1NYMA

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (cxb)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition and resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1nymA00
4Y7PA 4ZDXA 2Y2MA 1IEMA 1MPLA 1PIOA 3LY3A 4OQHA 3BEBA 4KG2A 3C4PA 5CHMA 1ONGA 4DF6A 3IXGA 3TG9A 5HARA 3MKEA 1FCNA 3ZNYA 5CERA 1YLWA 2RCXA 4MLLA 4E3OA 3AGDA 1M40A 4GD8A 4D2OA 3I7JA 3IWIA 4IBXA 3N7WA 3ZFZA 2X01A 1K54C 3ZHHA 5BOHA 3N8LA 5FQKA 4OQGA 2H5SA 4S2NA 1YLTA 1E3UA 5FQQA 4EBNA 2ZQAA 5U47A 3A3JA 5EECA 1BLHA 4Y0UA 1MBLA 1WYBA 1XP4A 5FQ9A 5KSCA 3OCLA 3M6HA 4Z9QA 4RX3A 1KGFA 4EWFA 5A92A 1FR6A 4DRTA 3FYZA 1PWDA 1IYSA 4JXVA 1PWGA 3CJMA 4LV1A 4U0XA 4QB8A 1FCMA 3QHYA 5FASA 1U60A 1FSWA 3RXXA 5KMWA 3A3IA 5FATA 3GQZA 5CEDA 4QU3A 5J8XA 1XX2A 2P9VA 4R4SA 2HDSA 4PM6A 2J9PA 5FAOA 1DY6A 1H8YA 3D4FA 4S2NC 3EQUA 2WKIA 2PU2A 4N92A 5CTNA 2WAFA 3HL9A 3NIAA 1CEGA 4KZ5A 2ZC3B 2Y2QA 1KDWA 1BZAA 1PZOA 2V2FF 1Q2QA 1DJCA 4S2IA 2HP6A 2XFTA 3FKWA 1YLZA 4WMCA 2DNSA 4DE2A 2ZC4B 4EBPA 2V1ZA 4OPQA 4QY6A 1ALQA 1K55A 1ZG6A 4XUXA 5CECA 3VSLA 1EI5A 4GNUA 5DTKA 5G18A 5M19A 4Q8IA 1I2WA 1LI0A 3ZG9B 3ZDJA 2XK1A 2H0YA 3PBTA 5E2GA 3SS4A 3UPPA 3CG5A 1MWTA 2OLVA 3OC2A 4OPYA 1HZOA 4OONA 4X56A 4K0XA 5CRFA 5CXWA 3UE0A 3C5AA 4GD6A 4XXRA 1BLSA 3HUOA 5HAIA 4JF4A 4EV4A 3OPHA 4EBLA 3HUNA 2ZC6B 3C7VA 4JXGA 3HREA 4R3BA 5A91A 4DE3A 5HAPA 3IF6C 4WEKA 5FA7A 4RVAA 1C3BA 3GR2A 3GTCA 2EXBA 3G30A 4PM8A 1IYQA 4LCMA 4NK3A 5AQBA 1SDEA 3ZGAB 4N1XA 2EX8A 4KG6A 5EE8A 4N1HA 4CJNA 5GHYA 1K56A 2WGWB 2X71A 5EPHA 3O88A 1ZC2A 1WE4A 2B5RA 2BLSA 3ITBA 4UAAA 4ZBEA 4QJGA 4OOLA 2WGVA 1XA7A 4JKTA 2OSUA 1KVLA 3GRJA 3MZDA 2IWBA 3V3RA 4KZ8A 5GHZA 2XD5A 2XGNA 1CEFA 1PI5A 3NDEA 4YINA 4OQ0A 1NY0A 4B4XA 2H0TA 2I72A 5FDHA 2EFUA 2QZ6A 5EUAA 4P6BA 4XUZA 2Y2KA 4P0MA 3G32A 4PPRA 4R23A 5F1GA 4LV0A 4R3JA 4Y0OA 1LI9A 3BFDA 4S2KA 3SH8A 3MZEA 1PWCA 1S6RA 3M6BA 4KZAA 1NYYA 5CTMA 3WRTA 1I2SA 3VOZA 1VM1A 2OLUA 4ZTKA 3IF5A 3UPNA 5L2FA 1TVFA 1IYPA 3NCKA 4BLMA 1W8YA 5HX9A 3V39A 3HLEA 2FFYA 4HBTA 5M18A 2C5WB 1LL9A 2Y2NA 4WM9A 3TSGA 1GA0A 4FH2A 2IWDA 4KZBA 4DE1A 2ZMAA 5D3OA 1DJAA 1HVBA 3VP1A 1K6SA 1NXYA 1YLYA 3O3VA 5FQIA 4KQRA 1K57C 3N8SA 2C6WB 1FSYA 3N6IA 3OPPA 1H8ZA 2XD1A 3A3DA 3PAGA 3GSGA 4KQQA 3W4PA 4OLDA 3ITAA 2J7VA 3PAEA 1NJ4A 2VGKA 3SS3A 2GDNA 4LENA 2G2UA 3ZVWA 5KSHA 2JCHA 4OP8A 3OZHA 3G2YA 1ERQA 1FQGA 1ESUA 4FCFA 4WMCD 3V5MA 2WAEA 3Q7VB 5E2FA 3VFHA 4S2PA 5DF7A 5AQ9A 3MBZA 2ZM2A 3VP3A 3DW0A 1JTDA 1G68A 5DTTA 3RXWA 3IF6B 3VSKA 1K38A 3MKFA 1S0WA 1HTZA 4K0WA 4BJPA 4OOYA 1FOFA 3BYDA 4S2MA 2QMIA 3PBOA 3N4IA 2WK0A 2WYXA 4OVDA 2EX9A 2ZQCA 4GDNA 4P87A 4ZJ2A 1KE4A 4GKUA 2WZXA 1GHMA 4C75A 1XGJA 5CGWA 1K25A 4FD8A 5GLDA 1SCWA 4X53A 2XEPA 1KE0A 3UDXA 4C6YA 4MBHA 2DRWA 2JC7A 3MZFA 3BM6A 4ZJ3A 3QNCA 5E2HA 3MXSA 3IHAA 1K55C 1O7EA 3HLWA 1YLPA 4JPMA 4S2LA 5GLAA 1RCJA 3WS5A 1Q2PA 1MKIA 4MBKA 1TDLA 5IHVA 3QNBA 1EROA 4CPKA 4E3JA 3C4OA 2VGJA 4B4ZA 3VOYA 5F83A 3UE1A 1NZOA 1W5DA 4S2JA 4WBGA 3HBRA 4OH0A 1YLJA 1I5QA 1PW1A 1YMXA 1HD8A 2H10A 3IQAA 4OQIA 4WEJA 4FH4A 5F1FA 3S4XA 3G4PA 1YQSA 4OPZA 1K4EA 2Y2HA 4ID4A 4WZ4A 3UO9A 4OKPA 3WRZA 1ERMA 4KQOA 3LEZA 4DE0A 2G2WA 4HEFA 1SKFA 1SHVA 2CC1A 2ZD8A 1GA9A 1MXOA 4FSFA 3PBSA 3ZCZA 1XXMA 5JYOA 4BD0A 2Q9MA 4A5RA 3S22A 4BL2A 1MWUA 2EX6A 2WKEA 3JYIA 2PBYA 1GCEA 1QMFA 2Y2OA 1L0FA 1PZPA 2WGWA 4LCLA 4DKIA 3E2KA 2ZC5B 5DVAA 3UDFA 4KZ7A 5M1AA 4QY5A 3IWOA 5FI2A 2EFXA 1BLCA 2Y55A 3Q81A 3OPRA 4IVIA 5DF8A 4DXBA 1BUEA 2Y2JA 4B88A 4U0TA 2Y2IA 1N9BA 3BRMA 4X55A 4IBRA 1PYYA 5TFQA 5EVIA 1GHPA 5GLBA 2HDQA 1IKGA 4E6XA 1ESIA 3Q7VA 4N9KA 4EUZA 3IXBA 5EVID 3VMAA 3BLSA 3NC8A 1XGIA 3UY6A 5A93A 4S2OA 4IVKA 3ZG5A 3C7UA 3IF6A 2R9XA 4HBUA 1KE3A 2EX2A 2JE5A 2P74A 3IHBA 4KG5A 4OOMA 4QD4A 4QHCA 1BSGA 3UPOA 1W8QA 3MXRA 2Z2LB 4RX2A 5GLCA 1XPBA 1IYOA 3DWKA 3NDGA 4WYYA 3VP0A 2FFFB 2XF3A 5FQJA 1O07A 2ZC7A 3SH9A 2X02A 3Q1FA 1JVJA 2A49A 4ZAMA 2EXAA 4E3NA 1YM1A 1DJBA 1NZUA 4JF5A 1K54A 1GHIA 2Y4AA 2ZM8A 3CZDA 5HFOA 3PBQA 3BLMA 1L0GA 1JWZA 4X6TA 4IEDA 4PM7A 3SH7A 4LV3A 5CGXA 3HLFA 4WZ5C 1K56D 2R9WA 4E3LA 4U3TA 4X68A 3B3XA 5CGSA 3WS2A 5CEBA 1L2SA 4DDSA 3IXHA 4K91A 5FQMA 3IT9A 1H5XA 2Y2LA 4JXSA 5JYPA 5GHXA 5F82A 5FSRA 1LLBA 1RGYA 1NRFA 1ONHA 1WYCA 1BTLA 2WADA 3V50A 4YFMA 3W4OA 4MBFA 4GDBA 3FKVA 3DTMA 5HAQA 1IELA 1LHYA 3DWZA 2BG1A 2HDRA 2PU4A 2Y2PA 2Q9NA 2ZQDA 3BFCA 1K57A 1RP5A 1IKIA 3RJUA 1CI9A 3M2KA 4GN2A 3IXDA 4DXCA 4GZBA 5EOEA 1QMEA 5DTSA 1YMSA 2ZQ9A 1ES3A 1TEMA 3PBNA 4M3KA 1KGGA 1ES4A 3N8RA 5AQ7A 4EQIA 5I94A 1MY8A 1MWSA 3V3SA 3TOIA 5FAQA 1PI4A 5KZHA 2Y91A 4H8RA 4RYEA 1N4OA 3FV7A 5CHJA 1ES2A 4KZ6A 2Z2MB 5E43A 3GV9A 2HPBA 4O7DA 3FZCA 1KGEA 3LCEA 2P9VB 2JBFA 4OPRA 1SDNA 1XKZA 1OMEA 4E3KA 3VP2A 3WS0A 3WWXA 1BT5A 3E2LA 5FI7A 1ZKJA 2Y59A 4GOGA 2ZM0A 3UN7A 3HLGA 3IWQA 4PM5A 1AXBA 3P98A 2WZZA 3Q82A 3ZG0A 1CK3A 3ZG8B 4PM9A 4HESA 4P85A 5TR7A 3SOIA 4E6WA 1JWVA 4R4RA 1JTGA 1EWZA 3CMZA 1ZG4A 5EVIB 1KDSA 1NYMA 4KZ3A 1RGZA 2ZLYA 3HVFA 4WELA 3O87A 4MEZA 4BENA 5HW3A 4OLGA 2XDMA 3LO7A 4KENB 3W8KA 3SS5A 4C3QA 4DDYA 3HLDA 5GL9A 4GB7A 3Q7ZA 5AQAA 2IWCA 4R0QA 1YT4A 5EOOA 3BECA 4ZJ1A 2J8YA 3NI9A 2WKHA 4X69A 5HL1A 4PMAA 1ES5A 2WUQA 3A3FA 2XR0A 1Z6FA 2DCFA 2QPNA 3GVBA 5CHUA 1MWRA 3M2JA 4Y0TA 4BD1A 2ZQ8A 3IH8A 3WS1A 1E25A 3BFFA 3ZVTA 1BULA 3FWLA 4WZ5A 5E2EA 3G34A 3EQVA 3NBLA 3UDIA 3WS4A 3VP4A 1W79A 4KZ4A 4NETA 3AGFA 4JF6A 2XQZA 5TGFA 3P09A 2V20A 4OP5A 3NY4A 4RA7A 1G6AA 3GMWA 1W7FA 4BQMA 3G35A 4BL3A 3UNWA 1KVMA 1Y54A 2OV5A 2ZQ7A 2HDUA 3IH9A 2RL3A 2UWXA 1JWPA 1L0DA 3G2ZA 3PBRA 5FI6A 4JBFA 3O86A 4LV2A 3W4QA 1BLPA 1FR1A 1K4FA 1L0EA 5EVIC 4E3MA 1M6KA 2WGIA 1LL5A 3A3EA 3BFEA 3ISGA 3BFGA 4UHUA 1VQQA 1FCOA 5EVLA 3VFFA 3OPLA 2HP5A 5DF9A 3S1YA 3HUMA 1J9MA 3PTEA 2E8IA 2Y2GA 4E3IA 4JXWA 2A3UA 4F94A 1TDGA 1XA1A 4KZ9A 2J9OA 1E4DA 4UA6A 3MFDA 2ZJ9A 3UE3A 3ZNTA 1K6RA 1PW8A 4MNRA 1E3UD 3ZG7B 4R1GA 4UA7A 3AGEA 2XH9A 3Q07A 5A90A 3HLBA 3OCNA 5FAPA 2XLNA 2HP9A 3G31A 4UA9A 3HLCA 4JLFA 3LY4A 2XFSA 4L0LA 4N9LA 1CI8A
chains in the Genus database with same CATH superfamily
4ZDXA 3GECA 5CHMA 1MC0A 2OWHA 3IXGA 5CERA 3KSGA 3K3CA 2NUTC 4GD8A 5BOHA 2JN7A 4OQGA 3A3JA 1BLHA 1J3WA 4Y0UA 2W3FA 4Z9QA 1KGFA 4DRTA 2K31A 2VV7A 3RXXA 1V9YA 3KSFA 3IX3A 2HDSA 2J9PA 1CF0A 1DY6A 1H8YA 4GS9A 4R38A 2WKIA 2PU2A 5A8BA 3QP6A 3B47A 4KZ5A 4I3IA 1F5MA 3A0SA 3TJZC 1Q2QA 2V2FF 4S2IA 2HP6A 1S1YA 2XFTA 1YLZA 4DJ2A 2V1ZA 4QY6A 1K55A 4KQDA 4QWOA 3VSLA 5DTKA 3F1OB 3ZG9B 3ZDJA 3PBTA 3SS4A 4K0XA 3UE0A 1NLZA 3EOIA 4II7A 4JF4A 3NHQA 3FPVA 3HREA 3MJQA 3BW6A 4RVAA 3IBJA 3GR2A 2EXBA 2GZAA 1IYQA 4LCMA 3VE3A 1SDEA 2EWWA 3ZGAB 3D72A 1ACFA 5GHYA 3D9YA 2ZOHA 1ZC2A 4QJGA 2B5RA 2WGVA 2P04A 4JKTA 1CQAA 5GHZA 2QWSA 3K3DA 1UWNX 2Y2KA 1TD5A 3MQOA 4Q0HA 4HI4A 4LV0A 2VZWA 4R3JA 4Y0OA 4S2KA 4X1LA 1TF1A 4MN6A 3MZEA 1PWCA 3M6BA 5CTMA 4KZAA 3WRTA 1SKOB 3VOZA 1VM1A 2OLUA 4ZTKA 3IF5A 3UPNA 4BLMA 5AVEA 5HSQA 3HLEA 5M18A 4I38A 1GA0A 4FH2A 2O9BA 3VP1A 1NXYA 1YLYA 2VGLS 3N8SA 2Z6DA 2C6WB 1FSYA 3OPPA 3E4PA 3PAGA 4KQQA 4OLDA 2VGKA 2V1AA 3SS3A 5HDSA 3ZVWA 1F2KA 4HH2A 3G2YA 1FQGA 2WAEA 3Q7VB 3CLOA 2PBDP 3MBZA 2ZM2A 3VP3A 2B02A 5HDDA 3IF6B 1HTZA 3MR0A 4OOYA 1FOFA 3EEHA 2ZQCA 4GDNA 1GHMA 3IBRA 4I39A 3BM6A 4ETXA 1D1JA 1YLPA 1PRQA 5GLAA 1WA9A 3QNBA 5TBMB 1S67L 3C4OA 4B4ZA 4LFUA 3UE1A 1NZOA 5J7EA 3S7QA 3HBRA 2QYBA 4HHDA 3RFBA 4CLCA 1HD8A 3IQAA 3S4XA 3G4PA 1YQSA 4ID4A 3UO9A 3WRZA 3QP5A 4KQOA 2V1BA 1SHVA 2ZD8A 3E4OA 3PBSA 4BD0A 1OPXA 3PR6A 3S22A 3JYIA 4R6LA 2ZC5B 3UDFA 2YKHA 4KZ7A 4QY5A 2A24A 2Y79A 3LR5A 2Y55A 4IVIA 4IUKA 3OPRA 5KMWA 1BUEA 2LB9A 4U0TA 3C2WA 2DMWA 1PYYA 2VK3A 1W63M 4N9KA 5G4ZA 4BBTA 2ACGA 4Q0IA 4HBUA 4B93A 2JE5A 1NRJA 1YAXA 1IYOA 1SZVA 3NDGA 3VP0A 5FQJA 3SH9A 1S66L 1YM1A 4IUHA 1NZUA 4NEED 5HFOA 3CZDA 4Y15A 1JWZA 4X6TA 4IEDA 4PM7A 5CGXA 2W3EA 1K56D 4X68A 5CGSA 3WS2A 4Q0JA 4K91A 3IX8A 4JXSA 5FSRA 1LLBA 1RGYA 1NRFA 3F1PA 3FKVA 2Q9NA 4CLCB 2O0YA 3ULFA 4FOFA 2V8CA 1QMEA 1ES3A 3PBNA 3LUQA 1OTAA 1MY8A 3V3SA 5EFWA 4XT2A 1PI4A 3FV7A 4KZ6A 2Z2MB 5DFYA 2HPBA 4E3KA 2P9VB 1OMEA 3R4KA 1VETA 1BT5A 3E2LA 4EXOA 2Y59A 4GOGA 3UN7A 4RQ9A 3OLOA 4PM5A 3Q82A 4EEUA 3ZG8B 4HESA 3UB6A 1XJ2A 3LI9A 4G3WA 3PXPA 4KZ3A 3O87A 4OLGA 3W8KA 3SS5A 1SKOA 4C3QA 5GL9A 2IWCA 4GJ4A 1YT4A 3L9KA 4PMAA 1XJ4A 3H82B 1Z6FA 4IJGA 5CHUA 3M2JA 2QJ7A 4BD1A 1AWIA 5EM0A 3LYXA 3FC7A 2Y8HA 3VP4A 3T4JA 1XFQA 3GMWA 1W7FA 2ZL1A 1Y54A 2RL3A 1L0DA 3PBRA 2HJEA 3W4QA 1BLPA 1K4FA 1L0EA 2WGIA 5KIZA 4GCZA 3OPLA 2E8IA 2Y2GA 3NULA 4JXWA 4F94A 1TDGA 4KZ9A 1E4DA 3ZNTA 3F1OA 3L7HA 1PW8A 2W3GA 4MNRA 4UA7A 3V67A 3Q07A 3OCNA 4UA9A 3HLCA 4DMZA 4DN0A 1DP9A 2XFSA 1TS6A 4N9LA 3FG8A 5E2FA 4H6JB 1MPLA 2JKRM 3EGXC 4KG2A 3T4LA 3W2ZA 3MKEA 3RH8B 2RCXA 1A0KA 1M40A 1BYWA 1OT6A 3I7JA 3MQ0A 3IWIA 5AVFA 3DTEA 2X01A 1Y28A 1YLTA 2ZQAA 5U47A 5EECA 5FQ9A 1MBLA 4WL9A 2WKPA 3M6HA 4L9GA 4EWFA 1FR6A 1PWDA 2JKTM 2V8FA 4JXVA 5DJUA 4QB8A 3CI6A 3T4OA 5FASA 3P01A 1FSWA 3O5YA 5FATA 3T4SA 5HWWA 2BTFP 1XX2A 4R4SA 2ZMVA 3CUEA 4EETB 4EEPA 1VETB 4NXBA 3EQUA 1DP6A 2HF6A 4WLAA 1LL8A 2A2LA 2DNSA 2ZC4B 4EBPA 5MC7A 1ALQA 4GNUA 5G18A 5LBRA 1YSPA 4Q8IA 2XK1A 5E2GA 4BWIA 3CG5A 1MWTA 3OC2A 4OONA 1HZOA 3T4KA 5CRFA 2K7SA 3BWLA 3LFVA 3IS2A 3HUOA 4EV4A 3OPHA 3HUNA 2ZC6B 3PYPA 4JXGA 4YNRA 2PRFA 5FA7A 3T12B 1C3BA 3G30A 4NK3A 4N1XA 5EE8A 1K56A 4WN5A 3SZTA 2BLSA 3GRJA 2XD5A 5HDCA 2XGNA 2EA9A 1PI5A 4YINA 3R7WB 3LR0A 2H0TA 2I72A 3LICA 5F5YA 3G32A 4ARZB 2OAP1 1GSXA 3SH8A 1I2SA 1FILA 4I3AA 5L2FA 2WKRA 1W8YA 3V39A 2FFYA 2C5WB 1LL9A 4WM9A 2L0WA 3MF0A 2JKGA 3UB5P 5D3OA 1DJAA 1K6SA 5FQIA 3MFXA 1K57C 2MJ6A 3BY8A 3T1SA 2VV6A 3A3DA 4HNBA 2VJWA 3ITAA 2ZL1B 3P7NA 2G2UA 3F1NA 3OZHA 1T19A 1ERQA 4S2PA 5DF7A 2VKSA 1FIKA 3DW0A 4F3LB 4LGWA 5DTTA 3RXWA 2PDRA 3MKFA 4BJPA 4GHIA 4S2MA 2EX9A 4P87A 1KE4A 4GKUA 4C75A 5GLDA 1SCWA 4X53A 4GLQA 2XEPA 3UDXA 4MBHA 3QP4A 2JC7A 1K0KA 3MXSA 1O7EA 3B42A 4JPMA 1MKIA 4MBKA 1TDLA 1EROA 3K2NA 1W5DA 2PD8A 4S2JA 3DAVA 1S1ZA 1P0ZA 1ERMA 1T1BA 1S4SA 2G2WA 4NKPA 5DJTA 2QHKA 1GA9A 1XXMA 5JYOA 4NG2A 2Q9MA 1OJ5A 4BL2A 1QMFA 2Y2OA 4DJ3A 4HJ3A 2L1MA 3Q81A 5DF8A 2XA7S 5TFQA 4X55A 2J3WA 5GLBA 2HDQA 3IXBA 5EVID 3VMAA 5A93A 1KE3A 4QD4A 2M7UA 3UPOA 1W8QA 2XRNA 3DWKA 3VE4A 2XF3A 2GX5A 2EXAA 2IA2A 1DJBA 2Y4AA 4H6JA 3SH7A 3HLFA 1PFLA 2R9WA 3MQQA 4O01A 4U3TA 1L3LA 3H7WB 4DDSA 3IXHA 1ODVA 5FQMA 3IT9A 2Y2LA 1WYCA 2WADA 4YFMA 4MBFA 5HAQA 3H7WA 3DWZA 2BG1A 2PU4A 1OJGA 1Z09A 2V0WA 3OBFA 3BFCA 1RP5A 3IXDA 4GZBA 1YMSA 4M3KA 1KGGA 1ES4A 3FPWA 3UB9A 1STZA 3DBAA 3TOIA 2Y91A 4H8RA 4RYEA 1ES2A 5E43A 4LLOB 4B9OA 2O9CA 3FZCA 3LCEA 1XKZA 5EVEA 3LIFA 3WS0A 3WWXA 1MZUA 3CITA 3UMDA 5FI7A 3KX0X 2ZM0A 3ZQ5A 2J3TD 3DTIA 3ZG0A 1CK3A 1TS8A 4PM9A 3SOIA 3CMZA 5EVIB 1KDSA 2ZLYA 4MEZA 4CLCC 3LO7A 3LIBA 3HLDA 4GB7A 5AQAA 4KUOA 3S7NA 4MN7A 3NECA 4X69A 1ES5A 3A3FA 2DCFA 3LI8A 4BBVA 4Y0TA 1G6OA 3BQ8A 5DFXA 3IH8A 1E25A 3BFFA 3IS2B 1BULA 3FWLA 3G34A 3GDIA 4R3AA 3A0VA 3WS4A 2W1TA 2VV8A 2M1CA 2XQZA 3P09A 2V20A 3NY4A 4RA7A 3UNWA 2OV5A 2QKPA 2O99A 2W1TB 2PD7A 1JWPA 5FI6A 3G2ZA 4GS9B 4JBFA 3O86A 4Y13A 1FR1A 4E3MA 2JHEA 2QJ5A 5C5KA 1H0MA 3BFEA 3ISGA 3C38A 4K08A 4ESPA 3LIEA 4E3IA 4UA6A 2J9OA 4EU0A 4ARZA 3MFDA 2ZJ9A 4CLCD 2VA0A 1E3UD 4LRZE 3ZG7B 4R1GA 2XH9A 5FAPA 3CWFA 1X0OA 3LY4A 3N7WA 3NOUC 4L0LA 4Y7PA 2Y2MA 4EUVA 3LY3A 3C4PA 1ONGA 5HARA 1FCNA 3ZNYA 4MLLA 4E3OA 3AGDA 2CMNA 2NUPC 2BASA 3ZHHA 1K54C 3N8LA 2PAVP 2H5SA 4S2NA 1E3UA 5FQQA 4ME4A 2UV0E 5J3WA 1WYBA 4NXFA 2W0NA 5AJGA 4RX3A 5G4YA 5I5LA 1IYSA 5FEFA 1PWGA 4LV1A 4P6ZM 4U0XA 1FCMA 3TE8A 1U60A 2W3HA 3A3IA 3GQZA 2PHYA 5HD3A 4QU3A 3ZYTA 5FAOA 4WF0A 4R70A 3D4FA 4S2NC 4N92A 2WAFA 1P97A 3NIAA 1CEGA 2Y2QA 3KYQA 1KDWA 1BZAA 4M4XA 1OTBA 5TJJA 1TS0A 3FKWA 4WMCA 3MXQA 4OPQA 4JGQA 5CECA 3UE6A 5M19A 2J3TC 1I2WA 1LI0A 1F98A 2H0YA 3UPPA 2OLVA 4OPYA 4X56A 5CXWA 3KSIA 3C5AA 4GD6A 4GW9A 2H28A 5HAIA 4EBLA 4PKYA 4R3BA 5HAPA 4NXGA 5L10A 1N9OA 4PM8A 4NXEA 3EEAA 4KG6A 4N1HA 4CJNA 1N9LA 2WGWB 3O88A 4ZBEA 4UAAA 3ITBA 1LT0A 1T1CA 1CJFA 3UMEA 2OSUA 2IWBA 3V3RA 4KZ8A 1CEFA 4OQ0A 1NY0A 5EUAA 4XUZA 2PYPA 4P0MA 4PPRA 4R23A 5F1GA 1YKDA 1LI9A 1NYYA 3TW8A 5L07A 1TVFA 1IYPA 3NCKA 1P9WA 1GSWA 5HX9A 5FL3A 3H82A 2XROA 2VEAA 3TSGA 4DE1A 2ZMAA 1HVBA 5IS1A 3GSGA 3W4PA 1NJ4A 3KSHA 2GDNA 2L4RA 4LENA 4BBUA 2LB5A 2JCHA 4OP8A 1ESUA 4FCFA 4WMCD 3U2AA 3JPUA 1N9NA 5AQ9A 1JTDA 3IX4A 3MMHA 1G68A 3VSKA 4K0WA 1S0WA 3PBOA 3LIDA 3HJIA 3NOTC 4OVDA 2WZXA 4HQAA 1K25A 4FD8A 4C6YA 2E8JA 3MZFA 3QNCA 2KOIA 5E2HA 3HLWA 4S2LA 1RCJA 1Q2PA 2JKFA 4CPKA 4E3JA 2K2NA 2GJ3A 2VGJA 4WBGA 4OH0A 4QPRA 4O8GA 1I5QA 3ICYA 2H10A 3CHWP 4UQIM 1GSVA 4OPZA 1K4EA 1VHMA 3SW1A 4OKPA 4DE0A 4HJ4A 4HEFA 1F9IA 2OOLA 2CC1A 3BY9A 5HL6A 4FSFA 4HP9A 4P6ZS 4A5RA 3EGDC 4FUWA 1MWUA 2EX6A 2PBYA 1GCEA 4YOFA 4LCLA 4DKIA 3E2KA 5DVAA 3T1QB 4ZRRA 3KYZA 3IWOA 1BLCA 4Y3IA 4DXBA 2Y2JA 3R7WA 1N9BA 4IBRA 5EV0A 5EVIA 1GHPA 4WUJA 5DKLA 3NC8A 1XGIA 2B18A 4S2OA 4IVKA 3ZG5A 3C7UA 4KG5A 2R9XA 2EX2A 3IHBA 2P74A 4QHCA 4Y17A 4RX2A 2Z2LB 1XPBA 5HPFA 2Q0OA 2FFFB 5J4EA 4YWZA 2ZC7A 2X02A 3Q1FA 1JVJA 4HIAA 4E3NA 1GHIA 3MSHA 3BLMA 1L0GA 1V9ZA 1IFQA 3B3XA 1TS7A 3CUEC 1DP8A 1H5XA 1G28A 5TBMA 1BTLA 3W4OA 4GDBA 3DTMA 1IELA 1LHYA 2HDRA 4PHTA 3D3OA 1P9RA 2ZQDA 3LR3A 1CI9A 2ZBBA 5DTSA 1TEMA 2KLIA 4EQIA 5KZHA 1N4OA 4PAUA 5DKKA 5CHJA 3KO6A 2OAQ1 1KGEA 2JBFA 1SDNA 4XT2B 1ZTUA 3HLGA 3IWQA 1AXBA 3P98A 4UQIS 3VOLA 4P85A 1JWVA 2VLGA 1JTGA 2VGLM 1NYMA 1RGZA 5HW3A 2M7VA 2PR6A 2XDMA 4KENB 5EOOA 3BECA 4L9EA 3NI9A 4E04A 2WKHA 2WUQA 3G6OA 1MWRA 5IU1A 3E0YA 3EQVA 1HLUP 3UDIA 4HH3A 1W79A 4KZ4A 3AGFA 4JF6A 4OP5A 3QP2A 1KVMA 1VEUB 2HDUA 4LV2A 1LL5A 4UHUA 1JNUA 5EVLA 5HWVA 3S1YA 3HUMA 3PTEA 2V9AA 3B33A 2A3UA 2PR5A 1XA1A 4Y2FA 3UE3A 1K6RA 1KOUA 5F6AA 1NLYA 2ZOIA 2EWVA 5FEGA 2XLNA 2HP9A 2FH5A 4JLFA 1DRMA 1CI8A 1IEMA 3S7PA 1PIOA 4OQHA 3BEBA 4DF6A 3TG9A 1YLWA 3E4QA 2KDKA 4D2OA 4IBXA 3ZFZA 4G3VA 5FQKA 4UEYA 3PHYA 5F69A 4EBNA 1XFNA 2HZ5A 1XJ3A 1XP4A 5KSCA 3OCLA 2A24B 4KUKA 5A92A 1W63Q 5HPIA 3FYZA 2YKFA 1LSXA 3CJMA 4X1MA 3QHYA 3QP1A 4JGOA 4MMNA 2P7JA 5CEDA 5J8XA 2P9VA 5HZHA 4PM6A 3BJNA 1YPRA 2XA7M 5CTNA 3HL9A 2ZC3B 2OWJA 1OT9A 1PZOA 1DJCA 4ETZA 3KYEA 2HV1A 1XJ6A 4DE2A 5CX7A 1ZG6A 3EWKA 5HWTA 3OOVA 4XUXA 1EI5A 2FZ0A 5L8MA 3F1PB 4HJ6A 1MKMA 4XXRA 4Y5FA 1BLSA 4DE3A 3C7VA 5A91A 2D01A 4HP4A 3T50A 3IF6C 4WEKA 5EM1A 3GTCA 5AQBA 2EX8A 1PNEA 2X71A 5EPHA 1WE4A 4OOLA 1UWPX 4LRYC 2W3DA 1XA7A 1KVLA 3MZDA 3MS6A 3NDEA 3JVUA 4B4XA 5FDHA 2EFUA 5F68A 2QZ6A 2O9AA 4P6BA 4L9FA 1H8MA 3BFDA 2W1RA 1S6RA 5L09A 3BQAA 4HY8A 3C8CA 2W27A 1YSQA 3S7OA 4Z1WA 4HBTA 2Y2NA 2IWDA 4KZBA 1LSWA 2HGVA 3O3VA 3E98A 4KQRA 3HJKA 1LSVA 3N6IA 1H8ZA 2XD1A 4EQ1A 3PAEA 2J7VA 4EERA 2AVXA 4PKYG 5KSHA 4CLCE 1D06A 2PT7A 2JKRI 3V5MA 3VFHA 3UB8A 4I3JA 3F1NB 3HCYA 1K38A 3BYDA 2QMIA 3H9WA 3N4IA 2WK0A 2WYXA 3VV4A 4AFIA 4ZJ2A 4MDZA 1XGJA 5CGWA 1KE0A 2DRWA 4ZJ3A 4LRXC 3IHAA 1K55C 3LR4A 3LEQA 3NOPC 3WS5A 5IHVA 2I9VA 3VOYA 5F83A 5IT5A 4O0PA 1YLJA 1PW1A 1YMXA 4OQIA 4WEJA 4FH4A 5F1FA 4MCWA 1H3QA 1UGUA 2Y2HA 4WZ4A 3LEZA 3CPTA 1SKFA 3A0RA 3NJAA 1MXOA 3ZCZA 2WKEA 4CQHA 2G7UA 1L0FA 1PZPA 2WGWA 4EW7A 3T1RA 5M1AA 5HD5A 1ZHHB 5FI2A 2EFXA 1EW0A 4B88A 2HJ9C 2Y2IA 3BRMA 1IKGA 4E6XA 1ESIA 3Q7VA 4EUZA 3T4TA 2JKTI 2ZMFA 3BLSA 3UY6A 2P08A 3IF6A 1S4RA 4OOMA 4GHIB 1BSGA 5GLCA 3MXRA 4HOIA 4WYYA 2J80A 4X25A 1O07A 4ZAMA 2A49A 4JF5A 1K54A 2ZM8A 1VB6A 3PBQA 4LV3A 4LPZA 4WZ5C 4E3LA 4JGPA 5CEBA 1L2SA 3JVVA 5JYPA 5GHXA 5F82A 1ONHA 3V50A 1OTDA 1G5UA 1Y4OA 3LIAA 5K5BA 2Y2PA 2GNXA 2D02A 1K57A 4IHQA 1IKIA 3RJUA 3M2KA 4GN2A 4DXCA 5EOEA 4G3KA 2ZQ9A 4JGRA 3N8RA 5AQ7A 5I94A 1MWSA 3CPTB 5FAQA 1NWZA 3GV9A 1T18A 4OPRA 4O7DA 3VP2A 4D60A 1ZKJA 3RTYA 2WZZA 5TR7A 4E6WA 1T1AA 4R4RA 1D7EA 2PYRA 2R78A 3C30A 4I5SA 1EWZA 4FTXA 1ZG4A 3LGOA 3HVFA 4WELA 4BENA 2INWA 4DDYA 3CAXA 3Q7ZA 3QP8A 4R0QA 4ZJ1A 2J8YA 5HL1A 2XR0A 3T4QA 4MN5A 2QPNA 3GVBA 2ZQ8A 3WS1A 3ZVTA 2V0UA 4WZ5A 5E2EA 3NBLA 1VEUA 3U4LP 2B95A 4NETA 5TGFA 1G6AA 4BQMA 4F3LA 3G35A 4BL3A 2ZQ7A 3IH9A 2UWXA 1OTEA 5EVIC 1M6KA 3TRCA 2VX8A 3A3EA 3BFGA 5FDSA 1VQQA 2WKQA 3UB7A 1FCOA 3VFFA 2HP5A 5DF9A 1J9MA 2XSSA 4BMWA 2Z6CA 1IOUA 3T1XA 3AGEA 5A90A 3DTKA 3HLBA 3G31A 1OTIA 2KX6A 4EESA
chains in the Genus database with same CATH topology
4Y7PA 4ZDXA 2Y2MA 1IEMA 1MPLA 1PIOA 3LY3A 4OQHA 3BEBA 4KG2A 3C4PA 5CHMA 1ONGA 4DF6A 3IXGA 3TG9A 5HARA 3MKEA 1FCNA 3ZNYA 5CERA 1YLWA 2RCXA 4MLLA 4E3OA 3AGDA 1M40A 4GD8A 4D2OA 3I7JA 3IWIA 4IBXA 3N7WA 3ZFZA 2X01A 1K54C 3ZHHA 5BOHA 3N8LA 5FQKA 4OQGA 2H5SA 4S2NA 1YLTA 1E3UA 5FQQA 4EBNA 2ZQAA 5U47A 3A3JA 5EECA 1BLHA 4Y0UA 1MBLA 1WYBA 1XP4A 5FQ9A 5KSCA 3OCLA 3M6HA 4Z9QA 4RX3A 1KGFA 4EWFA 5A92A 1FR6A 4DRTA 3FYZA 1PWDA 1IYSA 4JXVA 1PWGA 3CJMA 4LV1A 4U0XA 4QB8A 1FCMA 3QHYA 5FASA 1U60A 1FSWA 3RXXA 5KMWA 3A3IA 5FATA 3GQZA 5CEDA 4QU3A 5J8XA 1XX2A 2P9VA 4R4SA 2HDSA 4PM6A 2J9PA 5FAOA 1DY6A 1H8YA 3D4FA 4S2NC 3EQUA 2WKIA 2PU2A 4N92A 5CTNA 2WAFA 3HL9A 3NIAA 1CEGA 4KZ5A 2ZC3B 2Y2QA 1KDWA 1BZAA 1PZOA 2V2FF 1Q2QA 1DJCA 4S2IA 2HP6A 2XFTA 3FKWA 1YLZA 4WMCA 2DNSA 4DE2A 2ZC4B 4EBPA 2V1ZA 4OPQA 4QY6A 1ALQA 1K55A 1ZG6A 4XUXA 5CECA 3VSLA 1EI5A 4GNUA 5DTKA 5G18A 5M19A 4Q8IA 1I2WA 1LI0A 3ZG9B 3ZDJA 2XK1A 2H0YA 3PBTA 5E2GA 3SS4A 3UPPA 3CG5A 1MWTA 2OLVA 3OC2A 4OPYA 1HZOA 4OONA 4X56A 4K0XA 5CRFA 5CXWA 3UE0A 3C5AA 4GD6A 4XXRA 1BLSA 3HUOA 5HAIA 4JF4A 4EV4A 3OPHA 4EBLA 3HUNA 2ZC6B 3C7VA 4JXGA 3HREA 4R3BA 5A91A 4DE3A 5HAPA 3IF6C 4WEKA 5FA7A 4RVAA 1C3BA 3GR2A 3GTCA 2EXBA 3G30A 4PM8A 1IYQA 4LCMA 4NK3A 5AQBA 1SDEA 3ZGAB 4N1XA 2EX8A 4KG6A 5EE8A 4N1HA 4CJNA 5GHYA 1K56A 2WGWB 2X71A 5EPHA 3O88A 1ZC2A 1WE4A 2B5RA 2BLSA 3ITBA 4UAAA 4ZBEA 4QJGA 4OOLA 2WGVA 1XA7A 4JKTA 2OSUA 1KVLA 3GRJA 3MZDA 2IWBA 3V3RA 4KZ8A 5GHZA 2XD5A 2XGNA 1CEFA 1PI5A 3NDEA 4YINA 4OQ0A 1NY0A 4B4XA 2H0TA 2I72A 5FDHA 2EFUA 2QZ6A 5EUAA 4P6BA 4XUZA 2Y2KA 4P0MA 3G32A 4PPRA 4R23A 5F1GA 4LV0A 4R3JA 4Y0OA 1LI9A 3BFDA 4S2KA 3SH8A 3MZEA 1PWCA 1S6RA 3M6BA 4KZAA 1NYYA 5CTMA 3WRTA 1I2SA 3VOZA 1VM1A 2OLUA 4ZTKA 3IF5A 3UPNA 5L2FA 1TVFA 1IYPA 3NCKA 4BLMA 1W8YA 5HX9A 3V39A 3HLEA 2FFYA 4HBTA 5M18A 2C5WB 1LL9A 2Y2NA 4WM9A 3TSGA 1GA0A 4FH2A 2IWDA 4KZBA 4DE1A 2ZMAA 5D3OA 1DJAA 1HVBA 3VP1A 1K6SA 1NXYA 1YLYA 3O3VA 5FQIA 4KQRA 1K57C 3N8SA 2C6WB 1FSYA 3N6IA 3OPPA 1H8ZA 2XD1A 3A3DA 3PAGA 3GSGA 4KQQA 3W4PA 4OLDA 3ITAA 2J7VA 3PAEA 1NJ4A 2VGKA 3SS3A 2GDNA 4LENA 2G2UA 3ZVWA 5KSHA 2JCHA 4OP8A 3OZHA 3G2YA 1ERQA 1FQGA 1ESUA 4FCFA 4WMCD 3V5MA 2WAEA 3Q7VB 5E2FA 3VFHA 4S2PA 5DF7A 5AQ9A 3MBZA 2ZM2A 3VP3A 3DW0A 1JTDA 1G68A 5DTTA 3RXWA 3IF6B 3VSKA 1K38A 3MKFA 1S0WA 1HTZA 4K0WA 4BJPA 4OOYA 1FOFA 3BYDA 4S2MA 2QMIA 3PBOA 3N4IA 2WK0A 2WYXA 4OVDA 2EX9A 2ZQCA 4GDNA 4P87A 4ZJ2A 1KE4A 4GKUA 2WZXA 1GHMA 4C75A 1XGJA 5CGWA 1K25A 4FD8A 5GLDA 1SCWA 4X53A 2XEPA 1KE0A 3UDXA 4C6YA 4MBHA 2DRWA 2JC7A 3MZFA 3BM6A 4ZJ3A 3QNCA 5E2HA 3MXSA 3IHAA 1K55C 1O7EA 3HLWA 1YLPA 4JPMA 4S2LA 5GLAA 1RCJA 3WS5A 1Q2PA 1MKIA 4MBKA 1TDLA 5IHVA 3QNBA 1EROA 4CPKA 4E3JA 3C4OA 2VGJA 4B4ZA 3VOYA 5F83A 3UE1A 1NZOA 1W5DA 4S2JA 4WBGA 3HBRA 4OH0A 1YLJA 1I5QA 1PW1A 1YMXA 1HD8A 2H10A 3IQAA 4OQIA 4WEJA 4FH4A 5F1FA 3S4XA 3G4PA 1YQSA 4OPZA 1K4EA 2Y2HA 4ID4A 4WZ4A 3UO9A 4OKPA 3WRZA 1ERMA 4KQOA 3LEZA 4DE0A 2G2WA 4HEFA 1SKFA 1SHVA 2CC1A 2ZD8A 1GA9A 1MXOA 4FSFA 3PBSA 3ZCZA 1XXMA 5JYOA 4BD0A 2Q9MA 4A5RA 3S22A 4BL2A 1MWUA 2EX6A 2WKEA 3JYIA 2PBYA 1GCEA 1QMFA 2Y2OA 1L0FA 1PZPA 2WGWA 4LCLA 4DKIA 3E2KA 2ZC5B 5DVAA 3UDFA 4KZ7A 5M1AA 4QY5A 3IWOA 5FI2A 2EFXA 1BLCA 2Y55A 3Q81A 3OPRA 4IVIA 5DF8A 4DXBA 1BUEA 2Y2JA 4B88A 4U0TA 2Y2IA 1N9BA 3BRMA 4X55A 4IBRA 1PYYA 5TFQA 5EVIA 1GHPA 5GLBA 2HDQA 1IKGA 4E6XA 1ESIA 3Q7VA 4N9KA 4EUZA 3IXBA 5EVID 3VMAA 3BLSA 3NC8A 1XGIA 3UY6A 5A93A 4S2OA 4IVKA 3ZG5A 3C7UA 3IF6A 2R9XA 4HBUA 1KE3A 2EX2A 2JE5A 2P74A 3IHBA 4KG5A 4OOMA 4QD4A 4QHCA 1BSGA 3UPOA 1W8QA 3MXRA 2Z2LB 4RX2A 5GLCA 1XPBA 1IYOA 3DWKA 3NDGA 4WYYA 3VP0A 2FFFB 2XF3A 5FQJA 1O07A 2ZC7A 3SH9A 2X02A 3Q1FA 1JVJA 2A49A 4ZAMA 2EXAA 4E3NA 1YM1A 1DJBA 1NZUA 4JF5A 1K54A 1GHIA 2Y4AA 2ZM8A 3CZDA 5HFOA 3PBQA 3BLMA 1L0GA 1JWZA 4X6TA 4IEDA 4PM7A 3SH7A 4LV3A 5CGXA 3HLFA 4WZ5C 1K56D 2R9WA 4E3LA 4U3TA 4X68A 3B3XA 5CGSA 3WS2A 5CEBA 1L2SA 4DDSA 3IXHA 4K91A 5FQMA 3IT9A 1H5XA 2Y2LA 4JXSA 5JYPA 5GHXA 5F82A 5FSRA 1LLBA 1RGYA 1NRFA 1ONHA 1WYCA 1BTLA 2WADA 3V50A 4YFMA 3W4OA 4MBFA 4GDBA 3FKVA 3DTMA 5HAQA 1IELA 1LHYA 3DWZA 2BG1A 2HDRA 2PU4A 2Y2PA 2Q9NA 2ZQDA 3BFCA 1K57A 1RP5A 1IKIA 3RJUA 1CI9A 3M2KA 4GN2A 3IXDA 4DXCA 4GZBA 5EOEA 1QMEA 5DTSA 1YMSA 2ZQ9A 1ES3A 1TEMA 3PBNA 4M3KA 1KGGA 1ES4A 3N8RA 5AQ7A 4EQIA 5I94A 1MY8A 1MWSA 3V3SA 3TOIA 5FAQA 1PI4A 5KZHA 2Y91A 4H8RA 4RYEA 1N4OA 3FV7A 5CHJA 1ES2A 4KZ6A 2Z2MB 5E43A 3GV9A 2HPBA 4O7DA 3FZCA 1KGEA 3LCEA 2P9VB 2JBFA 4OPRA 1SDNA 1XKZA 1OMEA 4E3KA 3VP2A 3WS0A 3WWXA 1BT5A 3E2LA 5FI7A 1ZKJA 2Y59A 4GOGA 2ZM0A 3UN7A 3HLGA 3IWQA 4PM5A 1AXBA 3P98A 2WZZA 3Q82A 3ZG0A 1CK3A 3ZG8B 4PM9A 4HESA 4P85A 5TR7A 3SOIA 4E6WA 1JWVA 4R4RA 1JTGA 1EWZA 3CMZA 1ZG4A 5EVIB 1KDSA 1NYMA 4KZ3A 1RGZA 2ZLYA 3HVFA 4WELA 3O87A 4MEZA 4BENA 5HW3A 4OLGA 2XDMA 3LO7A 4KENB 3W8KA 3SS5A 4C3QA 4DDYA 3HLDA 5GL9A 4GB7A 3Q7ZA 5AQAA 2IWCA 4R0QA 1YT4A 5EOOA 3BECA 4ZJ1A 2J8YA 3NI9A 2WKHA 4X69A 5HL1A 4PMAA 1ES5A 2WUQA 3A3FA 2XR0A 1Z6FA 2DCFA 2QPNA 3GVBA 5CHUA 1MWRA 3M2JA 4Y0TA 4BD1A 2ZQ8A 3IH8A 3WS1A 1E25A 3BFFA 3ZVTA 1BULA 3FWLA 4WZ5A 5E2EA 3G34A 3EQVA 3NBLA 3UDIA 3WS4A 3VP4A 1W79A 4KZ4A 4NETA 3AGFA 4JF6A 2XQZA 5TGFA 3P09A 2V20A 4OP5A 3NY4A 4RA7A 1G6AA 3GMWA 1W7FA 4BQMA 3G35A 4BL3A 3UNWA 1KVMA 1Y54A 2OV5A 2ZQ7A 2HDUA 3IH9A 2RL3A 2UWXA 1JWPA 1L0DA 3G2ZA 3PBRA 5FI6A 4JBFA 3O86A 4LV2A 3W4QA 1BLPA 1FR1A 1K4FA 1L0EA 5EVIC 4E3MA 1M6KA 2WGIA 1LL5A 3A3EA 3BFEA 3ISGA 3BFGA 4UHUA 1VQQA 1FCOA 5EVLA 3VFFA 3OPLA 2HP5A 5DF9A 3S1YA 3HUMA 1J9MA 3PTEA 2E8IA 2Y2GA 4E3IA 4JXWA 2A3UA 4F94A 1TDGA 1XA1A 4KZ9A 2J9OA 1E4DA 4UA6A 3MFDA 2ZJ9A 3UE3A 3ZNTA 1K6RA 1PW8A 4MNRA 1E3UD 3ZG7B 4R1GA 4UA7A 3AGEA 2XH9A 3Q07A 5A90A 3HLBA 3OCNA 5FAPA 2XLNA 2HP9A 3G31A 4UA9A 3HLCA 4JLFA 3LY4A 2XFSA 4L0LA 4N9LA 1CI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7P A;  4ZDX A;  2Y2M A;  1IEM A;  1MPL A;  1PIO A;  3LY3 A;  4OQH A;  3BEB A;  4KG2 A;  3C4P A;  5CHM A;  1ONG A;  4DF6 A;  3IXG A;  3TG9 A;  5HAR A;  3MKE A;  1FCN A;  3ZNY A;  5CER A;  1YLW A;  2RCX A;  4MLL A;  4E3O A;  3AGD A;  1M40 A;  4GD8 A;  4D2O A;  3I7J A;  3IWI A;  4IBX A;  3N7W A;  3ZFZ A;  2X01 A;  1K54 C;  3ZHH A;  5BOH A;  3N8L A;  5FQK A;  4OQG A;  2H5S A;  4S2N A;  1YLT A;  1E3U A;  5FQQ A;  4EBN A;  2ZQA A;  5U47 A;  3A3J A;  5EEC A;  1BLH A;  4Y0U A;  1MBL A;  1WYB A;  1XP4 A;  5FQ9 A;  5KSC A;  3OCL A;  3M6H A;  4Z9Q A;  4RX3 A;  1KGF A;  4EWF A;  5A92 A;  1FR6 A;  4DRT A;  3FYZ A;  1PWD A;  1IYS A;  4JXV A;  1PWG A;  3CJM A;  4LV1 A;  4U0X A;  4QB8 A;  1FCM A;  3QHY A;  5FAS A;  1U60 A;  1FSW A;  3RXX A;  5KMW A;  3A3I A;  5FAT A;  3GQZ A;  5CED A;  4QU3 A;  5J8X A;  1XX2 A;  2P9V A;  4R4S A;  2HDS A;  4PM6 A;  2J9P A;  5FAO A;  1DY6 A;  1H8Y A;  3D4F A;  4S2N C;  3EQU A;  2WKI A;  2PU2 A;  4N92 A;  5CTN A;  2WAF A;  3HL9 A;  3NIA A;  1CEG A;  4KZ5 A;  2ZC3 B;  2Y2Q A;  1KDW A;  1BZA A;  1PZO A;  2V2F F;  1Q2Q A;  1DJC A;  4S2I A;  2HP6 A;  2XFT A;  3FKW A;  1YLZ A;  4WMC A;  2DNS A;  4DE2 A;  2ZC4 B;  4EBP A;  2V1Z A;  4OPQ A;  4QY6 A;  1ALQ A;  1K55 A;  1ZG6 A;  4XUX A;  5CEC A;  3VSL A;  1EI5 A;  4GNU A;  5DTK A;  5G18 A;  5M19 A;  4Q8I A;  1I2W A;  1LI0 A;  3ZG9 B;  3ZDJ A;  2XK1 A;  2H0Y A;  3PBT A;  5E2G A;  3SS4 A;  3UPP A;  3CG5 A;  1MWT A;  2OLV A;  3OC2 A;  4OPY A;  1HZO A;  4OON A;  4X56 A;  4K0X A;  5CRF A;  5CXW A;  3UE0 A;  3C5A A;  4GD6 A;  4XXR A;  1BLS A;  3HUO A;  5HAI A;  4JF4 A;  4EV4 A;  3OPH A;  4EBL A;  3HUN A;  2ZC6 B;  3C7V A;  4JXG A;  3HRE A;  4R3B A;  5A91 A;  4DE3 A;  5HAP A;  3IF6 C;  4WEK A;  5FA7 A;  4RVA A;  1C3B A;  3GR2 A;  3GTC A;  2EXB A;  3G30 A;  4PM8 A;  1IYQ A;  4LCM A;  4NK3 A;  5AQB A;  1SDE A;  3ZGA B;  4N1X A;  2EX8 A;  4KG6 A;  5EE8 A;  4N1H A;  4CJN A;  5GHY A;  1K56 A;  2WGW B;  2X71 A;  5EPH A;  3O88 A;  1ZC2 A;  1WE4 A;  2B5R A;  2BLS A;  3ITB A;  4UAA A;  4ZBE A;  4QJG A;  4OOL A;  2WGV A;  1XA7 A;  4JKT A;  2OSU A;  1KVL A;  3GRJ A;  3MZD A;  2IWB A;  3V3R A;  4KZ8 A;  5GHZ A;  2XD5 A;  2XGN A;  1CEF A;  1PI5 A;  3NDE A;  4YIN A;  4OQ0 A;  1NY0 A;  4B4X A;  2H0T A;  2I72 A;  5FDH A;  2EFU A;  2QZ6 A;  5EUA A;  4P6B A;  4XUZ A;  2Y2K A;  4P0M A;  3G32 A;  4PPR A;  4R23 A;  5F1G A;  4LV0 A;  4R3J A;  4Y0O A;  1LI9 A;  3BFD A;  4S2K A;  3SH8 A;  3MZE A;  1PWC A;  1S6R A;  3M6B A;  4KZA A;  1NYY A;  5CTM A;  3WRT A;  1I2S A;  3VOZ A;  1VM1 A;  2OLU A;  4ZTK A;  3IF5 A;  3UPN A;  5L2F A;  1TVF A;  1IYP A;  3NCK A;  4BLM A;  1W8Y A;  5HX9 A;  3V39 A;  3HLE A;  2FFY A;  4HBT A;  5M18 A;  2C5W B;  1LL9 A;  2Y2N A;  4WM9 A;  3TSG A;  1GA0 A;  4FH2 A;  2IWD A;  4KZB A;  4DE1 A;  2ZMA A;  5D3O A;  1DJA A;  1HVB A;  3VP1 A;  1K6S A;  1NXY A;  1YLY A;  3O3V A;  5FQI A;  4KQR A;  1K57 C;  3N8S A;  2C6W B;  1FSY A;  3N6I A;  3OPP A;  1H8Z A;  2XD1 A;  3A3D A;  3PAG A;  3GSG A;  4KQQ A;  3W4P A;  4OLD A;  3ITA A;  2J7V A;  3PAE A;  1NJ4 A;  2VGK A;  3SS3 A;  2GDN A;  4LEN A;  2G2U A;  3ZVW A;  5KSH A;  2JCH A;  4OP8 A;  3OZH A;  3G2Y A;  1ERQ A;  1FQG A;  1ESU A;  4FCF A;  4WMC D;  3V5M A;  2WAE A;  3Q7V B;  5E2F A;  3VFH A;  4S2P A;  5DF7 A;  5AQ9 A;  3MBZ A;  2ZM2 A;  3VP3 A;  3DW0 A;  1JTD A;  1G68 A;  5DTT A;  3RXW A;  3IF6 B;  3VSK A;  1K38 A;  3MKF A;  1S0W A;  1HTZ A;  4K0W A;  4BJP A;  4OOY A;  1FOF A;  3BYD A;  4S2M A;  2QMI A;  3PBO A;  3N4I A;  2WK0 A;  2WYX A;  4OVD A;  2EX9 A;  2ZQC A;  4GDN A;  4P87 A;  4ZJ2 A;  1KE4 A;  4GKU A;  2WZX A;  1GHM A;  4C75 A;  1XGJ A;  5CGW A;  1K25 A;  4FD8 A;  5GLD A;  1SCW A;  4X53 A;  2XEP A;  1KE0 A;  3UDX A;  4C6Y A;  4MBH A;  2DRW A;  2JC7 A;  3MZF A;  3BM6 A;  4ZJ3 A;  3QNC A;  5E2H A;  3MXS A;  3IHA A;  1K55 C;  1O7E A;  3HLW A;  1YLP A;  4JPM A;  4S2L A;  5GLA A;  1RCJ A;  3WS5 A;  1Q2P A;  1MKI A;  4MBK A;  1TDL A;  5IHV A;  3QNB A;  1ERO A;  4CPK A;  4E3J A;  3C4O A;  2VGJ A;  4B4Z A;  3VOY A;  5F83 A;  3UE1 A;  1NZO A;  1W5D A;  4S2J A;  4WBG A;  3HBR A;  4OH0 A;  1YLJ A;  1I5Q A;  1PW1 A;  1YMX A;  1HD8 A;  2H10 A;  3IQA A;  4OQI A;  4WEJ A;  4FH4 A;  5F1F A;  3S4X A;  3G4P A;  1YQS A;  4OPZ A;  1K4E A;  2Y2H A;  4ID4 A;  4WZ4 A;  3UO9 A;  4OKP A;  3WRZ A;  1ERM A;  4KQO A;  3LEZ A;  4DE0 A;  2G2W A;  4HEF A;  1SKF A;  1SHV A;  2CC1 A;  2ZD8 A;  1GA9 A;  1MXO A;  4FSF A;  3PBS A;  3ZCZ A;  1XXM A;  5JYO A;  4BD0 A;  2Q9M A;  4A5R A;  3S22 A;  4BL2 A;  1MWU A;  2EX6 A;  2WKE A;  3JYI A;  2PBY A;  1GCE A;  1QMF A;  2Y2O A;  1L0F A;  1PZP A;  2WGW A;  4LCL A;  4DKI A;  3E2K A;  2ZC5 B;  5DVA A;  3UDF A;  4KZ7 A;  5M1A A;  4QY5 A;  3IWO A;  5FI2 A;  2EFX A;  1BLC A;  2Y55 A;  3Q81 A;  3OPR A;  4IVI A;  5DF8 A;  4DXB A;  1BUE A;  2Y2J A;  4B88 A;  4U0T A;  2Y2I A;  1N9B A;  3BRM A;  4X55 A;  4IBR A;  1PYY A;  5TFQ A;  5EVI A;  1GHP A;  5GLB A;  2HDQ A;  1IKG A;  4E6X A;  1ESI A;  3Q7V A;  4N9K A;  4EUZ A;  3IXB A;  5EVI D;  3VMA A;  3BLS A;  3NC8 A;  1XGI A;  3UY6 A;  5A93 A;  4S2O A;  4IVK A;  3ZG5 A;  3C7U A;  3IF6 A;  2R9X A;  4HBU A;  1KE3 A;  2EX2 A;  2JE5 A;  2P74 A;  3IHB A;  4KG5 A;  4OOM A;  4QD4 A;  4QHC A;  1BSG A;  3UPO A;  1W8Q A;  3MXR A;  2Z2L B;  4RX2 A;  5GLC A;  1XPB A;  1IYO A;  3DWK A;  3NDG A;  4WYY A;  3VP0 A;  2FFF B;  2XF3 A;  5FQJ A;  1O07 A;  2ZC7 A;  3SH9 A;  2X02 A;  3Q1F A;  1JVJ A;  2A49 A;  4ZAM A;  2EXA A;  4E3N A;  1YM1 A;  1DJB A;  1NZU A;  4JF5 A;  1K54 A;  1GHI A;  2Y4A A;  2ZM8 A;  3CZD A;  5HFO A;  3PBQ A;  3BLM A;  1L0G A;  1JWZ A;  4X6T A;  4IED A;  4PM7 A;  3SH7 A;  4LV3 A;  5CGX A;  3HLF A;  4WZ5 C;  1K56 D;  2R9W A;  4E3L A;  4U3T A;  4X68 A;  3B3X A;  5CGS A;  3WS2 A;  5CEB A;  1L2S A;  4DDS A;  3IXH A;  4K91 A;  5FQM A;  3IT9 A;  1H5X A;  2Y2L A;  4JXS A;  5JYP A;  5GHX A;  5F82 A;  5FSR A;  1LLB A;  1RGY A;  1NRF A;  1ONH A;  1WYC A;  1BTL A;  2WAD A;  3V50 A;  4YFM A;  3W4O A;  4MBF A;  4GDB A;  3FKV A;  3DTM A;  5HAQ A;  1IEL A;  1LHY A;  3DWZ A;  2BG1 A;  2HDR A;  2PU4 A;  2Y2P A;  2Q9N A;  2ZQD A;  3BFC A;  1K57 A;  1RP5 A;  1IKI A;  3RJU A;  1CI9 A;  3M2K A;  4GN2 A;  3IXD A;  4DXC A;  4GZB A;  5EOE A;  1QME A;  5DTS A;  1YMS A;  2ZQ9 A;  1ES3 A;  1TEM A;  3PBN A;  4M3K A;  1KGG A;  1ES4 A;  3N8R A;  5AQ7 A;  4EQI A;  5I94 A;  1MY8 A;  1MWS A;  3V3S A;  3TOI A;  5FAQ A;  1PI4 A;  5KZH A;  2Y91 A;  4H8R A;  4RYE A;  1N4O A;  3FV7 A;  5CHJ A;  1ES2 A;  4KZ6 A;  2Z2M B;  5E43 A;  3GV9 A;  2HPB A;  4O7D A;  3FZC A;  1KGE A;  3LCE A;  2P9V B;  2JBF A;  4OPR A;  1SDN A;  1XKZ A;  1OME A;  4E3K A;  3VP2 A;  3WS0 A;  3WWX A;  1BT5 A;  3E2L A;  5FI7 A;  1ZKJ A;  2Y59 A;  4GOG A;  2ZM0 A;  3UN7 A;  3HLG A;  3IWQ A;  4PM5 A;  1AXB A;  3P98 A;  2WZZ A;  3Q82 A;  3ZG0 A;  1CK3 A;  3ZG8 B;  4PM9 A;  4HES A;  4P85 A;  5TR7 A;  3SOI A;  4E6W A;  1JWV A;  4R4R A;  1JTG A;  1EWZ A;  3CMZ A;  1ZG4 A;  5EVI B;  1KDS A;  1NYM A;  4KZ3 A;  1RGZ A;  2ZLY A;  3HVF A;  4WEL A;  3O87 A;  4MEZ A;  4BEN A;  5HW3 A;  4OLG A;  2XDM A;  3LO7 A;  4KEN B;  3W8K A;  3SS5 A;  4C3Q A;  4DDY A;  3HLD A;  5GL9 A;  4GB7 A;  3Q7Z A;  5AQA A;  2IWC A;  4R0Q A;  1YT4 A;  5EOO A;  3BEC A;  4ZJ1 A;  2J8Y A;  3NI9 A;  2WKH A;  4X69 A;  5HL1 A;  4PMA A;  1ES5 A;  2WUQ A;  3A3F A;  2XR0 A;  1Z6F A;  2DCF A;  2QPN A;  3GVB A;  5CHU A;  1MWR A;  3M2J A;  4Y0T A;  4BD1 A;  2ZQ8 A;  3IH8 A;  3WS1 A;  1E25 A;  3BFF A;  3ZVT A;  1BUL A;  3FWL A;  4WZ5 A;  5E2E A;  3G34 A;  3EQV A;  3NBL A;  3UDI A;  3WS4 A;  3VP4 A;  1W79 A;  4KZ4 A;  4NET A;  3AGF A;  4JF6 A;  2XQZ A;  5TGF A;  3P09 A;  2V20 A;  4OP5 A;  3NY4 A;  4RA7 A;  1G6A A;  3GMW A;  1W7F A;  4BQM A;  3G35 A;  4BL3 A;  3UNW A;  1KVM A;  1Y54 A;  2OV5 A;  2ZQ7 A;  2HDU A;  3IH9 A;  2RL3 A;  2UWX A;  1JWP A;  1L0D A;  3G2Z A;  3PBR A;  5FI6 A;  4JBF A;  3O86 A;  4LV2 A;  3W4Q A;  1BLP A;  1FR1 A;  1K4F A;  1L0E A;  5EVI C;  4E3M A;  1M6K A;  2WGI A;  1LL5 A;  3A3E A;  3BFE A;  3ISG A;  3BFG A;  4UHU A;  1VQQ A;  1FCO A;  5EVL A;  3VFF A;  3OPL A;  2HP5 A;  5DF9 A;  3S1Y A;  3HUM A;  1J9M A;  3PTE A;  2E8I A;  2Y2G A;  4E3I A;  4JXW A;  2A3U A;  4F94 A;  1TDG A;  1XA1 A;  4KZ9 A;  2J9O A;  1E4D A;  4UA6 A;  3MFD A;  2ZJ9 A;  3UE3 A;  3ZNT A;  1K6R A;  1PW8 A;  4MNR A;  1E3U D;  3ZG7 B;  4R1G A;  4UA7 A;  3AGE A;  2XH9 A;  3Q07 A;  5A90 A;  3HLB A;  3OCN A;  5FAP A;  2XLN A;  2HP9 A;  3G31 A;  4UA9 A;  3HLC A;  4JLF A;  3LY4 A;  2XFS A;  4L0L A;  4N9L A;  1CI8 A; 
#chains in the Genus database with same CATH topology
 4ZDX A;  3GEC A;  5CHM A;  1MC0 A;  2OWH A;  3IXG A;  5CER A;  3KSG A;  3K3C A;  2NUT C;  4GD8 A;  5BOH A;  2JN7 A;  4OQG A;  3A3J A;  1BLH A;  1J3W A;  4Y0U A;  2W3F A;  4Z9Q A;  1KGF A;  4DRT A;  2K31 A;  2VV7 A;  3RXX A;  1V9Y A;  3KSF A;  3IX3 A;  2HDS A;  2J9P A;  1CF0 A;  1DY6 A;  1H8Y A;  4GS9 A;  4R38 A;  2WKI A;  2PU2 A;  5A8B A;  3QP6 A;  3B47 A;  4KZ5 A;  4I3I A;  1F5M A;  3A0S A;  3TJZ C;  1Q2Q A;  2V2F F;  4S2I A;  2HP6 A;  1S1Y A;  2XFT A;  1YLZ A;  4DJ2 A;  2V1Z A;  4QY6 A;  1K55 A;  4KQD A;  4QWO A;  3VSL A;  5DTK A;  3F1O B;  3ZG9 B;  3ZDJ A;  3PBT A;  3SS4 A;  4K0X A;  3UE0 A;  1NLZ A;  3EOI A;  4II7 A;  4JF4 A;  3NHQ A;  3FPV A;  3HRE A;  3MJQ A;  3BW6 A;  4RVA A;  3IBJ A;  3GR2 A;  2EXB A;  2GZA A;  1IYQ A;  4LCM A;  3VE3 A;  1SDE A;  2EWW A;  3ZGA B;  3D72 A;  1ACF A;  5GHY A;  3D9Y A;  2ZOH A;  1ZC2 A;  4QJG A;  2B5R A;  2WGV A;  2P04 A;  4JKT A;  1CQA A;  5GHZ A;  2QWS A;  3K3D A;  1UWN X;  2Y2K A;  1TD5 A;  3MQO A;  4Q0H A;  4HI4 A;  4LV0 A;  2VZW A;  4R3J A;  4Y0O A;  4S2K A;  4X1L A;  1TF1 A;  4MN6 A;  3MZE A;  1PWC A;  3M6B A;  5CTM A;  4KZA A;  3WRT A;  1SKO B;  3VOZ A;  1VM1 A;  2OLU A;  4ZTK A;  3IF5 A;  3UPN A;  4BLM A;  5AVE A;  5HSQ A;  3HLE A;  5M18 A;  4I38 A;  1GA0 A;  4FH2 A;  2O9B A;  3VP1 A;  1NXY A;  1YLY A;  2VGL S;  3N8S A;  2Z6D A;  2C6W B;  1FSY A;  3OPP A;  3E4P A;  3PAG A;  4KQQ A;  4OLD A;  2VGK A;  2V1A A;  3SS3 A;  5HDS A;  3ZVW A;  1F2K A;  4HH2 A;  3G2Y A;  1FQG A;  2WAE A;  3Q7V B;  3CLO A;  2PBD P;  3MBZ A;  2ZM2 A;  3VP3 A;  2B02 A;  5HDD A;  3IF6 B;  1HTZ A;  3MR0 A;  4OOY A;  1FOF A;  3EEH A;  2ZQC A;  4GDN A;  1GHM A;  3IBR A;  4I39 A;  3BM6 A;  4ETX A;  1D1J A;  1YLP A;  1PRQ A;  5GLA A;  1WA9 A;  3QNB A;  5TBM B;  1S67 L;  3C4O A;  4B4Z A;  4LFU A;  3UE1 A;  1NZO A;  5J7E A;  3S7Q A;  3HBR A;  2QYB A;  4HHD A;  3RFB A;  4CLC A;  1HD8 A;  3IQA A;  3S4X A;  3G4P A;  1YQS A;  4ID4 A;  3UO9 A;  3WRZ A;  3QP5 A;  4KQO A;  2V1B A;  1SHV A;  2ZD8 A;  3E4O A;  3PBS A;  4BD0 A;  1OPX A;  3PR6 A;  3S22 A;  3JYI A;  4R6L A;  2ZC5 B;  3UDF A;  2YKH A;  4KZ7 A;  4QY5 A;  2A24 A;  2Y79 A;  3LR5 A;  2Y55 A;  4IVI A;  4IUK A;  3OPR A;  5KMW A;  1BUE A;  2LB9 A;  4U0T A;  3C2W A;  2DMW A;  1PYY A;  2VK3 A;  1W63 M;  4N9K A;  5G4Z A;  4BBT A;  2ACG A;  4Q0I A;  4HBU A;  4B93 A;  2JE5 A;  1NRJ A;  1YAX A;  1IYO A;  1SZV A;  3NDG A;  3VP0 A;  5FQJ A;  3SH9 A;  1S66 L;  1YM1 A;  4IUH A;  1NZU A;  4NEE D;  5HFO A;  3CZD A;  4Y15 A;  1JWZ A;  4X6T A;  4IED A;  4PM7 A;  5CGX A;  2W3E A;  1K56 D;  4X68 A;  5CGS A;  3WS2 A;  4Q0J A;  4K91 A;  3IX8 A;  4JXS A;  5FSR A;  1LLB A;  1RGY A;  1NRF A;  3F1P A;  3FKV A;  2Q9N A;  4CLC B;  2O0Y A;  3ULF A;  4FOF A;  2V8C A;  1QME A;  1ES3 A;  3PBN A;  3LUQ A;  1OTA A;  1MY8 A;  3V3S A;  5EFW A;  4XT2 A;  1PI4 A;  3FV7 A;  4KZ6 A;  2Z2M B;  5DFY A;  2HPB A;  4E3K A;  2P9V B;  1OME A;  3R4K A;  1VET A;  1BT5 A;  3E2L A;  4EXO A;  2Y59 A;  4GOG A;  3UN7 A;  4RQ9 A;  3OLO A;  4PM5 A;  3Q82 A;  4EEU A;  3ZG8 B;  4HES A;  3UB6 A;  1XJ2 A;  3LI9 A;  4G3W A;  3PXP A;  4KZ3 A;  3O87 A;  4OLG A;  3W8K A;  3SS5 A;  1SKO A;  4C3Q A;  5GL9 A;  2IWC A;  4GJ4 A;  1YT4 A;  3L9K A;  4PMA A;  1XJ4 A;  3H82 B;  1Z6F A;  4IJG A;  5CHU A;  3M2J A;  2QJ7 A;  4BD1 A;  1AWI A;  5EM0 A;  3LYX A;  3FC7 A;  2Y8H A;  3VP4 A;  3T4J A;  1XFQ A;  3GMW A;  1W7F A;  2ZL1 A;  1Y54 A;  2RL3 A;  1L0D A;  3PBR A;  2HJE A;  3W4Q A;  1BLP A;  1K4F A;  1L0E A;  2WGI A;  5KIZ A;  4GCZ A;  3OPL A;  2E8I A;  2Y2G A;  3NUL A;  4JXW A;  4F94 A;  1TDG A;  4KZ9 A;  1E4D A;  3ZNT A;  3F1O A;  3L7H A;  1PW8 A;  2W3G A;  4MNR A;  4UA7 A;  3V67 A;  3Q07 A;  3OCN A;  4UA9 A;  3HLC A;  4DMZ A;  4DN0 A;  1DP9 A;  2XFS A;  1TS6 A;  4N9L A;  3FG8 A;  5E2F A;  4H6J B;  1MPL A;  2JKR M;  3EGX C;  4KG2 A;  3T4L A;  3W2Z A;  3MKE A;  3RH8 B;  2RCX A;  1A0K A;  1M40 A;  1BYW A;  1OT6 A;  3I7J A;  3MQ0 A;  3IWI A;  5AVF A;  3DTE A;  2X01 A;  1Y28 A;  1YLT A;  2ZQA A;  5U47 A;  5EEC A;  5FQ9 A;  1MBL A;  4WL9 A;  2WKP A;  3M6H A;  4L9G A;  4EWF A;  1FR6 A;  1PWD A;  2JKT M;  2V8F A;  4JXV A;  5DJU A;  4QB8 A;  3CI6 A;  3T4O A;  5FAS A;  3P01 A;  1FSW A;  3O5Y A;  5FAT A;  3T4S A;  5HWW A;  2BTF P;  1XX2 A;  4R4S A;  2ZMV A;  3CUE A;  4EET B;  4EEP A;  1VET B;  4NXB A;  3EQU A;  1DP6 A;  2HF6 A;  4WLA A;  1LL8 A;  2A2L A;  2DNS A;  2ZC4 B;  4EBP A;  5MC7 A;  1ALQ A;  4GNU A;  5G18 A;  5LBR A;  1YSP A;  4Q8I A;  2XK1 A;  5E2G A;  4BWI A;  3CG5 A;  1MWT A;  3OC2 A;  4OON A;  1HZO A;  3T4K A;  5CRF A;  2K7S A;  3BWL A;  3LFV A;  3IS2 A;  3HUO A;  4EV4 A;  3OPH A;  3HUN A;  2ZC6 B;  3PYP A;  4JXG A;  4YNR A;  2PRF A;  5FA7 A;  3T12 B;  1C3B A;  3G30 A;  4NK3 A;  4N1X A;  5EE8 A;  1K56 A;  4WN5 A;  3SZT A;  2BLS A;  3GRJ A;  2XD5 A;  5HDC A;  2XGN A;  2EA9 A;  1PI5 A;  4YIN A;  3R7W B;  3LR0 A;  2H0T A;  2I72 A;  3LIC A;  5F5Y A;  3G32 A;  4ARZ B;  2OAP 1;  1GSX A;  3SH8 A;  1I2S A;  1FIL A;  4I3A A;  5L2F A;  2WKR A;  1W8Y A;  3V39 A;  2FFY A;  2C5W B;  1LL9 A;  4WM9 A;  2L0W A;  3MF0 A;  2JKG A;  3UB5 P;  5D3O A;  1DJA A;  1K6S A;  5FQI A;  3MFX A;  1K57 C;  2MJ6 A;  3BY8 A;  3T1S A;  2VV6 A;  3A3D A;  4HNB A;  2VJW A;  3ITA A;  2ZL1 B;  3P7N A;  2G2U A;  3F1N A;  3OZH A;  1T19 A;  1ERQ A;  4S2P A;  5DF7 A;  2VKS A;  1FIK A;  3DW0 A;  4F3L B;  4LGW A;  5DTT A;  3RXW A;  2PDR A;  3MKF A;  4BJP A;  4GHI A;  4S2M A;  2EX9 A;  4P87 A;  1KE4 A;  4GKU A;  4C75 A;  5GLD A;  1SCW A;  4X53 A;  4GLQ A;  2XEP A;  3UDX A;  4MBH A;  3QP4 A;  2JC7 A;  1K0K A;  3MXS A;  1O7E A;  3B42 A;  4JPM A;  1MKI A;  4MBK A;  1TDL A;  1ERO A;  3K2N A;  1W5D A;  2PD8 A;  4S2J A;  3DAV A;  1S1Z A;  1P0Z A;  1ERM A;  1T1B A;  1S4S A;  2G2W A;  4NKP A;  5DJT A;  2QHK A;  1GA9 A;  1XXM A;  5JYO A;  4NG2 A;  2Q9M A;  1OJ5 A;  4BL2 A;  1QMF A;  2Y2O A;  4DJ3 A;  4HJ3 A;  2L1M A;  3Q81 A;  5DF8 A;  2XA7 S;  5TFQ A;  4X55 A;  2J3W A;  5GLB A;  2HDQ A;  3IXB A;  5EVI D;  3VMA A;  5A93 A;  1KE3 A;  4QD4 A;  2M7U A;  3UPO A;  1W8Q A;  2XRN A;  3DWK A;  3VE4 A;  2XF3 A;  2GX5 A;  2EXA A;  2IA2 A;  1DJB A;  2Y4A A;  4H6J A;  3SH7 A;  3HLF A;  1PFL A;  2R9W A;  3MQQ A;  4O01 A;  4U3T A;  1L3L A;  3H7W B;  4DDS A;  3IXH A;  1ODV A;  5FQM A;  3IT9 A;  2Y2L A;  1WYC A;  2WAD A;  4YFM A;  4MBF A;  5HAQ A;  3H7W A;  3DWZ A;  2BG1 A;  2PU4 A;  1OJG A;  1Z09 A;  2V0W A;  3OBF A;  3BFC A;  1RP5 A;  3IXD A;  4GZB A;  1YMS A;  4M3K A;  1KGG A;  1ES4 A;  3FPW A;  3UB9 A;  1STZ A;  3DBA A;  3TOI A;  2Y91 A;  4H8R A;  4RYE A;  1ES2 A;  5E43 A;  4LLO B;  4B9O A;  2O9C A;  3FZC A;  3LCE A;  1XKZ A;  5EVE A;  3LIF A;  3WS0 A;  3WWX A;  1MZU A;  3CIT A;  3UMD A;  5FI7 A;  3KX0 X;  2ZM0 A;  3ZQ5 A;  2J3T D;  3DTI A;  3ZG0 A;  1CK3 A;  1TS8 A;  4PM9 A;  3SOI A;  3CMZ A;  5EVI B;  1KDS A;  2ZLY A;  4MEZ A;  4CLC C;  3LO7 A;  3LIB A;  3HLD A;  4GB7 A;  5AQA A;  4KUO A;  3S7N A;  4MN7 A;  3NEC A;  4X69 A;  1ES5 A;  3A3F A;  2DCF A;  3LI8 A;  4BBV A;  4Y0T A;  1G6O A;  3BQ8 A;  5DFX A;  3IH8 A;  1E25 A;  3BFF A;  3IS2 B;  1BUL A;  3FWL A;  3G34 A;  3GDI A;  4R3A A;  3A0V A;  3WS4 A;  2W1T A;  2VV8 A;  2M1C A;  2XQZ A;  3P09 A;  2V20 A;  3NY4 A;  4RA7 A;  3UNW A;  2OV5 A;  2QKP A;  2O99 A;  2W1T B;  2PD7 A;  1JWP A;  5FI6 A;  3G2Z A;  4GS9 B;  4JBF A;  3O86 A;  4Y13 A;  1FR1 A;  4E3M A;  2JHE A;  2QJ5 A;  5C5K A;  1H0M A;  3BFE A;  3ISG A;  3C38 A;  4K08 A;  4ESP A;  3LIE A;  4E3I A;  4UA6 A;  2J9O A;  4EU0 A;  4ARZ A;  3MFD A;  2ZJ9 A;  4CLC D;  2VA0 A;  1E3U D;  4LRZ E;  3ZG7 B;  4R1G A;  2XH9 A;  5FAP A;  3CWF A;  1X0O A;  3LY4 A;  3N7W A;  3NOU C;  4L0L A;  4Y7P A;  2Y2M A;  4EUV A;  3LY3 A;  3C4P A;  1ONG A;  5HAR A;  1FCN A;  3ZNY A;  4MLL A;  4E3O A;  3AGD A;  2CMN A;  2NUP C;  2BAS A;  3ZHH A;  1K54 C;  3N8L A;  2PAV P;  2H5S A;  4S2N A;  1E3U A;  5FQQ A;  4ME4 A;  2UV0 E;  5J3W A;  1WYB A;  4NXF A;  2W0N A;  5AJG A;  4RX3 A;  5G4Y A;  5I5L A;  1IYS A;  5FEF A;  1PWG A;  4LV1 A;  4P6Z M;  4U0X A;  1FCM A;  3TE8 A;  1U60 A;  2W3H A;  3A3I A;  3GQZ A;  2PHY A;  5HD3 A;  4QU3 A;  3ZYT A;  5FAO A;  4WF0 A;  4R70 A;  3D4F A;  4S2N C;  4N92 A;  2WAF A;  1P97 A;  3NIA A;  1CEG A;  2Y2Q A;  3KYQ A;  1KDW A;  1BZA A;  4M4X A;  1OTB A;  5TJJ A;  1TS0 A;  3FKW A;  4WMC A;  3MXQ A;  4OPQ A;  4JGQ A;  5CEC A;  3UE6 A;  5M19 A;  2J3T C;  1I2W A;  1LI0 A;  1F98 A;  2H0Y A;  3UPP A;  2OLV A;  4OPY A;  4X56 A;  5CXW A;  3KSI A;  3C5A A;  4GD6 A;  4GW9 A;  2H28 A;  5HAI A;  4EBL A;  4PKY A;  4R3B A;  5HAP A;  4NXG A;  5L10 A;  1N9O A;  4PM8 A;  4NXE A;  3EEA A;  4KG6 A;  4N1H A;  4CJN A;  1N9L A;  2WGW B;  3O88 A;  4ZBE A;  4UAA A;  3ITB A;  1LT0 A;  1T1C A;  1CJF A;  3UME A;  2OSU A;  2IWB A;  3V3R A;  4KZ8 A;  1CEF A;  4OQ0 A;  1NY0 A;  5EUA A;  4XUZ A;  2PYP A;  4P0M A;  4PPR A;  4R23 A;  5F1G A;  1YKD A;  1LI9 A;  1NYY A;  3TW8 A;  5L07 A;  1TVF A;  1IYP A;  3NCK A;  1P9W A;  1GSW A;  5HX9 A;  5FL3 A;  3H82 A;  2XRO A;  2VEA A;  3TSG A;  4DE1 A;  2ZMA A;  1HVB A;  5IS1 A;  3GSG A;  3W4P A;  1NJ4 A;  3KSH A;  2GDN A;  2L4R A;  4LEN A;  4BBU A;  2LB5 A;  2JCH A;  4OP8 A;  1ESU A;  4FCF A;  4WMC D;  3U2A A;  3JPU A;  1N9N A;  5AQ9 A;  1JTD A;  3IX4 A;  3MMH A;  1G68 A;  3VSK A;  4K0W A;  1S0W A;  3PBO A;  3LID A;  3HJI A;  3NOT C;  4OVD A;  2WZX A;  4HQA A;  1K25 A;  4FD8 A;  4C6Y A;  2E8J A;  3MZF A;  3QNC A;  2KOI A;  5E2H A;  3HLW A;  4S2L A;  1RCJ A;  1Q2P A;  2JKF A;  4CPK A;  4E3J A;  2K2N A;  2GJ3 A;  2VGJ A;  4WBG A;  4OH0 A;  4QPR A;  4O8G A;  1I5Q A;  3ICY A;  2H10 A;  3CHW P;  4UQI M;  1GSV A;  4OPZ A;  1K4E A;  1VHM A;  3SW1 A;  4OKP A;  4DE0 A;  4HJ4 A;  4HEF A;  1F9I A;  2OOL A;  2CC1 A;  3BY9 A;  5HL6 A;  4FSF A;  4HP9 A;  4P6Z S;  4A5R A;  3EGD C;  4FUW A;  1MWU A;  2EX6 A;  2PBY A;  1GCE A;  4YOF A;  4LCL A;  4DKI A;  3E2K A;  5DVA A;  3T1Q B;  4ZRR A;  3KYZ A;  3IWO A;  1BLC A;  4Y3I A;  4DXB A;  2Y2J A;  3R7W A;  1N9B A;  4IBR A;  5EV0 A;  5EVI A;  1GHP A;  4WUJ A;  5DKL A;  3NC8 A;  1XGI A;  2B18 A;  4S2O A;  4IVK A;  3ZG5 A;  3C7U A;  4KG5 A;  2R9X A;  2EX2 A;  3IHB A;  2P74 A;  4QHC A;  4Y17 A;  4RX2 A;  2Z2L B;  1XPB A;  5HPF A;  2Q0O A;  2FFF B;  5J4E A;  4YWZ A;  2ZC7 A;  2X02 A;  3Q1F A;  1JVJ A;  4HIA A;  4E3N A;  1GHI A;  3MSH A;  3BLM A;  1L0G A;  1V9Z A;  1IFQ A;  3B3X A;  1TS7 A;  3CUE C;  1DP8 A;  1H5X A;  1G28 A;  5TBM A;  1BTL A;  3W4O A;  4GDB A;  3DTM A;  1IEL A;  1LHY A;  2HDR A;  4PHT A;  3D3O A;  1P9R A;  2ZQD A;  3LR3 A;  1CI9 A;  2ZBB A;  5DTS A;  1TEM A;  2KLI A;  4EQI A;  5KZH A;  1N4O A;  4PAU A;  5DKK A;  5CHJ A;  3KO6 A;  2OAQ 1;  1KGE A;  2JBF A;  1SDN A;  4XT2 B;  1ZTU A;  3HLG A;  3IWQ A;  1AXB A;  3P98 A;  4UQI S;  3VOL A;  4P85 A;  1JWV A;  2VLG A;  1JTG A;  2VGL M;  1NYM A;  1RGZ A;  5HW3 A;  2M7V A;  2PR6 A;  2XDM A;  4KEN B;  5EOO A;  3BEC A;  4L9E A;  3NI9 A;  4E04 A;  2WKH A;  2WUQ A;  3G6O A;  1MWR A;  5IU1 A;  3E0Y A;  3EQV A;  1HLU P;  3UDI A;  4HH3 A;  1W79 A;  4KZ4 A;  3AGF A;  4JF6 A;  4OP5 A;  3QP2 A;  1KVM A;  1VEU B;  2HDU A;  4LV2 A;  1LL5 A;  4UHU A;  1JNU A;  5EVL A;  5HWV A;  3S1Y A;  3HUM A;  3PTE A;  2V9A A;  3B33 A;  2A3U A;  2PR5 A;  1XA1 A;  4Y2F A;  3UE3 A;  1K6R A;  1KOU A;  5F6A A;  1NLY A;  2ZOI A;  2EWV A;  5FEG A;  2XLN A;  2HP9 A;  2FH5 A;  4JLF A;  1DRM A;  1CI8 A;  1IEM A;  3S7P A;  1PIO A;  4OQH A;  3BEB A;  4DF6 A;  3TG9 A;  1YLW A;  3E4Q A;  2KDK A;  4D2O A;  4IBX A;  3ZFZ A;  4G3V A;  5FQK A;  4UEY A;  3PHY A;  5F69 A;  4EBN A;  1XFN A;  2HZ5 A;  1XJ3 A;  1XP4 A;  5KSC A;  3OCL A;  2A24 B;  4KUK A;  5A92 A;  1W63 Q;  5HPI A;  3FYZ A;  2YKF A;  1LSX A;  3CJM A;  4X1M A;  3QHY A;  3QP1 A;  4JGO A;  4MMN A;  2P7J A;  5CED A;  5J8X A;  2P9V A;  5HZH A;  4PM6 A;  3BJN A;  1YPR A;  2XA7 M;  5CTN A;  3HL9 A;  2ZC3 B;  2OWJ A;  1OT9 A;  1PZO A;  1DJC A;  4ETZ A;  3KYE A;  2HV1 A;  1XJ6 A;  4DE2 A;  5CX7 A;  1ZG6 A;  3EWK A;  5HWT A;  3OOV A;  4XUX A;  1EI5 A;  2FZ0 A;  5L8M A;  3F1P B;  4HJ6 A;  1MKM A;  4XXR A;  4Y5F A;  1BLS A;  4DE3 A;  3C7V A;  5A91 A;  2D01 A;  4HP4 A;  3T50 A;  3IF6 C;  4WEK A;  5EM1 A;  3GTC A;  5AQB A;  2EX8 A;  1PNE A;  2X71 A;  5EPH A;  1WE4 A;  4OOL A;  1UWP X;  4LRY C;  2W3D A;  1XA7 A;  1KVL A;  3MZD A;  3MS6 A;  3NDE A;  3JVU A;  4B4X A;  5FDH A;  2EFU A;  5F68 A;  2QZ6 A;  2O9A A;  4P6B A;  4L9F A;  1H8M A;  3BFD A;  2W1R A;  1S6R A;  5L09 A;  3BQA A;  4HY8 A;  3C8C A;  2W27 A;  1YSQ A;  3S7O A;  4Z1W A;  4HBT A;  2Y2N A;  2IWD A;  4KZB A;  1LSW A;  2HGV A;  3O3V A;  3E98 A;  4KQR A;  3HJK A;  1LSV A;  3N6I A;  1H8Z A;  2XD1 A;  4EQ1 A;  3PAE A;  2J7V A;  4EER A;  2AVX A;  4PKY G;  5KSH A;  4CLC E;  1D06 A;  2PT7 A;  2JKR I;  3V5M A;  3VFH A;  3UB8 A;  4I3J A;  3F1N B;  3HCY A;  1K38 A;  3BYD A;  2QMI A;  3H9W A;  3N4I A;  2WK0 A;  2WYX A;  3VV4 A;  4AFI A;  4ZJ2 A;  4MDZ A;  1XGJ A;  5CGW A;  1KE0 A;  2DRW A;  4ZJ3 A;  4LRX C;  3IHA A;  1K55 C;  3LR4 A;  3LEQ A;  3NOP C;  3WS5 A;  5IHV A;  2I9V A;  3VOY A;  5F83 A;  5IT5 A;  4O0P A;  1YLJ A;  1PW1 A;  1YMX A;  4OQI A;  4WEJ A;  4FH4 A;  5F1F A;  4MCW A;  1H3Q A;  1UGU A;  2Y2H A;  4WZ4 A;  3LEZ A;  3CPT A;  1SKF A;  3A0R A;  3NJA A;  1MXO A;  3ZCZ A;  2WKE A;  4CQH A;  2G7U A;  1L0F A;  1PZP A;  2WGW A;  4EW7 A;  3T1R A;  5M1A A;  5HD5 A;  1ZHH B;  5FI2 A;  2EFX A;  1EW0 A;  4B88 A;  2HJ9 C;  2Y2I A;  3BRM A;  1IKG A;  4E6X A;  1ESI A;  3Q7V A;  4EUZ A;  3T4T A;  2JKT I;  2ZMF A;  3BLS A;  3UY6 A;  2P08 A;  3IF6 A;  1S4R A;  4OOM A;  4GHI B;  1BSG A;  5GLC A;  3MXR A;  4HOI A;  4WYY A;  2J80 A;  4X25 A;  1O07 A;  4ZAM A;  2A49 A;  4JF5 A;  1K54 A;  2ZM8 A;  1VB6 A;  3PBQ A;  4LV3 A;  4LPZ A;  4WZ5 C;  4E3L A;  4JGP A;  5CEB A;  1L2S A;  3JVV A;  5JYP A;  5GHX A;  5F82 A;  1ONH A;  3V50 A;  1OTD A;  1G5U A;  1Y4O A;  3LIA A;  5K5B A;  2Y2P A;  2GNX A;  2D02 A;  1K57 A;  4IHQ A;  1IKI A;  3RJU A;  3M2K A;  4GN2 A;  4DXC A;  5EOE A;  4G3K A;  2ZQ9 A;  4JGR A;  3N8R A;  5AQ7 A;  5I94 A;  1MWS A;  3CPT B;  5FAQ A;  1NWZ A;  3GV9 A;  1T18 A;  4OPR A;  4O7D A;  3VP2 A;  4D60 A;  1ZKJ A;  3RTY A;  2WZZ A;  5TR7 A;  4E6W A;  1T1A A;  4R4R A;  1D7E A;  2PYR A;  2R78 A;  3C30 A;  4I5S A;  1EWZ A;  4FTX A;  1ZG4 A;  3LGO A;  3HVF A;  4WEL A;  4BEN A;  2INW A;  4DDY A;  3CAX A;  3Q7Z A;  3QP8 A;  4R0Q A;  4ZJ1 A;  2J8Y A;  5HL1 A;  2XR0 A;  3T4Q A;  4MN5 A;  2QPN A;  3GVB A;  2ZQ8 A;  3WS1 A;  3ZVT A;  2V0U A;  4WZ5 A;  5E2E A;  3NBL A;  1VEU A;  3U4L P;  2B95 A;  4NET A;  5TGF A;  1G6A A;  4BQM A;  4F3L A;  3G35 A;  4BL3 A;  2ZQ7 A;  3IH9 A;  2UWX A;  1OTE A;  5EVI C;  1M6K A;  3TRC A;  2VX8 A;  3A3E A;  3BFG A;  5FDS A;  1VQQ A;  2WKQ A;  3UB7 A;  1FCO A;  3VFF A;  2HP5 A;  5DF9 A;  1J9M A;  2XSS A;  4BMW A;  2Z6C A;  1IOU A;  3T1X A;  3AGE A;  5A90 A;  3DTK A;  3HLB A;  3G31 A;  1OTI A;  2KX6 A;  4EES A; 
#chains in the Genus database with same CATH homology
 4Y7P A;  4ZDX A;  2Y2M A;  1IEM A;  1MPL A;  1PIO A;  3LY3 A;  4OQH A;  3BEB A;  4KG2 A;  3C4P A;  5CHM A;  1ONG A;  4DF6 A;  3IXG A;  3TG9 A;  5HAR A;  3MKE A;  1FCN A;  3ZNY A;  5CER A;  1YLW A;  2RCX A;  4MLL A;  4E3O A;  3AGD A;  1M40 A;  4GD8 A;  4D2O A;  3I7J A;  3IWI A;  4IBX A;  3N7W A;  3ZFZ A;  2X01 A;  1K54 C;  3ZHH A;  5BOH A;  3N8L A;  5FQK A;  4OQG A;  2H5S A;  4S2N A;  1YLT A;  1E3U A;  5FQQ A;  4EBN A;  2ZQA A;  5U47 A;  3A3J A;  5EEC A;  1BLH A;  4Y0U A;  1MBL A;  1WYB A;  1XP4 A;  5FQ9 A;  5KSC A;  3OCL A;  3M6H A;  4Z9Q A;  4RX3 A;  1KGF A;  4EWF A;  5A92 A;  1FR6 A;  4DRT A;  3FYZ A;  1PWD A;  1IYS A;  4JXV A;  1PWG A;  3CJM A;  4LV1 A;  4U0X A;  4QB8 A;  1FCM A;  3QHY A;  5FAS A;  1U60 A;  1FSW A;  3RXX A;  5KMW A;  3A3I A;  5FAT A;  3GQZ A;  5CED A;  4QU3 A;  5J8X A;  1XX2 A;  2P9V A;  4R4S A;  2HDS A;  4PM6 A;  2J9P A;  5FAO A;  1DY6 A;  1H8Y A;  3D4F A;  4S2N C;  3EQU A;  2WKI A;  2PU2 A;  4N92 A;  5CTN A;  2WAF A;  3HL9 A;  3NIA A;  1CEG A;  4KZ5 A;  2ZC3 B;  2Y2Q A;  1KDW A;  1BZA A;  1PZO A;  2V2F F;  1Q2Q A;  1DJC A;  4S2I A;  2HP6 A;  2XFT A;  3FKW A;  1YLZ A;  4WMC A;  2DNS A;  4DE2 A;  2ZC4 B;  4EBP A;  2V1Z A;  4OPQ A;  4QY6 A;  1ALQ A;  1K55 A;  1ZG6 A;  4XUX A;  5CEC A;  3VSL A;  1EI5 A;  4GNU A;  5DTK A;  5G18 A;  5M19 A;  4Q8I A;  1I2W A;  1LI0 A;  3ZG9 B;  3ZDJ A;  2XK1 A;  2H0Y A;  3PBT A;  5E2G A;  3SS4 A;  3UPP A;  3CG5 A;  1MWT A;  2OLV A;  3OC2 A;  4OPY A;  1HZO A;  4OON A;  4X56 A;  4K0X A;  5CRF A;  5CXW A;  3UE0 A;  3C5A A;  4GD6 A;  4XXR A;  1BLS A;  3HUO A;  5HAI A;  4JF4 A;  4EV4 A;  3OPH A;  4EBL A;  3HUN A;  2ZC6 B;  3C7V A;  4JXG A;  3HRE A;  4R3B A;  5A91 A;  4DE3 A;  5HAP A;  3IF6 C;  4WEK A;  5FA7 A;  4RVA A;  1C3B A;  3GR2 A;  3GTC A;  2EXB A;  3G30 A;  4PM8 A;  1IYQ A;  4LCM A;  4NK3 A;  5AQB A;  1SDE A;  3ZGA B;  4N1X A;  2EX8 A;  4KG6 A;  5EE8 A;  4N1H A;  4CJN A;  5GHY A;  1K56 A;  2WGW B;  2X71 A;  5EPH A;  3O88 A;  1ZC2 A;  1WE4 A;  2B5R A;  2BLS A;  3ITB A;  4UAA A;  4ZBE A;  4QJG A;  4OOL A;  2WGV A;  1XA7 A;  4JKT A;  2OSU A;  1KVL A;  3GRJ A;  3MZD A;  2IWB A;  3V3R A;  4KZ8 A;  5GHZ A;  2XD5 A;  2XGN A;  1CEF A;  1PI5 A;  3NDE A;  4YIN A;  4OQ0 A;  1NY0 A;  4B4X A;  2H0T A;  2I72 A;  5FDH A;  2EFU A;  2QZ6 A;  5EUA A;  4P6B A;  4XUZ A;  2Y2K A;  4P0M A;  3G32 A;  4PPR A;  4R23 A;  5F1G A;  4LV0 A;  4R3J A;  4Y0O A;  1LI9 A;  3BFD A;  4S2K A;  3SH8 A;  3MZE A;  1PWC A;  1S6R A;  3M6B A;  4KZA A;  1NYY A;  5CTM A;  3WRT A;  1I2S A;  3VOZ A;  1VM1 A;  2OLU A;  4ZTK A;  3IF5 A;  3UPN A;  5L2F A;  1TVF A;  1IYP A;  3NCK A;  4BLM A;  1W8Y A;  5HX9 A;  3V39 A;  3HLE A;  2FFY A;  4HBT A;  5M18 A;  2C5W B;  1LL9 A;  2Y2N A;  4WM9 A;  3TSG A;  1GA0 A;  4FH2 A;  2IWD A;  4KZB A;  4DE1 A;  2ZMA A;  5D3O A;  1DJA A;  1HVB A;  3VP1 A;  1K6S A;  1NXY A;  1YLY A;  3O3V A;  5FQI A;  4KQR A;  1K57 C;  3N8S A;  2C6W B;  1FSY A;  3N6I A;  3OPP A;  1H8Z A;  2XD1 A;  3A3D A;  3PAG A;  3GSG A;  4KQQ A;  3W4P A;  4OLD A;  3ITA A;  2J7V A;  3PAE A;  1NJ4 A;  2VGK A;  3SS3 A;  2GDN A;  4LEN A;  2G2U A;  3ZVW A;  5KSH A;  2JCH A;  4OP8 A;  3OZH A;  3G2Y A;  1ERQ A;  1FQG A;  1ESU A;  4FCF A;  4WMC D;  3V5M A;  2WAE A;  3Q7V B;  5E2F A;  3VFH A;  4S2P A;  5DF7 A;  5AQ9 A;  3MBZ A;  2ZM2 A;  3VP3 A;  3DW0 A;  1JTD A;  1G68 A;  5DTT A;  3RXW A;  3IF6 B;  3VSK A;  1K38 A;  3MKF A;  1S0W A;  1HTZ A;  4K0W A;  4BJP A;  4OOY A;  1FOF A;  3BYD A;  4S2M A;  2QMI A;  3PBO A;  3N4I A;  2WK0 A;  2WYX A;  4OVD A;  2EX9 A;  2ZQC A;  4GDN A;  4P87 A;  4ZJ2 A;  1KE4 A;  4GKU A;  2WZX A;  1GHM A;  4C75 A;  1XGJ A;  5CGW A;  1K25 A;  4FD8 A;  5GLD A;  1SCW A;  4X53 A;  2XEP A;  1KE0 A;  3UDX A;  4C6Y A;  4MBH A;  2DRW A;  2JC7 A;  3MZF A;  3BM6 A;  4ZJ3 A;  3QNC A;  5E2H A;  3MXS A;  3IHA A;  1K55 C;  1O7E A;  3HLW A;  1YLP A;  4JPM A;  4S2L A;  5GLA A;  1RCJ A;  3WS5 A;  1Q2P A;  1MKI A;  4MBK A;  1TDL A;  5IHV A;  3QNB A;  1ERO A;  4CPK A;  4E3J A;  3C4O A;  2VGJ A;  4B4Z A;  3VOY A;  5F83 A;  3UE1 A;  1NZO A;  1W5D A;  4S2J A;  4WBG A;  3HBR A;  4OH0 A;  1YLJ A;  1I5Q A;  1PW1 A;  1YMX A;  1HD8 A;  2H10 A;  3IQA A;  4OQI A;  4WEJ A;  4FH4 A;  5F1F A;  3S4X A;  3G4P A;  1YQS A;  4OPZ A;  1K4E A;  2Y2H A;  4ID4 A;  4WZ4 A;  3UO9 A;  4OKP A;  3WRZ A;  1ERM A;  4KQO A;  3LEZ A;  4DE0 A;  2G2W A;  4HEF A;  1SKF A;  1SHV A;  2CC1 A;  2ZD8 A;  1GA9 A;  1MXO A;  4FSF A;  3PBS A;  3ZCZ A;  1XXM A;  5JYO A;  4BD0 A;  2Q9M A;  4A5R A;  3S22 A;  4BL2 A;  1MWU A;  2EX6 A;  2WKE A;  3JYI A;  2PBY A;  1GCE A;  1QMF A;  2Y2O A;  1L0F A;  1PZP A;  2WGW A;  4LCL A;  4DKI A;  3E2K A;  2ZC5 B;  5DVA A;  3UDF A;  4KZ7 A;  5M1A A;  4QY5 A;  3IWO A;  5FI2 A;  2EFX A;  1BLC A;  2Y55 A;  3Q81 A;  3OPR A;  4IVI A;  5DF8 A;  4DXB A;  1BUE A;  2Y2J A;  4B88 A;  4U0T A;  2Y2I A;  1N9B A;  3BRM A;  4X55 A;  4IBR A;  1PYY A;  5TFQ A;  5EVI A;  1GHP A;  5GLB A;  2HDQ A;  1IKG A;  4E6X A;  1ESI A;  3Q7V A;  4N9K A;  4EUZ A;  3IXB A;  5EVI D;  3VMA A;  3BLS A;  3NC8 A;  1XGI A;  3UY6 A;  5A93 A;  4S2O A;  4IVK A;  3ZG5 A;  3C7U A;  3IF6 A;  2R9X A;  4HBU A;  1KE3 A;  2EX2 A;  2JE5 A;  2P74 A;  3IHB A;  4KG5 A;  4OOM A;  4QD4 A;  4QHC A;  1BSG A;  3UPO A;  1W8Q A;  3MXR A;  2Z2L B;  4RX2 A;  5GLC A;  1XPB A;  1IYO A;  3DWK A;  3NDG A;  4WYY A;  3VP0 A;  2FFF B;  2XF3 A;  5FQJ A;  1O07 A;  2ZC7 A;  3SH9 A;  2X02 A;  3Q1F A;  1JVJ A;  2A49 A;  4ZAM A;  2EXA A;  4E3N A;  1YM1 A;  1DJB A;  1NZU A;  4JF5 A;  1K54 A;  1GHI A;  2Y4A A;  2ZM8 A;  3CZD A;  5HFO A;  3PBQ A;  3BLM A;  1L0G A;  1JWZ A;  4X6T A;  4IED A;  4PM7 A;  3SH7 A;  4LV3 A;  5CGX A;  3HLF A;  4WZ5 C;  1K56 D;  2R9W A;  4E3L A;  4U3T A;  4X68 A;  3B3X A;  5CGS A;  3WS2 A;  5CEB A;  1L2S A;  4DDS A;  3IXH A;  4K91 A;  5FQM A;  3IT9 A;  1H5X A;  2Y2L A;  4JXS A;  5JYP A;  5GHX A;  5F82 A;  5FSR A;  1LLB A;  1RGY A;  1NRF A;  1ONH A;  1WYC A;  1BTL A;  2WAD A;  3V50 A;  4YFM A;  3W4O A;  4MBF A;  4GDB A;  3FKV A;  3DTM A;  5HAQ A;  1IEL A;  1LHY A;  3DWZ A;  2BG1 A;  2HDR A;  2PU4 A;  2Y2P A;  2Q9N A;  2ZQD A;  3BFC A;  1K57 A;  1RP5 A;  1IKI A;  3RJU A;  1CI9 A;  3M2K A;  4GN2 A;  3IXD A;  4DXC A;  4GZB A;  5EOE A;  1QME A;  5DTS A;  1YMS A;  2ZQ9 A;  1ES3 A;  1TEM A;  3PBN A;  4M3K A;  1KGG A;  1ES4 A;  3N8R A;  5AQ7 A;  4EQI A;  5I94 A;  1MY8 A;  1MWS A;  3V3S A;  3TOI A;  5FAQ A;  1PI4 A;  5KZH A;  2Y91 A;  4H8R A;  4RYE A;  1N4O A;  3FV7 A;  5CHJ A;  1ES2 A;  4KZ6 A;  2Z2M B;  5E43 A;  3GV9 A;  2HPB A;  4O7D A;  3FZC A;  1KGE A;  3LCE A;  2P9V B;  2JBF A;  4OPR A;  1SDN A;  1XKZ A;  1OME A;  4E3K A;  3VP2 A;  3WS0 A;  3WWX A;  1BT5 A;  3E2L A;  5FI7 A;  1ZKJ A;  2Y59 A;  4GOG A;  2ZM0 A;  3UN7 A;  3HLG A;  3IWQ A;  4PM5 A;  1AXB A;  3P98 A;  2WZZ A;  3Q82 A;  3ZG0 A;  1CK3 A;  3ZG8 B;  4PM9 A;  4HES A;  4P85 A;  5TR7 A;  3SOI A;  4E6W A;  1JWV A;  4R4R A;  1JTG A;  1EWZ A;  3CMZ A;  1ZG4 A;  5EVI B;  1KDS A;  1NYM A;  4KZ3 A;  1RGZ A;  2ZLY A;  3HVF A;  4WEL A;  3O87 A;  4MEZ A;  4BEN A;  5HW3 A;  4OLG A;  2XDM A;  3LO7 A;  4KEN B;  3W8K A;  3SS5 A;  4C3Q A;  4DDY A;  3HLD A;  5GL9 A;  4GB7 A;  3Q7Z A;  5AQA A;  2IWC A;  4R0Q A;  1YT4 A;  5EOO A;  3BEC A;  4ZJ1 A;  2J8Y A;  3NI9 A;  2WKH A;  4X69 A;  5HL1 A;  4PMA A;  1ES5 A;  2WUQ A;  3A3F A;  2XR0 A;  1Z6F A;  2DCF A;  2QPN A;  3GVB A;  5CHU A;  1MWR A;  3M2J A;  4Y0T A;  4BD1 A;  2ZQ8 A;  3IH8 A;  3WS1 A;  1E25 A;  3BFF A;  3ZVT A;  1BUL A;  3FWL A;  4WZ5 A;  5E2E A;  3G34 A;  3EQV A;  3NBL A;  3UDI A;  3WS4 A;  3VP4 A;  1W79 A;  4KZ4 A;  4NET A;  3AGF A;  4JF6 A;  2XQZ A;  5TGF A;  3P09 A;  2V20 A;  4OP5 A;  3NY4 A;  4RA7 A;  1G6A A;  3GMW A;  1W7F A;  4BQM A;  3G35 A;  4BL3 A;  3UNW A;  1KVM A;  1Y54 A;  2OV5 A;  2ZQ7 A;  2HDU A;  3IH9 A;  2RL3 A;  2UWX A;  1JWP A;  1L0D A;  3G2Z A;  3PBR A;  5FI6 A;  4JBF A;  3O86 A;  4LV2 A;  3W4Q A;  1BLP A;  1FR1 A;  1K4F A;  1L0E A;  5EVI C;  4E3M A;  1M6K A;  2WGI A;  1LL5 A;  3A3E A;  3BFE A;  3ISG A;  3BFG A;  4UHU A;  1VQQ A;  1FCO A;  5EVL A;  3VFF A;  3OPL A;  2HP5 A;  5DF9 A;  3S1Y A;  3HUM A;  1J9M A;  3PTE A;  2E8I A;  2Y2G A;  4E3I A;  4JXW A;  2A3U A;  4F94 A;  1TDG A;  1XA1 A;  4KZ9 A;  2J9O A;  1E4D A;  4UA6 A;  3MFD A;  2ZJ9 A;  3UE3 A;  3ZNT A;  1K6R A;  1PW8 A;  4MNR A;  1E3U D;  3ZG7 B;  4R1G A;  4UA7 A;  3AGE A;  2XH9 A;  3Q07 A;  5A90 A;  3HLB A;  3OCN A;  5FAP A;  2XLN A;  2HP9 A;  3G31 A;  4UA9 A;  3HLC A;  4JLF A;  3LY4 A;  2XFS A;  4L0L A;  4N9L A;  1CI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...