1NYMA

Crystal structure of the complex between m182t mutant of tem-1 and a boronic acid inhibitor (cxb)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Recognition and resistance in TEM beta-lactamase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 97
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1nymA00
4OPYA 4LV3A 4CJNA 5E2FA 2Q9MA 3BYDA 1E3UD 1SDEA 2Y2OA 4E3OA 2JCHA 1WE4A 5D3OA 3OPRA 2Y2IA 4BD1A 4LCLA 4B4XA 1E3UA 3ZDJA 2P74A 1HTZA 1ES5A 5FQKA 1IYQA 4S2PA 3ZVWA 3CG5A 1NXYA 5FQQA 3UO9A 3LCEA 4E6WA 4BLMA 2VGJA 4U0TA 5CECA 3O87A 2OLUA 3PBOA 2HPBA 4KZAA 1M6KA 5GLBA 1FCNA 5KZHA 5I94A 1FR6A 5A90A 5E2HA 1KVLA 2HP6A 5CEBA 1NY0A 4OH0A 4XXRA 1S6RA 5CHUA 5FQIA 4EBLA 2A49A 1W79A 3JYIA 3PBQA 4QJGA 1NZOA 5AQ7A 1DJBA 1CI8A 1ESUA 3BRMA 2A3UA 4IEDA 4K0XA 4OPQA 1I2SA 1MXOA 4X55A 4DDYA 4OONA 1LI9A 2ZD8A 3IWQA 3RJUA 1SCWA 4BQMA 3MBZA 5FSRA 5F1FA 1U60A 1WYBA 2PU4A 5FAQA 1WYCA 3BEBA 3S4XA 2RCXA 3M6BA 5J8XA 1ES4A 1K54A 3TG9A 4ZJ3A 4BD0A 1DY6A 2WK0A 1YM1A 3WS1A 3FKVA 3BLMA 2EX6A 2WAFA 2X02A 3UPNA 4DE2A 4EBPA 3MFDA 4N9KA 5FI6A 4C6YA 3O88A 3MZDA 3WS2A 4UAAA 1PWDA 4KZ3A 4PM9A 3G35A 1JWPA 4R3BA 2G2WA 3RXWA 5U47A 1K4FA 3SH7A 4KZBA 5FA7A 1NYYA 2ZC5B 2EFXA 3TSGA 3OZHA 4K0WA 1PW1A 2XLNA 3QNCA 2ZQDA 1K57A 1K55C 3GTCA 4KZ8A 5GLDA 1VM1A 1I2WA 1XGIA 1E4DA 3P09A 3GV9A 5FI2A 5EVLA 4P6BA 2XD1A 2EX8A 4WEJA 5DVAA 4NK3A 5GLCA 2ZMAA 3V3SA 4KG6A 3FKWA 3PBRA 3ZHHA 2ZQCA 4LV1A 5CGWA 1CI9A 1QMEA 1YMXA 2J7VA 3SS3A 4M3KA 2X71A 3AGFA 2XDMA 1BLHA 4R0QA 1HVBA 3VP4A 1AXBA 4WELA 1JWVA 4N9LA 1Q2PA 3GQZA 5CRFA 1ONHA 3FZCA 4GDNA 2OV5A 4WZ5A 3BFFA 1YLTA 2Y2NA 1EROA 2C5WB 4HEFA 2QMIA 3G4PA 3C5AA 1SKFA 3FYZA 3GSGA 4OP8A 2XFSA 2WZZA 5AQBA 4WBGA 5DTTA 3UNWA 4C75A 4KZ9A 3VOYA 4S2LA 4E3NA 4X53A 2R9WA 1FSWA 3ZGAB 2Q9NA 4DRTA 3B3XA 4IVIA 5A91A 4OPZA 5A92A 4DF6A 3WRZA 1CEGA 1ERQA 3DW0A 4OQGA 4X68A 5FI7A 2J9PA 4JLFA 1RGYA 3GVBA 3MKEA 4FH2A 2IWDA 4Y7PA 1KGGA 1G6AA 5FQJA 5AQAA 3EQVA 2H5SA 5GHZA 5KSHA 4R1GA 5EVIB 4OQ0A 1NZUA 2P9VA 2FFFB 3OPLA 3Q7ZA 2ZQ7A 5HL1A 1TVFA 1HZOA 3WS0A 4OLDA 2DNSA 1MWRA 4ZDXA 3BFDA 3O3VA 4LV0A 1Y54A 4MEZA 5EECA 5TGFA 3UN7A 2WKIA 4C3QA 2ZQ8A 2WZXA 5FQ9A 1CK3A 4KQQA 1IEMA 4EWFA 5GLAA 1ONGA 5DF7A 2HDUA 4KZ7A 3W4OA 3N8RA 3DTMA 1H8ZA 2H10A 4WMCA 4RVAA 5E2GA 3ZNTA 1K6SA 1IKGA 3V3RA 3IQAA 3NBLA 5CEDA 1BT5A 5BOHA 1YMSA 1KGFA 1MWTA 4P85A 5E2EA 5F82A 3ZCZA 5DTKA 3IHAA 3A3EA 3E2LA 5JYOA 2CC1A 3WS5A 4Q8IA 1LI0A 3EQUA 2XF3A 3MZFA 4OP5A 4XUZA 3ZG5A 4F94A 5EUAA 1NRFA 4GDBA 3VP0A 5GL9A 2WGIA 4KZ5A 1XGJA 1O7EA 2P9VB 3GR2A 1ZKJA 1ES2A 2Y59A 3G32A 1XKZA 3MZEA 4S2NA 5HARA 1N4OA 3VP2A 3IWOA 5KMWA 4R3JA 4DE3A 2ZC6B 3MKFA 3IH9A 3QNBA 3UDXA 3Q7VB 2Y2MA 4OPRA 1ESIA 4WYYA 5FASA 1GHMA 1EWZA 1N9BA 4DKIA 2I72A 4PM5A 3NY4A 3C7UA 2XGNA 5CHJA 1ALQA 4L0LA 1XPBA 4JXSA 1ES3A 1IYOA 3BFCA 3AGDA 3BECA 5HAPA 4XUXA 1ZG4A 4UA6A 3PTEA 4UA9A 3UDIA 2EX9A 1K54C 1BULA 5TR7A 1FOFA 1ZG6A 2XD5A 1YLZA 5FAPA 4KG2A 3VOZA 3N4IA 5CHMA 1L0GA 3UE3A 3CMZA 1EI5A 3DWZA 1W8QA 5CERA 1RP5A 1K56A 4FSFA 5GHXA 4JBFA 2H0YA 4GZBA 1BLCA 2WUQA 2WYXA 3A3DA 3N7WA 4BL3A 3UDFA 1PI5A 4JPMA 2ZC7A 5HFOA 4ZAMA 3OPHA 1K57C 2DCFA 4KZ4A 3GMWA 4KZ6A 4E3MA 3HLCA 1W8YA 4KENB 4LENA 1MY8A 5FAOA 4N1XA 3FV7A 3SH9A 2Y55A 1S0WA 3OC2A 5EVID 2E8IA 3BFEA 2J9OA 2VGKA 4GN2A 4PM6A 4EV4A 3P98A 3G30A 1FQGA 2ZJ9A 4QB8A 5EVIA 2XK1A 3S1YA 1BSGA 2XFTA 4PM8A 2HDRA 1MPLA 2HP5A 4PM7A 2EXAA 3HLEA 4JXVA 5EVIC 3UE1A 4EBNA 1IELA 1GHIA 5HX9A 3IH8A 1O07A 1XXMA 3VP1A 4GD8A 3SH8A 3C7VA 4GOGA 4MBKA 5FDHA 5IHVA 3G31A 1DJAA 4WZ5C 2WAEA 4U0XA 2EXBA 1M40A 1XA7A 4Y0UA 4FCFA 3W4QA 2XQZA 3LEZA 3VP3A 1BZAA 3BM6A 3ISGA 3O86A 2FFYA 4EUZA 2Z2MB 3V50A 1RCJA 3IXGA 3W4PA 1K6RA 1KE0A 3A3JA 3IT9A 3SS4A 3N8LA 3Q81A 2WKEA 4R4SA 4PMAA 1FCOA 4GKUA 1K4EA 3OPPA 1YT4A 3G34A 4QY5A 2ZM8A 4BENA 3S22A 1BLSA 3D4FA 1QMFA 1GCEA 2V2FF 3LY3A 1DJCA 4JKTA 4UHUA 2Y2PA 4P87A 2JE5A 1GHPA 5EPHA 1K38A 3ZFZA 3N6IA 1W5DA 4RX3A 4E6XA 1BUEA 3UPPA 2IWCA 3V39A 5DF8A 2PBYA 2EFUA 1SHVA 4FD8A 4ZJ2A 2Z2LB 4JF6A 2RL3A 1FCMA 4S2OA 4X56A 3PBSA 4OOLA 4MNRA 4JXWA 4IBRA 4WMCD 1MBLA 3PAEA 3Q7VA 2GDNA 4S2IA 2EX2A 4DE1A 2XH9A 3CZDA 3Q82A 3ZNYA 3BLSA 1LHYA 3HLBA 4QHCA 5HAIA 1L0EA 4U3TA 4QD4A 4E3JA 5CGSA 1PWGA 1TDLA 3C4OA 3HVFA 1JTDA 2B5RA 3BFGA 4DXBA 3LO7A 1GA9A 3IF6A 1L0DA 1LL5A 4MBFA 1PZPA 2R9XA 3G2ZA 4WM9A 1ZC2A 4JF5A 4GNUA 1FSYA 4E3KA 5DTSA 1H8YA 5HAQA 2WGWA 5EOEA 2QPNA 4ID4A 5FQMA 2PU2A 4K91A 1PWCA 1JTGA 3IF5A 4FH4A 5E43A 3ZVTA 4DE0A 5M18A 3ITBA 4WZ4A 1L2SA 4OLGA 3M2KA 4OOYA 4S2NC 5DF9A 4X69A 4A5RA 4WEKA 1KE3A 1PW8A 3MXRA 4N92A 3HLGA 3RXXA 3HUMA 3PBTA 3A3IA 2XEPA 4S2JA 3HBRA 3MXSA 5CGXA 3IXDA 4D2OA 1IYSA 3IF6B 4DXCA 1KE4A 1XX2A 1ERMA 3OCLA 2Y2KA 2X01A 3SS5A 3A3FA 5CTNA 2HDSA 4QU3A 4UA7A 1PZOA 4HBUA 2C6WB 3C4PA 4JXGA 3I7JA 2WGWB 3VFHA 3NI9A 4E3LA 4E3IA 4P0MA 4H8RA 1K56D 3HREA 3UY6A 1MWSA 4IBXA 3WWXA 4QY6A 1XP4A 1YLWA 4HBTA 2WADA 2ZLYA 3AGEA 1YLYA 1IYPA 5HW3A 3IHBA 4OQHA 3ZG0A 5TFQA 3PBNA 4CPKA 1Q2QA 1IKIA 1NYMA 3SOIA 2ZC4B 1C3BA 1PYYA 3HUOA 3N8SA 4S2KA 1YLJA 2ZC3B 3GRJA 5JYPA 3VSKA 4RYEA 1KDWA 3VSLA 1OMEA 1TEMA 3IXHA 4GB7A 2OLVA 2ZQAA 1E25A 1SDNA 2J8YA 2ZM2A 5L2FA 4ZBEA 3CJMA 1MKIA 3UE0A 3UPOA 2Y2LA 5A93A 1J9MA 1KGEA 3NC8A 1K55A 1H5XA 5EE8A 4HESA 4RA7A 3E2KA 1W7FA 5GHYA 4MLLA 3WS4A 3ZG9B 5F83A 1XA1A 4JF4A 1CEFA 4LCMA 1MWUA 1K25A 2Y2JA 4YINA 4MBHA 4YFMA 4R23A 4B88A 2BLSA 4O7DA 3DWKA 4R4RA 3IXBA 1GA0A 1Z6FA 4KG5A 3IWIA 1JVJA 3HUNA 1TDGA 1BTLA 3HLWA 3Q07A 1LLBA 5CXWA 5KSCA 5CTMA 4KQRA 4DDSA 5M1AA 3VFFA 4Z9QA 1NJ4A 3FWLA 2G2UA 2HP9A 4GD6A 3HL9A 2JBFA 4LV2A 2DRWA 4S2MA 4Y0OA 1I5QA 3NDGA 3HLFA 5FATA 5G18A 1KDSA 1RGZA 4EQIA 4OQIA 4OKPA 3PAGA 3NDEA 5EOOA 4KQOA 2WKHA 1BLPA 3OCNA 3ZG8B 1PI4A 1FR1A 2Y4AA 3M6HA 1VQQA 3NCKA 4OOMA 1HD8A 2XR0A 2OSUA 3QHYA 2V20A 2BG1A 1G68A 4ZTKA 3WRTA 4OVDA 5F1GA 3TOIA 3M2JA 2JC7A 4PPRA 2ZQ9A 2IWBA 3W8KA 2HDQA 3HLDA 2Y91A 1L0FA 4ZJ1A 2QZ6A 3VMAA 2ZM0A 1JWZA 3LY4A 1PIOA 4IVKA 4X6TA 1YQSA 3V5MA 3ITAA 2Y2GA 3IF6C 1KVMA 4NETA 4RX2A 2Y2QA 4N1HA 3G2YA 2WGVA 4BL2A 2V1ZA 5AQ9A 1LL9A 4B4ZA 4Y0TA 3ZG7B 3Q1FA 4BJPA 2H0TA 2Y2HA 5M19A 1YLPA 2UWXA 3NIAA
chains in the Genus database with same CATH superfamily
4OPYA 4LV3A 5E2FA 1E3UD 1SDEA 4E3OA 2JCHA 2D01A 3CUEC 1GSVA 3IS2B 3D9YA 1ES5A 4S2PA 3UO9A 4E6WA 2VGJA 5EV0A 2W3DA 2HPBA 3F1NA 4KZAA 5GLBA 4L9GA 5KZHA 3IBJA 5CEBA 4XXRA 5CHUA 1NZOA 1LSXA 4ESPA 4GJ4A 1YSQA 2ZD8A 3BQAA 1J3WA 3MBZA 2PYPA 3BEBA 2RCXA 1T19A 3F1OB 3EEAA 3WS2A 3QP5A 4KZ8A 5GLDA 1E4DA 2QYBA 1G5UA 4G3KA 5DVAA 4KG6A 1YKDA 3ZHHA 2L4RA 3JVUA 5CGWA 1CI9A 2J7VA 3HJIA 1H3QA 2X71A 2XDMA 4NKPA 1HVBA 1VB6A 2VV7A 1AXBA 2VK3A 4WELA 3L7HA 3IBRA 3GSGA 3MJQA 5DTTA 3UNWA 3H82B 4BMWA 2Q0OA 3ZGAB 2PD7A 4DF6A 3WRZA 3B33A 4JLFA 1D1JA 3GVBA 3L9KA 3EEHA 5AQAA 4EERA 4R1GA 5EVIB 3OPLA 5HDDA 1HZOA 2DNSA 4LV0A 5TGFA 4C3QA 4KQQA 1IEMA 4EWFA 5J4EA 5E2GA 3K3CA 4G3VA 3V3RA 3T4KA 3KSHA 4Y3IA 3MQ0A 5F82A 3ZCZA 3EQUA 3FG8A 4GCZA 4FTXA 4GDBA 4GS9A 2KX6A 2L1MA 4KZ5A 2P9VB 2W0NA 5HDCA 3IWOA 1LSVA 5KMWA 2K31A 4F3LA 2ZC6B 1A0KA 3MKFA 4CLCC 3UDXA 4WN5A 2Y2MA 4WYYA 1GHMA 3BQ8A 1VEUA 4DKIA 2I72A 3NOUC 4PM5A 2XGNA 5L8MA 3NOTC 1ES3A 3BECA 4UA6A 3K3DA 3PTEA 3UDIA 1K54C 3EGDC 5TR7A 1MC0A 4BBUA 2XD5A 4HJ3A 2JKFA 2J3TC 3TJZC 4B9OA 3OOVA 5CHMA 3UE3A 1EI5A 4GLQA 5CERA 5GHXA 4GZBA 1BLCA 4JPMA 4BBVA 1NLYA 1W8YA 2J80A 5JYOA 1MY8A 2E8IA 3V67A 3H7WB 1P9WA 4Y15A 4PM6A 4ZRRA 3P98A 2XK1A 1BSGA 4PM8A 4PM7A 2EXAA 1IELA 5HX9A 3IH8A 4GOGA 3NJAA 4U0XA 1V9ZA 1M40A 4Y0UA 3W4QA 3BY8A 2O99A 3BM6A 3O86A 2FFYA 1KE0A 3A3JA 4FUWA 5HD5A 3N8LA 3Q81A 3R4KA 3G34A 3CI6A 5HWTA 4YNRA 2W27A 3LR5A 3F1PB 4E6XA 3V39A 5DF8A 2EFUA 1K0KA 2Z2LB 4S2OA 3MQQA 4X56A 3PBSA 4IBRA 1MBLA 4O01A 4S2IA 2LB9A 2EX2A 4DE1A 2EWVA 3CZDA 3Q82A 3HLBA 5HAIA 1L0EA 1OTEA 4QD4A 4BBTA 1PWGA 3C4OA 3HVFA 2B5RA 3LO7A 4I39A 1GA9A 3G2ZA 4WM9A 1FSYA 4ID4A 5FQMA 2Z6CA 4FH4A 3IF5A 5E43A 2JKTI 5CX7A 5M18A 4Y5FA 4LPZA 3O5YA 3S7OA 4Y13A 4OLGA 3M2KA 4EW7A 4IHQA 4WEKA 1PW8A 3MXRA 3HUMA 3PBTA 3A3IA 3HBRA 3IXDA 2GJ3A 4BWIA 1KE4A 1CJFA 1ERMA 3A0RA 3I7JA 2WGWB 4ARZA 3NI9A 5J7EA 4P0MA 1K56D 3WWXA 4NG2A 1ZTUA 2ZLYA 1YLYA 3C2WA 4CPKA 1Q2QA 4HI4A 3CLOA 1ZHHB 5TBMA 2P04A 3N8SA 4QPRA 4S2KA 1YLJA 2ZC3B 3CAXA 4GB7A 3IXHA 2V0WA 2EWWA 3CJMA 2Y2LA 5A93A 2VJWA 3NC8A 2JN7A 1K55A 4HESA 3DTEA 3ZG9B 1XA1A 1MWUA 2Y2JA 3CPTA 4YFMA 4O7DA 1GA0A 3IWIA 1JVJA 3LIFA 1LLBA 3T4SA 1OPXA 3IX4A 3K2NA 4RQ9A 2HF6A 4GD6A 4R38A 1KDSA 5DKLA 2I9VA 5EOOA 4PKYG 1BLPA 1MZUA 1FIKA 3A0VA 3OCNA 1FR1A 1P9RA 2Y4AA 3QHYA 3C8CA 4PAUA 2QJ7A 3IS2A 5EM0A 2JC7A 2ZQ9A 2HDQA 1XFQA 2QZ6A 2ZM0A 3LY4A 5AVEA 4IVKA 3MQOA 1YQSA 3V5MA 3ITAA 3LYXA 4RX2A 1PRQA 3D72A 3E0YA 4Y0TA 3ZG7B 2UWXA 4O8GA 3BW6A 3BYDA 1S4RA 2K2NA 1WE4A 3T4LA 3OPRA 4HHDA 5HL6A 3F1OA 1LSWA 5FQKA 3CG5A 2JKRM 3VOLA 2OLUA 1FCNA 2OWJA 5FQIA 3T4TA 2A49A 1TS8A 2NUPC 5AQ7A 1ESUA 4IEDA 4OPQA 1MXOA 4X55A 1SCWA 1WYBA 1WYCA 3UE6A 4MCWA 1HLUP 4BD0A 1DY6A 1YM1A 5HDSA 2EX6A 2WAFA 5IU1A 2X02A 4DE2A 4EBPA 3MFDA 4N9KA 4DJ3A 3MZDA 2HZ5A 4UEYA 4UAAA 4P6ZS 1JWPA 2PT7A 2G2WA 4R3BA 1K4FA 4KZBA 3H82A 5FEGA 1NYYA 1H0MA 3TSGA 1STZA 4K0WA 2ZQDA 1K57A 3GTCA 1VM1A 2VKSA 3FPVA 2XD1A 2EX8A 4NK3A 5GLCA 4D60A 2ZQCA 4LV1A 1QMEA 1GSXA 3KSIA 4M3KA 1GSWA 1SKOB 3AGFA 1BLHA 4R0QA 3PYPA 5CRFA 4G3WA 2B02A 2VA0A 2VV6A 2QMIA 1SKFA 4C75A 2M7UA 3ZQ5A 4S2LA 5I5LA 4E3NA 4X53A 4DRTA 2YKHA 4IVIA 5A92A 2W3FA 4MN6A 3DW0A 4HP9A 4X1LA 2J9PA 2WKRA 3UB8A 1KGGA 5FQJA 1F9IA 4OQ0A 2P9VA 2FFFB 3Q7ZA 2V1AA 2V1BA 3UN7A 1Y54A 5EECA 1EW0A 2QKPA 5FQ9A 2WZXA 4II7A 1ONGA 3W4OA 1H8ZA 2H10A 2UV0E 3IQAA 3NBLA 4JGPA 4ME4A 5CEDA 4HJ4A 3P7NA 1YMSA 4KQDA 5DTKA 3IHAA 3A3EA 4KUOA 3WS5A 4Q8IA 2NUTC 4F94A 5GL9A 1O7EA 3GR2A 5TJJA 1ZKJA 5HARA 3MZEA 3T1QB 1OT9A 3LIEA 1G6OA 4R3JA 3RTYA 3QNBA 2ZOIA 3TW8A 5DFXA 5HSQA 3KYEA 3NY4A 3GECA 5FL3A 1ALQA 4L0LA 3H7WA 3BFCA 2P08A 2PBDP 4XUXA 1ZG4A 4UA9A 1BULA 1ZG6A 4R3AA 2HJ9C 3N4IA 3DWZA 3KYZA 4JBFA 2H0YA 1WA9A 4BL3A 3N7WA 3T4JA 3UDFA 2ZC7A 5HFOA 3LFVA 4ZAMA 1W63M 3OPHA 4E3MA 3HLCA 5FAOA 3SH9A 5HD3A 1S0WA 3VV4A 1UGUA 2J9OA 3G30A 2ZJ9A 3TRCA 5HPIA 3S1YA 2LB5A 1MPLA 4LLOB 2Z6DA 4JXVA 1O07A 3VP1A 3SH8A 5IHVA 4WZ5C 1XA7A 1S67L 3VP3A 1BZAA 4EUZA 2Z2MB 3V50A 3IXGA 3W4PA 4PHTA 2VGLM 4R4SA 1T1AA 1FCOA 4GKUA 1K4EA 1OTAA 2ZM8A 4EESA 4BENA 3S22A 3D4FA 1GCEA 4JKTA 2MJ6A 2VX8A 4P87A 2JE5A 1K38A 4JGOA 1BUEA 2IWCA 1JNUA 1SHVA 4ZJ2A 4JF6A 4OOLA 1X0OA 4WMCD 3U4LP 3Q7VA 3ZNYA 3BLSA 4ETXA 4H6JA 2XSSA 2VV8A 2XA7M 1ZC2A 3NULA 4GNUA 4XT2A 5DTSA 1H8YA 2E8JA 5HAQA 2WGWA 2R78A 2QPNA 1N9LA 1PWCA 3LI8A 3ITBA 4WZ4A 2W1TA 1LL8A 4S2NC 3CUEA 1KE3A 3E4PA 2L0WA 2XEPA 4S2JA 3QP4A 4EUVA 1D06A 4QU3A 4UA7A 1PZOA 4HBUA 4JXGA 3IX3A 4HIAA 4E3IA 2PR6A 3UY6A 1MWSA 4EXOA 4QY6A 4HBTA 2WADA 3IHBA 3MXQA 3MS6A 5TFQA 3MMHA 3MFXA 3HUOA 1YAXA 1OMEA 2J8YA 3R7WB 3JPUA 5G4YA 2H28A 1KGEA 2W3GA 3UMDA 5GHYA 3QP1A 3WS4A 4JF4A 1CEFA 4LCMA 3MR0A 4B88A 2BLSA 4KG5A 5DFYA 1F5MA 1NWZA 3B47A 3T1XA 5CXWA 5KSCA 1Y28A 1H8MA 1NJ4A 3PR6A 2G2UA 3HL9A 4LV2A 3HLFA 1RGZA 3PAGA 3M6HA 4I38A 1VQQA 4NXEA 3W2ZA 3ZYTA 1HD8A 4GHIA 2V20A 3WRTA 3CITA 3M2JA 3W8KA 3MSHA 1XJ4A 2Y91A 3GDIA 3VMAA 1JWZA 1TS6A 4MN7A 1F98A 3IF6C 2Y2QA 2JKGA 4N1HA 3G2YA 2V1ZA 2IA2A 3DTKA 4B4ZA 1BYWA 2Y2HA 4HOIA 4FOFA 2FH5A 1OJ5A 2Q9MA 5D3OA 4I5SA 2Y2IA 4B4XA 2P74A 1HTZA 3ZVWA 1VETA 1NXYA 5FQQA 3O87A 3KSFA 4CLCA 4IUHA 3C38A 5I94A 1FR6A 3LIAA 1TS7A 5J3WA 5A90A 4Q0HA 1T1BA 2HP6A 1S6RA 4EBLA 4CQHA 4QJGA 1DJBA 1CI8A 2OWHA 4DDYA 5M19A 2ZMVA 1LI9A 3IWQA 5FSRA 5F1FA 1U60A 2PU4A 5FAQA 3S4XA 2ZL1A 1SKOA 1K54A 4O0PA 2ZOHA 2WK0A 3WS1A 3FKVA 3BLMA 5FI6A 4C6YA 3O88A 2O9CA 4KZ3A 3G35A 1NLZA 4NXGA 3RXWA 3SH7A 2ZC5B 1PW1A 5HWVA 3QNCA 5F69A 1N9OA 4UQIM 1IFQA 3V3SA 4P6ZM 1SZVA 2HJEA 3SS3A 4JGQA 1JWVA 4N9LA 1Q2PA 3FZCA 4GDNA 2OV5A 3BFFA 1EROA 3T1SA 2WKQA 3G4PA 3C5AA 3FYZA 4OP8A 5L07A 4X25A 1VHMA 3QP6A 2WZZA 5AQBA 3ICYA 4KZ9A 1DP9A 2XRNA 4MN5A 1FSWA 3B3XA 4OPZA 1UWPX 1ERQA 4X68A 4OQGA 5FI7A 1S4SA 3NHQA 3MKEA 4FH2A 4ETZA 2IWDA 4Y7PA 4I3IA 1G6AA 3EQVA 1NZUA 4LFUA 4YWZA 2ZQ7A 5HL1A 1TVFA 3RH8B 3WS0A 4HNBA 1XJ6A 1MWRA 4MEZA 3SZTA 2ZQ8A 1CK3A 2PDRA 1Y4OA 2HDUA 1XJ2A 4IJGA 2PHYA 1BT5A 4PKYA 3S7PA 5BOHA 1KGFA 1MWTA 4P85A 5E2EA 3E2LA 2CC1A 3H9WA 3MZFA 2XF3A 4OP5A 4MMNA 3FC7A 5EUAA 1NRFA 1XGJA 3G32A 1XKZA 3VP2A 4HH2A 1N4OA 3IH9A 5FEFA 5FASA 1EWZA 4LRXC 1P0ZA 2BTFP 1KOUA 3C7UA 5CHJA 4JXSA 4DJ2A 3T4OA 4X1MA 3AGDA 5HAPA 3LIDA 2V0UA 3VE3A 1K56A 4FSFA 3TE8A 1PI5A 2V8FA 3KYQA 3UB5P 3OBFA 4I3AA 4KZ4A 4WUJA 5KSHA 2QWSA 3OC2A 2AVXA 2VGKA 1DRMA 4GN2A 3T50A 5IS1A 1FQGA 4QB8A 5EVIA 2JKRI 2HDRA 3HLEA 4EBNA 1GHIA 3C7VA 5FDHA 3G31A 1DJAA 2WAEA 2EXBA 4FCFA 3LEZA 5KIZA 4KUKA 1K6RA 4M4XA 5TBMB 3SS4A 2GNXA 4QY5A 3NOPC 1QMFA 1DJCA 2VZWA 4UHUA 1GHPA 3ZFZA 1W5DA 5EM1A 5FDSA 3UPPA 5F5YA 2RL3A 1FCMA 2W1RA 2PAVP 4MNRA 3PAEA 2XH9A 5F68A 4NXBA 4U3TA 4WL9A 5CGSA 1JTDA 1L0DA 5IT5A 1LL5A 4MBFA 1PZPA 1S1ZA 2PU2A 4K91A 2K7SA 2WKPA 4OOYA 1UWNX 3D3OA 5DF9A 4AFIA 3RXXA 3C30A 2KDKA 1T18A 3LGOA 2OAP1 4Y2FA 1IYSA 2V9AA 3IF6B 2O9BA 1XX2A 2B18A 3R7WA 2X01A 3SS5A 5EVEA 2HDSA 1OJGA 1N9NA 3C4PA 4E3LA 4H8RA 3DBAA 3HREA 3VE4A 1IOUA 5EFWA 5HW3A 1T1CA 4OQHA 1IKIA 3LR0A 3SOIA 1C3BA 1AWIA 4DN0A 4EU0A 5JYPA 2PR5A 2OLVA 2ZQAA 4EQ1A 4MDZA 4ZBEA 3F1PA 3UPOA 1J9MA 4L9FA 4R6LA 5EE8A 4RA7A 3E2KA 1W7FA 2PRFA 5F83A 4YINA 4MBHA 3DWKA 1OT6A 3IXBA 4GW9A 1TDGA 3Q07A 2KOIA 4DDSA 3LR3A 5M1AA 4Z9QA 3VFFA 1PNEA 3FWLA 4IUKA 2HP9A 4E04A 4S2MA 2DRWA 5G18A 1CF0A 4OQIA 5A8BA 1L3LA 3IX8A 3A0SA 5DJUA 1PI4A 3KSGA 3NCKA 4OOMA 2XR0A 2OSUA 3CHWP 1G68A 4OVDA 5F1GA 3TOIA 1XFNA 5L09A 2IWBA 4ZJ1A 2M7VA 3PXPA 4X6TA 2Y2GA 3EOIA 3B42A 4NETA 4BL2A 5AQ9A 1LL9A 3Q1FA 4BJPA 2H0TA 4K0XA 4Q0IA 5EPHA 2PD8A 4CJNA 3G6OA 5AJGA 2Y2OA 4R70A 4BD1A 4LCLA 1E3UA 4YOFA 2CMNA 3ZDJA 1IYQA 4CLCD 2ZMFA 3LCEA 5G4ZA 4BLMA 2EA9A 4U0TA 5CECA 3PBOA 3U2AA 1M6KA 1PFLA 2A24B 5E2HA 1KVLA 1NY0A 4OH0A 1NRJA 1W79A 3CWFA 3JYIA 3PBQA 4DMZA 3BRMA 2A3UA 1I2SA 1OTIA 4OONA 3RJUA 4BQMA 3T4QA 2J3TD 3M6BA 5J8XA 1ES4A 3JVVA 3TG9A 4ZJ3A 1Z09A 3UPNA 4HJ6A 1PWDA 4PM9A 2O0YA 3F1NB 5U47A 5FA7A 2EFXA 3OZHA 2XLNA 1K55C 1I2WA 1XGIA 2O9AA 3P09A 3GV9A 5FI2A 5EVLA 4P6BA 1MKMA 4WEJA 2ZMAA 3FKWA 3PBRA 1YMXA 3VP4A 2Y8HA 3UB7A 2VGLS 3GQZA 1ONHA 2JKTM 4WZ5A 1YLTA 2Y2NA 2B95A 2C5WB 4HEFA 2XFSA 2HGVA 4WBGA 3VOYA 3T12B 1ACFA 3E98A 5F6AA 2R9WA 3LEQA 2Q9NA 5A91A 1CEGA 3PHYA 1RGYA 2H5SA 5GHZA 4JGRA 4EEPA 3ULFA 3LI9A 3E4OA 4OLDA 3RFBA 3UMEA 2XA7S 4ZDXA 1V9YA 2M1CA 3BFDA 3O3VA 3SW1A 2WKIA 5AVFA 5GLAA 5DF7A 4KZ7A 2D02A 3N8RA 3DTMA 3ZNTA 4WMCA 4RVAA 1F2KA 1K6SA 1IKGA 1OTDA 1YPRA 1LI0A 4XUZA 3ZG5A 3VP0A 2WGIA 3DTIA 5L10A 2Y59A 1ES2A 3LR4A 4S2NA 4DE3A 4QWOA 3Q7VB 2GX5A 4K08A 4OPRA 1ESIA 2DMWA 3BWLA 5C5KA 1TF1A 1N9BA 3T1RA 4H6JB 4HP4A 1XPBA 1CQAA 4Y17A 1IYOA 2OOLA 4XT2B 2PYRA 2EX9A 4Z1WA 1DP8A 1FOFA 4LRZE 4GS9B 1YLZA 5FAPA 1OTBA 4KG2A 3VOZA 2ACGA 1L0GA 3CMZA 3UB6A 1W8QA 2INWA 1RP5A 2W1TB 4F3LB 2WUQA 2WYXA 3A3DA 3S7NA 2Y79A 3HJKA 2OAQ1 1K57C 3KX0X 1VEUB 2DCFA 3GMWA 4KZ6A 4KENB 4LENA 4N1XA 3EWKA 3FV7A 2Y55A 5EVID 3BFEA 3EGXC 4EV4A 3MF0A 2XFTA 4EEUA 3DAVA 2HP5A 4I3JA 3UE1A 5EVIC 1XXMA 4GD8A 4MBKA 4B93A 2A2LA 1YSPA 2XQZA 3ISGA 1D7EA 1RCJA 3IT9A 2WKEA 4HQAA 4PMAA 3OPPA 1YT4A 2YKFA 1BLSA 2V2FF 3LY3A 2Y2PA 2V8CA 3N6IA 1XJ3A 4RX3A 2PBYA 4FD8A 3E4QA 4JXWA 2GDNA 2W3HA 5K5BA 5HWWA 4WLAA 1LHYA 4QHCA 4E3JA 1TDLA 4CLCE 3BFGA 4DXBA 5MC7A 3IF6A 3BJNA 2R9XA 4JF5A 4LGWA 1S1YA 3FPWA 4E3KA 5EOEA 1JTGA 4DE0A 3ZVTA 3HCYA 3P01A 2ZBBA 1L2SA 4GHIB 4Q0JA 4X69A 5DKKA 4A5RA 4L9EA 3LUQA 4N92A 3HLGA 2XROA 1ODVA 3MXSA 5CGXA 3NECA 4NXFA 4D2OA 4DXCA 3OCLA 2Y2KA 2G7UA 3A3FA 5CTNA 4WF0A 1TD5A 2C6WB 3VFHA 1FILA 5HZHA 2JHEA 4EETB 4IBXA 1XP4A 1YLWA 3AGEA 1IYPA 3ZG0A 3PBNA 4HY8A 1NYMA 3UB9A 2ZC4B 3OLOA 1PYYA 2J3WA 3LICA 4UQIS 3GRJA 4HH3A 3VSKA 1VETB 4LRYC 1KDWA 4RYEA 3VSLA 5LBRA 1TEMA 1E25A 1SDNA 2ZM2A 5L2FA 2GZAA 3LIBA 1MKIA 4CLCB 3UE0A 1H5XA 2W3EA 1G28A 4ARZB 4MLLA 1P97A 1K25A 4R23A 4R4RA 2FZ0A 1Z6FA 3HUNA 2P7JA 1BTLA 3HLWA 1TS0A 2VLGA 2ZL1B 5CTMA 4KQRA 2KLIA 2JBFA 4Y0OA 5FATA 1I5QA 3NDGA 4EQIA 4OKPA 3NDEA 2VEAA 1DP6A 4KQOA 2WKHA 3ZG8B 1S66L 3CPTB 2BG1A 4ZTKA 2HV1A 3BY9A 5DJTA 1W63Q 4PPRA 3S7QA 3HLDA 1L0FA 4NEED 1PIOA 3QP8A 2QHKA 2QJ5A 1KVMA 2A24A 5HPFA 2WGVA 3KO6A 3QP2A 1LT0A 1YLPA 2BASA 3NIAA
chains in the Genus database with same CATH topology
4OPYA 4LV3A 4CJNA 5E2FA 2Q9MA 3BYDA 1E3UD 1SDEA 2Y2OA 4E3OA 2JCHA 1WE4A 5D3OA 3OPRA 2Y2IA 4BD1A 4LCLA 4B4XA 1E3UA 3ZDJA 2P74A 1HTZA 1ES5A 5FQKA 1IYQA 4S2PA 3ZVWA 3CG5A 1NXYA 5FQQA 3UO9A 3LCEA 4E6WA 4BLMA 2VGJA 4U0TA 5CECA 3O87A 2OLUA 3PBOA 2HPBA 4KZAA 1M6KA 5GLBA 1FCNA 5KZHA 5I94A 1FR6A 5A90A 5E2HA 1KVLA 2HP6A 5CEBA 1NY0A 4OH0A 4XXRA 1S6RA 5CHUA 5FQIA 4EBLA 2A49A 1W79A 3JYIA 3PBQA 4QJGA 1NZOA 5AQ7A 1DJBA 1CI8A 1ESUA 3BRMA 2A3UA 4IEDA 4K0XA 4OPQA 1I2SA 1MXOA 4X55A 4DDYA 4OONA 1LI9A 2ZD8A 3IWQA 3RJUA 1SCWA 4BQMA 3MBZA 5FSRA 5F1FA 1U60A 1WYBA 2PU4A 5FAQA 1WYCA 3BEBA 3S4XA 2RCXA 3M6BA 5J8XA 1ES4A 1K54A 3TG9A 4ZJ3A 4BD0A 1DY6A 2WK0A 1YM1A 3WS1A 3FKVA 3BLMA 2EX6A 2WAFA 2X02A 3UPNA 4DE2A 4EBPA 3MFDA 4N9KA 5FI6A 4C6YA 3O88A 3MZDA 3WS2A 4UAAA 1PWDA 4KZ3A 4PM9A 3G35A 1JWPA 4R3BA 2G2WA 3RXWA 5U47A 1K4FA 3SH7A 4KZBA 5FA7A 1NYYA 2ZC5B 2EFXA 3TSGA 3OZHA 4K0WA 1PW1A 2XLNA 3QNCA 2ZQDA 1K57A 1K55C 3GTCA 4KZ8A 5GLDA 1VM1A 1I2WA 1XGIA 1E4DA 3P09A 3GV9A 5FI2A 5EVLA 4P6BA 2XD1A 2EX8A 4WEJA 5DVAA 4NK3A 5GLCA 2ZMAA 3V3SA 4KG6A 3FKWA 3PBRA 3ZHHA 2ZQCA 4LV1A 5CGWA 1CI9A 1QMEA 1YMXA 2J7VA 3SS3A 4M3KA 2X71A 3AGFA 2XDMA 1BLHA 4R0QA 1HVBA 3VP4A 1AXBA 4WELA 1JWVA 4N9LA 1Q2PA 3GQZA 5CRFA 1ONHA 3FZCA 4GDNA 2OV5A 4WZ5A 3BFFA 1YLTA 2Y2NA 1EROA 2C5WB 4HEFA 2QMIA 3G4PA 3C5AA 1SKFA 3FYZA 3GSGA 4OP8A 2XFSA 2WZZA 5AQBA 4WBGA 5DTTA 3UNWA 4C75A 4KZ9A 3VOYA 4S2LA 4E3NA 4X53A 2R9WA 1FSWA 3ZGAB 2Q9NA 4DRTA 3B3XA 4IVIA 5A91A 4OPZA 5A92A 4DF6A 3WRZA 1CEGA 1ERQA 3DW0A 4OQGA 4X68A 5FI7A 2J9PA 4JLFA 1RGYA 3GVBA 3MKEA 4FH2A 2IWDA 4Y7PA 1KGGA 1G6AA 5FQJA 5AQAA 3EQVA 2H5SA 5GHZA 5KSHA 4R1GA 5EVIB 4OQ0A 1NZUA 2P9VA 2FFFB 3OPLA 3Q7ZA 2ZQ7A 5HL1A 1TVFA 1HZOA 3WS0A 4OLDA 2DNSA 1MWRA 4ZDXA 3BFDA 3O3VA 4LV0A 1Y54A 4MEZA 5EECA 5TGFA 3UN7A 2WKIA 4C3QA 2ZQ8A 2WZXA 5FQ9A 1CK3A 4KQQA 1IEMA 4EWFA 5GLAA 1ONGA 5DF7A 2HDUA 4KZ7A 3W4OA 3N8RA 3DTMA 1H8ZA 2H10A 4WMCA 4RVAA 5E2GA 3ZNTA 1K6SA 1IKGA 3V3RA 3IQAA 3NBLA 5CEDA 1BT5A 5BOHA 1YMSA 1KGFA 1MWTA 4P85A 5E2EA 5F82A 3ZCZA 5DTKA 3IHAA 3A3EA 3E2LA 5JYOA 2CC1A 3WS5A 4Q8IA 1LI0A 3EQUA 2XF3A 3MZFA 4OP5A 4XUZA 3ZG5A 4F94A 5EUAA 1NRFA 4GDBA 3VP0A 5GL9A 2WGIA 4KZ5A 1XGJA 1O7EA 2P9VB 3GR2A 1ZKJA 1ES2A 2Y59A 3G32A 1XKZA 3MZEA 4S2NA 5HARA 1N4OA 3VP2A 3IWOA 5KMWA 4R3JA 4DE3A 2ZC6B 3MKFA 3IH9A 3QNBA 3UDXA 3Q7VB 2Y2MA 4OPRA 1ESIA 4WYYA 5FASA 1GHMA 1EWZA 1N9BA 4DKIA 2I72A 4PM5A 3NY4A 3C7UA 2XGNA 5CHJA 1ALQA 4L0LA 1XPBA 4JXSA 1ES3A 1IYOA 3BFCA 3AGDA 3BECA 5HAPA 4XUXA 1ZG4A 4UA6A 3PTEA 4UA9A 3UDIA 2EX9A 1K54C 1BULA 5TR7A 1FOFA 1ZG6A 2XD5A 1YLZA 5FAPA 4KG2A 3VOZA 3N4IA 5CHMA 1L0GA 3UE3A 3CMZA 1EI5A 3DWZA 1W8QA 5CERA 1RP5A 1K56A 4FSFA 5GHXA 4JBFA 2H0YA 4GZBA 1BLCA 2WUQA 2WYXA 3A3DA 3N7WA 4BL3A 3UDFA 1PI5A 4JPMA 2ZC7A 5HFOA 4ZAMA 3OPHA 1K57C 2DCFA 4KZ4A 3GMWA 4KZ6A 4E3MA 3HLCA 1W8YA 4KENB 4LENA 1MY8A 5FAOA 4N1XA 3FV7A 3SH9A 2Y55A 1S0WA 3OC2A 5EVID 2E8IA 3BFEA 2J9OA 2VGKA 4GN2A 4PM6A 4EV4A 3P98A 3G30A 1FQGA 2ZJ9A 4QB8A 5EVIA 2XK1A 3S1YA 1BSGA 2XFTA 4PM8A 2HDRA 1MPLA 2HP5A 4PM7A 2EXAA 3HLEA 4JXVA 5EVIC 3UE1A 4EBNA 1IELA 1GHIA 5HX9A 3IH8A 1O07A 1XXMA 3VP1A 4GD8A 3SH8A 3C7VA 4GOGA 4MBKA 5FDHA 5IHVA 3G31A 1DJAA 4WZ5C 2WAEA 4U0XA 2EXBA 1M40A 1XA7A 4Y0UA 4FCFA 3W4QA 2XQZA 3LEZA 3VP3A 1BZAA 3BM6A 3ISGA 3O86A 2FFYA 4EUZA 2Z2MB 3V50A 1RCJA 3IXGA 3W4PA 1K6RA 1KE0A 3A3JA 3IT9A 3SS4A 3N8LA 3Q81A 2WKEA 4R4SA 4PMAA 1FCOA 4GKUA 1K4EA 3OPPA 1YT4A 3G34A 4QY5A 2ZM8A 4BENA 3S22A 1BLSA 3D4FA 1QMFA 1GCEA 2V2FF 3LY3A 1DJCA 4JKTA 4UHUA 2Y2PA 4P87A 2JE5A 1GHPA 5EPHA 1K38A 3ZFZA 3N6IA 1W5DA 4RX3A 4E6XA 1BUEA 3UPPA 2IWCA 3V39A 5DF8A 2PBYA 2EFUA 1SHVA 4FD8A 4ZJ2A 2Z2LB 4JF6A 2RL3A 1FCMA 4S2OA 4X56A 3PBSA 4OOLA 4MNRA 4JXWA 4IBRA 4WMCD 1MBLA 3PAEA 3Q7VA 2GDNA 4S2IA 2EX2A 4DE1A 2XH9A 3CZDA 3Q82A 3ZNYA 3BLSA 1LHYA 3HLBA 4QHCA 5HAIA 1L0EA 4U3TA 4QD4A 4E3JA 5CGSA 1PWGA 1TDLA 3C4OA 3HVFA 1JTDA 2B5RA 3BFGA 4DXBA 3LO7A 1GA9A 3IF6A 1L0DA 1LL5A 4MBFA 1PZPA 2R9XA 3G2ZA 4WM9A 1ZC2A 4JF5A 4GNUA 1FSYA 4E3KA 5DTSA 1H8YA 5HAQA 2WGWA 5EOEA 2QPNA 4ID4A 5FQMA 2PU2A 4K91A 1PWCA 1JTGA 3IF5A 4FH4A 5E43A 3ZVTA 4DE0A 5M18A 3ITBA 4WZ4A 1L2SA 4OLGA 3M2KA 4OOYA 4S2NC 5DF9A 4X69A 4A5RA 4WEKA 1KE3A 1PW8A 3MXRA 4N92A 3HLGA 3RXXA 3HUMA 3PBTA 3A3IA 2XEPA 4S2JA 3HBRA 3MXSA 5CGXA 3IXDA 4D2OA 1IYSA 3IF6B 4DXCA 1KE4A 1XX2A 1ERMA 3OCLA 2Y2KA 2X01A 3SS5A 3A3FA 5CTNA 2HDSA 4QU3A 4UA7A 1PZOA 4HBUA 2C6WB 3C4PA 4JXGA 3I7JA 2WGWB 3VFHA 3NI9A 4E3LA 4E3IA 4P0MA 4H8RA 1K56D 3HREA 3UY6A 1MWSA 4IBXA 3WWXA 4QY6A 1XP4A 1YLWA 4HBTA 2WADA 2ZLYA 3AGEA 1YLYA 1IYPA 5HW3A 3IHBA 4OQHA 3ZG0A 5TFQA 3PBNA 4CPKA 1Q2QA 1IKIA 1NYMA 3SOIA 2ZC4B 1C3BA 1PYYA 3HUOA 3N8SA 4S2KA 1YLJA 2ZC3B 3GRJA 5JYPA 3VSKA 4RYEA 1KDWA 3VSLA 1OMEA 1TEMA 3IXHA 4GB7A 2OLVA 2ZQAA 1E25A 1SDNA 2J8YA 2ZM2A 5L2FA 4ZBEA 3CJMA 1MKIA 3UE0A 3UPOA 2Y2LA 5A93A 1J9MA 1KGEA 3NC8A 1K55A 1H5XA 5EE8A 4HESA 4RA7A 3E2KA 1W7FA 5GHYA 4MLLA 3WS4A 3ZG9B 5F83A 1XA1A 4JF4A 1CEFA 4LCMA 1MWUA 1K25A 2Y2JA 4YINA 4MBHA 4YFMA 4R23A 4B88A 2BLSA 4O7DA 3DWKA 4R4RA 3IXBA 1GA0A 1Z6FA 4KG5A 3IWIA 1JVJA 3HUNA 1TDGA 1BTLA 3HLWA 3Q07A 1LLBA 5CXWA 5KSCA 5CTMA 4KQRA 4DDSA 5M1AA 3VFFA 4Z9QA 1NJ4A 3FWLA 2G2UA 2HP9A 4GD6A 3HL9A 2JBFA 4LV2A 2DRWA 4S2MA 4Y0OA 1I5QA 3NDGA 3HLFA 5FATA 5G18A 1KDSA 1RGZA 4EQIA 4OQIA 4OKPA 3PAGA 3NDEA 5EOOA 4KQOA 2WKHA 1BLPA 3OCNA 3ZG8B 1PI4A 1FR1A 2Y4AA 3M6HA 1VQQA 3NCKA 4OOMA 1HD8A 2XR0A 2OSUA 3QHYA 2V20A 2BG1A 1G68A 4ZTKA 3WRTA 4OVDA 5F1GA 3TOIA 3M2JA 2JC7A 4PPRA 2ZQ9A 2IWBA 3W8KA 2HDQA 3HLDA 2Y91A 1L0FA 4ZJ1A 2QZ6A 3VMAA 2ZM0A 1JWZA 3LY4A 1PIOA 4IVKA 4X6TA 1YQSA 3V5MA 3ITAA 2Y2GA 3IF6C 1KVMA 4NETA 4RX2A 2Y2QA 4N1HA 3G2YA 2WGVA 4BL2A 2V1ZA 5AQ9A 1LL9A 4B4ZA 4Y0TA 3ZG7B 3Q1FA 4BJPA 2H0TA 2Y2HA 5M19A 1YLPA 2UWXA 3NIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPY A;  4LV3 A;  4CJN A;  5E2F A;  2Q9M A;  3BYD A;  1E3U D;  1SDE A;  2Y2O A;  4E3O A;  2JCH A;  1WE4 A;  5D3O A;  3OPR A;  2Y2I A;  4BD1 A;  4LCL A;  4B4X A;  1E3U A;  3ZDJ A;  2P74 A;  1HTZ A;  1ES5 A;  5FQK A;  1IYQ A;  4S2P A;  3ZVW A;  3CG5 A;  1NXY A;  5FQQ A;  3UO9 A;  3LCE A;  4E6W A;  4BLM A;  2VGJ A;  4U0T A;  5CEC A;  3O87 A;  2OLU A;  3PBO A;  2HPB A;  4KZA A;  1M6K A;  5GLB A;  1FCN A;  5KZH A;  5I94 A;  1FR6 A;  5A90 A;  5E2H A;  1KVL A;  2HP6 A;  5CEB A;  1NY0 A;  4OH0 A;  4XXR A;  1S6R A;  5CHU A;  5FQI A;  4EBL A;  2A49 A;  1W79 A;  3JYI A;  3PBQ A;  4QJG A;  1NZO A;  5AQ7 A;  1DJB A;  1CI8 A;  1ESU A;  3BRM A;  2A3U A;  4IED A;  4K0X A;  4OPQ A;  1I2S A;  1MXO A;  4X55 A;  4DDY A;  4OON A;  1LI9 A;  2ZD8 A;  3IWQ A;  3RJU A;  1SCW A;  4BQM A;  3MBZ A;  5FSR A;  5F1F A;  1U60 A;  1WYB A;  2PU4 A;  5FAQ A;  1WYC A;  3BEB A;  3S4X A;  2RCX A;  3M6B A;  5J8X A;  1ES4 A;  1K54 A;  3TG9 A;  4ZJ3 A;  4BD0 A;  1DY6 A;  2WK0 A;  1YM1 A;  3WS1 A;  3FKV A;  3BLM A;  2EX6 A;  2WAF A;  2X02 A;  3UPN A;  4DE2 A;  4EBP A;  3MFD A;  4N9K A;  5FI6 A;  4C6Y A;  3O88 A;  3MZD A;  3WS2 A;  4UAA A;  1PWD A;  4KZ3 A;  4PM9 A;  3G35 A;  1JWP A;  4R3B A;  2G2W A;  3RXW A;  5U47 A;  1K4F A;  3SH7 A;  4KZB A;  5FA7 A;  1NYY A;  2ZC5 B;  2EFX A;  3TSG A;  3OZH A;  4K0W A;  1PW1 A;  2XLN A;  3QNC A;  2ZQD A;  1K57 A;  1K55 C;  3GTC A;  4KZ8 A;  5GLD A;  1VM1 A;  1I2W A;  1XGI A;  1E4D A;  3P09 A;  3GV9 A;  5FI2 A;  5EVL A;  4P6B A;  2XD1 A;  2EX8 A;  4WEJ A;  5DVA A;  4NK3 A;  5GLC A;  2ZMA A;  3V3S A;  4KG6 A;  3FKW A;  3PBR A;  3ZHH A;  2ZQC A;  4LV1 A;  5CGW A;  1CI9 A;  1QME A;  1YMX A;  2J7V A;  3SS3 A;  4M3K A;  2X71 A;  3AGF A;  2XDM A;  1BLH A;  4R0Q A;  1HVB A;  3VP4 A;  1AXB A;  4WEL A;  1JWV A;  4N9L A;  1Q2P A;  3GQZ A;  5CRF A;  1ONH A;  3FZC A;  4GDN A;  2OV5 A;  4WZ5 A;  3BFF A;  1YLT A;  2Y2N A;  1ERO A;  2C5W B;  4HEF A;  2QMI A;  3G4P A;  3C5A A;  1SKF A;  3FYZ A;  3GSG A;  4OP8 A;  2XFS A;  2WZZ A;  5AQB A;  4WBG A;  5DTT A;  3UNW A;  4C75 A;  4KZ9 A;  3VOY A;  4S2L A;  4E3N A;  4X53 A;  2R9W A;  1FSW A;  3ZGA B;  2Q9N A;  4DRT A;  3B3X A;  4IVI A;  5A91 A;  4OPZ A;  5A92 A;  4DF6 A;  3WRZ A;  1CEG A;  1ERQ A;  3DW0 A;  4OQG A;  4X68 A;  5FI7 A;  2J9P A;  4JLF A;  1RGY A;  3GVB A;  3MKE A;  4FH2 A;  2IWD A;  4Y7P A;  1KGG A;  1G6A A;  5FQJ A;  5AQA A;  3EQV A;  2H5S A;  5GHZ A;  5KSH A;  4R1G A;  5EVI B;  4OQ0 A;  1NZU A;  2P9V A;  2FFF B;  3OPL A;  3Q7Z A;  2ZQ7 A;  5HL1 A;  1TVF A;  1HZO A;  3WS0 A;  4OLD A;  2DNS A;  1MWR A;  4ZDX A;  3BFD A;  3O3V A;  4LV0 A;  1Y54 A;  4MEZ A;  5EEC A;  5TGF A;  3UN7 A;  2WKI A;  4C3Q A;  2ZQ8 A;  2WZX A;  5FQ9 A;  1CK3 A;  4KQQ A;  1IEM A;  4EWF A;  5GLA A;  1ONG A;  5DF7 A;  2HDU A;  4KZ7 A;  3W4O A;  3N8R A;  3DTM A;  1H8Z A;  2H10 A;  4WMC A;  4RVA A;  5E2G A;  3ZNT A;  1K6S A;  1IKG A;  3V3R A;  3IQA A;  3NBL A;  5CED A;  1BT5 A;  5BOH A;  1YMS A;  1KGF A;  1MWT A;  4P85 A;  5E2E A;  5F82 A;  3ZCZ A;  5DTK A;  3IHA A;  3A3E A;  3E2L A;  5JYO A;  2CC1 A;  3WS5 A;  4Q8I A;  1LI0 A;  3EQU A;  2XF3 A;  3MZF A;  4OP5 A;  4XUZ A;  3ZG5 A;  4F94 A;  5EUA A;  1NRF A;  4GDB A;  3VP0 A;  5GL9 A;  2WGI A;  4KZ5 A;  1XGJ A;  1O7E A;  2P9V B;  3GR2 A;  1ZKJ A;  1ES2 A;  2Y59 A;  3G32 A;  1XKZ A;  3MZE A;  4S2N A;  5HAR A;  1N4O A;  3VP2 A;  3IWO A;  5KMW A;  4R3J A;  4DE3 A;  2ZC6 B;  3MKF A;  3IH9 A;  3QNB A;  3UDX A;  3Q7V B;  2Y2M A;  4OPR A;  1ESI A;  4WYY A;  5FAS A;  1GHM A;  1EWZ A;  1N9B A;  4DKI A;  2I72 A;  4PM5 A;  3NY4 A;  3C7U A;  2XGN A;  5CHJ A;  1ALQ A;  4L0L A;  1XPB A;  4JXS A;  1ES3 A;  1IYO A;  3BFC A;  3AGD A;  3BEC A;  5HAP A;  4XUX A;  1ZG4 A;  4UA6 A;  3PTE A;  4UA9 A;  3UDI A;  2EX9 A;  1K54 C;  1BUL A;  5TR7 A;  1FOF A;  1ZG6 A;  2XD5 A;  1YLZ A;  5FAP A;  4KG2 A;  3VOZ A;  3N4I A;  5CHM A;  1L0G A;  3UE3 A;  3CMZ A;  1EI5 A;  3DWZ A;  1W8Q A;  5CER A;  1RP5 A;  1K56 A;  4FSF A;  5GHX A;  4JBF A;  2H0Y A;  4GZB A;  1BLC A;  2WUQ A;  2WYX A;  3A3D A;  3N7W A;  4BL3 A;  3UDF A;  1PI5 A;  4JPM A;  2ZC7 A;  5HFO A;  4ZAM A;  3OPH A;  1K57 C;  2DCF A;  4KZ4 A;  3GMW A;  4KZ6 A;  4E3M A;  3HLC A;  1W8Y A;  4KEN B;  4LEN A;  1MY8 A;  5FAO A;  4N1X A;  3FV7 A;  3SH9 A;  2Y55 A;  1S0W A;  3OC2 A;  5EVI D;  2E8I A;  3BFE A;  2J9O A;  2VGK A;  4GN2 A;  4PM6 A;  4EV4 A;  3P98 A;  3G30 A;  1FQG A;  2ZJ9 A;  4QB8 A;  5EVI A;  2XK1 A;  3S1Y A;  1BSG A;  2XFT A;  4PM8 A;  2HDR A;  1MPL A;  2HP5 A;  4PM7 A;  2EXA A;  3HLE A;  4JXV A;  5EVI C;  3UE1 A;  4EBN A;  1IEL A;  1GHI A;  5HX9 A;  3IH8 A;  1O07 A;  1XXM A;  3VP1 A;  4GD8 A;  3SH8 A;  3C7V A;  4GOG A;  4MBK A;  5FDH A;  5IHV A;  3G31 A;  1DJA A;  4WZ5 C;  2WAE A;  4U0X A;  2EXB A;  1M40 A;  1XA7 A;  4Y0U A;  4FCF A;  3W4Q A;  2XQZ A;  3LEZ A;  3VP3 A;  1BZA A;  3BM6 A;  3ISG A;  3O86 A;  2FFY A;  4EUZ A;  2Z2M B;  3V50 A;  1RCJ A;  3IXG A;  3W4P A;  1K6R A;  1KE0 A;  3A3J A;  3IT9 A;  3SS4 A;  3N8L A;  3Q81 A;  2WKE A;  4R4S A;  4PMA A;  1FCO A;  4GKU A;  1K4E A;  3OPP A;  1YT4 A;  3G34 A;  4QY5 A;  2ZM8 A;  4BEN A;  3S22 A;  1BLS A;  3D4F A;  1QMF A;  1GCE A;  2V2F F;  3LY3 A;  1DJC A;  4JKT A;  4UHU A;  2Y2P A;  4P87 A;  2JE5 A;  1GHP A;  5EPH A;  1K38 A;  3ZFZ A;  3N6I A;  1W5D A;  4RX3 A;  4E6X A;  1BUE A;  3UPP A;  2IWC A;  3V39 A;  5DF8 A;  2PBY A;  2EFU A;  1SHV A;  4FD8 A;  4ZJ2 A;  2Z2L B;  4JF6 A;  2RL3 A;  1FCM A;  4S2O A;  4X56 A;  3PBS A;  4OOL A;  4MNR A;  4JXW A;  4IBR A;  4WMC D;  1MBL A;  3PAE A;  3Q7V A;  2GDN A;  4S2I A;  2EX2 A;  4DE1 A;  2XH9 A;  3CZD A;  3Q82 A;  3ZNY A;  3BLS A;  1LHY A;  3HLB A;  4QHC A;  5HAI A;  1L0E A;  4U3T A;  4QD4 A;  4E3J A;  5CGS A;  1PWG A;  1TDL A;  3C4O A;  3HVF A;  1JTD A;  2B5R A;  3BFG A;  4DXB A;  3LO7 A;  1GA9 A;  3IF6 A;  1L0D A;  1LL5 A;  4MBF A;  1PZP A;  2R9X A;  3G2Z A;  4WM9 A;  1ZC2 A;  4JF5 A;  4GNU A;  1FSY A;  4E3K A;  5DTS A;  1H8Y A;  5HAQ A;  2WGW A;  5EOE A;  2QPN A;  4ID4 A;  5FQM A;  2PU2 A;  4K91 A;  1PWC A;  1JTG A;  3IF5 A;  4FH4 A;  5E43 A;  3ZVT A;  4DE0 A;  5M18 A;  3ITB A;  4WZ4 A;  1L2S A;  4OLG A;  3M2K A;  4OOY A;  4S2N C;  5DF9 A;  4X69 A;  4A5R A;  4WEK A;  1KE3 A;  1PW8 A;  3MXR A;  4N92 A;  3HLG A;  3RXX A;  3HUM A;  3PBT A;  3A3I A;  2XEP A;  4S2J A;  3HBR A;  3MXS A;  5CGX A;  3IXD A;  4D2O A;  1IYS A;  3IF6 B;  4DXC A;  1KE4 A;  1XX2 A;  1ERM A;  3OCL A;  2Y2K A;  2X01 A;  3SS5 A;  3A3F A;  5CTN A;  2HDS A;  4QU3 A;  4UA7 A;  1PZO A;  4HBU A;  2C6W B;  3C4P A;  4JXG A;  3I7J A;  2WGW B;  3VFH A;  3NI9 A;  4E3L A;  4E3I A;  4P0M A;  4H8R A;  1K56 D;  3HRE A;  3UY6 A;  1MWS A;  4IBX A;  3WWX A;  4QY6 A;  1XP4 A;  1YLW A;  4HBT A;  2WAD A;  2ZLY A;  3AGE A;  1YLY A;  1IYP A;  5HW3 A;  3IHB A;  4OQH A;  3ZG0 A;  5TFQ A;  3PBN A;  4CPK A;  1Q2Q A;  1IKI A;  1NYM A;  3SOI A;  2ZC4 B;  1C3B A;  1PYY A;  3HUO A;  3N8S A;  4S2K A;  1YLJ A;  2ZC3 B;  3GRJ A;  5JYP A;  3VSK A;  4RYE A;  1KDW A;  3VSL A;  1OME A;  1TEM A;  3IXH A;  4GB7 A;  2OLV A;  2ZQA A;  1E25 A;  1SDN A;  2J8Y A;  2ZM2 A;  5L2F A;  4ZBE A;  3CJM A;  1MKI A;  3UE0 A;  3UPO A;  2Y2L A;  5A93 A;  1J9M A;  1KGE A;  3NC8 A;  1K55 A;  1H5X A;  5EE8 A;  4HES A;  4RA7 A;  3E2K A;  1W7F A;  5GHY A;  4MLL A;  3WS4 A;  3ZG9 B;  5F83 A;  1XA1 A;  4JF4 A;  1CEF A;  4LCM A;  1MWU A;  1K25 A;  2Y2J A;  4YIN A;  4MBH A;  4YFM A;  4R23 A;  4B88 A;  2BLS A;  4O7D A;  3DWK A;  4R4R A;  3IXB A;  1GA0 A;  1Z6F A;  4KG5 A;  3IWI A;  1JVJ A;  3HUN A;  1TDG A;  1BTL A;  3HLW A;  3Q07 A;  1LLB A;  5CXW A;  5KSC A;  5CTM A;  4KQR A;  4DDS A;  5M1A A;  3VFF A;  4Z9Q A;  1NJ4 A;  3FWL A;  2G2U A;  2HP9 A;  4GD6 A;  3HL9 A;  2JBF A;  4LV2 A;  2DRW A;  4S2M A;  4Y0O A;  1I5Q A;  3NDG A;  3HLF A;  5FAT A;  5G18 A;  1KDS A;  1RGZ A;  4EQI A;  4OQI A;  4OKP A;  3PAG A;  3NDE A;  5EOO A;  4KQO A;  2WKH A;  1BLP A;  3OCN A;  3ZG8 B;  1PI4 A;  1FR1 A;  2Y4A A;  3M6H A;  1VQQ A;  3NCK A;  4OOM A;  1HD8 A;  2XR0 A;  2OSU A;  3QHY A;  2V20 A;  2BG1 A;  1G68 A;  4ZTK A;  3WRT A;  4OVD A;  5F1G A;  3TOI A;  3M2J A;  2JC7 A;  4PPR A;  2ZQ9 A;  2IWB A;  3W8K A;  2HDQ A;  3HLD A;  2Y91 A;  1L0F A;  4ZJ1 A;  2QZ6 A;  3VMA A;  2ZM0 A;  1JWZ A;  3LY4 A;  1PIO A;  4IVK A;  4X6T A;  1YQS A;  3V5M A;  3ITA A;  2Y2G A;  3IF6 C;  1KVM A;  4NET A;  4RX2 A;  2Y2Q A;  4N1H A;  3G2Y A;  2WGV A;  4BL2 A;  2V1Z A;  5AQ9 A;  1LL9 A;  4B4Z A;  4Y0T A;  3ZG7 B;  3Q1F A;  4BJP A;  2H0T A;  2Y2H A;  5M19 A;  1YLP A;  2UWX A;  3NIA A; 
#chains in the Genus database with same CATH topology
 4OPY A;  4LV3 A;  5E2F A;  1E3U D;  1SDE A;  4E3O A;  2JCH A;  2D01 A;  3CUE C;  1GSV A;  3IS2 B;  3D9Y A;  1ES5 A;  4S2P A;  3UO9 A;  4E6W A;  2VGJ A;  5EV0 A;  2W3D A;  2HPB A;  3F1N A;  4KZA A;  5GLB A;  4L9G A;  5KZH A;  3IBJ A;  5CEB A;  4XXR A;  5CHU A;  1NZO A;  1LSX A;  4ESP A;  4GJ4 A;  1YSQ A;  2ZD8 A;  3BQA A;  1J3W A;  3MBZ A;  2PYP A;  3BEB A;  2RCX A;  1T19 A;  3F1O B;  3EEA A;  3WS2 A;  3QP5 A;  4KZ8 A;  5GLD A;  1E4D A;  2QYB A;  1G5U A;  4G3K A;  5DVA A;  4KG6 A;  1YKD A;  3ZHH A;  2L4R A;  3JVU A;  5CGW A;  1CI9 A;  2J7V A;  3HJI A;  1H3Q A;  2X71 A;  2XDM A;  4NKP A;  1HVB A;  1VB6 A;  2VV7 A;  1AXB A;  2VK3 A;  4WEL A;  3L7H A;  3IBR A;  3GSG A;  3MJQ A;  5DTT A;  3UNW A;  3H82 B;  4BMW A;  2Q0O A;  3ZGA B;  2PD7 A;  4DF6 A;  3WRZ A;  3B33 A;  4JLF A;  1D1J A;  3GVB A;  3L9K A;  3EEH A;  5AQA A;  4EER A;  4R1G A;  5EVI B;  3OPL A;  5HDD A;  1HZO A;  2DNS A;  4LV0 A;  5TGF A;  4C3Q A;  4KQQ A;  1IEM A;  4EWF A;  5J4E A;  5E2G A;  3K3C A;  4G3V A;  3V3R A;  3T4K A;  3KSH A;  4Y3I A;  3MQ0 A;  5F82 A;  3ZCZ A;  3EQU A;  3FG8 A;  4GCZ A;  4FTX A;  4GDB A;  4GS9 A;  2KX6 A;  2L1M A;  4KZ5 A;  2P9V B;  2W0N A;  5HDC A;  3IWO A;  1LSV A;  5KMW A;  2K31 A;  4F3L A;  2ZC6 B;  1A0K A;  3MKF A;  4CLC C;  3UDX A;  4WN5 A;  2Y2M A;  4WYY A;  1GHM A;  3BQ8 A;  1VEU A;  4DKI A;  2I72 A;  3NOU C;  4PM5 A;  2XGN A;  5L8M A;  3NOT C;  1ES3 A;  3BEC A;  4UA6 A;  3K3D A;  3PTE A;  3UDI A;  1K54 C;  3EGD C;  5TR7 A;  1MC0 A;  4BBU A;  2XD5 A;  4HJ3 A;  2JKF A;  2J3T C;  3TJZ C;  4B9O A;  3OOV A;  5CHM A;  3UE3 A;  1EI5 A;  4GLQ A;  5CER A;  5GHX A;  4GZB A;  1BLC A;  4JPM A;  4BBV A;  1NLY A;  1W8Y A;  2J80 A;  5JYO A;  1MY8 A;  2E8I A;  3V67 A;  3H7W B;  1P9W A;  4Y15 A;  4PM6 A;  4ZRR A;  3P98 A;  2XK1 A;  1BSG A;  4PM8 A;  4PM7 A;  2EXA A;  1IEL A;  5HX9 A;  3IH8 A;  4GOG A;  3NJA A;  4U0X A;  1V9Z A;  1M40 A;  4Y0U A;  3W4Q A;  3BY8 A;  2O99 A;  3BM6 A;  3O86 A;  2FFY A;  1KE0 A;  3A3J A;  4FUW A;  5HD5 A;  3N8L A;  3Q81 A;  3R4K A;  3G34 A;  3CI6 A;  5HWT A;  4YNR A;  2W27 A;  3LR5 A;  3F1P B;  4E6X A;  3V39 A;  5DF8 A;  2EFU A;  1K0K A;  2Z2L B;  4S2O A;  3MQQ A;  4X56 A;  3PBS A;  4IBR A;  1MBL A;  4O01 A;  4S2I A;  2LB9 A;  2EX2 A;  4DE1 A;  2EWV A;  3CZD A;  3Q82 A;  3HLB A;  5HAI A;  1L0E A;  1OTE A;  4QD4 A;  4BBT A;  1PWG A;  3C4O A;  3HVF A;  2B5R A;  3LO7 A;  4I39 A;  1GA9 A;  3G2Z A;  4WM9 A;  1FSY A;  4ID4 A;  5FQM A;  2Z6C A;  4FH4 A;  3IF5 A;  5E43 A;  2JKT I;  5CX7 A;  5M18 A;  4Y5F A;  4LPZ A;  3O5Y A;  3S7O A;  4Y13 A;  4OLG A;  3M2K A;  4EW7 A;  4IHQ A;  4WEK A;  1PW8 A;  3MXR A;  3HUM A;  3PBT A;  3A3I A;  3HBR A;  3IXD A;  2GJ3 A;  4BWI A;  1KE4 A;  1CJF A;  1ERM A;  3A0R A;  3I7J A;  2WGW B;  4ARZ A;  3NI9 A;  5J7E A;  4P0M A;  1K56 D;  3WWX A;  4NG2 A;  1ZTU A;  2ZLY A;  1YLY A;  3C2W A;  4CPK A;  1Q2Q A;  4HI4 A;  3CLO A;  1ZHH B;  5TBM A;  2P04 A;  3N8S A;  4QPR A;  4S2K A;  1YLJ A;  2ZC3 B;  3CAX A;  4GB7 A;  3IXH A;  2V0W A;  2EWW A;  3CJM A;  2Y2L A;  5A93 A;  2VJW A;  3NC8 A;  2JN7 A;  1K55 A;  4HES A;  3DTE A;  3ZG9 B;  1XA1 A;  1MWU A;  2Y2J A;  3CPT A;  4YFM A;  4O7D A;  1GA0 A;  3IWI A;  1JVJ A;  3LIF A;  1LLB A;  3T4S A;  1OPX A;  3IX4 A;  3K2N A;  4RQ9 A;  2HF6 A;  4GD6 A;  4R38 A;  1KDS A;  5DKL A;  2I9V A;  5EOO A;  4PKY G;  1BLP A;  1MZU A;  1FIK A;  3A0V A;  3OCN A;  1FR1 A;  1P9R A;  2Y4A A;  3QHY A;  3C8C A;  4PAU A;  2QJ7 A;  3IS2 A;  5EM0 A;  2JC7 A;  2ZQ9 A;  2HDQ A;  1XFQ A;  2QZ6 A;  2ZM0 A;  3LY4 A;  5AVE A;  4IVK A;  3MQO A;  1YQS A;  3V5M A;  3ITA A;  3LYX A;  4RX2 A;  1PRQ A;  3D72 A;  3E0Y A;  4Y0T A;  3ZG7 B;  2UWX A;  4O8G A;  3BW6 A;  3BYD A;  1S4R A;  2K2N A;  1WE4 A;  3T4L A;  3OPR A;  4HHD A;  5HL6 A;  3F1O A;  1LSW A;  5FQK A;  3CG5 A;  2JKR M;  3VOL A;  2OLU A;  1FCN A;  2OWJ A;  5FQI A;  3T4T A;  2A49 A;  1TS8 A;  2NUP C;  5AQ7 A;  1ESU A;  4IED A;  4OPQ A;  1MXO A;  4X55 A;  1SCW A;  1WYB A;  1WYC A;  3UE6 A;  4MCW A;  1HLU P;  4BD0 A;  1DY6 A;  1YM1 A;  5HDS A;  2EX6 A;  2WAF A;  5IU1 A;  2X02 A;  4DE2 A;  4EBP A;  3MFD A;  4N9K A;  4DJ3 A;  3MZD A;  2HZ5 A;  4UEY A;  4UAA A;  4P6Z S;  1JWP A;  2PT7 A;  2G2W A;  4R3B A;  1K4F A;  4KZB A;  3H82 A;  5FEG A;  1NYY A;  1H0M A;  3TSG A;  1STZ A;  4K0W A;  2ZQD A;  1K57 A;  3GTC A;  1VM1 A;  2VKS A;  3FPV A;  2XD1 A;  2EX8 A;  4NK3 A;  5GLC A;  4D60 A;  2ZQC A;  4LV1 A;  1QME A;  1GSX A;  3KSI A;  4M3K A;  1GSW A;  1SKO B;  3AGF A;  1BLH A;  4R0Q A;  3PYP A;  5CRF A;  4G3W A;  2B02 A;  2VA0 A;  2VV6 A;  2QMI A;  1SKF A;  4C75 A;  2M7U A;  3ZQ5 A;  4S2L A;  5I5L A;  4E3N A;  4X53 A;  4DRT A;  2YKH A;  4IVI A;  5A92 A;  2W3F A;  4MN6 A;  3DW0 A;  4HP9 A;  4X1L A;  2J9P A;  2WKR A;  3UB8 A;  1KGG A;  5FQJ A;  1F9I A;  4OQ0 A;  2P9V A;  2FFF B;  3Q7Z A;  2V1A A;  2V1B A;  3UN7 A;  1Y54 A;  5EEC A;  1EW0 A;  2QKP A;  5FQ9 A;  2WZX A;  4II7 A;  1ONG A;  3W4O A;  1H8Z A;  2H10 A;  2UV0 E;  3IQA A;  3NBL A;  4JGP A;  4ME4 A;  5CED A;  4HJ4 A;  3P7N A;  1YMS A;  4KQD A;  5DTK A;  3IHA A;  3A3E A;  4KUO A;  3WS5 A;  4Q8I A;  2NUT C;  4F94 A;  5GL9 A;  1O7E A;  3GR2 A;  5TJJ A;  1ZKJ A;  5HAR A;  3MZE A;  3T1Q B;  1OT9 A;  3LIE A;  1G6O A;  4R3J A;  3RTY A;  3QNB A;  2ZOI A;  3TW8 A;  5DFX A;  5HSQ A;  3KYE A;  3NY4 A;  3GEC A;  5FL3 A;  1ALQ A;  4L0L A;  3H7W A;  3BFC A;  2P08 A;  2PBD P;  4XUX A;  1ZG4 A;  4UA9 A;  1BUL A;  1ZG6 A;  4R3A A;  2HJ9 C;  3N4I A;  3DWZ A;  3KYZ A;  4JBF A;  2H0Y A;  1WA9 A;  4BL3 A;  3N7W A;  3T4J A;  3UDF A;  2ZC7 A;  5HFO A;  3LFV A;  4ZAM A;  1W63 M;  3OPH A;  4E3M A;  3HLC A;  5FAO A;  3SH9 A;  5HD3 A;  1S0W A;  3VV4 A;  1UGU A;  2J9O A;  3G30 A;  2ZJ9 A;  3TRC A;  5HPI A;  3S1Y A;  2LB5 A;  1MPL A;  4LLO B;  2Z6D A;  4JXV A;  1O07 A;  3VP1 A;  3SH8 A;  5IHV A;  4WZ5 C;  1XA7 A;  1S67 L;  3VP3 A;  1BZA A;  4EUZ A;  2Z2M B;  3V50 A;  3IXG A;  3W4P A;  4PHT A;  2VGL M;  4R4S A;  1T1A A;  1FCO A;  4GKU A;  1K4E A;  1OTA A;  2ZM8 A;  4EES A;  4BEN A;  3S22 A;  3D4F A;  1GCE A;  4JKT A;  2MJ6 A;  2VX8 A;  4P87 A;  2JE5 A;  1K38 A;  4JGO A;  1BUE A;  2IWC A;  1JNU A;  1SHV A;  4ZJ2 A;  4JF6 A;  4OOL A;  1X0O A;  4WMC D;  3U4L P;  3Q7V A;  3ZNY A;  3BLS A;  4ETX A;  4H6J A;  2XSS A;  2VV8 A;  2XA7 M;  1ZC2 A;  3NUL A;  4GNU A;  4XT2 A;  5DTS A;  1H8Y A;  2E8J A;  5HAQ A;  2WGW A;  2R78 A;  2QPN A;  1N9L A;  1PWC A;  3LI8 A;  3ITB A;  4WZ4 A;  2W1T A;  1LL8 A;  4S2N C;  3CUE A;  1KE3 A;  3E4P A;  2L0W A;  2XEP A;  4S2J A;  3QP4 A;  4EUV A;  1D06 A;  4QU3 A;  4UA7 A;  1PZO A;  4HBU A;  4JXG A;  3IX3 A;  4HIA A;  4E3I A;  2PR6 A;  3UY6 A;  1MWS A;  4EXO A;  4QY6 A;  4HBT A;  2WAD A;  3IHB A;  3MXQ A;  3MS6 A;  5TFQ A;  3MMH A;  3MFX A;  3HUO A;  1YAX A;  1OME A;  2J8Y A;  3R7W B;  3JPU A;  5G4Y A;  2H28 A;  1KGE A;  2W3G A;  3UMD A;  5GHY A;  3QP1 A;  3WS4 A;  4JF4 A;  1CEF A;  4LCM A;  3MR0 A;  4B88 A;  2BLS A;  4KG5 A;  5DFY A;  1F5M A;  1NWZ A;  3B47 A;  3T1X A;  5CXW A;  5KSC A;  1Y28 A;  1H8M A;  1NJ4 A;  3PR6 A;  2G2U A;  3HL9 A;  4LV2 A;  3HLF A;  1RGZ A;  3PAG A;  3M6H A;  4I38 A;  1VQQ A;  4NXE A;  3W2Z A;  3ZYT A;  1HD8 A;  4GHI A;  2V20 A;  3WRT A;  3CIT A;  3M2J A;  3W8K A;  3MSH A;  1XJ4 A;  2Y91 A;  3GDI A;  3VMA A;  1JWZ A;  1TS6 A;  4MN7 A;  1F98 A;  3IF6 C;  2Y2Q A;  2JKG A;  4N1H A;  3G2Y A;  2V1Z A;  2IA2 A;  3DTK A;  4B4Z A;  1BYW A;  2Y2H A;  4HOI A;  4FOF A;  2FH5 A;  1OJ5 A;  2Q9M A;  5D3O A;  4I5S A;  2Y2I A;  4B4X A;  2P74 A;  1HTZ A;  3ZVW A;  1VET A;  1NXY A;  5FQQ A;  3O87 A;  3KSF A;  4CLC A;  4IUH A;  3C38 A;  5I94 A;  1FR6 A;  3LIA A;  1TS7 A;  5J3W A;  5A90 A;  4Q0H A;  1T1B A;  2HP6 A;  1S6R A;  4EBL A;  4CQH A;  4QJG A;  1DJB A;  1CI8 A;  2OWH A;  4DDY A;  5M19 A;  2ZMV A;  1LI9 A;  3IWQ A;  5FSR A;  5F1F A;  1U60 A;  2PU4 A;  5FAQ A;  3S4X A;  2ZL1 A;  1SKO A;  1K54 A;  4O0P A;  2ZOH A;  2WK0 A;  3WS1 A;  3FKV A;  3BLM A;  5FI6 A;  4C6Y A;  3O88 A;  2O9C A;  4KZ3 A;  3G35 A;  1NLZ A;  4NXG A;  3RXW A;  3SH7 A;  2ZC5 B;  1PW1 A;  5HWV A;  3QNC A;  5F69 A;  1N9O A;  4UQI M;  1IFQ A;  3V3S A;  4P6Z M;  1SZV A;  2HJE A;  3SS3 A;  4JGQ A;  1JWV A;  4N9L A;  1Q2P A;  3FZC A;  4GDN A;  2OV5 A;  3BFF A;  1ERO A;  3T1S A;  2WKQ A;  3G4P A;  3C5A A;  3FYZ A;  4OP8 A;  5L07 A;  4X25 A;  1VHM A;  3QP6 A;  2WZZ A;  5AQB A;  3ICY A;  4KZ9 A;  1DP9 A;  2XRN A;  4MN5 A;  1FSW A;  3B3X A;  4OPZ A;  1UWP X;  1ERQ A;  4X68 A;  4OQG A;  5FI7 A;  1S4S A;  3NHQ A;  3MKE A;  4FH2 A;  4ETZ A;  2IWD A;  4Y7P A;  4I3I A;  1G6A A;  3EQV A;  1NZU A;  4LFU A;  4YWZ A;  2ZQ7 A;  5HL1 A;  1TVF A;  3RH8 B;  3WS0 A;  4HNB A;  1XJ6 A;  1MWR A;  4MEZ A;  3SZT A;  2ZQ8 A;  1CK3 A;  2PDR A;  1Y4O A;  2HDU A;  1XJ2 A;  4IJG A;  2PHY A;  1BT5 A;  4PKY A;  3S7P A;  5BOH A;  1KGF A;  1MWT A;  4P85 A;  5E2E A;  3E2L A;  2CC1 A;  3H9W A;  3MZF A;  2XF3 A;  4OP5 A;  4MMN A;  3FC7 A;  5EUA A;  1NRF A;  1XGJ A;  3G32 A;  1XKZ A;  3VP2 A;  4HH2 A;  1N4O A;  3IH9 A;  5FEF A;  5FAS A;  1EWZ A;  4LRX C;  1P0Z A;  2BTF P;  1KOU A;  3C7U A;  5CHJ A;  4JXS A;  4DJ2 A;  3T4O A;  4X1M A;  3AGD A;  5HAP A;  3LID A;  2V0U A;  3VE3 A;  1K56 A;  4FSF A;  3TE8 A;  1PI5 A;  2V8F A;  3KYQ A;  3UB5 P;  3OBF A;  4I3A A;  4KZ4 A;  4WUJ A;  5KSH A;  2QWS A;  3OC2 A;  2AVX A;  2VGK A;  1DRM A;  4GN2 A;  3T50 A;  5IS1 A;  1FQG A;  4QB8 A;  5EVI A;  2JKR I;  2HDR A;  3HLE A;  4EBN A;  1GHI A;  3C7V A;  5FDH A;  3G31 A;  1DJA A;  2WAE A;  2EXB A;  4FCF A;  3LEZ A;  5KIZ A;  4KUK A;  1K6R A;  4M4X A;  5TBM B;  3SS4 A;  2GNX A;  4QY5 A;  3NOP C;  1QMF A;  1DJC A;  2VZW A;  4UHU A;  1GHP A;  3ZFZ A;  1W5D A;  5EM1 A;  5FDS A;  3UPP A;  5F5Y A;  2RL3 A;  1FCM A;  2W1R A;  2PAV P;  4MNR A;  3PAE A;  2XH9 A;  5F68 A;  4NXB A;  4U3T A;  4WL9 A;  5CGS A;  1JTD A;  1L0D A;  5IT5 A;  1LL5 A;  4MBF A;  1PZP A;  1S1Z A;  2PU2 A;  4K91 A;  2K7S A;  2WKP A;  4OOY A;  1UWN X;  3D3O A;  5DF9 A;  4AFI A;  3RXX A;  3C30 A;  2KDK A;  1T18 A;  3LGO A;  2OAP 1;  4Y2F A;  1IYS A;  2V9A A;  3IF6 B;  2O9B A;  1XX2 A;  2B18 A;  3R7W A;  2X01 A;  3SS5 A;  5EVE A;  2HDS A;  1OJG A;  1N9N A;  3C4P A;  4E3L A;  4H8R A;  3DBA A;  3HRE A;  3VE4 A;  1IOU A;  5EFW A;  5HW3 A;  1T1C A;  4OQH A;  1IKI A;  3LR0 A;  3SOI A;  1C3B A;  1AWI A;  4DN0 A;  4EU0 A;  5JYP A;  2PR5 A;  2OLV A;  2ZQA A;  4EQ1 A;  4MDZ A;  4ZBE A;  3F1P A;  3UPO A;  1J9M A;  4L9F A;  4R6L A;  5EE8 A;  4RA7 A;  3E2K A;  1W7F A;  2PRF A;  5F83 A;  4YIN A;  4MBH A;  3DWK A;  1OT6 A;  3IXB A;  4GW9 A;  1TDG A;  3Q07 A;  2KOI A;  4DDS A;  3LR3 A;  5M1A A;  4Z9Q A;  3VFF A;  1PNE A;  3FWL A;  4IUK A;  2HP9 A;  4E04 A;  4S2M A;  2DRW A;  5G18 A;  1CF0 A;  4OQI A;  5A8B A;  1L3L A;  3IX8 A;  3A0S A;  5DJU A;  1PI4 A;  3KSG A;  3NCK A;  4OOM A;  2XR0 A;  2OSU A;  3CHW P;  1G68 A;  4OVD A;  5F1G A;  3TOI A;  1XFN A;  5L09 A;  2IWB A;  4ZJ1 A;  2M7V A;  3PXP A;  4X6T A;  2Y2G A;  3EOI A;  3B42 A;  4NET A;  4BL2 A;  5AQ9 A;  1LL9 A;  3Q1F A;  4BJP A;  2H0T A;  4K0X A;  4Q0I A;  5EPH A;  2PD8 A;  4CJN A;  3G6O A;  5AJG A;  2Y2O A;  4R70 A;  4BD1 A;  4LCL A;  1E3U A;  4YOF A;  2CMN A;  3ZDJ A;  1IYQ A;  4CLC D;  2ZMF A;  3LCE A;  5G4Z A;  4BLM A;  2EA9 A;  4U0T A;  5CEC A;  3PBO A;  3U2A A;  1M6K A;  1PFL A;  2A24 B;  5E2H A;  1KVL A;  1NY0 A;  4OH0 A;  1NRJ A;  1W79 A;  3CWF A;  3JYI A;  3PBQ A;  4DMZ A;  3BRM A;  2A3U A;  1I2S A;  1OTI A;  4OON A;  3RJU A;  4BQM A;  3T4Q A;  2J3T D;  3M6B A;  5J8X A;  1ES4 A;  3JVV A;  3TG9 A;  4ZJ3 A;  1Z09 A;  3UPN A;  4HJ6 A;  1PWD A;  4PM9 A;  2O0Y A;  3F1N B;  5U47 A;  5FA7 A;  2EFX A;  3OZH A;  2XLN A;  1K55 C;  1I2W A;  1XGI A;  2O9A A;  3P09 A;  3GV9 A;  5FI2 A;  5EVL A;  4P6B A;  1MKM A;  4WEJ A;  2ZMA A;  3FKW A;  3PBR A;  1YMX A;  3VP4 A;  2Y8H A;  3UB7 A;  2VGL S;  3GQZ A;  1ONH A;  2JKT M;  4WZ5 A;  1YLT A;  2Y2N A;  2B95 A;  2C5W B;  4HEF A;  2XFS A;  2HGV A;  4WBG A;  3VOY A;  3T12 B;  1ACF A;  3E98 A;  5F6A A;  2R9W A;  3LEQ A;  2Q9N A;  5A91 A;  1CEG A;  3PHY A;  1RGY A;  2H5S A;  5GHZ A;  4JGR A;  4EEP A;  3ULF A;  3LI9 A;  3E4O A;  4OLD A;  3RFB A;  3UME A;  2XA7 S;  4ZDX A;  1V9Y A;  2M1C A;  3BFD A;  3O3V A;  3SW1 A;  2WKI A;  5AVF A;  5GLA A;  5DF7 A;  4KZ7 A;  2D02 A;  3N8R A;  3DTM A;  3ZNT A;  4WMC A;  4RVA A;  1F2K A;  1K6S A;  1IKG A;  1OTD A;  1YPR A;  1LI0 A;  4XUZ A;  3ZG5 A;  3VP0 A;  2WGI A;  3DTI A;  5L10 A;  2Y59 A;  1ES2 A;  3LR4 A;  4S2N A;  4DE3 A;  4QWO A;  3Q7V B;  2GX5 A;  4K08 A;  4OPR A;  1ESI A;  2DMW A;  3BWL A;  5C5K A;  1TF1 A;  1N9B A;  3T1R A;  4H6J B;  4HP4 A;  1XPB A;  1CQA A;  4Y17 A;  1IYO A;  2OOL A;  4XT2 B;  2PYR A;  2EX9 A;  4Z1W A;  1DP8 A;  1FOF A;  4LRZ E;  4GS9 B;  1YLZ A;  5FAP A;  1OTB A;  4KG2 A;  3VOZ A;  2ACG A;  1L0G A;  3CMZ A;  3UB6 A;  1W8Q A;  2INW A;  1RP5 A;  2W1T B;  4F3L B;  2WUQ A;  2WYX A;  3A3D A;  3S7N A;  2Y79 A;  3HJK A;  2OAQ 1;  1K57 C;  3KX0 X;  1VEU B;  2DCF A;  3GMW A;  4KZ6 A;  4KEN B;  4LEN A;  4N1X A;  3EWK A;  3FV7 A;  2Y55 A;  5EVI D;  3BFE A;  3EGX C;  4EV4 A;  3MF0 A;  2XFT A;  4EEU A;  3DAV A;  2HP5 A;  4I3J A;  3UE1 A;  5EVI C;  1XXM A;  4GD8 A;  4MBK A;  4B93 A;  2A2L A;  1YSP A;  2XQZ A;  3ISG A;  1D7E A;  1RCJ A;  3IT9 A;  2WKE A;  4HQA A;  4PMA A;  3OPP A;  1YT4 A;  2YKF A;  1BLS A;  2V2F F;  3LY3 A;  2Y2P A;  2V8C A;  3N6I A;  1XJ3 A;  4RX3 A;  2PBY A;  4FD8 A;  3E4Q A;  4JXW A;  2GDN A;  2W3H A;  5K5B A;  5HWW A;  4WLA A;  1LHY A;  4QHC A;  4E3J A;  1TDL A;  4CLC E;  3BFG A;  4DXB A;  5MC7 A;  3IF6 A;  3BJN A;  2R9X A;  4JF5 A;  4LGW A;  1S1Y A;  3FPW A;  4E3K A;  5EOE A;  1JTG A;  4DE0 A;  3ZVT A;  3HCY A;  3P01 A;  2ZBB A;  1L2S A;  4GHI B;  4Q0J A;  4X69 A;  5DKK A;  4A5R A;  4L9E A;  3LUQ A;  4N92 A;  3HLG A;  2XRO A;  1ODV A;  3MXS A;  5CGX A;  3NEC A;  4NXF A;  4D2O A;  4DXC A;  3OCL A;  2Y2K A;  2G7U A;  3A3F A;  5CTN A;  4WF0 A;  1TD5 A;  2C6W B;  3VFH A;  1FIL A;  5HZH A;  2JHE A;  4EET B;  4IBX A;  1XP4 A;  1YLW A;  3AGE A;  1IYP A;  3ZG0 A;  3PBN A;  4HY8 A;  1NYM A;  3UB9 A;  2ZC4 B;  3OLO A;  1PYY A;  2J3W A;  3LIC A;  4UQI S;  3GRJ A;  4HH3 A;  3VSK A;  1VET B;  4LRY C;  1KDW A;  4RYE A;  3VSL A;  5LBR A;  1TEM A;  1E25 A;  1SDN A;  2ZM2 A;  5L2F A;  2GZA A;  3LIB A;  1MKI A;  4CLC B;  3UE0 A;  1H5X A;  2W3E A;  1G28 A;  4ARZ B;  4MLL A;  1P97 A;  1K25 A;  4R23 A;  4R4R A;  2FZ0 A;  1Z6F A;  3HUN A;  2P7J A;  1BTL A;  3HLW A;  1TS0 A;  2VLG A;  2ZL1 B;  5CTM A;  4KQR A;  2KLI A;  2JBF A;  4Y0O A;  5FAT A;  1I5Q A;  3NDG A;  4EQI A;  4OKP A;  3NDE A;  2VEA A;  1DP6 A;  4KQO A;  2WKH A;  3ZG8 B;  1S66 L;  3CPT B;  2BG1 A;  4ZTK A;  2HV1 A;  3BY9 A;  5DJT A;  1W63 Q;  4PPR A;  3S7Q A;  3HLD A;  1L0F A;  4NEE D;  1PIO A;  3QP8 A;  2QHK A;  2QJ5 A;  1KVM A;  2A24 A;  5HPF A;  2WGV A;  3KO6 A;  3QP2 A;  1LT0 A;  1YLP A;  2BAS A;  3NIA A; 
#chains in the Genus database with same CATH homology
 4OPY A;  4LV3 A;  4CJN A;  5E2F A;  2Q9M A;  3BYD A;  1E3U D;  1SDE A;  2Y2O A;  4E3O A;  2JCH A;  1WE4 A;  5D3O A;  3OPR A;  2Y2I A;  4BD1 A;  4LCL A;  4B4X A;  1E3U A;  3ZDJ A;  2P74 A;  1HTZ A;  1ES5 A;  5FQK A;  1IYQ A;  4S2P A;  3ZVW A;  3CG5 A;  1NXY A;  5FQQ A;  3UO9 A;  3LCE A;  4E6W A;  4BLM A;  2VGJ A;  4U0T A;  5CEC A;  3O87 A;  2OLU A;  3PBO A;  2HPB A;  4KZA A;  1M6K A;  5GLB A;  1FCN A;  5KZH A;  5I94 A;  1FR6 A;  5A90 A;  5E2H A;  1KVL A;  2HP6 A;  5CEB A;  1NY0 A;  4OH0 A;  4XXR A;  1S6R A;  5CHU A;  5FQI A;  4EBL A;  2A49 A;  1W79 A;  3JYI A;  3PBQ A;  4QJG A;  1NZO A;  5AQ7 A;  1DJB A;  1CI8 A;  1ESU A;  3BRM A;  2A3U A;  4IED A;  4K0X A;  4OPQ A;  1I2S A;  1MXO A;  4X55 A;  4DDY A;  4OON A;  1LI9 A;  2ZD8 A;  3IWQ A;  3RJU A;  1SCW A;  4BQM A;  3MBZ A;  5FSR A;  5F1F A;  1U60 A;  1WYB A;  2PU4 A;  5FAQ A;  1WYC A;  3BEB A;  3S4X A;  2RCX A;  3M6B A;  5J8X A;  1ES4 A;  1K54 A;  3TG9 A;  4ZJ3 A;  4BD0 A;  1DY6 A;  2WK0 A;  1YM1 A;  3WS1 A;  3FKV A;  3BLM A;  2EX6 A;  2WAF A;  2X02 A;  3UPN A;  4DE2 A;  4EBP A;  3MFD A;  4N9K A;  5FI6 A;  4C6Y A;  3O88 A;  3MZD A;  3WS2 A;  4UAA A;  1PWD A;  4KZ3 A;  4PM9 A;  3G35 A;  1JWP A;  4R3B A;  2G2W A;  3RXW A;  5U47 A;  1K4F A;  3SH7 A;  4KZB A;  5FA7 A;  1NYY A;  2ZC5 B;  2EFX A;  3TSG A;  3OZH A;  4K0W A;  1PW1 A;  2XLN A;  3QNC A;  2ZQD A;  1K57 A;  1K55 C;  3GTC A;  4KZ8 A;  5GLD A;  1VM1 A;  1I2W A;  1XGI A;  1E4D A;  3P09 A;  3GV9 A;  5FI2 A;  5EVL A;  4P6B A;  2XD1 A;  2EX8 A;  4WEJ A;  5DVA A;  4NK3 A;  5GLC A;  2ZMA A;  3V3S A;  4KG6 A;  3FKW A;  3PBR A;  3ZHH A;  2ZQC A;  4LV1 A;  5CGW A;  1CI9 A;  1QME A;  1YMX A;  2J7V A;  3SS3 A;  4M3K A;  2X71 A;  3AGF A;  2XDM A;  1BLH A;  4R0Q A;  1HVB A;  3VP4 A;  1AXB A;  4WEL A;  1JWV A;  4N9L A;  1Q2P A;  3GQZ A;  5CRF A;  1ONH A;  3FZC A;  4GDN A;  2OV5 A;  4WZ5 A;  3BFF A;  1YLT A;  2Y2N A;  1ERO A;  2C5W B;  4HEF A;  2QMI A;  3G4P A;  3C5A A;  1SKF A;  3FYZ A;  3GSG A;  4OP8 A;  2XFS A;  2WZZ A;  5AQB A;  4WBG A;  5DTT A;  3UNW A;  4C75 A;  4KZ9 A;  3VOY A;  4S2L A;  4E3N A;  4X53 A;  2R9W A;  1FSW A;  3ZGA B;  2Q9N A;  4DRT A;  3B3X A;  4IVI A;  5A91 A;  4OPZ A;  5A92 A;  4DF6 A;  3WRZ A;  1CEG A;  1ERQ A;  3DW0 A;  4OQG A;  4X68 A;  5FI7 A;  2J9P A;  4JLF A;  1RGY A;  3GVB A;  3MKE A;  4FH2 A;  2IWD A;  4Y7P A;  1KGG A;  1G6A A;  5FQJ A;  5AQA A;  3EQV A;  2H5S A;  5GHZ A;  5KSH A;  4R1G A;  5EVI B;  4OQ0 A;  1NZU A;  2P9V A;  2FFF B;  3OPL A;  3Q7Z A;  2ZQ7 A;  5HL1 A;  1TVF A;  1HZO A;  3WS0 A;  4OLD A;  2DNS A;  1MWR A;  4ZDX A;  3BFD A;  3O3V A;  4LV0 A;  1Y54 A;  4MEZ A;  5EEC A;  5TGF A;  3UN7 A;  2WKI A;  4C3Q A;  2ZQ8 A;  2WZX A;  5FQ9 A;  1CK3 A;  4KQQ A;  1IEM A;  4EWF A;  5GLA A;  1ONG A;  5DF7 A;  2HDU A;  4KZ7 A;  3W4O A;  3N8R A;  3DTM A;  1H8Z A;  2H10 A;  4WMC A;  4RVA A;  5E2G A;  3ZNT A;  1K6S A;  1IKG A;  3V3R A;  3IQA A;  3NBL A;  5CED A;  1BT5 A;  5BOH A;  1YMS A;  1KGF A;  1MWT A;  4P85 A;  5E2E A;  5F82 A;  3ZCZ A;  5DTK A;  3IHA A;  3A3E A;  3E2L A;  5JYO A;  2CC1 A;  3WS5 A;  4Q8I A;  1LI0 A;  3EQU A;  2XF3 A;  3MZF A;  4OP5 A;  4XUZ A;  3ZG5 A;  4F94 A;  5EUA A;  1NRF A;  4GDB A;  3VP0 A;  5GL9 A;  2WGI A;  4KZ5 A;  1XGJ A;  1O7E A;  2P9V B;  3GR2 A;  1ZKJ A;  1ES2 A;  2Y59 A;  3G32 A;  1XKZ A;  3MZE A;  4S2N A;  5HAR A;  1N4O A;  3VP2 A;  3IWO A;  5KMW A;  4R3J A;  4DE3 A;  2ZC6 B;  3MKF A;  3IH9 A;  3QNB A;  3UDX A;  3Q7V B;  2Y2M A;  4OPR A;  1ESI A;  4WYY A;  5FAS A;  1GHM A;  1EWZ A;  1N9B A;  4DKI A;  2I72 A;  4PM5 A;  3NY4 A;  3C7U A;  2XGN A;  5CHJ A;  1ALQ A;  4L0L A;  1XPB A;  4JXS A;  1ES3 A;  1IYO A;  3BFC A;  3AGD A;  3BEC A;  5HAP A;  4XUX A;  1ZG4 A;  4UA6 A;  3PTE A;  4UA9 A;  3UDI A;  2EX9 A;  1K54 C;  1BUL A;  5TR7 A;  1FOF A;  1ZG6 A;  2XD5 A;  1YLZ A;  5FAP A;  4KG2 A;  3VOZ A;  3N4I A;  5CHM A;  1L0G A;  3UE3 A;  3CMZ A;  1EI5 A;  3DWZ A;  1W8Q A;  5CER A;  1RP5 A;  1K56 A;  4FSF A;  5GHX A;  4JBF A;  2H0Y A;  4GZB A;  1BLC A;  2WUQ A;  2WYX A;  3A3D A;  3N7W A;  4BL3 A;  3UDF A;  1PI5 A;  4JPM A;  2ZC7 A;  5HFO A;  4ZAM A;  3OPH A;  1K57 C;  2DCF A;  4KZ4 A;  3GMW A;  4KZ6 A;  4E3M A;  3HLC A;  1W8Y A;  4KEN B;  4LEN A;  1MY8 A;  5FAO A;  4N1X A;  3FV7 A;  3SH9 A;  2Y55 A;  1S0W A;  3OC2 A;  5EVI D;  2E8I A;  3BFE A;  2J9O A;  2VGK A;  4GN2 A;  4PM6 A;  4EV4 A;  3P98 A;  3G30 A;  1FQG A;  2ZJ9 A;  4QB8 A;  5EVI A;  2XK1 A;  3S1Y A;  1BSG A;  2XFT A;  4PM8 A;  2HDR A;  1MPL A;  2HP5 A;  4PM7 A;  2EXA A;  3HLE A;  4JXV A;  5EVI C;  3UE1 A;  4EBN A;  1IEL A;  1GHI A;  5HX9 A;  3IH8 A;  1O07 A;  1XXM A;  3VP1 A;  4GD8 A;  3SH8 A;  3C7V A;  4GOG A;  4MBK A;  5FDH A;  5IHV A;  3G31 A;  1DJA A;  4WZ5 C;  2WAE A;  4U0X A;  2EXB A;  1M40 A;  1XA7 A;  4Y0U A;  4FCF A;  3W4Q A;  2XQZ A;  3LEZ A;  3VP3 A;  1BZA A;  3BM6 A;  3ISG A;  3O86 A;  2FFY A;  4EUZ A;  2Z2M B;  3V50 A;  1RCJ A;  3IXG A;  3W4P A;  1K6R A;  1KE0 A;  3A3J A;  3IT9 A;  3SS4 A;  3N8L A;  3Q81 A;  2WKE A;  4R4S A;  4PMA A;  1FCO A;  4GKU A;  1K4E A;  3OPP A;  1YT4 A;  3G34 A;  4QY5 A;  2ZM8 A;  4BEN A;  3S22 A;  1BLS A;  3D4F A;  1QMF A;  1GCE A;  2V2F F;  3LY3 A;  1DJC A;  4JKT A;  4UHU A;  2Y2P A;  4P87 A;  2JE5 A;  1GHP A;  5EPH A;  1K38 A;  3ZFZ A;  3N6I A;  1W5D A;  4RX3 A;  4E6X A;  1BUE A;  3UPP A;  2IWC A;  3V39 A;  5DF8 A;  2PBY A;  2EFU A;  1SHV A;  4FD8 A;  4ZJ2 A;  2Z2L B;  4JF6 A;  2RL3 A;  1FCM A;  4S2O A;  4X56 A;  3PBS A;  4OOL A;  4MNR A;  4JXW A;  4IBR A;  4WMC D;  1MBL A;  3PAE A;  3Q7V A;  2GDN A;  4S2I A;  2EX2 A;  4DE1 A;  2XH9 A;  3CZD A;  3Q82 A;  3ZNY A;  3BLS A;  1LHY A;  3HLB A;  4QHC A;  5HAI A;  1L0E A;  4U3T A;  4QD4 A;  4E3J A;  5CGS A;  1PWG A;  1TDL A;  3C4O A;  3HVF A;  1JTD A;  2B5R A;  3BFG A;  4DXB A;  3LO7 A;  1GA9 A;  3IF6 A;  1L0D A;  1LL5 A;  4MBF A;  1PZP A;  2R9X A;  3G2Z A;  4WM9 A;  1ZC2 A;  4JF5 A;  4GNU A;  1FSY A;  4E3K A;  5DTS A;  1H8Y A;  5HAQ A;  2WGW A;  5EOE A;  2QPN A;  4ID4 A;  5FQM A;  2PU2 A;  4K91 A;  1PWC A;  1JTG A;  3IF5 A;  4FH4 A;  5E43 A;  3ZVT A;  4DE0 A;  5M18 A;  3ITB A;  4WZ4 A;  1L2S A;  4OLG A;  3M2K A;  4OOY A;  4S2N C;  5DF9 A;  4X69 A;  4A5R A;  4WEK A;  1KE3 A;  1PW8 A;  3MXR A;  4N92 A;  3HLG A;  3RXX A;  3HUM A;  3PBT A;  3A3I A;  2XEP A;  4S2J A;  3HBR A;  3MXS A;  5CGX A;  3IXD A;  4D2O A;  1IYS A;  3IF6 B;  4DXC A;  1KE4 A;  1XX2 A;  1ERM A;  3OCL A;  2Y2K A;  2X01 A;  3SS5 A;  3A3F A;  5CTN A;  2HDS A;  4QU3 A;  4UA7 A;  1PZO A;  4HBU A;  2C6W B;  3C4P A;  4JXG A;  3I7J A;  2WGW B;  3VFH A;  3NI9 A;  4E3L A;  4E3I A;  4P0M A;  4H8R A;  1K56 D;  3HRE A;  3UY6 A;  1MWS A;  4IBX A;  3WWX A;  4QY6 A;  1XP4 A;  1YLW A;  4HBT A;  2WAD A;  2ZLY A;  3AGE A;  1YLY A;  1IYP A;  5HW3 A;  3IHB A;  4OQH A;  3ZG0 A;  5TFQ A;  3PBN A;  4CPK A;  1Q2Q A;  1IKI A;  1NYM A;  3SOI A;  2ZC4 B;  1C3B A;  1PYY A;  3HUO A;  3N8S A;  4S2K A;  1YLJ A;  2ZC3 B;  3GRJ A;  5JYP A;  3VSK A;  4RYE A;  1KDW A;  3VSL A;  1OME A;  1TEM A;  3IXH A;  4GB7 A;  2OLV A;  2ZQA A;  1E25 A;  1SDN A;  2J8Y A;  2ZM2 A;  5L2F A;  4ZBE A;  3CJM A;  1MKI A;  3UE0 A;  3UPO A;  2Y2L A;  5A93 A;  1J9M A;  1KGE A;  3NC8 A;  1K55 A;  1H5X A;  5EE8 A;  4HES A;  4RA7 A;  3E2K A;  1W7F A;  5GHY A;  4MLL A;  3WS4 A;  3ZG9 B;  5F83 A;  1XA1 A;  4JF4 A;  1CEF A;  4LCM A;  1MWU A;  1K25 A;  2Y2J A;  4YIN A;  4MBH A;  4YFM A;  4R23 A;  4B88 A;  2BLS A;  4O7D A;  3DWK A;  4R4R A;  3IXB A;  1GA0 A;  1Z6F A;  4KG5 A;  3IWI A;  1JVJ A;  3HUN A;  1TDG A;  1BTL A;  3HLW A;  3Q07 A;  1LLB A;  5CXW A;  5KSC A;  5CTM A;  4KQR A;  4DDS A;  5M1A A;  3VFF A;  4Z9Q A;  1NJ4 A;  3FWL A;  2G2U A;  2HP9 A;  4GD6 A;  3HL9 A;  2JBF A;  4LV2 A;  2DRW A;  4S2M A;  4Y0O A;  1I5Q A;  3NDG A;  3HLF A;  5FAT A;  5G18 A;  1KDS A;  1RGZ A;  4EQI A;  4OQI A;  4OKP A;  3PAG A;  3NDE A;  5EOO A;  4KQO A;  2WKH A;  1BLP A;  3OCN A;  3ZG8 B;  1PI4 A;  1FR1 A;  2Y4A A;  3M6H A;  1VQQ A;  3NCK A;  4OOM A;  1HD8 A;  2XR0 A;  2OSU A;  3QHY A;  2V20 A;  2BG1 A;  1G68 A;  4ZTK A;  3WRT A;  4OVD A;  5F1G A;  3TOI A;  3M2J A;  2JC7 A;  4PPR A;  2ZQ9 A;  2IWB A;  3W8K A;  2HDQ A;  3HLD A;  2Y91 A;  1L0F A;  4ZJ1 A;  2QZ6 A;  3VMA A;  2ZM0 A;  1JWZ A;  3LY4 A;  1PIO A;  4IVK A;  4X6T A;  1YQS A;  3V5M A;  3ITA A;  2Y2G A;  3IF6 C;  1KVM A;  4NET A;  4RX2 A;  2Y2Q A;  4N1H A;  3G2Y A;  2WGV A;  4BL2 A;  2V1Z A;  5AQ9 A;  1LL9 A;  4B4Z A;  4Y0T A;  3ZG7 B;  3Q1F A;  4BJP A;  2H0T A;  2Y2H A;  5M19 A;  1YLP A;  2UWX A;  3NIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...