4OPQA

Room temperature crystal structure of stabilized tem-1 beta-lactamase variant v.13 carrying r164s/g238s mutations
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
258
Chain Sequence
HPETLVKVKDAEDQLGGRVGYIELDLASGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVGELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDSWEPELNDERDTTTPVAMATTLRKLLTGELLTAASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGASERGSRGIIAALGPDGKPSRIVVIYMTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Negative Epistasis and Evolvability in TEM-1 beta-Lactamase--The Thin Line between an Enzyme's Conformational Freedom and Disorder.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords TEM-94 ES-beta-lactamase
total genus 96
structure length 258
sequence length 263
ec nomenclature
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4opqA00
2P74A 4MEZA 3G30A 5FAOA 3PAGA 5FQKA 1YLYA 3MZEA 2EX2A 2HP9A 3G35A 4WM9A 5BOHA 2EFUA 4S2NA 4QY6A 4X55A 1E25A 5CEDA 4LV2A 1Y54A 4MBFA 5CRFA 4N9KA 3IH9A 4OQGA 1H5XA 1NZOA 1U60A 2PBYA 2XDMA 2Z2MB 1MBLA 3LY4A 5HX9A 2HPBA 1MWUA 3N4IA 1K56D 1MWRA 2PU4A 3IWQA 3HL9A 1PW8A 3UE3A 4RX3A 5FAQA 2Y2IA 1FCNA 2Y4AA 4ZJ2A 2ZMAA 4O7DA 1BLCA 1JTDA 4NETA 1FR1A 1TDGA 4DXCA 2P9VA 5GLDA 3ZG8B 1BLSA 3FWLA 3MXSA 4GDBA 1JTGA 4GZBA 3NDGA 2E8IA 4PPRA 1ONHA 4P0MA 5CTMA 5EPHA 1PI5A 3NBLA 3Q1FA 4QY5A 5FQQA 1WE4A 2OLVA 4P87A 3SS5A 3O86A 3OPLA 1W7FA 4JPMA 3PBNA 4R3JA 4GNUA 4KZ7A 3IHBA 3EQVA 1OMEA 4N1XA 5CTNA 3LEZA 3N7WA 1EWZA 4OOMA 1YM1A 3A3IA 3N8SA 4K0WA 5F1FA 5A92A 5DF7A 3NIAA 3VP2A 3ZVWA 3FKWA 1NYMA 5EVIA 4HEFA 5EECA 3GRJA 4OOLA 4XXRA 4E3IA 4C3QA 1KDWA 1SHVA 3BFCA 2H10A 3M2KA 3MZDA 5GHYA 1K4FA 2DRWA 4KQOA 1IYPA 2ZC7A 1BTLA 3RXWA 1KGEA 1K54C 4QJGA 5JYOA 1IELA 2ZQCA 4R4RA 1L0EA 5FATA 4OOYA 2EX8A 2VGKA 4WZ5A 5FQIA 3IXDA 1I2SA 3HLWA 3IXGA 5TR7A 3DWKA 3HREA 1KE3A 5F1GA 1MKIA 3IF6A 3A3DA 1FQGA 3M6HA 4NK3A 2WGWB 3VOYA 1M40A 3ZCZA 1S0WA 2Y91A 4R23A 1NY0A 4DE1A 2EX6A 4S2PA 1QMEA 1K54A 1YMXA 2ZM8A 4KG2A 3P09A 2GDNA 1L2SA 1ES5A 1PI4A 2XK1A 5CHJA 2EFXA 2XF3A 3PBTA 2Q9NA 1KE4A 1N9BA 1K55A 3I7JA 2A49A 5DF9A 5F82A 2X02A 1XA7A 1PIOA 3MZFA 5DTSA 3UDXA 2ZQAA 2HP6A 2J9OA 1LLBA 3SH9A 3BECA 3N6IA 3UDIA 2WK0A 4E6WA 5CXWA 3BLMA 4ID4A 1BUEA 2Z2LB 3CG5A 3QNBA 4S2JA 3UDFA 5FDHA 2QPNA 4S2LA 3NI9A 4PM7A 4B4XA 3IF6B 3IHAA 1CEFA 2ZM2A 3G2ZA 3ISGA 3VSKA 1YQSA 5AQAA 5CERA 1LI9A 1I5QA 1CEGA 1K55C 4X56A 2OV5A 2XH9A 4FD8A 3ZFZA 5AQBA 4KZBA 2WZXA 4KZ9A 2JBFA 3SH8A 4DF6A 3MBZA 1ES3A 2Y2HA 1PWCA 4YINA 5I94A 3N8LA 5FA7A 3W4QA 3BEBA 2Y2JA 4DRTA 1XKZA 3WS2A 4KZ3A 5GLBA 3IXBA 1EI5A 5D3OA 2FFYA 5GLCA 1ONGA 2EX9A 3RJUA 5HL1A 4DDSA 2WGIA 2CC1A 1YT4A 3UPPA 3VOZA 1G68A 4FSFA 4M3KA 5M1AA 3Q7VB 3M6BA 4KENB 1DY6A 4R0QA 5E43A 5FI7A 5EVID 4EV4A 3V50A 2C6WB 3WRZA 4GB7A 3ZNYA 2BLSA 1FSWA 3G4PA 4WZ5C 1LI0A 2WGWA 3Q81A 4IBRA 1KE0A 1ZKJA 4BL2A 4KZ4A 1GHIA 1LL9A 2WYXA 4JXSA 5EVLA 4LENA 4FCFA 3HLEA 4Y0TA 2X71A 1S6RA 2Y2GA 1NZUA 4PM6A 3LCEA 2ZQDA 5CEBA 3UNWA 1IYOA 2Y59A 4LV1A 1GHPA 1MY8A 5GLAA 3WRTA 3G2YA 2EXAA 1K57C 1PZPA 1YLZA 2WZZA 1N4OA 1FCOA 1SKFA 1L0GA 3GSGA 4KQQA 3SOIA 4R3BA 3ITAA 4JXVA 4LCMA 4XUZA 3WS0A 3V39A 4RVAA 4X6TA 3ZG7B 2ZLYA 4KZAA 3WS4A 4E3JA 4MBKA 4P85A 4MLLA 1YMSA 2WKIA 3BFDA 1BT5A 3PBRA 4IBXA 4DDYA 3CMZA 1RGZA 1ES4A 1PZOA 3Q7VA 4X53A 2ZD8A 1ERMA 2JC7A 2Y2MA 4DE2A 1NYYA 3OCNA 1L0FA 5EVIB 4C75A 2R9WA 2ZC4B 2X01A 2ZC5B 2I72A 4IVIA 4X68A 1AXBA 1W8YA 2IWCA 2ZC6B 4OLDA 1RGYA 4B4ZA 1TVFA 5KSCA 2H5SA 3BFFA 4K91A 4S2IA 3TSGA 1ZG4A 4KZ5A 2P9VB 4WZ4A 3MFDA 4R1GA 3VFHA 2Y2QA 5AQ7A 4HBTA 3N8RA 4GDNA 3DTMA 3S4XA 1JWVA 3VP4A 4R4SA 3MKEA 2Q9MA 3G31A 4OPYA 4KZ8A 5EOOA 1KVMA 5KZHA 5GL9A 1ZC2A 1FOFA 4KG5A 1RCJA 2WKEA 1QMFA 3O87A 1RP5A 1MWTA 4KQRA 5M18A 3B3XA 3HUNA 2RL3A 5FAPA 3VSLA 5GHXA 3SS4A 3UY6A 1L0DA 3TG9A 2IWBA 1FSYA 2XFSA 3W4OA 5JYPA 3FYZA 3HLGA 4RX2A 3WWXA 5HFOA 3WS1A 4S2MA 1HVBA 1MXOA 2V2FF 2WAFA 5CHMA 4Q8IA 1JWPA 3HUMA 2Y2KA 4ZDXA 1J9MA 4Y0OA 2Y2OA 5A90A 1NXYA 2V1ZA 1ERQA 4Y7PA 2J9PA 4BQMA 3GV9A 1YLJA 4U0TA 1BZAA 4UA9A 4EBNA 5CECA 5HW3A 4WEJA 3VFFA 2OLUA 4MBHA 3ZG9B 5IHVA 1IKGA 1KDSA 1KGFA 5CHUA 2R9XA 1IYSA 1IEMA 2HP5A 1G6AA 1WYBA 1CK3A 4EQIA 1K38A 2J7VA 5HAPA 1W79A 3GMWA 5FQ9A 3HLBA 1CI9A 5A93A 5FASA 5A91A 1BLHA 2C5WB 3RXXA 1E3UA 3IWOA 1XP4A 5FQMA 4JF6A 2QZ6A 4UA6A 3AGDA 1VM1A 5CGSA 4UHUA 3LO7A 2H0YA 5FI2A 4PM8A 2XEPA 4GD8A 1EROA 3VP1A 3C7VA 1NRFA 1VQQA 1IKIA 4WMCA 1HD8A 1XA1A 3QNCA 5TFQA 4EBLA 4EWFA 3PTEA 3GVBA 1JVJA 2Y2NA 4WELA 4GOGA 4PMAA 3IF5A 4PM9A 3UN7A 3DW0A 5DTTA 1GA9A 3TOIA 1E3UD 1K6SA 3PBOA 2DNSA 4OLGA 1Q2QA 3FV7A 3IQAA 2VGJA 3NDEA 3GQZA 4DE0A 4UA7A 4E3OA 3IWIA 1K4EA 5F83A 3UPNA 4FH2A 5KMWA 2XFTA 3BFGA 4JLFA 3G32A 4U3TA 3G34A 5FI6A 5DF8A 5CGXA 3PAEA 1MWSA 2Y55A 3A3FA 1HZOA 3VP0A 4IVKA 1HTZA 4OPRA 2WADA 1DJCA 2ZQ7A 3NY4A 3Q07A 1XX2A 2XR0A 1NJ4A 5DVAA 1ESUA 4OH0A 5HAQA 2HDQA 4MNRA 1YLWA 3E2LA 3W8KA 1ESIA 1PYYA 3V3RA 1KVLA 4B88A 1XGJA 2EXBA 1ES2A 3SS3A 4DE3A 1BSGA 1DJAA 4ZBEA 4OP8A 2WKHA 3S22A 4E3NA 1LL5A 3VMAA 3D4FA 1K6RA 3OC2A 3GTCA 4HBUA 3LY3A 4BD1A 4JXWA 4HESA 4FH4A 4S2KA 5AQ9A 2XLNA 3BYDA 4OKPA 2RCXA 3C4OA 1XPBA 5E2GA 3VP3A 3O3VA 3FKVA 3IF6C 3UE0A 2XD5A 2WUQA 2JE5A 4E3KA 5KSHA 3BM6A 4ZTKA 5E2FA 4GD6A 4OONA 4EUZA 1DJBA 1FCMA 4QB8A 1Z6FA 4S2NC 4E3MA 4E3LA 1GHMA 3HBRA 4F94A 1GA0A 4H8RA 5TGFA 3AGEA 5HAIA 2HDSA 1SCWA 2ZQ9A 4BLMA 3EQUA 4OPQA 3GR2A 4BL3A 2B5RA 5E2EA 5U47A 4WEKA 1SDEA 1H8ZA 4JXGA 4JKTA 5GHZA 3ZDJA 2G2WA 4JF5A 4LV0A 4LCLA 4QD4A 3FZCA 5CGWA 1PWGA 4DXBA 5EVIC 4ZJ3A 4BENA 2ZC3B 1O7EA 3V5MA 2QMIA 2BG1A 4OQHA 5EE8A 3E2KA 4UAAA 3A3EA 1TEMA 3UO9A 4PM5A 3HLCA 3OCLA 4CJNA 1XXMA 2UWXA 4ZAMA 2ZM0A 3CZDA 4WMCD 3ZVTA 2Y2PA 3OPPA 4X69A 3Q82A 2OSUA 3BLSA 3MXRA 4N9LA 3HLFA 1IYQA 2FFFB 2WGVA 2XQZA 2HDUA 4IEDA 4C6YA 2DCFA 4BJPA 4A5RA 4Z9QA 3ZHHA 1BULA 5G18A 3IXHA 3C5AA 3W4PA 4GN2A 4DKIA 3PBQA 3HLDA 3PBSA 4KZ6A 4U0XA 1W8QA 3C7UA 3IH8A 4XUXA 4BD0A 3OZHA 4QU3A 3SH7A 1BLPA 3NC8A 1KGGA 3UPOA 3IT9A 4RA7A 1C3BA 2V20A 4E6XA 4WYYA 1ALQA 3V3SA 1Q2PA 1ZG6A 3ZG0A 5DTKA 3NCKA 1XGIA 4EBPA 3M2JA 3BFEA 5L2FA 1PWDA 4OP5A 4N1HA 3C4PA 4ZJ1A 1FR6A 4LV3A 3P98A 2XGNA 3O88A 2ZQ8A 4JBFA 1YLPA 3DWZA 5J8XA 2HDRA 4S2OA 1GCEA 1M6KA 1YLTA 4Y0UA 4L0LA 1PW1A 1WYCA 3ZGAB 1O07A 3CJMA 5M19A 1TDLA 1K25A 1K57A 3BRMA 2JCHA 1I2WA 3OPHA 2Y2LA 4CPKA 1W5DA 4YFMA 4OQIA 4RYEA 4WBGA 4GKUA 2PU2A 1SDNA 2A3UA 1E4DA 4JF4A 4OPZA 4KG6A 3AGFA 5FSRA 3OPRA 3S1YA 2XD1A 3WS5A 2IWDA 5EUAA 2ZJ9A 2J8YA 2WAEA 1LHYA 2H0TA 5E2HA 1H8YA 3HVFA 3ZNTA 4K0XA 4OVDA 4OQ0A 3A3JA 3HUOA 3Q7ZA 5EOEA 1CI8A 4D2OA 1MPLA 3ITBA 5HARA 3ZG5A 3QHYA 3JYIA 1JWZA 1K56A 3UE1A 4P6BA 2G2UA 4N92A 5FQJA 4QHCA 3MKFA
chains in the Genus database with same CATH superfamily
1Y4OA 1YPRA 4WM9A 2EX2A 3FPVA 4X55A 2W3DA 3A0SA 4MBFA 3IH9A 1H5XA 1U60A 2PBYA 1MBLA 1YSPA 2Z6CA 2PAVP 4MN5A 1F2KA 2Y2IA 2VV6A 3LFVA 3R7WA 4NETA 2WKRA 4DXCA 3T4QA 3MXSA 4GDBA 4GZBA 2E8IA 5AVFA 3Q1FA 4QY5A 4KQDA 2HZ5A 1W7FA 4GNUA 3CPTA 1OMEA 3A3IA 2VA0A 5A92A 1IOUA 3EOIA 2VGLS 3FKWA 3LYXA 4XXRA 2INWA 4HP4A 2PT7A 2H10A 5GHYA 2KX6A 4X1LA 1K54C 1L0EA 2PBDP 2VGKA 2G7UA 3IXDA 5TR7A 3OOVA 4DJ3A 3A3DA 3T1RA 3VOYA 2E8JA 4S2PA 1MZUA 1NWZA 2V1BA 4I3JA 4KG2A 4YNRA 2WKPA 2GDNA 1L2SA 3KO6A 5CHJA 2XF3A 3JVUA 1KE4A 5AJGA 2VKSA 2A49A 3C8CA 5DF9A 3MZFA 1OJGA 3UDXA 2ZQAA 3BECA 2WK0A 4ID4A 2Z2LB 1P9RA 5IS1A 3IHAA 4R3AA 1CEFA 2ZM2A 3ISGA 1YQSA 1K55C 2OV5A 3SH8A 2JBFA 2Y2HA 5I94A 4YINA 1OT6A 5FA7A 1CJFA 3RJUA 4DDSA 2K7SA 5F68A 5M1AA 5HD5A 3VE3A 4KENB 3NJAA 4R0QA 5EVID 4EV4A 3V50A 2V0UA 4WZ5C 3G4PA 4KZ4A 1GHIA 4JXSA 5EM0A 4Y0TA 4I38A 3UE6A 3LCEA 3UB8A 1NLZA 3JPUA 4Y5FA 3WRTA 5GLAA 3QP5A 1PZPA 2WZZA 2ZLYA 3WS4A 2QJ7A 3CPTB 4MLLA 2WKIA 4DDYA 4P6ZS 1EW0A 1PZOA 2W1TB 2JC7A 2Y2MA 4C75A 2ZC4B 4ZRRA 2X01A 2ZC5B 4LRXC 5KSCA 2VV7A 4S2IA 1ZG4A 1TS7A 1T1CA 4FOFA 2Y2QA 4GDNA 3S4XA 1JWVA 2WKEA 1RP5A 5M18A 2RL3A 1XFQA 5FAPA 5GHXA 3SS4A 3UY6A 4R70A 3FYZA 4G3WA 5FEGA 3WS1A 3CHWP 2V2FF 3HUMA 4EXOA 3CUEC 1ERQA 4QPRA 3P01A 2ZMVA 1BZAA 1V9ZA 2HV1A 4EBNA 5CECA 4MMNA 3GECA 2R9XA 1IEMA 1G6AA 1K38A 5HAPA 2IA2A 5A93A 5FASA 2C5WB 3NOPC 1E3UA 1X0OA 2A24A 1OTDA 4UHUA 1N9LA 2XEPA 3KSGA 4GD8A 3S7QA 3QP1A 3C7VA 1VQQA 4EBLA 3GVBA 1T19A 4GOGA 3IF5A 4GS9B 4PM9A 5DTTA 1GA9A 3PHYA 4OLGA 3UB5P 4Y2FA 3IQAA 2V0WA 1OTEA 2V8CA 5F83A 3OLOA 2XFTA 5DJTA 3G34A 3E0YA 4HJ4A 5FI6A 1F98A 1MWSA 1HZOA 3ULFA 1VEUA 1ESUA 5HAQA 1PYYA 3V3RA 1KVLA 2EXBA 3SS3A 4DE3A 5HWWA 4ZBEA 5HSQA 4OP8A 2WKHA 5MC7A 3EEHA 3D4FA 4HBUA 4BD1A 4ME4A 4HESA 1DP9A 3C4OA 3VP3A 3IF6C 2JE5A 4E3KA 5KSHA 4ZTKA 4OONA 1OPXA 4R38A 4S2NC 2O9AA 4E3LA 1BYWA 4F94A 5TGFA 1G6OA 1SDEA 2BTFP 4JXGA 5GHZA 3ZDJA 5EVEA 1PWGA 2ZC3B 1O7EA 4BBUA 2PR5A 3E2KA 4UAAA 1TEMA 1XXMA 2UWXA 4AFIA 4HH3A 3ZVTA 3BLSA 4N9LA 1IYQA 2HDUA 4C6YA 1BULA 3W4PA 3C5AA 1JNUA 1W8QA 2H28A 3OZHA 3LIDA 1F9IA 3NC8A 2A24B 4E6XA 3V3SA 1ZG6A 5LBRA 1PWDA 3B47A 2J3TC 4N1HA 1FR6A 1MC0A 4LFUA 2ZQ8A 2HDRA 3KX0X 4S2OA 1GCEA 1YLTA 4Y0UA 4JGPA 3ZGAB 1K25A 4ETZA 1K57A 3BRMA 1I2WA 3CITA 4CPKA 3T1SA 4WBGA 1SDNA 2A3UA 1E4DA 4EEPA 4KG6A 3OPRA 3LGOA 2IWDA 1LHYA 3MMHA 5E2HA 2HGVA 3ZNTA 4CLCB 3A3JA 1MPLA 3BQAA 3QHYA 1JWZA 4QHCA 3NOTC 3MKFA 3BY8A 4MEZA 1S1ZA 3PAGA 1YLYA 2HP9A 3G35A 3IS2B 2EWWA 1P0ZA 4S2NA 1E25A 1YAXA 3P7NA 4NEED 1Y54A 3MF0A 1DP8A 4MDZA 4N9KA 5CRFA 1NZOA 1F5MA 1MWUA 3LIBA 2EWVA 3IWQA 3HL9A 3V67A 3D3OA 1FCNA 2LB9A 4EESA 1JTDA 3D72A 3FWLA 2XROA 3NDGA 3CLOA 5FL3A 1PI5A 4O8GA 1WE4A 3BJNA 5FEFA 1DP6A 2HJEA 4KZ7A 3IHBA 3EQVA 4N1XA 5CTNA 2PYPA 3LUQA 1T18A 1YM1A 4K0WA 5DF7A 1UGUA 4LLOB 3VP2A 3ZVWA 1NYMA 4O01A 5EVIA 2PD8A 2CMNA 5G4YA 4C3QA 2QJ5A 3M2KA 3MZDA 1K4FA 3NOUC 4KQOA 2QWSA 1BTLA 5JYOA 2P08A 5HPFA 5FQIA 3IXGA 3HREA 1KE3A 4WLAA 1MKIA 3NHQA 2W3FA 4NK3A 4Z1WA 4PHTA 3UB7A 5L10A 1N9BA 2ZOHA 2X02A 3BWLA 2HP6A 3E4QA 3UDIA 3C30A 4E6WA 5CXWA 3BLMA 3CG5A 4S2JA 3MQOA 2QPNA 4PM7A 4B4XA 3IF6B 3G2ZA 5AQAA 5CERA 4X56A 2B02A 3DTEA 5AQBA 3T4OA 4DRTA 3BEBA 2Y2JA 1XKZA 2FFYA 5GLCA 3JVVA 3FPWA 2CC1A 1YT4A 1HLUP 4M3KA 2Y79A 2M7VA 3M6BA 1DY6A 5FI7A 4DN0A 4ARZA 3WRZA 2BLSA 5DJUA 1LI0A 1ZTUA 1KE0A 1ZKJA 3H9WA 4FCFA 1TS0A 2X71A 1S6RA 5CEBA 3UNWA 1IYOA 2Y59A 3G2YA 1LT0A 4EW7A 4HNBA 1SKFA 3SOIA 1V9YA 2WKQA 3MSHA 4KZAA 3L7HA 1D06A 1H3QA 3BFDA 1BT5A 3CMZA 1RGZA 1ES4A 3Q7VA 4DE2A 3OCNA 5EVIB 2R9WA 1H8MA 2I72A 4X68A 2IWCA 2ZC6B 4L9FA 3TSGA 3HJIA 5HWTA 4R1GA 3VFHA 3LR4A 4R4SA 3MKEA 2Q9MA 4OPYA 5EOOA 4KZ8A 5F5YA 5GL9A 4KG5A 5HL6A 1RCJA 1QMFA 3O87A 1TS8A 1Z09A 4H6JA 4Q0IA 1FSYA 2XFSA 3T4KA 1XJ6A 3W4OA 5JYPA 4RX2A 5HPIA 1HVBA 4Q8IA 2ZBBA 3IS2A 3S7OA 5A90A 4F3LA 2J9PA 4D60A 4U0TA 3EGDC 2A2LA 4HQAA 4MBHA 1GSXA 3ZG9B 5IT5A 1KDSA 5CHUA 1WYBA 2JKRM 1W79A 5FQ9A 5A91A 3IWOA 1N9NA 4JF6A 4UA6A 3UB6A 3B42A 5FI2A 4BWIA 4EWFA 1IKIA 1XA1A 2JKFA 4WELA 1P97A 3TOIA 2DNSA 3FV7A 1NRJA 4DE0A 3GQZA 3LI9A 3IWIA 1K4EA 3G32A 5DF8A 2Y55A 3VP0A 1HTZA 4P6ZM 2ZQ7A 3S7PA 1L3LA 2HDQA 3E2LA 3W8KA 4I3IA 1XGJA 1YSQA 1BSGA 1DJAA 1ODVA 3RTYA 3S22A 3TW8A 1K6RA 2PDRA 3O3VA 2PR6A 2WUQA 3BM6A 4GD6A 4EUZA 1DJBA 4QB8A 4PAUA 5J3WA 5J4EA 3HBRA 2OAQ1 3AGEA 3PYPA 3VOLA 2ZQ9A 4L9EA 5DFXA 4BLMA 3EQUA 3GR2A 2B5RA 2V1AA 4YWZA 2G2WA 4JF5A 4B93A 4LCLA 4DXBA 5EVIC 5EE8A 2O99A 4NG2A 4PM5A 3MQ0A 3OCLA 3DTIA 3A0VA 2ZM0A 3CZDA 2Y2PA 3OPPA 2JKRI 2OSUA 2QHKA 2WGVA 2XQZA 4LRZE 3LR3A 5KIZA 4Y13A 5G18A 1XJ2A 3IXHA 3CUEA 3HLDA 3IH8A 4BD0A 5HDCA 2OWJA 1BLPA 3UPOA 4Q0HA 1C3BA 4WYYA 3E4PA 1T1BA 4XT2B 3ZG0A 1XGIA 4MN6A 5K5BA 3C4PA 4ZJ1A 3O88A 4L0LA 1O07A 1LSWA 3CJMA 1FILA 3F1PA 3QP4A 3R4KA 1W5DA 4Y17A 3T1XA 4B9OA 4GJ4A 2W3EA 2VGLM 3HCYA 2H0TA 2M1CA 1H8YA 3MR0A 4HI4A 3EWKA 3SW1A 5TBMA 4P6BA 3L9KA 4NXBA 2P74A 3G30A 2MJ6A 3MZEA 2J80A 1TS6A 5BOHA 2EFUA 1CQAA 5CEDA 4QY6A 4Y3IA 4OQGA 2XDMA 5HX9A 1K56D 2XA7M 2FH5A 4GLQA 4RX3A 4DMZA 2VZWA 4O7DA 1TDGA 4WF0A 3ZG8B 1OTBA 4EQ1A 1BLSA 5I5LA 1JTGA 4IHQA 4PPRA 2JKTM 4P0MA 5CTMA 5EPHA 4K08A 3NBLA 5FQQA 5IU1A 2OLVA 4P87A 3T4TA 3UMDA 3O86A 4JPMA 3RH8B 1LSXA 3N7WA 4OOMA 3N8SA 4I39A 4OOLA 3G6OA 1KDWA 1SHVA 2J3WA 4EU0A 3KYQA 3UB9A 2ZC7A 3RXWA 1KGEA 1SKOA 4FTXA 1IELA 2ZQCA 4R4RA 3H7WB 5FATA 4OOYA 4HOIA 4NXGA 1I2SA 2PYRA 3DWKA 3IF6A 1FQGA 4KUKA 2J3TD 1S0WA 2ACGA 4R23A 4UQIM 4DE1A 4X25A 1YMXA 1K54A 3P09A 4FUWA 2XK1A 1ES5A 1PI4A 2V8FA 3PBTA 2Q9NA 3I7JA 5F82A 1XA7A 1P9WA 1BUEA 3QNBA 1STZA 4MN7A 3NI9A 4IJGA 2Z6DA 1LI9A 2UV0E 3KSFA 1CEGA 1UWPX 3ZFZA 2OAP1 2XH9A 2GJ3A 4WL9A 4KZBA 4KZ9A 4DF6A 1ES3A 1PWCA 3ZQ5A 5GLBA 3IXBA 1EI5A 1S1YA 2EX9A 2WGIA 3UPPA 1G68A 1OJ5A 3IX8A 4FSFA 1KOUA 2B18A 4HJ6A 4G3KA 4ESPA 4GB7A 2KLIA 2WGWA 4IBRA 3F1NA 3T50A 2WYXA 4QWOA 5TBMB 4LENA 3HLEA 3NULA 4PM6A 4G3VA 2ZQDA 1GHPA 3PR6A 4HH2A 2EXAA 1K57C 1YLZA 1N4OA 1FCOA 1L0GA 3GSGA 4R3BA 3ITAA 3ZYTA 4H6JB 4X6TA 3ZG7B 3CI6A 2O9CA 4E3JA 4P85A 1YMSA 4IBXA 4WN5A 1ERMA 1S67L 3LR5A 5J7EA 4GHIB 3NECA 5HDSA 3FG8A 1AXBA 4OLDA 1RGYA 2H5SA 4KZ5A 4WZ4A 3GDIA 5AQ7A 3N8RA 3VP4A 3DTMA 4X1MA 3MS6A 5KZHA 5EV0A 1MWTA 4KQRA 3B3XA 3LI8A 4CLCC 1L0DA 3WWXA 1VETB 5F69A 5C5KA 2P7JA 5CHMA 2WAFA 1YKDA 4YOFA 3A0RA 5L07A 4Y0OA 2JN7A 5EM1A 2V1ZA 3LICA 3MQQA 3H82A 3BQ8A 2O9BA 1YLJA 4BMWA 4WEJA 3VFFA 2OLUA 2OOLA 3W2ZA 1KGFA 3T1QB 1IYSA 4EQIA 4HY8A 3GMWA 1CI9A 1BLHA 3VV4A 1S66L 4CQHA 4PKYG 1TD5A 1VM1A 2FZ0A 3LO7A 2H0YA 1Y28A 4PM8A 2ZL1B 2L0WA 2PD7A 1OTAA 2JKTI 3VP1A 5TFQA 4WMCA 3IBRA 3QNCA 1JVJA 5FDSA 3QP6A 3DW0A 1K6SA 3HJKA 4E3OA 1NLYA 3T4JA 5KMWA 4JLFA 4I5SA 3PAEA 5CGXA 2HJ9C 2O0YA 2BASA 4OPRA 2WADA 1DJCA 1FIKA 2VK3A 3NY4A 2XR0A 1NJ4A 5DVAA 5DKLA 4OH0A 1YLWA 4CLCE 1LL5A 3VMAA 4ETXA 3GTCA 4DJ2A 2VV8A 4JXWA 4FH4A 2XLNA 2RCXA 5E2GA 1XPBA 3D9YA 2XD5A 4JGRA 4E04A 5E2FA 4MCWA 2GZAA 1GHMA 1GA0A 4H8RA 3CWFA 1A0KA 4BL3A 1W63M 1H8ZA 4JKTA 3C2WA 5L8MA 3T12B 2Y8HA 4OQHA 3ICYA 2GX5A 2XSSA 3UO9A 4WMCD 2KOIA 2Q0OA 3DAVA 2VEAA 3MXRA 2DCFA 3F1OA 3LIEA 3ZHHA 1IFQA 4BBVA 4DKIA 1T1AA 4KZ6A 4XUXA 3PXPA 4QU3A 1GSVA 1KGGA 4O0PA 1SZVA 2AVXA 1SKOB 1UWNX 5DTKA 3NCKA 4EBPA 5L2FA 3BFEA 3H82B 4OP5A 3P98A 5J8XA 1YLPA 3DWZA 3SZTA 4L9GA 1LSVA 1PFLA 4CLCA 1DRMA 5M19A 1TDLA 1CF0A 4JGQA 2JCHA 4RYEA 4GKUA 2PU2A 3AGFA 2W3HA 5EUAA 2ZJ9A 4PKYA 2WAEA 3HVFA 2OWHA 4K0XA 1VETA 3HUOA 3EEAA 2VX8A 5EOEA 1CI8A 4D2OA 5HARA 3IX4A 4R6LA 4N92A 5FAOA 4F3LB 5FQKA 2K2NA 1MKMA 5DFYA 4LV2A 2XRNA 5EFWA 1WA9A 4M4XA 2R78A 4HP9A 1G5UA 2Z2MB 3LY4A 2HPBA 3RFBA 3N4IA 3B33A 1MWRA 2PU4A 4LPZA 3UE3A 1PW8A 3F1PB 3U2AA 2PHYA 5FAQA 2Y4AA 1AWIA 4ZJ2A 2ZMAA 1BLCA 5F6AA 3C38A 1FR1A 3H7WA 2P9VA 5GLDA 1ACFA 4IUKA 3E98A 3LEQA 1ONHA 3SS5A 3OPLA 2LB5A 3PBNA 4R3JA 1XJ3A 5AVEA 3LEZA 1EWZA 5F1FA 3NIAA 4HEFA 5EECA 3GRJA 4E3IA 3BFCA 2QYBA 4HJ3A 5CX7A 2DRWA 1IYPA 3TJZC 4QJGA 2DMWA 1S4RA 4NKPA 2EX8A 4WZ5A 3HLWA 5F1GA 4GW9A 4NXEA 3M6HA 2WGWB 1M40A 2D02A 2HF6A 3ZCZA 2Y91A 1NY0A 3T4LA 4Q0JA 2EX6A 1QMEA 2ZM8A 3F1OB 2VJWA 2XA7S 2EFXA 3T4SA 1K55A 3UMEA 1PIOA 5DTSA 4Y15A 2J9OA 1LLBA 3SH9A 3N6IA 3FC7A 3F1NB 3UDFA 5FDHA 4S2LA 3VSKA 1I5QA 4FD8A 1D7EA 2WZXA 3QP2A 2W1RA 3MBZA 1K0KA 3N8LA 3W4QA 2ZMFA 5G4ZA 4LGWA 3O5YA 1D1JA 4KZ3A 3WS2A 5D3OA 1ONGA 5HL1A 4UEYA 3VOZA 2ZL1A 1H0MA 2P04A 3Q7VB 5E43A 4GHIA 2C6WB 2D01A 3ZNYA 1FSWA 1ZHHB 3Q81A 3TE8A 1OT9A 4BL2A 1LL9A 2JHEA 5EVLA 2Y2GA 3S7NA 1NZUA 2ZOIA 4HIAA 1VB6A 4EEUA 1N9OA 1G28A 4LV1A 1MY8A 4RQ9A 2L4RA 2W0NA 4KQQA 4JXVA 4LCMA 4XUZA 3WS0A 3V39A 4RVAA 3MXQA 4MBKA 3PBRA 4X53A 2ZD8A 1NYYA 3MJQA 1L0FA 4IVIA 1W8YA 3BY9A 4B4ZA 1TVFA 3LR0A 3BFFA 4K91A 2P9VB 3MFDA 2PRFA 4GCZA 4HBTA 5HZHA 3G31A 1KVMA 2KDKA 1ZC2A 1FOFA 3DTKA 4HHDA 2YKHA 3HUNA 3VSLA 3TG9A 2IWBA 3KSIA 3KYZA 3HLGA 5HFOA 3K2NA 4S2MA 1MXOA 4ZDXA 1JWPA 2Y2KA 1J9MA 2Y2OA 1NXYA 4II7A 4Y7PA 1LL8A 4BQMA 3GV9A 4UA9A 5HW3A 3K3CA 1VHMA 4EETB 5IHVA 1IKGA 2NUPC 2HP5A 2V9AA 2W27A 1CK3A 2J7VA 1XFNA 3HLBA 4LRYC 4EUVA 3RXXA 1XP4A 5FQMA 5HD3A 2I9VA 2QZ6A 3EGXC 1TF1A 3AGDA 3TRCA 4NXFA 5CGSA 3U4LP 3MFXA 2NUTC 1EROA 1NRFA 1HD8A 5TJJA 3PTEA 2Y2NA 4PMAA 3UN7A 1J3WA 1E3UD 3PBOA 5A8BA 1Q2QA 2VGJA 3NDEA 4UA7A 5L09A 3QP8A 2W3GA 3UPNA 4FH2A 3BFGA 4U3TA 1W63Q 2JKGA 3K3DA 3A3FA 4IVKA 3Q07A 1XX2A 3R7WB 1PRQA 4MNRA 1ESIA 4JGOA 4B88A 1ES2A 3VE4A 4GS9A 4E3NA 2GNXA 1S4SA 3OC2A 3LY3A 4S2KA 5AQ9A 2W1TA 3BYDA 4OKPA 1PNEA 3FKVA 3UE0A 1FCMA 2K31A 1Z6FA 4UQIS 4E3MA 5HAIA 2HDSA 1SCWA 4OPQA 3LIFA 5E2EA 5U47A 4WEKA 4LV0A 4QD4A 3FZCA 5CGWA 4ZJ3A 4BENA 3DBAA 3V5MA 2QMIA 2BG1A 3LIAA 2L1MA 3IBJA 3A3EA 1OTIA 2QKPA 3KSHA 3HLCA 4CJNA 5HWVA 4ZAMA 3CAXA 1GSWA 4ARZB 4X69A 3OBFA 3Q82A 1VEUB 3HLFA 2FFFB 4I3AA 4IEDA 2B95A 4A5RA 4BJPA 4Z9QA 4KUOA 4GN2A 3PBQA 3PBSA 4U0XA 3C7UA 3SH7A 3IT9A 4CLCD 4RA7A 2V20A 2EA9A 1ALQA 1Q2PA 3M2JA 5DKKA 4LV3A 2XGNA 4JBFA 2YKFA 1M6KA 1WYCA 1PW1A 1XJ4A 4WUJA 3OPHA 2Y2LA 4YFMA 4OQIA 5FSRA 4JF4A 4IUHA 4OPZA 3BW6A 4XT2A 3S1YA 2XD1A 3WS5A 2J8YA 2M7UA 4BBTA 3E4OA 3KYEA 4EERA 4OVDA 4OQ0A 3Q7ZA 2VLGA 5HDDA 3ITBA 3ZG5A 3UE1A 3JYIA 1K56A 3IX3A 2G2UA 5FQJA
chains in the Genus database with same CATH topology
2P74A 4MEZA 3G30A 5FAOA 3PAGA 5FQKA 1YLYA 3MZEA 2EX2A 2HP9A 3G35A 4WM9A 5BOHA 2EFUA 4S2NA 4QY6A 4X55A 1E25A 5CEDA 4LV2A 1Y54A 4MBFA 5CRFA 4N9KA 3IH9A 4OQGA 1H5XA 1NZOA 1U60A 2PBYA 2XDMA 2Z2MB 1MBLA 3LY4A 5HX9A 2HPBA 1MWUA 3N4IA 1K56D 1MWRA 2PU4A 3IWQA 3HL9A 1PW8A 3UE3A 4RX3A 5FAQA 2Y2IA 1FCNA 2Y4AA 4ZJ2A 2ZMAA 4O7DA 1BLCA 1JTDA 4NETA 1FR1A 1TDGA 4DXCA 2P9VA 5GLDA 3ZG8B 1BLSA 3FWLA 3MXSA 4GDBA 1JTGA 4GZBA 3NDGA 2E8IA 4PPRA 1ONHA 4P0MA 5CTMA 5EPHA 1PI5A 3NBLA 3Q1FA 4QY5A 5FQQA 1WE4A 2OLVA 4P87A 3SS5A 3O86A 3OPLA 1W7FA 4JPMA 3PBNA 4R3JA 4GNUA 4KZ7A 3IHBA 3EQVA 1OMEA 4N1XA 5CTNA 3LEZA 3N7WA 1EWZA 4OOMA 1YM1A 3A3IA 3N8SA 4K0WA 5F1FA 5A92A 5DF7A 3NIAA 3VP2A 3ZVWA 3FKWA 1NYMA 5EVIA 4HEFA 5EECA 3GRJA 4OOLA 4XXRA 4E3IA 4C3QA 1KDWA 1SHVA 3BFCA 2H10A 3M2KA 3MZDA 5GHYA 1K4FA 2DRWA 4KQOA 1IYPA 2ZC7A 1BTLA 3RXWA 1KGEA 1K54C 4QJGA 5JYOA 1IELA 2ZQCA 4R4RA 1L0EA 5FATA 4OOYA 2EX8A 2VGKA 4WZ5A 5FQIA 3IXDA 1I2SA 3HLWA 3IXGA 5TR7A 3DWKA 3HREA 1KE3A 5F1GA 1MKIA 3IF6A 3A3DA 1FQGA 3M6HA 4NK3A 2WGWB 3VOYA 1M40A 3ZCZA 1S0WA 2Y91A 4R23A 1NY0A 4DE1A 2EX6A 4S2PA 1QMEA 1K54A 1YMXA 2ZM8A 4KG2A 3P09A 2GDNA 1L2SA 1ES5A 1PI4A 2XK1A 5CHJA 2EFXA 2XF3A 3PBTA 2Q9NA 1KE4A 1N9BA 1K55A 3I7JA 2A49A 5DF9A 5F82A 2X02A 1XA7A 1PIOA 3MZFA 5DTSA 3UDXA 2ZQAA 2HP6A 2J9OA 1LLBA 3SH9A 3BECA 3N6IA 3UDIA 2WK0A 4E6WA 5CXWA 3BLMA 4ID4A 1BUEA 2Z2LB 3CG5A 3QNBA 4S2JA 3UDFA 5FDHA 2QPNA 4S2LA 3NI9A 4PM7A 4B4XA 3IF6B 3IHAA 1CEFA 2ZM2A 3G2ZA 3ISGA 3VSKA 1YQSA 5AQAA 5CERA 1LI9A 1I5QA 1CEGA 1K55C 4X56A 2OV5A 2XH9A 4FD8A 3ZFZA 5AQBA 4KZBA 2WZXA 4KZ9A 2JBFA 3SH8A 4DF6A 3MBZA 1ES3A 2Y2HA 1PWCA 4YINA 5I94A 3N8LA 5FA7A 3W4QA 3BEBA 2Y2JA 4DRTA 1XKZA 3WS2A 4KZ3A 5GLBA 3IXBA 1EI5A 5D3OA 2FFYA 5GLCA 1ONGA 2EX9A 3RJUA 5HL1A 4DDSA 2WGIA 2CC1A 1YT4A 3UPPA 3VOZA 1G68A 4FSFA 4M3KA 5M1AA 3Q7VB 3M6BA 4KENB 1DY6A 4R0QA 5E43A 5FI7A 5EVID 4EV4A 3V50A 2C6WB 3WRZA 4GB7A 3ZNYA 2BLSA 1FSWA 3G4PA 4WZ5C 1LI0A 2WGWA 3Q81A 4IBRA 1KE0A 1ZKJA 4BL2A 4KZ4A 1GHIA 1LL9A 2WYXA 4JXSA 5EVLA 4LENA 4FCFA 3HLEA 4Y0TA 2X71A 1S6RA 2Y2GA 1NZUA 4PM6A 3LCEA 2ZQDA 5CEBA 3UNWA 1IYOA 2Y59A 4LV1A 1GHPA 1MY8A 5GLAA 3WRTA 3G2YA 2EXAA 1K57C 1PZPA 1YLZA 2WZZA 1N4OA 1FCOA 1SKFA 1L0GA 3GSGA 4KQQA 3SOIA 4R3BA 3ITAA 4JXVA 4LCMA 4XUZA 3WS0A 3V39A 4RVAA 4X6TA 3ZG7B 2ZLYA 4KZAA 3WS4A 4E3JA 4MBKA 4P85A 4MLLA 1YMSA 2WKIA 3BFDA 1BT5A 3PBRA 4IBXA 4DDYA 3CMZA 1RGZA 1ES4A 1PZOA 3Q7VA 4X53A 2ZD8A 1ERMA 2JC7A 2Y2MA 4DE2A 1NYYA 3OCNA 1L0FA 5EVIB 4C75A 2R9WA 2ZC4B 2X01A 2ZC5B 2I72A 4IVIA 4X68A 1AXBA 1W8YA 2IWCA 2ZC6B 4OLDA 1RGYA 4B4ZA 1TVFA 5KSCA 2H5SA 3BFFA 4K91A 4S2IA 3TSGA 1ZG4A 4KZ5A 2P9VB 4WZ4A 3MFDA 4R1GA 3VFHA 2Y2QA 5AQ7A 4HBTA 3N8RA 4GDNA 3DTMA 3S4XA 1JWVA 3VP4A 4R4SA 3MKEA 2Q9MA 3G31A 4OPYA 4KZ8A 5EOOA 1KVMA 5KZHA 5GL9A 1ZC2A 1FOFA 4KG5A 1RCJA 2WKEA 1QMFA 3O87A 1RP5A 1MWTA 4KQRA 5M18A 3B3XA 3HUNA 2RL3A 5FAPA 3VSLA 5GHXA 3SS4A 3UY6A 1L0DA 3TG9A 2IWBA 1FSYA 2XFSA 3W4OA 5JYPA 3FYZA 3HLGA 4RX2A 3WWXA 5HFOA 3WS1A 4S2MA 1HVBA 1MXOA 2V2FF 2WAFA 5CHMA 4Q8IA 1JWPA 3HUMA 2Y2KA 4ZDXA 1J9MA 4Y0OA 2Y2OA 5A90A 1NXYA 2V1ZA 1ERQA 4Y7PA 2J9PA 4BQMA 3GV9A 1YLJA 4U0TA 1BZAA 4UA9A 4EBNA 5CECA 5HW3A 4WEJA 3VFFA 2OLUA 4MBHA 3ZG9B 5IHVA 1IKGA 1KDSA 1KGFA 5CHUA 2R9XA 1IYSA 1IEMA 2HP5A 1G6AA 1WYBA 1CK3A 4EQIA 1K38A 2J7VA 5HAPA 1W79A 3GMWA 5FQ9A 3HLBA 1CI9A 5A93A 5FASA 5A91A 1BLHA 2C5WB 3RXXA 1E3UA 3IWOA 1XP4A 5FQMA 4JF6A 2QZ6A 4UA6A 3AGDA 1VM1A 5CGSA 4UHUA 3LO7A 2H0YA 5FI2A 4PM8A 2XEPA 4GD8A 1EROA 3VP1A 3C7VA 1NRFA 1VQQA 1IKIA 4WMCA 1HD8A 1XA1A 3QNCA 5TFQA 4EBLA 4EWFA 3PTEA 3GVBA 1JVJA 2Y2NA 4WELA 4GOGA 4PMAA 3IF5A 4PM9A 3UN7A 3DW0A 5DTTA 1GA9A 3TOIA 1E3UD 1K6SA 3PBOA 2DNSA 4OLGA 1Q2QA 3FV7A 3IQAA 2VGJA 3NDEA 3GQZA 4DE0A 4UA7A 4E3OA 3IWIA 1K4EA 5F83A 3UPNA 4FH2A 5KMWA 2XFTA 3BFGA 4JLFA 3G32A 4U3TA 3G34A 5FI6A 5DF8A 5CGXA 3PAEA 1MWSA 2Y55A 3A3FA 1HZOA 3VP0A 4IVKA 1HTZA 4OPRA 2WADA 1DJCA 2ZQ7A 3NY4A 3Q07A 1XX2A 2XR0A 1NJ4A 5DVAA 1ESUA 4OH0A 5HAQA 2HDQA 4MNRA 1YLWA 3E2LA 3W8KA 1ESIA 1PYYA 3V3RA 1KVLA 4B88A 1XGJA 2EXBA 1ES2A 3SS3A 4DE3A 1BSGA 1DJAA 4ZBEA 4OP8A 2WKHA 3S22A 4E3NA 1LL5A 3VMAA 3D4FA 1K6RA 3OC2A 3GTCA 4HBUA 3LY3A 4BD1A 4JXWA 4HESA 4FH4A 4S2KA 5AQ9A 2XLNA 3BYDA 4OKPA 2RCXA 3C4OA 1XPBA 5E2GA 3VP3A 3O3VA 3FKVA 3IF6C 3UE0A 2XD5A 2WUQA 2JE5A 4E3KA 5KSHA 3BM6A 4ZTKA 5E2FA 4GD6A 4OONA 4EUZA 1DJBA 1FCMA 4QB8A 1Z6FA 4S2NC 4E3MA 4E3LA 1GHMA 3HBRA 4F94A 1GA0A 4H8RA 5TGFA 3AGEA 5HAIA 2HDSA 1SCWA 2ZQ9A 4BLMA 3EQUA 4OPQA 3GR2A 4BL3A 2B5RA 5E2EA 5U47A 4WEKA 1SDEA 1H8ZA 4JXGA 4JKTA 5GHZA 3ZDJA 2G2WA 4JF5A 4LV0A 4LCLA 4QD4A 3FZCA 5CGWA 1PWGA 4DXBA 5EVIC 4ZJ3A 4BENA 2ZC3B 1O7EA 3V5MA 2QMIA 2BG1A 4OQHA 5EE8A 3E2KA 4UAAA 3A3EA 1TEMA 3UO9A 4PM5A 3HLCA 3OCLA 4CJNA 1XXMA 2UWXA 4ZAMA 2ZM0A 3CZDA 4WMCD 3ZVTA 2Y2PA 3OPPA 4X69A 3Q82A 2OSUA 3BLSA 3MXRA 4N9LA 3HLFA 1IYQA 2FFFB 2WGVA 2XQZA 2HDUA 4IEDA 4C6YA 2DCFA 4BJPA 4A5RA 4Z9QA 3ZHHA 1BULA 5G18A 3IXHA 3C5AA 3W4PA 4GN2A 4DKIA 3PBQA 3HLDA 3PBSA 4KZ6A 4U0XA 1W8QA 3C7UA 3IH8A 4XUXA 4BD0A 3OZHA 4QU3A 3SH7A 1BLPA 3NC8A 1KGGA 3UPOA 3IT9A 4RA7A 1C3BA 2V20A 4E6XA 4WYYA 1ALQA 3V3SA 1Q2PA 1ZG6A 3ZG0A 5DTKA 3NCKA 1XGIA 4EBPA 3M2JA 3BFEA 5L2FA 1PWDA 4OP5A 4N1HA 3C4PA 4ZJ1A 1FR6A 4LV3A 3P98A 2XGNA 3O88A 2ZQ8A 4JBFA 1YLPA 3DWZA 5J8XA 2HDRA 4S2OA 1GCEA 1M6KA 1YLTA 4Y0UA 4L0LA 1PW1A 1WYCA 3ZGAB 1O07A 3CJMA 5M19A 1TDLA 1K25A 1K57A 3BRMA 2JCHA 1I2WA 3OPHA 2Y2LA 4CPKA 1W5DA 4YFMA 4OQIA 4RYEA 4WBGA 4GKUA 2PU2A 1SDNA 2A3UA 1E4DA 4JF4A 4OPZA 4KG6A 3AGFA 5FSRA 3OPRA 3S1YA 2XD1A 3WS5A 2IWDA 5EUAA 2ZJ9A 2J8YA 2WAEA 1LHYA 2H0TA 5E2HA 1H8YA 3HVFA 3ZNTA 4K0XA 4OVDA 4OQ0A 3A3JA 3HUOA 3Q7ZA 5EOEA 1CI8A 4D2OA 1MPLA 3ITBA 5HARA 3ZG5A 3QHYA 3JYIA 1JWZA 1K56A 3UE1A 4P6BA 2G2UA 4N92A 5FQJA 4QHCA 3MKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P74 A;  4MEZ A;  3G30 A;  5FAO A;  3PAG A;  5FQK A;  1YLY A;  3MZE A;  2EX2 A;  2HP9 A;  3G35 A;  4WM9 A;  5BOH A;  2EFU A;  4S2N A;  4QY6 A;  4X55 A;  1E25 A;  5CED A;  4LV2 A;  1Y54 A;  4MBF A;  5CRF A;  4N9K A;  3IH9 A;  4OQG A;  1H5X A;  1NZO A;  1U60 A;  2PBY A;  2XDM A;  2Z2M B;  1MBL A;  3LY4 A;  5HX9 A;  2HPB A;  1MWU A;  3N4I A;  1K56 D;  1MWR A;  2PU4 A;  3IWQ A;  3HL9 A;  1PW8 A;  3UE3 A;  4RX3 A;  5FAQ A;  2Y2I A;  1FCN A;  2Y4A A;  4ZJ2 A;  2ZMA A;  4O7D A;  1BLC A;  1JTD A;  4NET A;  1FR1 A;  1TDG A;  4DXC A;  2P9V A;  5GLD A;  3ZG8 B;  1BLS A;  3FWL A;  3MXS A;  4GDB A;  1JTG A;  4GZB A;  3NDG A;  2E8I A;  4PPR A;  1ONH A;  4P0M A;  5CTM A;  5EPH A;  1PI5 A;  3NBL A;  3Q1F A;  4QY5 A;  5FQQ A;  1WE4 A;  2OLV A;  4P87 A;  3SS5 A;  3O86 A;  3OPL A;  1W7F A;  4JPM A;  3PBN A;  4R3J A;  4GNU A;  4KZ7 A;  3IHB A;  3EQV A;  1OME A;  4N1X A;  5CTN A;  3LEZ A;  3N7W A;  1EWZ A;  4OOM A;  1YM1 A;  3A3I A;  3N8S A;  4K0W A;  5F1F A;  5A92 A;  5DF7 A;  3NIA A;  3VP2 A;  3ZVW A;  3FKW A;  1NYM A;  5EVI A;  4HEF A;  5EEC A;  3GRJ A;  4OOL A;  4XXR A;  4E3I A;  4C3Q A;  1KDW A;  1SHV A;  3BFC A;  2H10 A;  3M2K A;  3MZD A;  5GHY A;  1K4F A;  2DRW A;  4KQO A;  1IYP A;  2ZC7 A;  1BTL A;  3RXW A;  1KGE A;  1K54 C;  4QJG A;  5JYO A;  1IEL A;  2ZQC A;  4R4R A;  1L0E A;  5FAT A;  4OOY A;  2EX8 A;  2VGK A;  4WZ5 A;  5FQI A;  3IXD A;  1I2S A;  3HLW A;  3IXG A;  5TR7 A;  3DWK A;  3HRE A;  1KE3 A;  5F1G A;  1MKI A;  3IF6 A;  3A3D A;  1FQG A;  3M6H A;  4NK3 A;  2WGW B;  3VOY A;  1M40 A;  3ZCZ A;  1S0W A;  2Y91 A;  4R23 A;  1NY0 A;  4DE1 A;  2EX6 A;  4S2P A;  1QME A;  1K54 A;  1YMX A;  2ZM8 A;  4KG2 A;  3P09 A;  2GDN A;  1L2S A;  1ES5 A;  1PI4 A;  2XK1 A;  5CHJ A;  2EFX A;  2XF3 A;  3PBT A;  2Q9N A;  1KE4 A;  1N9B A;  1K55 A;  3I7J A;  2A49 A;  5DF9 A;  5F82 A;  2X02 A;  1XA7 A;  1PIO A;  3MZF A;  5DTS A;  3UDX A;  2ZQA A;  2HP6 A;  2J9O A;  1LLB A;  3SH9 A;  3BEC A;  3N6I A;  3UDI A;  2WK0 A;  4E6W A;  5CXW A;  3BLM A;  4ID4 A;  1BUE A;  2Z2L B;  3CG5 A;  3QNB A;  4S2J A;  3UDF A;  5FDH A;  2QPN A;  4S2L A;  3NI9 A;  4PM7 A;  4B4X A;  3IF6 B;  3IHA A;  1CEF A;  2ZM2 A;  3G2Z A;  3ISG A;  3VSK A;  1YQS A;  5AQA A;  5CER A;  1LI9 A;  1I5Q A;  1CEG A;  1K55 C;  4X56 A;  2OV5 A;  2XH9 A;  4FD8 A;  3ZFZ A;  5AQB A;  4KZB A;  2WZX A;  4KZ9 A;  2JBF A;  3SH8 A;  4DF6 A;  3MBZ A;  1ES3 A;  2Y2H A;  1PWC A;  4YIN A;  5I94 A;  3N8L A;  5FA7 A;  3W4Q A;  3BEB A;  2Y2J A;  4DRT A;  1XKZ A;  3WS2 A;  4KZ3 A;  5GLB A;  3IXB A;  1EI5 A;  5D3O A;  2FFY A;  5GLC A;  1ONG A;  2EX9 A;  3RJU A;  5HL1 A;  4DDS A;  2WGI A;  2CC1 A;  1YT4 A;  3UPP A;  3VOZ A;  1G68 A;  4FSF A;  4M3K A;  5M1A A;  3Q7V B;  3M6B A;  4KEN B;  1DY6 A;  4R0Q A;  5E43 A;  5FI7 A;  5EVI D;  4EV4 A;  3V50 A;  2C6W B;  3WRZ A;  4GB7 A;  3ZNY A;  2BLS A;  1FSW A;  3G4P A;  4WZ5 C;  1LI0 A;  2WGW A;  3Q81 A;  4IBR A;  1KE0 A;  1ZKJ A;  4BL2 A;  4KZ4 A;  1GHI A;  1LL9 A;  2WYX A;  4JXS A;  5EVL A;  4LEN A;  4FCF A;  3HLE A;  4Y0T A;  2X71 A;  1S6R A;  2Y2G A;  1NZU A;  4PM6 A;  3LCE A;  2ZQD A;  5CEB A;  3UNW A;  1IYO A;  2Y59 A;  4LV1 A;  1GHP A;  1MY8 A;  5GLA A;  3WRT A;  3G2Y A;  2EXA A;  1K57 C;  1PZP A;  1YLZ A;  2WZZ A;  1N4O A;  1FCO A;  1SKF A;  1L0G A;  3GSG A;  4KQQ A;  3SOI A;  4R3B A;  3ITA A;  4JXV A;  4LCM A;  4XUZ A;  3WS0 A;  3V39 A;  4RVA A;  4X6T A;  3ZG7 B;  2ZLY A;  4KZA A;  3WS4 A;  4E3J A;  4MBK A;  4P85 A;  4MLL A;  1YMS A;  2WKI A;  3BFD A;  1BT5 A;  3PBR A;  4IBX A;  4DDY A;  3CMZ A;  1RGZ A;  1ES4 A;  1PZO A;  3Q7V A;  4X53 A;  2ZD8 A;  1ERM A;  2JC7 A;  2Y2M A;  4DE2 A;  1NYY A;  3OCN A;  1L0F A;  5EVI B;  4C75 A;  2R9W A;  2ZC4 B;  2X01 A;  2ZC5 B;  2I72 A;  4IVI A;  4X68 A;  1AXB A;  1W8Y A;  2IWC A;  2ZC6 B;  4OLD A;  1RGY A;  4B4Z A;  1TVF A;  5KSC A;  2H5S A;  3BFF A;  4K91 A;  4S2I A;  3TSG A;  1ZG4 A;  4KZ5 A;  2P9V B;  4WZ4 A;  3MFD A;  4R1G A;  3VFH A;  2Y2Q A;  5AQ7 A;  4HBT A;  3N8R A;  4GDN A;  3DTM A;  3S4X A;  1JWV A;  3VP4 A;  4R4S A;  3MKE A;  2Q9M A;  3G31 A;  4OPY A;  4KZ8 A;  5EOO A;  1KVM A;  5KZH A;  5GL9 A;  1ZC2 A;  1FOF A;  4KG5 A;  1RCJ A;  2WKE A;  1QMF A;  3O87 A;  1RP5 A;  1MWT A;  4KQR A;  5M18 A;  3B3X A;  3HUN A;  2RL3 A;  5FAP A;  3VSL A;  5GHX A;  3SS4 A;  3UY6 A;  1L0D A;  3TG9 A;  2IWB A;  1FSY A;  2XFS A;  3W4O A;  5JYP A;  3FYZ A;  3HLG A;  4RX2 A;  3WWX A;  5HFO A;  3WS1 A;  4S2M A;  1HVB A;  1MXO A;  2V2F F;  2WAF A;  5CHM A;  4Q8I A;  1JWP A;  3HUM A;  2Y2K A;  4ZDX A;  1J9M A;  4Y0O A;  2Y2O A;  5A90 A;  1NXY A;  2V1Z A;  1ERQ A;  4Y7P A;  2J9P A;  4BQM A;  3GV9 A;  1YLJ A;  4U0T A;  1BZA A;  4UA9 A;  4EBN A;  5CEC A;  5HW3 A;  4WEJ A;  3VFF A;  2OLU A;  4MBH A;  3ZG9 B;  5IHV A;  1IKG A;  1KDS A;  1KGF A;  5CHU A;  2R9X A;  1IYS A;  1IEM A;  2HP5 A;  1G6A A;  1WYB A;  1CK3 A;  4EQI A;  1K38 A;  2J7V A;  5HAP A;  1W79 A;  3GMW A;  5FQ9 A;  3HLB A;  1CI9 A;  5A93 A;  5FAS A;  5A91 A;  1BLH A;  2C5W B;  3RXX A;  1E3U A;  3IWO A;  1XP4 A;  5FQM A;  4JF6 A;  2QZ6 A;  4UA6 A;  3AGD A;  1VM1 A;  5CGS A;  4UHU A;  3LO7 A;  2H0Y A;  5FI2 A;  4PM8 A;  2XEP A;  4GD8 A;  1ERO A;  3VP1 A;  3C7V A;  1NRF A;  1VQQ A;  1IKI A;  4WMC A;  1HD8 A;  1XA1 A;  3QNC A;  5TFQ A;  4EBL A;  4EWF A;  3PTE A;  3GVB A;  1JVJ A;  2Y2N A;  4WEL A;  4GOG A;  4PMA A;  3IF5 A;  4PM9 A;  3UN7 A;  3DW0 A;  5DTT A;  1GA9 A;  3TOI A;  1E3U D;  1K6S A;  3PBO A;  2DNS A;  4OLG A;  1Q2Q A;  3FV7 A;  3IQA A;  2VGJ A;  3NDE A;  3GQZ A;  4DE0 A;  4UA7 A;  4E3O A;  3IWI A;  1K4E A;  5F83 A;  3UPN A;  4FH2 A;  5KMW A;  2XFT A;  3BFG A;  4JLF A;  3G32 A;  4U3T A;  3G34 A;  5FI6 A;  5DF8 A;  5CGX A;  3PAE A;  1MWS A;  2Y55 A;  3A3F A;  1HZO A;  3VP0 A;  4IVK A;  1HTZ A;  4OPR A;  2WAD A;  1DJC A;  2ZQ7 A;  3NY4 A;  3Q07 A;  1XX2 A;  2XR0 A;  1NJ4 A;  5DVA A;  1ESU A;  4OH0 A;  5HAQ A;  2HDQ A;  4MNR A;  1YLW A;  3E2L A;  3W8K A;  1ESI A;  1PYY A;  3V3R A;  1KVL A;  4B88 A;  1XGJ A;  2EXB A;  1ES2 A;  3SS3 A;  4DE3 A;  1BSG A;  1DJA A;  4ZBE A;  4OP8 A;  2WKH A;  3S22 A;  4E3N A;  1LL5 A;  3VMA A;  3D4F A;  1K6R A;  3OC2 A;  3GTC A;  4HBU A;  3LY3 A;  4BD1 A;  4JXW A;  4HES A;  4FH4 A;  4S2K A;  5AQ9 A;  2XLN A;  3BYD A;  4OKP A;  2RCX A;  3C4O A;  1XPB A;  5E2G A;  3VP3 A;  3O3V A;  3FKV A;  3IF6 C;  3UE0 A;  2XD5 A;  2WUQ A;  2JE5 A;  4E3K A;  5KSH A;  3BM6 A;  4ZTK A;  5E2F A;  4GD6 A;  4OON A;  4EUZ A;  1DJB A;  1FCM A;  4QB8 A;  1Z6F A;  4S2N C;  4E3M A;  4E3L A;  1GHM A;  3HBR A;  4F94 A;  1GA0 A;  4H8R A;  5TGF A;  3AGE A;  5HAI A;  2HDS A;  1SCW A;  2ZQ9 A;  4BLM A;  3EQU A;  4OPQ A;  3GR2 A;  4BL3 A;  2B5R A;  5E2E A;  5U47 A;  4WEK A;  1SDE A;  1H8Z A;  4JXG A;  4JKT A;  5GHZ A;  3ZDJ A;  2G2W A;  4JF5 A;  4LV0 A;  4LCL A;  4QD4 A;  3FZC A;  5CGW A;  1PWG A;  4DXB A;  5EVI C;  4ZJ3 A;  4BEN A;  2ZC3 B;  1O7E A;  3V5M A;  2QMI A;  2BG1 A;  4OQH A;  5EE8 A;  3E2K A;  4UAA A;  3A3E A;  1TEM A;  3UO9 A;  4PM5 A;  3HLC A;  3OCL A;  4CJN A;  1XXM A;  2UWX A;  4ZAM A;  2ZM0 A;  3CZD A;  4WMC D;  3ZVT A;  2Y2P A;  3OPP A;  4X69 A;  3Q82 A;  2OSU A;  3BLS A;  3MXR A;  4N9L A;  3HLF A;  1IYQ A;  2FFF B;  2WGV A;  2XQZ A;  2HDU A;  4IED A;  4C6Y A;  2DCF A;  4BJP A;  4A5R A;  4Z9Q A;  3ZHH A;  1BUL A;  5G18 A;  3IXH A;  3C5A A;  3W4P A;  4GN2 A;  4DKI A;  3PBQ A;  3HLD A;  3PBS A;  4KZ6 A;  4U0X A;  1W8Q A;  3C7U A;  3IH8 A;  4XUX A;  4BD0 A;  3OZH A;  4QU3 A;  3SH7 A;  1BLP A;  3NC8 A;  1KGG A;  3UPO A;  3IT9 A;  4RA7 A;  1C3B A;  2V20 A;  4E6X A;  4WYY A;  1ALQ A;  3V3S A;  1Q2P A;  1ZG6 A;  3ZG0 A;  5DTK A;  3NCK A;  1XGI A;  4EBP A;  3M2J A;  3BFE A;  5L2F A;  1PWD A;  4OP5 A;  4N1H A;  3C4P A;  4ZJ1 A;  1FR6 A;  4LV3 A;  3P98 A;  2XGN A;  3O88 A;  2ZQ8 A;  4JBF A;  1YLP A;  3DWZ A;  5J8X A;  2HDR A;  4S2O A;  1GCE A;  1M6K A;  1YLT A;  4Y0U A;  4L0L A;  1PW1 A;  1WYC A;  3ZGA B;  1O07 A;  3CJM A;  5M19 A;  1TDL A;  1K25 A;  1K57 A;  3BRM A;  2JCH A;  1I2W A;  3OPH A;  2Y2L A;  4CPK A;  1W5D A;  4YFM A;  4OQI A;  4RYE A;  4WBG A;  4GKU A;  2PU2 A;  1SDN A;  2A3U A;  1E4D A;  4JF4 A;  4OPZ A;  4KG6 A;  3AGF A;  5FSR A;  3OPR A;  3S1Y A;  2XD1 A;  3WS5 A;  2IWD A;  5EUA A;  2ZJ9 A;  2J8Y A;  2WAE A;  1LHY A;  2H0T A;  5E2H A;  1H8Y A;  3HVF A;  3ZNT A;  4K0X A;  4OVD A;  4OQ0 A;  3A3J A;  3HUO A;  3Q7Z A;  5EOE A;  1CI8 A;  4D2O A;  1MPL A;  3ITB A;  5HAR A;  3ZG5 A;  3QHY A;  3JYI A;  1JWZ A;  1K56 A;  3UE1 A;  4P6B A;  2G2U A;  4N92 A;  5FQJ A;  4QHC A;  3MKF A; 
#chains in the Genus database with same CATH topology
 1Y4O A;  1YPR A;  4WM9 A;  2EX2 A;  3FPV A;  4X55 A;  2W3D A;  3A0S A;  4MBF A;  3IH9 A;  1H5X A;  1U60 A;  2PBY A;  1MBL A;  1YSP A;  2Z6C A;  2PAV P;  4MN5 A;  1F2K A;  2Y2I A;  2VV6 A;  3LFV A;  3R7W A;  4NET A;  2WKR A;  4DXC A;  3T4Q A;  3MXS A;  4GDB A;  4GZB A;  2E8I A;  5AVF A;  3Q1F A;  4QY5 A;  4KQD A;  2HZ5 A;  1W7F A;  4GNU A;  3CPT A;  1OME A;  3A3I A;  2VA0 A;  5A92 A;  1IOU A;  3EOI A;  2VGL S;  3FKW A;  3LYX A;  4XXR A;  2INW A;  4HP4 A;  2PT7 A;  2H10 A;  5GHY A;  2KX6 A;  4X1L A;  1K54 C;  1L0E A;  2PBD P;  2VGK A;  2G7U A;  3IXD A;  5TR7 A;  3OOV A;  4DJ3 A;  3A3D A;  3T1R A;  3VOY A;  2E8J A;  4S2P A;  1MZU A;  1NWZ A;  2V1B A;  4I3J A;  4KG2 A;  4YNR A;  2WKP A;  2GDN A;  1L2S A;  3KO6 A;  5CHJ A;  2XF3 A;  3JVU A;  1KE4 A;  5AJG A;  2VKS A;  2A49 A;  3C8C A;  5DF9 A;  3MZF A;  1OJG A;  3UDX A;  2ZQA A;  3BEC A;  2WK0 A;  4ID4 A;  2Z2L B;  1P9R A;  5IS1 A;  3IHA A;  4R3A A;  1CEF A;  2ZM2 A;  3ISG A;  1YQS A;  1K55 C;  2OV5 A;  3SH8 A;  2JBF A;  2Y2H A;  5I94 A;  4YIN A;  1OT6 A;  5FA7 A;  1CJF A;  3RJU A;  4DDS A;  2K7S A;  5F68 A;  5M1A A;  5HD5 A;  3VE3 A;  4KEN B;  3NJA A;  4R0Q A;  5EVI D;  4EV4 A;  3V50 A;  2V0U A;  4WZ5 C;  3G4P A;  4KZ4 A;  1GHI A;  4JXS A;  5EM0 A;  4Y0T A;  4I38 A;  3UE6 A;  3LCE A;  3UB8 A;  1NLZ A;  3JPU A;  4Y5F A;  3WRT A;  5GLA A;  3QP5 A;  1PZP A;  2WZZ A;  2ZLY A;  3WS4 A;  2QJ7 A;  3CPT B;  4MLL A;  2WKI A;  4DDY A;  4P6Z S;  1EW0 A;  1PZO A;  2W1T B;  2JC7 A;  2Y2M A;  4C75 A;  2ZC4 B;  4ZRR A;  2X01 A;  2ZC5 B;  4LRX C;  5KSC A;  2VV7 A;  4S2I A;  1ZG4 A;  1TS7 A;  1T1C A;  4FOF A;  2Y2Q A;  4GDN A;  3S4X A;  1JWV A;  2WKE A;  1RP5 A;  5M18 A;  2RL3 A;  1XFQ A;  5FAP A;  5GHX A;  3SS4 A;  3UY6 A;  4R70 A;  3FYZ A;  4G3W A;  5FEG A;  3WS1 A;  3CHW P;  2V2F F;  3HUM A;  4EXO A;  3CUE C;  1ERQ A;  4QPR A;  3P01 A;  2ZMV A;  1BZA A;  1V9Z A;  2HV1 A;  4EBN A;  5CEC A;  4MMN A;  3GEC A;  2R9X A;  1IEM A;  1G6A A;  1K38 A;  5HAP A;  2IA2 A;  5A93 A;  5FAS A;  2C5W B;  3NOP C;  1E3U A;  1X0O A;  2A24 A;  1OTD A;  4UHU A;  1N9L A;  2XEP A;  3KSG A;  4GD8 A;  3S7Q A;  3QP1 A;  3C7V A;  1VQQ A;  4EBL A;  3GVB A;  1T19 A;  4GOG A;  3IF5 A;  4GS9 B;  4PM9 A;  5DTT A;  1GA9 A;  3PHY A;  4OLG A;  3UB5 P;  4Y2F A;  3IQA A;  2V0W A;  1OTE A;  2V8C A;  5F83 A;  3OLO A;  2XFT A;  5DJT A;  3G34 A;  3E0Y A;  4HJ4 A;  5FI6 A;  1F98 A;  1MWS A;  1HZO A;  3ULF A;  1VEU A;  1ESU A;  5HAQ A;  1PYY A;  3V3R A;  1KVL A;  2EXB A;  3SS3 A;  4DE3 A;  5HWW A;  4ZBE A;  5HSQ A;  4OP8 A;  2WKH A;  5MC7 A;  3EEH A;  3D4F A;  4HBU A;  4BD1 A;  4ME4 A;  4HES A;  1DP9 A;  3C4O A;  3VP3 A;  3IF6 C;  2JE5 A;  4E3K A;  5KSH A;  4ZTK A;  4OON A;  1OPX A;  4R38 A;  4S2N C;  2O9A A;  4E3L A;  1BYW A;  4F94 A;  5TGF A;  1G6O A;  1SDE A;  2BTF P;  4JXG A;  5GHZ A;  3ZDJ A;  5EVE A;  1PWG A;  2ZC3 B;  1O7E A;  4BBU A;  2PR5 A;  3E2K A;  4UAA A;  1TEM A;  1XXM A;  2UWX A;  4AFI A;  4HH3 A;  3ZVT A;  3BLS A;  4N9L A;  1IYQ A;  2HDU A;  4C6Y A;  1BUL A;  3W4P A;  3C5A A;  1JNU A;  1W8Q A;  2H28 A;  3OZH A;  3LID A;  1F9I A;  3NC8 A;  2A24 B;  4E6X A;  3V3S A;  1ZG6 A;  5LBR A;  1PWD A;  3B47 A;  2J3T C;  4N1H A;  1FR6 A;  1MC0 A;  4LFU A;  2ZQ8 A;  2HDR A;  3KX0 X;  4S2O A;  1GCE A;  1YLT A;  4Y0U A;  4JGP A;  3ZGA B;  1K25 A;  4ETZ A;  1K57 A;  3BRM A;  1I2W A;  3CIT A;  4CPK A;  3T1S A;  4WBG A;  1SDN A;  2A3U A;  1E4D A;  4EEP A;  4KG6 A;  3OPR A;  3LGO A;  2IWD A;  1LHY A;  3MMH A;  5E2H A;  2HGV A;  3ZNT A;  4CLC B;  3A3J A;  1MPL A;  3BQA A;  3QHY A;  1JWZ A;  4QHC A;  3NOT C;  3MKF A;  3BY8 A;  4MEZ A;  1S1Z A;  3PAG A;  1YLY A;  2HP9 A;  3G35 A;  3IS2 B;  2EWW A;  1P0Z A;  4S2N A;  1E25 A;  1YAX A;  3P7N A;  4NEE D;  1Y54 A;  3MF0 A;  1DP8 A;  4MDZ A;  4N9K A;  5CRF A;  1NZO A;  1F5M A;  1MWU A;  3LIB A;  2EWV A;  3IWQ A;  3HL9 A;  3V67 A;  3D3O A;  1FCN A;  2LB9 A;  4EES A;  1JTD A;  3D72 A;  3FWL A;  2XRO A;  3NDG A;  3CLO A;  5FL3 A;  1PI5 A;  4O8G A;  1WE4 A;  3BJN A;  5FEF A;  1DP6 A;  2HJE A;  4KZ7 A;  3IHB A;  3EQV A;  4N1X A;  5CTN A;  2PYP A;  3LUQ A;  1T18 A;  1YM1 A;  4K0W A;  5DF7 A;  1UGU A;  4LLO B;  3VP2 A;  3ZVW A;  1NYM A;  4O01 A;  5EVI A;  2PD8 A;  2CMN A;  5G4Y A;  4C3Q A;  2QJ5 A;  3M2K A;  3MZD A;  1K4F A;  3NOU C;  4KQO A;  2QWS A;  1BTL A;  5JYO A;  2P08 A;  5HPF A;  5FQI A;  3IXG A;  3HRE A;  1KE3 A;  4WLA A;  1MKI A;  3NHQ A;  2W3F A;  4NK3 A;  4Z1W A;  4PHT A;  3UB7 A;  5L10 A;  1N9B A;  2ZOH A;  2X02 A;  3BWL A;  2HP6 A;  3E4Q A;  3UDI A;  3C30 A;  4E6W A;  5CXW A;  3BLM A;  3CG5 A;  4S2J A;  3MQO A;  2QPN A;  4PM7 A;  4B4X A;  3IF6 B;  3G2Z A;  5AQA A;  5CER A;  4X56 A;  2B02 A;  3DTE A;  5AQB A;  3T4O A;  4DRT A;  3BEB A;  2Y2J A;  1XKZ A;  2FFY A;  5GLC A;  3JVV A;  3FPW A;  2CC1 A;  1YT4 A;  1HLU P;  4M3K A;  2Y79 A;  2M7V A;  3M6B A;  1DY6 A;  5FI7 A;  4DN0 A;  4ARZ A;  3WRZ A;  2BLS A;  5DJU A;  1LI0 A;  1ZTU A;  1KE0 A;  1ZKJ A;  3H9W A;  4FCF A;  1TS0 A;  2X71 A;  1S6R A;  5CEB A;  3UNW A;  1IYO A;  2Y59 A;  3G2Y A;  1LT0 A;  4EW7 A;  4HNB A;  1SKF A;  3SOI A;  1V9Y A;  2WKQ A;  3MSH A;  4KZA A;  3L7H A;  1D06 A;  1H3Q A;  3BFD A;  1BT5 A;  3CMZ A;  1RGZ A;  1ES4 A;  3Q7V A;  4DE2 A;  3OCN A;  5EVI B;  2R9W A;  1H8M A;  2I72 A;  4X68 A;  2IWC A;  2ZC6 B;  4L9F A;  3TSG A;  3HJI A;  5HWT A;  4R1G A;  3VFH A;  3LR4 A;  4R4S A;  3MKE A;  2Q9M A;  4OPY A;  5EOO A;  4KZ8 A;  5F5Y A;  5GL9 A;  4KG5 A;  5HL6 A;  1RCJ A;  1QMF A;  3O87 A;  1TS8 A;  1Z09 A;  4H6J A;  4Q0I A;  1FSY A;  2XFS A;  3T4K A;  1XJ6 A;  3W4O A;  5JYP A;  4RX2 A;  5HPI A;  1HVB A;  4Q8I A;  2ZBB A;  3IS2 A;  3S7O A;  5A90 A;  4F3L A;  2J9P A;  4D60 A;  4U0T A;  3EGD C;  2A2L A;  4HQA A;  4MBH A;  1GSX A;  3ZG9 B;  5IT5 A;  1KDS A;  5CHU A;  1WYB A;  2JKR M;  1W79 A;  5FQ9 A;  5A91 A;  3IWO A;  1N9N A;  4JF6 A;  4UA6 A;  3UB6 A;  3B42 A;  5FI2 A;  4BWI A;  4EWF A;  1IKI A;  1XA1 A;  2JKF A;  4WEL A;  1P97 A;  3TOI A;  2DNS A;  3FV7 A;  1NRJ A;  4DE0 A;  3GQZ A;  3LI9 A;  3IWI A;  1K4E A;  3G32 A;  5DF8 A;  2Y55 A;  3VP0 A;  1HTZ A;  4P6Z M;  2ZQ7 A;  3S7P A;  1L3L A;  2HDQ A;  3E2L A;  3W8K A;  4I3I A;  1XGJ A;  1YSQ A;  1BSG A;  1DJA A;  1ODV A;  3RTY A;  3S22 A;  3TW8 A;  1K6R A;  2PDR A;  3O3V A;  2PR6 A;  2WUQ A;  3BM6 A;  4GD6 A;  4EUZ A;  1DJB A;  4QB8 A;  4PAU A;  5J3W A;  5J4E A;  3HBR A;  2OAQ 1;  3AGE A;  3PYP A;  3VOL A;  2ZQ9 A;  4L9E A;  5DFX A;  4BLM A;  3EQU A;  3GR2 A;  2B5R A;  2V1A A;  4YWZ A;  2G2W A;  4JF5 A;  4B93 A;  4LCL A;  4DXB A;  5EVI C;  5EE8 A;  2O99 A;  4NG2 A;  4PM5 A;  3MQ0 A;  3OCL A;  3DTI A;  3A0V A;  2ZM0 A;  3CZD A;  2Y2P A;  3OPP A;  2JKR I;  2OSU A;  2QHK A;  2WGV A;  2XQZ A;  4LRZ E;  3LR3 A;  5KIZ A;  4Y13 A;  5G18 A;  1XJ2 A;  3IXH A;  3CUE A;  3HLD A;  3IH8 A;  4BD0 A;  5HDC A;  2OWJ A;  1BLP A;  3UPO A;  4Q0H A;  1C3B A;  4WYY A;  3E4P A;  1T1B A;  4XT2 B;  3ZG0 A;  1XGI A;  4MN6 A;  5K5B A;  3C4P A;  4ZJ1 A;  3O88 A;  4L0L A;  1O07 A;  1LSW A;  3CJM A;  1FIL A;  3F1P A;  3QP4 A;  3R4K A;  1W5D A;  4Y17 A;  3T1X A;  4B9O A;  4GJ4 A;  2W3E A;  2VGL M;  3HCY A;  2H0T A;  2M1C A;  1H8Y A;  3MR0 A;  4HI4 A;  3EWK A;  3SW1 A;  5TBM A;  4P6B A;  3L9K A;  4NXB A;  2P74 A;  3G30 A;  2MJ6 A;  3MZE A;  2J80 A;  1TS6 A;  5BOH A;  2EFU A;  1CQA A;  5CED A;  4QY6 A;  4Y3I A;  4OQG A;  2XDM A;  5HX9 A;  1K56 D;  2XA7 M;  2FH5 A;  4GLQ A;  4RX3 A;  4DMZ A;  2VZW A;  4O7D A;  1TDG A;  4WF0 A;  3ZG8 B;  1OTB A;  4EQ1 A;  1BLS A;  5I5L A;  1JTG A;  4IHQ A;  4PPR A;  2JKT M;  4P0M A;  5CTM A;  5EPH A;  4K08 A;  3NBL A;  5FQQ A;  5IU1 A;  2OLV A;  4P87 A;  3T4T A;  3UMD A;  3O86 A;  4JPM A;  3RH8 B;  1LSX A;  3N7W A;  4OOM A;  3N8S A;  4I39 A;  4OOL A;  3G6O A;  1KDW A;  1SHV A;  2J3W A;  4EU0 A;  3KYQ A;  3UB9 A;  2ZC7 A;  3RXW A;  1KGE A;  1SKO A;  4FTX A;  1IEL A;  2ZQC A;  4R4R A;  3H7W B;  5FAT A;  4OOY A;  4HOI A;  4NXG A;  1I2S A;  2PYR A;  3DWK A;  3IF6 A;  1FQG A;  4KUK A;  2J3T D;  1S0W A;  2ACG A;  4R23 A;  4UQI M;  4DE1 A;  4X25 A;  1YMX A;  1K54 A;  3P09 A;  4FUW A;  2XK1 A;  1ES5 A;  1PI4 A;  2V8F A;  3PBT A;  2Q9N A;  3I7J A;  5F82 A;  1XA7 A;  1P9W A;  1BUE A;  3QNB A;  1STZ A;  4MN7 A;  3NI9 A;  4IJG A;  2Z6D A;  1LI9 A;  2UV0 E;  3KSF A;  1CEG A;  1UWP X;  3ZFZ A;  2OAP 1;  2XH9 A;  2GJ3 A;  4WL9 A;  4KZB A;  4KZ9 A;  4DF6 A;  1ES3 A;  1PWC A;  3ZQ5 A;  5GLB A;  3IXB A;  1EI5 A;  1S1Y A;  2EX9 A;  2WGI A;  3UPP A;  1G68 A;  1OJ5 A;  3IX8 A;  4FSF A;  1KOU A;  2B18 A;  4HJ6 A;  4G3K A;  4ESP A;  4GB7 A;  2KLI A;  2WGW A;  4IBR A;  3F1N A;  3T50 A;  2WYX A;  4QWO A;  5TBM B;  4LEN A;  3HLE A;  3NUL A;  4PM6 A;  4G3V A;  2ZQD A;  1GHP A;  3PR6 A;  4HH2 A;  2EXA A;  1K57 C;  1YLZ A;  1N4O A;  1FCO A;  1L0G A;  3GSG A;  4R3B A;  3ITA A;  3ZYT A;  4H6J B;  4X6T A;  3ZG7 B;  3CI6 A;  2O9C A;  4E3J A;  4P85 A;  1YMS A;  4IBX A;  4WN5 A;  1ERM A;  1S67 L;  3LR5 A;  5J7E A;  4GHI B;  3NEC A;  5HDS A;  3FG8 A;  1AXB A;  4OLD A;  1RGY A;  2H5S A;  4KZ5 A;  4WZ4 A;  3GDI A;  5AQ7 A;  3N8R A;  3VP4 A;  3DTM A;  4X1M A;  3MS6 A;  5KZH A;  5EV0 A;  1MWT A;  4KQR A;  3B3X A;  3LI8 A;  4CLC C;  1L0D A;  3WWX A;  1VET B;  5F69 A;  5C5K A;  2P7J A;  5CHM A;  2WAF A;  1YKD A;  4YOF A;  3A0R A;  5L07 A;  4Y0O A;  2JN7 A;  5EM1 A;  2V1Z A;  3LIC A;  3MQQ A;  3H82 A;  3BQ8 A;  2O9B A;  1YLJ A;  4BMW A;  4WEJ A;  3VFF A;  2OLU A;  2OOL A;  3W2Z A;  1KGF A;  3T1Q B;  1IYS A;  4EQI A;  4HY8 A;  3GMW A;  1CI9 A;  1BLH A;  3VV4 A;  1S66 L;  4CQH A;  4PKY G;  1TD5 A;  1VM1 A;  2FZ0 A;  3LO7 A;  2H0Y A;  1Y28 A;  4PM8 A;  2ZL1 B;  2L0W A;  2PD7 A;  1OTA A;  2JKT I;  3VP1 A;  5TFQ A;  4WMC A;  3IBR A;  3QNC A;  1JVJ A;  5FDS A;  3QP6 A;  3DW0 A;  1K6S A;  3HJK A;  4E3O A;  1NLY A;  3T4J A;  5KMW A;  4JLF A;  4I5S A;  3PAE A;  5CGX A;  2HJ9 C;  2O0Y A;  2BAS A;  4OPR A;  2WAD A;  1DJC A;  1FIK A;  2VK3 A;  3NY4 A;  2XR0 A;  1NJ4 A;  5DVA A;  5DKL A;  4OH0 A;  1YLW A;  4CLC E;  1LL5 A;  3VMA A;  4ETX A;  3GTC A;  4DJ2 A;  2VV8 A;  4JXW A;  4FH4 A;  2XLN A;  2RCX A;  5E2G A;  1XPB A;  3D9Y A;  2XD5 A;  4JGR A;  4E04 A;  5E2F A;  4MCW A;  2GZA A;  1GHM A;  1GA0 A;  4H8R A;  3CWF A;  1A0K A;  4BL3 A;  1W63 M;  1H8Z A;  4JKT A;  3C2W A;  5L8M A;  3T12 B;  2Y8H A;  4OQH A;  3ICY A;  2GX5 A;  2XSS A;  3UO9 A;  4WMC D;  2KOI A;  2Q0O A;  3DAV A;  2VEA A;  3MXR A;  2DCF A;  3F1O A;  3LIE A;  3ZHH A;  1IFQ A;  4BBV A;  4DKI A;  1T1A A;  4KZ6 A;  4XUX A;  3PXP A;  4QU3 A;  1GSV A;  1KGG A;  4O0P A;  1SZV A;  2AVX A;  1SKO B;  1UWN X;  5DTK A;  3NCK A;  4EBP A;  5L2F A;  3BFE A;  3H82 B;  4OP5 A;  3P98 A;  5J8X A;  1YLP A;  3DWZ A;  3SZT A;  4L9G A;  1LSV A;  1PFL A;  4CLC A;  1DRM A;  5M19 A;  1TDL A;  1CF0 A;  4JGQ A;  2JCH A;  4RYE A;  4GKU A;  2PU2 A;  3AGF A;  2W3H A;  5EUA A;  2ZJ9 A;  4PKY A;  2WAE A;  3HVF A;  2OWH A;  4K0X A;  1VET A;  3HUO A;  3EEA A;  2VX8 A;  5EOE A;  1CI8 A;  4D2O A;  5HAR A;  3IX4 A;  4R6L A;  4N92 A;  5FAO A;  4F3L B;  5FQK A;  2K2N A;  1MKM A;  5DFY A;  4LV2 A;  2XRN A;  5EFW A;  1WA9 A;  4M4X A;  2R78 A;  4HP9 A;  1G5U A;  2Z2M B;  3LY4 A;  2HPB A;  3RFB A;  3N4I A;  3B33 A;  1MWR A;  2PU4 A;  4LPZ A;  3UE3 A;  1PW8 A;  3F1P B;  3U2A A;  2PHY A;  5FAQ A;  2Y4A A;  1AWI A;  4ZJ2 A;  2ZMA A;  1BLC A;  5F6A A;  3C38 A;  1FR1 A;  3H7W A;  2P9V A;  5GLD A;  1ACF A;  4IUK A;  3E98 A;  3LEQ A;  1ONH A;  3SS5 A;  3OPL A;  2LB5 A;  3PBN A;  4R3J A;  1XJ3 A;  5AVE A;  3LEZ A;  1EWZ A;  5F1F A;  3NIA A;  4HEF A;  5EEC A;  3GRJ A;  4E3I A;  3BFC A;  2QYB A;  4HJ3 A;  5CX7 A;  2DRW A;  1IYP A;  3TJZ C;  4QJG A;  2DMW A;  1S4R A;  4NKP A;  2EX8 A;  4WZ5 A;  3HLW A;  5F1G A;  4GW9 A;  4NXE A;  3M6H A;  2WGW B;  1M40 A;  2D02 A;  2HF6 A;  3ZCZ A;  2Y91 A;  1NY0 A;  3T4L A;  4Q0J A;  2EX6 A;  1QME A;  2ZM8 A;  3F1O B;  2VJW A;  2XA7 S;  2EFX A;  3T4S A;  1K55 A;  3UME A;  1PIO A;  5DTS A;  4Y15 A;  2J9O A;  1LLB A;  3SH9 A;  3N6I A;  3FC7 A;  3F1N B;  3UDF A;  5FDH A;  4S2L A;  3VSK A;  1I5Q A;  4FD8 A;  1D7E A;  2WZX A;  3QP2 A;  2W1R A;  3MBZ A;  1K0K A;  3N8L A;  3W4Q A;  2ZMF A;  5G4Z A;  4LGW A;  3O5Y A;  1D1J A;  4KZ3 A;  3WS2 A;  5D3O A;  1ONG A;  5HL1 A;  4UEY A;  3VOZ A;  2ZL1 A;  1H0M A;  2P04 A;  3Q7V B;  5E43 A;  4GHI A;  2C6W B;  2D01 A;  3ZNY A;  1FSW A;  1ZHH B;  3Q81 A;  3TE8 A;  1OT9 A;  4BL2 A;  1LL9 A;  2JHE A;  5EVL A;  2Y2G A;  3S7N A;  1NZU A;  2ZOI A;  4HIA A;  1VB6 A;  4EEU A;  1N9O A;  1G28 A;  4LV1 A;  1MY8 A;  4RQ9 A;  2L4R A;  2W0N A;  4KQQ A;  4JXV A;  4LCM A;  4XUZ A;  3WS0 A;  3V39 A;  4RVA A;  3MXQ A;  4MBK A;  3PBR A;  4X53 A;  2ZD8 A;  1NYY A;  3MJQ A;  1L0F A;  4IVI A;  1W8Y A;  3BY9 A;  4B4Z A;  1TVF A;  3LR0 A;  3BFF A;  4K91 A;  2P9V B;  3MFD A;  2PRF A;  4GCZ A;  4HBT A;  5HZH A;  3G31 A;  1KVM A;  2KDK A;  1ZC2 A;  1FOF A;  3DTK A;  4HHD A;  2YKH A;  3HUN A;  3VSL A;  3TG9 A;  2IWB A;  3KSI A;  3KYZ A;  3HLG A;  5HFO A;  3K2N A;  4S2M A;  1MXO A;  4ZDX A;  1JWP A;  2Y2K A;  1J9M A;  2Y2O A;  1NXY A;  4II7 A;  4Y7P A;  1LL8 A;  4BQM A;  3GV9 A;  4UA9 A;  5HW3 A;  3K3C A;  1VHM A;  4EET B;  5IHV A;  1IKG A;  2NUP C;  2HP5 A;  2V9A A;  2W27 A;  1CK3 A;  2J7V A;  1XFN A;  3HLB A;  4LRY C;  4EUV A;  3RXX A;  1XP4 A;  5FQM A;  5HD3 A;  2I9V A;  2QZ6 A;  3EGX C;  1TF1 A;  3AGD A;  3TRC A;  4NXF A;  5CGS A;  3U4L P;  3MFX A;  2NUT C;  1ERO A;  1NRF A;  1HD8 A;  5TJJ A;  3PTE A;  2Y2N A;  4PMA A;  3UN7 A;  1J3W A;  1E3U D;  3PBO A;  5A8B A;  1Q2Q A;  2VGJ A;  3NDE A;  4UA7 A;  5L09 A;  3QP8 A;  2W3G A;  3UPN A;  4FH2 A;  3BFG A;  4U3T A;  1W63 Q;  2JKG A;  3K3D A;  3A3F A;  4IVK A;  3Q07 A;  1XX2 A;  3R7W B;  1PRQ A;  4MNR A;  1ESI A;  4JGO A;  4B88 A;  1ES2 A;  3VE4 A;  4GS9 A;  4E3N A;  2GNX A;  1S4S A;  3OC2 A;  3LY3 A;  4S2K A;  5AQ9 A;  2W1T A;  3BYD A;  4OKP A;  1PNE A;  3FKV A;  3UE0 A;  1FCM A;  2K31 A;  1Z6F A;  4UQI S;  4E3M A;  5HAI A;  2HDS A;  1SCW A;  4OPQ A;  3LIF A;  5E2E A;  5U47 A;  4WEK A;  4LV0 A;  4QD4 A;  3FZC A;  5CGW A;  4ZJ3 A;  4BEN A;  3DBA A;  3V5M A;  2QMI A;  2BG1 A;  3LIA A;  2L1M A;  3IBJ A;  3A3E A;  1OTI A;  2QKP A;  3KSH A;  3HLC A;  4CJN A;  5HWV A;  4ZAM A;  3CAX A;  1GSW A;  4ARZ B;  4X69 A;  3OBF A;  3Q82 A;  1VEU B;  3HLF A;  2FFF B;  4I3A A;  4IED A;  2B95 A;  4A5R A;  4BJP A;  4Z9Q A;  4KUO A;  4GN2 A;  3PBQ A;  3PBS A;  4U0X A;  3C7U A;  3SH7 A;  3IT9 A;  4CLC D;  4RA7 A;  2V20 A;  2EA9 A;  1ALQ A;  1Q2P A;  3M2J A;  5DKK A;  4LV3 A;  2XGN A;  4JBF A;  2YKF A;  1M6K A;  1WYC A;  1PW1 A;  1XJ4 A;  4WUJ A;  3OPH A;  2Y2L A;  4YFM A;  4OQI A;  5FSR A;  4JF4 A;  4IUH A;  4OPZ A;  3BW6 A;  4XT2 A;  3S1Y A;  2XD1 A;  3WS5 A;  2J8Y A;  2M7U A;  4BBT A;  3E4O A;  3KYE A;  4EER A;  4OVD A;  4OQ0 A;  3Q7Z A;  2VLG A;  5HDD A;  3ITB A;  3ZG5 A;  3UE1 A;  3JYI A;  1K56 A;  3IX3 A;  2G2U A;  5FQJ A; 
#chains in the Genus database with same CATH homology
 2P74 A;  4MEZ A;  3G30 A;  5FAO A;  3PAG A;  5FQK A;  1YLY A;  3MZE A;  2EX2 A;  2HP9 A;  3G35 A;  4WM9 A;  5BOH A;  2EFU A;  4S2N A;  4QY6 A;  4X55 A;  1E25 A;  5CED A;  4LV2 A;  1Y54 A;  4MBF A;  5CRF A;  4N9K A;  3IH9 A;  4OQG A;  1H5X A;  1NZO A;  1U60 A;  2PBY A;  2XDM A;  2Z2M B;  1MBL A;  3LY4 A;  5HX9 A;  2HPB A;  1MWU A;  3N4I A;  1K56 D;  1MWR A;  2PU4 A;  3IWQ A;  3HL9 A;  1PW8 A;  3UE3 A;  4RX3 A;  5FAQ A;  2Y2I A;  1FCN A;  2Y4A A;  4ZJ2 A;  2ZMA A;  4O7D A;  1BLC A;  1JTD A;  4NET A;  1FR1 A;  1TDG A;  4DXC A;  2P9V A;  5GLD A;  3ZG8 B;  1BLS A;  3FWL A;  3MXS A;  4GDB A;  1JTG A;  4GZB A;  3NDG A;  2E8I A;  4PPR A;  1ONH A;  4P0M A;  5CTM A;  5EPH A;  1PI5 A;  3NBL A;  3Q1F A;  4QY5 A;  5FQQ A;  1WE4 A;  2OLV A;  4P87 A;  3SS5 A;  3O86 A;  3OPL A;  1W7F A;  4JPM A;  3PBN A;  4R3J A;  4GNU A;  4KZ7 A;  3IHB A;  3EQV A;  1OME A;  4N1X A;  5CTN A;  3LEZ A;  3N7W A;  1EWZ A;  4OOM A;  1YM1 A;  3A3I A;  3N8S A;  4K0W A;  5F1F A;  5A92 A;  5DF7 A;  3NIA A;  3VP2 A;  3ZVW A;  3FKW A;  1NYM A;  5EVI A;  4HEF A;  5EEC A;  3GRJ A;  4OOL A;  4XXR A;  4E3I A;  4C3Q A;  1KDW A;  1SHV A;  3BFC A;  2H10 A;  3M2K A;  3MZD A;  5GHY A;  1K4F A;  2DRW A;  4KQO A;  1IYP A;  2ZC7 A;  1BTL A;  3RXW A;  1KGE A;  1K54 C;  4QJG A;  5JYO A;  1IEL A;  2ZQC A;  4R4R A;  1L0E A;  5FAT A;  4OOY A;  2EX8 A;  2VGK A;  4WZ5 A;  5FQI A;  3IXD A;  1I2S A;  3HLW A;  3IXG A;  5TR7 A;  3DWK A;  3HRE A;  1KE3 A;  5F1G A;  1MKI A;  3IF6 A;  3A3D A;  1FQG A;  3M6H A;  4NK3 A;  2WGW B;  3VOY A;  1M40 A;  3ZCZ A;  1S0W A;  2Y91 A;  4R23 A;  1NY0 A;  4DE1 A;  2EX6 A;  4S2P A;  1QME A;  1K54 A;  1YMX A;  2ZM8 A;  4KG2 A;  3P09 A;  2GDN A;  1L2S A;  1ES5 A;  1PI4 A;  2XK1 A;  5CHJ A;  2EFX A;  2XF3 A;  3PBT A;  2Q9N A;  1KE4 A;  1N9B A;  1K55 A;  3I7J A;  2A49 A;  5DF9 A;  5F82 A;  2X02 A;  1XA7 A;  1PIO A;  3MZF A;  5DTS A;  3UDX A;  2ZQA A;  2HP6 A;  2J9O A;  1LLB A;  3SH9 A;  3BEC A;  3N6I A;  3UDI A;  2WK0 A;  4E6W A;  5CXW A;  3BLM A;  4ID4 A;  1BUE A;  2Z2L B;  3CG5 A;  3QNB A;  4S2J A;  3UDF A;  5FDH A;  2QPN A;  4S2L A;  3NI9 A;  4PM7 A;  4B4X A;  3IF6 B;  3IHA A;  1CEF A;  2ZM2 A;  3G2Z A;  3ISG A;  3VSK A;  1YQS A;  5AQA A;  5CER A;  1LI9 A;  1I5Q A;  1CEG A;  1K55 C;  4X56 A;  2OV5 A;  2XH9 A;  4FD8 A;  3ZFZ A;  5AQB A;  4KZB A;  2WZX A;  4KZ9 A;  2JBF A;  3SH8 A;  4DF6 A;  3MBZ A;  1ES3 A;  2Y2H A;  1PWC A;  4YIN A;  5I94 A;  3N8L A;  5FA7 A;  3W4Q A;  3BEB A;  2Y2J A;  4DRT A;  1XKZ A;  3WS2 A;  4KZ3 A;  5GLB A;  3IXB A;  1EI5 A;  5D3O A;  2FFY A;  5GLC A;  1ONG A;  2EX9 A;  3RJU A;  5HL1 A;  4DDS A;  2WGI A;  2CC1 A;  1YT4 A;  3UPP A;  3VOZ A;  1G68 A;  4FSF A;  4M3K A;  5M1A A;  3Q7V B;  3M6B A;  4KEN B;  1DY6 A;  4R0Q A;  5E43 A;  5FI7 A;  5EVI D;  4EV4 A;  3V50 A;  2C6W B;  3WRZ A;  4GB7 A;  3ZNY A;  2BLS A;  1FSW A;  3G4P A;  4WZ5 C;  1LI0 A;  2WGW A;  3Q81 A;  4IBR A;  1KE0 A;  1ZKJ A;  4BL2 A;  4KZ4 A;  1GHI A;  1LL9 A;  2WYX A;  4JXS A;  5EVL A;  4LEN A;  4FCF A;  3HLE A;  4Y0T A;  2X71 A;  1S6R A;  2Y2G A;  1NZU A;  4PM6 A;  3LCE A;  2ZQD A;  5CEB A;  3UNW A;  1IYO A;  2Y59 A;  4LV1 A;  1GHP A;  1MY8 A;  5GLA A;  3WRT A;  3G2Y A;  2EXA A;  1K57 C;  1PZP A;  1YLZ A;  2WZZ A;  1N4O A;  1FCO A;  1SKF A;  1L0G A;  3GSG A;  4KQQ A;  3SOI A;  4R3B A;  3ITA A;  4JXV A;  4LCM A;  4XUZ A;  3WS0 A;  3V39 A;  4RVA A;  4X6T A;  3ZG7 B;  2ZLY A;  4KZA A;  3WS4 A;  4E3J A;  4MBK A;  4P85 A;  4MLL A;  1YMS A;  2WKI A;  3BFD A;  1BT5 A;  3PBR A;  4IBX A;  4DDY A;  3CMZ A;  1RGZ A;  1ES4 A;  1PZO A;  3Q7V A;  4X53 A;  2ZD8 A;  1ERM A;  2JC7 A;  2Y2M A;  4DE2 A;  1NYY A;  3OCN A;  1L0F A;  5EVI B;  4C75 A;  2R9W A;  2ZC4 B;  2X01 A;  2ZC5 B;  2I72 A;  4IVI A;  4X68 A;  1AXB A;  1W8Y A;  2IWC A;  2ZC6 B;  4OLD A;  1RGY A;  4B4Z A;  1TVF A;  5KSC A;  2H5S A;  3BFF A;  4K91 A;  4S2I A;  3TSG A;  1ZG4 A;  4KZ5 A;  2P9V B;  4WZ4 A;  3MFD A;  4R1G A;  3VFH A;  2Y2Q A;  5AQ7 A;  4HBT A;  3N8R A;  4GDN A;  3DTM A;  3S4X A;  1JWV A;  3VP4 A;  4R4S A;  3MKE A;  2Q9M A;  3G31 A;  4OPY A;  4KZ8 A;  5EOO A;  1KVM A;  5KZH A;  5GL9 A;  1ZC2 A;  1FOF A;  4KG5 A;  1RCJ A;  2WKE A;  1QMF A;  3O87 A;  1RP5 A;  1MWT A;  4KQR A;  5M18 A;  3B3X A;  3HUN A;  2RL3 A;  5FAP A;  3VSL A;  5GHX A;  3SS4 A;  3UY6 A;  1L0D A;  3TG9 A;  2IWB A;  1FSY A;  2XFS A;  3W4O A;  5JYP A;  3FYZ A;  3HLG A;  4RX2 A;  3WWX A;  5HFO A;  3WS1 A;  4S2M A;  1HVB A;  1MXO A;  2V2F F;  2WAF A;  5CHM A;  4Q8I A;  1JWP A;  3HUM A;  2Y2K A;  4ZDX A;  1J9M A;  4Y0O A;  2Y2O A;  5A90 A;  1NXY A;  2V1Z A;  1ERQ A;  4Y7P A;  2J9P A;  4BQM A;  3GV9 A;  1YLJ A;  4U0T A;  1BZA A;  4UA9 A;  4EBN A;  5CEC A;  5HW3 A;  4WEJ A;  3VFF A;  2OLU A;  4MBH A;  3ZG9 B;  5IHV A;  1IKG A;  1KDS A;  1KGF A;  5CHU A;  2R9X A;  1IYS A;  1IEM A;  2HP5 A;  1G6A A;  1WYB A;  1CK3 A;  4EQI A;  1K38 A;  2J7V A;  5HAP A;  1W79 A;  3GMW A;  5FQ9 A;  3HLB A;  1CI9 A;  5A93 A;  5FAS A;  5A91 A;  1BLH A;  2C5W B;  3RXX A;  1E3U A;  3IWO A;  1XP4 A;  5FQM A;  4JF6 A;  2QZ6 A;  4UA6 A;  3AGD A;  1VM1 A;  5CGS A;  4UHU A;  3LO7 A;  2H0Y A;  5FI2 A;  4PM8 A;  2XEP A;  4GD8 A;  1ERO A;  3VP1 A;  3C7V A;  1NRF A;  1VQQ A;  1IKI A;  4WMC A;  1HD8 A;  1XA1 A;  3QNC A;  5TFQ A;  4EBL A;  4EWF A;  3PTE A;  3GVB A;  1JVJ A;  2Y2N A;  4WEL A;  4GOG A;  4PMA A;  3IF5 A;  4PM9 A;  3UN7 A;  3DW0 A;  5DTT A;  1GA9 A;  3TOI A;  1E3U D;  1K6S A;  3PBO A;  2DNS A;  4OLG A;  1Q2Q A;  3FV7 A;  3IQA A;  2VGJ A;  3NDE A;  3GQZ A;  4DE0 A;  4UA7 A;  4E3O A;  3IWI A;  1K4E A;  5F83 A;  3UPN A;  4FH2 A;  5KMW A;  2XFT A;  3BFG A;  4JLF A;  3G32 A;  4U3T A;  3G34 A;  5FI6 A;  5DF8 A;  5CGX A;  3PAE A;  1MWS A;  2Y55 A;  3A3F A;  1HZO A;  3VP0 A;  4IVK A;  1HTZ A;  4OPR A;  2WAD A;  1DJC A;  2ZQ7 A;  3NY4 A;  3Q07 A;  1XX2 A;  2XR0 A;  1NJ4 A;  5DVA A;  1ESU A;  4OH0 A;  5HAQ A;  2HDQ A;  4MNR A;  1YLW A;  3E2L A;  3W8K A;  1ESI A;  1PYY A;  3V3R A;  1KVL A;  4B88 A;  1XGJ A;  2EXB A;  1ES2 A;  3SS3 A;  4DE3 A;  1BSG A;  1DJA A;  4ZBE A;  4OP8 A;  2WKH A;  3S22 A;  4E3N A;  1LL5 A;  3VMA A;  3D4F A;  1K6R A;  3OC2 A;  3GTC A;  4HBU A;  3LY3 A;  4BD1 A;  4JXW A;  4HES A;  4FH4 A;  4S2K A;  5AQ9 A;  2XLN A;  3BYD A;  4OKP A;  2RCX A;  3C4O A;  1XPB A;  5E2G A;  3VP3 A;  3O3V A;  3FKV A;  3IF6 C;  3UE0 A;  2XD5 A;  2WUQ A;  2JE5 A;  4E3K A;  5KSH A;  3BM6 A;  4ZTK A;  5E2F A;  4GD6 A;  4OON A;  4EUZ A;  1DJB A;  1FCM A;  4QB8 A;  1Z6F A;  4S2N C;  4E3M A;  4E3L A;  1GHM A;  3HBR A;  4F94 A;  1GA0 A;  4H8R A;  5TGF A;  3AGE A;  5HAI A;  2HDS A;  1SCW A;  2ZQ9 A;  4BLM A;  3EQU A;  4OPQ A;  3GR2 A;  4BL3 A;  2B5R A;  5E2E A;  5U47 A;  4WEK A;  1SDE A;  1H8Z A;  4JXG A;  4JKT A;  5GHZ A;  3ZDJ A;  2G2W A;  4JF5 A;  4LV0 A;  4LCL A;  4QD4 A;  3FZC A;  5CGW A;  1PWG A;  4DXB A;  5EVI C;  4ZJ3 A;  4BEN A;  2ZC3 B;  1O7E A;  3V5M A;  2QMI A;  2BG1 A;  4OQH A;  5EE8 A;  3E2K A;  4UAA A;  3A3E A;  1TEM A;  3UO9 A;  4PM5 A;  3HLC A;  3OCL A;  4CJN A;  1XXM A;  2UWX A;  4ZAM A;  2ZM0 A;  3CZD A;  4WMC D;  3ZVT A;  2Y2P A;  3OPP A;  4X69 A;  3Q82 A;  2OSU A;  3BLS A;  3MXR A;  4N9L A;  3HLF A;  1IYQ A;  2FFF B;  2WGV A;  2XQZ A;  2HDU A;  4IED A;  4C6Y A;  2DCF A;  4BJP A;  4A5R A;  4Z9Q A;  3ZHH A;  1BUL A;  5G18 A;  3IXH A;  3C5A A;  3W4P A;  4GN2 A;  4DKI A;  3PBQ A;  3HLD A;  3PBS A;  4KZ6 A;  4U0X A;  1W8Q A;  3C7U A;  3IH8 A;  4XUX A;  4BD0 A;  3OZH A;  4QU3 A;  3SH7 A;  1BLP A;  3NC8 A;  1KGG A;  3UPO A;  3IT9 A;  4RA7 A;  1C3B A;  2V20 A;  4E6X A;  4WYY A;  1ALQ A;  3V3S A;  1Q2P A;  1ZG6 A;  3ZG0 A;  5DTK A;  3NCK A;  1XGI A;  4EBP A;  3M2J A;  3BFE A;  5L2F A;  1PWD A;  4OP5 A;  4N1H A;  3C4P A;  4ZJ1 A;  1FR6 A;  4LV3 A;  3P98 A;  2XGN A;  3O88 A;  2ZQ8 A;  4JBF A;  1YLP A;  3DWZ A;  5J8X A;  2HDR A;  4S2O A;  1GCE A;  1M6K A;  1YLT A;  4Y0U A;  4L0L A;  1PW1 A;  1WYC A;  3ZGA B;  1O07 A;  3CJM A;  5M19 A;  1TDL A;  1K25 A;  1K57 A;  3BRM A;  2JCH A;  1I2W A;  3OPH A;  2Y2L A;  4CPK A;  1W5D A;  4YFM A;  4OQI A;  4RYE A;  4WBG A;  4GKU A;  2PU2 A;  1SDN A;  2A3U A;  1E4D A;  4JF4 A;  4OPZ A;  4KG6 A;  3AGF A;  5FSR A;  3OPR A;  3S1Y A;  2XD1 A;  3WS5 A;  2IWD A;  5EUA A;  2ZJ9 A;  2J8Y A;  2WAE A;  1LHY A;  2H0T A;  5E2H A;  1H8Y A;  3HVF A;  3ZNT A;  4K0X A;  4OVD A;  4OQ0 A;  3A3J A;  3HUO A;  3Q7Z A;  5EOE A;  1CI8 A;  4D2O A;  1MPL A;  3ITB A;  5HAR A;  3ZG5 A;  3QHY A;  3JYI A;  1JWZ A;  1K56 A;  3UE1 A;  4P6B A;  2G2U A;  4N92 A;  5FQJ A;  4QHC A;  3MKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...