1T1AA

Late intermediate il1 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
total genus 33
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t1aA00
5F69A 4EEUA 4B9OA 3IBRA 2V1AA 4JGPA 1LL8A 2I9VA 4PKYG 4EXOA 5HWWA 5A8BA 4LRYC 1EW0A 2B02A 1TS7A 4EERA 3D72A 4HI4A 4HJ3A 3F1NB 2H28A 1P97A 2WKQA 4HH3A 1XJ3A 2QWSA 3FC7A 4EW7A 1P0ZA 2OWJA 2L0WA 1T18A 2ZOIA 3E4PA 2K7SA 4GCZA 3VOLA 1ODVA 5TBMA 3A0VA 4MN5A 3VE3A 3A0RA 1OJGA 4WUJA 1LSWA 2PHYA 3BWLA 1OTEA 3MQOA 4R6LA 1S4RA 1JNUA 1S67L 2JN7A 3EEHA 4HJ6A 4XT2B 1DP6A 1LSVA 2PD7A 4GHIB 2HV1A 1XJ4A 1GSVA 2D01A 4I39A 4DJ2A 3NOPC 5HWTA 3ICYA 1F9IA 2PDRA 3UB7A 2VV6A 3ULFA 1MZUA 4HHDA 3PHYA 3GECA 3B33A 3A0SA 2V9AA 3C2WA 2WKRA 2CMNA 3CAXA 4L9FA 3MR0A 1GSXA 2PR5A 2Z6CA 3LIBA 4GHIA 3NHQA 5I5LA 1F98A 4HY8A 4M4XA 1V9ZA 1NWZA 1VB6A 4LRZE 3UB9A 1D7EA 3BY8A 4BBTA 2ZOHA 4NXEA 3UMEA 2INWA 3LIDA 1OT9A 2PD8A 3KX0X 1OJ5A 3EWKA 4JGOA 4WL9A 3UE6A 2VEAA 4I3AA 2VLGA 3P7NA 4NXGA 3NJAA 5J3WA 1OTIA 3H82B 2GJ3A 3E4QA 3IS2A 1N9OA 3LIEA 5DKLA 1GSWA 3CWFA 3NOUC 1UWPX 3K3DA 5AVEA 2W0NA 5EFWA 2A24A 4RQ9A 2YKHA 4LLOB 5J4EA 1T1BA 4BBVA 2QJ7A 4LPZA 4JGRA 1S1YA 1TS8A 4WN5A 3F1PB 3MXQA 4NXFA 2A24B 4H6JB 2PYPA 5F5YA 3MFXA 4R70A 3C8CA 4JGQA 1DP8A 1T19A 1XJ2A 2V0WA 1DP9A 2L4RA 2QHKA 4KUOA 3ZQ5A 4I3IA 4R38A 3IS2B 1N9NA 1UGUA 2P7JA 2YKFA 3H82A 4HP4A 2EA9A 5DJTA 4EESA 1S1ZA 3LIFA 3G6OA 4KUKA 3LYXA 5HD3A 4E04A 5J7EA 4I38A 1LT0A 1WA9A 1XJ6A 2VV8A 4LRXC 4EETB 3GDIA 1OTDA 5DKKA 4L9EA 4DJ3A 4I3JA 2V1BA 1D06A 2OWHA 2VV7A 4F3LA 4HIAA 2W27A 3FG8A 1X0OA 3H7WB 5HDDA 4EQ1A 5HSQA 4HH2A 4WF0A 2QJ5A 2D02A 2ZBBA 2OOLA 4GS9B 4K08A 1OTAA 2V0UA 3F1OA 4L9GA 3VE4A 4BBUA 2PR6A 5G4YA 4YWZA 1G28A 1OTBA 2BASA 3MJQA 1TS6A 3MQQA 3LIAA 4WLAA 5F68A 3RTYA 3F1OB 3LICA 4HOIA 3RH8B 4GS9A 1S4SA 2J80A 2JHEA 2L1MA 4PKYA 5F6AA 5G4ZA 4HNBA 3HJIA 1DRMA 1OT6A 1V9YA 2Z6DA 3H7WA 1T1AA 3CLOA 4XT2A 4HP9A 4R3AA 5IS1A 4F3LB 2QKPA 4HJ4A 5HZHA 3H9WA 5IU1A 2KDKA 3E4OA 3PYPA 1XFNA 2R78A 2PYRA 4I5SA 5TBMB 5KIZA 2WKPA 1BYWA 3UMDA 1N9LA 3F1NA 5AVFA 3UB6A 3NOTC 4GW9A 3LI9A 5HWVA 1Y28A 3LI8A 2KX6A 4EEPA 3LUQA 5HDSA 2M1CA 1UWNX 1KOUA 4H6JA 3F1PA 4KQDA 1LSXA 1S66L 3HJKA 4MN6A 3UB8A 5DJUA 1TS0A 3SW1A 3K3CA 4NXBA 1T1CA 3T50A 5HD5A 1XFQA 4HQAA 3OLOA 5HDCA 3BY9A
chains in the Genus database with same CATH superfamily
2ZMAA 3WS5A 2L0WA 4MBHA 1OTEA 3DWZA 3HLEA 5JYPA 3T4SA 4R23A 1CI8A 3G30A 5EV0A 4L9FA 3NECA 3DTKA 1NZOA 1F2KA 3LO7A 1STZA 1NWZA 1J9MA 2ZJ9A 4LRZE 3UB9A 2ZD8A 3SZTA 2EX2A 1J3WA 3MXRA 1ZKJA 3Q81A 2W3FA 3VFHA 2QJ7A 1U60A 1E25A 3BRMA 4NETA 3TJZC 2MJ6A 2V20A 2H10A 3VSKA 1YLZA 1MWRA 1T19A 5L8MA 1ZG4A 3VOYA 3VP0A 4HP4A 5K5BA 2Y2QA 1RGZA 4LRXC 3CITA 3PBOA 3IWIA 2OWHA 3PBNA 2W27A 1BLSA 3O3VA 4MDZA 4YNRA 2D02A 1L0GA 1OTBA 4E3LA 2GDNA 3U2AA 3HJIA 2Z2MB 3LCEA 5FAPA 1PI4A 4ZAMA 3H9WA 1QMFA 3PTEA 1PI5A 1N9LA 3PBSA 3B42A 3UB6A 4ESPA 1VETB 4EWFA 1K4FA 4MNRA 4H6JA 3V50A 4FH2A 1TS0A 4EBLA 2XD5A 1KGGA 3TSGA 5L07A 4DE2A 2H28A 4CLCD 4DE3A 1RP5A 2W1RA 3CUEC 3NY4A 1JNUA 2W3HA 1DP6A 3MMHA 3RXWA 3SH7A 3MZEA 4EV4A 3FV7A 5HAPA 4HY8A 1PZOA 1YSQA 3T1RA 4BD0A 2HP6A 2VGJA 4JXVA 2OLUA 3UE6A 2VLGA 1DJAA 1IELA 3E4QA 4KZ3A 2H5SA 1Q2PA 3C5AA 5FSRA 2IWDA 4ARZB 2XA7S 4ZJ2A 2FZ0A 3MXQA 3VV4A 3HLWA 4KZAA 5F5YA 4JGQA 3KYEA 5F82A 5FQIA 1G6OA 3IS2B 5KMWA 3QNBA 2HJEA 3LIFA 4LV0A 4Y3IA 1N4OA 4OQIA 3JPUA 4KG6A 2ZBBA 5A92A 4UAAA 1TS6A 3FZCA 3ZYTA 3S7NA 4GB7A 1BYWA 4OPQA 4GN2A 4CQHA 1K55C 3LUQA 5EVEA 1LSXA 3C38A 1SKFA 3S22A 2VK3A 1SKOA 1HLUP 2WGWA 3R4KA 4C3QA 1PW8A 2Y59A 3ITBA 4JLFA 1ACFA 2V2FF 3A3EA 3BFFA 3T12B 5KZHA 1PW1A 2B18A 2R9XA 1O7EA 3VP4A 4ETZA 2XA7M 3FKWA 4IEDA 2V1ZA 1YM1A 1OT9A 5GHYA 2GJ3A 4UHUA 1N9OA 3HLBA 1GSWA 1NYYA 2ZC7A 3V67A 5AQ9A 5AJGA 1XJ2A 4MBFA 2EA9A 4DF6A 4P85A 3UE0A 3MZDA 2XGNA 1GHMA 3ZFZA 3W2ZA 2X02A 3FG8A 3T1XA 3GVBA 2Y2MA 3PR6A 4P87A 3BFEA 5GHXA 5F1GA 2AVXA 3V3SA 2PU4A 3RTYA 1PWDA 5F68A 3LEQA 1GHIA 4XT2A 1NRFA 3U4LP 2XSSA 3F1NA 4GW9A 1E3UA 5I94A 4B93A 3UB8A 4MN6A 1VHMA 2WAEA 4GDBA 1FR6A 5FQ9A 3MXSA 5LBRA 2P04A 5J8XA 1SDEA 2A3UA 4B9OA 2ZC4B 1FSYA 1IYPA 3Q82A 2QWSA 3FC7A 1P0ZA 5L10A 2HJ9C 1OJGA 1LSWA 3T4JA 2JN7A 2NUTC 5TGFA 2M7UA 2P08A 1XJ4A 4KG2A 4EBPA 4EUZA 5EM1A 4OPYA 4KZ5A 2VV6A 1I2SA 1YKDA 3A3JA 5F83A 1GSXA 2V8FA 1F98A 1WYCA 2XH9A 3SS5A 4BBTA 2ZOHA 2PD8A 5EPHA 3G2ZA 4X53A 4D2OA 3G4PA 5U47A 2O0YA 2A24A 4IVKA 2QMIA 2YKHA 3BJNA 4XUXA 1Y54A 2A24B 1W63Q 4S2JA 2HDRA 2GZAA 3IHBA 4FH4A 3B47A 2J9OA 4GKUA 3VOZA 3IXDA 4UA6A 4LV3A 2Y91A 3DTIA 4K08A 4N1XA 3LICA 4GS9A 1OT6A 4KZBA 4R3JA 3UO9A 4F3LB 2HP9A 3TE8A 3UMDA 1PWCA 3PBTA 1TF1A 1YLWA 4B4XA 4OPRA 4FCFA 5A90A 5DJUA 3UE3A 3N6IA 3AGFA 3N4IA 1K6RA 1LI9A 1PIOA 3NDGA 4PKYG 5HX9A 1P97A 1XJ3A 3QP5A 4QY5A 3K2NA 4RYEA 1OMEA 4S2NC 3BWLA 2PD7A 5G18A 2HV1A 5TFQA 1GSVA 2D01A 2O9BA 2PU2A 3TRCA 2XDMA 1XGJA 5FQMA 4RX3A 4WELA 3KSIA 3MR0A 2PR5A 4GHIA 1I5QA 1V9ZA 3N8SA 4CLCE 2INWA 3KX0X 2VEAA 3W4PA 4YOFA 2W0NA 2G2WA 4X6TA 5J4EA 1T1BA 2RL3A 2HDQA 5DTKA 4ETXA 4Y13A 4R70A 4I3IA 1MWTA 3OPHA 3UDIA 3CPTB 5J7EA 2W1TA 4I38A 3ITAA 3HL9A 3MQ0A 1ZTUA 3D4FA 3GR2A 1PFLA 5HDDA 2VGLM 4BQMA 4WF0A 5DTSA 3VE4A 2ZLYA 2XEPA 2J9PA 3G34A 3CHWP 4OQHA 4R3AA 4CLCC 4X25A 2R78A 1BT5A 5CHUA 3HBRA 4Y5FA 2EX9A 1HVBA 4ID4A 3NOTC 3BYDA 1G6AA 3KSFA 4BMWA 2B5RA 2EWWA 4E3NA 3AGDA 1RCJA 4U0XA 4UEYA 3UDXA 1HZOA 2UWXA 5DF8A 1TS7A 4HI4A 5JYOA 2WKQA 4G3KA 2ZOIA 3P98A 4QU3A 3VE3A 3A0RA 1XX2A 2C5WB 4Z1WA 3BFGA 3PAGA 1M6KA 1K6SA 2WZXA 3UNWA 2CMNA 4S2LA 3C7VA 3OPLA 4M4XA 4Y0TA 1ERQA 1YQSA 1VB6A 3DBAA 4NKPA 4PM7A 1TEMA 2W1TB 4WL9A 1W63M 4OKPA 5J3WA 3DTEA 1H5XA 4NXGA 4KENB 3UDFA 5DVAA 1GHPA 1W79A 3WRZA 1BLCA 2XK1A 3QP4A 4WYYA 1JWVA 3TW8A 5L09A 3WS0A 3V5MA 3L9KA 3LGOA 1DJCA 4EESA 2ZQCA 5HARA 1O07A 3OBFA 5EECA 3EGXC 3EOIA 2K2NA 3GQZA 2WGIA 5HSQA 3LEZA 2WUQA 4WBGA 3IF5A 5CECA 1K56A 4G3WA 2X71A 2J80A 4PKYA 1SHVA 2Z6DA 3ZGAB 3CMZA 4WMCA 2JBFA 4CJNA 3HLFA 1KE4A 5KIZA 2WGVA 5CTNA 1MKIA 3VP2A 1AWIA 5EE8A 4KQOA 3Q1FA 3PXPA 4O8GA 5CGXA 4II7A 1FOFA 3TG9A 2PRFA 2EXAA 1XFQA 4HQAA 2GX5A 4LCLA 3S1YA 5F69A 4EEUA 5HWWA 4JGPA 1LL8A 2I9VA 2Y4AA 5FI6A 5E2GA 3E4PA 3IF6A 4LFUA 3IX4A 4QY6A 1HTZA 2NUPC 1L0DA 4ZRRA 2WAFA 4PHTA 3TOIA 1K54A 3GECA 3PHYA 3KYZA 1IFQA 5GL9A 2ZQAA 4BL3A 5HPIA 1PWGA 1KE0A 5EFWA 4BJPA 1VM1A 1IOUA 3ZHHA 3QP2A 1ESUA 2PYPA 1DP9A 3M2KA 1I2WA 1TDLA 2ACGA 3G6OA 3S4XA 2ZL1A 3AGEA 5E2HA 3ZG9B 4QD4A 4Q0HA 3RFBA 5FEGA 1X0OA 2PBDP 4ME4A 5HW3A 5CTMA 2QPNA 3F1OA 5CGSA 4BBUA 4MCWA 1ES5A 4B88A 4P6ZM 4O0PA 5E2EA 3CJMA 5DTTA 2BG1A 2L1MA 3BQAA 2B95A 3UPNA 5IS1A 4FTXA 5FQJA 4S2OA 2QYBA 1G68A 1W8QA 4N9KA 5FASA 1SCWA 1JWPA 3PAEA 3HJKA 4HEFA 3SW1A 3T50A 1NRJA 1BZAA 3IBRA 3P09A 1ONHA 3F1NB 1E3UD 4WEKA 5TBMA 4MN5A 2P74A 3N7WA 4GD6A 4XT2B 4GHIB 4MN7A 2ZMFA 3IX3A 2JKGA 5HWTA 3ICYA 3UB7A 4JF4A 2WKIA 2GNXA 3B33A 4N92A 4X69A 2ZC3B 2Y2LA 3IXGA 3NHQA 4C75A 4OOLA 2Y2GA 3W8KA 1ZHHB 2JKRI 3C30A 3P7NA 3ZG8B 2XLNA 3CWFA 4WZ4A 3JYIA 4RQ9A 3HLCA 1IYSA 2OLVA 4LPZA 3ZNYA 1PZPA 3LY3A 3ZVWA 4H6JB 1H3QA 3C8CA 2O9CA 3H82A 1KDSA 1WE4A 5FI7A 2VV7A 5M18A 2WYXA 3M6HA 2KOIA 4R1GA 4QHCA 3MJQA 5EOOA 3S7PA 3MBZA 4EEPA 1CJFA 4HNBA 2E8IA 3T4TA 1XXMA 3OCNA 3PBRA 2EFUA 4B4ZA 1XFNA 3L7HA 4PM8A 4R0QA 3KSGA 1K38A 2VGLS 1MC0A 1UWNX 4OP8A 2PAVP 4H8RA 3K3CA 4P6BA 4ZTKA 1BTLA 1CQAA 5HFOA 3LR4A 2QZ6A 3KSHA 3ZDJA 2H0TA 3VOLA 2K7SA 5TJJA 3HUOA 1MWSA 2Q0OA 4E3IA 1AXBA 3EQUA 1XA1A 4Q0JA 5GLDA 4HBTA 2WKRA 5EUAA 1XA7A 1S0WA 2ZC5B 4DE0A 1SZVA 1MXOA 2E8JA 3IBJA 3DW0A 5EM0A 5GLAA 2C6WB 4IBXA 3CPTA 3H82B 2LB5A 3ZG7B 1F5MA 3K3DA 3E2LA 5AVEA 4OLGA 1P9RA 3HREA 4R4SA 4DDYA 1W8YA 2HDUA 2WZZA 4HESA 1TS8A 3G32A 3MFXA 3LR0A 5CERA 3RXXA 4X56A 1PYYA 1MY8A 4DE1A 3LYXA 2VV8A 1OTDA 1IKGA 5DKKA 4DJ3A 4D60A 2PT7A 4DMZA 3UN7A 4JF6A 3WS4A 2BASA 3HUMA 4ZDXA 1V9YA 1NJ4A 5EVID 1JTGA 5TBMB 2EX8A 3NCKA 3O86A 2XD1A 5FATA 5HL1A 2HPBA 3S7QA 2JKTM 3F1PA 2VA0A 3SH9A 4ZBEA 4NXBA 4BENA 2OV5A 3BM6A 3ZVTA 3OLOA 5CHJA 4EXOA 3QNCA 3HCYA 4C6YA 4S2IA 2B02A 4HH3A 4ZJ1A 1IYOA 2IA2A 2Y2JA 2JE5A 1S6RA 4WZ5A 3Q7VB 5E2FA 1S4RA 4YINA 3GRJA 1L3LA 4DJ2A 1H8ZA 3PBQA 4ZJ3A 2V9AA 3C2WA 4PMAA 4NXEA 4KZ4A 4MBKA 1ALQA 4M3KA 4BL2A 1CEFA 4UQIM 5AQBA 4LGWA 4LLOB 4BBVA 3BECA 5FL3A 3P01A 1UGUA 2VZWA 3S7OA 5HPFA 5A93A 3A3IA 1G5UA 4L0LA 5F1FA 4OLDA 3G2YA 1YSPA 4Z9QA 4DDSA 1OTAA 2BTFP 5EVIC 3BW6A 1YAXA 3MFDA 2OAQ1 4JKTA 4LV1A 2J7VA 1Z6FA 1NXYA 3E2KA 3O5YA 5GLCA 2PYRA 5AQ7A 3R7WB 5M1AA 2EFXA 3ZG5A 5TR7A 2IWBA 1H8YA 1DY6A 1T1CA 2IWCA 5HD5A 4ARZA 4JPMA 4HJ3A 3CG5A 3I7JA 4GCZA 3ZCZA 1ODVA 1ZG6A 4KQRA 1TDGA 3OPRA 3FKVA 4GOGA 4R6LA 3EEHA 4OPZA 2HGVA 3GSGA 4NK3A 1F9IA 5FDHA 2HP5A 2EX6A 1YLTA 4RVAA 4N9LA 3MS6A 4E3KA 3IHAA 2JCHA 1CI9A 2W3EA 2Z6CA 1TVFA 2X01A 1D1JA 3UMEA 4OQGA 3MSHA 4WM9A 4QB8A 5CX7A 1K25A 1UWPX 3UPOA 4DKIA 4K0WA 3QP8A 1S1YA 3G35A 4WN5A 4IUHA 1FIKA 1FCMA 2V0WA 3IT9A 4LCMA 4KUOA 2Q9MA 4GJ4A 2YKFA 4E3MA 4E04A 1QMEA 3A3DA 3FPWA 1XJ6A 1OPXA 4F3LA 5E43A 5KSCA 5CHMA 4GS9B 2Y2KA 2PR6A 3WS1A 1NZUA 3GMWA 4EUVA 4E6WA 1MKMA 5F6AA 1DRMA 1FQGA 2XQZA 1EWZA 4HP9A 1L0FA 1ONGA 1FILA 5IT5A 3B3XA 1K54C 2WGWB 2J3TD 3LI8A 5CXWA 1IYQA 3Q7ZA 3T4OA 1S66L 4FD8A 1XP4A 4OH0A 1ZC2A 4EQIA 4BD1A 2V1AA 1YPRA 3IWQA 4KZ6A 1EW0A 4A5RA 2WKHA 1KGFA 4EW7A 2OWJA 3A0VA 3N8RA 2H0YA 4WUJA 2PHYA 3VSLA 1LHYA 4I39A 3NOPC 3ULFA 1MZUA 5KSHA 2ZM2A 5I5LA 5CEBA 3BLMA 1XKZA 1N9BA 4QJGA 4OP5A 3D3OA 1YMXA 5EVIA 5CEDA 2Y2OA 2VKSA 3IS2A 3DTMA 4RX2A 5DKLA 3D9YA 4OVDA 2ZMVA 3EEAA 4OQ0A 2DMWA 5D3OA 1PRQA 5HL6A 4CLCA 3HLDA 2P7JA 2Y2NA 3FPVA 3R7WA 1IKIA 3GDIA 5MC7A 2BLSA 1D06A 3DWKA 3O88A 4HIAA 4DRTA 1M40A 1ERMA 2QJ5A 1YT4A 3OPPA 4LV2A 4KZ8A 1JVJA 1G28A 3IH9A 3RH8B 1LLBA 1S4SA 1YMSA 3IXHA 5CGWA 4IVIA 3BFCA 1FR1A 1KGEA 5IU1A 2XR0A 3PYPA 2G7UA 4S2NA 5FA7A 2KX6A 4KQDA 4XUZA 3ZG0A 3FYZA 5FAOA 3UPPA 4X55A 5A8BA 5GHZA 2ZQDA 4MEZA 1KE3A 4NG2A 1T18A 3SS4A 5FQKA 1WYBA 4Q0IA 4Y2FA 1LSVA 2EXBA 2HZ5A 3SS3A 3DAVA 3FWLA 1CEGA 5HAIA 2P9VA 3CAXA 3GV9A 4MMNA 1EROA 2W3GA 4GD8A 3T4KA 4RA7A 3NBLA 2A2LA 3E0YA 1LI0A 5DFXA 1OJ5A 5EVLA 1A0KA 4X68A 4WZ5C 2V8CA 3LIEA 3MKEA 5C5KA 2FFYA 1SKOB 3ZNTA 1P9WA 1GA0A 3NI9A 4X1LA 4NXFA 1DP8A 2JKFA 2QHKA 4OOYA 3ZQ5A 2EWVA 1N9NA 1ESIA 3IQAA 2J3WA 4OONA 5IHVA 2Q9NA 4UQIS 4EQ1A 1BLHA 1MPLA 2ZM0A 3H7WB 3BFDA 2OOLA 4L9GA 3CI6A 4WLAA 4GNUA 3VMAA 2CC1A 4FUWA 5DFYA 5FDSA 1T1AA 3CLOA 2HF6A 3E4OA 4Y15A 5L2FA 4XXRA 2WKPA 1CF0A 4O7DA 1K0KA 1Y28A 5DF9A 1KVLA 4UA9A 1NLYA 4IBRA 3GTCA 3E98A 4S2MA 3MKFA 1JTDA 2OAP1 1NLZA 3OCLA 3WS2A 3V39A 4FOFA 5EVIB 1LL9A 1JWZA 2VX8A 1S67L 4KQQA 2G2UA 1LL5A 4FSFA 5GLBA 1KDWA 2XF3A 3A0SA 3KYQA 3LIBA 1KVMA 1Y4OA 4IHQA 4K91A 3UY6A 2JKRM 2VGKA 3EWKA 3VFFA 4JGOA 4KZ7A 4IUKA 3CUEA 2J3TC 3SOIA 4Y7PA 3NOUC 2UV0E 3OZHA 5CRFA 3V3RA 1K57C 3NULA 3Q07A 2XROA 1VETA 2O9AA 2Z2LB 4R38A 3W4OA 3WRTA 4GLQA 5HD3A 1K57A 4WMCD 2XRNA 2JC7A 4L9EA 3LR3A 1ES4A 3UE1A 4JXGA 4X1MA 2V0UA 1YLJA 1Q2QA 4EU0A 3M6BA 1EI5A 4JBFA 4HOIA 2JHEA 2DRWA 3NC8A 2WKEA 2O99A 4NEED 3MZFA 3W4QA 3OOVA 1TD5A 4E6XA 3IWOA 3LI9A 1KOUA 3IX8A 2HDSA 1H8MA 3BY9A 3QP1A 3D72A 3RJUA 4OOMA 2VJWA 4R3BA 4E3JA 3SH8A 4AFIA 1DJBA 4JXWA 1FCNA 3VP1A 4O01A 1GCEA 1RGYA 3A3FA 4Y0UA 4HHDA 4LENA 4Y17A 1YLYA 3M2JA 1MBLA 2LB9A 3VP3A 3EQVA 4GDNA 2DNSA 1D7EA 4DXCA 4KG5A 3MF0A 1K4EA 1ES3A 2WK0A 5A91A 1BUEA 2ZC6B 3NJAA 1Z09A 1NYMA 4DN0A 4CLCB 4PAUA 2Y8HA 1XGIA 3C7UA 4R4RA 2ZQ9A 2DCFA 2Y55A 4JGRA 2Y79A 1C3BA 2ZQ8A 1BLPA 1VQQA 1BULA 2ZM8A 1NY0A 4P6ZS 1S1ZA 4KUKA 1W5DA 1LT0A 1WA9A 4EETB 4F94A 3T1QB 5M19A 3QP6A 4N1HA 4HH2A 3T4LA 1MWUA 5G4YA 3KO6A 1CK3A 4EBNA 4P0MA 3NDEA 1BSGA 3F1OB 1YLPA 3IH8A 5G4ZA 5FQQA 3H7WA 2QKPA 4WEJA 4G3VA 5HZHA 2KDKA 2XFSA 3LR5A 2ZQ7A 4BLMA 2ZL1B 4PM9A 3ISGA 5AVFA 5HWVA 2M1CA 3G31A 2RCXA 1GA9A 2M7VA 1FSWA 5HDCA 4MLLA 1E4DA 3T4QA 4Y0OA 1PNEA 5FAQA 3LY4A 3LFVA 4LRYC 1XPBA 4EERA 1VEUB 3O87A 1FCOA 4KZ9A 3JVVA 4QPRA 3MQOA 4Q8IA 4HJ6A 4S2KA 4PPRA 1L0EA 3NIAA 4HBUA 2PDRA 2P9VB 4JF5A 4DXBA 4S2PA 5BOHA 4CPKA 3BEBA 2Y2PA 3IF6C 3QHYA 4JXSA 4YFMA 1HD8A 3Q7VA 5FI2A 3BY8A 3LIDA 3IF6B 2JKTI 4PM5A 4I3AA 1VEUA 1OTIA 1W7FA 2WADA 2FFFB 3JVUA 4U3TA 2XFTA 2KLIA 4BWIA 2OSUA 3F1PB 2W3DA 2L4RA 5EOEA 5DF7A 1ES2A 5DJTA 3WWXA 4U0TA 4I3JA 5AQAA 2V1BA 1L2SA 1IEMA 1K56D 1K55A 2FH5A 4YWZA 3MQQA 2Y2HA 3HVFA 2I72A 3LIAA 4PM6A 3IXBA 3T1SA 4QWOA 3EGDC 2PBYA 3HLGA 3BQ8A 4HJ4A 3OC2A 2A49A 4I5SA 3CZDA 2K31A 2Y2IA 5FEFA 4K0XA 3N8LA 3HUNA 4IJGA 4E3OA 2R9WA 3UB5P 5HAQA 5HDSA 4UA7A 2J8YA 1H0MA 4GZBA 1SDNA 3C4PA 3BLSA 3C4OA
chains in the Genus database with same CATH topology
4PKYG 3LR4A 5A8BA 3KSHA 1P97A 1XJ3A 2L0WA 1T18A 3VOLA 2K7SA 5TJJA 3K2NA 4Q0IA 3BWLA 1OTEA 4Y2FA 1LSVA 2PD7A 2HV1A 1GSVA 2D01A 2O9BA 3EQUA 4Q0JA 3T4SA 3TRCA 4L9FA 2WKRA 3CAXA 4WELA 3KSIA 3MR0A 2PR5A 4GHIA 4MMNA 2W3GA 1STZA 3IBJA 1V9ZA 1NWZA 4LRZE 3UB9A 4CLCE 3T4KA 2INWA 2A2LA 3E0YA 5DFXA 3KX0X 1OJ5A 2VEAA 3H82B 2LB5A 3LIEA 1F5MA 3K3DA 5C5KA 4YOFA 5AVEA 2W0NA 1P9RA 2W3FA 1P9WA 5J4EA 1T1BA 2QJ7A 1TS8A 4ETXA 4NXFA 3TJZC 2MJ6A 3MFXA 4R70A 1DP8A 1T19A 3LR0A 2QHKA 3ZQ5A 5L8MA 4I3IA 2EWVA 1N9NA 4HP4A 5K5BA 5J7EA 3LYXA 2W1TA 2J3WA 3CITA 2VV8A 4I38A 4LRXC 3PBOA 3MQ0A 1OTDA 1ZTUA 5DKKA 4DJ3A 2OWHA 2PT7A 3PBNA 2W27A 4UQIS 5HDDA 2VGLM 3H7WB 4MDZA 4EQ1A 4DMZA 4WF0A 4YNRA 2D02A 2OOLA 4L9GA 3VE4A 1OTBA 2BASA 3CI6A 4WLAA 3U2AA 3HJIA 5DFYA 1V9YA 1T1AA 3CLOA 4R3AA 4CLCC 2HF6A 3H9WA 3E4OA 2R78A 5TBMB 2WKPA 4Y5FA 1N9LA 3PBSA 3B42A 3UB6A 3NOTC 1Y28A 5DF9A 3KSFA 3S7QA 4H6JA 2JKTM 3F1PA 4BMWA 2VA0A 1TS0A 1NLYA 4NXBA 2EWWA 3OLOA 3E98A 4UEYA 4EXOA 3HCYA 2OAP1 2B02A 1NLZA 1TS7A 4HI4A 2H28A 4HH3A 2WKQA 3OCLA 4CLCD 4G3KA 2ZOIA 2IA2A 4FOFA 2W1RA 3CUEC 3VE3A 3A0RA 2VX8A 1S4RA 1JNUA 1S67L 2W3HA 1DP6A 3MMHA 4Z1WA 4DJ2A 4FSFA 3PBQA 3A0SA 2V9AA 3C2WA 3KYQA 2CMNA 3LIBA 4HY8A 4M4XA 1VB6A 3DBAA 4IHQA 1YSQA 4NKPA 4NXEA 2JKRM 3EWKA 2W1TB 4JGOA 1W63M 4WL9A 3UE6A 4IUKA 3CUEA 5J3WA 2VLGA 2J3TC 4NXGA 3E4QA 3NOUC 4UQIM 4LLOB 4BBVA 4ARZB 3TW8A 2XA7S 2FZ0A 3MXQA 3VV4A 5F5YA 2XROA 4JGQA 5FL3A 2O9AA 1G6OA 3IS2B 3P01A 1UGUA 4R38A 2VZWA 2HJEA 4EESA 3LIFA 4GLQA 3S7OA 5HD3A 4Y3IA 5HPFA 2XRNA 3OBFA 3EGXC 4L0LA 3EOIA 4L9EA 2K2NA 3LR3A 5HSQA 1YSPA 2ZBBA 1OTAA 2V0UA 3BW6A 1YAXA 4EU0A 2OAQ1 4G3WA 1TS6A 4HOIA 3ZYTA 2J80A 2JHEA 4PKYA 2O99A 2Z6DA 3O5YA 4NEED 3S7NA 3OOVA 5KIZA 2PYRA 1TD5A 3R7WB 1BYWA 4KQOA 3LI9A 3PXPA 4O8GA 4CQHA 3LUQA 4II7A 1KOUA 1LSXA 1T1CA 3C38A 1H8MA 5HD5A 4ARZA 1XFQA 4HQAA 2GX5A 3BY9A 5F69A 4EEUA 5HWWA 4JGPA 1LL8A 2I9VA 3R4KA 3D72A 4HJ3A 4OOMA 2VJWA 3E4PA 4GCZA 1ODVA 4AFIA 4R6LA 3EEHA 4O01A 2NUPC 2B18A 2HGVA 4ZRRA 1F9IA 4PHTA 4ETZA 4HHDA 3PHYA 3GECA 2XA7M 2W3EA 2LB9A 2Z6CA 3KYZA 3EQVA 1IFQA 1D7EA 3UMEA 3MF0A 1OT9A 3NJAA 5CX7A 2GJ3A 1N9OA 4DN0A 4CLCB 1GSWA 1UWPX 5HPIA 4PAUA 2Y8HA 5EFWA 4BJPA 4JGRA 1S1YA 3V67A 2Y79A 4WN5A 4IUHA 2PYPA 5AJGA 1XJ2A 2V0WA 1DP9A 4KUOA 4GJ4A 2YKFA 2EA9A 4P6ZS 1S1ZA 4KUKA 3G6OA 4E04A 3FPWA 1LT0A 1WA9A 1XJ6A 4EETB 1OPXA 4Q0HA 4F3LA 3W2ZA 3FG8A 3RFBA 1X0OA 4HH2A 3PR6A 4ME4A 3T4LA 4GS9B 3F1OA 4BBUA 4MCWA 2PR6A 4P6ZM 3KO6A 4O0PA 5G4YA 3RTYA 5F68A 4EUVA 3F1OB 1MKMA 5G4ZA 2L1MA 3BQAA 5F6AA 1DRMA 3H7WA 4XT2A 4HP9A 5IS1A 2QKPA 4WEJA 4G3VA 5HZHA 2KDKA 3LR5A 5IT5A 2XSSA 2QYBA 3F1NA 5AVFA 4GW9A 2J3TD 5HWVA 3LI8A 2M1CA 4B93A 3T4OA 1S66L 3HJKA 4MN6A 1VHMA 2M7VA 3UB8A 3SW1A 3T50A 1NRJA 5LBRA 2P04A 5HDCA 3T4QA 3IBRA 2V1AA 4B9OA 4LRYC 3LFVA 1EW0A 4EERA 3F1NB 2QWSA 3FC7A 4EW7A 1P0ZA 2OWJA 3JVVA 4WEKA 2HJ9C 5TBMA 3A0VA 4MN5A 4QPRA 1OJGA 4WUJA 1LSWA 2PHYA 3MQOA 3T4JA 4XT2B 4HJ6A 2JN7A 2NUTC 4GHIB 4MN7A 2ZMFA 2P08A 2M7UA 1XJ4A 4I39A 3NOPC 5HWTA 3ICYA 2PDRA 3UB7A 2VV6A 3ULFA 1MZUA 2GNXA 5KSHA 1YKDA 3B33A 5I5LA 1GSXA 3NHQA 1F98A 4OOLA 3D3OA 3BY8A 4BBTA 2ZOHA 3LIDA 1ZHHB 2PD8A 2JKRI 2JKTI 3C30A 4I3AA 3P7NA 1OTIA 2VKSA 3IS2A 3JVUA 5DKLA 3CWFA 2O0YA 2ZMVA 2KLIA 2A24A 4RQ9A 2YKHA 4BWIA 3EEAA 4LPZA 3BJNA 3F1PB 2A24B 4H6JB 1H3QA 1W63Q 2DMWA 3C8CA 2W3DA 2L4RA 5HL6A 4CLCA 2O9CA 2P7JA 3H82A 5DJTA 3FPVA 2GZAA 3R7WA 3B47A 3GDIA 5MC7A 4I3JA 2V1BA 1D06A 2VV7A 4HIAA 2QJ5A 2KOIA 4K08A 2FH5A 4YWZA 1G28A 3MJQA 3MQQA 3LIAA 3LICA 3RH8B 3S7PA 4EEPA 4GS9A 1S4SA 4HNBA 1OT6A 3EGDC 3T4TA 4F3LB 3BQ8A 3OCNA 3OC2A 3PBRA 4HJ4A 5IU1A 3PYPA 1XFNA 4I5SA 3TE8A 2K31A 3UMDA 2G7UA 3KSGA 4IJGA 3PBTA 1TF1A 2VGLS 1MC0A 2KX6A 5HDSA 1UWNX 4KQDA 5DJUA 3K3CA 3UE3A 1IOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F69 A;  4EEU A;  4B9O A;  3IBR A;  2V1A A;  4JGP A;  1LL8 A;  2I9V A;  4PKY G;  4EXO A;  5HWW A;  5A8B A;  4LRY C;  1EW0 A;  2B02 A;  1TS7 A;  4EER A;  3D72 A;  4HI4 A;  4HJ3 A;  3F1N B;  2H28 A;  1P97 A;  2WKQ A;  4HH3 A;  1XJ3 A;  2QWS A;  3FC7 A;  4EW7 A;  1P0Z A;  2OWJ A;  2L0W A;  1T18 A;  2ZOI A;  3E4P A;  2K7S A;  4GCZ A;  3VOL A;  1ODV A;  5TBM A;  3A0V A;  4MN5 A;  3VE3 A;  3A0R A;  1OJG A;  4WUJ A;  1LSW A;  2PHY A;  3BWL A;  1OTE A;  3MQO A;  4R6L A;  1S4R A;  1JNU A;  1S67 L;  2JN7 A;  3EEH A;  4HJ6 A;  4XT2 B;  1DP6 A;  1LSV A;  2PD7 A;  4GHI B;  2HV1 A;  1XJ4 A;  1GSV A;  2D01 A;  4I39 A;  4DJ2 A;  3NOP C;  5HWT A;  3ICY A;  1F9I A;  2PDR A;  3UB7 A;  2VV6 A;  3ULF A;  1MZU A;  4HHD A;  3PHY A;  3GEC A;  3B33 A;  3A0S A;  2V9A A;  3C2W A;  2WKR A;  2CMN A;  3CAX A;  4L9F A;  3MR0 A;  1GSX A;  2PR5 A;  2Z6C A;  3LIB A;  4GHI A;  3NHQ A;  5I5L A;  1F98 A;  4HY8 A;  4M4X A;  1V9Z A;  1NWZ A;  1VB6 A;  4LRZ E;  3UB9 A;  1D7E A;  3BY8 A;  4BBT A;  2ZOH A;  4NXE A;  3UME A;  2INW A;  3LID A;  1OT9 A;  2PD8 A;  3KX0 X;  1OJ5 A;  3EWK A;  4JGO A;  4WL9 A;  3UE6 A;  2VEA A;  4I3A A;  2VLG A;  3P7N A;  4NXG A;  3NJA A;  5J3W A;  1OTI A;  3H82 B;  2GJ3 A;  3E4Q A;  3IS2 A;  1N9O A;  3LIE A;  5DKL A;  1GSW A;  3CWF A;  3NOU C;  1UWP X;  3K3D A;  5AVE A;  2W0N A;  5EFW A;  2A24 A;  4RQ9 A;  2YKH A;  4LLO B;  5J4E A;  1T1B A;  4BBV A;  2QJ7 A;  4LPZ A;  4JGR A;  1S1Y A;  1TS8 A;  4WN5 A;  3F1P B;  3MXQ A;  4NXF A;  2A24 B;  4H6J B;  2PYP A;  5F5Y A;  3MFX A;  4R70 A;  3C8C A;  4JGQ A;  1DP8 A;  1T19 A;  1XJ2 A;  2V0W A;  1DP9 A;  2L4R A;  2QHK A;  4KUO A;  3ZQ5 A;  4I3I A;  4R38 A;  3IS2 B;  1N9N A;  1UGU A;  2P7J A;  2YKF A;  3H82 A;  4HP4 A;  2EA9 A;  5DJT A;  4EES A;  1S1Z A;  3LIF A;  3G6O A;  4KUK A;  3LYX A;  5HD3 A;  4E04 A;  5J7E A;  4I38 A;  1LT0 A;  1WA9 A;  1XJ6 A;  2VV8 A;  4LRX C;  4EET B;  3GDI A;  1OTD A;  5DKK A;  4L9E A;  4DJ3 A;  4I3J A;  2V1B A;  1D06 A;  2OWH A;  2VV7 A;  4F3L A;  4HIA A;  2W27 A;  3FG8 A;  1X0O A;  3H7W B;  5HDD A;  4EQ1 A;  5HSQ A;  4HH2 A;  4WF0 A;  2QJ5 A;  2D02 A;  2ZBB A;  2OOL A;  4GS9 B;  4K08 A;  1OTA A;  2V0U A;  3F1O A;  4L9G A;  3VE4 A;  4BBU A;  2PR6 A;  5G4Y A;  4YWZ A;  1G28 A;  1OTB A;  2BAS A;  3MJQ A;  1TS6 A;  3MQQ A;  3LIA A;  4WLA A;  5F68 A;  3RTY A;  3F1O B;  3LIC A;  4HOI A;  3RH8 B;  4GS9 A;  1S4S A;  2J80 A;  2JHE A;  2L1M A;  4PKY A;  5F6A A;  5G4Z A;  4HNB A;  3HJI A;  1DRM A;  1OT6 A;  1V9Y A;  2Z6D A;  3H7W A;  1T1A A;  3CLO A;  4XT2 A;  4HP9 A;  4R3A A;  5IS1 A;  4F3L B;  2QKP A;  4HJ4 A;  5HZH A;  3H9W A;  5IU1 A;  2KDK A;  3E4O A;  3PYP A;  1XFN A;  2R78 A;  2PYR A;  4I5S A;  5TBM B;  5KIZ A;  2WKP A;  1BYW A;  3UMD A;  1N9L A;  3F1N A;  5AVF A;  3UB6 A;  3NOT C;  4GW9 A;  3LI9 A;  5HWV A;  1Y28 A;  3LI8 A;  2KX6 A;  4EEP A;  3LUQ A;  5HDS A;  2M1C A;  1UWN X;  1KOU A;  4H6J A;  3F1P A;  4KQD A;  1LSX A;  1S66 L;  3HJK A;  4MN6 A;  3UB8 A;  5DJU A;  1TS0 A;  3SW1 A;  3K3C A;  4NXB A;  1T1C A;  3T50 A;  5HD5 A;  1XFQ A;  4HQA A;  3OLO A;  5HDC A;  3BY9 A; 
#chains in the Genus database with same CATH topology
 2ZMA A;  3WS5 A;  2L0W A;  4MBH A;  1OTE A;  3DWZ A;  3HLE A;  5JYP A;  3T4S A;  4R23 A;  1CI8 A;  3G30 A;  5EV0 A;  4L9F A;  3NEC A;  3DTK A;  1NZO A;  1F2K A;  3LO7 A;  1STZ A;  1NWZ A;  1J9M A;  2ZJ9 A;  4LRZ E;  3UB9 A;  2ZD8 A;  3SZT A;  2EX2 A;  1J3W A;  3MXR A;  1ZKJ A;  3Q81 A;  2W3F A;  3VFH A;  2QJ7 A;  1U60 A;  1E25 A;  3BRM A;  4NET A;  3TJZ C;  2MJ6 A;  2V20 A;  2H10 A;  3VSK A;  1YLZ A;  1MWR A;  1T19 A;  5L8M A;  1ZG4 A;  3VOY A;  3VP0 A;  4HP4 A;  5K5B A;  2Y2Q A;  1RGZ A;  4LRX C;  3CIT A;  3PBO A;  3IWI A;  2OWH A;  3PBN A;  2W27 A;  1BLS A;  3O3V A;  4MDZ A;  4YNR A;  2D02 A;  1L0G A;  1OTB A;  4E3L A;  2GDN A;  3U2A A;  3HJI A;  2Z2M B;  3LCE A;  5FAP A;  1PI4 A;  4ZAM A;  3H9W A;  1QMF A;  3PTE A;  1PI5 A;  1N9L A;  3PBS A;  3B42 A;  3UB6 A;  4ESP A;  1VET B;  4EWF A;  1K4F A;  4MNR A;  4H6J A;  3V50 A;  4FH2 A;  1TS0 A;  4EBL A;  2XD5 A;  1KGG A;  3TSG A;  5L07 A;  4DE2 A;  2H28 A;  4CLC D;  4DE3 A;  1RP5 A;  2W1R A;  3CUE C;  3NY4 A;  1JNU A;  2W3H A;  1DP6 A;  3MMH A;  3RXW A;  3SH7 A;  3MZE A;  4EV4 A;  3FV7 A;  5HAP A;  4HY8 A;  1PZO A;  1YSQ A;  3T1R A;  4BD0 A;  2HP6 A;  2VGJ A;  4JXV A;  2OLU A;  3UE6 A;  2VLG A;  1DJA A;  1IEL A;  3E4Q A;  4KZ3 A;  2H5S A;  1Q2P A;  3C5A A;  5FSR A;  2IWD A;  4ARZ B;  2XA7 S;  4ZJ2 A;  2FZ0 A;  3MXQ A;  3VV4 A;  3HLW A;  4KZA A;  5F5Y A;  4JGQ A;  3KYE A;  5F82 A;  5FQI A;  1G6O A;  3IS2 B;  5KMW A;  3QNB A;  2HJE A;  3LIF A;  4LV0 A;  4Y3I A;  1N4O A;  4OQI A;  3JPU A;  4KG6 A;  2ZBB A;  5A92 A;  4UAA A;  1TS6 A;  3FZC A;  3ZYT A;  3S7N A;  4GB7 A;  1BYW A;  4OPQ A;  4GN2 A;  4CQH A;  1K55 C;  3LUQ A;  5EVE A;  1LSX A;  3C38 A;  1SKF A;  3S22 A;  2VK3 A;  1SKO A;  1HLU P;  2WGW A;  3R4K A;  4C3Q A;  1PW8 A;  2Y59 A;  3ITB A;  4JLF A;  1ACF A;  2V2F F;  3A3E A;  3BFF A;  3T12 B;  5KZH A;  1PW1 A;  2B18 A;  2R9X A;  1O7E A;  3VP4 A;  4ETZ A;  2XA7 M;  3FKW A;  4IED A;  2V1Z A;  1YM1 A;  1OT9 A;  5GHY A;  2GJ3 A;  4UHU A;  1N9O A;  3HLB A;  1GSW A;  1NYY A;  2ZC7 A;  3V67 A;  5AQ9 A;  5AJG A;  1XJ2 A;  4MBF A;  2EA9 A;  4DF6 A;  4P85 A;  3UE0 A;  3MZD A;  2XGN A;  1GHM A;  3ZFZ A;  3W2Z A;  2X02 A;  3FG8 A;  3T1X A;  3GVB A;  2Y2M A;  3PR6 A;  4P87 A;  3BFE A;  5GHX A;  5F1G A;  2AVX A;  3V3S A;  2PU4 A;  3RTY A;  1PWD A;  5F68 A;  3LEQ A;  1GHI A;  4XT2 A;  1NRF A;  3U4L P;  2XSS A;  3F1N A;  4GW9 A;  1E3U A;  5I94 A;  4B93 A;  3UB8 A;  4MN6 A;  1VHM A;  2WAE A;  4GDB A;  1FR6 A;  5FQ9 A;  3MXS A;  5LBR A;  2P04 A;  5J8X A;  1SDE A;  2A3U A;  4B9O A;  2ZC4 B;  1FSY A;  1IYP A;  3Q82 A;  2QWS A;  3FC7 A;  1P0Z A;  5L10 A;  2HJ9 C;  1OJG A;  1LSW A;  3T4J A;  2JN7 A;  2NUT C;  5TGF A;  2M7U A;  2P08 A;  1XJ4 A;  4KG2 A;  4EBP A;  4EUZ A;  5EM1 A;  4OPY A;  4KZ5 A;  2VV6 A;  1I2S A;  1YKD A;  3A3J A;  5F83 A;  1GSX A;  2V8F A;  1F98 A;  1WYC A;  2XH9 A;  3SS5 A;  4BBT A;  2ZOH A;  2PD8 A;  5EPH A;  3G2Z A;  4X53 A;  4D2O A;  3G4P A;  5U47 A;  2O0Y A;  2A24 A;  4IVK A;  2QMI A;  2YKH A;  3BJN A;  4XUX A;  1Y54 A;  2A24 B;  1W63 Q;  4S2J A;  2HDR A;  2GZA A;  3IHB A;  4FH4 A;  3B47 A;  2J9O A;  4GKU A;  3VOZ A;  3IXD A;  4UA6 A;  4LV3 A;  2Y91 A;  3DTI A;  4K08 A;  4N1X A;  3LIC A;  4GS9 A;  1OT6 A;  4KZB A;  4R3J A;  3UO9 A;  4F3L B;  2HP9 A;  3TE8 A;  3UMD A;  1PWC A;  3PBT A;  1TF1 A;  1YLW A;  4B4X A;  4OPR A;  4FCF A;  5A90 A;  5DJU A;  3UE3 A;  3N6I A;  3AGF A;  3N4I A;  1K6R A;  1LI9 A;  1PIO A;  3NDG A;  4PKY G;  5HX9 A;  1P97 A;  1XJ3 A;  3QP5 A;  4QY5 A;  3K2N A;  4RYE A;  1OME A;  4S2N C;  3BWL A;  2PD7 A;  5G18 A;  2HV1 A;  5TFQ A;  1GSV A;  2D01 A;  2O9B A;  2PU2 A;  3TRC A;  2XDM A;  1XGJ A;  5FQM A;  4RX3 A;  4WEL A;  3KSI A;  3MR0 A;  2PR5 A;  4GHI A;  1I5Q A;  1V9Z A;  3N8S A;  4CLC E;  2INW A;  3KX0 X;  2VEA A;  3W4P A;  4YOF A;  2W0N A;  2G2W A;  4X6T A;  5J4E A;  1T1B A;  2RL3 A;  2HDQ A;  5DTK A;  4ETX A;  4Y13 A;  4R70 A;  4I3I A;  1MWT A;  3OPH A;  3UDI A;  3CPT B;  5J7E A;  2W1T A;  4I38 A;  3ITA A;  3HL9 A;  3MQ0 A;  1ZTU A;  3D4F A;  3GR2 A;  1PFL A;  5HDD A;  2VGL M;  4BQM A;  4WF0 A;  5DTS A;  3VE4 A;  2ZLY A;  2XEP A;  2J9P A;  3G34 A;  3CHW P;  4OQH A;  4R3A A;  4CLC C;  4X25 A;  2R78 A;  1BT5 A;  5CHU A;  3HBR A;  4Y5F A;  2EX9 A;  1HVB A;  4ID4 A;  3NOT C;  3BYD A;  1G6A A;  3KSF A;  4BMW A;  2B5R A;  2EWW A;  4E3N A;  3AGD A;  1RCJ A;  4U0X A;  4UEY A;  3UDX A;  1HZO A;  2UWX A;  5DF8 A;  1TS7 A;  4HI4 A;  5JYO A;  2WKQ A;  4G3K A;  2ZOI A;  3P98 A;  4QU3 A;  3VE3 A;  3A0R A;  1XX2 A;  2C5W B;  4Z1W A;  3BFG A;  3PAG A;  1M6K A;  1K6S A;  2WZX A;  3UNW A;  2CMN A;  4S2L A;  3C7V A;  3OPL A;  4M4X A;  4Y0T A;  1ERQ A;  1YQS A;  1VB6 A;  3DBA A;  4NKP A;  4PM7 A;  1TEM A;  2W1T B;  4WL9 A;  1W63 M;  4OKP A;  5J3W A;  3DTE A;  1H5X A;  4NXG A;  4KEN B;  3UDF A;  5DVA A;  1GHP A;  1W79 A;  3WRZ A;  1BLC A;  2XK1 A;  3QP4 A;  4WYY A;  1JWV A;  3TW8 A;  5L09 A;  3WS0 A;  3V5M A;  3L9K A;  3LGO A;  1DJC A;  4EES A;  2ZQC A;  5HAR A;  1O07 A;  3OBF A;  5EEC A;  3EGX C;  3EOI A;  2K2N A;  3GQZ A;  2WGI A;  5HSQ A;  3LEZ A;  2WUQ A;  4WBG A;  3IF5 A;  5CEC A;  1K56 A;  4G3W A;  2X71 A;  2J80 A;  4PKY A;  1SHV A;  2Z6D A;  3ZGA B;  3CMZ A;  4WMC A;  2JBF A;  4CJN A;  3HLF A;  1KE4 A;  5KIZ A;  2WGV A;  5CTN A;  1MKI A;  3VP2 A;  1AWI A;  5EE8 A;  4KQO A;  3Q1F A;  3PXP A;  4O8G A;  5CGX A;  4II7 A;  1FOF A;  3TG9 A;  2PRF A;  2EXA A;  1XFQ A;  4HQA A;  2GX5 A;  4LCL A;  3S1Y A;  5F69 A;  4EEU A;  5HWW A;  4JGP A;  1LL8 A;  2I9V A;  2Y4A A;  5FI6 A;  5E2G A;  3E4P A;  3IF6 A;  4LFU A;  3IX4 A;  4QY6 A;  1HTZ A;  2NUP C;  1L0D A;  4ZRR A;  2WAF A;  4PHT A;  3TOI A;  1K54 A;  3GEC A;  3PHY A;  3KYZ A;  1IFQ A;  5GL9 A;  2ZQA A;  4BL3 A;  5HPI A;  1PWG A;  1KE0 A;  5EFW A;  4BJP A;  1VM1 A;  1IOU A;  3ZHH A;  3QP2 A;  1ESU A;  2PYP A;  1DP9 A;  3M2K A;  1I2W A;  1TDL A;  2ACG A;  3G6O A;  3S4X A;  2ZL1 A;  3AGE A;  5E2H A;  3ZG9 B;  4QD4 A;  4Q0H A;  3RFB A;  5FEG A;  1X0O A;  2PBD P;  4ME4 A;  5HW3 A;  5CTM A;  2QPN A;  3F1O A;  5CGS A;  4BBU A;  4MCW A;  1ES5 A;  4B88 A;  4P6Z M;  4O0P A;  5E2E A;  3CJM A;  5DTT A;  2BG1 A;  2L1M A;  3BQA A;  2B95 A;  3UPN A;  5IS1 A;  4FTX A;  5FQJ A;  4S2O A;  2QYB A;  1G68 A;  1W8Q A;  4N9K A;  5FAS A;  1SCW A;  1JWP A;  3PAE A;  3HJK A;  4HEF A;  3SW1 A;  3T50 A;  1NRJ A;  1BZA A;  3IBR A;  3P09 A;  1ONH A;  3F1N B;  1E3U D;  4WEK A;  5TBM A;  4MN5 A;  2P74 A;  3N7W A;  4GD6 A;  4XT2 B;  4GHI B;  4MN7 A;  2ZMF A;  3IX3 A;  2JKG A;  5HWT A;  3ICY A;  3UB7 A;  4JF4 A;  2WKI A;  2GNX A;  3B33 A;  4N92 A;  4X69 A;  2ZC3 B;  2Y2L A;  3IXG A;  3NHQ A;  4C75 A;  4OOL A;  2Y2G A;  3W8K A;  1ZHH B;  2JKR I;  3C30 A;  3P7N A;  3ZG8 B;  2XLN A;  3CWF A;  4WZ4 A;  3JYI A;  4RQ9 A;  3HLC A;  1IYS A;  2OLV A;  4LPZ A;  3ZNY A;  1PZP A;  3LY3 A;  3ZVW A;  4H6J B;  1H3Q A;  3C8C A;  2O9C A;  3H82 A;  1KDS A;  1WE4 A;  5FI7 A;  2VV7 A;  5M18 A;  2WYX A;  3M6H A;  2KOI A;  4R1G A;  4QHC A;  3MJQ A;  5EOO A;  3S7P A;  3MBZ A;  4EEP A;  1CJF A;  4HNB A;  2E8I A;  3T4T A;  1XXM A;  3OCN A;  3PBR A;  2EFU A;  4B4Z A;  1XFN A;  3L7H A;  4PM8 A;  4R0Q A;  3KSG A;  1K38 A;  2VGL S;  1MC0 A;  1UWN X;  4OP8 A;  2PAV P;  4H8R A;  3K3C A;  4P6B A;  4ZTK A;  1BTL A;  1CQA A;  5HFO A;  3LR4 A;  2QZ6 A;  3KSH A;  3ZDJ A;  2H0T A;  3VOL A;  2K7S A;  5TJJ A;  3HUO A;  1MWS A;  2Q0O A;  4E3I A;  1AXB A;  3EQU A;  1XA1 A;  4Q0J A;  5GLD A;  4HBT A;  2WKR A;  5EUA A;  1XA7 A;  1S0W A;  2ZC5 B;  4DE0 A;  1SZV A;  1MXO A;  2E8J A;  3IBJ A;  3DW0 A;  5EM0 A;  5GLA A;  2C6W B;  4IBX A;  3CPT A;  3H82 B;  2LB5 A;  3ZG7 B;  1F5M A;  3K3D A;  3E2L A;  5AVE A;  4OLG A;  1P9R A;  3HRE A;  4R4S A;  4DDY A;  1W8Y A;  2HDU A;  2WZZ A;  4HES A;  1TS8 A;  3G32 A;  3MFX A;  3LR0 A;  5CER A;  3RXX A;  4X56 A;  1PYY A;  1MY8 A;  4DE1 A;  3LYX A;  2VV8 A;  1OTD A;  1IKG A;  5DKK A;  4DJ3 A;  4D60 A;  2PT7 A;  4DMZ A;  3UN7 A;  4JF6 A;  3WS4 A;  2BAS A;  3HUM A;  4ZDX A;  1V9Y A;  1NJ4 A;  5EVI D;  1JTG A;  5TBM B;  2EX8 A;  3NCK A;  3O86 A;  2XD1 A;  5FAT A;  5HL1 A;  2HPB A;  3S7Q A;  2JKT M;  3F1P A;  2VA0 A;  3SH9 A;  4ZBE A;  4NXB A;  4BEN A;  2OV5 A;  3BM6 A;  3ZVT A;  3OLO A;  5CHJ A;  4EXO A;  3QNC A;  3HCY A;  4C6Y A;  4S2I A;  2B02 A;  4HH3 A;  4ZJ1 A;  1IYO A;  2IA2 A;  2Y2J A;  2JE5 A;  1S6R A;  4WZ5 A;  3Q7V B;  5E2F A;  1S4R A;  4YIN A;  3GRJ A;  1L3L A;  4DJ2 A;  1H8Z A;  3PBQ A;  4ZJ3 A;  2V9A A;  3C2W A;  4PMA A;  4NXE A;  4KZ4 A;  4MBK A;  1ALQ A;  4M3K A;  4BL2 A;  1CEF A;  4UQI M;  5AQB A;  4LGW A;  4LLO B;  4BBV A;  3BEC A;  5FL3 A;  3P01 A;  1UGU A;  2VZW A;  3S7O A;  5HPF A;  5A93 A;  3A3I A;  1G5U A;  4L0L A;  5F1F A;  4OLD A;  3G2Y A;  1YSP A;  4Z9Q A;  4DDS A;  1OTA A;  2BTF P;  5EVI C;  3BW6 A;  1YAX A;  3MFD A;  2OAQ 1;  4JKT A;  4LV1 A;  2J7V A;  1Z6F A;  1NXY A;  3E2K A;  3O5Y A;  5GLC A;  2PYR A;  5AQ7 A;  3R7W B;  5M1A A;  2EFX A;  3ZG5 A;  5TR7 A;  2IWB A;  1H8Y A;  1DY6 A;  1T1C A;  2IWC A;  5HD5 A;  4ARZ A;  4JPM A;  4HJ3 A;  3CG5 A;  3I7J A;  4GCZ A;  3ZCZ A;  1ODV A;  1ZG6 A;  4KQR A;  1TDG A;  3OPR A;  3FKV A;  4GOG A;  4R6L A;  3EEH A;  4OPZ A;  2HGV A;  3GSG A;  4NK3 A;  1F9I A;  5FDH A;  2HP5 A;  2EX6 A;  1YLT A;  4RVA A;  4N9L A;  3MS6 A;  4E3K A;  3IHA A;  2JCH A;  1CI9 A;  2W3E A;  2Z6C A;  1TVF A;  2X01 A;  1D1J A;  3UME A;  4OQG A;  3MSH A;  4WM9 A;  4QB8 A;  5CX7 A;  1K25 A;  1UWP X;  3UPO A;  4DKI A;  4K0W A;  3QP8 A;  1S1Y A;  3G35 A;  4WN5 A;  4IUH A;  1FIK A;  1FCM A;  2V0W A;  3IT9 A;  4LCM A;  4KUO A;  2Q9M A;  4GJ4 A;  2YKF A;  4E3M A;  4E04 A;  1QME A;  3A3D A;  3FPW A;  1XJ6 A;  1OPX A;  4F3L A;  5E43 A;  5KSC A;  5CHM A;  4GS9 B;  2Y2K A;  2PR6 A;  3WS1 A;  1NZU A;  3GMW A;  4EUV A;  4E6W A;  1MKM A;  5F6A A;  1DRM A;  1FQG A;  2XQZ A;  1EWZ A;  4HP9 A;  1L0F A;  1ONG A;  1FIL A;  5IT5 A;  3B3X A;  1K54 C;  2WGW B;  2J3T D;  3LI8 A;  5CXW A;  1IYQ A;  3Q7Z A;  3T4O A;  1S66 L;  4FD8 A;  1XP4 A;  4OH0 A;  1ZC2 A;  4EQI A;  4BD1 A;  2V1A A;  1YPR A;  3IWQ A;  4KZ6 A;  1EW0 A;  4A5R A;  2WKH A;  1KGF A;  4EW7 A;  2OWJ A;  3A0V A;  3N8R A;  2H0Y A;  4WUJ A;  2PHY A;  3VSL A;  1LHY A;  4I39 A;  3NOP C;  3ULF A;  1MZU A;  5KSH A;  2ZM2 A;  5I5L A;  5CEB A;  3BLM A;  1XKZ A;  1N9B A;  4QJG A;  4OP5 A;  3D3O A;  1YMX A;  5EVI A;  5CED A;  2Y2O A;  2VKS A;  3IS2 A;  3DTM A;  4RX2 A;  5DKL A;  3D9Y A;  4OVD A;  2ZMV A;  3EEA A;  4OQ0 A;  2DMW A;  5D3O A;  1PRQ A;  5HL6 A;  4CLC A;  3HLD A;  2P7J A;  2Y2N A;  3FPV A;  3R7W A;  1IKI A;  3GDI A;  5MC7 A;  2BLS A;  1D06 A;  3DWK A;  3O88 A;  4HIA A;  4DRT A;  1M40 A;  1ERM A;  2QJ5 A;  1YT4 A;  3OPP A;  4LV2 A;  4KZ8 A;  1JVJ A;  1G28 A;  3IH9 A;  3RH8 B;  1LLB A;  1S4S A;  1YMS A;  3IXH A;  5CGW A;  4IVI A;  3BFC A;  1FR1 A;  1KGE A;  5IU1 A;  2XR0 A;  3PYP A;  2G7U A;  4S2N A;  5FA7 A;  2KX6 A;  4KQD A;  4XUZ A;  3ZG0 A;  3FYZ A;  5FAO A;  3UPP A;  4X55 A;  5A8B A;  5GHZ A;  2ZQD A;  4MEZ A;  1KE3 A;  4NG2 A;  1T18 A;  3SS4 A;  5FQK A;  1WYB A;  4Q0I A;  4Y2F A;  1LSV A;  2EXB A;  2HZ5 A;  3SS3 A;  3DAV A;  3FWL A;  1CEG A;  5HAI A;  2P9V A;  3CAX A;  3GV9 A;  4MMN A;  1ERO A;  2W3G A;  4GD8 A;  3T4K A;  4RA7 A;  3NBL A;  2A2L A;  3E0Y A;  1LI0 A;  5DFX A;  1OJ5 A;  5EVL A;  1A0K A;  4X68 A;  4WZ5 C;  2V8C A;  3LIE A;  3MKE A;  5C5K A;  2FFY A;  1SKO B;  3ZNT A;  1P9W A;  1GA0 A;  3NI9 A;  4X1L A;  4NXF A;  1DP8 A;  2JKF A;  2QHK A;  4OOY A;  3ZQ5 A;  2EWV A;  1N9N A;  1ESI A;  3IQA A;  2J3W A;  4OON A;  5IHV A;  2Q9N A;  4UQI S;  4EQ1 A;  1BLH A;  1MPL A;  2ZM0 A;  3H7W B;  3BFD A;  2OOL A;  4L9G A;  3CI6 A;  4WLA A;  4GNU A;  3VMA A;  2CC1 A;  4FUW A;  5DFY A;  5FDS A;  1T1A A;  3CLO A;  2HF6 A;  3E4O A;  4Y15 A;  5L2F A;  4XXR A;  2WKP A;  1CF0 A;  4O7D A;  1K0K A;  1Y28 A;  5DF9 A;  1KVL A;  4UA9 A;  1NLY A;  4IBR A;  3GTC A;  3E98 A;  4S2M A;  3MKF A;  1JTD A;  2OAP 1;  1NLZ A;  3OCL A;  3WS2 A;  3V39 A;  4FOF A;  5EVI B;  1LL9 A;  1JWZ A;  2VX8 A;  1S67 L;  4KQQ A;  2G2U A;  1LL5 A;  4FSF A;  5GLB A;  1KDW A;  2XF3 A;  3A0S A;  3KYQ A;  3LIB A;  1KVM A;  1Y4O A;  4IHQ A;  4K91 A;  3UY6 A;  2JKR M;  2VGK A;  3EWK A;  3VFF A;  4JGO A;  4KZ7 A;  4IUK A;  3CUE A;  2J3T C;  3SOI A;  4Y7P A;  3NOU C;  2UV0 E;  3OZH A;  5CRF A;  3V3R A;  1K57 C;  3NUL A;  3Q07 A;  2XRO A;  1VET A;  2O9A A;  2Z2L B;  4R38 A;  3W4O A;  3WRT A;  4GLQ A;  5HD3 A;  1K57 A;  4WMC D;  2XRN A;  2JC7 A;  4L9E A;  3LR3 A;  1ES4 A;  3UE1 A;  4JXG A;  4X1M A;  2V0U A;  1YLJ A;  1Q2Q A;  4EU0 A;  3M6B A;  1EI5 A;  4JBF A;  4HOI A;  2JHE A;  2DRW A;  3NC8 A;  2WKE A;  2O99 A;  4NEE D;  3MZF A;  3W4Q A;  3OOV A;  1TD5 A;  4E6X A;  3IWO A;  3LI9 A;  1KOU A;  3IX8 A;  2HDS A;  1H8M A;  3BY9 A;  3QP1 A;  3D72 A;  3RJU A;  4OOM A;  2VJW A;  4R3B A;  4E3J A;  3SH8 A;  4AFI A;  1DJB A;  4JXW A;  1FCN A;  3VP1 A;  4O01 A;  1GCE A;  1RGY A;  3A3F A;  4Y0U A;  4HHD A;  4LEN A;  4Y17 A;  1YLY A;  3M2J A;  1MBL A;  2LB9 A;  3VP3 A;  3EQV A;  4GDN A;  2DNS A;  1D7E A;  4DXC A;  4KG5 A;  3MF0 A;  1K4E A;  1ES3 A;  2WK0 A;  5A91 A;  1BUE A;  2ZC6 B;  3NJA A;  1Z09 A;  1NYM A;  4DN0 A;  4CLC B;  4PAU A;  2Y8H A;  1XGI A;  3C7U A;  4R4R A;  2ZQ9 A;  2DCF A;  2Y55 A;  4JGR A;  2Y79 A;  1C3B A;  2ZQ8 A;  1BLP A;  1VQQ A;  1BUL A;  2ZM8 A;  1NY0 A;  4P6Z S;  1S1Z A;  4KUK A;  1W5D A;  1LT0 A;  1WA9 A;  4EET B;  4F94 A;  3T1Q B;  5M19 A;  3QP6 A;  4N1H A;  4HH2 A;  3T4L A;  1MWU A;  5G4Y A;  3KO6 A;  1CK3 A;  4EBN A;  4P0M A;  3NDE A;  1BSG A;  3F1O B;  1YLP A;  3IH8 A;  5G4Z A;  5FQQ A;  3H7W A;  2QKP A;  4WEJ A;  4G3V A;  5HZH A;  2KDK A;  2XFS A;  3LR5 A;  2ZQ7 A;  4BLM A;  2ZL1 B;  4PM9 A;  3ISG A;  5AVF A;  5HWV A;  2M1C A;  3G31 A;  2RCX A;  1GA9 A;  2M7V A;  1FSW A;  5HDC A;  4MLL A;  1E4D A;  3T4Q A;  4Y0O A;  1PNE A;  5FAQ A;  3LY4 A;  3LFV A;  4LRY C;  1XPB A;  4EER A;  1VEU B;  3O87 A;  1FCO A;  4KZ9 A;  3JVV A;  4QPR A;  3MQO A;  4Q8I A;  4HJ6 A;  4S2K A;  4PPR A;  1L0E A;  3NIA A;  4HBU A;  2PDR A;  2P9V B;  4JF5 A;  4DXB A;  4S2P A;  5BOH A;  4CPK A;  3BEB A;  2Y2P A;  3IF6 C;  3QHY A;  4JXS A;  4YFM A;  1HD8 A;  3Q7V A;  5FI2 A;  3BY8 A;  3LID A;  3IF6 B;  2JKT I;  4PM5 A;  4I3A A;  1VEU A;  1OTI A;  1W7F A;  2WAD A;  2FFF B;  3JVU A;  4U3T A;  2XFT A;  2KLI A;  4BWI A;  2OSU A;  3F1P B;  2W3D A;  2L4R A;  5EOE A;  5DF7 A;  1ES2 A;  5DJT A;  3WWX A;  4U0T A;  4I3J A;  5AQA A;  2V1B A;  1L2S A;  1IEM A;  1K56 D;  1K55 A;  2FH5 A;  4YWZ A;  3MQQ A;  2Y2H A;  3HVF A;  2I72 A;  3LIA A;  4PM6 A;  3IXB A;  3T1S A;  4QWO A;  3EGD C;  2PBY A;  3HLG A;  3BQ8 A;  4HJ4 A;  3OC2 A;  2A49 A;  4I5S A;  3CZD A;  2K31 A;  2Y2I A;  5FEF A;  4K0X A;  3N8L A;  3HUN A;  4IJG A;  4E3O A;  2R9W A;  3UB5 P;  5HAQ A;  5HDS A;  4UA7 A;  2J8Y A;  1H0M A;  4GZB A;  1SDN A;  3C4P A;  3BLS A;  3C4O A; 
#chains in the Genus database with same CATH homology
 4PKY G;  3LR4 A;  5A8B A;  3KSH A;  1P97 A;  1XJ3 A;  2L0W A;  1T18 A;  3VOL A;  2K7S A;  5TJJ A;  3K2N A;  4Q0I A;  3BWL A;  1OTE A;  4Y2F A;  1LSV A;  2PD7 A;  2HV1 A;  1GSV A;  2D01 A;  2O9B A;  3EQU A;  4Q0J A;  3T4S A;  3TRC A;  4L9F A;  2WKR A;  3CAX A;  4WEL A;  3KSI A;  3MR0 A;  2PR5 A;  4GHI A;  4MMN A;  2W3G A;  1STZ A;  3IBJ A;  1V9Z A;  1NWZ A;  4LRZ E;  3UB9 A;  4CLC E;  3T4K A;  2INW A;  2A2L A;  3E0Y A;  5DFX A;  3KX0 X;  1OJ5 A;  2VEA A;  3H82 B;  2LB5 A;  3LIE A;  1F5M A;  3K3D A;  5C5K A;  4YOF A;  5AVE A;  2W0N A;  1P9R A;  2W3F A;  1P9W A;  5J4E A;  1T1B A;  2QJ7 A;  1TS8 A;  4ETX A;  4NXF A;  3TJZ C;  2MJ6 A;  3MFX A;  4R70 A;  1DP8 A;  1T19 A;  3LR0 A;  2QHK A;  3ZQ5 A;  5L8M A;  4I3I A;  2EWV A;  1N9N A;  4HP4 A;  5K5B A;  5J7E A;  3LYX A;  2W1T A;  2J3W A;  3CIT A;  2VV8 A;  4I38 A;  4LRX C;  3PBO A;  3MQ0 A;  1OTD A;  1ZTU A;  5DKK A;  4DJ3 A;  2OWH A;  2PT7 A;  3PBN A;  2W27 A;  4UQI S;  5HDD A;  2VGL M;  3H7W B;  4MDZ A;  4EQ1 A;  4DMZ A;  4WF0 A;  4YNR A;  2D02 A;  2OOL A;  4L9G A;  3VE4 A;  1OTB A;  2BAS A;  3CI6 A;  4WLA A;  3U2A A;  3HJI A;  5DFY A;  1V9Y A;  1T1A A;  3CLO A;  4R3A A;  4CLC C;  2HF6 A;  3H9W A;  3E4O A;  2R78 A;  5TBM B;  2WKP A;  4Y5F A;  1N9L A;  3PBS A;  3B42 A;  3UB6 A;  3NOT C;  1Y28 A;  5DF9 A;  3KSF A;  3S7Q A;  4H6J A;  2JKT M;  3F1P A;  4BMW A;  2VA0 A;  1TS0 A;  1NLY A;  4NXB A;  2EWW A;  3OLO A;  3E98 A;  4UEY A;  4EXO A;  3HCY A;  2OAP 1;  2B02 A;  1NLZ A;  1TS7 A;  4HI4 A;  2H28 A;  4HH3 A;  2WKQ A;  3OCL A;  4CLC D;  4G3K A;  2ZOI A;  2IA2 A;  4FOF A;  2W1R A;  3CUE C;  3VE3 A;  3A0R A;  2VX8 A;  1S4R A;  1JNU A;  1S67 L;  2W3H A;  1DP6 A;  3MMH A;  4Z1W A;  4DJ2 A;  4FSF A;  3PBQ A;  3A0S A;  2V9A A;  3C2W A;  3KYQ A;  2CMN A;  3LIB A;  4HY8 A;  4M4X A;  1VB6 A;  3DBA A;  4IHQ A;  1YSQ A;  4NKP A;  4NXE A;  2JKR M;  3EWK A;  2W1T B;  4JGO A;  1W63 M;  4WL9 A;  3UE6 A;  4IUK A;  3CUE A;  5J3W A;  2VLG A;  2J3T C;  4NXG A;  3E4Q A;  3NOU C;  4UQI M;  4LLO B;  4BBV A;  4ARZ B;  3TW8 A;  2XA7 S;  2FZ0 A;  3MXQ A;  3VV4 A;  5F5Y A;  2XRO A;  4JGQ A;  5FL3 A;  2O9A A;  1G6O A;  3IS2 B;  3P01 A;  1UGU A;  4R38 A;  2VZW A;  2HJE A;  4EES A;  3LIF A;  4GLQ A;  3S7O A;  5HD3 A;  4Y3I A;  5HPF A;  2XRN A;  3OBF A;  3EGX C;  4L0L A;  3EOI A;  4L9E A;  2K2N A;  3LR3 A;  5HSQ A;  1YSP A;  2ZBB A;  1OTA A;  2V0U A;  3BW6 A;  1YAX A;  4EU0 A;  2OAQ 1;  4G3W A;  1TS6 A;  4HOI A;  3ZYT A;  2J80 A;  2JHE A;  4PKY A;  2O99 A;  2Z6D A;  3O5Y A;  4NEE D;  3S7N A;  3OOV A;  5KIZ A;  2PYR A;  1TD5 A;  3R7W B;  1BYW A;  4KQO A;  3LI9 A;  3PXP A;  4O8G A;  4CQH A;  3LUQ A;  4II7 A;  1KOU A;  1LSX A;  1T1C A;  3C38 A;  1H8M A;  5HD5 A;  4ARZ A;  1XFQ A;  4HQA A;  2GX5 A;  3BY9 A;  5F69 A;  4EEU A;  5HWW A;  4JGP A;  1LL8 A;  2I9V A;  3R4K A;  3D72 A;  4HJ3 A;  4OOM A;  2VJW A;  3E4P A;  4GCZ A;  1ODV A;  4AFI A;  4R6L A;  3EEH A;  4O01 A;  2NUP C;  2B18 A;  2HGV A;  4ZRR A;  1F9I A;  4PHT A;  4ETZ A;  4HHD A;  3PHY A;  3GEC A;  2XA7 M;  2W3E A;  2LB9 A;  2Z6C A;  3KYZ A;  3EQV A;  1IFQ A;  1D7E A;  3UME A;  3MF0 A;  1OT9 A;  3NJA A;  5CX7 A;  2GJ3 A;  1N9O A;  4DN0 A;  4CLC B;  1GSW A;  1UWP X;  5HPI A;  4PAU A;  2Y8H A;  5EFW A;  4BJP A;  4JGR A;  1S1Y A;  3V67 A;  2Y79 A;  4WN5 A;  4IUH A;  2PYP A;  5AJG A;  1XJ2 A;  2V0W A;  1DP9 A;  4KUO A;  4GJ4 A;  2YKF A;  2EA9 A;  4P6Z S;  1S1Z A;  4KUK A;  3G6O A;  4E04 A;  3FPW A;  1LT0 A;  1WA9 A;  1XJ6 A;  4EET B;  1OPX A;  4Q0H A;  4F3L A;  3W2Z A;  3FG8 A;  3RFB A;  1X0O A;  4HH2 A;  3PR6 A;  4ME4 A;  3T4L A;  4GS9 B;  3F1O A;  4BBU A;  4MCW A;  2PR6 A;  4P6Z M;  3KO6 A;  4O0P A;  5G4Y A;  3RTY A;  5F68 A;  4EUV A;  3F1O B;  1MKM A;  5G4Z A;  2L1M A;  3BQA A;  5F6A A;  1DRM A;  3H7W A;  4XT2 A;  4HP9 A;  5IS1 A;  2QKP A;  4WEJ A;  4G3V A;  5HZH A;  2KDK A;  3LR5 A;  5IT5 A;  2XSS A;  2QYB A;  3F1N A;  5AVF A;  4GW9 A;  2J3T D;  5HWV A;  3LI8 A;  2M1C A;  4B93 A;  3T4O A;  1S66 L;  3HJK A;  4MN6 A;  1VHM A;  2M7V A;  3UB8 A;  3SW1 A;  3T50 A;  1NRJ A;  5LBR A;  2P04 A;  5HDC A;  3T4Q A;  3IBR A;  2V1A A;  4B9O A;  4LRY C;  3LFV A;  1EW0 A;  4EER A;  3F1N B;  2QWS A;  3FC7 A;  4EW7 A;  1P0Z A;  2OWJ A;  3JVV A;  4WEK A;  2HJ9 C;  5TBM A;  3A0V A;  4MN5 A;  4QPR A;  1OJG A;  4WUJ A;  1LSW A;  2PHY A;  3MQO A;  3T4J A;  4XT2 B;  4HJ6 A;  2JN7 A;  2NUT C;  4GHI B;  4MN7 A;  2ZMF A;  2P08 A;  2M7U A;  1XJ4 A;  4I39 A;  3NOP C;  5HWT A;  3ICY A;  2PDR A;  3UB7 A;  2VV6 A;  3ULF A;  1MZU A;  2GNX A;  5KSH A;  1YKD A;  3B33 A;  5I5L A;  1GSX A;  3NHQ A;  1F98 A;  4OOL A;  3D3O A;  3BY8 A;  4BBT A;  2ZOH A;  3LID A;  1ZHH B;  2PD8 A;  2JKR I;  2JKT I;  3C30 A;  4I3A A;  3P7N A;  1OTI A;  2VKS A;  3IS2 A;  3JVU A;  5DKL A;  3CWF A;  2O0Y A;  2ZMV A;  2KLI A;  2A24 A;  4RQ9 A;  2YKH A;  4BWI A;  3EEA A;  4LPZ A;  3BJN A;  3F1P B;  2A24 B;  4H6J B;  1H3Q A;  1W63 Q;  2DMW A;  3C8C A;  2W3D A;  2L4R A;  5HL6 A;  4CLC A;  2O9C A;  2P7J A;  3H82 A;  5DJT A;  3FPV A;  2GZA A;  3R7W A;  3B47 A;  3GDI A;  5MC7 A;  4I3J A;  2V1B A;  1D06 A;  2VV7 A;  4HIA A;  2QJ5 A;  2KOI A;  4K08 A;  2FH5 A;  4YWZ A;  1G28 A;  3MJQ A;  3MQQ A;  3LIA A;  3LIC A;  3RH8 B;  3S7P A;  4EEP A;  4GS9 A;  1S4S A;  4HNB A;  1OT6 A;  3EGD C;  3T4T A;  4F3L B;  3BQ8 A;  3OCN A;  3OC2 A;  3PBR A;  4HJ4 A;  5IU1 A;  3PYP A;  1XFN A;  4I5S A;  3TE8 A;  2K31 A;  3UMD A;  2G7U A;  3KSG A;  4IJG A;  3PBT A;  1TF1 A;  2VGL S;  1MC0 A;  2KX6 A;  5HDS A;  1UWN X;  4KQD A;  5DJU A;  3K3C A;  3UE3 A;  1IOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...