1NYMA

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (cxb)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
publication title Recognition and resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1nymA00
4BD0A 5EOOA 4JXWA 3VOYA 2QPNA 2OLVA 1C3BA 1YLJA 2WADA 3CG5A 1LLBA 4RA7A 2Y2KA 4Y7PA 1NYMA 3VFFA 3EQUA 2XLNA 4LCMA 5CTNA 5E2GA 5FDHA 1IELA 3GRJA 5HAQA 2FFYA 3V3RA 2ZLYA 1CI9A 4X55A 5A91A 1PI4A 4PM5A 2HDSA 4UA7A 1MBLA 5CXWA 1YLWA 2XH9A 4JXSA 2V20A 2I72A 3WS4A 2J9OA 4GZBA 4O7DA 2Y59A 3ZG0A 3BLMA 4E6XA 4U0XA 1SDNA 1YLZA 2E8IA 4GDBA 2WGWA 4GKUA 4Z9QA 2Z2LB 3NC8A 1K6SA 3HLDA 4OQGA 3HUNA 2A49A 4DXBA 2BLSA 2QMIA 3C5AA 5GLDA 3IF6B 4OH0A 2B5RA 3HREA 2H0TA 1ES3A 5GHZA 1IKGA 1DJCA 3PBOA 4PM8A 5L2FA 3N7WA 4Y0UA 3V3SA 1JWVA 2RL3A 1PW1A 1KE3A 1PW8A 4S2PA 1FCOA 4HEFA 3WWXA 3NY4A 4YFMA 1ES4A 1GHPA 1XX2A 3UDFA 1N9BA 1HVBA 4JXGA 4X53A 3NBLA 4GD6A 1RGZA 2IWDA 4OVDA 3BFEA 3IT9A 4WZ5A 3BFDA 2ZM0A 1YLTA 4RX2A 3I7JA 2WYXA 3NDEA 1K4FA 3OCLA 3PBTA 4K91A 3MKFA 3Q82A 1IYPA 1KGEA 3W8KA 1O7EA 5FQIA 5GLAA 3BRMA 3W4QA 3VSLA 4DE3A 4KZBA 4R3BA 4QHCA 3OZHA 1K56A 5DTSA 1KE0A 1PWCA 1BT5A 1IYQA 3BFGA 5DTKA 1XGIA 1KDSA 2Y55A 1ES5A 3SS4A 3SS3A 4DDYA 1ONHA 3AGDA 3GQZA 3GV9A 1MWSA 2R9XA 3LY3A 1EWZA 1DJAA 2WKHA 3OPRA 5M1AA 5KZHA 1H8YA 4OOYA 4R1GA 5CHUA 5CECA 2V2FF 4N1HA 4E3OA 1EI5A 2ZQ8A 2OSUA 4XUZA 1TDGA 3OPHA 3PBNA 5GLBA 1LL9A 1U60A 4KZ9A 3PBSA 4WYYA 3V5MA 4K0WA 4YINA 3E2LA 2ZQCA 2EXBA 4EBPA 3IWQA 5E43A 2HDUA 1GA0A 5CHMA 2H5SA 2Z2MB 1K54A 3FYZA 1XP4A 5FSRA 5EUAA 3G2YA 4B88A 1NRFA 3ITAA 4WZ5C 1J9MA 1Z6FA 3GSGA 4A5RA 1BLSA 3CJMA 3MKEA 1W8QA 3OPPA 4LV2A 4NK3A 1E3UD 4E3IA 4N9LA 2EX8A 3SS5A 1BLHA 5U47A 4X6TA 1TDLA 1YLPA 2WZZA 3G2ZA 2XR0A 5DF9A 1NY0A 5DF7A 2ZQ7A 4FD8A 4ID4A 4PMAA 2EX6A 4EV4A 2HDRA 3OC2A 3FZCA 3FV7A 1MXOA 2Q9NA 4LENA 5EE8A 3UO9A 2J8YA 3C7UA 4P6BA 5FAPA 5M19A 2G2WA 3HL9A 4N9KA 3UDXA 3HVFA 3QHYA 4JBFA 2J7VA 4BL2A 5BOHA 1O07A 2X02A 4JLFA 1HTZA 1CI8A 3SH7A 3UDIA 4KZAA 3IF6C 2XF3A 5FQKA 1G68A 3O3VA 3IWOA 4NETA 3DW0A 3P09A 3B3XA 4GNUA 3HUOA 1K25A 5E2EA 3GMWA 4OOMA 2JBFA 4EUZA 3EQVA 5JYOA 1KDWA 3LEZA 4KQOA 3ZG7B 3MBZA 4C3QA 4WELA 4ZJ3A 1K54C 2X71A 2Y2JA 3NIAA 2ZQ9A 4GOGA 1M6KA 5F82A 5GLCA 3MZDA 5KSHA 4GN2A 4ZBEA 5J8XA 4GB7A 3ZG8B 1DY6A 5FASA 3DWKA 5GHYA 3IXGA 1YQSA 3VP3A 4S2LA 4DKIA 2EXAA 4PPRA 2XD5A 5GL9A 3BFCA 1LI0A 3BYDA 4N1XA 3VP0A 2Y2HA 2IWCA 3IH9A 1ERMA 5CHJA 1YMXA 1GHMA 3VP1A 2UWXA 2H0YA 5DVAA 1BLPA 4BQMA 5HAPA 1PZOA 4WEJA 2GDNA 4C6YA 4F94A 2ZQDA 4LCLA 4BL3A 3S4XA 1HD8A 3M6HA 2JC7A 4D2OA 2A3UA 3WS1A 4E6WA 2JCHA 1KVMA 4FSFA 2Y2NA 1GA9A 2WKIA 4IBRA 2ZC3B 4EBLA 2HP9A 2P74A 4R3JA 1PIOA 1W7FA 1WYBA 3ZNTA 2ZC5B 2XK1A 3A3FA 3HLGA 2C6WB 3C4OA 1Q2QA 1BSGA 4DE1A 4XXRA 1FR1A 1I2WA 1I5QA 2Y2QA 4U3TA 1PZPA 1K38A 2XGNA 3VSKA 2XDMA 5A90A 1FSWA 3HUMA 3AGFA 4Y0OA 4BENA 4E3JA 3CMZA 5FQ9A 1VQQA 2ZJ9A 1L0GA 1RP5A 2ZC4B 3A3JA 3SOIA 3W4PA 1ERQA 4HBUA 4OQIA 3LY4A 2Y2IA 1YM1A 3IQAA 3HLCA 3M6BA 3VP4A 2RCXA 4Q8IA 3BECA 2IWBA 2FFFB 1ESUA 1E25A 5CRFA 3ZFZA 3HLBA 2JE5A 5EVID 1MY8A 3NCKA 3WS2A 2HP6A 4PM7A 1IKIA 2Y2GA 4FH2A 3UY6A 4X56A 2VGKA 3TG9A 4UHUA 2WK0A 5I94A 1TVFA 2XEPA 1H5XA 1JWZA 2P9VB 4JF5A 1EROA 3MXRA 5EECA 1SCWA 4R4SA 5FI7A 4MBHA 3ISGA 1XXMA 3QNBA 4DXCA 1BZAA 2ZQAA 3IF6A 3O88A 4QU3A 4C75A 1K57C 3ZVTA 5EVIB 5KMWA 4QY5A 4MBKA 2HP5A 5IHVA 3IH8A 4WM9A 4QD4A 5F1GA 3TOIA 4S2JA 1ESIA 1CK3A 4E3KA 4ZAMA 2WAFA 4MNRA 5CGXA 2WUQA 1NXYA 1NYYA 5E2HA 2Y91A 4OQ0A 1MWRA 3IXDA 3JYIA 3V50A 4B4XA 2Y2MA 4OPZA 3D4FA 5CGWA 5TFQA 1WYCA 3UN7A 1W5DA 4QB8A 3G30A 5KSCA 5EPHA 4WBGA 4U0TA 4H8RA 5HARA 4WMCD 3BLSA 2CC1A 3ZGAB 1ZKJA 1LHYA 2Q9MA 3VOZA 1IYSA 2X01A 3ITBA 3PBRA 5FAQA 4P0MA 3RXXA 1ALQA 4DE0A 1JWPA 4IBXA 3MFDA 4S2OA 1KGGA 4LV0A 3UE1A 1BULA 1S0WA 1XA7A 5AQ7A 3UE0A 5TR7A 3IHBA 4EWFA 2EFUA 3BM6A 3HLFA 2WGWB 4S2NA 4CPKA 1IYOA 1PI5A 3SH8A 4KG6A 3A3IA 5EOEA 3WRTA 3UPOA 2WZXA 3OCNA 4KZ6A 3G34A 1ES2A 5FQMA 2ZD8A 5CGSA 5FA7A 1XGJA 3UE3A 3UNWA 2HPBA 4HBTA 1K6RA 1K55C 1KVLA 3O86A 4M3KA 3HBRA 4S2IA 5E2FA 3UPNA 3WS5A 4KENB 5AQ9A 1KE4A 1TEMA 3AGEA 2EFXA 3IXBA 3M2JA 3A3DA 4HESA 5DF8A 5M18A 1QMEA 1YT4A 1ZC2A 4L0LA 3ZHHA 1DJBA 2OV5A 5FAOA 3DWZA 1BTLA 2C5WB 3GTCA 5FQJA 4KQQA 4IEDA 5HX9A 4ZDXA 1BUEA 4PM6A 1PWGA 3ZNYA 1K56D 3FKWA 4KZ3A 2ZC7A 2PU4A 1XA1A 2VGJA 4UA9A 4OPYA 3LO7A 2XFTA 5G18A 1FR6A 1XPBA 2BG1A 2QZ6A 1FCNA 3P98A 2ZM2A 2V1ZA 5FQQA 1L2SA 5A93A 1CEFA 4UAAA 4LV1A 1K57A 2H10A 3FKVA 1YMSA 2OLUA 3S1YA 4DF6A 4OP8A 2G2UA 4BD1A 4MEZA 5D3OA 4KZ5A 4S2NC 5EVLA 2PBYA 1GCEA 4EBNA 1OMEA 3PBQA 2EX2A 1LI9A 3W4OA 1Q2PA 3BEBA 4WMCA 1E3UA 4JF6A 3M2KA 1PWDA 3N8RA 4R0QA 2DRWA 5AQBA 1L0DA 5GHXA 3RJUA 3V39A 1QMFA 4OP5A 3N8LA 5JYPA 4FH4A 2WGIA 1WE4A 2XQZA 1BLCA 1FQGA 4KQRA 3G35A 5HW3A 2WGVA 4IVKA 3IHAA 4JKTA 5EVIC 2XD1A 3GR2A 3C4PA 3TSGA 4E3LA 1MPLA 4BLMA 1E4DA 1NZOA 1NJ4A 5FI2A 4K0XA 2PU2A 1M40A 3DTMA 2XFSA 4OONA 3Q1FA 4EQIA 3IWIA 3NI9A 4OLGA 2DCFA 5AQAA 3UPPA 2J9PA 1SKFA 4E3MA 1L0FA 1MKIA 3BFFA 5CEBA 3O87A 4DE2A 1RGYA 4P85A 3G4PA 1YLYA 3Q07A 4E3NA 5CEDA 1LL5A 2HDQA 1H8ZA 1IEMA 3IF5A 1SDEA 4KZ4A 5F83A 3E2KA 1MWUA 4P87A 3Q7VB 4S2KA 3RXWA 1FSYA 4GDNA 4KG2A 1K55A 1JTGA 3G32A 4GD8A 4PM9A 3G31A 3MZEA 4JF4A 4JPMA 3C7VA 1W8YA 3NDGA 4R23A 3S22A 3FWLA 3Q81A 1Y54A 3QNCA 4R4RA 4CJNA 1GHIA 1VM1A 5CERA 5TGFA 3HLEA 4QJGA 1FOFA 5HAIA 4OQHA 5FI6A 4IVIA 4RYEA 1G6AA 1AXBA 5FATA 3WRZA 3OPLA 4RVAA 3VP2A 3LCEA 3VMAA 1S6RA 4DRTA 4ZJ1A 4Y0TA 3VFHA 2WAEA 4ZTKA 3ZG9B 4OOLA 2ZC6B 4BJPA 3Q7ZA 2Y2LA 1N4OA 4OKPA 4KG5A 5HL1A 2DNSA 2Y2OA 1NZUA 4MLLA 4RX3A 3PAEA 3MZFA 4OPQA 4S2MA 4FCFA 4WZ4A 4X69A 4MBFA 1ONGA 1KGFA 1JTDA 5DTTA 3SH9A 4X68A 1ZG6A 1FCMA 3IXHA 1W79A 2EX9A 3N6IA 4DDSA 5F1FA 1I2SA 2ZMAA 3ZG5A 4UA6A 3PTEA 1ZG4A 4N92A 4WEKA 5HFOA 4ZJ2A 3ZVWA 3N4IA 3PAGA 5A92A 3N8SA 1K4EA 4JXVA 2ZM8A 4OLDA 3MXSA 1SHVA 1JVJA 2P9VA 4B4ZA 2Y2PA 3Q7VA 4XUXA 1CEGA 4OPRA 2R9WA 1HZOA 3ZDJA 1PYYA 3HLWA 5CTMA 5EVIA 3ZCZA 3GVBA 4KZ7A 4QY6A 2Y4AA 1L0EA 3CZDA 4LV3A 1MWTA 1RCJA 2WKEA 3A3EA 4KZ8A 3WS0A 1XKZA
chains in the Genus database with same CATH superfamily
4BD0A 4CQHA 5EOOA 3VOYA 2DMWA 2QPNA 1LLBA 2O9AA 3CITA 1NLZA 2Y2KA 3IX8A 1P9RA 3VFFA 1CI9A 4GS9B 2FH5A 2VV7A 4UA7A 1VHMA 1YLWA 2I72A 4GZBA 2Y59A 1SDNA 2E8IA 4OQGA 3C38A 2M1CA 3HUNA 2A49A 4DXBA 2QMIA 3HREA 2H0TA 4CLCB 5HDCA 1S4SA 3KYEA 2XA7S 2M7VA 3WWXA 4EEUA 1YSPA 1GHPA 4EESA 4X53A 2IWDA 4OVDA 3VE3A 2G7UA 1YLTA 4GLQA 3NDEA 4JGOA 3OCLA 3PBTA 4EUVA 3MKFA 3Q82A 4GS9A 3KO6A 2P04A 4R3BA 4QHCA 1KE0A 5DKKA 1ES5A 3T1SA 4DDYA 3GV9A 5FDSA 1GSWA 3P01A 5HL6A 3MFXA 5HWWA 1DJAA 5KZHA 2XRNA 4N1HA 4E3OA 4XUZA 1TDGA 1N9LA 1FILA 1LL9A 3PBSA 2PBDP 4K0WA 4IUKA 1UWNX 1H8MA 2HDUA 1GA0A 3BY9A 1F2KA 3D72A 4K08A 2PRFA 3G2YA 2AVXA 3ITAA 3LI8A 4DJ2A 1J9MA 3GSGA 3MKEA 1W8QA 1E3UD 2PR6A 3E4QA 4N9LA 2EX8A 4BBVA 5AJGA 1YLPA 5FL3A 5DF7A 4FD8A 2QHKA 4ID4A 3OC2A 2Q9NA 2V1BA 3C7UA 1Y4OA 1K0KA 4IUHA 1CI8A 1G68A 3O3VA 3P09A 3B3XA 4NKPA 1ODVA 1S67L 2JBFA 5JYOA 3EQVA 3LEZA 4ZJ3A 2X71A 3NIAA 1S4RA 2ZQ9A 5F82A 1P97A 4GN2A 3ZG8B 5FASA 4JGPA 3DWKA 4S2LA 2XD5A 2GX5A 1ERMA 3HJIA 1BYWA 4F94A 2ZQDA 5FEFA 3S4XA 3WS1A 5KIZA 2QYBA 4IBRA 2HP9A 4HH3A 1PIOA 3TRCA 3C4OA 4LRZE 3CPTB 1BSGA 4WUJA 1I5QA 3UE6A 5A90A 1PZPA 3RH8B 2GJ3A 3U4LP 3HUMA 4BENA 3MR0A 3W4PA 2ZC4B 3SOIA 3OLOA 3IQAA 3HLCA 3M6BA 3ZYTA 1CJFA 2FFFB 1ESUA 1F5MA 5CRFA 3ZFZA 4L9FA 3NCKA 3WS2A 3UY6A 2JKTM 3TG9A 2WK0A 5I94A 3DAVA 2XEPA 3UMDA 5AVFA 1XXMA 1W63Q 2ZQAA 2VA0A 3ZVTA 4QY5A 5IHVA 3CWFA 4S2JA 2HF6A 4H6JA 4ZAMA 4MNRA 2WUQA 4Y3IA 2Y91A 4GCZA 2Y2MA 5TFQA 3D4FA 5CGWA 4H8RA 2JN7A 5HD3A 2Q9MA 3L9KA 3UE1A 3LR5A 1BULA 3MSHA 3IHBA 3BM6A 3H82A 1W63M 3H9WA 3KSIA 3UPOA 5CGSA 1XGJA 5K5BA 1TD5A 3HCYA 4HBTA 1K6RA 1K55C 4RQ9A 5DJTA 3E4PA 3UPNA 3IX3A 5AQ9A 1TEMA 3M2JA 4HESA 3DTIA 5DF8A 5M18A 4L0LA 1DJBA 2PD7A 2K7SA 1G6OA 1BTLA 2C5WB 3GTCA 5HX9A 1XA1A 4UA9A 5G18A 4R38A 1OPXA 1FR6A 3P98A 5FQQA 4UAAA 5CX7A 4L9GA 5EM1A 3NULA 1VETA 2G2UA 4BD1A 2HGVA 4KZ5A 4NXEA 4S2NC 5EVLA 4YOFA 4EBNA 1OMEA 3PBQA 2O9BA 1Q2PA 4WMCA 1E3UA 4JF6A 4R0QA 2DRWA 3FC7A 4OP5A 2V8CA 5JYPA 2V0WA 4EERA 3P7NA 3DTEA 3EEHA 2ZBBA 2WGVA 4IVKA 3GR2A 4E3LA 1E4DA 5FI2A 1VEUB 4ESPA 2XFSA 4OONA 5C5KA 3NI9A 3UB8A 1SKFA 3BFFA 1MKIA 3D9YA 3SZTA 5CEBA 3O87A 4E3NA 4MMNA 4EXOA 5L8MA 2A2LA 1MWUA 3RXWA 4GDNA 3G32A 4GD8A 3D3OA 3MZEA 4JPMA 3NDGA 4HH2A 4R23A 1Y54A 1VB6A 4EEPA 4R6LA 2W3FA 4DJ3A 4OQHA 5FI6A 1Y28A 1GSVA 4RYEA 1G6AA 3ULFA 3VP2A 2WAEA 3ZG9B 1N4OA 1ZHHB 2QJ7A 3CUEA 3K2NA 2Y2OA 1TS8A 1S1YA 4WZ4A 1KGFA 1JTDA 3V67A 3KSHA 4X68A 1FCMA 2VKSA 2ZOHA 4Y17A 4UA6A 4ZJ2A 3ZVWA 1AWIA 5A92A 4OLDA 1JVJA 2Y2PA 3EGDC 4XUXA 1CEGA 3ZDJA 1PYYA 2FZ0A 3BQ8A 3ZCZA 4GHIA 4KZ7A 2Y4AA 1L0EA 4LV3A 1RCJA 4KZ8A 3VOLA 2OLVA 2W3HA 2WADA 1OTEA 3ZQ5A 4Y7PA 1NYMA 2QKPA 5CTNA 4LCMA 3F1OB 5HAQA 3V3RA 2ZLYA 2M7UA 4PM5A 1L3LA 2HDSA 4FOFA 1A0KA 4JXSA 2V20A 2VLGA 3WS4A 2L4RA 4CLCD 2A24B 3EEAA 1YLZA 4KUOA 4Z9QA 3QP2A 1K6SA 2P08A 1D7EA 4HQAA 2BLSA 3FPVA 3H7WA 5GLDA 3IF6B 2B5RA 5HZHA 3NJAA 1ES3A 1DJCA 5L2FA 3N7WA 4Y0UA 4EW7A 4HI4A 3NY4A 4YFMA 1ES4A 1XX2A 3HJKA 3UDFA 2Y79A 1HVBA 1G28A 3UB5P 1RGZA 4WZ5A 2ZM0A 4RX2A 1N9NA 4K91A 2W0NA 5FQIA 1NWZA 1D06A 4KZBA 2VV8A 5DTKA 2H28A 1KDSA 2Y55A 3SS3A 3UB7A 2ACGA 1EW0A 1ONHA 1T1CA 3AGDA 3GQZA 1MWSA 1EWZA 2K31A 3S7OA 4I5SA 5CECA 2ZQ8A 3OPHA 3PBNA 1MC0A 2J3TC 4WYYA 3QP5A 2PAVP 2ZQCA 5E43A 1K54A 4BMWA 1NRFA 4WLAA 1BLSA 3CJMA 3OPPA 4LV2A 4NK3A 4EQ1A 1BLHA 4X6TA 5IT5A 5EVEA 3OBFA 2ZQ7A 3FZCA 3FV7A 4LENA 4PKYA 2G2WA 1TS0A 3HL9A 4ME4A 5HWVA 2J7VA 3IBJA 3R4KA 5HDDA 4BL2A 1OJGA 2XF3A 5FQKA 2K2NA 4GNUA 2NUPC 1OJ5A 5E2EA 4OOMA 5G4ZA 4EUZA 5HDSA 4C3QA 4WELA 4UQIM 1M6KA 4WL9A 2E8JA 5DJUA 2ZL1A 5GHYA 1LI0A 3VP0A 2Y2HA 3IH9A 4BBTA 1S1ZA 3VP1A 2UWXA 2P7JA 4WEJA 3NOPC 3T1RA 2GZAA 2A3UA 4E6WA 2JCHA 4FSFA 2WKIA 2ZC3B 4EBLA 1W7FA 3ZNTA 3A3FA 3HLGA 2C6WB 1Q2QA 2JKFA 4XXRA 1FR1A 1I2WA 2Y2QA 3VSKA 2XGNA 2XDMA 4Y0OA 2ZJ9A 1L0GA 1ERQA 3VP4A 4NXFA 2IWBA 1F98A 1SZVA 2JKRM 4PM7A 1IKIA 4FH2A 1TVFA 2P9VB 1EROA 3MXRA 1OTIA 1BZAA 4C75A 4JGRA 5EVIB 4GW9A 4CLCA 3IH8A 5AVEA 4QD4A 3NHQA 1XJ2A 1CK3A 5TBMB 5CGXA 1NXYA 4II7A 3FG8A 1MWRA 3IXDA 3V50A 3UN7A 1WYCA 4WBGA 5HARA 4WMCD 3BLSA 3ZGAB 1ZKJA 3E0YA 3S7QA 3VOZA 2X01A 3ITBA 1XJ6A 5FAQA 3RXXA 4IBXA 4S2OA 2LB9A 5TR7A 4CPKA 2XA7M 2WGWB 4EU0A 1PI5A 3SH8A 5EOEA 2WZXA 1ES2A 5FQMA 3O86A 3LIEA 4M3KA 1LL8A 4HJ3A 3IXBA 3A3DA 5HPIA 1QMEA 1YT4A 4Z1WA 1YKDA 3NOUC 5FQJA 4IEDA 1BUEA 3MMHA 1K56D 4KZ3A 2EWWA 4AFIA 2PU4A 4ZRRA 3CUEC 4OPYA 4R3AA 3S7NA 1XPBA 2BG1A 2ZM2A 4MCWA 1T18A 5A93A 1CEFA 4LV1A 1K57A 5D3OA 3BEBA 3TE8A 4EETB 3RJUA 3V39A 4O01A 2UV0E 2KLIA 3LICA 3N8LA 3A0SA 4FH4A 2WGIA 5HW3A 2O0YA 1OTDA 1CQAA 2XD1A 3C4PA 1MPLA 4BLMA 1M40A 3DTMA 4EQIA 3IWIA 4D60A 2WKPA 4E3MA 5EM0A 2KOIA 1XJ3A 1IEMA 3LUQA 4KZ4A 4X25A 1FSYA 4KG2A 1JTGA 3MF0A 1W8YA 4XT2B 3FWLA 3Q81A 4R4RA 5CERA 1H0MA 3HLEA 4HIAA 1JNUA 2VJWA 4G3KA 4RVAA 2W1TB 4DRTA 4ZJ1A 4Y0TA 3U2AA 4BJPA 3KYZA 1NZUA 3CPTA 4RX3A 3PAEA 4MBFA 1ONGA 3B47A 1XFNA 3SH9A 1W79A 5F68A 1V9ZA 5F1FA 3KYQA 3ZG5A 2ZOIA 2OOLA 3N4IA 1GSXA 3T4KA 3N8SA 2BTFP 1K4EA 3PXPA 1KOUA 2R9WA 4JGQA 3HLWA 5CTMA 4Y15A 4XT2A 3GVBA 4QY6A 3GDIA 4NG2A 1MWTA 3LGOA 3MQ0A 1SKOB 4JXWA 2CMNA 2W1TA 1MKMA 3CG5A 4RA7A 2V1AA 5E2GA 1IELA 3GRJA 2FFYA 5A91A 1PI4A 3CLOA 1MBLA 2PR5A 2XH9A 2HZ5A 3QP8A 2J9OA 1T19A 4O7DA 4P6ZS 3ZG0A 4NXGA 3DTKA 4UEYA 2B18A 3NC8A 3C5AA 3A0VA 4OH0A 3LI9A 2QJ5A 5J7EA 1IKGA 3PBOA 1DP8A 3V3SA 1JWVA 1PW1A 4S2PA 1PW8A 1FCOA 4HEFA 5TJJA 4O0PA 4JXGA 4Y13A 3BFDA 3I7JA 3KSFA 1K4FA 1IYPA 1KGEA 2VEAA 4X1LA 5GLAA 3BRMA 3W4QA 4DE3A 4MN5A 1K56A 1BT5A 1V9YA 2W3GA 2R9XA 2WKHA 4OOYA 5CHUA 1NLYA 2OSUA 2W27A 5GLBA 4HJ4A 4KZ9A 4HNBA 4B9OA 3F1PB 5CHMA 2H5SA 2Z2MB 1VEUA 4E04A 3FYZA 1XP4A 5FSRA 4IJGA 4P6ZM 5EUAA 1LSXA 4I39A 3SS5A 1LT0A 5U47A 1LSWA 2WZZA 2OAP1 5DF9A 1NY0A 4PAUA 1UWPX 4PMAA 4EV4A 1MXOA 2J8YA 3KSGA 4P6BA 5FAPA 5M19A 3UDXA 3QHYA 3EWKA 4JBFA 2VK3A 3QP1A 1OTAA 3A0RA 2X02A 1HTZA 2PD8A 1DP9A 2KDKA 2NUTC 3IWOA 3T4QA 2V9AA 3DW0A 5HSQA 4CLCC 3IS2B 1K25A 2J80A 1KDWA 4KQOA 3ZG7B 3KX0X 2Y2JA 3S7PA 4HJ6A 5KSHA 3LIDA 4ZBEA 1DY6A 1YQSA 4DKIA 2EXAA 1TS7A 5GL9A 4N1XA 5CHJA 1YMXA 5DVAA 4BQMA 1PZOA 1ZTUA 2GDNA 4BL3A 1HD8A 3M6HA 2JC7A 1KVMA 2J3WA 2Y2NA 2P74A 2ZC5B 2XK1A 4ETZA 4BBUA 2EA9A 1OT9A 4U3TA 1K38A 4L9EA 2ZMVA 4I3IA 4E3JA 5I5LA 3F1OA 3PYPA 3QP6A 1P0ZA 3L7HA 1YM1A 4HOIA 4Q8IA 2B95A 3BECA 2JKTI 3JVVA 4F3LB 1E25A 5J4EA 5EVID 1MY8A 2HP6A 3LFVA 2A24A 4UHUA 3FPWA 1H5XA 4JF5A 5EECA 3TW8A 1SCWA 4R4SA 2IA2A 3ISGA 4DXCA 3IF6A 3O88A 4QU3A 1K57C 2PYPA 4MBKA 2HP5A 4WM9A 1YPRA 5F1GA 4I3JA 3JVUA 4B4XA 1W5DA 4QB8A 4R70A 2CC1A 4YNRA 2LB5A 5L09A 3EOIA 3PBRA 1P9WA 2VGLS 4P0MA 1ALQA 4DE0A 1PRQA 1JWPA 3MFDA 4LV0A 1S0WA 5AQ7A 3CI6A 3UE0A 4EWFA 4S2NA 2EFUA 1IYOA 2D01A 3MQQA 3WRTA 4F3LA 4KZ6A 3G34A 3MXQA 2MJ6A 4Q0JA 3UNWA 3HBRA 4KENB 1KE4A 3AGEA 3ZHHA 1DP6A 4ZDXA 4KQQA 1T1BA 3MQOA 4PM6A 1PWGA 3ZNYA 3LYXA 2VGJA 2HJ9C 5F6AA 2YKHA 3LO7A 2QZ6A 2V1ZA 4NEED 1L2SA 2Y8HA 1IFQA 4NXBA 1YMSA 2OLUA 4DF6A 4OP8A 4MEZA 1LI9A 3W4OA 3VV4A 5GHXA 2YKFA 1QMFA 3MS6A 1WE4A 2XQZA 1BLCA 1STZA 2B02A 3G35A 4DMZA 3TSGA 1NJ4A 4K0XA 2D02A 4G3VA 2O99A 2VGLM 4OLGA 3UPPA 2J9PA 1L0FA 5DFYA 4DE2A 2L0WA 1RGYA 3Q07A 5CEDA 1LL5A 2HDQA 1H8ZA 3IF5A 1SDEA 5F83A 1J3WA 3T1XA 3VE4A 3R7WB 4PM9A 1UGUA 3S22A 4CJNA 5TGFA 4QJGA 3MJQA 5HAIA 2OWJA 5J3WA 4IVIA 5FATA 1AXBA 3WRZA 3OPLA 3LCEA 1S6RA 3VFHA 1XFQA 4OKPA 5HL1A 4MLLA 4OPQA 3C30A 3T4TA 4FCFA 3NOTC 4X69A 4LRXC 2KX6A 2W1RA 3SW1A 3T4SA 3LR0A 1ZG6A 4LPZA 2EX9A 1G5UA 4DDSA 1I2SA 3LIBA 3BY8A 4G3WA 3PTEA 1ZG4A 3B42A 4N92A 4WEKA 4YWZA 2VX8A 2ZM8A 3MXSA 2P9VA 3R7WA 4OPRA 1HZOA 5EVIA 4ETXA 3PR6A 3CZDA 4IHQA 5F69A 5MC7A 3T4OA 3WS0A 2Z2LB 1XKZA 5TBMA 1C3BA 1YLJA 5IS1A 1X0OA 3EQUA 3T4LA 2XLNA 5FDHA 1WA9A 3K3CA 4Y2FA 4X55A 2VV6A 5CXWA 1TF1A 1CF0A 2PYRA 3QP4A 3BLMA 4HHDA 4ARZB 4E6XA 2OWHA 1Z09A 4U0XA 4GDBA 2WGWA 4GKUA 3HLDA 5GHZA 4PM8A 1TS6A 1PNEA 4WN5A 4H6JB 3UMEA 2RL3A 1KE3A 3E98A 1DRMA 1IOUA 2I9VA 1N9BA 3NBLA 3LIFA 4GD6A 3C2WA 3BFEA 3IT9A 4FTXA 2WYXA 5F5YA 4LRYC 3EGXC 3W8KA 1O7EA 3VSLA 3H82B 3OZHA 5DTSA 2XROA 1PWCA 3BFGA 1IYQA 1XGIA 3SS4A 2W3EA 4ARZA 3T50A 3LY3A 3JPUA 5M1AA 3OPRA 1F9IA 1H8YA 4QWOA 4R1GA 2V2FF 4PHTA 1EI5A 1U60A 3CAXA 3C8CA 3V5MA 3O5YA 4YINA 3F1NB 3NECA 3E2LA 2EXBA 4EBPA 3IWQA 4DN0A 2HV1A 2W3DA 4B88A 4WZ5C 1Z6FA 4A5RA 5A8BA 5G4YA 4E3IA 4X1MA 1TDLA 3G2ZA 5HPFA 1VETB 2XR0A 3T4JA 2EX6A 2HDRA 3UO9A 1OT6A 5EE8A 4N9KA 2WKQA 3HVFA 4Y5FA 5LBRA 4MN6A 5BOHA 1O07A 2R78A 2ZMFA 2INWA 4JLFA 3UDIA 3SH7A 4KZAA 3IF6C 3PHYA 4NETA 3HUOA 3GMWA 5L07A 4I3AA 3MBZA 3F1NA 1K54C 4GOGA 5GLCA 3MZDA 4BWIA 5J8XA 4GB7A 2GNXA 3IXGA 4LGWA 3VP3A 1PFLA 4PPRA 3BFCA 3BYDA 3LIAA 2IWCA 1GHMA 5FEGA 2H0YA 1H3QA 1BLPA 5HAPA 3OOVA 4C6YA 4LCLA 1HLUP 4D2OA 3G6OA 4GJ4A 1GA9A 4R3JA 1WYBA 1SKOA 4DE1A 1FSWA 3AGFA 3CMZA 5FQ9A 1VQQA 1RP5A 3A3JA 3BQAA 3BJNA 4HBUA 4OQIA 2JKRI 3LY4A 2Y2IA 3DBAA 3RFBA 2HJEA 2RCXA 4KQDA 3E4OA 4M4XA 4WF0A 3HLBA 2JE5A 2Y2GA 4X56A 2VGKA 1JWZA 1YSQA 4Q0IA 2XSSA 5FI7A 4MBHA 3QNBA 5KMWA 3IX4A 4GHIB 3TOIA 1ESIA 4E3KA 2WAFA 1FIKA 2Z6DA 1NYYA 5E2HA 4OQ0A 4FUWA 3UB9A 3JYIA 1YAXA 4OPZA 3G30A 4B93A 5KSCA 5EPHA 4U0TA 2L1MA 1LHYA 5HD5A 1IYSA 2V0UA 3LEQA 5IU1A 1KGGA 1XA7A 3HLFA 2JHEA 4KG6A 3A3IA 2PDRA 3OCNA 2OAQ1 3H7WB 2ZD8A 5FA7A 4HY8A 3UE3A 2HPBA 1T1AA 1KVLA 4S2IA 5E2FA 3WS5A 2EFXA 3GECA 1ZC2A 2OV5A 4KUKA 5FAOA 3DWZA 1OTBA 4QPRA 4MDZA 3F1PA 3FKWA 4Q0HA 2ZC7A 4MN7A 2Z6CA 3BW6A 2XFTA 3LR4A 4LLOB 3TJZC 1FCNA 1LSVA 5EV0A 3FKVA 2H10A 3S1YA 2V8FA 3T12B 4CLCE 2PBYA 2PT7A 1GCEA 3CHWP 2EX2A 5EFWA 1N9OA 5DFXA 3M2KA 1PWDA 3N8RA 5AQBA 1L0DA 5HWTA 1FQGA 4KQRA 1ACFA 1D1JA 3IBRA 3IHAA 4JKTA 5EVIC 3UB6A 1NZOA 3IS2A 2PU2A 3B33A 3Q1FA 5AQAA 2DCFA 4I38A 4P85A 2O9CA 1YLYA 3G4PA 3E2KA 4P87A 3Q7VB 4S2KA 1K55A 3G31A 4JF4A 3C7VA 3QNCA 1GHIA 1VM1A 3LR3A 4UQIS 5L10A 2BASA 1FOFA 1S66L 4PKYG 3BWLA 3VMAA 2PHYA 4ZTKA 4OOLA 1NRJA 3T1QB 2ZC6B 3Q7ZA 2Y2LA 4KG5A 2DNSA 2Q0OA 4O8GA 3MZFA 4S2MA 5DKLA 1XJ4A 5DTTA 3K3DA 3IXHA 2ZL1B 2J3TD 3N6IA 2JKGA 3ICYA 2ZMAA 4LFUA 5HFOA 3PAGA 2WKRA 4JXVA 4HP4A 1SHVA 4HP9A 4B4ZA 3Q7VA 2QWSA 2EWVA 3RTYA 3W2ZA 2WKEA 3A3EA 1MZUA 2VZWA
chains in the Genus database with same CATH topology
4BD0A 5EOOA 4JXWA 3VOYA 2QPNA 2OLVA 1C3BA 1YLJA 2WADA 3CG5A 1LLBA 4RA7A 2Y2KA 4Y7PA 1NYMA 3VFFA 3EQUA 2XLNA 4LCMA 5CTNA 5E2GA 5FDHA 1IELA 3GRJA 5HAQA 2FFYA 3V3RA 2ZLYA 1CI9A 4X55A 5A91A 1PI4A 4PM5A 2HDSA 4UA7A 1MBLA 5CXWA 1YLWA 2XH9A 4JXSA 2V20A 2I72A 3WS4A 2J9OA 4GZBA 4O7DA 2Y59A 3ZG0A 3BLMA 4E6XA 4U0XA 1SDNA 1YLZA 2E8IA 4GDBA 2WGWA 4GKUA 4Z9QA 2Z2LB 3NC8A 1K6SA 3HLDA 4OQGA 3HUNA 2A49A 4DXBA 2BLSA 2QMIA 3C5AA 5GLDA 3IF6B 4OH0A 2B5RA 3HREA 2H0TA 1ES3A 5GHZA 1IKGA 1DJCA 3PBOA 4PM8A 5L2FA 3N7WA 4Y0UA 3V3SA 1JWVA 2RL3A 1PW1A 1KE3A 1PW8A 4S2PA 1FCOA 4HEFA 3WWXA 3NY4A 4YFMA 1ES4A 1GHPA 1XX2A 3UDFA 1N9BA 1HVBA 4JXGA 4X53A 3NBLA 4GD6A 1RGZA 2IWDA 4OVDA 3BFEA 3IT9A 4WZ5A 3BFDA 2ZM0A 1YLTA 4RX2A 3I7JA 2WYXA 3NDEA 1K4FA 3OCLA 3PBTA 4K91A 3MKFA 3Q82A 1IYPA 1KGEA 3W8KA 1O7EA 5FQIA 5GLAA 3BRMA 3W4QA 3VSLA 4DE3A 4KZBA 4R3BA 4QHCA 3OZHA 1K56A 5DTSA 1KE0A 1PWCA 1BT5A 1IYQA 3BFGA 5DTKA 1XGIA 1KDSA 2Y55A 1ES5A 3SS4A 3SS3A 4DDYA 1ONHA 3AGDA 3GQZA 3GV9A 1MWSA 2R9XA 3LY3A 1EWZA 1DJAA 2WKHA 3OPRA 5M1AA 5KZHA 1H8YA 4OOYA 4R1GA 5CHUA 5CECA 2V2FF 4N1HA 4E3OA 1EI5A 2ZQ8A 2OSUA 4XUZA 1TDGA 3OPHA 3PBNA 5GLBA 1LL9A 1U60A 4KZ9A 3PBSA 4WYYA 3V5MA 4K0WA 4YINA 3E2LA 2ZQCA 2EXBA 4EBPA 3IWQA 5E43A 2HDUA 1GA0A 5CHMA 2H5SA 2Z2MB 1K54A 3FYZA 1XP4A 5FSRA 5EUAA 3G2YA 4B88A 1NRFA 3ITAA 4WZ5C 1J9MA 1Z6FA 3GSGA 4A5RA 1BLSA 3CJMA 3MKEA 1W8QA 3OPPA 4LV2A 4NK3A 1E3UD 4E3IA 4N9LA 2EX8A 3SS5A 1BLHA 5U47A 4X6TA 1TDLA 1YLPA 2WZZA 3G2ZA 2XR0A 5DF9A 1NY0A 5DF7A 2ZQ7A 4FD8A 4ID4A 4PMAA 2EX6A 4EV4A 2HDRA 3OC2A 3FZCA 3FV7A 1MXOA 2Q9NA 4LENA 5EE8A 3UO9A 2J8YA 3C7UA 4P6BA 5FAPA 5M19A 2G2WA 3HL9A 4N9KA 3UDXA 3HVFA 3QHYA 4JBFA 2J7VA 4BL2A 5BOHA 1O07A 2X02A 4JLFA 1HTZA 1CI8A 3SH7A 3UDIA 4KZAA 3IF6C 2XF3A 5FQKA 1G68A 3O3VA 3IWOA 4NETA 3DW0A 3P09A 3B3XA 4GNUA 3HUOA 1K25A 5E2EA 3GMWA 4OOMA 2JBFA 4EUZA 3EQVA 5JYOA 1KDWA 3LEZA 4KQOA 3ZG7B 3MBZA 4C3QA 4WELA 4ZJ3A 1K54C 2X71A 2Y2JA 3NIAA 2ZQ9A 4GOGA 1M6KA 5F82A 5GLCA 3MZDA 5KSHA 4GN2A 4ZBEA 5J8XA 4GB7A 3ZG8B 1DY6A 5FASA 3DWKA 5GHYA 3IXGA 1YQSA 3VP3A 4S2LA 4DKIA 2EXAA 4PPRA 2XD5A 5GL9A 3BFCA 1LI0A 3BYDA 4N1XA 3VP0A 2Y2HA 2IWCA 3IH9A 1ERMA 5CHJA 1YMXA 1GHMA 3VP1A 2UWXA 2H0YA 5DVAA 1BLPA 4BQMA 5HAPA 1PZOA 4WEJA 2GDNA 4C6YA 4F94A 2ZQDA 4LCLA 4BL3A 3S4XA 1HD8A 3M6HA 2JC7A 4D2OA 2A3UA 3WS1A 4E6WA 2JCHA 1KVMA 4FSFA 2Y2NA 1GA9A 2WKIA 4IBRA 2ZC3B 4EBLA 2HP9A 2P74A 4R3JA 1PIOA 1W7FA 1WYBA 3ZNTA 2ZC5B 2XK1A 3A3FA 3HLGA 2C6WB 3C4OA 1Q2QA 1BSGA 4DE1A 4XXRA 1FR1A 1I2WA 1I5QA 2Y2QA 4U3TA 1PZPA 1K38A 2XGNA 3VSKA 2XDMA 5A90A 1FSWA 3HUMA 3AGFA 4Y0OA 4BENA 4E3JA 3CMZA 5FQ9A 1VQQA 2ZJ9A 1L0GA 1RP5A 2ZC4B 3A3JA 3SOIA 3W4PA 1ERQA 4HBUA 4OQIA 3LY4A 2Y2IA 1YM1A 3IQAA 3HLCA 3M6BA 3VP4A 2RCXA 4Q8IA 3BECA 2IWBA 2FFFB 1ESUA 1E25A 5CRFA 3ZFZA 3HLBA 2JE5A 5EVID 1MY8A 3NCKA 3WS2A 2HP6A 4PM7A 1IKIA 2Y2GA 4FH2A 3UY6A 4X56A 2VGKA 3TG9A 4UHUA 2WK0A 5I94A 1TVFA 2XEPA 1H5XA 1JWZA 2P9VB 4JF5A 1EROA 3MXRA 5EECA 1SCWA 4R4SA 5FI7A 4MBHA 3ISGA 1XXMA 3QNBA 4DXCA 1BZAA 2ZQAA 3IF6A 3O88A 4QU3A 4C75A 1K57C 3ZVTA 5EVIB 5KMWA 4QY5A 4MBKA 2HP5A 5IHVA 3IH8A 4WM9A 4QD4A 5F1GA 3TOIA 4S2JA 1ESIA 1CK3A 4E3KA 4ZAMA 2WAFA 4MNRA 5CGXA 2WUQA 1NXYA 1NYYA 5E2HA 2Y91A 4OQ0A 1MWRA 3IXDA 3JYIA 3V50A 4B4XA 2Y2MA 4OPZA 3D4FA 5CGWA 5TFQA 1WYCA 3UN7A 1W5DA 4QB8A 3G30A 5KSCA 5EPHA 4WBGA 4U0TA 4H8RA 5HARA 4WMCD 3BLSA 2CC1A 3ZGAB 1ZKJA 1LHYA 2Q9MA 3VOZA 1IYSA 2X01A 3ITBA 3PBRA 5FAQA 4P0MA 3RXXA 1ALQA 4DE0A 1JWPA 4IBXA 3MFDA 4S2OA 1KGGA 4LV0A 3UE1A 1BULA 1S0WA 1XA7A 5AQ7A 3UE0A 5TR7A 3IHBA 4EWFA 2EFUA 3BM6A 3HLFA 2WGWB 4S2NA 4CPKA 1IYOA 1PI5A 3SH8A 4KG6A 3A3IA 5EOEA 3WRTA 3UPOA 2WZXA 3OCNA 4KZ6A 3G34A 1ES2A 5FQMA 2ZD8A 5CGSA 5FA7A 1XGJA 3UE3A 3UNWA 2HPBA 4HBTA 1K6RA 1K55C 1KVLA 3O86A 4M3KA 3HBRA 4S2IA 5E2FA 3UPNA 3WS5A 4KENB 5AQ9A 1KE4A 1TEMA 3AGEA 2EFXA 3IXBA 3M2JA 3A3DA 4HESA 5DF8A 5M18A 1QMEA 1YT4A 1ZC2A 4L0LA 3ZHHA 1DJBA 2OV5A 5FAOA 3DWZA 1BTLA 2C5WB 3GTCA 5FQJA 4KQQA 4IEDA 5HX9A 4ZDXA 1BUEA 4PM6A 1PWGA 3ZNYA 1K56D 3FKWA 4KZ3A 2ZC7A 2PU4A 1XA1A 2VGJA 4UA9A 4OPYA 3LO7A 2XFTA 5G18A 1FR6A 1XPBA 2BG1A 2QZ6A 1FCNA 3P98A 2ZM2A 2V1ZA 5FQQA 1L2SA 5A93A 1CEFA 4UAAA 4LV1A 1K57A 2H10A 3FKVA 1YMSA 2OLUA 3S1YA 4DF6A 4OP8A 2G2UA 4BD1A 4MEZA 5D3OA 4KZ5A 4S2NC 5EVLA 2PBYA 1GCEA 4EBNA 1OMEA 3PBQA 2EX2A 1LI9A 3W4OA 1Q2PA 3BEBA 4WMCA 1E3UA 4JF6A 3M2KA 1PWDA 3N8RA 4R0QA 2DRWA 5AQBA 1L0DA 5GHXA 3RJUA 3V39A 1QMFA 4OP5A 3N8LA 5JYPA 4FH4A 2WGIA 1WE4A 2XQZA 1BLCA 1FQGA 4KQRA 3G35A 5HW3A 2WGVA 4IVKA 3IHAA 4JKTA 5EVIC 2XD1A 3GR2A 3C4PA 3TSGA 4E3LA 1MPLA 4BLMA 1E4DA 1NZOA 1NJ4A 5FI2A 4K0XA 2PU2A 1M40A 3DTMA 2XFSA 4OONA 3Q1FA 4EQIA 3IWIA 3NI9A 4OLGA 2DCFA 5AQAA 3UPPA 2J9PA 1SKFA 4E3MA 1L0FA 1MKIA 3BFFA 5CEBA 3O87A 4DE2A 1RGYA 4P85A 3G4PA 1YLYA 3Q07A 4E3NA 5CEDA 1LL5A 2HDQA 1H8ZA 1IEMA 3IF5A 1SDEA 4KZ4A 5F83A 3E2KA 1MWUA 4P87A 3Q7VB 4S2KA 3RXWA 1FSYA 4GDNA 4KG2A 1K55A 1JTGA 3G32A 4GD8A 4PM9A 3G31A 3MZEA 4JF4A 4JPMA 3C7VA 1W8YA 3NDGA 4R23A 3S22A 3FWLA 3Q81A 1Y54A 3QNCA 4R4RA 4CJNA 1GHIA 1VM1A 5CERA 5TGFA 3HLEA 4QJGA 1FOFA 5HAIA 4OQHA 5FI6A 4IVIA 4RYEA 1G6AA 1AXBA 5FATA 3WRZA 3OPLA 4RVAA 3VP2A 3LCEA 3VMAA 1S6RA 4DRTA 4ZJ1A 4Y0TA 3VFHA 2WAEA 4ZTKA 3ZG9B 4OOLA 2ZC6B 4BJPA 3Q7ZA 2Y2LA 1N4OA 4OKPA 4KG5A 5HL1A 2DNSA 2Y2OA 1NZUA 4MLLA 4RX3A 3PAEA 3MZFA 4OPQA 4S2MA 4FCFA 4WZ4A 4X69A 4MBFA 1ONGA 1KGFA 1JTDA 5DTTA 3SH9A 4X68A 1ZG6A 1FCMA 3IXHA 1W79A 2EX9A 3N6IA 4DDSA 5F1FA 1I2SA 2ZMAA 3ZG5A 4UA6A 3PTEA 1ZG4A 4N92A 4WEKA 5HFOA 4ZJ2A 3ZVWA 3N4IA 3PAGA 5A92A 3N8SA 1K4EA 4JXVA 2ZM8A 4OLDA 3MXSA 1SHVA 1JVJA 2P9VA 4B4ZA 2Y2PA 3Q7VA 4XUXA 1CEGA 4OPRA 2R9WA 1HZOA 3ZDJA 1PYYA 3HLWA 5CTMA 5EVIA 3ZCZA 3GVBA 4KZ7A 4QY6A 2Y4AA 1L0EA 3CZDA 4LV3A 1MWTA 1RCJA 2WKEA 3A3EA 4KZ8A 3WS0A 1XKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BD0 A;  5EOO A;  4JXW A;  3VOY A;  2QPN A;  2OLV A;  1C3B A;  1YLJ A;  2WAD A;  3CG5 A;  1LLB A;  4RA7 A;  2Y2K A;  4Y7P A;  1NYM A;  3VFF A;  3EQU A;  2XLN A;  4LCM A;  5CTN A;  5E2G A;  5FDH A;  1IEL A;  3GRJ A;  5HAQ A;  2FFY A;  3V3R A;  2ZLY A;  1CI9 A;  4X55 A;  5A91 A;  1PI4 A;  4PM5 A;  2HDS A;  4UA7 A;  1MBL A;  5CXW A;  1YLW A;  2XH9 A;  4JXS A;  2V20 A;  2I72 A;  3WS4 A;  2J9O A;  4GZB A;  4O7D A;  2Y59 A;  3ZG0 A;  3BLM A;  4E6X A;  4U0X A;  1SDN A;  1YLZ A;  2E8I A;  4GDB A;  2WGW A;  4GKU A;  4Z9Q A;  2Z2L B;  3NC8 A;  1K6S A;  3HLD A;  4OQG A;  3HUN A;  2A49 A;  4DXB A;  2BLS A;  2QMI A;  3C5A A;  5GLD A;  3IF6 B;  4OH0 A;  2B5R A;  3HRE A;  2H0T A;  1ES3 A;  5GHZ A;  1IKG A;  1DJC A;  3PBO A;  4PM8 A;  5L2F A;  3N7W A;  4Y0U A;  3V3S A;  1JWV A;  2RL3 A;  1PW1 A;  1KE3 A;  1PW8 A;  4S2P A;  1FCO A;  4HEF A;  3WWX A;  3NY4 A;  4YFM A;  1ES4 A;  1GHP A;  1XX2 A;  3UDF A;  1N9B A;  1HVB A;  4JXG A;  4X53 A;  3NBL A;  4GD6 A;  1RGZ A;  2IWD A;  4OVD A;  3BFE A;  3IT9 A;  4WZ5 A;  3BFD A;  2ZM0 A;  1YLT A;  4RX2 A;  3I7J A;  2WYX A;  3NDE A;  1K4F A;  3OCL A;  3PBT A;  4K91 A;  3MKF A;  3Q82 A;  1IYP A;  1KGE A;  3W8K A;  1O7E A;  5FQI A;  5GLA A;  3BRM A;  3W4Q A;  3VSL A;  4DE3 A;  4KZB A;  4R3B A;  4QHC A;  3OZH A;  1K56 A;  5DTS A;  1KE0 A;  1PWC A;  1BT5 A;  1IYQ A;  3BFG A;  5DTK A;  1XGI A;  1KDS A;  2Y55 A;  1ES5 A;  3SS4 A;  3SS3 A;  4DDY A;  1ONH A;  3AGD A;  3GQZ A;  3GV9 A;  1MWS A;  2R9X A;  3LY3 A;  1EWZ A;  1DJA A;  2WKH A;  3OPR A;  5M1A A;  5KZH A;  1H8Y A;  4OOY A;  4R1G A;  5CHU A;  5CEC A;  2V2F F;  4N1H A;  4E3O A;  1EI5 A;  2ZQ8 A;  2OSU A;  4XUZ A;  1TDG A;  3OPH A;  3PBN A;  5GLB A;  1LL9 A;  1U60 A;  4KZ9 A;  3PBS A;  4WYY A;  3V5M A;  4K0W A;  4YIN A;  3E2L A;  2ZQC A;  2EXB A;  4EBP A;  3IWQ A;  5E43 A;  2HDU A;  1GA0 A;  5CHM A;  2H5S A;  2Z2M B;  1K54 A;  3FYZ A;  1XP4 A;  5FSR A;  5EUA A;  3G2Y A;  4B88 A;  1NRF A;  3ITA A;  4WZ5 C;  1J9M A;  1Z6F A;  3GSG A;  4A5R A;  1BLS A;  3CJM A;  3MKE A;  1W8Q A;  3OPP A;  4LV2 A;  4NK3 A;  1E3U D;  4E3I A;  4N9L A;  2EX8 A;  3SS5 A;  1BLH A;  5U47 A;  4X6T A;  1TDL A;  1YLP A;  2WZZ A;  3G2Z A;  2XR0 A;  5DF9 A;  1NY0 A;  5DF7 A;  2ZQ7 A;  4FD8 A;  4ID4 A;  4PMA A;  2EX6 A;  4EV4 A;  2HDR A;  3OC2 A;  3FZC A;  3FV7 A;  1MXO A;  2Q9N A;  4LEN A;  5EE8 A;  3UO9 A;  2J8Y A;  3C7U A;  4P6B A;  5FAP A;  5M19 A;  2G2W A;  3HL9 A;  4N9K A;  3UDX A;  3HVF A;  3QHY A;  4JBF A;  2J7V A;  4BL2 A;  5BOH A;  1O07 A;  2X02 A;  4JLF A;  1HTZ A;  1CI8 A;  3SH7 A;  3UDI A;  4KZA A;  3IF6 C;  2XF3 A;  5FQK A;  1G68 A;  3O3V A;  3IWO A;  4NET A;  3DW0 A;  3P09 A;  3B3X A;  4GNU A;  3HUO A;  1K25 A;  5E2E A;  3GMW A;  4OOM A;  2JBF A;  4EUZ A;  3EQV A;  5JYO A;  1KDW A;  3LEZ A;  4KQO A;  3ZG7 B;  3MBZ A;  4C3Q A;  4WEL A;  4ZJ3 A;  1K54 C;  2X71 A;  2Y2J A;  3NIA A;  2ZQ9 A;  4GOG A;  1M6K A;  5F82 A;  5GLC A;  3MZD A;  5KSH A;  4GN2 A;  4ZBE A;  5J8X A;  4GB7 A;  3ZG8 B;  1DY6 A;  5FAS A;  3DWK A;  5GHY A;  3IXG A;  1YQS A;  3VP3 A;  4S2L A;  4DKI A;  2EXA A;  4PPR A;  2XD5 A;  5GL9 A;  3BFC A;  1LI0 A;  3BYD A;  4N1X A;  3VP0 A;  2Y2H A;  2IWC A;  3IH9 A;  1ERM A;  5CHJ A;  1YMX A;  1GHM A;  3VP1 A;  2UWX A;  2H0Y A;  5DVA A;  1BLP A;  4BQM A;  5HAP A;  1PZO A;  4WEJ A;  2GDN A;  4C6Y A;  4F94 A;  2ZQD A;  4LCL A;  4BL3 A;  3S4X A;  1HD8 A;  3M6H A;  2JC7 A;  4D2O A;  2A3U A;  3WS1 A;  4E6W A;  2JCH A;  1KVM A;  4FSF A;  2Y2N A;  1GA9 A;  2WKI A;  4IBR A;  2ZC3 B;  4EBL A;  2HP9 A;  2P74 A;  4R3J A;  1PIO A;  1W7F A;  1WYB A;  3ZNT A;  2ZC5 B;  2XK1 A;  3A3F A;  3HLG A;  2C6W B;  3C4O A;  1Q2Q A;  1BSG A;  4DE1 A;  4XXR A;  1FR1 A;  1I2W A;  1I5Q A;  2Y2Q A;  4U3T A;  1PZP A;  1K38 A;  2XGN A;  3VSK A;  2XDM A;  5A90 A;  1FSW A;  3HUM A;  3AGF A;  4Y0O A;  4BEN A;  4E3J A;  3CMZ A;  5FQ9 A;  1VQQ A;  2ZJ9 A;  1L0G A;  1RP5 A;  2ZC4 B;  3A3J A;  3SOI A;  3W4P A;  1ERQ A;  4HBU A;  4OQI A;  3LY4 A;  2Y2I A;  1YM1 A;  3IQA A;  3HLC A;  3M6B A;  3VP4 A;  2RCX A;  4Q8I A;  3BEC A;  2IWB A;  2FFF B;  1ESU A;  1E25 A;  5CRF A;  3ZFZ A;  3HLB A;  2JE5 A;  5EVI D;  1MY8 A;  3NCK A;  3WS2 A;  2HP6 A;  4PM7 A;  1IKI A;  2Y2G A;  4FH2 A;  3UY6 A;  4X56 A;  2VGK A;  3TG9 A;  4UHU A;  2WK0 A;  5I94 A;  1TVF A;  2XEP A;  1H5X A;  1JWZ A;  2P9V B;  4JF5 A;  1ERO A;  3MXR A;  5EEC A;  1SCW A;  4R4S A;  5FI7 A;  4MBH A;  3ISG A;  1XXM A;  3QNB A;  4DXC A;  1BZA A;  2ZQA A;  3IF6 A;  3O88 A;  4QU3 A;  4C75 A;  1K57 C;  3ZVT A;  5EVI B;  5KMW A;  4QY5 A;  4MBK A;  2HP5 A;  5IHV A;  3IH8 A;  4WM9 A;  4QD4 A;  5F1G A;  3TOI A;  4S2J A;  1ESI A;  1CK3 A;  4E3K A;  4ZAM A;  2WAF A;  4MNR A;  5CGX A;  2WUQ A;  1NXY A;  1NYY A;  5E2H A;  2Y91 A;  4OQ0 A;  1MWR A;  3IXD A;  3JYI A;  3V50 A;  4B4X A;  2Y2M A;  4OPZ A;  3D4F A;  5CGW A;  5TFQ A;  1WYC A;  3UN7 A;  1W5D A;  4QB8 A;  3G30 A;  5KSC A;  5EPH A;  4WBG A;  4U0T A;  4H8R A;  5HAR A;  4WMC D;  3BLS A;  2CC1 A;  3ZGA B;  1ZKJ A;  1LHY A;  2Q9M A;  3VOZ A;  1IYS A;  2X01 A;  3ITB A;  3PBR A;  5FAQ A;  4P0M A;  3RXX A;  1ALQ A;  4DE0 A;  1JWP A;  4IBX A;  3MFD A;  4S2O A;  1KGG A;  4LV0 A;  3UE1 A;  1BUL A;  1S0W A;  1XA7 A;  5AQ7 A;  3UE0 A;  5TR7 A;  3IHB A;  4EWF A;  2EFU A;  3BM6 A;  3HLF A;  2WGW B;  4S2N A;  4CPK A;  1IYO A;  1PI5 A;  3SH8 A;  4KG6 A;  3A3I A;  5EOE A;  3WRT A;  3UPO A;  2WZX A;  3OCN A;  4KZ6 A;  3G34 A;  1ES2 A;  5FQM A;  2ZD8 A;  5CGS A;  5FA7 A;  1XGJ A;  3UE3 A;  3UNW A;  2HPB A;  4HBT A;  1K6R A;  1K55 C;  1KVL A;  3O86 A;  4M3K A;  3HBR A;  4S2I A;  5E2F A;  3UPN A;  3WS5 A;  4KEN B;  5AQ9 A;  1KE4 A;  1TEM A;  3AGE A;  2EFX A;  3IXB A;  3M2J A;  3A3D A;  4HES A;  5DF8 A;  5M18 A;  1QME A;  1YT4 A;  1ZC2 A;  4L0L A;  3ZHH A;  1DJB A;  2OV5 A;  5FAO A;  3DWZ A;  1BTL A;  2C5W B;  3GTC A;  5FQJ A;  4KQQ A;  4IED A;  5HX9 A;  4ZDX A;  1BUE A;  4PM6 A;  1PWG A;  3ZNY A;  1K56 D;  3FKW A;  4KZ3 A;  2ZC7 A;  2PU4 A;  1XA1 A;  2VGJ A;  4UA9 A;  4OPY A;  3LO7 A;  2XFT A;  5G18 A;  1FR6 A;  1XPB A;  2BG1 A;  2QZ6 A;  1FCN A;  3P98 A;  2ZM2 A;  2V1Z A;  5FQQ A;  1L2S A;  5A93 A;  1CEF A;  4UAA A;  4LV1 A;  1K57 A;  2H10 A;  3FKV A;  1YMS A;  2OLU A;  3S1Y A;  4DF6 A;  4OP8 A;  2G2U A;  4BD1 A;  4MEZ A;  5D3O A;  4KZ5 A;  4S2N C;  5EVL A;  2PBY A;  1GCE A;  4EBN A;  1OME A;  3PBQ A;  2EX2 A;  1LI9 A;  3W4O A;  1Q2P A;  3BEB A;  4WMC A;  1E3U A;  4JF6 A;  3M2K A;  1PWD A;  3N8R A;  4R0Q A;  2DRW A;  5AQB A;  1L0D A;  5GHX A;  3RJU A;  3V39 A;  1QMF A;  4OP5 A;  3N8L A;  5JYP A;  4FH4 A;  2WGI A;  1WE4 A;  2XQZ A;  1BLC A;  1FQG A;  4KQR A;  3G35 A;  5HW3 A;  2WGV A;  4IVK A;  3IHA A;  4JKT A;  5EVI C;  2XD1 A;  3GR2 A;  3C4P A;  3TSG A;  4E3L A;  1MPL A;  4BLM A;  1E4D A;  1NZO A;  1NJ4 A;  5FI2 A;  4K0X A;  2PU2 A;  1M40 A;  3DTM A;  2XFS A;  4OON A;  3Q1F A;  4EQI A;  3IWI A;  3NI9 A;  4OLG A;  2DCF A;  5AQA A;  3UPP A;  2J9P A;  1SKF A;  4E3M A;  1L0F A;  1MKI A;  3BFF A;  5CEB A;  3O87 A;  4DE2 A;  1RGY A;  4P85 A;  3G4P A;  1YLY A;  3Q07 A;  4E3N A;  5CED A;  1LL5 A;  2HDQ A;  1H8Z A;  1IEM A;  3IF5 A;  1SDE A;  4KZ4 A;  5F83 A;  3E2K A;  1MWU A;  4P87 A;  3Q7V B;  4S2K A;  3RXW A;  1FSY A;  4GDN A;  4KG2 A;  1K55 A;  1JTG A;  3G32 A;  4GD8 A;  4PM9 A;  3G31 A;  3MZE A;  4JF4 A;  4JPM A;  3C7V A;  1W8Y A;  3NDG A;  4R23 A;  3S22 A;  3FWL A;  3Q81 A;  1Y54 A;  3QNC A;  4R4R A;  4CJN A;  1GHI A;  1VM1 A;  5CER A;  5TGF A;  3HLE A;  4QJG A;  1FOF A;  5HAI A;  4OQH A;  5FI6 A;  4IVI A;  4RYE A;  1G6A A;  1AXB A;  5FAT A;  3WRZ A;  3OPL A;  4RVA A;  3VP2 A;  3LCE A;  3VMA A;  1S6R A;  4DRT A;  4ZJ1 A;  4Y0T A;  3VFH A;  2WAE A;  4ZTK A;  3ZG9 B;  4OOL A;  2ZC6 B;  4BJP A;  3Q7Z A;  2Y2L A;  1N4O A;  4OKP A;  4KG5 A;  5HL1 A;  2DNS A;  2Y2O A;  1NZU A;  4MLL A;  4RX3 A;  3PAE A;  3MZF A;  4OPQ A;  4S2M A;  4FCF A;  4WZ4 A;  4X69 A;  4MBF A;  1ONG A;  1KGF A;  1JTD A;  5DTT A;  3SH9 A;  4X68 A;  1ZG6 A;  1FCM A;  3IXH A;  1W79 A;  2EX9 A;  3N6I A;  4DDS A;  5F1F A;  1I2S A;  2ZMA A;  3ZG5 A;  4UA6 A;  3PTE A;  1ZG4 A;  4N92 A;  4WEK A;  5HFO A;  4ZJ2 A;  3ZVW A;  3N4I A;  3PAG A;  5A92 A;  3N8S A;  1K4E A;  4JXV A;  2ZM8 A;  4OLD A;  3MXS A;  1SHV A;  1JVJ A;  2P9V A;  4B4Z A;  2Y2P A;  3Q7V A;  4XUX A;  1CEG A;  4OPR A;  2R9W A;  1HZO A;  3ZDJ A;  1PYY A;  3HLW A;  5CTM A;  5EVI A;  3ZCZ A;  3GVB A;  4KZ7 A;  4QY6 A;  2Y4A A;  1L0E A;  3CZD A;  4LV3 A;  1MWT A;  1RCJ A;  2WKE A;  3A3E A;  4KZ8 A;  3WS0 A;  1XKZ A; 
#chains in the Genus database with same CATH topology
 4BD0 A;  4CQH A;  5EOO A;  3VOY A;  2DMW A;  2QPN A;  1LLB A;  2O9A A;  3CIT A;  1NLZ A;  2Y2K A;  3IX8 A;  1P9R A;  3VFF A;  1CI9 A;  4GS9 B;  2FH5 A;  2VV7 A;  4UA7 A;  1VHM A;  1YLW A;  2I72 A;  4GZB A;  2Y59 A;  1SDN A;  2E8I A;  4OQG A;  3C38 A;  2M1C A;  3HUN A;  2A49 A;  4DXB A;  2QMI A;  3HRE A;  2H0T A;  4CLC B;  5HDC A;  1S4S A;  3KYE A;  2XA7 S;  2M7V A;  3WWX A;  4EEU A;  1YSP A;  1GHP A;  4EES A;  4X53 A;  2IWD A;  4OVD A;  3VE3 A;  2G7U A;  1YLT A;  4GLQ A;  3NDE A;  4JGO A;  3OCL A;  3PBT A;  4EUV A;  3MKF A;  3Q82 A;  4GS9 A;  3KO6 A;  2P04 A;  4R3B A;  4QHC A;  1KE0 A;  5DKK A;  1ES5 A;  3T1S A;  4DDY A;  3GV9 A;  5FDS A;  1GSW A;  3P01 A;  5HL6 A;  3MFX A;  5HWW A;  1DJA A;  5KZH A;  2XRN A;  4N1H A;  4E3O A;  4XUZ A;  1TDG A;  1N9L A;  1FIL A;  1LL9 A;  3PBS A;  2PBD P;  4K0W A;  4IUK A;  1UWN X;  1H8M A;  2HDU A;  1GA0 A;  3BY9 A;  1F2K A;  3D72 A;  4K08 A;  2PRF A;  3G2Y A;  2AVX A;  3ITA A;  3LI8 A;  4DJ2 A;  1J9M A;  3GSG A;  3MKE A;  1W8Q A;  1E3U D;  2PR6 A;  3E4Q A;  4N9L A;  2EX8 A;  4BBV A;  5AJG A;  1YLP A;  5FL3 A;  5DF7 A;  4FD8 A;  2QHK A;  4ID4 A;  3OC2 A;  2Q9N A;  2V1B A;  3C7U A;  1Y4O A;  1K0K A;  4IUH A;  1CI8 A;  1G68 A;  3O3V A;  3P09 A;  3B3X A;  4NKP A;  1ODV A;  1S67 L;  2JBF A;  5JYO A;  3EQV A;  3LEZ A;  4ZJ3 A;  2X71 A;  3NIA A;  1S4R A;  2ZQ9 A;  5F82 A;  1P97 A;  4GN2 A;  3ZG8 B;  5FAS A;  4JGP A;  3DWK A;  4S2L A;  2XD5 A;  2GX5 A;  1ERM A;  3HJI A;  1BYW A;  4F94 A;  2ZQD A;  5FEF A;  3S4X A;  3WS1 A;  5KIZ A;  2QYB A;  4IBR A;  2HP9 A;  4HH3 A;  1PIO A;  3TRC A;  3C4O A;  4LRZ E;  3CPT B;  1BSG A;  4WUJ A;  1I5Q A;  3UE6 A;  5A90 A;  1PZP A;  3RH8 B;  2GJ3 A;  3U4L P;  3HUM A;  4BEN A;  3MR0 A;  3W4P A;  2ZC4 B;  3SOI A;  3OLO A;  3IQA A;  3HLC A;  3M6B A;  3ZYT A;  1CJF A;  2FFF B;  1ESU A;  1F5M A;  5CRF A;  3ZFZ A;  4L9F A;  3NCK A;  3WS2 A;  3UY6 A;  2JKT M;  3TG9 A;  2WK0 A;  5I94 A;  3DAV A;  2XEP A;  3UMD A;  5AVF A;  1XXM A;  1W63 Q;  2ZQA A;  2VA0 A;  3ZVT A;  4QY5 A;  5IHV A;  3CWF A;  4S2J A;  2HF6 A;  4H6J A;  4ZAM A;  4MNR A;  2WUQ A;  4Y3I A;  2Y91 A;  4GCZ A;  2Y2M A;  5TFQ A;  3D4F A;  5CGW A;  4H8R A;  2JN7 A;  5HD3 A;  2Q9M A;  3L9K A;  3UE1 A;  3LR5 A;  1BUL A;  3MSH A;  3IHB A;  3BM6 A;  3H82 A;  1W63 M;  3H9W A;  3KSI A;  3UPO A;  5CGS A;  1XGJ A;  5K5B A;  1TD5 A;  3HCY A;  4HBT A;  1K6R A;  1K55 C;  4RQ9 A;  5DJT A;  3E4P A;  3UPN A;  3IX3 A;  5AQ9 A;  1TEM A;  3M2J A;  4HES A;  3DTI A;  5DF8 A;  5M18 A;  4L0L A;  1DJB A;  2PD7 A;  2K7S A;  1G6O A;  1BTL A;  2C5W B;  3GTC A;  5HX9 A;  1XA1 A;  4UA9 A;  5G18 A;  4R38 A;  1OPX A;  1FR6 A;  3P98 A;  5FQQ A;  4UAA A;  5CX7 A;  4L9G A;  5EM1 A;  3NUL A;  1VET A;  2G2U A;  4BD1 A;  2HGV A;  4KZ5 A;  4NXE A;  4S2N C;  5EVL A;  4YOF A;  4EBN A;  1OME A;  3PBQ A;  2O9B A;  1Q2P A;  4WMC A;  1E3U A;  4JF6 A;  4R0Q A;  2DRW A;  3FC7 A;  4OP5 A;  2V8C A;  5JYP A;  2V0W A;  4EER A;  3P7N A;  3DTE A;  3EEH A;  2ZBB A;  2WGV A;  4IVK A;  3GR2 A;  4E3L A;  1E4D A;  5FI2 A;  1VEU B;  4ESP A;  2XFS A;  4OON A;  5C5K A;  3NI9 A;  3UB8 A;  1SKF A;  3BFF A;  1MKI A;  3D9Y A;  3SZT A;  5CEB A;  3O87 A;  4E3N A;  4MMN A;  4EXO A;  5L8M A;  2A2L A;  1MWU A;  3RXW A;  4GDN A;  3G32 A;  4GD8 A;  3D3O A;  3MZE A;  4JPM A;  3NDG A;  4HH2 A;  4R23 A;  1Y54 A;  1VB6 A;  4EEP A;  4R6L A;  2W3F A;  4DJ3 A;  4OQH A;  5FI6 A;  1Y28 A;  1GSV A;  4RYE A;  1G6A A;  3ULF A;  3VP2 A;  2WAE A;  3ZG9 B;  1N4O A;  1ZHH B;  2QJ7 A;  3CUE A;  3K2N A;  2Y2O A;  1TS8 A;  1S1Y A;  4WZ4 A;  1KGF A;  1JTD A;  3V67 A;  3KSH A;  4X68 A;  1FCM A;  2VKS A;  2ZOH A;  4Y17 A;  4UA6 A;  4ZJ2 A;  3ZVW A;  1AWI A;  5A92 A;  4OLD A;  1JVJ A;  2Y2P A;  3EGD C;  4XUX A;  1CEG A;  3ZDJ A;  1PYY A;  2FZ0 A;  3BQ8 A;  3ZCZ A;  4GHI A;  4KZ7 A;  2Y4A A;  1L0E A;  4LV3 A;  1RCJ A;  4KZ8 A;  3VOL A;  2OLV A;  2W3H A;  2WAD A;  1OTE A;  3ZQ5 A;  4Y7P A;  1NYM A;  2QKP A;  5CTN A;  4LCM A;  3F1O B;  5HAQ A;  3V3R A;  2ZLY A;  2M7U A;  4PM5 A;  1L3L A;  2HDS A;  4FOF A;  1A0K A;  4JXS A;  2V20 A;  2VLG A;  3WS4 A;  2L4R A;  4CLC D;  2A24 B;  3EEA A;  1YLZ A;  4KUO A;  4Z9Q A;  3QP2 A;  1K6S A;  2P08 A;  1D7E A;  4HQA A;  2BLS A;  3FPV A;  3H7W A;  5GLD A;  3IF6 B;  2B5R A;  5HZH A;  3NJA A;  1ES3 A;  1DJC A;  5L2F A;  3N7W A;  4Y0U A;  4EW7 A;  4HI4 A;  3NY4 A;  4YFM A;  1ES4 A;  1XX2 A;  3HJK A;  3UDF A;  2Y79 A;  1HVB A;  1G28 A;  3UB5 P;  1RGZ A;  4WZ5 A;  2ZM0 A;  4RX2 A;  1N9N A;  4K91 A;  2W0N A;  5FQI A;  1NWZ A;  1D06 A;  4KZB A;  2VV8 A;  5DTK A;  2H28 A;  1KDS A;  2Y55 A;  3SS3 A;  3UB7 A;  2ACG A;  1EW0 A;  1ONH A;  1T1C A;  3AGD A;  3GQZ A;  1MWS A;  1EWZ A;  2K31 A;  3S7O A;  4I5S A;  5CEC A;  2ZQ8 A;  3OPH A;  3PBN A;  1MC0 A;  2J3T C;  4WYY A;  3QP5 A;  2PAV P;  2ZQC A;  5E43 A;  1K54 A;  4BMW A;  1NRF A;  4WLA A;  1BLS A;  3CJM A;  3OPP A;  4LV2 A;  4NK3 A;  4EQ1 A;  1BLH A;  4X6T A;  5IT5 A;  5EVE A;  3OBF A;  2ZQ7 A;  3FZC A;  3FV7 A;  4LEN A;  4PKY A;  2G2W A;  1TS0 A;  3HL9 A;  4ME4 A;  5HWV A;  2J7V A;  3IBJ A;  3R4K A;  5HDD A;  4BL2 A;  1OJG A;  2XF3 A;  5FQK A;  2K2N A;  4GNU A;  2NUP C;  1OJ5 A;  5E2E A;  4OOM A;  5G4Z A;  4EUZ A;  5HDS A;  4C3Q A;  4WEL A;  4UQI M;  1M6K A;  4WL9 A;  2E8J A;  5DJU A;  2ZL1 A;  5GHY A;  1LI0 A;  3VP0 A;  2Y2H A;  3IH9 A;  4BBT A;  1S1Z A;  3VP1 A;  2UWX A;  2P7J A;  4WEJ A;  3NOP C;  3T1R A;  2GZA A;  2A3U A;  4E6W A;  2JCH A;  4FSF A;  2WKI A;  2ZC3 B;  4EBL A;  1W7F A;  3ZNT A;  3A3F A;  3HLG A;  2C6W B;  1Q2Q A;  2JKF A;  4XXR A;  1FR1 A;  1I2W A;  2Y2Q A;  3VSK A;  2XGN A;  2XDM A;  4Y0O A;  2ZJ9 A;  1L0G A;  1ERQ A;  3VP4 A;  4NXF A;  2IWB A;  1F98 A;  1SZV A;  2JKR M;  4PM7 A;  1IKI A;  4FH2 A;  1TVF A;  2P9V B;  1ERO A;  3MXR A;  1OTI A;  1BZA A;  4C75 A;  4JGR A;  5EVI B;  4GW9 A;  4CLC A;  3IH8 A;  5AVE A;  4QD4 A;  3NHQ A;  1XJ2 A;  1CK3 A;  5TBM B;  5CGX A;  1NXY A;  4II7 A;  3FG8 A;  1MWR A;  3IXD A;  3V50 A;  3UN7 A;  1WYC A;  4WBG A;  5HAR A;  4WMC D;  3BLS A;  3ZGA B;  1ZKJ A;  3E0Y A;  3S7Q A;  3VOZ A;  2X01 A;  3ITB A;  1XJ6 A;  5FAQ A;  3RXX A;  4IBX A;  4S2O A;  2LB9 A;  5TR7 A;  4CPK A;  2XA7 M;  2WGW B;  4EU0 A;  1PI5 A;  3SH8 A;  5EOE A;  2WZX A;  1ES2 A;  5FQM A;  3O86 A;  3LIE A;  4M3K A;  1LL8 A;  4HJ3 A;  3IXB A;  3A3D A;  5HPI A;  1QME A;  1YT4 A;  4Z1W A;  1YKD A;  3NOU C;  5FQJ A;  4IED A;  1BUE A;  3MMH A;  1K56 D;  4KZ3 A;  2EWW A;  4AFI A;  2PU4 A;  4ZRR A;  3CUE C;  4OPY A;  4R3A A;  3S7N A;  1XPB A;  2BG1 A;  2ZM2 A;  4MCW A;  1T18 A;  5A93 A;  1CEF A;  4LV1 A;  1K57 A;  5D3O A;  3BEB A;  3TE8 A;  4EET B;  3RJU A;  3V39 A;  4O01 A;  2UV0 E;  2KLI A;  3LIC A;  3N8L A;  3A0S A;  4FH4 A;  2WGI A;  5HW3 A;  2O0Y A;  1OTD A;  1CQA A;  2XD1 A;  3C4P A;  1MPL A;  4BLM A;  1M40 A;  3DTM A;  4EQI A;  3IWI A;  4D60 A;  2WKP A;  4E3M A;  5EM0 A;  2KOI A;  1XJ3 A;  1IEM A;  3LUQ A;  4KZ4 A;  4X25 A;  1FSY A;  4KG2 A;  1JTG A;  3MF0 A;  1W8Y A;  4XT2 B;  3FWL A;  3Q81 A;  4R4R A;  5CER A;  1H0M A;  3HLE A;  4HIA A;  1JNU A;  2VJW A;  4G3K A;  4RVA A;  2W1T B;  4DRT A;  4ZJ1 A;  4Y0T A;  3U2A A;  4BJP A;  3KYZ A;  1NZU A;  3CPT A;  4RX3 A;  3PAE A;  4MBF A;  1ONG A;  3B47 A;  1XFN A;  3SH9 A;  1W79 A;  5F68 A;  1V9Z A;  5F1F A;  3KYQ A;  3ZG5 A;  2ZOI A;  2OOL A;  3N4I A;  1GSX A;  3T4K A;  3N8S A;  2BTF P;  1K4E A;  3PXP A;  1KOU A;  2R9W A;  4JGQ A;  3HLW A;  5CTM A;  4Y15 A;  4XT2 A;  3GVB A;  4QY6 A;  3GDI A;  4NG2 A;  1MWT A;  3LGO A;  3MQ0 A;  1SKO B;  4JXW A;  2CMN A;  2W1T A;  1MKM A;  3CG5 A;  4RA7 A;  2V1A A;  5E2G A;  1IEL A;  3GRJ A;  2FFY A;  5A91 A;  1PI4 A;  3CLO A;  1MBL A;  2PR5 A;  2XH9 A;  2HZ5 A;  3QP8 A;  2J9O A;  1T19 A;  4O7D A;  4P6Z S;  3ZG0 A;  4NXG A;  3DTK A;  4UEY A;  2B18 A;  3NC8 A;  3C5A A;  3A0V A;  4OH0 A;  3LI9 A;  2QJ5 A;  5J7E A;  1IKG A;  3PBO A;  1DP8 A;  3V3S A;  1JWV A;  1PW1 A;  4S2P A;  1PW8 A;  1FCO A;  4HEF A;  5TJJ A;  4O0P A;  4JXG A;  4Y13 A;  3BFD A;  3I7J A;  3KSF A;  1K4F A;  1IYP A;  1KGE A;  2VEA A;  4X1L A;  5GLA A;  3BRM A;  3W4Q A;  4DE3 A;  4MN5 A;  1K56 A;  1BT5 A;  1V9Y A;  2W3G A;  2R9X A;  2WKH A;  4OOY A;  5CHU A;  1NLY A;  2OSU A;  2W27 A;  5GLB A;  4HJ4 A;  4KZ9 A;  4HNB A;  4B9O A;  3F1P B;  5CHM A;  2H5S A;  2Z2M B;  1VEU A;  4E04 A;  3FYZ A;  1XP4 A;  5FSR A;  4IJG A;  4P6Z M;  5EUA A;  1LSX A;  4I39 A;  3SS5 A;  1LT0 A;  5U47 A;  1LSW A;  2WZZ A;  2OAP 1;  5DF9 A;  1NY0 A;  4PAU A;  1UWP X;  4PMA A;  4EV4 A;  1MXO A;  2J8Y A;  3KSG A;  4P6B A;  5FAP A;  5M19 A;  3UDX A;  3QHY A;  3EWK A;  4JBF A;  2VK3 A;  3QP1 A;  1OTA A;  3A0R A;  2X02 A;  1HTZ A;  2PD8 A;  1DP9 A;  2KDK A;  2NUT C;  3IWO A;  3T4Q A;  2V9A A;  3DW0 A;  5HSQ A;  4CLC C;  3IS2 B;  1K25 A;  2J80 A;  1KDW A;  4KQO A;  3ZG7 B;  3KX0 X;  2Y2J A;  3S7P A;  4HJ6 A;  5KSH A;  3LID A;  4ZBE A;  1DY6 A;  1YQS A;  4DKI A;  2EXA A;  1TS7 A;  5GL9 A;  4N1X A;  5CHJ A;  1YMX A;  5DVA A;  4BQM A;  1PZO A;  1ZTU A;  2GDN A;  4BL3 A;  1HD8 A;  3M6H A;  2JC7 A;  1KVM A;  2J3W A;  2Y2N A;  2P74 A;  2ZC5 B;  2XK1 A;  4ETZ A;  4BBU A;  2EA9 A;  1OT9 A;  4U3T A;  1K38 A;  4L9E A;  2ZMV A;  4I3I A;  4E3J A;  5I5L A;  3F1O A;  3PYP A;  3QP6 A;  1P0Z A;  3L7H A;  1YM1 A;  4HOI A;  4Q8I A;  2B95 A;  3BEC A;  2JKT I;  3JVV A;  4F3L B;  1E25 A;  5J4E A;  5EVI D;  1MY8 A;  2HP6 A;  3LFV A;  2A24 A;  4UHU A;  3FPW A;  1H5X A;  4JF5 A;  5EEC A;  3TW8 A;  1SCW A;  4R4S A;  2IA2 A;  3ISG A;  4DXC A;  3IF6 A;  3O88 A;  4QU3 A;  1K57 C;  2PYP A;  4MBK A;  2HP5 A;  4WM9 A;  1YPR A;  5F1G A;  4I3J A;  3JVU A;  4B4X A;  1W5D A;  4QB8 A;  4R70 A;  2CC1 A;  4YNR A;  2LB5 A;  5L09 A;  3EOI A;  3PBR A;  1P9W A;  2VGL S;  4P0M A;  1ALQ A;  4DE0 A;  1PRQ A;  1JWP A;  3MFD A;  4LV0 A;  1S0W A;  5AQ7 A;  3CI6 A;  3UE0 A;  4EWF A;  4S2N A;  2EFU A;  1IYO A;  2D01 A;  3MQQ A;  3WRT A;  4F3L A;  4KZ6 A;  3G34 A;  3MXQ A;  2MJ6 A;  4Q0J A;  3UNW A;  3HBR A;  4KEN B;  1KE4 A;  3AGE A;  3ZHH A;  1DP6 A;  4ZDX A;  4KQQ A;  1T1B A;  3MQO A;  4PM6 A;  1PWG A;  3ZNY A;  3LYX A;  2VGJ A;  2HJ9 C;  5F6A A;  2YKH A;  3LO7 A;  2QZ6 A;  2V1Z A;  4NEE D;  1L2S A;  2Y8H A;  1IFQ A;  4NXB A;  1YMS A;  2OLU A;  4DF6 A;  4OP8 A;  4MEZ A;  1LI9 A;  3W4O A;  3VV4 A;  5GHX A;  2YKF A;  1QMF A;  3MS6 A;  1WE4 A;  2XQZ A;  1BLC A;  1STZ A;  2B02 A;  3G35 A;  4DMZ A;  3TSG A;  1NJ4 A;  4K0X A;  2D02 A;  4G3V A;  2O99 A;  2VGL M;  4OLG A;  3UPP A;  2J9P A;  1L0F A;  5DFY A;  4DE2 A;  2L0W A;  1RGY A;  3Q07 A;  5CED A;  1LL5 A;  2HDQ A;  1H8Z A;  3IF5 A;  1SDE A;  5F83 A;  1J3W A;  3T1X A;  3VE4 A;  3R7W B;  4PM9 A;  1UGU A;  3S22 A;  4CJN A;  5TGF A;  4QJG A;  3MJQ A;  5HAI A;  2OWJ A;  5J3W A;  4IVI A;  5FAT A;  1AXB A;  3WRZ A;  3OPL A;  3LCE A;  1S6R A;  3VFH A;  1XFQ A;  4OKP A;  5HL1 A;  4MLL A;  4OPQ A;  3C30 A;  3T4T A;  4FCF A;  3NOT C;  4X69 A;  4LRX C;  2KX6 A;  2W1R A;  3SW1 A;  3T4S A;  3LR0 A;  1ZG6 A;  4LPZ A;  2EX9 A;  1G5U A;  4DDS A;  1I2S A;  3LIB A;  3BY8 A;  4G3W A;  3PTE A;  1ZG4 A;  3B42 A;  4N92 A;  4WEK A;  4YWZ A;  2VX8 A;  2ZM8 A;  3MXS A;  2P9V A;  3R7W A;  4OPR A;  1HZO A;  5EVI A;  4ETX A;  3PR6 A;  3CZD A;  4IHQ A;  5F69 A;  5MC7 A;  3T4O A;  3WS0 A;  2Z2L B;  1XKZ A;  5TBM A;  1C3B A;  1YLJ A;  5IS1 A;  1X0O A;  3EQU A;  3T4L A;  2XLN A;  5FDH A;  1WA9 A;  3K3C A;  4Y2F A;  4X55 A;  2VV6 A;  5CXW A;  1TF1 A;  1CF0 A;  2PYR A;  3QP4 A;  3BLM A;  4HHD A;  4ARZ B;  4E6X A;  2OWH A;  1Z09 A;  4U0X A;  4GDB A;  2WGW A;  4GKU A;  3HLD A;  5GHZ A;  4PM8 A;  1TS6 A;  1PNE A;  4WN5 A;  4H6J B;  3UME A;  2RL3 A;  1KE3 A;  3E98 A;  1DRM A;  1IOU A;  2I9V A;  1N9B A;  3NBL A;  3LIF A;  4GD6 A;  3C2W A;  3BFE A;  3IT9 A;  4FTX A;  2WYX A;  5F5Y A;  4LRY C;  3EGX C;  3W8K A;  1O7E A;  3VSL A;  3H82 B;  3OZH A;  5DTS A;  2XRO A;  1PWC A;  3BFG A;  1IYQ A;  1XGI A;  3SS4 A;  2W3E A;  4ARZ A;  3T50 A;  3LY3 A;  3JPU A;  5M1A A;  3OPR A;  1F9I A;  1H8Y A;  4QWO A;  4R1G A;  2V2F F;  4PHT A;  1EI5 A;  1U60 A;  3CAX A;  3C8C A;  3V5M A;  3O5Y A;  4YIN A;  3F1N B;  3NEC A;  3E2L A;  2EXB A;  4EBP A;  3IWQ A;  4DN0 A;  2HV1 A;  2W3D A;  4B88 A;  4WZ5 C;  1Z6F A;  4A5R A;  5A8B A;  5G4Y A;  4E3I A;  4X1M A;  1TDL A;  3G2Z A;  5HPF A;  1VET B;  2XR0 A;  3T4J A;  2EX6 A;  2HDR A;  3UO9 A;  1OT6 A;  5EE8 A;  4N9K A;  2WKQ A;  3HVF A;  4Y5F A;  5LBR A;  4MN6 A;  5BOH A;  1O07 A;  2R78 A;  2ZMF A;  2INW A;  4JLF A;  3UDI A;  3SH7 A;  4KZA A;  3IF6 C;  3PHY A;  4NET A;  3HUO A;  3GMW A;  5L07 A;  4I3A A;  3MBZ A;  3F1N A;  1K54 C;  4GOG A;  5GLC A;  3MZD A;  4BWI A;  5J8X A;  4GB7 A;  2GNX A;  3IXG A;  4LGW A;  3VP3 A;  1PFL A;  4PPR A;  3BFC A;  3BYD A;  3LIA A;  2IWC A;  1GHM A;  5FEG A;  2H0Y A;  1H3Q A;  1BLP A;  5HAP A;  3OOV A;  4C6Y A;  4LCL A;  1HLU P;  4D2O A;  3G6O A;  4GJ4 A;  1GA9 A;  4R3J A;  1WYB A;  1SKO A;  4DE1 A;  1FSW A;  3AGF A;  3CMZ A;  5FQ9 A;  1VQQ A;  1RP5 A;  3A3J A;  3BQA A;  3BJN A;  4HBU A;  4OQI A;  2JKR I;  3LY4 A;  2Y2I A;  3DBA A;  3RFB A;  2HJE A;  2RCX A;  4KQD A;  3E4O A;  4M4X A;  4WF0 A;  3HLB A;  2JE5 A;  2Y2G A;  4X56 A;  2VGK A;  1JWZ A;  1YSQ A;  4Q0I A;  2XSS A;  5FI7 A;  4MBH A;  3QNB A;  5KMW A;  3IX4 A;  4GHI B;  3TOI A;  1ESI A;  4E3K A;  2WAF A;  1FIK A;  2Z6D A;  1NYY A;  5E2H A;  4OQ0 A;  4FUW A;  3UB9 A;  3JYI A;  1YAX A;  4OPZ A;  3G30 A;  4B93 A;  5KSC A;  5EPH A;  4U0T A;  2L1M A;  1LHY A;  5HD5 A;  1IYS A;  2V0U A;  3LEQ A;  5IU1 A;  1KGG A;  1XA7 A;  3HLF A;  2JHE A;  4KG6 A;  3A3I A;  2PDR A;  3OCN A;  2OAQ 1;  3H7W B;  2ZD8 A;  5FA7 A;  4HY8 A;  3UE3 A;  2HPB A;  1T1A A;  1KVL A;  4S2I A;  5E2F A;  3WS5 A;  2EFX A;  3GEC A;  1ZC2 A;  2OV5 A;  4KUK A;  5FAO A;  3DWZ A;  1OTB A;  4QPR A;  4MDZ A;  3F1P A;  3FKW A;  4Q0H A;  2ZC7 A;  4MN7 A;  2Z6C A;  3BW6 A;  2XFT A;  3LR4 A;  4LLO B;  3TJZ C;  1FCN A;  1LSV A;  5EV0 A;  3FKV A;  2H10 A;  3S1Y A;  2V8F A;  3T12 B;  4CLC E;  2PBY A;  2PT7 A;  1GCE A;  3CHW P;  2EX2 A;  5EFW A;  1N9O A;  5DFX A;  3M2K A;  1PWD A;  3N8R A;  5AQB A;  1L0D A;  5HWT A;  1FQG A;  4KQR A;  1ACF A;  1D1J A;  3IBR A;  3IHA A;  4JKT A;  5EVI C;  3UB6 A;  1NZO A;  3IS2 A;  2PU2 A;  3B33 A;  3Q1F A;  5AQA A;  2DCF A;  4I38 A;  4P85 A;  2O9C A;  1YLY A;  3G4P A;  3E2K A;  4P87 A;  3Q7V B;  4S2K A;  1K55 A;  3G31 A;  4JF4 A;  3C7V A;  3QNC A;  1GHI A;  1VM1 A;  3LR3 A;  4UQI S;  5L10 A;  2BAS A;  1FOF A;  1S66 L;  4PKY G;  3BWL A;  3VMA A;  2PHY A;  4ZTK A;  4OOL A;  1NRJ A;  3T1Q B;  2ZC6 B;  3Q7Z A;  2Y2L A;  4KG5 A;  2DNS A;  2Q0O A;  4O8G A;  3MZF A;  4S2M A;  5DKL A;  1XJ4 A;  5DTT A;  3K3D A;  3IXH A;  2ZL1 B;  2J3T D;  3N6I A;  2JKG A;  3ICY A;  2ZMA A;  4LFU A;  5HFO A;  3PAG A;  2WKR A;  4JXV A;  4HP4 A;  1SHV A;  4HP9 A;  4B4Z A;  3Q7V A;  2QWS A;  2EWV A;  3RTY A;  3W2Z A;  2WKE A;  3A3E A;  1MZU A;  2VZW A; 
#chains in the Genus database with same CATH homology
 4BD0 A;  5EOO A;  4JXW A;  3VOY A;  2QPN A;  2OLV A;  1C3B A;  1YLJ A;  2WAD A;  3CG5 A;  1LLB A;  4RA7 A;  2Y2K A;  4Y7P A;  1NYM A;  3VFF A;  3EQU A;  2XLN A;  4LCM A;  5CTN A;  5E2G A;  5FDH A;  1IEL A;  3GRJ A;  5HAQ A;  2FFY A;  3V3R A;  2ZLY A;  1CI9 A;  4X55 A;  5A91 A;  1PI4 A;  4PM5 A;  2HDS A;  4UA7 A;  1MBL A;  5CXW A;  1YLW A;  2XH9 A;  4JXS A;  2V20 A;  2I72 A;  3WS4 A;  2J9O A;  4GZB A;  4O7D A;  2Y59 A;  3ZG0 A;  3BLM A;  4E6X A;  4U0X A;  1SDN A;  1YLZ A;  2E8I A;  4GDB A;  2WGW A;  4GKU A;  4Z9Q A;  2Z2L B;  3NC8 A;  1K6S A;  3HLD A;  4OQG A;  3HUN A;  2A49 A;  4DXB A;  2BLS A;  2QMI A;  3C5A A;  5GLD A;  3IF6 B;  4OH0 A;  2B5R A;  3HRE A;  2H0T A;  1ES3 A;  5GHZ A;  1IKG A;  1DJC A;  3PBO A;  4PM8 A;  5L2F A;  3N7W A;  4Y0U A;  3V3S A;  1JWV A;  2RL3 A;  1PW1 A;  1KE3 A;  1PW8 A;  4S2P A;  1FCO A;  4HEF A;  3WWX A;  3NY4 A;  4YFM A;  1ES4 A;  1GHP A;  1XX2 A;  3UDF A;  1N9B A;  1HVB A;  4JXG A;  4X53 A;  3NBL A;  4GD6 A;  1RGZ A;  2IWD A;  4OVD A;  3BFE A;  3IT9 A;  4WZ5 A;  3BFD A;  2ZM0 A;  1YLT A;  4RX2 A;  3I7J A;  2WYX A;  3NDE A;  1K4F A;  3OCL A;  3PBT A;  4K91 A;  3MKF A;  3Q82 A;  1IYP A;  1KGE A;  3W8K A;  1O7E A;  5FQI A;  5GLA A;  3BRM A;  3W4Q A;  3VSL A;  4DE3 A;  4KZB A;  4R3B A;  4QHC A;  3OZH A;  1K56 A;  5DTS A;  1KE0 A;  1PWC A;  1BT5 A;  1IYQ A;  3BFG A;  5DTK A;  1XGI A;  1KDS A;  2Y55 A;  1ES5 A;  3SS4 A;  3SS3 A;  4DDY A;  1ONH A;  3AGD A;  3GQZ A;  3GV9 A;  1MWS A;  2R9X A;  3LY3 A;  1EWZ A;  1DJA A;  2WKH A;  3OPR A;  5M1A A;  5KZH A;  1H8Y A;  4OOY A;  4R1G A;  5CHU A;  5CEC A;  2V2F F;  4N1H A;  4E3O A;  1EI5 A;  2ZQ8 A;  2OSU A;  4XUZ A;  1TDG A;  3OPH A;  3PBN A;  5GLB A;  1LL9 A;  1U60 A;  4KZ9 A;  3PBS A;  4WYY A;  3V5M A;  4K0W A;  4YIN A;  3E2L A;  2ZQC A;  2EXB A;  4EBP A;  3IWQ A;  5E43 A;  2HDU A;  1GA0 A;  5CHM A;  2H5S A;  2Z2M B;  1K54 A;  3FYZ A;  1XP4 A;  5FSR A;  5EUA A;  3G2Y A;  4B88 A;  1NRF A;  3ITA A;  4WZ5 C;  1J9M A;  1Z6F A;  3GSG A;  4A5R A;  1BLS A;  3CJM A;  3MKE A;  1W8Q A;  3OPP A;  4LV2 A;  4NK3 A;  1E3U D;  4E3I A;  4N9L A;  2EX8 A;  3SS5 A;  1BLH A;  5U47 A;  4X6T A;  1TDL A;  1YLP A;  2WZZ A;  3G2Z A;  2XR0 A;  5DF9 A;  1NY0 A;  5DF7 A;  2ZQ7 A;  4FD8 A;  4ID4 A;  4PMA A;  2EX6 A;  4EV4 A;  2HDR A;  3OC2 A;  3FZC A;  3FV7 A;  1MXO A;  2Q9N A;  4LEN A;  5EE8 A;  3UO9 A;  2J8Y A;  3C7U A;  4P6B A;  5FAP A;  5M19 A;  2G2W A;  3HL9 A;  4N9K A;  3UDX A;  3HVF A;  3QHY A;  4JBF A;  2J7V A;  4BL2 A;  5BOH A;  1O07 A;  2X02 A;  4JLF A;  1HTZ A;  1CI8 A;  3SH7 A;  3UDI A;  4KZA A;  3IF6 C;  2XF3 A;  5FQK A;  1G68 A;  3O3V A;  3IWO A;  4NET A;  3DW0 A;  3P09 A;  3B3X A;  4GNU A;  3HUO A;  1K25 A;  5E2E A;  3GMW A;  4OOM A;  2JBF A;  4EUZ A;  3EQV A;  5JYO A;  1KDW A;  3LEZ A;  4KQO A;  3ZG7 B;  3MBZ A;  4C3Q A;  4WEL A;  4ZJ3 A;  1K54 C;  2X71 A;  2Y2J A;  3NIA A;  2ZQ9 A;  4GOG A;  1M6K A;  5F82 A;  5GLC A;  3MZD A;  5KSH A;  4GN2 A;  4ZBE A;  5J8X A;  4GB7 A;  3ZG8 B;  1DY6 A;  5FAS A;  3DWK A;  5GHY A;  3IXG A;  1YQS A;  3VP3 A;  4S2L A;  4DKI A;  2EXA A;  4PPR A;  2XD5 A;  5GL9 A;  3BFC A;  1LI0 A;  3BYD A;  4N1X A;  3VP0 A;  2Y2H A;  2IWC A;  3IH9 A;  1ERM A;  5CHJ A;  1YMX A;  1GHM A;  3VP1 A;  2UWX A;  2H0Y A;  5DVA A;  1BLP A;  4BQM A;  5HAP A;  1PZO A;  4WEJ A;  2GDN A;  4C6Y A;  4F94 A;  2ZQD A;  4LCL A;  4BL3 A;  3S4X A;  1HD8 A;  3M6H A;  2JC7 A;  4D2O A;  2A3U A;  3WS1 A;  4E6W A;  2JCH A;  1KVM A;  4FSF A;  2Y2N A;  1GA9 A;  2WKI A;  4IBR A;  2ZC3 B;  4EBL A;  2HP9 A;  2P74 A;  4R3J A;  1PIO A;  1W7F A;  1WYB A;  3ZNT A;  2ZC5 B;  2XK1 A;  3A3F A;  3HLG A;  2C6W B;  3C4O A;  1Q2Q A;  1BSG A;  4DE1 A;  4XXR A;  1FR1 A;  1I2W A;  1I5Q A;  2Y2Q A;  4U3T A;  1PZP A;  1K38 A;  2XGN A;  3VSK A;  2XDM A;  5A90 A;  1FSW A;  3HUM A;  3AGF A;  4Y0O A;  4BEN A;  4E3J A;  3CMZ A;  5FQ9 A;  1VQQ A;  2ZJ9 A;  1L0G A;  1RP5 A;  2ZC4 B;  3A3J A;  3SOI A;  3W4P A;  1ERQ A;  4HBU A;  4OQI A;  3LY4 A;  2Y2I A;  1YM1 A;  3IQA A;  3HLC A;  3M6B A;  3VP4 A;  2RCX A;  4Q8I A;  3BEC A;  2IWB A;  2FFF B;  1ESU A;  1E25 A;  5CRF A;  3ZFZ A;  3HLB A;  2JE5 A;  5EVI D;  1MY8 A;  3NCK A;  3WS2 A;  2HP6 A;  4PM7 A;  1IKI A;  2Y2G A;  4FH2 A;  3UY6 A;  4X56 A;  2VGK A;  3TG9 A;  4UHU A;  2WK0 A;  5I94 A;  1TVF A;  2XEP A;  1H5X A;  1JWZ A;  2P9V B;  4JF5 A;  1ERO A;  3MXR A;  5EEC A;  1SCW A;  4R4S A;  5FI7 A;  4MBH A;  3ISG A;  1XXM A;  3QNB A;  4DXC A;  1BZA A;  2ZQA A;  3IF6 A;  3O88 A;  4QU3 A;  4C75 A;  1K57 C;  3ZVT A;  5EVI B;  5KMW A;  4QY5 A;  4MBK A;  2HP5 A;  5IHV A;  3IH8 A;  4WM9 A;  4QD4 A;  5F1G A;  3TOI A;  4S2J A;  1ESI A;  1CK3 A;  4E3K A;  4ZAM A;  2WAF A;  4MNR A;  5CGX A;  2WUQ A;  1NXY A;  1NYY A;  5E2H A;  2Y91 A;  4OQ0 A;  1MWR A;  3IXD A;  3JYI A;  3V50 A;  4B4X A;  2Y2M A;  4OPZ A;  3D4F A;  5CGW A;  5TFQ A;  1WYC A;  3UN7 A;  1W5D A;  4QB8 A;  3G30 A;  5KSC A;  5EPH A;  4WBG A;  4U0T A;  4H8R A;  5HAR A;  4WMC D;  3BLS A;  2CC1 A;  3ZGA B;  1ZKJ A;  1LHY A;  2Q9M A;  3VOZ A;  1IYS A;  2X01 A;  3ITB A;  3PBR A;  5FAQ A;  4P0M A;  3RXX A;  1ALQ A;  4DE0 A;  1JWP A;  4IBX A;  3MFD A;  4S2O A;  1KGG A;  4LV0 A;  3UE1 A;  1BUL A;  1S0W A;  1XA7 A;  5AQ7 A;  3UE0 A;  5TR7 A;  3IHB A;  4EWF A;  2EFU A;  3BM6 A;  3HLF A;  2WGW B;  4S2N A;  4CPK A;  1IYO A;  1PI5 A;  3SH8 A;  4KG6 A;  3A3I A;  5EOE A;  3WRT A;  3UPO A;  2WZX A;  3OCN A;  4KZ6 A;  3G34 A;  1ES2 A;  5FQM A;  2ZD8 A;  5CGS A;  5FA7 A;  1XGJ A;  3UE3 A;  3UNW A;  2HPB A;  4HBT A;  1K6R A;  1K55 C;  1KVL A;  3O86 A;  4M3K A;  3HBR A;  4S2I A;  5E2F A;  3UPN A;  3WS5 A;  4KEN B;  5AQ9 A;  1KE4 A;  1TEM A;  3AGE A;  2EFX A;  3IXB A;  3M2J A;  3A3D A;  4HES A;  5DF8 A;  5M18 A;  1QME A;  1YT4 A;  1ZC2 A;  4L0L A;  3ZHH A;  1DJB A;  2OV5 A;  5FAO A;  3DWZ A;  1BTL A;  2C5W B;  3GTC A;  5FQJ A;  4KQQ A;  4IED A;  5HX9 A;  4ZDX A;  1BUE A;  4PM6 A;  1PWG A;  3ZNY A;  1K56 D;  3FKW A;  4KZ3 A;  2ZC7 A;  2PU4 A;  1XA1 A;  2VGJ A;  4UA9 A;  4OPY A;  3LO7 A;  2XFT A;  5G18 A;  1FR6 A;  1XPB A;  2BG1 A;  2QZ6 A;  1FCN A;  3P98 A;  2ZM2 A;  2V1Z A;  5FQQ A;  1L2S A;  5A93 A;  1CEF A;  4UAA A;  4LV1 A;  1K57 A;  2H10 A;  3FKV A;  1YMS A;  2OLU A;  3S1Y A;  4DF6 A;  4OP8 A;  2G2U A;  4BD1 A;  4MEZ A;  5D3O A;  4KZ5 A;  4S2N C;  5EVL A;  2PBY A;  1GCE A;  4EBN A;  1OME A;  3PBQ A;  2EX2 A;  1LI9 A;  3W4O A;  1Q2P A;  3BEB A;  4WMC A;  1E3U A;  4JF6 A;  3M2K A;  1PWD A;  3N8R A;  4R0Q A;  2DRW A;  5AQB A;  1L0D A;  5GHX A;  3RJU A;  3V39 A;  1QMF A;  4OP5 A;  3N8L A;  5JYP A;  4FH4 A;  2WGI A;  1WE4 A;  2XQZ A;  1BLC A;  1FQG A;  4KQR A;  3G35 A;  5HW3 A;  2WGV A;  4IVK A;  3IHA A;  4JKT A;  5EVI C;  2XD1 A;  3GR2 A;  3C4P A;  3TSG A;  4E3L A;  1MPL A;  4BLM A;  1E4D A;  1NZO A;  1NJ4 A;  5FI2 A;  4K0X A;  2PU2 A;  1M40 A;  3DTM A;  2XFS A;  4OON A;  3Q1F A;  4EQI A;  3IWI A;  3NI9 A;  4OLG A;  2DCF A;  5AQA A;  3UPP A;  2J9P A;  1SKF A;  4E3M A;  1L0F A;  1MKI A;  3BFF A;  5CEB A;  3O87 A;  4DE2 A;  1RGY A;  4P85 A;  3G4P A;  1YLY A;  3Q07 A;  4E3N A;  5CED A;  1LL5 A;  2HDQ A;  1H8Z A;  1IEM A;  3IF5 A;  1SDE A;  4KZ4 A;  5F83 A;  3E2K A;  1MWU A;  4P87 A;  3Q7V B;  4S2K A;  3RXW A;  1FSY A;  4GDN A;  4KG2 A;  1K55 A;  1JTG A;  3G32 A;  4GD8 A;  4PM9 A;  3G31 A;  3MZE A;  4JF4 A;  4JPM A;  3C7V A;  1W8Y A;  3NDG A;  4R23 A;  3S22 A;  3FWL A;  3Q81 A;  1Y54 A;  3QNC A;  4R4R A;  4CJN A;  1GHI A;  1VM1 A;  5CER A;  5TGF A;  3HLE A;  4QJG A;  1FOF A;  5HAI A;  4OQH A;  5FI6 A;  4IVI A;  4RYE A;  1G6A A;  1AXB A;  5FAT A;  3WRZ A;  3OPL A;  4RVA A;  3VP2 A;  3LCE A;  3VMA A;  1S6R A;  4DRT A;  4ZJ1 A;  4Y0T A;  3VFH A;  2WAE A;  4ZTK A;  3ZG9 B;  4OOL A;  2ZC6 B;  4BJP A;  3Q7Z A;  2Y2L A;  1N4O A;  4OKP A;  4KG5 A;  5HL1 A;  2DNS A;  2Y2O A;  1NZU A;  4MLL A;  4RX3 A;  3PAE A;  3MZF A;  4OPQ A;  4S2M A;  4FCF A;  4WZ4 A;  4X69 A;  4MBF A;  1ONG A;  1KGF A;  1JTD A;  5DTT A;  3SH9 A;  4X68 A;  1ZG6 A;  1FCM A;  3IXH A;  1W79 A;  2EX9 A;  3N6I A;  4DDS A;  5F1F A;  1I2S A;  2ZMA A;  3ZG5 A;  4UA6 A;  3PTE A;  1ZG4 A;  4N92 A;  4WEK A;  5HFO A;  4ZJ2 A;  3ZVW A;  3N4I A;  3PAG A;  5A92 A;  3N8S A;  1K4E A;  4JXV A;  2ZM8 A;  4OLD A;  3MXS A;  1SHV A;  1JVJ A;  2P9V A;  4B4Z A;  2Y2P A;  3Q7V A;  4XUX A;  1CEG A;  4OPR A;  2R9W A;  1HZO A;  3ZDJ A;  1PYY A;  3HLW A;  5CTM A;  5EVI A;  3ZCZ A;  3GVB A;  4KZ7 A;  4QY6 A;  2Y4A A;  1L0E A;  3CZD A;  4LV3 A;  1MWT A;  1RCJ A;  2WKE A;  3A3E A;  4KZ8 A;  3WS0 A;  1XKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...