYZA 3HLEA 4R3BA 3O86A 4NK3A 4S2OA 3SH7A 2P9VA 3OPLA 4R0QA 3G31A 4EBNA 4N9LA 3NCKA 5CTNA 2Y2OA 4UA9A 1NY0A 1FR6A 3Q07A 4BD1A 1WE4A 1TEMA 1L0EA 4HBTA 2ZC6B 3PBTA 3O3VA 4S2KA 4E3KA 3Q1FA 1RCJA 2J9OA 2OLVA 1BLSA 1LL9A 1GHMA 3IWOA 3C7VA 1TDLA 1CI8A 5FI2A 4BL3A 2JCHA 3PAEA 2QZ6A 3UE0A 2WKIA 2RCXA 3NBLA 4MBKA 3BEBA 4JF4A 5FQ9A 1IEMA 4R23A 3WRTA 1U60A 4IEDA 4K0XA 3A3JA 2ZC3B 3OPRA 1MXOA 4LV0A 5KMWA 4BQMA 4P0MA 4X55A 5TFQA 1LHYA 1HTZA 4OQGA 3PBNA 5HAQA 3TOIA 2HDRA 1ERQA 3EQVA 4KZ5A 3TSGA 5AQ7A 4ZTKA 4X68A 3MXSA 3OC2A 1E3UA 1KE4A 1EROA 3IHBA 4XUXA 2Y2PA 3WRZA 3MZEA 2ZM8A 2XD1A 2WKHA 1PWDA 4OONA 2EX9A 3OCNA 2JBFA 4WMCA 4HEFA 1KE3A 2EXBA 4KG6A 5A93A 2Y2KA 2WKEA 5FDHA 3HLFA 1Y54A 5EVIC 2UWXA 5GHZA 3HLBA 5EE8A 5FATA 4OPZA 5CHMA 2V1ZA 3ITAA 3M2KA 2WUQA 4DE2A 2DRWA 3C4PA 5IHVA 4GKUA 1ES2A 2XQZA 2ZJ9A 4JLFA 4KZ4A 2ZM2A 4KQQA 5EUAA 3RJUA 3HLDA 3OPHA 4PM9A 5DTSA 3IWIA 2ZC5B 3I7JA 3DTMA 3PBOA 2FFYA 3Q7VA 2H0TA 1HD8A 3C5AA 3PBQA 2HDQA 2Q9NA 4OPRA 4DE1A 5GHYA 4KZ7A 5CHJA 3UDFA 1YMSA 1YLTA 1ZC2A 1CK3A 1TDGA 1GA9A 2XFTA 3HLWA 2WGWA 1GCEA 4MBHA 1ES4A 1NRFA 3IQAA 2Y2QA 1NJ4A 4ZBEA 2ZQAA 4ZJ1A 3GRJA 4WYYA 3FV7A 1KGEA 1N9BA 4HBUA 2ZM0A 1K57A 5CGWA 4OLDA 1K56A 1ESIA 2WGIA 1RGYA 4GD6A 1EI5A 4BJPA 3ZG8B 1SCWA 2Y59A 2R9XA 2ZD8A 1KDWA 1QMEA 2A49A 3IXGA 3GMWA 1PI5A 1BSGA 3SS4A 1XA1A 4LV1A 3NY4A 2QMIA 2G2UA 1JVJA 2Z2LB 1HVBA 5E2FA 5E2HA 2I72A 5L2FA 3S4XA 5TGFA 3NC8A 1CEGA 4P6BA 3A3FA 4U3TA 1TVFA 4QU3A 3BFEA 2WZZA 2J7VA 1EWZA 5KZHA 2VGJA 4MLLA 1W7FA 2PU2A 3PTEA 4E3MA 3NDGA 4Z9QA 1MBLA 2EX6A 1ZKJA 4LCMA 4OPYA 3W4OA 3QNBA 4DF6A 4EV4A 2ZQ9A 3IH8A 4OKPA 1YLPA 2R9WA 5CECA 5EOOA 2OSUA 5EVID 3IF6B 4N92A 1H8ZA 4JF5A 3LY3A 1SDNA 2BG1A 3G30A 5GHXA 5JYPA 1J9MA 4RX3A 3NDEA 1E25A 1PWCA 4R4SA 4BENA 2EFXA 5HX9A 4IVKA 1W8YA 4S2NA 4F94A 3EQUA 3OCLA 1H8YA 4OLGA 4PM5A 1I2SA 3V3RA 3VFHA 4E3IA 1DJBA 1GHPA 1Z6FA 5AQAA 1FCOA 4GD8A 3BM6A 4U0TA 3SS5A 1XGJA 2VGKA 2Y4AA 2WYXA 3G2ZA 5FAPA 1K54C 2ZQ8A 4MBFA 1IYPA 4E6WA 1XKZA 3VOZA 1G68A 4PM7A 5FQJA 3D4FA 4JPMA 1ERMA 2Y2GA 1PWGA 4PPRA 2ZLYA 3CZDA 4JXWA 4MNRA 5DF8A 1GHIA 4KQRA 4UA6A 4WM9A 5FA7A 3UPNA 5JYOA 2PU4A 1XA7A 2XK1A 4KZ8A 3IF5A 4X53A 3UE1A 3MXRA 4E3OA 1K4FA 4HESA 4RVAA 4YFMA 2DNSA 3W8KA 1PW8A 3AGFA 2OLUA 3ZNTA 2WAEA 5F1FA 3UNWA 3FWLA 4ZJ3A 2H10A 4R3JA 5CRFA 2XFSA 4GZBA 3GVBA 5HAPA 5A91A 2Z2MB 2EX2A 2JC7A 5M18A 4E3NA 3RXWA 2ZMAA 1K54A 3MFDA 3N4IA 1H5XA 3G2YA 4UHUA 4UA7A 4R1GA 1JTGA 2XGNA 3FZCA 4K91A 5M1AA 4EWFA 4N1HA 3C4OA 4H8RA 2HDUA 5AQBA 3PAGA 4JKTA 2Y55A 1ESUA 1YT4A 2Y2MA 2WK0A 4OQIA 5F1GA 1K57C 4LCLA 4S2IA 3GV9A 3M6BA 3IXDA 3WS2A 4DXBA 1L2SA 3IH9A 4Y0TA 3BFDA 4IBXA 4KZBA 4D2OA 4WELA 3VP2A 1IYQA 1MPLA 3HLCA 4JXSA 1KVLA 4WEKA 4KZ6A 3WS4A 4DDSA 5A90A 2WADA 3V3SA 1IYOA 1CEFA 5EECA 5FASA 4R4RA 1XXMA 4P87A 1K38A 3HUMA 1Q2PA 5CGSA 2IWCA 3PBSA 3UE3A 5I94A 4Q8IA 4ZDXA 5HARA 4C3QA 3VFFA 1ES5A 4WZ4A 1NZOA 5GLAA 4WZ5A 5EVIB 2Y2JA 1RGZA 3QHYA 4LENA 2WAFA 1CI9A 5FAOA 4QB8A 1MWSA 3BRMA 1E3UD 4S2JA 2XDMA 5TR7A 2JE5A 4S2PA 2IWBA 4DDYA 1KE0A 2Y2NA 1FCNA 4GDNA 1M6KA 1S6RA 3UDXA 5CTMA 3VMAA 4N9KA 5FSRA 1IKIA 4WBGA 4KG5A 3SS3A 1FCMA 4OQ0A 4WMCD 3RXXA 5KSCA 3FKWA 4FD8A 1I5QA 3UO9A 1E4DA 4FH2A 5EOEA 3ZG0A 1L0GA 1K4EA 1GA0A 4KZ9A 4RYEA 5CXWA 4EBLA 1S0WA 1ZG4A 2Y2HA 1JWVA 1BLCA 3VP4A 3HUNA 4CJNA 4E3LA 4EQIA 2WZXA 3Q7ZA 4DRTA 3BLMA 3ZCZA 4OPQA 1WYBA 2ZQ7A 3DWKA 3UDIA 5FQMA 1N4OA 1SHVA 4KG2A 2HP6A 4S2NC 2G2WA 5U47A 1PW1A 3W4QA 3AGEA 5E2EA 1PI4A 3BLSA 4EBPA 1KGGA 3C7UA 3N6IA 1RP5A 3G32A 3N8SA 3GSGA 3ZFZA 3G4PA 2EXAA 4JF6A 5HAIA 3WS0A 4FCFA 5M19A 5EVLA 2E8IA 2XD5A 1LLBA 4JXVA 3NIAA 2P9VB 2QPNA 5CGXA 1MY8A 3MZDA 3IF6C 3M6HA 3ZVTA 2J8YA 3LY4A 3A3DA 1L0FA 4QJGA 2XH9A 1K56D 2ZC4B 1YM1A 1KVMA 1BT5A 3V50A 4GDBA 4EUZA 3B3XA 3M2JA 4GNUA 3NI9A 3HUOA 1L0DA 1BULA 3ZGAB 4OOMA 3N8LA 5FI7A 4ZJ2A 5KSHA 1K6RA 1YQSA 3PBRA 3FKVA 3P09A 4JBFA 4OQHA 1KGFA 5HFOA 1LI9A 4KENB 2XF3A 1PIOA 3BYDA 3CG5A 1DJAA 1DY6A 4OP5A 1I2WA 2RL3A 5AQ9A 5BOHA 3LEZA 3O88A 1BLPA 2HDSA 4NETA 1MKIA 2H5SA 5CHUA 4IVIA 3N7WA 3ZG7B 2Y91A 2H0YA 4B88A 3SH9A 4BD0A 4PM6A 1YLYA 1YMXA 3IF6A 3UY6A 2HP5A 4Y0UA 4OOYA 3MBZA 4ID4A 2XR0A 1VM1A 4GOGA 1LL5A 5GL9A 3IHAA 4BL2A 2BLSA 2Y2IA 3OZHA 1K55C 5CERA 3O87A 4U0XA 3HVFA 2OV5A 3AGDA 3HLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X02 A;  1FSY A;  1YLZ A;  3E2L A;  1BTL A;  4C75 A;  3ISG A;  4KZ3 A;  5FI6 A;  5FQI A;  3G35 A;  4Y0O A;  3VP1 A;  1XP4 A;  4S2L A;  1JWZ A;  1NYM A;  3ZG9 B;  3CJM A;  3QNC A;  5F83 A;  3MZF A;  4WZ5 C;  1IYS A;  4GB7 A;  1ES3 A;  4OVD A;  3BFF A;  4YIN A;  2Y2L A;  2GDN A;  1PZP A;  2EX8 A;  1MWT A;  4X56 A;  3SOI A;  3WS5 A;  1YLW A;  3OPP A;  3IWQ A;  5GLD A;  5E43 A;  5F82 A;  3V5M A;  3WWX A;  4BLM A;  5GLC A;  5CEB A;  4LV3 A;  2PBY A;  3Q7V B;  1K55 A;  2DCF A;  3P98 A;  4E6X A;  3JYI A;  4GN2 A;  2ZC7 A;  4XUZ A;  1XPB A;  4QHC A;  1ONG A;  1K6S A;  1WYC A;  3S1Y A;  2J9P A;  5DVA A;  1BLH A;  1W5D A;  2EFU A;  4C6Y A;  1IKG A;  2WGW B;  4P85 A;  3UN7 A;  4IBR A;  4XXR A;  4QY6 A;  4WEJ A;  4JXG A;  4DXC A;  1NZU A;  4M3K A;  2ZQD A;  3IXB A;  3ZG5 A;  2V20 A;  5EPH A;  5HW3 A;  3VP0 A;  1XGI A;  2HP9 A;  3UPO A;  1ZG6 A;  5CED A;  5DF7 A;  1MWR A;  1PYY A;  1QMF A;  5FAQ A;  2HPB A;  2C6W B;  2X01 A;  3ZHH A;  3ZVW A;  2C5W B;  2XLN A;  3HL9 A;  1DJC A;  4B4X A;  3VP3 A;  4UAA A;  1C3B A;  1ONH A;  1NXY A;  5G18 A;  4OOL A;  4LV2 A;  1XX2 A;  5FQK A;  2XEP A;  3BEC A;  5E2G A;  1AXB A;  4RX2 A;  1OME A;  1BUE A;  3UPP A;  4DKI A;  1HZO A;  1MWU A;  1W79 A;  4Y7P A;  4CPK A;  4N1X A;  4QD4 A;  5DTK A;  4A5R A;  2ZQC A;  3E2K A;  1Q2Q A;  3G34 A;  1BZA A;  2WGV A;  3ITB A;  5EVI A;  1SKF A;  3TG9 A;  4X6T A;  1FR1 A;  3W4P A;  4KQO A;  1M40 A;  2X71 A;  3N8R A;  1NYY A;  4KZA A;  3WS1 A;  2CC1 A;  2IWD A;  2Q9M A;  5DTT A;  3VSL A;  5HL1 A;  4DE0 A;  2A3U A;  3HBR A;  3Q82 A;  5DF9 A;  3VOY A;  1FQG A;  4O7D A;  4X69 A;  1IEL A;  4S2M A;  1FOF A;  1YLJ A;  2P74 A;  3BFG A;  4FSF A;  3A3I A;  3DW0 A;  2FFF B;  3MKF A;  3GQZ A;  1VQQ A;  3GR2 A;  1LI0 A;  4L0L A;  5D3O A;  5A92 A;  4FH4 A;  2V2F F;  4QY5 A;  4PM8 A;  3S22 A;  1JTD A;  3CMZ A;  4OP8 A;  4DE3 A;  4K0W A;  4RA7 A;  3BFC A;  1PZO A;  1SDE A;  3IT9 A;  3Q81 A;  5FQQ A;  3ZDJ A;  3ZNY A;  4B4Z A;  3LO7 A;  1O07 A;  3DWZ A;  3SH8 A;  4PMA A;  3V39 A;  1KDS A;  3LCE A;  1K25 A;  3VSK A;  4E3J A;  3MKE A;  4ZAM A;  1G6A A;  2B5R A;  3IXH A;  4MEZ A;  1JWP A;  3HRE A;  1FSW A;  3GTC A;  5GLB A;  5J8X A;  1ALQ A;  1W8Q A;  3A3E A;  1O7E A;  4OH0 A;  3FYZ A;  3HLE A;  4R3B A;  3O86 A;  4NK3 A;  4S2O A;  3SH7 A;  2P9V A;  3OPL A;  4R0Q A;  3G31 A;  4EBN A;  4N9L A;  3NCK A;  5CTN A;  2Y2O A;  4UA9 A;  1NY0 A;  1FR6 A;  3Q07 A;  4BD1 A;  1WE4 A;  1TEM A;  1L0E A;  4HBT A;  2ZC6 B;  3PBT A;  3O3V A;  4S2K A;  4E3K A;  3Q1F A;  1RCJ A;  2J9O A;  2OLV A;  1BLS A;  1LL9 A;  1GHM A;  3IWO A;  3C7V A;  1TDL A;  1CI8 A;  5FI2 A;  4BL3 A;  2JCH A;  3PAE A;  2QZ6 A;  3UE0 A;  2WKI A;  2RCX A;  3NBL A;  4MBK A;  3BEB A;  4JF4 A;  5FQ9 A;  1IEM A;  4R23 A;  3WRT A;  1U60 A;  4IED A;  4K0X A;  3A3J A;  2ZC3 B;  3OPR A;  1MXO A;  4LV0 A;  5KMW A;  4BQM A;  4P0M A;  4X55 A;  5TFQ A;  1LHY A;  1HTZ A;  4OQG A;  3PBN A;  5HAQ A;  3TOI A;  2HDR A;  1ERQ A;  3EQV A;  4KZ5 A;  3TSG A;  5AQ7 A;  4ZTK A;  4X68 A;  3MXS A;  3OC2 A;  1E3U A;  1KE4 A;  1ERO A;  3IHB A;  4XUX A;  2Y2P A;  3WRZ A;  3MZE A;  2ZM8 A;  2XD1 A;  2WKH A;  1PWD A;  4OON A;  2EX9 A;  3OCN A;  2JBF A;  4WMC A;  4HEF A;  1KE3 A;  2EXB A;  4KG6 A;  5A93 A;  2Y2K A;  2WKE A;  5FDH A;  3HLF A;  1Y54 A;  5EVI C;  2UWX A;  5GHZ A;  3HLB A;  5EE8 A;  5FAT A;  4OPZ A;  5CHM A;  2V1Z A;  3ITA A;  3M2K A;  2WUQ A;  4DE2 A;  2DRW A;  3C4P A;  5IHV A;  4GKU A;  1ES2 A;  2XQZ A;  2ZJ9 A;  4JLF A;  4KZ4 A;  2ZM2 A;  4KQQ A;  5EUA A;  3RJU A;  3HLD A;  3OPH A;  4PM9 A;  5DTS A;  3IWI A;  2ZC5 B;  3I7J A;  3DTM A;  3PBO A;  2FFY A;  3Q7V A;  2H0T A;  1HD8 A;  3C5A A;  3PBQ A;  2HDQ A;  2Q9N A;  4OPR A;  4DE1 A;  5GHY A;  4KZ7 A;  5CHJ A;  3UDF A;  1YMS A;  1YLT A;  1ZC2 A;  1CK3 A;  1TDG A;  1GA9 A;  2XFT A;  3HLW A;  2WGW A;  1GCE A;  4MBH A;  1ES4 A;  1NRF A;  3IQA A;  2Y2Q A;  1NJ4 A;  4ZBE A;  2ZQA A;  4ZJ1 A;  3GRJ A;  4WYY A;  3FV7 A;  1KGE A;  1N9B A;  4HBU A;  2ZM0 A;  1K57 A;  5CGW A;  4OLD A;  1K56 A;  1ESI A;  2WGI A;  1RGY A;  4GD6 A;  1EI5 A;  4BJP A;  3ZG8 B;  1SCW A;  2Y59 A;  2R9X A;  2ZD8 A;  1KDW A;  1QME A;  2A49 A;  3IXG A;  3GMW A;  1PI5 A;  1BSG A;  3SS4 A;  1XA1 A;  4LV1 A;  3NY4 A;  2QMI A;  2G2U A;  1JVJ A;  2Z2L B;  1HVB A;  5E2F A;  5E2H A;  2I72 A;  5L2F A;  3S4X A;  5TGF A;  3NC8 A;  1CEG A;  4P6B A;  3A3F A;  4U3T A;  1TVF A;  4QU3 A;  3BFE A;  2WZZ A;  2J7V A;  1EWZ A;  5KZH A;  2VGJ A;  4MLL A;  1W7F A;  2PU2 A;  3PTE A;  4E3M A;  3NDG A;  4Z9Q A;  1MBL A;  2EX6 A;  1ZKJ A;  4LCM A;  4OPY A;  3W4O A;  3QNB A;  4DF6 A;  4EV4 A;  2ZQ9 A;  3IH8 A;  4OKP A;  1YLP A;  2R9W A;  5CEC A;  5EOO A;  2OSU A;  5EVI D;  3IF6 B;  4N92 A;  1H8Z A;  4JF5 A;  3LY3 A;  1SDN A;  2BG1 A;  3G30 A;  5GHX A;  5JYP A;  1J9M A;  4RX3 A;  3NDE A;  1E25 A;  1PWC A;  4R4S A;  4BEN A;  2EFX A;  5HX9 A;  4IVK A;  1W8Y A;  4S2N A;  4F94 A;  3EQU A;  3OCL A;  1H8Y A;  4OLG A;  4PM5 A;  1I2S A;  3V3R A;  3VFH A;  4E3I A;  1DJB A;  1GHP A;  1Z6F A;  5AQA A;  1FCO A;  4GD8 A;  3BM6 A;  4U0T A;  3SS5 A;  1XGJ A;  2VGK A;  2Y4A A;  2WYX A;  3G2Z A;  5FAP A;  1K54 C;  2ZQ8 A;  4MBF A;  1IYP A;  4E6W A;  1XKZ A;  3VOZ A;  1G68 A;  4PM7 A;  5FQJ A;  3D4F A;  4JPM A;  1ERM A;  2Y2G A;  1PWG A;  4PPR A;  2ZLY A;  3CZD A;  4JXW A;  4MNR A;  5DF8 A;  1GHI A;  4KQR A;  4UA6 A;  4WM9 A;  5FA7 A;  3UPN A;  5JYO A;  2PU4 A;  1XA7 A;  2XK1 A;  4KZ8 A;  3IF5 A;  4X53 A;  3UE1 A;  3MXR A;  4E3O A;  1K4F A;  4HES A;  4RVA A;  4YFM A;  2DNS A;  3W8K A;  1PW8 A;  3AGF A;  2OLU A;  3ZNT A;  2WAE A;  5F1F A;  3UNW A;  3FWL A;  4ZJ3 A;  2H10 A;  4R3J A;  5CRF A;  2XFS A;  4GZB A;  3GVB A;  5HAP A;  5A91 A;  2Z2M B;  2EX2 A;  2JC7 A;  5M18 A;  4E3N A;  3RXW A;  2ZMA A;  1K54 A;  3MFD A;  3N4I A;  1H5X A;  3G2Y A;  4UHU A;  4UA7 A;  4R1G A;  1JTG A;  2XGN A;  3FZC A;  4K91 A;  5M1A A;  4EWF A;  4N1H A;  3C4O A;  4H8R A;  2HDU A;  5AQB A;  3PAG A;  4JKT A;  2Y55 A;  1ESU A;  1YT4 A;  2Y2M A;  2WK0 A;  4OQI A;  5F1G A;  1K57 C;  4LCL A;  4S2I A;  3GV9 A;  3M6B A;  3IXD A;  3WS2 A;  4DXB A;  1L2S A;  3IH9 A;  4Y0T A;  3BFD A;  4IBX A;  4KZB A;  4D2O A;  4WEL A;  3VP2 A;  1IYQ A;  1MPL A;  3HLC A;  4JXS A;  1KVL A;  4WEK A;  4KZ6 A;  3WS4 A;  4DDS A;  5A90 A;  2WAD A;  3V3S A;  1IYO A;  1CEF A;  5EEC A;  5FAS A;  4R4R A;  1XXM A;  4P87 A;  1K38 A;  3HUM A;  1Q2P A;  5CGS A;  2IWC A;  3PBS A;  3UE3 A;  5I94 A;  4Q8I A;  4ZDX A;  5HAR A;  4C3Q A;  3VFF A;  1ES5 A;  4WZ4 A;  1NZO A;  5GLA A;  4WZ5 A;  5EVI B;  2Y2J A;  1RGZ A;  3QHY A;  4LEN A;  2WAF A;  1CI9 A;  5FAO A;  4QB8 A;  1MWS A;  3BRM A;  1E3U D;  4S2J A;  2XDM A;  5TR7 A;  2JE5 A;  4S2P A;  2IWB A;  4DDY A;  1KE0 A;  2Y2N A;  1FCN A;  4GDN A;  1M6K A;  1S6R A;  3UDX A;  5CTM A;  3VMA A;  4N9K A;  5FSR A;  1IKI A;  4WBG A;  4KG5 A;  3SS3 A;  1FCM A;  4OQ0 A;  4WMC D;  3RXX A;  5KSC A;  3FKW A;  4FD8 A;  1I5Q A;  3UO9 A;  1E4D A;  4FH2 A;  5EOE A;  3ZG0 A;  1L0G A;  1K4E A;  1GA0 A;  4KZ9 A;  4RYE A;  5CXW A;  4EBL A;  1S0W A;  1ZG4 A;  2Y2H A;  1JWV A;  1BLC A;  3VP4 A;  3HUN A;  4CJN A;  4E3L A;  4EQI A;  2WZX A;  3Q7Z A;  4DRT A;  3BLM A;  3ZCZ A;  4OPQ A;  1WYB A;  2ZQ7 A;  3DWK A;  3UDI A;  5FQM A;  1N4O A;  1SHV A;  4KG2 A;  2HP6 A;  4S2N C;  2G2W A;  5U47 A;  1PW1 A;  3W4Q A;  3AGE A;  5E2E A;  1PI4 A;  3BLS A;  4EBP A;  1KGG A;  3C7U A;  3N6I A;  1RP5 A;  3G32 A;  3N8S A;  3GSG A;  3ZFZ A;  3G4P A;  2EXA A;  4JF6 A;  5HAI A;  3WS0 A;  4FCF A;  5M19 A;  5EVL A;  2E8I A;  2XD5 A;  1LLB A;  4JXV A;  3NIA A;  2P9V B;  2QPN A;  5CGX A;  1MY8 A;  3MZD A;  3IF6 C;  3M6H A;  3ZVT A;  2J8Y A;  3LY4 A;  3A3D A;  1L0F A;  4QJG A;  2XH9 A;  1K56 D;  2ZC4 B;  1YM1 A;  1KVM A;  1BT5 A;  3V50 A;  4GDB A;  4EUZ A;  3B3X A;  3M2J A;  4GNU A;  3NI9 A;  3HUO A;  1L0D A;  1BUL A;  3ZGA B;  4OOM A;  3N8L A;  5FI7 A;  4ZJ2 A;  5KSH A;  1K6R A;  1YQS A;  3PBR A;  3FKV A;  3P09 A;  4JBF A;  4OQH A;  1KGF A;  5HFO A;  1LI9 A;  4KEN B;  2XF3 A;  1PIO A;  3BYD A;  3CG5 A;  1DJA A;  1DY6 A;  4OP5 A;  1I2W A;  2RL3 A;  5AQ9 A;  5BOH A;  3LEZ A;  3O88 A;  1BLP A;  2HDS A;  4NET A;  1MKI A;  2H5S A;  5CHU A;  4IVI A;  3N7W A;  3ZG7 B;  2Y91 A;  2H0Y A;  4B88 A;  3SH9 A;  4BD0 A;  4PM6 A;  1YLY A;  1YMX A;  3IF6 A;  3UY6 A;  2HP5 A;  4Y0U A;  4OOY A;  3MBZ A;  4ID4 A;  2XR0 A;  1VM1 A;  4GOG A;  1LL5 A;  5GL9 A;  3IHA A;  4BL2 A;  2BLS A;  2Y2I A;  3OZH A;  1K55 C;  5CER A;  3O87 A;  4U0X A;  3HVF A;  2OV5 A;  3AGD A;  3HLG A; 
#chains in the Genus database with same CATH topology
 1TS7 A;  1FSY A;  1BTL A;  5FI6 A;  5FQI A;  3G35 A;  3K3C A;  4Y0O A;  3VP1 A;  3CJM A;  3QNC A;  5F83 A;  1ES3 A;  4YIN A;  5TBM B;  3V67 A;  3CI6 A;  1OTI A;  3WS5 A;  5F82 A;  4BLM A;  2O9C A;  5C5K A;  5GLC A;  4LV3 A;  3Q7V B;  2DCF A;  2GX5 A;  2O9A A;  4MN7 A;  3P98 A;  3JYI A;  4M4X A;  1K6S A;  5DVA A;  2EFU A;  1ACF A;  1VET B;  1F9I A;  3TW8 A;  2ZQD A;  3ZG5 A;  4Q0J A;  4Y17 A;  5EPH A;  3VP0 A;  2HP9 A;  3E4P A;  5CED A;  5DF7 A;  1MWR A;  4HOI A;  3T4S A;  2HPB A;  3MQO A;  3ZVW A;  2C5W B;  1DJC A;  3VOL A;  4HHD A;  2XEP A;  4HH2 A;  1OME A;  1HZO A;  1D06 A;  1AWI A;  4N1X A;  5DTK A;  4A5R A;  3ITB A;  2X71 A;  1NYY A;  5HL1 A;  2CC1 A;  5DTT A;  4DE0 A;  3HBR A;  3B47 A;  1LSX A;  5I5L A;  1YLJ A;  2P74 A;  3QP6 A;  3BFG A;  4FSF A;  3A3I A;  3GQZ A;  4BBV A;  3S22 A;  4DE3 A;  3BFC A;  3Q81 A;  3ZNY A;  3LO7 A;  4H6J A;  4PMA A;  5TJJ A;  3PHY A;  3C38 A;  1JWP A;  1FSW A;  3GTC A;  5J8X A;  1ALQ A;  3EWK A;  5G4Y A;  3HLE A;  1D7E A;  4NK3 A;  4S2O A;  3SH7 A;  4R0Q A;  3OPL A;  4Q0H A;  4L9F A;  4R6L A;  3ZQ5 A;  4DMZ A;  2YKH A;  1WE4 A;  1L0E A;  3HJI A;  1VEU A;  1RCJ A;  1BLS A;  5J3W A;  3BEB A;  1IEM A;  1U60 A;  3IS2 A;  1FIK A;  2ZC3 B;  1MXO A;  4LV0 A;  3ULF A;  5EFW A;  4X55 A;  3T1Q B;  4JGQ A;  1HTZ A;  4OQG A;  1ERQ A;  1H3Q A;  3MXS A;  3OC2 A;  4II7 A;  4OON A;  3JVV A;  4KG6 A;  3L9K A;  2Y2K A;  3HLF A;  5TBM A;  2V1Z A;  2DRW A;  4GKU A;  1ES2 A;  2ZJ9 A;  3OPH A;  1UGU A;  3TE8 A;  3Q7V A;  3C5A A;  4DE1 A;  2HDQ A;  2Q9N A;  5CHJ A;  1YMS A;  1CK3 A;  1Y4O A;  3MQ0 A;  1GCE A;  1NRF A;  1VET A;  1TD5 A;  2Y2Q A;  4ZBE A;  3GRJ A;  4QPR A;  4CLC B;  4WYY A;  3FV7 A;  1XJ4 A;  4HBU A;  1F98 A;  4WF0 A;  4DJ3 A;  4OLD A;  1ESI A;  2WGI A;  4GW9 A;  5F6A A;  2V8F A;  1QME A;  2VLG A;  2A49 A;  3IXG A;  3GMW A;  2QYB A;  4I3J A;  1BSG A;  4HJ6 A;  2QMI A;  3FPW A;  4JGO A;  4QU3 A;  3KSF A;  2WZZ A;  2J7V A;  3BY9 A;  2HGV A;  3W4O A;  1IOU A;  2INW A;  4DF6 A;  5IS1 A;  2R9W A;  3DTI A;  2OSU A;  4HH3 A;  5EVI D;  3IF6 B;  5HDD A;  1SDN A;  4CLC D;  3G30 A;  5HZH A;  4BEN A;  3PR6 A;  1ZHH B;  3EQU A;  3MR0 A;  3OCL A;  1H8Y A;  4PM5 A;  1LT0 A;  3VFH A;  2W1R A;  4GD8 A;  1XGJ A;  2Y4A A;  1K54 C;  1SZV A;  4HNB A;  4MBF A;  4E6W A;  1XKZ A;  1G68 A;  3GDI A;  4JXW A;  3CZD A;  4MNR A;  3LID A;  3D9Y A;  1GHI A;  2PU4 A;  1XA7 A;  4PKY A;  3UE1 A;  3H9W A;  3MFX A;  3T4Q A;  2DNS A;  3W8K A;  1PW8 A;  3AGF A;  2K2N A;  2XFS A;  3DTE A;  5A91 A;  2JC7 A;  4LLO B;  4DJ2 A;  1K54 A;  4UA7 A;  1DP6 A;  4Y15 A;  4EWF A;  3C4O A;  2M1C A;  3PAG A;  1WA9 A;  1GSV A;  4JKT A;  1ESU A;  1YT4 A;  4OQI A;  1TF1 A;  4LCL A;  3BW6 A;  5F5Y A;  1YKD A;  4WEK A;  4JXS A;  1KVL A;  4HJ3 A;  1CEF A;  1XXM A;  2IWC A;  3CWF A;  4WZ4 A;  1DP8 A;  3QP1 A;  2Y2J A;  1RGZ A;  4JGR A;  1MWS A;  5TR7 A;  2JE5 A;  1FCN A;  5CTM A;  3VMA A;  5IT5 A;  1LSV A;  3U4L P;  3K2N A;  1IKI A;  4OQ0 A;  3RXX A;  3NOP C;  4FH2 A;  5EOE A;  3ZG0 A;  1K4E A;  3T1S A;  4EBL A;  1S0W A;  1ZG4 A;  2WZX A;  2LB9 A;  3IX3 A;  3DWK A;  3UDI A;  1N4O A;  2HP6 A;  4S2N C;  2XA7 M;  3AGE A;  1PI4 A;  3BLS A;  3KYQ A;  4EBP A;  2V8C A;  3EEH A;  1KGG A;  3C7U A;  1RP5 A;  3ZFZ A;  3G4P A;  2J3T D;  3F1P B;  3PXP A;  5M19 A;  2E8I A;  3IF6 C;  2XSS A;  2XH9 A;  4HI4 A;  2XA7 S;  3V50 A;  4GDB A;  1BUL A;  3IX8 A;  4ZJ2 A;  3EGD C;  5KSH A;  1J3W A;  2W3E A;  1K6R A;  1PFL A;  4R3A A;  1LI9 A;  4KEN B;  3CG5 A;  1I2W A;  2RL3 A;  5BOH A;  1BLP A;  3N7W A;  1T19 A;  3ZG7 B;  2H0Y A;  1S1Y A;  3IF6 A;  3UY6 A;  1VM1 A;  5GL9 A;  2BLS A;  5FEG A;  1K55 C;  1N9N A;  4MDZ A;  3CLO A;  2OV5 A;  3H7W B;  2V1A A;  5HWT A;  3T1X A;  1XP4 A;  4S2L A;  3ZG9 B;  3JPU A;  5L8M A;  3MZF A;  1IYS A;  4GB7 A;  4B9O A;  2Y2L A;  1MWT A;  4X56 A;  2E8J A;  1YLW A;  5GLD A;  2JN7 A;  2PT7 A;  1K55 A;  2PD7 A;  2VGL M;  4E04 A;  4E6X A;  3VE4 A;  4GN2 A;  1XPB A;  4QHC A;  1T1C A;  2J9P A;  4HP4 A;  1W5D A;  1IKG A;  2WGW B;  4XXR A;  1OTE A;  4QY6 A;  1H8M A;  1NZU A;  3IXB A;  2V20 A;  2BAS A;  1XGI A;  3UPO A;  3MXQ A;  1QMF A;  2VGL S;  4B4X A;  5G18 A;  3LFV A;  5E2G A;  1AXB A;  4RX2 A;  4L9E A;  4DKI A;  3E2K A;  1BZA A;  4X6T A;  4KQO A;  1M40 A;  3N8R A;  4KZA A;  2IWD A;  2Q9M A;  3VOY A;  3Q82 A;  1F2K A;  4O7D A;  4LPZ A;  2J80 A;  2M7V A;  3DW0 A;  2FFF B;  3MKF A;  3GR2 A;  2A24 B;  3T4T A;  4OP8 A;  1TS6 A;  4K0W A;  4RA7 A;  3IT9 A;  1O07 A;  3SH8 A;  4Y5F A;  4FUW A;  3LR4 A;  1V9Y A;  1K25 A;  4E3J A;  3MKE A;  2B5R A;  1EW0 A;  2PBD P;  3IXH A;  2ACG A;  1KOU A;  4XT2 B;  3LI8 A;  3F1P A;  5DJU A;  1O7E A;  3LIA A;  3FYZ A;  4R3B A;  2M7U A;  3S7O A;  1V9Z A;  3G31 A;  5CTN A;  2Y2O A;  2HJ9 C;  3CPT B;  4FTX A;  3C7V A;  1NLZ A;  2QHK A;  4BL3 A;  2QZ6 A;  3NBL A;  4R23 A;  3KSG A;  3WRT A;  1SKO B;  2ZOH A;  1MZU A;  4K0X A;  4EQ1 A;  2UV0 E;  5KMW A;  5HDS A;  4P0M A;  3TJZ C;  5HD3 A;  2KOI A;  4ZRR A;  5HAQ A;  2HDR A;  3EQV A;  5AQ7 A;  1KE4 A;  1ERO A;  3IHB A;  2OAP 1;  3MZE A;  4EEU A;  1PWD A;  2PR6 A;  2EX9 A;  2JBF A;  4WMC A;  1KE3 A;  2EXB A;  3MMH A;  2UWX A;  3ITA A;  2V9A A;  2WUQ A;  4JLF A;  2ZM2 A;  4PM9 A;  5DTS A;  3DTM A;  2FFY A;  3T1R A;  1HD8 A;  4KZ7 A;  1GA9 A;  3HLW A;  2WGW A;  1ES4 A;  3IQA A;  2ZQA A;  3UE6 A;  1CJF A;  2B95 A;  4UQI M;  1PRQ A;  1S67 L;  4BJP A;  3ZG8 B;  2R9X A;  1KDW A;  3RTY A;  4ARZ B;  1W63 Q;  2L4R A;  3OLO A;  5E2F A;  5L2F A;  1CEG A;  4P6B A;  2O99 A;  3A0V A;  3UB7 A;  4UQI S;  1W7F A;  2PU2 A;  4DN0 A;  1D1J A;  4Z9Q A;  1MBL A;  4LCM A;  4HP9 A;  4O8G A;  2K31 A;  3NJA A;  2ZQ9 A;  5CEC A;  2W0N A;  1H8Z A;  2PDR A;  2VJW A;  4I38 A;  2ZMF A;  4R38 A;  5JYP A;  1J9M A;  4RX3 A;  2JKR M;  3NDE A;  1E25 A;  3CHW P;  2PHY A;  1OTA A;  2A24 A;  4OLG A;  1I2S A;  3V3R A;  2W27 A;  1S4R A;  1LL8 A;  3SS5 A;  1FCO A;  2VV7 A;  2VGK A;  5F69 A;  1MKM A;  2WYX A;  3G2Z A;  4BBU A;  1IYP A;  5FQJ A;  3D4F A;  4JPM A;  2O9B A;  2Y2G A;  2ZLY A;  3K3D A;  4XT2 A;  3FPV A;  5DF8 A;  4KQR A;  5JYO A;  4EU0 A;  3IF5 A;  4X53 A;  3LGO A;  3MXR A;  1K4F A;  4EER A;  3DTK A;  2KX6 A;  3LR5 A;  2OLU A;  3CPT A;  2WAE A;  5F1F A;  5EM0 A;  3FWL A;  1TS0 A;  4ZJ3 A;  3GVB A;  1L3L A;  2JKT M;  2GNX A;  4E3N A;  1A0K A;  2JKG A;  3MFD A;  3N4I A;  1H5X A;  4UHU A;  1Y28 A;  4R1G A;  1JTG A;  2P7J A;  2L1M A;  4N1H A;  2WKQ A;  2W3D A;  2Y55 A;  3GEC A;  1SKO A;  2WK0 A;  4DXB A;  3M6B A;  2J3W A;  4Y0T A;  3BFD A;  4IBX A;  3F1O B;  4KZB A;  4R70 A;  3RH8 B;  1IYQ A;  4KZ6 A;  3EEA A;  4DDS A;  2WAD A;  1OJ5 A;  3V3S A;  3QP5 A;  3E98 A;  1YPR A;  3HUM A;  3UE3 A;  5I94 A;  4Q8I A;  4ZDX A;  5KIZ A;  2W1T B;  5GLA A;  4WZ5 A;  5EVI B;  4LEN A;  2ZMV A;  5FAO A;  4QB8 A;  4S2J A;  4DDY A;  1E3U D;  2XDM A;  4S2P A;  1W63 M;  1KE0 A;  2Y2N A;  4GDN A;  3UDX A;  3LIB A;  3LR3 A;  3SS3 A;  4G3K A;  5KSC A;  2H28 A;  1I5Q A;  3UO9 A;  2PRF A;  3S7P A;  3EGX C;  3UB6 A;  3LIF A;  3U2A A;  1GA0 A;  4RYE A;  5CXW A;  1BLC A;  3VP4 A;  4OPQ A;  1WYB A;  5FQM A;  1SHV A;  1T18 A;  4KG2 A;  3G6O A;  5U47 A;  2G2W A;  5HWW A;  3N6I A;  5J4E A;  3G32 A;  2EXA A;  5HAI A;  3WS0 A;  1LLB A;  4QWO A;  3R7W B;  3LY4 A;  3B33 A;  1K56 D;  4ARZ A;  2ZC4 B;  1KVM A;  1S4S A;  4GNU A;  2GJ3 A;  3ZGA B;  3BWL A;  4OOM A;  5FI7 A;  3NHQ A;  1YQS A;  3P09 A;  1OJG A;  4OQH A;  2XF3 A;  3BYD A;  1DY6 A;  4IUK A;  1H0M A;  2KLI A;  4KUO A;  1T1B A;  2H5S A;  2QWS A;  3SZT A;  4BD0 A;  1XFQ A;  5LBR A;  3MSH A;  2P04 A;  4Y0U A;  4ID4 A;  4DRT A;  4U0X A;  3C2W A;  5EM1 A;  3HLG A;  3P7N A;  2X02 A;  1YLZ A;  4C75 A;  5EVE A;  2R78 A;  1NYM A;  2NUP C;  4OVD A;  3BFF A;  4MMN A;  5E43 A;  3V5M A;  5L07 A;  3WWX A;  2PBY A;  4NEE D;  4XUZ A;  2CMN A;  4MN5 A;  1OT9 A;  1WYC A;  4C6Y A;  1VHM A;  4P85 A;  4WLA A;  3UN7 A;  5HPI A;  1TS8 A;  4WEJ A;  4JXG A;  4M3K A;  5HW3 A;  5FEF A;  1YAX A;  1MC0 A;  1ZG6 A;  3KSH A;  3BQ8 A;  1PYY A;  5FAQ A;  3UB9 A;  4CLC C;  2C6W B;  2X01 A;  3R4K A;  2XLN A;  3VP3 A;  4UAA A;  1C3B A;  1ONH A;  1NXY A;  3F1O A;  2JKR I;  4OOL A;  4LV2 A;  1XX2 A;  5FQK A;  5L09 A;  2V0W A;  1BUE A;  4EEP A;  3UPP A;  4HQA A;  1W79 A;  2QKP A;  4CPK A;  2ZQC A;  4NXG A;  1Q2Q A;  2WGV A;  2W1T A;  4UEY A;  2JKF A;  5EVI A;  1FR1 A;  3W4P A;  4YWZ A;  3W2Z A;  4NXF A;  4CLC A;  3OOV A;  5DFY A;  4X69 A;  1IEL A;  4S2M A;  4LRZ E;  2QJ5 A;  1FOF A;  5FL3 A;  3JVU A;  3UB8 A;  1N9O A;  4L0L A;  5A92 A;  4FH4 A;  2V2F F;  3CMZ A;  1PZO A;  2JKT I;  5FQQ A;  3ZDJ A;  4LFU A;  2BTF P;  3DWZ A;  3V39 A;  4BBT A;  2VK3 A;  2W3H A;  3ZYT A;  1G6A A;  1PNE A;  4MEZ A;  3HRE A;  5GLB A;  1W8Q A;  4OH0 A;  2PR5 A;  3NUL A;  4N9L A;  3NCK A;  1UWN X;  2ZBB A;  3R7W A;  4UA9 A;  1NY0 A;  3BY8 A;  3O3V A;  4S2K A;  2PD8 A;  4E3K A;  3LI9 A;  3Q1F A;  3TRC A;  4GCZ A;  2J9O A;  2OLV A;  1LL9 A;  4WL9 A;  1CI8 A;  5FI2 A;  4GLQ A;  3PAE A;  2EA9 A;  4Z1W A;  2RCX A;  4MBK A;  5FQ9 A;  3KYZ A;  1YSP A;  5HPF A;  3UMD A;  2DMW A;  5TFQ A;  2EWV A;  1LHY A;  5IU1 A;  1NWZ A;  3TSG A;  2XRO A;  1YSQ A;  2W3F A;  4ZTK A;  2Y2P A;  2XD1 A;  2PYP A;  4HEF A;  3PYP A;  1Y54 A;  5GHZ A;  5FAT A;  4OPZ A;  5CHM A;  3M2K A;  2HJE A;  5IHV A;  4KZ4 A;  5EUA A;  4KQQ A;  3VV4 A;  4KUK A;  2ZC5 B;  2Y8H A;  3PBO A;  4OPR A;  3PBQ A;  2VV6 A;  5GHY A;  3UDF A;  1YLT A;  4L9G A;  4MBH A;  5HD5 A;  2Z6D A;  4ZJ1 A;  4GS9 B;  5AVE A;  3L7H A;  4LRX C;  2VV8 A;  4WUJ A;  1K57 A;  5CGW A;  3P01 A;  4GD6 A;  1EI5 A;  1P9W A;  2ZD8 A;  2V1B A;  4X1M A;  3KYE A;  1PI5 A;  5HWV A;  3SS4 A;  1XA1 A;  1T1A A;  2Z2L B;  2G2U A;  1JVJ A;  4IJG A;  1HVB A;  5DKL A;  3S4X A;  3A3F A;  1TVF A;  3BFE A;  1EWZ A;  3PTE A;  4E3M A;  3NDG A;  1CF0 A;  2EX6 A;  4OPY A;  2V0U A;  3QNB A;  4ETX A;  3IH8 A;  4OKP A;  1XJ3 A;  4N92 A;  4JF5 A;  3QP2 A;  3HJK A;  4MCW A;  3UME A;  1VEU B;  4YNR A;  1PWC A;  5HX9 A;  4IVK A;  1W8Y A;  2XRN A;  5A8B A;  1Z6F A;  2KDK A;  5AQA A;  3BM6 A;  2ZQ8 A;  3NOT C;  3MS6 A;  4PM7 A;  4LRY C;  2LB5 A;  4F3L B;  2FH5 A;  1PWG A;  4PPR A;  5HSQ A;  4UA6 A;  4WM9 A;  3UPN A;  3MF0 A;  2XK1 A;  4E3O A;  4HES A;  3ZNT A;  1XFN A;  2H10 A;  4R3J A;  5CRF A;  1OTD A;  4I3I A;  4GZB A;  4WN5 A;  2Z2M B;  3H7W A;  4EUV A;  3RXW A;  2ZMA A;  3FZC A;  2Z6C A;  4JGP A;  5M1A A;  4H8R A;  5AQB A;  3LIE A;  2D02 A;  1K0K A;  4PHT A;  5F1G A;  3GV9 A;  1L2S A;  4K08 A;  4D2O A;  2PAV P;  4WEL A;  1GSW A;  5MC7 A;  1HLU P;  2VX8 A;  3WS4 A;  1IYO A;  5FAS A;  3E4Q A;  4P87 A;  1Q2P A;  2JHE A;  5CGS A;  5HAR A;  4C3Q A;  4ESP A;  2YKF A;  2WAF A;  1CI9 A;  3A0R A;  2IWB A;  2D01 A;  2IA2 A;  1M6K A;  2OWJ A;  4N9K A;  4IHQ A;  4WBG A;  4KG5 A;  2HZ5 A;  3T50 A;  3FKW A;  2PYR A;  4O0P A;  1E4D A;  1L0G A;  3LEQ A;  2OAQ 1;  3KX0 X;  4CJN A;  4EQI A;  1G28 A;  3CUE C;  2ZQ7 A;  3H82 B;  4NG2 A;  3W4Q A;  5E2E A;  2HV1 A;  4GS9 A;  3N8S A;  3GSG A;  1OPX A;  5EVL A;  3SW1 A;  3NIA A;  2P9V B;  5AVF A;  2QPN A;  3HCY A;  4Y3I A;  1MY8 A;  3MZD A;  3ZVT A;  1XJ2 A;  2J8Y A;  1BT5 A;  1P0Z A;  3CUE A;  3NI9 A;  3HUO A;  1L0D A;  3PBR A;  4JBF A;  4P6Z M;  5HFO A;  5DJT A;  1PIO A;  1DJA A;  1JNU A;  5AQ9 A;  3LEZ A;  3LR0 A;  2HDS A;  5CHU A;  4IVI A;  4B88 A;  2Y91 A;  3UB5 P;  4Q0I A;  4IUH A;  4FOF A;  4GOG A;  1LL5 A;  2A2L A;  4P6Z S;  3D3O A;  3C30 A;  3E2L A;  3DAV A;  3ISG A;  4KZ3 A;  1JWZ A;  1S66 L;  2HF6 A;  4MN6 A;  4WZ5 C;  2GDN A;  1PZP A;  2EX8 A;  3SOI A;  4F3L A;  3OPP A;  3IWQ A;  5CEB A;  4KQD A;  3F1N B;  2ZC7 A;  1ONG A;  4EW7 A;  3IX4 A;  3S1Y A;  1BLH A;  3T12 B;  4IBR A;  4DXC A;  4NKP A;  3ZHH A;  3KSI A;  3HL9 A;  4HY8 A;  3BEC A;  2AVX A;  4Y13 A;  1MWU A;  4CLC E;  5DFX A;  4Y7P A;  4QD4 A;  2B02 A;  3EOI A;  3G34 A;  1G6O A;  1SKF A;  3TG9 A;  2OOL A;  3VE3 A;  3T4O A;  3WS1 A;  3VSL A;  4EET B;  4GHI B;  1OT6 A;  3FC7 A;  2A3U A;  1XJ6 A;  5DF9 A;  2K7S A;  1FQG A;  3IBJ A;  1S1Z A;  5FDS A;  3B42 A;  4G3W A;  1IFQ A;  1VQQ A;  1LI0 A;  5D3O A;  2GZA A;  4QY5 A;  4PM8 A;  4NXE A;  1JTD A;  4B4Z A;  1SDE A;  3H82 A;  1KDS A;  3RFB A;  3LCE A;  3VSK A;  4BWI A;  4ZAM A;  1N9L A;  2WKR A;  3LYX A;  3A3E A;  3O86 A;  3LUQ A;  2P9V A;  4EBN A;  4I3A A;  4X25 A;  4HJ4 A;  1FR6 A;  3NEC A;  3Q07 A;  5F68 A;  4BD1 A;  1TEM A;  4HBT A;  2ZC6 B;  3PBT A;  4Y2F A;  4CQH A;  4ETZ A;  4I5S A;  1GHM A;  2FZ0 A;  3IWO A;  1TDL A;  5K5B A;  1F5M A;  2JCH A;  3UE0 A;  2WKI A;  4JF4 A;  3BJN A;  1X0O A;  4IED A;  3NOU C;  2WKP A;  3A3J A;  3OPR A;  2NUT C;  4BQM A;  4YOF A;  4PAU A;  1DRM A;  3PBN A;  3TOI A;  4KZ5 A;  4X68 A;  1E3U A;  1OTB A;  4XUX A;  3WRZ A;  2ZM8 A;  2WKH A;  3OCN A;  5EV0 A;  5A93 A;  2WKE A;  5FDH A;  5EVI C;  3HLB A;  5EE8 A;  4DE2 A;  3E4O A;  3C4P A;  3A0S A;  2XQZ A;  3C8C A;  3RJU A;  3HLD A;  3KO6 A;  3IWI A;  3I7J A;  2ZL1 B;  4HIA A;  2H0T A;  3F1N A;  5HL6 A;  4LGW A;  1ZC2 A;  1TDG A;  2XFT A;  4B93 A;  1BYW A;  5G4Z A;  1NJ4 A;  1KGE A;  1N9B A;  2ZM0 A;  2L0W A;  1K56 A;  1RGY A;  3BQA A;  1SCW A;  2Y59 A;  2B18 A;  2W3G A;  4LV1 A;  3NY4 A;  5E2H A;  2I72 A;  5TGF A;  3NC8 A;  4BMW A;  3FG8 A;  4U3T A;  1ZTU A;  5CX7 A;  5KZH A;  2VGJ A;  4MLL A;  2VZW A;  2P08 A;  1ZKJ A;  3T4J A;  4GHI A;  4EV4 A;  1YLP A;  5EOO A;  4GJ4 A;  3LY3 A;  1ODV A;  1GSX A;  4I39 A;  2BG1 A;  5GHX A;  5DKK A;  3CAX A;  4R4S A;  2EFX A;  4S2N A;  4F94 A;  4E3I A;  5AJG A;  3E0Y A;  3CIT A;  1DJB A;  1GHP A;  4U0T A;  3DBA A;  4AFI A;  5FAP A;  2VKS A;  1P9R A;  3VOZ A;  4NXB A;  4D60 A;  3T4L A;  1ERM A;  5FA7 A;  4KZ8 A;  1DP9 A;  4RVA A;  4YFM A;  1FIL A;  3UNW A;  3IBR A;  1UWP X;  5HAP A;  5L10 A;  2EX2 A;  5M18 A;  1Z09 A;  2QJ7 A;  2J3T C;  3G2Y A;  4G3V A;  2XGN A;  3ICY A;  4K91 A;  2HDU A;  4EES A;  2MJ6 A;  2Y2M A;  3WS2 A;  1K57 C;  4S2I A;  3IXD A;  3IH9 A;  2O0Y A;  2OWH A;  3VP2 A;  1MPL A;  3HLC A;  2Y79 A;  2EWW A;  5A90 A;  5EEC A;  4R4R A;  5HDC A;  3T4K A;  1K38 A;  3PBS A;  3VFF A;  1ES5 A;  3LIC A;  1NZO A;  3QHY A;  3BRM A;  4EXO A;  1P97 A;  3MQQ A;  3S7N A;  1S6R A;  5J7E A;  4X1L A;  3S7Q A;  5FSR A;  1NLY A;  1FCM A;  4WMC D;  2VA0 A;  4FD8 A;  4PKY G;  1VB6 A;  2ZL1 A;  4KZ9 A;  2Y2H A;  1JWV A;  3HUN A;  4E3L A;  3Q7Z A;  3BLM A;  3ZCZ A;  4H6J B;  1PW1 A;  3O5Y A;  3OBF A;  1G5U A;  4JF6 A;  4FCF A;  1NRJ A;  2XD5 A;  4JXV A;  5CGX A;  3M6H A;  2VEA A;  3A3D A;  1L0F A;  4QJG A;  2I9V A;  1LSW A;  1YM1 A;  2ZOI A;  4ME4 A;  4EUZ A;  3D72 A;  3B3X A;  3M2J A;  3N8L A;  4O01 A;  3FKV A;  1KGF A;  2G7U A;  3QP8 A;  4OP5 A;  3QP4 A;  3IS2 B;  3O88 A;  4NET A;  1MKI A;  1STZ A;  1CQA A;  3SH9 A;  4PM6 A;  1YLY A;  1YMX A;  2Q0O A;  2HP5 A;  4OOY A;  3MBZ A;  2XR0 A;  4RQ9 A;  4BL2 A;  3IHA A;  2Y2I A;  3OZH A;  3MJQ A;  5CER A;  3O87 A;  3HVF A;  3AGD A; 
#chains in the Genus database with same CATH homology
 2X02 A;  1FSY A;  1YLZ A;  3E2L A;  1BTL A;  4C75 A;  3ISG A;  4KZ3 A;  5FI6 A;  5FQI A;  3G35 A;  4Y0O A;  3VP1 A;  1XP4 A;  4S2L A;  1JWZ A;  1NYM A;  3ZG9 B;  3CJM A;  3QNC A;  5F83 A;  3MZF A;  4WZ5 C;  1IYS A;  4GB7 A;  1ES3 A;  4OVD A;  3BFF A;  4YIN A;  2Y2L A;  2GDN A;  1PZP A;  2EX8 A;  1MWT A;  4X56 A;  3SOI A;  3WS5 A;  1YLW A;  3OPP A;  3IWQ A;  5GLD A;  5E43 A;  5F82 A;  3V5M A;  3WWX A;  4BLM A;  5GLC A;  5CEB A;  4LV3 A;  2PBY A;  3Q7V B;  1K55 A;  2DCF A;  3P98 A;  4E6X A;  3JYI A;  4GN2 A;  2ZC7 A;  4XUZ A;  1XPB A;  4QHC A;  1ONG A;  1K6S A;  1WYC A;  3S1Y A;  2J9P A;  5DVA A;  1BLH A;  1W5D A;  2EFU A;  4C6Y A;  1IKG A;  2WGW B;  4P85 A;  3UN7 A;  4IBR A;  4XXR A;  4QY6 A;  4WEJ A;  4JXG A;  4DXC A;  1NZU A;  4M3K A;  2ZQD A;  3IXB A;  3ZG5 A;  2V20 A;  5EPH A;  5HW3 A;  3VP0 A;  1XGI A;  2HP9 A;  3UPO A;  1ZG6 A;  5CED A;  5DF7 A;  1MWR A;  1PYY A;  1QMF A;  5FAQ A;  2HPB A;  2C6W B;  2X01 A;  3ZHH A;  3ZVW A;  2C5W B;  2XLN A;  3HL9 A;  1DJC A;  4B4X A;  3VP3 A;  4UAA A;  1C3B A;  1ONH A;  1NXY A;  5G18 A;  4OOL A;  4LV2 A;  1XX2 A;  5FQK A;  2XEP A;  3BEC A;  5E2G A;  1AXB A;  4RX2 A;  1OME A;  1BUE A;  3UPP A;  4DKI A;  1HZO A;  1MWU A;  1W79 A;  4Y7P A;  4CPK A;  4N1X A;  4QD4 A;  5DTK A;  4A5R A;  2ZQC A;  3E2K A;  1Q2Q A;  3G34 A;  1BZA A;  2WGV A;  3ITB A;  5EVI A;  1SKF A;  3TG9 A;  4X6T A;  1FR1 A;  3W4P A;  4KQO A;  1M40 A;  2X71 A;  3N8R A;  1NYY A;  4KZA A;  3WS1 A;  2CC1 A;  2IWD A;  2Q9M A;  5DTT A;  3VSL A;  5HL1 A;  4DE0 A;  2A3U A;  3HBR A;  3Q82 A;  5DF9 A;  3VOY A;  1FQG A;  4O7D A;  4X69 A;  1IEL A;  4S2M A;  1FOF A;  1YLJ A;  2P74 A;  3BFG A;  4FSF A;  3A3I A;  3DW0 A;  2FFF B;  3MKF A;  3GQZ A;  1VQQ A;  3GR2 A;  1LI0 A;  4L0L A;  5D3O A;  5A92 A;  4FH4 A;  2V2F F;  4QY5 A;  4PM8 A;  3S22 A;  1JTD A;  3CMZ A;  4OP8 A;  4DE3 A;  4K0W A;  4RA7 A;  3BFC A;  1PZO A;  1SDE A;  3IT9 A;  3Q81 A;  5FQQ A;  3ZDJ A;  3ZNY A;  4B4Z A;  3LO7 A;  1O07 A;  3DWZ A;  3SH8 A;  4PMA A;  3V39 A;  1KDS A;  3LCE A;  1K25 A;  3VSK A;  4E3J A;  3MKE A;  4ZAM A;  1G6A A;  2B5R A;  3IXH A;  4MEZ A;  1JWP A;  3HRE A;  1FSW A;  3GTC A;  5GLB A;  5J8X A;  1ALQ A;  1W8Q A;  3A3E A;  1O7E A;  4OH0 A;  3FYZ A;  3HLE A;  4R3B A;  3O86 A;  4NK3 A;  4S2O A;  3SH7 A;  2P9V A;  3OPL A;  4R0Q A;  3G31 A;  4EBN A;  4N9L A;  3NCK A;  5CTN A;  2Y2O A;  4UA9 A;  1NY0 A;  1FR6 A;  3Q07 A;  4BD1 A;  1WE4 A;  1TEM A;  1L0E A;  4HBT A;  2ZC6 B;  3PBT A;  3O3V A;  4S2K A;  4E3K A;  3Q1F A;  1RCJ A;  2J9O A;  2OLV A;  1BLS A;  1LL9 A;  1GHM A;  3IWO A;  3C7V A;  1TDL A;  1CI8 A;  5FI2 A;  4BL3 A;  2JCH A;  3PAE A;  2QZ6 A;  3UE0 A;  2WKI A;  2RCX A;  3NBL A;  4MBK A;  3BEB A;  4JF4 A;  5FQ9 A;  1IEM A;  4R23 A;  3WRT A;  1U60 A;  4IED A;  4K0X A;  3A3J A;  2ZC3 B;  3OPR A;  1MXO A;  4LV0 A;  5KMW A;  4BQM A;  4P0M A;  4X55 A;  5TFQ A;  1LHY A;  1HTZ A;  4OQG A;  3PBN A;  5HAQ A;  3TOI A;  2HDR A;  1ERQ A;  3EQV A;  4KZ5 A;  3TSG A;  5AQ7 A;  4ZTK A;  4X68 A;  3MXS A;  3OC2 A;  1E3U A;  1KE4 A;  1ERO A;  3IHB A;  4XUX A;  2Y2P A;  3WRZ A;  3MZE A;  2ZM8 A;  2XD1 A;  2WKH A;  1PWD A;  4OON A;  2EX9 A;  3OCN A;  2JBF A;  4WMC A;  4HEF A;  1KE3 A;  2EXB A;  4KG6 A;  5A93 A;  2Y2K A;  2WKE A;  5FDH A;  3HLF A;  1Y54 A;  5EVI C;  2UWX A;  5GHZ A;  3HLB A;  5EE8 A;  5FAT A;  4OPZ A;  5CHM A;  2V1Z A;  3ITA A;  3M2K A;  2WUQ A;  4DE2 A;  2DRW A;  3C4P A;  5IHV A;  4GKU A;  1ES2 A;  2XQZ A;  2ZJ9 A;  4JLF A;  4KZ4 A;  2ZM2 A;  4KQQ A;  5EUA A;  3RJU A;  3HLD A;  3OPH A;  4PM9 A;  5DTS A;  3IWI A;  2ZC5 B;  3I7J A;  3DTM A;  3PBO A;  2FFY A;  3Q7V A;  2H0T A;  1HD8 A;  3C5A A;  3PBQ A;  2HDQ A;  2Q9N A;  4OPR A;  4DE1 A;  5GHY A;  4KZ7 A;  5CHJ A;  3UDF A;  1YMS A;  1YLT A;  1ZC2 A;  1CK3 A;  1TDG A;  1GA9 A;  2XFT A;  3HLW A;  2WGW A;  1GCE A;  4MBH A;  1ES4 A;  1NRF A;  3IQA A;  2Y2Q A;  1NJ4 A;  4ZBE A;  2ZQA A;  4ZJ1 A;  3GRJ A;  4WYY A;  3FV7 A;  1KGE A;  1N9B A;  4HBU A;  2ZM0 A;  1K57 A;  5CGW A;  4OLD A;  1K56 A;  1ESI A;  2WGI A;  1RGY A;  4GD6 A;  1EI5 A;  4BJP A;  3ZG8 B;  1SCW A;  2Y59 A;  2R9X A;  2ZD8 A;  1KDW A;  1QME A;  2A49 A;  3IXG A;  3GMW A;  1PI5 A;  1BSG A;  3SS4 A;  1XA1 A;  4LV1 A;  3NY4 A;  2QMI A;  2G2U A;  1JVJ A;  2Z2L B;  1HVB A;  5E2F A;  5E2H A;  2I72 A;  5L2F A;  3S4X A;  5TGF A;  3NC8 A;  1CEG A;  4P6B A;  3A3F A;  4U3T A;  1TVF A;  4QU3 A;  3BFE A;  2WZZ A;  2J7V A;  1EWZ A;  5KZH A;  2VGJ A;  4MLL A;  1W7F A;  2PU2 A;  3PTE A;  4E3M A;  3NDG A;  4Z9Q A;  1MBL A;  2EX6 A;  1ZKJ A;  4LCM A;  4OPY A;  3W4O A;  3QNB A;  4DF6 A;  4EV4 A;  2ZQ9 A;  3IH8 A;  4OKP A;  1YLP A;  2R9W A;  5CEC A;  5EOO A;  2OSU A;  5EVI D;  3IF6 B;  4N92 A;  1H8Z A;  4JF5 A;  3LY3 A;  1SDN A;  2BG1 A;  3G30 A;  5GHX A;  5JYP A;  1J9M A;  4RX3 A;  3NDE A;  1E25 A;  1PWC A;  4R4S A;  4BEN A;  2EFX A;  5HX9 A;  4IVK A;  1W8Y A;  4S2N A;  4F94 A;  3EQU A;  3OCL A;  1H8Y A;  4OLG A;  4PM5 A;  1I2S A;  3V3R A;  3VFH A;  4E3I A;  1DJB A;  1GHP A;  1Z6F A;  5AQA A;  1FCO A;  4GD8 A;  3BM6 A;  4U0T A;  3SS5 A;  1XGJ A;  2VGK A;  2Y4A A;  2WYX A;  3G2Z A;  5FAP A;  1K54 C;  2ZQ8 A;  4MBF A;  1IYP A;  4E6W A;  1XKZ A;  3VOZ A;  1G68 A;  4PM7 A;  5FQJ A;  3D4F A;  4JPM A;  1ERM A;  2Y2G A;  1PWG A;  4PPR A;  2ZLY A;  3CZD A;  4JXW A;  4MNR A;  5DF8 A;  1GHI A;  4KQR A;  4UA6 A;  4WM9 A;  5FA7 A;  3UPN A;  5JYO A;  2PU4 A;  1XA7 A;  2XK1 A;  4KZ8 A;  3IF5 A;  4X53 A;  3UE1 A;  3MXR A;  4E3O A;  1K4F A;  4HES A;  4RVA A;  4YFM A;  2DNS A;  3W8K A;  1PW8 A;  3AGF A;  2OLU A;  3ZNT A;  2WAE A;  5F1F A;  3UNW A;  3FWL A;  4ZJ3 A;  2H10 A;  4R3J A;  5CRF A;  2XFS A;  4GZB A;  3GVB A;  5HAP A;  5A91 A;  2Z2M B;  2EX2 A;  2JC7 A;  5M18 A;  4E3N A;  3RXW A;  2ZMA A;  1K54 A;  3MFD A;  3N4I A;  1H5X A;  3G2Y A;  4UHU A;  4UA7 A;  4R1G A;  1JTG A;  2XGN A;  3FZC A;  4K91 A;  5M1A A;  4EWF A;  4N1H A;  3C4O A;  4H8R A;  2HDU A;  5AQB A;  3PAG A;  4JKT A;  2Y55 A;  1ESU A;  1YT4 A;  2Y2M A;  2WK0 A;  4OQI A;  5F1G A;  1K57 C;  4LCL A;  4S2I A;  3GV9 A;  3M6B A;  3IXD A;  3WS2 A;  4DXB A;  1L2S A;  3IH9 A;  4Y0T A;  3BFD A;  4IBX A;  4KZB A;  4D2O A;  4WEL A;  3VP2 A;  1IYQ A;  1MPL A;  3HLC A;  4JXS A;  1KVL A;  4WEK A;  4KZ6 A;  3WS4 A;  4DDS A;  5A90 A;  2WAD A;  3V3S A;  1IYO A;  1CEF A;  5EEC A;  5FAS A;  4R4R A;  1XXM A;  4P87 A;  1K38 A;  3HUM A;  1Q2P A;  5CGS A;  2IWC A;  3PBS A;  3UE3 A;  5I94 A;  4Q8I A;  4ZDX A;  5HAR A;  4C3Q A;  3VFF A;  1ES5 A;  4WZ4 A;  1NZO A;  5GLA A;  4WZ5 A;  5EVI B;  2Y2J A;  1RGZ A;  3QHY A;  4LEN A;  2WAF A;  1CI9 A;  5FAO A;  4QB8 A;  1MWS A;  3BRM A;  1E3U D;  4S2J A;  2XDM A;  5TR7 A;  2JE5 A;  4S2P A;  2IWB A;  4DDY A;  1KE0 A;  2Y2N A;  1FCN A;  4GDN A;  1M6K A;  1S6R A;  3UDX A;  5CTM A;  3VMA A;  4N9K A;  5FSR A;  1IKI A;  4WBG A;  4KG5 A;  3SS3 A;  1FCM A;  4OQ0 A;  4WMC D;  3RXX A;  5KSC A;  3FKW A;  4FD8 A;  1I5Q A;  3UO9 A;  1E4D A;  4FH2 A;  5EOE A;  3ZG0 A;  1L0G A;  1K4E A;  1GA0 A;  4KZ9 A;  4RYE A;  5CXW A;  4EBL A;  1S0W A;  1ZG4 A;  2Y2H A;  1JWV A;  1BLC A;  3VP4 A;  3HUN A;  4CJN A;  4E3L A;  4EQI A;  2WZX A;  3Q7Z A;  4DRT A;  3BLM A;  3ZCZ A;  4OPQ A;  1WYB A;  2ZQ7 A;  3DWK A;  3UDI A;  5FQM A;  1N4O A;  1SHV A;  4KG2 A;  2HP6 A;  4S2N C;  2G2W A;  5U47 A;  1PW1 A;  3W4Q A;  3AGE A;  5E2E A;  1PI4 A;  3BLS A;  4EBP A;  1KGG A;  3C7U A;  3N6I A;  1RP5 A;  3G32 A;  3N8S A;  3GSG A;  3ZFZ A;  3G4P A;  2EXA A;  4JF6 A;  5HAI A;  3WS0 A;  4FCF A;  5M19 A;  5EVL A;  2E8I A;  2XD5 A;  1LLB A;  4JXV A;  3NIA A;  2P9V B;  2QPN A;  5CGX A;  1MY8 A;  3MZD A;  3IF6 C;  3M6H A;  3ZVT A;  2J8Y A;  3LY4 A;  3A3D A;  1L0F A;  4QJG A;  2XH9 A;  1K56 D;  2ZC4 B;  1YM1 A;  1KVM A;  1BT5 A;  3V50 A;  4GDB A;  4EUZ A;  3B3X A;  3M2J A;  4GNU A;  3NI9 A;  3HUO A;  1L0D A;  1BUL A;  3ZGA B;  4OOM A;  3N8L A;  5FI7 A;  4ZJ2 A;  5KSH A;  1K6R A;  1YQS A;  3PBR A;  3FKV A;  3P09 A;  4JBF A;  4OQH A;  1KGF A;  5HFO A;  1LI9 A;  4KEN B;  2XF3 A;  1PIO A;  3BYD A;  3CG5 A;  1DJA A;  1DY6 A;  4OP5 A;  1I2W A;  2RL3 A;  5AQ9 A;  5BOH A;  3LEZ A;  3O88 A;  1BLP A;  2HDS A;  4NET A;  1MKI A;  2H5S A;  5CHU A;  4IVI A;  3N7W A;  3ZG7 B;  2Y91 A;  2H0Y A;  4B88 A;  3SH9 A;  4BD0 A;  4PM6 A;  1YLY A;  1YMX A;  3IF6 A;  3UY6 A;  2HP5 A;  4Y0U A;  4OOY A;  3MBZ A;  4ID4 A;  2XR0 A;  1VM1 A;  4GOG A;  1LL5 A;  5GL9 A;  3IHA A;  4BL2 A;  2BLS A;  2Y2I A;  3OZH A;  1K55 C;  5CER A;  3O87 A;  4U0X A;  3HVF A;  2OV5 A;  3AGD A;  3HLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...