1T1AA

Late intermediate il1 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 33
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t1aA00
3H9WA 2PHYA 3NOPC 4GS9B 2D01A 4R3AA 5A8BA 4XT2A 3BY9A 4HJ3A 4LRXC 5DKKA 3LICA 1S1ZA 2Z6CA 1OT9A 2V1BA 3RH8B 5HDSA 3LIAA 3G6OA 5F69A 3IBRA 2QJ5A 4GCZA 1TS7A 3ICYA 5TBMA 4HY8A 5HD3A 2ZOIA 1XJ4A 5HWVA 4HP9A 2KDKA 1DP6A 5DJUA 1XFNA 2PYRA 4MN5A 3K3CA 3CLOA 3UMDA 2A24B 3PHYA 5DJTA 4EEUA 1X0OA 1OTIA 4XT2B 4F3LB 2PYPA 4HH3A 3SW1A 1XJ3A 4HP4A 2V0WA 2VV7A 3MQQA 4EQ1A 3HJKA 2OOLA 4EERA 1S1YA 4L9GA 2ZOHA 2VV8A 1TS8A 3OLOA 4HJ6A 4DJ3A 4EW7A 3UB9A 2QWSA 2HV1A 5TBMB 1OTBA 2INWA 1F9IA 2V9AA 1KOUA 2VV6A 1N9OA 2JN7A 3T50A 3IS2A 2QJ7A 1TS0A 3MR0A 1S67L 1VB6A 3LIFA 3MXQA 4BBTA 1P0ZA 1EW0A 2PDRA 3F1NA 3MJQA 3D72A 4GHIA 1XJ6A 4F3LA 4WUJA 1OTAA 4JGQA 3MFXA 4HQAA 1JNUA 2PD7A 3A0VA 5J7EA 4KQDA 1NWZA 2YKHA 1OJ5A 3GECA 1LSXA 1V9ZA 4H6JA 3LYXA 4BBUA 1OTEA 4WL9A 3P7NA 3ULFA 4M4XA 1T1AA 2Z6DA 2ZBBA 4I5SA 3MQOA 2PR5A 3NJAA 5F5YA 1GSVA 1S4SA 3E4QA 2K7SA 1V9YA 3LI8A 3UMEA 4NXFA 3IS2B 2D02A 3UB6A 3NOUC 4JGOA 2V1AA 4K08A 5KIZA 1DP9A 1Y28A 1OJGA 3CWFA 3VOLA 3F1NB 3LIEA 4GHIB 5HDCA 5AVFA 1LL8A 4HOIA 1UWPX 3GDIA 4I3AA 2W27A 1GSXA 1D06A 1T18A 4WLAA 4PKYA 2VEAA 1XJ2A 3UE6A 5J4EA 2M1CA 5F68A 3BWLA 4HJ4A 4EETB 4H6JB 2H28A 2W0NA 2PR6A 2V0UA 1G28A 4JGPA 5HD5A 4I38A 4LRYC 3F1PA 4E04A 4L9EA 4B9OA 4BBVA 3PYPA 5EFWA 2OWJA 1LSVA 1MZUA 2KX6A 3FC7A 2YKFA 2R78A 4HH2A 5J3WA 4RQ9A 1DRMA 5HWWA 2L0WA 3HJIA 3LI9A 2QKPA 5AVEA 1GSWA 1TS6A 1F98A 3NHQA 3H82A 1D7EA 3VE3A 1S4RA 1DP8A 5I5LA 3EEHA 1T1CA 4JGRA 1N9NA 2VLGA 4HIAA 3F1OA 3B33A 1XFQA 2L1MA 4R6LA 5IS1A 3VE4A 5HSQA 2J80A 4WF0A 4WN5A 4NXGA 3E4PA 2WKRA 3H7WA 1ODVA 5IU1A 5HZHA 3F1PB 2P7JA 4YWZA 3RTYA 2JHEA 3UB8A 4L9FA 5DKLA 1LSWA 4PKYG 1LT0A 3BY8A 2GJ3A 3CAXA 5G4YA 2CMNA 4GS9A 2B02A 3ZQ5A 5F6AA 1UGUA 1S66L 2WKPA 2QHKA 3LUQA 4R38A 4NXBA 3H82B 4HI4A 3LIDA 5HWTA 2I9VA 4LPZA 2WKQA 4KUKA 3FG8A 3EWKA 5HDDA 4GW9A 3A0SA 4HNBA 4DJ2A 4EEPA 3F1OB 3KX0X 5G4ZA 4LRZE 2BASA 4I3JA 4MN6A 2OWHA 2L4RA 3LIBA 1T19A 2PD8A 3C2WA 1N9LA 1UWNX 4R70A 3H7WB 4I3IA 1OT6A 4NXEA 2EA9A 3A0RA 4HHDA 1T1BA 4I39A 3NOTC 3UB7A 4EESA 3E4OA 3C8CA 4LLOB 1WA9A 3K3DA 1BYWA 1P97A 2A24A 1OTDA 4KUOA 4EXOA
chains in the Genus database with same CATH superfamily
1YAXA 5GHYA 2E8JA 4DXBA 2HP5A 3C30A 4BQMA 4Y5FA 3DTIA 4QY6A 1A0KA 2Y2GA 5HDSA 1G6OA 1HZOA 3G6OA 4DDYA 2J3TD 3WS4A 2ZC6B 4X6TA 2JKFA 4ZJ3A 2VK3A 4GCZA 3NIAA 1TS7A 3CI6A 3R4KA 1E4DA 5TBMA 4P0MA 2Z2MB 4Y7PA 5HD3A 3ZVWA 1CEGA 1FILA 1ZG6A 2O99A 4HP9A 4KZ8A 3TE8A 4Q0JA 1G6AA 5DJUA 3A3EA 1YT4A 5HAIA 3MFDA 1XX2A 3KYQA 4MBHA 4Y13A 2AVXA 4LFUA 3AGDA 2PT7A 3M6HA 1LL9A 3LR4A 1YKDA 2KOIA 5DJTA 1X0OA 3DWKA 3M2JA 3FPVA 3T1QB 5DFYA 2ZLYA 3NDEA 4HP4A 3W4OA 4E3KA 1F5MA 2OOLA 3BJNA 3HL9A 1W63Q 1W8YA 1S1YA 5JYPA 2VV8A 1TS8A 1EROA 3PAEA 1K54C 3LR5A 5EM1A 2IA2A 3NI9A 5TBMB 5TGFA 1NJ4A 1YLWA 3ZGAB 4KQOA 2VV6A 1N9OA 5FQJA 2XH9A 4WZ5A 2E8IA 1TS0A 3NC8A 1PZOA 4N92A 3NULA 4K91A 3MXQA 4BBTA 2PU2A 1TDLA 1P0ZA 1EW0A 3PR6A 4IUHA 3CMZA 5L09A 3ZG8B 3IH9A 5FDHA 2X71A 2W3EA 1E3UA 2H0TA 4KZ4A 3QNCA 4R4SA 5HPFA 2ZJ9A 3N6IA 3IXDA 5U47A 2XGNA 3VV4A 4X69A 4KQRA 2JKRI 2EFXA 2Y4AA 2VA0A 1MC0A 2VGLM 1OJ5A 3SH9A 1YQSA 2X01A 1ES3A 3T4LA 4H6JA 3V3RA 3NDGA 1MKIA 1OTEA 2Z2LB 3KYZA 3P7NA 4GDNA 2HZ5A 3ULFA 5E2FA 4S2MA 2M7UA 4JF6A 4ESPA 1K25A 3CUEC 2FH5A 5A91A 4IHQA 2ZQ7A 5KZHA 3IF6A 2PAVP 2O9CA 5MC7A 4GJ4A 3EQVA 1GCEA 3MXRA 4KZ6A 4X55A 4KG2A 4KZ3A 5BOHA 5KIZA 1Y28A 1OJGA 4EBNA 1OPXA 3G34A 4WBGA 1M6KA 3O86A 5AVFA 3SS5A 2WAEA 1UWPX 3MZFA 2KLIA 2W27A 4BENA 4OPYA 1D06A 4WLAA 3T1RA 3A3FA 5HL6A 4Y15A 5EECA 2FFFB 4PM7A 3TW8A 1BLHA 5DF9A 1KDSA 4HJ4A 2PBYA 3SS4A 4FOFA 1CI9A 4H6JB 5F82A 2W0NA 4ZTKA 3IH8A 4ZRRA 3ZG7B 2PR6A 5FASA 4M3KA 4Q0IA 1PRQA 1MWRA 1KE3A 4QHCA 1FQGA 4R3BA 1PYYA 4E04A 3IF6B 1KGEA 4L9EA 5K5BA 4OLDA 1EWZA 5EFWA 1LSVA 1MZUA 2RL3A 3FC7A 1G5UA 4HH2A 2O9AA 3L7HA 1IYSA 3M2KA 1QMEA 3VOZA 4ETXA 1HVBA 1IYQA 1K56A 3JYIA 1GSWA 3NHQA 3ZVTA 2JKTI 1HD8A 4RYEA 4MEZA 1DP8A 1H8YA 4MDZA 4S2KA 1N9NA 4XXRA 2XR0A 1Q2PA 4HIAA 2WKHA 4G3WA 3QP1A 4CQHA 1PIOA 3G30A 5FAOA 5TFQA 4WEKA 3TJZC 1LLBA 4NXGA 4S2NC 4S2OA 3PBRA 1E25A 1ES2A 1SKFA 5L07A 1XA1A 4WEJA 3HUNA 4OQIA 2H0YA 1L0FA 4QJGA 3LGOA 5F83A 3V67A 3W8KA 5HZHA 3BFFA 1W5DA 4E6XA 3EGDC 4KZBA 4P87A 2HDRA 3CPTA 5DKLA 1L0EA 1NYMA 3BQAA 4PKYG 5DTTA 5AQ7A 2M7VA 3CAXA 2CMNA 4UA9A 3V39A 4KZAA 1UGUA 5A93A 4R38A 4UA7A 3A3JA 5HDDA 3Q7ZA 1NLZA 2Y2HA 3CJMA 5EVIA 4CLCA 4DJ2A 5FDSA 5IT5A 2EXAA 2V8CA 4PM5A 5D3OA 2BLSA 2R9XA 2Y2NA 4PM8A 3JVVA 5GLAA 1BUEA 3NCKA 3N8RA 4NK3A 4N1HA 5KSHA 4GKUA 4R70A 4X1LA 4I3IA 3VP4A 1H3QA 3A0RA 3AGEA 1SDNA 3MSHA 3S4XA 3ZNYA 3BW6A 3AGFA 1K57A 3QP6A 3VOYA 2XQZA 1BLCA 4MN7A 1WA9A 1VQQA 1BYWA 2BTFP 3GQZA 4KUOA 4EXOA 1VM1A 3NOPC 3S1YA 4R3AA 3IHBA 4OOYA 5CHJA 1ACFA 4ZBEA 3DWZA 1FCOA 4Y0OA 1OT9A 2ZQAA 3HLEA 3LIAA 3WRTA 5GHZA 5E2EA 1J3WA 5EVIB 5F69A 4CLCB 1MWTA 2HDUA 4R0QA 4QU3A 4B4XA 1MKMA 4YFMA 3T1XA 2QPNA 4QWOA 3Q81A 2JE5A 3P98A 4HY8A 1K4EA 2IWBA 1Y54A 3UE3A 5HWVA 1XKZA 3T4JA 1IFQA 4IVKA 3UPPA 1PI5A 2WKEA 3VMAA 3BECA 4MCWA 2VZWA 1XFNA 4BL2A 3CG5A 5M18A 3WS0A 3SS3A 5HL1A 3IXGA 1L2SA 3VSLA 4MN5A 3K3CA 3CITA 4E3OA 1BZAA 2EXBA 2K2NA 4JF5A 4E3IA 1PNEA 4RX2A 5CXWA 2ZM2A 4FTXA 1KGGA 1EI5A 3N8SA 4PM6A 3UPOA 3SW1A 4D60A 2V0WA 2LB9A 1E3UD 3DAVA 1H5XA 4X56A 2G2UA 5FAQA 3D4FA 1GA0A 4EV4A 4IBXA 3UB9A 3KSIA 1P9WA 1OTBA 1KOUA 1YSPA 3OPRA 2H5SA 3JVUA 2NUTC 3T50A 3IS2A 1CK3A 3MR0A 3HLFA 4U3TA 1S67L 1VB6A 2JBFA 3LIFA 3DTMA 2Y79A 3F1NA 2O0YA 1BTLA 3D72A 2ZC7A 3SOIA 1OTAA 5LBRA 1SHVA 2HDQA 4X68A 3S7PA 3SH7A 3ZG5A 4IBRA 4IJGA 4KQQA 1FOFA 5EVEA 4GB7A 1YLTA 2Y2LA 4Y0UA 2WGWA 5E2HA 1K54A 3IXBA 3A0VA 3QP2A 3U4LP 1VETA 3V50A 3N7WA 2OV5A 3UDIA 4KQDA 1LSXA 4BD1A 3BRMA 4BJPA 2P74A 4ME4A 1MWUA 2VGKA 3QP4A 3IX3A 3BLMA 2XA7S 1XXMA 2Y2JA 3WS1A 4C75A 4M4XA 5HAQA 1NZUA 1VEUA 2Z6DA 3MXSA 3LEZA 2ZBBA 3UE1A 1IOUA 5A92A 3LO7A 3OZHA 1Z09A 4OP8A 3NJAA 3KO6A 4HBTA 2ZQDA 3UMEA 3IS2B 4GZBA 5FQMA 1SDEA 1K55A 5FAPA 3NOUC 1BLPA 3ZNTA 4JGOA 4ZJ2A 3HLBA 1FSWA 3VOLA 3T1SA 3F1NB 2Y2KA 4KG6A 1TDGA 4E3NA 1L0GA 1XPBA 1ES4A 3RJUA 4HOIA 3IXHA 1K6SA 3Q82A 2VX8A 3GDIA 3OPHA 4Q0HA 4F94A 4I3AA 2V2FF 5CTNA 1GSXA 3A3DA 1IYOA 3CUEA 2WGWB 2Q0OA 2FZ0A 1XJ2A 3VFHA 1VETB 2M1CA 5F68A 1K38A 3FYZA 1K56D 4UQIS 1PZPA 4EETB 3VSKA 2H28A 1FCMA 1GHPA 5HAPA 2V0UA 1VEUB 2RCXA 4XUZA 4ZAMA 4NEED 3EQUA 4OOLA 3IX4A 4FUWA 1JWPA 4S2LA 1DY6A 2XF3A 2ACGA 1BULA 4MBFA 1XA7A 1ZTUA 3MQ0A 4BBVA 5F1FA 2KX6A 4KZ7A 1JTGA 1GHIA 5CTMA 1YLJA 4ZJ1A 3MZEA 4DDSA 2DNSA 2L0WA 4EU0A 3Q07A 3BEBA 2WUQA 2OAP1 5AVEA 1F98A 2K31A 1K55C 3C5AA 4U0TA 1FR6A 4DXCA 1ESIA 2VLGA 2WZXA 2XD5A 3VP3A 3F1OA 3G2ZA 3N8LA 1H0MA 4P6ZS 4IUKA 4WZ4A 1XFQA 2L1MA 4R6LA 4EUVA 3LEQA 3HLDA 3OOVA 3VE4A 4GDBA 5DTKA 4N9KA 4WF0A 2HDSA 1Y4OA 3C4OA 4GN2A 2WKRA 5EVID 4CLCD 1YLPA 2HGVA 4R23A 5IU1A 3MKFA 1STZA 4YWZA 3RTYA 4L9FA 4S2IA 5GL9A 1ERMA 1L0DA 3FKWA 2MJ6A 1WYBA 3BY8A 4GS9A 1S66L 4LV2A 4LV0A 3LUQA 2C6WB 4CJNA 1BLSA 2I9VA 1IKGA 3BFCA 4S2NA 2HP6A 2ZQ8A 4HNBA 4EEPA 5E43A 1ZKJA 3F1OB 3FKVA 4ID4A 4FSFA 3FZCA 4I3JA 3B3XA 5DVAA 4G3VA 2ZC5B 5JYOA 4BD0A 2V8FA 4EBPA 2PD8A 3LCEA 1N9LA 4IEDA 1UWNX 4OLGA 1YPRA 2X02A 4R3JA 4X1MA 1TD5A 1U60A 2PBDP 2ZMFA 4N9LA 2V20A 4E3LA 3UB7A 1SKOA 4EESA 5CHMA 3E4OA 1NLYA 4QB8A 4JXSA 3ZFZA 5EV0A 2A3UA 5FA7A 3S7OA 4JBFA 1P97A 4DN0A 3NBLA 1RP5A 5HARA 3OCLA 4ETZA 2V1ZA 2Y2MA 3H9WA 4GS9B 4OQHA 2D01A 4K0XA 3WS5A 4X53A 4UAAA 4XT2A 4R1GA 3BY9A 2DMWA 4HJ3A 3WRZA 3LICA 1S1ZA 3E2KA 4C6YA 1QMFA 2V1BA 3RH8B 4CPKA 1KVMA 3W4PA 4U0XA 1TF1A 5CERA 5EM0A 4KG5A 3Q1FA 3CHWP 5AQ9A 3E98A 4QPRA 5FSRA 1IYPA 4FD8A 3PBSA 4BLMA 2XFSA 2J9OA 4LCLA 3O3VA 3TSGA 2XFTA 3GMWA 2ZOIA 1XJ4A 1ESUA 2KDKA 1C3BA 1KDWA 5EE8A 3UPNA 3C38A 2BG1A 4O7DA 1GHMA 3NECA 2QMIA 1SKOB 2XLNA 1ALQA 4E6WA 3IQAA 2W3HA 3CLOA 4Y0TA 3UMDA 3W4QA 5AJGA 5CECA 5CEDA 1ONGA 2PU4A 4XT2B 4F3LB 1ERQA 1PW8A 4HH3A 3UNWA 1KE4A 1L3LA 3EEAA 2EWWA 4WELA 2VV7A 4EQ1A 3HJKA 2Y2QA 3WWXA 3BQ8A 2ZC3B 3VFFA 4EERA 4L9GA 2ZOHA 2XA7M 1PWGA 3OLOA 4DJ3A 1AWIA 2W1RA 1CJFA 4OOMA 2QWSA 2HV1A 1AXBA 2V9AA 3VP0A 3TG9A 4Z9QA 5EPHA 2QJ7A 5TR7A 5DTSA 2JCHA 2W3DA 1IKIA 2PDRA 3MJQA 5CGXA 1FCNA 3MMHA 3UO9A 3P09A 4P85A 2WAFA 5A90A 4WUJA 3KSFA 1JTDA 4MLLA 4OONA 2EX6A 4JGQA 3QNBA 2LB5A 4HQAA 1XP4A 1JWZA 1DJCA 1IELA 2Y55A 1JNUA 4H8RA 2PD7A 4OP5A 4E3MA 3HUOA 4DE0A 1NWZA 2YKHA 3O87A 3LR0A 3E0YA 4UQIM 3FPWA 4EQIA 3LYXA 3KSGA 3MS6A 3ZG0A 4WL9A 4WMCA 5FI7A 5FQ9A 5TJJA 4GD6A 2VKSA 5FI6A 2OSUA 4I5SA 3HREA 5F5YA 1S4SA 3RXXA 3WS2A 2K7SA 1V9YA 3LI8A 3UDXA 4NXFA 4ZDXA 1YLYA 4OPQA 3UB6A 3V5MA 1K4FA 5HPIA 2V1AA 4K08A 5FEFA 1DP9A 3CWFA 1JVJA 3LIEA 2VJWA 4YINA 2G2WA 2Y2PA 5GLDA 5FQIA 1S6RA 2HJ9C 4JXVA 2JC7A 1ZG4A 2VEAA 1DJBA 3P01A 3UE6A 4P6ZM 4YNRA 4GOGA 2HP9A 3IT9A 1ZC2A 4MNRA 1D1JA 4YOFA 3V3SA 3PBOA 3S7QA 3RXWA 1RCJA 1NZOA 4O01A 5EVLA 1YMSA 4Z1WA 1SZVA 2P9VA 4FCFA 4KZ5A 1W79A 4I38A 1FR1A 4LRYC 3F1PA 1PWDA 3DBAA 4B4ZA 1N4OA 2XK1A 5J8XA 4JLFA 1FIKA 3MZDA 2YKFA 4RQ9A 2O9BA 1DRMA 4DE2A 1GA9A 2OAQ1 4Y17A 3HCYA 3LI9A 2W1TA 5EOOA 1TS6A 4LCMA 3T4SA 3HUMA 3H82A 5L8MA 3VE3A 2WGVA 5I5LA 4II7A 3EEHA 5HX9A 1T1CA 5FATA 4JGRA 5F1GA 3D9YA 4HESA 3B33A 5G18A 1PI4A 2W3GA 4O0PA 3C7UA 1W7FA 3OPPA 2J80A 5FEGA 5HSQA 4OVDA 2GX5A 2J9PA 2FFYA 4WN5A 4D2OA 3B42A 4NG2A 5DF8A 3H7WA 2P9VB 3UB5P 4BMWA 3BFGA 3F1PB 3BFDA 1NYYA 3LY4A 3OPLA 2J8YA 4LGWA 1CQAA 2JHEA 3HVFA 3IWOA 1MPLA 1LT0A 4RVAA 5FL3A 3ISGA 4QD4A 1XGJA 3D3OA 2ZM0A 3ZQ5A 3MF0A 3R7WA 4Y3IA 2W1TB 5F6AA 2WKPA 4HEFA 4NXBA 3H82B 4HI4A 5HW3A 4G3KA 3FG8A 3L9KA 3HLGA 1LHYA 4JXWA 5FI2A 2EX9A 3GSGA 3KX0X 3LFVA 4LRZE 3OC2A 1YLZA 4EBLA 2Y91A 5EOEA 2BASA 4MN6A 5KSCA 2CC1A 4B88A 3LIBA 4S2JA 1T19A 1ES5A 1O07A 3C7VA 4PPRA 3H7WB 2EA9A 3BYDA 5AQAA 1T1BA 4I39A 1HTZA 5EUAA 2J7VA 2XEPA 3T4QA 3W2ZA 3HBRA 4LV1A 4OPZA 4B93A 2XRNA 4LLOB 1K6RA 4NKPA 3K3DA 1YM1A 2A24A 1H8MA 1OTDA 3LR3A 3PAGA 1J9MA 2PHYA 3IBJA 3KSHA 5A8BA 2Y59A 5CHUA 1I2SA 4LRXC 3R7WB 5DKKA 4MMNA 3PBTA 2EX2A 3ITAA 2Z6CA 4UA6A 1Q2QA 3BLSA 4OPRA 2G7UA 2OLUA 1TEMA 2ZMAA 3BFEA 4BWIA 1TVFA 3GTCA 3IBRA 3TRCA 2QJ5A 3GVBA 1DJAA 4UEYA 3MBZA 3M6BA 3ICYA 1MY8A 4WYYA 2WKIA 4E3JA 1MBLA 1VHMA 3MKEA 1DP6A 2GDNA 1NXYA 3GRJA 3Q7VA 4JKTA 1LL5A 3JPUA 1N9BA 2B95A 3UDFA 3PBNA 4GNUA 3C4PA 5M19A 1KE0A 1I2WA 2PYRA 4JXGA 1M40A 3ZCZA 2A24B 3PHYA 5FQKA 4EEUA 4WZ5C 2PRFA 1OTIA 3ZYTA 1K0KA 2VGJA 3CZDA 3IWIA 2PYPA 1XJ3A 3NY4A 4GD8A 1LI9A 2GZAA 3MQQA 5CX7A 1BT5A 1RGZA 1HLUP 5DFXA 1WE4A 2NUPC 4XUXA 2W3FA 1OMEA 3GR2A 4HJ6A 4EW7A 2WK0A 1Z6FA 4PAUA 2INWA 1F9IA 2JN7A 2HPBA 2XDMA 3DTKA 5KMWA 2C5WB 4WMCD 4HBUA 3Q7VB 2QZ6A 1BSGA 2DCFA 4GHIA 1XJ6A 4F3LA 2GNXA 2HJEA 3IF6C 4ARZA 3MFXA 2OLVA 3QHYA 1ONHA 2J3WA 2JKRM 2JKGA 1FSYA 4Y2FA 1G68A 2J3TC 3B47A 5J7EA 3G32A 5L10A 3BM6A 1NRFA 3UN7A 3GECA 4KZ9A 3T12B 1V9ZA 4BBUA 1YMXA 3DW0A 3T4OA 5HFOA 5CRFA 2UV0E 5I94A 3G35A 1PFLA 3O5YA 1T1AA 3EOIA 4N1XA 3IX8A 3PBQA 3MQOA 2WYXA 2PR5A 1H8ZA 1GSVA 1WYCA 1IEMA 2ZM8A 1PW1A 2A49A 4O8GA 3E4QA 1O7EA 5CGSA 2D02A 3QP5A 3GV9A 4P6BA 5AQBA 3LY3A 2WGIA 3SH8A 2ZC4B 2ZD8A 4PHTA 4A5RA 4GHIB 5HDCA 5L2FA 2EX8A 4Q8IA 1NRJA 1LL8A 4ARZB 1CEFA 3EGXC 3PXPA 1T18A 4PKYA 1S0WA 1PWCA 3N4IA 5GLBA 4OQGA 4LV3A 3DTEA 5CGWA 2ZL1A 2VGLS 5J4EA 3T4KA 4QY5A 4OQ0A 3S7NA 2Y2OA 3IF5A 3G4PA 3BWLA 4WM9A 3T4TA 4LENA 3I7JA 2IWCA 4OH0A 1P9RA 4FH4A 3O88A 1G28A 2I72A 2IWDA 4JGPA 5HD5A 2P04A 1LI0A 3A3IA 2QYBA 4JPMA 5CEBA 4R4RA 4C3QA 1NY0A 4L0LA 4B9OA 2A2LA 3PYPA 2OWJA 2EWVA 2XSSA 2R9WA 1F2KA 2R78A 3K2NA 5J3WA 5HWWA 3VP2A 5GLCA 3IHAA 3HJIA 2H10A 2QKPA 3UY6A 3CPTB 2JKTM 3VP1A 1CF0A 1D7EA 4FH2A 3TOIA 3OBFA 1S4RA 1JWVA 1W8QA 4DF6A 2ZMVA 3KYEA 3FV7A 3IWQA 2WADA 3HLWA 4PMAA 4AFIA 2XROA 2ZL1B 5IS1A 2Q9MA 4RX3A 4UHUA 3E2LA 4BL3A 4DKIA 3FWLA 2UWXA 1ZHHB 1KGFA 1YSQA 2DRWA 2B18A 3E4PA 4DMZA 5C5KA 5EVIC 4CLCC 1ODVA 4EUZA 4DE1A 3SZTA 2WZZA 2ZQCA 4K0WA 2P7JA 3G31A 2ZQ9A 3ZHHA 5E2GA 3UB8A 4MBKA 2B5RA 1LSWA 2GJ3A 1KVLA 3PTEA 5G4YA 4KENB 4NETA 2B02A 1SCWA 2HF6A 3UE0A 2QHKA 4JF4A 3LIDA 5HWTA 3ZDJA 4LPZA 2WKQA 1RGYA 2P08A 4KUKA 3EWKA 1K57C 4GW9A 3A0SA 5G4ZA 2XD1A 3OCNA 3S22A 4PM9A 1MWSA 1W63M 1XGIA 4RA7A 5DF7A 2OWHA 4GLQA 5FQQA 2L4RA 4S2PA 4EWFA 5IHVA 2Q9NA 3ZG9B 3C2WA 5GHXA 4DRTA 1MXOA 3QP8A 1OT6A 2Y2IA 4NXEA 4CLCE 3HLCA 4IVIA 1I5QA 4HHDA 3NOTC 2Y8HA 4OKPA 3C8CA 1CI8A 5M1AA 3RFBA 2EFUA 4X25A 3U2AA 3ITBA 4DE3A 3G2YA
chains in the Genus database with same CATH topology
4ETZA 3H9WA 2PHYA 3NOPC 3IBJA 1YAXA 4GS9B 2D01A 4R3AA 3KSHA 5A8BA 4XT2A 3BY9A 2DMWA 4HJ3A 4LRXC 3R7WB 5DKKA 3LICA 4MMNA 1S1ZA 3PBTA 2Z6CA 3C30A 1OT9A 4Y5FA 2V1BA 3RH8B 2G7UA 5HDSA 3LIAA 1G6OA 3G6OA 4BWIA 1TF1A 5F69A 4CLCB 2J3TD 3IBRA 3TRCA 2QJ5A 3E98A 4QPRA 1MKMA 4GCZA 4UEYA 1TS7A 3CI6A 3ICYA 3PBSA 3R4KA 5TBMA 4HY8A 5HD3A 3UE3A 2ZOIA 1XJ4A 5HWVA 1VHMA 2O99A 4HP9A 2KDKA 1DP6A 3T4JA 3TE8A 1IFQA 4Q0JA 3C38A 5DJUA 4MCWA 2VZWA 1XFNA 3PBNA 3KYQA 2W3HA 2PYRA 4MN5A 3K3CA 2PT7A 3CLOA 3LR4A 3CITA 1YKDA 2KOIA 3UMDA 2A24B 3PHYA 2K2NA 5DJTA 4EEUA 1X0OA 5AJGA 1OTIA 3ZYTA 3FPVA 5DFYA 4XT2B 4F3LB 2PYPA 4HH3A 3SW1A 1XJ3A 3EEAA 2GZAA 4HP4A 2EWWA 4WELA 2V0WA 2VV7A 3MQQA 5CX7A 2LB9A 4EQ1A 3HJKA 1F5MA 3BQ8A 2OOLA 3BJNA 5DFXA 1W63Q 4EERA 1S1YA 2NUPC 4L9GA 2ZOHA 2W3FA 2XA7M 2VV8A 1TS8A 3OLOA 4HJ6A 4DJ3A 2W1RA 4EW7A 3UB9A 4OOMA 2QWSA 3LR5A 2HV1A 2IA2A 5TBMB 3KSIA 1P9WA 1OTBA 4PAUA 2INWA 1F9IA 2V9AA 1KOUA 4KQOA 2VV6A 1N9OA 2JN7A 1YSPA 3JVUA 2NUTC 3T50A 3IS2A 2QJ7A 1TS0A 3MR0A 1S67L 1VB6A 3LIFA 2W3DA 3MXQA 4BBTA 1P0ZA 1EW0A 2Y79A 2PDRA 3F1NA 3PR6A 4IUHA 2O0YA 3MJQA 3D72A 3MMHA 2W3EA 4GHIA 1XJ6A 4F3LA 4WUJA 1OTAA 2GNXA 3KSFA 2HJEA 5LBRA 4ARZA 4JGQA 5HPFA 3MFXA 3S7PA 2LB5A 4HQAA 1JNUA 4IJGA 3VV4A 2J3WA 2PD7A 2JKRM 4Y2FA 2JKRI 3A0VA 2J3TC 3B47A 2VA0A 1MC0A 5J7EA 2VGLM 4KQDA 1NWZA 2YKHA 1OJ5A 3GECA 1LSXA 3LR0A 3T4LA 4ME4A 4BJPA 3E0YA 1V9ZA 4UQIM 4H6JA 3FPWA 3LYXA 4BBUA 3KSGA 2XA7S 3T4OA 1OTEA 4WL9A 3KYZA 3P7NA 3ULFA 4M4XA 5TJJA 2VKSA 3O5YA 1T1AA 2Z6DA 1IOUA 2ZBBA 2M7UA 3EOIA 3CUEC 2FH5A 3PBQA 4I5SA 4IHQA 3MQOA 2PR5A 3NJAA 5F5YA 1GSVA 1S4SA 4O8GA 3E4QA 3KO6A 2O9CA 5MC7A 4GJ4A 2K7SA 1V9YA 3EQVA 3LI8A 3UMEA 4NXFA 3IS2B 2D02A 3UB6A 3NOUC 5HPIA 4JGOA 2V1AA 4K08A 5KIZA 1DP9A 1Y28A 1OJGA 3CWFA 3VOLA 1OPXA 3F1NB 2VJWA 3LIEA 4PHTA 4GHIB 5HDCA 1NRJA 2HJ9C 5AVFA 1LL8A 4ARZB 4HOIA 1UWPX 2VX8A 3GDIA 4Q0HA 4I3AA 2KLIA 2W27A 3EGXC 3PXPA 1GSXA 1D06A 1T18A 4WLAA 4PKYA 3CUEA 2VEAA 3P01A 2VGLS 2FZ0A 1XJ2A 3UE6A 4P6ZM 5J4EA 3T4KA 2M1CA 5F68A 4YNRA 5HL6A 3S7NA 4UQIS 3BWLA 3TW8A 5DF9A 4HJ4A 3T4TA 4EETB 4FOFA 4H6JB 4YOFA 3PBOA 3S7QA 2H28A 1P9RA 2W0NA 4ZRRA 2PR6A 2V0UA 4O01A 4Q0IA 1G28A 4Z1WA 4JGPA 4NEED 5HD5A 2P04A 3EQUA 4OOLA 4I38A 2QYBA 4LRYC 3F1PA 3DBAA 4E04A 1ZTUA 3MQ0A 4L9EA 5K5BA 4L0LA 4B9OA 4BBVA 2A2LA 3PYPA 2OWJA 1LSVA 1MZUA 2EWVA 2KX6A 2XSSA 5EFWA 3FC7A 2YKFA 2R78A 3K2NA 2O9AA 4HH2A 5J3WA 4RQ9A 2O9BA 1DRMA 5HWWA 2L0WA 4EU0A 4ETXA 2OAQ1 3HJIA 3HCYA 3LI9A 2OAP1 2QKPA 2W1TA 2JKTM 5AVEA 1GSWA 1TS6A 3T4SA 1F98A 3NHQA 2K31A 2JKTI 3H82A 1D7EA 5L8MA 3VE3A 3OBFA 1S4RA 1DP8A 4MDZA 5I5LA 4II7A 3EEHA 1T1CA 2ZMVA 4JGRA 1N9NA 2VLGA 4HIAA 3F1OA 3B33A 4G3WA 4P6ZS 2W3GA 4AFIA 4IUKA 4O0PA 2XROA 1XFQA 2L1MA 4R6LA 4CQHA 4EUVA 5IS1A 3OOVA 3VE4A 4WEKA 5HSQA 2J80A 2GX5A 4WF0A 3TJZC 1ZHHB 4WN5A 1YSQA 4NXGA 3PBRA 2B18A 3B42A 3E4PA 2WKRA 3H7WA 4CLCD 4DMZA 5C5KA 4CLCC 4WEJA 1ODVA 2HGVA 5IU1A 3V67A 4BMWA 5HZHA 3F1PB 2P7JA 1STZA 4YWZA 3EGDC 3RTYA 2JHEA 3UB8A 4L9FA 5DKLA 1LSWA 2MJ6A 3BQAA 4PKYG 2M7VA 1LT0A 3BY8A 2GJ3A 3CAXA 5G4YA 2CMNA 4GS9A 5FL3A 2B02A 3D3OA 3ZQ5A 3MF0A 3R7WA 4Y3IA 2W1TB 2HF6A 5F6AA 1UGUA 1S66L 2WKPA 2QHKA 3LUQA 4R38A 4NXBA 3H82B 4HI4A 3LIDA 5HWTA 2I9VA 4LPZA 2WKQA 2P08A 3FG8A 4G3KA 3EWKA 4KUKA 5HDDA 1NLZA 4GW9A 3A0SA 4CLCA 4HNBA 4DJ2A 5IT5A 4EEPA 3F1OB 3KX0X 3LFVA 5G4ZA 3OCNA 4FSFA 4LRZE 3OC2A 2BASA 1W63M 4I3JA 4MN6A 3JVVA 2OWHA 4GLQA 2L4RA 4G3VA 3LIBA 1T19A 2PD8A 3C2WA 5KSHA 1N9LA 1UWNX 4R70A 3H7WB 4I3IA 1OT6A 4NXEA 2EA9A 1H3QA 4CLCE 1TD5A 3A0RA 4HHDA 1T1BA 2ZMFA 4I39A 3NOTC 3T4QA 3UB7A 2Y8HA 3W2ZA 4EESA 3BW6A 3E4OA 1NLYA 3C8CA 3RFBA 4B93A 2XRNA 4LLOB 4MN7A 1WA9A 4NKPA 3K3DA 3S7OA 4DN0A 1BYWA 1P97A 2A24A 3U2AA 1H8MA 1OTDA 4KUOA 4EXOA 3LR3A 3OCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H9W A;  2PHY A;  3NOP C;  4GS9 B;  2D01 A;  4R3A A;  5A8B A;  4XT2 A;  3BY9 A;  4HJ3 A;  4LRX C;  5DKK A;  3LIC A;  1S1Z A;  2Z6C A;  1OT9 A;  2V1B A;  3RH8 B;  5HDS A;  3LIA A;  3G6O A;  5F69 A;  3IBR A;  2QJ5 A;  4GCZ A;  1TS7 A;  3ICY A;  5TBM A;  4HY8 A;  5HD3 A;  2ZOI A;  1XJ4 A;  5HWV A;  4HP9 A;  2KDK A;  1DP6 A;  5DJU A;  1XFN A;  2PYR A;  4MN5 A;  3K3C A;  3CLO A;  3UMD A;  2A24 B;  3PHY A;  5DJT A;  4EEU A;  1X0O A;  1OTI A;  4XT2 B;  4F3L B;  2PYP A;  4HH3 A;  3SW1 A;  1XJ3 A;  4HP4 A;  2V0W A;  2VV7 A;  3MQQ A;  4EQ1 A;  3HJK A;  2OOL A;  4EER A;  1S1Y A;  4L9G A;  2ZOH A;  2VV8 A;  1TS8 A;  3OLO A;  4HJ6 A;  4DJ3 A;  4EW7 A;  3UB9 A;  2QWS A;  2HV1 A;  5TBM B;  1OTB A;  2INW A;  1F9I A;  2V9A A;  1KOU A;  2VV6 A;  1N9O A;  2JN7 A;  3T50 A;  3IS2 A;  2QJ7 A;  1TS0 A;  3MR0 A;  1S67 L;  1VB6 A;  3LIF A;  3MXQ A;  4BBT A;  1P0Z A;  1EW0 A;  2PDR A;  3F1N A;  3MJQ A;  3D72 A;  4GHI A;  1XJ6 A;  4F3L A;  4WUJ A;  1OTA A;  4JGQ A;  3MFX A;  4HQA A;  1JNU A;  2PD7 A;  3A0V A;  5J7E A;  4KQD A;  1NWZ A;  2YKH A;  1OJ5 A;  3GEC A;  1LSX A;  1V9Z A;  4H6J A;  3LYX A;  4BBU A;  1OTE A;  4WL9 A;  3P7N A;  3ULF A;  4M4X A;  1T1A A;  2Z6D A;  2ZBB A;  4I5S A;  3MQO A;  2PR5 A;  3NJA A;  5F5Y A;  1GSV A;  1S4S A;  3E4Q A;  2K7S A;  1V9Y A;  3LI8 A;  3UME A;  4NXF A;  3IS2 B;  2D02 A;  3UB6 A;  3NOU C;  4JGO A;  2V1A A;  4K08 A;  5KIZ A;  1DP9 A;  1Y28 A;  1OJG A;  3CWF A;  3VOL A;  3F1N B;  3LIE A;  4GHI B;  5HDC A;  5AVF A;  1LL8 A;  4HOI A;  1UWP X;  3GDI A;  4I3A A;  2W27 A;  1GSX A;  1D06 A;  1T18 A;  4WLA A;  4PKY A;  2VEA A;  1XJ2 A;  3UE6 A;  5J4E A;  2M1C A;  5F68 A;  3BWL A;  4HJ4 A;  4EET B;  4H6J B;  2H28 A;  2W0N A;  2PR6 A;  2V0U A;  1G28 A;  4JGP A;  5HD5 A;  4I38 A;  4LRY C;  3F1P A;  4E04 A;  4L9E A;  4B9O A;  4BBV A;  3PYP A;  5EFW A;  2OWJ A;  1LSV A;  1MZU A;  2KX6 A;  3FC7 A;  2YKF A;  2R78 A;  4HH2 A;  5J3W A;  4RQ9 A;  1DRM A;  5HWW A;  2L0W A;  3HJI A;  3LI9 A;  2QKP A;  5AVE A;  1GSW A;  1TS6 A;  1F98 A;  3NHQ A;  3H82 A;  1D7E A;  3VE3 A;  1S4R A;  1DP8 A;  5I5L A;  3EEH A;  1T1C A;  4JGR A;  1N9N A;  2VLG A;  4HIA A;  3F1O A;  3B33 A;  1XFQ A;  2L1M A;  4R6L A;  5IS1 A;  3VE4 A;  5HSQ A;  2J80 A;  4WF0 A;  4WN5 A;  4NXG A;  3E4P A;  2WKR A;  3H7W A;  1ODV A;  5IU1 A;  5HZH A;  3F1P B;  2P7J A;  4YWZ A;  3RTY A;  2JHE A;  3UB8 A;  4L9F A;  5DKL A;  1LSW A;  4PKY G;  1LT0 A;  3BY8 A;  2GJ3 A;  3CAX A;  5G4Y A;  2CMN A;  4GS9 A;  2B02 A;  3ZQ5 A;  5F6A A;  1UGU A;  1S66 L;  2WKP A;  2QHK A;  3LUQ A;  4R38 A;  4NXB A;  3H82 B;  4HI4 A;  3LID A;  5HWT A;  2I9V A;  4LPZ A;  2WKQ A;  4KUK A;  3FG8 A;  3EWK A;  5HDD A;  4GW9 A;  3A0S A;  4HNB A;  4DJ2 A;  4EEP A;  3F1O B;  3KX0 X;  5G4Z A;  4LRZ E;  2BAS A;  4I3J A;  4MN6 A;  2OWH A;  2L4R A;  3LIB A;  1T19 A;  2PD8 A;  3C2W A;  1N9L A;  1UWN X;  4R70 A;  3H7W B;  4I3I A;  1OT6 A;  4NXE A;  2EA9 A;  3A0R A;  4HHD A;  1T1B A;  4I39 A;  3NOT C;  3UB7 A;  4EES A;  3E4O A;  3C8C A;  4LLO B;  1WA9 A;  3K3D A;  1BYW A;  1P97 A;  2A24 A;  1OTD A;  4KUO A;  4EXO A; 
#chains in the Genus database with same CATH topology
 1YAX A;  5GHY A;  2E8J A;  4DXB A;  2HP5 A;  3C30 A;  4BQM A;  4Y5F A;  3DTI A;  4QY6 A;  1A0K A;  2Y2G A;  5HDS A;  1G6O A;  1HZO A;  3G6O A;  4DDY A;  2J3T D;  3WS4 A;  2ZC6 B;  4X6T A;  2JKF A;  4ZJ3 A;  2VK3 A;  4GCZ A;  3NIA A;  1TS7 A;  3CI6 A;  3R4K A;  1E4D A;  5TBM A;  4P0M A;  2Z2M B;  4Y7P A;  5HD3 A;  3ZVW A;  1CEG A;  1FIL A;  1ZG6 A;  2O99 A;  4HP9 A;  4KZ8 A;  3TE8 A;  4Q0J A;  1G6A A;  5DJU A;  3A3E A;  1YT4 A;  5HAI A;  3MFD A;  1XX2 A;  3KYQ A;  4MBH A;  4Y13 A;  2AVX A;  4LFU A;  3AGD A;  2PT7 A;  3M6H A;  1LL9 A;  3LR4 A;  1YKD A;  2KOI A;  5DJT A;  1X0O A;  3DWK A;  3M2J A;  3FPV A;  3T1Q B;  5DFY A;  2ZLY A;  3NDE A;  4HP4 A;  3W4O A;  4E3K A;  1F5M A;  2OOL A;  3BJN A;  3HL9 A;  1W63 Q;  1W8Y A;  1S1Y A;  5JYP A;  2VV8 A;  1TS8 A;  1ERO A;  3PAE A;  1K54 C;  3LR5 A;  5EM1 A;  2IA2 A;  3NI9 A;  5TBM B;  5TGF A;  1NJ4 A;  1YLW A;  3ZGA B;  4KQO A;  2VV6 A;  1N9O A;  5FQJ A;  2XH9 A;  4WZ5 A;  2E8I A;  1TS0 A;  3NC8 A;  1PZO A;  4N92 A;  3NUL A;  4K91 A;  3MXQ A;  4BBT A;  2PU2 A;  1TDL A;  1P0Z A;  1EW0 A;  3PR6 A;  4IUH A;  3CMZ A;  5L09 A;  3ZG8 B;  3IH9 A;  5FDH A;  2X71 A;  2W3E A;  1E3U A;  2H0T A;  4KZ4 A;  3QNC A;  4R4S A;  5HPF A;  2ZJ9 A;  3N6I A;  3IXD A;  5U47 A;  2XGN A;  3VV4 A;  4X69 A;  4KQR A;  2JKR I;  2EFX A;  2Y4A A;  2VA0 A;  1MC0 A;  2VGL M;  1OJ5 A;  3SH9 A;  1YQS A;  2X01 A;  1ES3 A;  3T4L A;  4H6J A;  3V3R A;  3NDG A;  1MKI A;  1OTE A;  2Z2L B;  3KYZ A;  3P7N A;  4GDN A;  2HZ5 A;  3ULF A;  5E2F A;  4S2M A;  2M7U A;  4JF6 A;  4ESP A;  1K25 A;  3CUE C;  2FH5 A;  5A91 A;  4IHQ A;  2ZQ7 A;  5KZH A;  3IF6 A;  2PAV P;  2O9C A;  5MC7 A;  4GJ4 A;  3EQV A;  1GCE A;  3MXR A;  4KZ6 A;  4X55 A;  4KG2 A;  4KZ3 A;  5BOH A;  5KIZ A;  1Y28 A;  1OJG A;  4EBN A;  1OPX A;  3G34 A;  4WBG A;  1M6K A;  3O86 A;  5AVF A;  3SS5 A;  2WAE A;  1UWP X;  3MZF A;  2KLI A;  2W27 A;  4BEN A;  4OPY A;  1D06 A;  4WLA A;  3T1R A;  3A3F A;  5HL6 A;  4Y15 A;  5EEC A;  2FFF B;  4PM7 A;  3TW8 A;  1BLH A;  5DF9 A;  1KDS A;  4HJ4 A;  2PBY A;  3SS4 A;  4FOF A;  1CI9 A;  4H6J B;  5F82 A;  2W0N A;  4ZTK A;  3IH8 A;  4ZRR A;  3ZG7 B;  2PR6 A;  5FAS A;  4M3K A;  4Q0I A;  1PRQ A;  1MWR A;  1KE3 A;  4QHC A;  1FQG A;  4R3B A;  1PYY A;  4E04 A;  3IF6 B;  1KGE A;  4L9E A;  5K5B A;  4OLD A;  1EWZ A;  5EFW A;  1LSV A;  1MZU A;  2RL3 A;  3FC7 A;  1G5U A;  4HH2 A;  2O9A A;  3L7H A;  1IYS A;  3M2K A;  1QME A;  3VOZ A;  4ETX A;  1HVB A;  1IYQ A;  1K56 A;  3JYI A;  1GSW A;  3NHQ A;  3ZVT A;  2JKT I;  1HD8 A;  4RYE A;  4MEZ A;  1DP8 A;  1H8Y A;  4MDZ A;  4S2K A;  1N9N A;  4XXR A;  2XR0 A;  1Q2P A;  4HIA A;  2WKH A;  4G3W A;  3QP1 A;  4CQH A;  1PIO A;  3G30 A;  5FAO A;  5TFQ A;  4WEK A;  3TJZ C;  1LLB A;  4NXG A;  4S2N C;  4S2O A;  3PBR A;  1E25 A;  1ES2 A;  1SKF A;  5L07 A;  1XA1 A;  4WEJ A;  3HUN A;  4OQI A;  2H0Y A;  1L0F A;  4QJG A;  3LGO A;  5F83 A;  3V67 A;  3W8K A;  5HZH A;  3BFF A;  1W5D A;  4E6X A;  3EGD C;  4KZB A;  4P87 A;  2HDR A;  3CPT A;  5DKL A;  1L0E A;  1NYM A;  3BQA A;  4PKY G;  5DTT A;  5AQ7 A;  2M7V A;  3CAX A;  2CMN A;  4UA9 A;  3V39 A;  4KZA A;  1UGU A;  5A93 A;  4R38 A;  4UA7 A;  3A3J A;  5HDD A;  3Q7Z A;  1NLZ A;  2Y2H A;  3CJM A;  5EVI A;  4CLC A;  4DJ2 A;  5FDS A;  5IT5 A;  2EXA A;  2V8C A;  4PM5 A;  5D3O A;  2BLS A;  2R9X A;  2Y2N A;  4PM8 A;  3JVV A;  5GLA A;  1BUE A;  3NCK A;  3N8R A;  4NK3 A;  4N1H A;  5KSH A;  4GKU A;  4R70 A;  4X1L A;  4I3I A;  3VP4 A;  1H3Q A;  3A0R A;  3AGE A;  1SDN A;  3MSH A;  3S4X A;  3ZNY A;  3BW6 A;  3AGF A;  1K57 A;  3QP6 A;  3VOY A;  2XQZ A;  1BLC A;  4MN7 A;  1WA9 A;  1VQQ A;  1BYW A;  2BTF P;  3GQZ A;  4KUO A;  4EXO A;  1VM1 A;  3NOP C;  3S1Y A;  4R3A A;  3IHB A;  4OOY A;  5CHJ A;  1ACF A;  4ZBE A;  3DWZ A;  1FCO A;  4Y0O A;  1OT9 A;  2ZQA A;  3HLE A;  3LIA A;  3WRT A;  5GHZ A;  5E2E A;  1J3W A;  5EVI B;  5F69 A;  4CLC B;  1MWT A;  2HDU A;  4R0Q A;  4QU3 A;  4B4X A;  1MKM A;  4YFM A;  3T1X A;  2QPN A;  4QWO A;  3Q81 A;  2JE5 A;  3P98 A;  4HY8 A;  1K4E A;  2IWB A;  1Y54 A;  3UE3 A;  5HWV A;  1XKZ A;  3T4J A;  1IFQ A;  4IVK A;  3UPP A;  1PI5 A;  2WKE A;  3VMA A;  3BEC A;  4MCW A;  2VZW A;  1XFN A;  4BL2 A;  3CG5 A;  5M18 A;  3WS0 A;  3SS3 A;  5HL1 A;  3IXG A;  1L2S A;  3VSL A;  4MN5 A;  3K3C A;  3CIT A;  4E3O A;  1BZA A;  2EXB A;  2K2N A;  4JF5 A;  4E3I A;  1PNE A;  4RX2 A;  5CXW A;  2ZM2 A;  4FTX A;  1KGG A;  1EI5 A;  3N8S A;  4PM6 A;  3UPO A;  3SW1 A;  4D60 A;  2V0W A;  2LB9 A;  1E3U D;  3DAV A;  1H5X A;  4X56 A;  2G2U A;  5FAQ A;  3D4F A;  1GA0 A;  4EV4 A;  4IBX A;  3UB9 A;  3KSI A;  1P9W A;  1OTB A;  1KOU A;  1YSP A;  3OPR A;  2H5S A;  3JVU A;  2NUT C;  3T50 A;  3IS2 A;  1CK3 A;  3MR0 A;  3HLF A;  4U3T A;  1S67 L;  1VB6 A;  2JBF A;  3LIF A;  3DTM A;  2Y79 A;  3F1N A;  2O0Y A;  1BTL A;  3D72 A;  2ZC7 A;  3SOI A;  1OTA A;  5LBR A;  1SHV A;  2HDQ A;  4X68 A;  3S7P A;  3SH7 A;  3ZG5 A;  4IBR A;  4IJG A;  4KQQ A;  1FOF A;  5EVE A;  4GB7 A;  1YLT A;  2Y2L A;  4Y0U A;  2WGW A;  5E2H A;  1K54 A;  3IXB A;  3A0V A;  3QP2 A;  3U4L P;  1VET A;  3V50 A;  3N7W A;  2OV5 A;  3UDI A;  4KQD A;  1LSX A;  4BD1 A;  3BRM A;  4BJP A;  2P74 A;  4ME4 A;  1MWU A;  2VGK A;  3QP4 A;  3IX3 A;  3BLM A;  2XA7 S;  1XXM A;  2Y2J A;  3WS1 A;  4C75 A;  4M4X A;  5HAQ A;  1NZU A;  1VEU A;  2Z6D A;  3MXS A;  3LEZ A;  2ZBB A;  3UE1 A;  1IOU A;  5A92 A;  3LO7 A;  3OZH A;  1Z09 A;  4OP8 A;  3NJA A;  3KO6 A;  4HBT A;  2ZQD A;  3UME A;  3IS2 B;  4GZB A;  5FQM A;  1SDE A;  1K55 A;  5FAP A;  3NOU C;  1BLP A;  3ZNT A;  4JGO A;  4ZJ2 A;  3HLB A;  1FSW A;  3VOL A;  3T1S A;  3F1N B;  2Y2K A;  4KG6 A;  1TDG A;  4E3N A;  1L0G A;  1XPB A;  1ES4 A;  3RJU A;  4HOI A;  3IXH A;  1K6S A;  3Q82 A;  2VX8 A;  3GDI A;  3OPH A;  4Q0H A;  4F94 A;  4I3A A;  2V2F F;  5CTN A;  1GSX A;  3A3D A;  1IYO A;  3CUE A;  2WGW B;  2Q0O A;  2FZ0 A;  1XJ2 A;  3VFH A;  1VET B;  2M1C A;  5F68 A;  1K38 A;  3FYZ A;  1K56 D;  4UQI S;  1PZP A;  4EET B;  3VSK A;  2H28 A;  1FCM A;  1GHP A;  5HAP A;  2V0U A;  1VEU B;  2RCX A;  4XUZ A;  4ZAM A;  4NEE D;  3EQU A;  4OOL A;  3IX4 A;  4FUW A;  1JWP A;  4S2L A;  1DY6 A;  2XF3 A;  2ACG A;  1BUL A;  4MBF A;  1XA7 A;  1ZTU A;  3MQ0 A;  4BBV A;  5F1F A;  2KX6 A;  4KZ7 A;  1JTG A;  1GHI A;  5CTM A;  1YLJ A;  4ZJ1 A;  3MZE A;  4DDS A;  2DNS A;  2L0W A;  4EU0 A;  3Q07 A;  3BEB A;  2WUQ A;  2OAP 1;  5AVE A;  1F98 A;  2K31 A;  1K55 C;  3C5A A;  4U0T A;  1FR6 A;  4DXC A;  1ESI A;  2VLG A;  2WZX A;  2XD5 A;  3VP3 A;  3F1O A;  3G2Z A;  3N8L A;  1H0M A;  4P6Z S;  4IUK A;  4WZ4 A;  1XFQ A;  2L1M A;  4R6L A;  4EUV A;  3LEQ A;  3HLD A;  3OOV A;  3VE4 A;  4GDB A;  5DTK A;  4N9K A;  4WF0 A;  2HDS A;  1Y4O A;  3C4O A;  4GN2 A;  2WKR A;  5EVI D;  4CLC D;  1YLP A;  2HGV A;  4R23 A;  5IU1 A;  3MKF A;  1STZ A;  4YWZ A;  3RTY A;  4L9F A;  4S2I A;  5GL9 A;  1ERM A;  1L0D A;  3FKW A;  2MJ6 A;  1WYB A;  3BY8 A;  4GS9 A;  1S66 L;  4LV2 A;  4LV0 A;  3LUQ A;  2C6W B;  4CJN A;  1BLS A;  2I9V A;  1IKG A;  3BFC A;  4S2N A;  2HP6 A;  2ZQ8 A;  4HNB A;  4EEP A;  5E43 A;  1ZKJ A;  3F1O B;  3FKV A;  4ID4 A;  4FSF A;  3FZC A;  4I3J A;  3B3X A;  5DVA A;  4G3V A;  2ZC5 B;  5JYO A;  4BD0 A;  2V8F A;  4EBP A;  2PD8 A;  3LCE A;  1N9L A;  4IED A;  1UWN X;  4OLG A;  1YPR A;  2X02 A;  4R3J A;  4X1M A;  1TD5 A;  1U60 A;  2PBD P;  2ZMF A;  4N9L A;  2V20 A;  4E3L A;  3UB7 A;  1SKO A;  4EES A;  5CHM A;  3E4O A;  1NLY A;  4QB8 A;  4JXS A;  3ZFZ A;  5EV0 A;  2A3U A;  5FA7 A;  3S7O A;  4JBF A;  1P97 A;  4DN0 A;  3NBL A;  1RP5 A;  5HAR A;  3OCL A;  4ETZ A;  2V1Z A;  2Y2M A;  3H9W A;  4GS9 B;  4OQH A;  2D01 A;  4K0X A;  3WS5 A;  4X53 A;  4UAA A;  4XT2 A;  4R1G A;  3BY9 A;  2DMW A;  4HJ3 A;  3WRZ A;  3LIC A;  1S1Z A;  3E2K A;  4C6Y A;  1QMF A;  2V1B A;  3RH8 B;  4CPK A;  1KVM A;  3W4P A;  4U0X A;  1TF1 A;  5CER A;  5EM0 A;  4KG5 A;  3Q1F A;  3CHW P;  5AQ9 A;  3E98 A;  4QPR A;  5FSR A;  1IYP A;  4FD8 A;  3PBS A;  4BLM A;  2XFS A;  2J9O A;  4LCL A;  3O3V A;  3TSG A;  2XFT A;  3GMW A;  2ZOI A;  1XJ4 A;  1ESU A;  2KDK A;  1C3B A;  1KDW A;  5EE8 A;  3UPN A;  3C38 A;  2BG1 A;  4O7D A;  1GHM A;  3NEC A;  2QMI A;  1SKO B;  2XLN A;  1ALQ A;  4E6W A;  3IQA A;  2W3H A;  3CLO A;  4Y0T A;  3UMD A;  3W4Q A;  5AJG A;  5CEC A;  5CED A;  1ONG A;  2PU4 A;  4XT2 B;  4F3L B;  1ERQ A;  1PW8 A;  4HH3 A;  3UNW A;  1KE4 A;  1L3L A;  3EEA A;  2EWW A;  4WEL A;  2VV7 A;  4EQ1 A;  3HJK A;  2Y2Q A;  3WWX A;  3BQ8 A;  2ZC3 B;  3VFF A;  4EER A;  4L9G A;  2ZOH A;  2XA7 M;  1PWG A;  3OLO A;  4DJ3 A;  1AWI A;  2W1R A;  1CJF A;  4OOM A;  2QWS A;  2HV1 A;  1AXB A;  2V9A A;  3VP0 A;  3TG9 A;  4Z9Q A;  5EPH A;  2QJ7 A;  5TR7 A;  5DTS A;  2JCH A;  2W3D A;  1IKI A;  2PDR A;  3MJQ A;  5CGX A;  1FCN A;  3MMH A;  3UO9 A;  3P09 A;  4P85 A;  2WAF A;  5A90 A;  4WUJ A;  3KSF A;  1JTD A;  4MLL A;  4OON A;  2EX6 A;  4JGQ A;  3QNB A;  2LB5 A;  4HQA A;  1XP4 A;  1JWZ A;  1DJC A;  1IEL A;  2Y55 A;  1JNU A;  4H8R A;  2PD7 A;  4OP5 A;  4E3M A;  3HUO A;  4DE0 A;  1NWZ A;  2YKH A;  3O87 A;  3LR0 A;  3E0Y A;  4UQI M;  3FPW A;  4EQI A;  3LYX A;  3KSG A;  3MS6 A;  3ZG0 A;  4WL9 A;  4WMC A;  5FI7 A;  5FQ9 A;  5TJJ A;  4GD6 A;  2VKS A;  5FI6 A;  2OSU A;  4I5S A;  3HRE A;  5F5Y A;  1S4S A;  3RXX A;  3WS2 A;  2K7S A;  1V9Y A;  3LI8 A;  3UDX A;  4NXF A;  4ZDX A;  1YLY A;  4OPQ A;  3UB6 A;  3V5M A;  1K4F A;  5HPI A;  2V1A A;  4K08 A;  5FEF A;  1DP9 A;  3CWF A;  1JVJ A;  3LIE A;  2VJW A;  4YIN A;  2G2W A;  2Y2P A;  5GLD A;  5FQI A;  1S6R A;  2HJ9 C;  4JXV A;  2JC7 A;  1ZG4 A;  2VEA A;  1DJB A;  3P01 A;  3UE6 A;  4P6Z M;  4YNR A;  4GOG A;  2HP9 A;  3IT9 A;  1ZC2 A;  4MNR A;  1D1J A;  4YOF A;  3V3S A;  3PBO A;  3S7Q A;  3RXW A;  1RCJ A;  1NZO A;  4O01 A;  5EVL A;  1YMS A;  4Z1W A;  1SZV A;  2P9V A;  4FCF A;  4KZ5 A;  1W79 A;  4I38 A;  1FR1 A;  4LRY C;  3F1P A;  1PWD A;  3DBA A;  4B4Z A;  1N4O A;  2XK1 A;  5J8X A;  4JLF A;  1FIK A;  3MZD A;  2YKF A;  4RQ9 A;  2O9B A;  1DRM A;  4DE2 A;  1GA9 A;  2OAQ 1;  4Y17 A;  3HCY A;  3LI9 A;  2W1T A;  5EOO A;  1TS6 A;  4LCM A;  3T4S A;  3HUM A;  3H82 A;  5L8M A;  3VE3 A;  2WGV A;  5I5L A;  4II7 A;  3EEH A;  5HX9 A;  1T1C A;  5FAT A;  4JGR A;  5F1G A;  3D9Y A;  4HES A;  3B33 A;  5G18 A;  1PI4 A;  2W3G A;  4O0P A;  3C7U A;  1W7F A;  3OPP A;  2J80 A;  5FEG A;  5HSQ A;  4OVD A;  2GX5 A;  2J9P A;  2FFY A;  4WN5 A;  4D2O A;  3B42 A;  4NG2 A;  5DF8 A;  3H7W A;  2P9V B;  3UB5 P;  4BMW A;  3BFG A;  3F1P B;  3BFD A;  1NYY A;  3LY4 A;  3OPL A;  2J8Y A;  4LGW A;  1CQA A;  2JHE A;  3HVF A;  3IWO A;  1MPL A;  1LT0 A;  4RVA A;  5FL3 A;  3ISG A;  4QD4 A;  1XGJ A;  3D3O A;  2ZM0 A;  3ZQ5 A;  3MF0 A;  3R7W A;  4Y3I A;  2W1T B;  5F6A A;  2WKP A;  4HEF A;  4NXB A;  3H82 B;  4HI4 A;  5HW3 A;  4G3K A;  3FG8 A;  3L9K A;  3HLG A;  1LHY A;  4JXW A;  5FI2 A;  2EX9 A;  3GSG A;  3KX0 X;  3LFV A;  4LRZ E;  3OC2 A;  1YLZ A;  4EBL A;  2Y91 A;  5EOE A;  2BAS A;  4MN6 A;  5KSC A;  2CC1 A;  4B88 A;  3LIB A;  4S2J A;  1T19 A;  1ES5 A;  1O07 A;  3C7V A;  4PPR A;  3H7W B;  2EA9 A;  3BYD A;  5AQA A;  1T1B A;  4I39 A;  1HTZ A;  5EUA A;  2J7V A;  2XEP A;  3T4Q A;  3W2Z A;  3HBR A;  4LV1 A;  4OPZ A;  4B93 A;  2XRN A;  4LLO B;  1K6R A;  4NKP A;  3K3D A;  1YM1 A;  2A24 A;  1H8M A;  1OTD A;  3LR3 A;  3PAG A;  1J9M A;  2PHY A;  3IBJ A;  3KSH A;  5A8B A;  2Y59 A;  5CHU A;  1I2S A;  4LRX C;  3R7W B;  5DKK A;  4MMN A;  3PBT A;  2EX2 A;  3ITA A;  2Z6C A;  4UA6 A;  1Q2Q A;  3BLS A;  4OPR A;  2G7U A;  2OLU A;  1TEM A;  2ZMA A;  3BFE A;  4BWI A;  1TVF A;  3GTC A;  3IBR A;  3TRC A;  2QJ5 A;  3GVB A;  1DJA A;  4UEY A;  3MBZ A;  3M6B A;  3ICY A;  1MY8 A;  4WYY A;  2WKI A;  4E3J A;  1MBL A;  1VHM A;  3MKE A;  1DP6 A;  2GDN A;  1NXY A;  3GRJ A;  3Q7V A;  4JKT A;  1LL5 A;  3JPU A;  1N9B A;  2B95 A;  3UDF A;  3PBN A;  4GNU A;  3C4P A;  5M19 A;  1KE0 A;  1I2W A;  2PYR A;  4JXG A;  1M40 A;  3ZCZ A;  2A24 B;  3PHY A;  5FQK A;  4EEU A;  4WZ5 C;  2PRF A;  1OTI A;  3ZYT A;  1K0K A;  2VGJ A;  3CZD A;  3IWI A;  2PYP A;  1XJ3 A;  3NY4 A;  4GD8 A;  1LI9 A;  2GZA A;  3MQQ A;  5CX7 A;  1BT5 A;  1RGZ A;  1HLU P;  5DFX A;  1WE4 A;  2NUP C;  4XUX A;  2W3F A;  1OME A;  3GR2 A;  4HJ6 A;  4EW7 A;  2WK0 A;  1Z6F A;  4PAU A;  2INW A;  1F9I A;  2JN7 A;  2HPB A;  2XDM A;  3DTK A;  5KMW A;  2C5W B;  4WMC D;  4HBU A;  3Q7V B;  2QZ6 A;  1BSG A;  2DCF A;  4GHI A;  1XJ6 A;  4F3L A;  2GNX A;  2HJE A;  3IF6 C;  4ARZ A;  3MFX A;  2OLV A;  3QHY A;  1ONH A;  2J3W A;  2JKR M;  2JKG A;  1FSY A;  4Y2F A;  1G68 A;  2J3T C;  3B47 A;  5J7E A;  3G32 A;  5L10 A;  3BM6 A;  1NRF A;  3UN7 A;  3GEC A;  4KZ9 A;  3T12 B;  1V9Z A;  4BBU A;  1YMX A;  3DW0 A;  3T4O A;  5HFO A;  5CRF A;  2UV0 E;  5I94 A;  3G35 A;  1PFL A;  3O5Y A;  1T1A A;  3EOI A;  4N1X A;  3IX8 A;  3PBQ A;  3MQO A;  2WYX A;  2PR5 A;  1H8Z A;  1GSV A;  1WYC A;  1IEM A;  2ZM8 A;  1PW1 A;  2A49 A;  4O8G A;  3E4Q A;  1O7E A;  5CGS A;  2D02 A;  3QP5 A;  3GV9 A;  4P6B A;  5AQB A;  3LY3 A;  2WGI A;  3SH8 A;  2ZC4 B;  2ZD8 A;  4PHT A;  4A5R A;  4GHI B;  5HDC A;  5L2F A;  2EX8 A;  4Q8I A;  1NRJ A;  1LL8 A;  4ARZ B;  1CEF A;  3EGX C;  3PXP A;  1T18 A;  4PKY A;  1S0W A;  1PWC A;  3N4I A;  5GLB A;  4OQG A;  4LV3 A;  3DTE A;  5CGW A;  2ZL1 A;  2VGL S;  5J4E A;  3T4K A;  4QY5 A;  4OQ0 A;  3S7N A;  2Y2O A;  3IF5 A;  3G4P A;  3BWL A;  4WM9 A;  3T4T A;  4LEN A;  3I7J A;  2IWC A;  4OH0 A;  1P9R A;  4FH4 A;  3O88 A;  1G28 A;  2I72 A;  2IWD A;  4JGP A;  5HD5 A;  2P04 A;  1LI0 A;  3A3I A;  2QYB A;  4JPM A;  5CEB A;  4R4R A;  4C3Q A;  1NY0 A;  4L0L A;  4B9O A;  2A2L A;  3PYP A;  2OWJ A;  2EWV A;  2XSS A;  2R9W A;  1F2K A;  2R78 A;  3K2N A;  5J3W A;  5HWW A;  3VP2 A;  5GLC A;  3IHA A;  3HJI A;  2H10 A;  2QKP A;  3UY6 A;  3CPT B;  2JKT M;  3VP1 A;  1CF0 A;  1D7E A;  4FH2 A;  3TOI A;  3OBF A;  1S4R A;  1JWV A;  1W8Q A;  4DF6 A;  2ZMV A;  3KYE A;  3FV7 A;  3IWQ A;  2WAD A;  3HLW A;  4PMA A;  4AFI A;  2XRO A;  2ZL1 B;  5IS1 A;  2Q9M A;  4RX3 A;  4UHU A;  3E2L A;  4BL3 A;  4DKI A;  3FWL A;  2UWX A;  1ZHH B;  1KGF A;  1YSQ A;  2DRW A;  2B18 A;  3E4P A;  4DMZ A;  5C5K A;  5EVI C;  4CLC C;  1ODV A;  4EUZ A;  4DE1 A;  3SZT A;  2WZZ A;  2ZQC A;  4K0W A;  2P7J A;  3G31 A;  2ZQ9 A;  3ZHH A;  5E2G A;  3UB8 A;  4MBK A;  2B5R A;  1LSW A;  2GJ3 A;  1KVL A;  3PTE A;  5G4Y A;  4KEN B;  4NET A;  2B02 A;  1SCW A;  2HF6 A;  3UE0 A;  2QHK A;  4JF4 A;  3LID A;  5HWT A;  3ZDJ A;  4LPZ A;  2WKQ A;  1RGY A;  2P08 A;  4KUK A;  3EWK A;  1K57 C;  4GW9 A;  3A0S A;  5G4Z A;  2XD1 A;  3OCN A;  3S22 A;  4PM9 A;  1MWS A;  1W63 M;  1XGI A;  4RA7 A;  5DF7 A;  2OWH A;  4GLQ A;  5FQQ A;  2L4R A;  4S2P A;  4EWF A;  5IHV A;  2Q9N A;  3ZG9 B;  3C2W A;  5GHX A;  4DRT A;  1MXO A;  3QP8 A;  1OT6 A;  2Y2I A;  4NXE A;  4CLC E;  3HLC A;  4IVI A;  1I5Q A;  4HHD A;  3NOT C;  2Y8H A;  4OKP A;  3C8C A;  1CI8 A;  5M1A A;  3RFB A;  2EFU A;  4X25 A;  3U2A A;  3ITB A;  4DE3 A;  3G2Y A; 
#chains in the Genus database with same CATH homology
 4ETZ A;  3H9W A;  2PHY A;  3NOP C;  3IBJ A;  1YAX A;  4GS9 B;  2D01 A;  4R3A A;  3KSH A;  5A8B A;  4XT2 A;  3BY9 A;  2DMW A;  4HJ3 A;  4LRX C;  3R7W B;  5DKK A;  3LIC A;  4MMN A;  1S1Z A;  3PBT A;  2Z6C A;  3C30 A;  1OT9 A;  4Y5F A;  2V1B A;  3RH8 B;  2G7U A;  5HDS A;  3LIA A;  1G6O A;  3G6O A;  4BWI A;  1TF1 A;  5F69 A;  4CLC B;  2J3T D;  3IBR A;  3TRC A;  2QJ5 A;  3E98 A;  4QPR A;  1MKM A;  4GCZ A;  4UEY A;  1TS7 A;  3CI6 A;  3ICY A;  3PBS A;  3R4K A;  5TBM A;  4HY8 A;  5HD3 A;  3UE3 A;  2ZOI A;  1XJ4 A;  5HWV A;  1VHM A;  2O99 A;  4HP9 A;  2KDK A;  1DP6 A;  3T4J A;  3TE8 A;  1IFQ A;  4Q0J A;  3C38 A;  5DJU A;  4MCW A;  2VZW A;  1XFN A;  3PBN A;  3KYQ A;  2W3H A;  2PYR A;  4MN5 A;  3K3C A;  2PT7 A;  3CLO A;  3LR4 A;  3CIT A;  1YKD A;  2KOI A;  3UMD A;  2A24 B;  3PHY A;  2K2N A;  5DJT A;  4EEU A;  1X0O A;  5AJG A;  1OTI A;  3ZYT A;  3FPV A;  5DFY A;  4XT2 B;  4F3L B;  2PYP A;  4HH3 A;  3SW1 A;  1XJ3 A;  3EEA A;  2GZA A;  4HP4 A;  2EWW A;  4WEL A;  2V0W A;  2VV7 A;  3MQQ A;  5CX7 A;  2LB9 A;  4EQ1 A;  3HJK A;  1F5M A;  3BQ8 A;  2OOL A;  3BJN A;  5DFX A;  1W63 Q;  4EER A;  1S1Y A;  2NUP C;  4L9G A;  2ZOH A;  2W3F A;  2XA7 M;  2VV8 A;  1TS8 A;  3OLO A;  4HJ6 A;  4DJ3 A;  2W1R A;  4EW7 A;  3UB9 A;  4OOM A;  2QWS A;  3LR5 A;  2HV1 A;  2IA2 A;  5TBM B;  3KSI A;  1P9W A;  1OTB A;  4PAU A;  2INW A;  1F9I A;  2V9A A;  1KOU A;  4KQO A;  2VV6 A;  1N9O A;  2JN7 A;  1YSP A;  3JVU A;  2NUT C;  3T50 A;  3IS2 A;  2QJ7 A;  1TS0 A;  3MR0 A;  1S67 L;  1VB6 A;  3LIF A;  2W3D A;  3MXQ A;  4BBT A;  1P0Z A;  1EW0 A;  2Y79 A;  2PDR A;  3F1N A;  3PR6 A;  4IUH A;  2O0Y A;  3MJQ A;  3D72 A;  3MMH A;  2W3E A;  4GHI A;  1XJ6 A;  4F3L A;  4WUJ A;  1OTA A;  2GNX A;  3KSF A;  2HJE A;  5LBR A;  4ARZ A;  4JGQ A;  5HPF A;  3MFX A;  3S7P A;  2LB5 A;  4HQA A;  1JNU A;  4IJG A;  3VV4 A;  2J3W A;  2PD7 A;  2JKR M;  4Y2F A;  2JKR I;  3A0V A;  2J3T C;  3B47 A;  2VA0 A;  1MC0 A;  5J7E A;  2VGL M;  4KQD A;  1NWZ A;  2YKH A;  1OJ5 A;  3GEC A;  1LSX A;  3LR0 A;  3T4L A;  4ME4 A;  4BJP A;  3E0Y A;  1V9Z A;  4UQI M;  4H6J A;  3FPW A;  3LYX A;  4BBU A;  3KSG A;  2XA7 S;  3T4O A;  1OTE A;  4WL9 A;  3KYZ A;  3P7N A;  3ULF A;  4M4X A;  5TJJ A;  2VKS A;  3O5Y A;  1T1A A;  2Z6D A;  1IOU A;  2ZBB A;  2M7U A;  3EOI A;  3CUE C;  2FH5 A;  3PBQ A;  4I5S A;  4IHQ A;  3MQO A;  2PR5 A;  3NJA A;  5F5Y A;  1GSV A;  1S4S A;  4O8G A;  3E4Q A;  3KO6 A;  2O9C A;  5MC7 A;  4GJ4 A;  2K7S A;  1V9Y A;  3EQV A;  3LI8 A;  3UME A;  4NXF A;  3IS2 B;  2D02 A;  3UB6 A;  3NOU C;  5HPI A;  4JGO A;  2V1A A;  4K08 A;  5KIZ A;  1DP9 A;  1Y28 A;  1OJG A;  3CWF A;  3VOL A;  1OPX A;  3F1N B;  2VJW A;  3LIE A;  4PHT A;  4GHI B;  5HDC A;  1NRJ A;  2HJ9 C;  5AVF A;  1LL8 A;  4ARZ B;  4HOI A;  1UWP X;  2VX8 A;  3GDI A;  4Q0H A;  4I3A A;  2KLI A;  2W27 A;  3EGX C;  3PXP A;  1GSX A;  1D06 A;  1T18 A;  4WLA A;  4PKY A;  3CUE A;  2VEA A;  3P01 A;  2VGL S;  2FZ0 A;  1XJ2 A;  3UE6 A;  4P6Z M;  5J4E A;  3T4K A;  2M1C A;  5F68 A;  4YNR A;  5HL6 A;  3S7N A;  4UQI S;  3BWL A;  3TW8 A;  5DF9 A;  4HJ4 A;  3T4T A;  4EET B;  4FOF A;  4H6J B;  4YOF A;  3PBO A;  3S7Q A;  2H28 A;  1P9R A;  2W0N A;  4ZRR A;  2PR6 A;  2V0U A;  4O01 A;  4Q0I A;  1G28 A;  4Z1W A;  4JGP A;  4NEE D;  5HD5 A;  2P04 A;  3EQU A;  4OOL A;  4I38 A;  2QYB A;  4LRY C;  3F1P A;  3DBA A;  4E04 A;  1ZTU A;  3MQ0 A;  4L9E A;  5K5B A;  4L0L A;  4B9O A;  4BBV A;  2A2L A;  3PYP A;  2OWJ A;  1LSV A;  1MZU A;  2EWV A;  2KX6 A;  2XSS A;  5EFW A;  3FC7 A;  2YKF A;  2R78 A;  3K2N A;  2O9A A;  4HH2 A;  5J3W A;  4RQ9 A;  2O9B A;  1DRM A;  5HWW A;  2L0W A;  4EU0 A;  4ETX A;  2OAQ 1;  3HJI A;  3HCY A;  3LI9 A;  2OAP 1;  2QKP A;  2W1T A;  2JKT M;  5AVE A;  1GSW A;  1TS6 A;  3T4S A;  1F98 A;  3NHQ A;  2K31 A;  2JKT I;  3H82 A;  1D7E A;  5L8M A;  3VE3 A;  3OBF A;  1S4R A;  1DP8 A;  4MDZ A;  5I5L A;  4II7 A;  3EEH A;  1T1C A;  2ZMV A;  4JGR A;  1N9N A;  2VLG A;  4HIA A;  3F1O A;  3B33 A;  4G3W A;  4P6Z S;  2W3G A;  4AFI A;  4IUK A;  4O0P A;  2XRO A;  1XFQ A;  2L1M A;  4R6L A;  4CQH A;  4EUV A;  5IS1 A;  3OOV A;  3VE4 A;  4WEK A;  5HSQ A;  2J80 A;  2GX5 A;  4WF0 A;  3TJZ C;  1ZHH B;  4WN5 A;  1YSQ A;  4NXG A;  3PBR A;  2B18 A;  3B42 A;  3E4P A;  2WKR A;  3H7W A;  4CLC D;  4DMZ A;  5C5K A;  4CLC C;  4WEJ A;  1ODV A;  2HGV A;  5IU1 A;  3V67 A;  4BMW A;  5HZH A;  3F1P B;  2P7J A;  1STZ A;  4YWZ A;  3EGD C;  3RTY A;  2JHE A;  3UB8 A;  4L9F A;  5DKL A;  1LSW A;  2MJ6 A;  3BQA A;  4PKY G;  2M7V A;  1LT0 A;  3BY8 A;  2GJ3 A;  3CAX A;  5G4Y A;  2CMN A;  4GS9 A;  5FL3 A;  2B02 A;  3D3O A;  3ZQ5 A;  3MF0 A;  3R7W A;  4Y3I A;  2W1T B;  2HF6 A;  5F6A A;  1UGU A;  1S66 L;  2WKP A;  2QHK A;  3LUQ A;  4R38 A;  4NXB A;  3H82 B;  4HI4 A;  3LID A;  5HWT A;  2I9V A;  4LPZ A;  2WKQ A;  2P08 A;  3FG8 A;  4G3K A;  3EWK A;  4KUK A;  5HDD A;  1NLZ A;  4GW9 A;  3A0S A;  4CLC A;  4HNB A;  4DJ2 A;  5IT5 A;  4EEP A;  3F1O B;  3KX0 X;  3LFV A;  5G4Z A;  3OCN A;  4FSF A;  4LRZ E;  3OC2 A;  2BAS A;  1W63 M;  4I3J A;  4MN6 A;  3JVV A;  2OWH A;  4GLQ A;  2L4R A;  4G3V A;  3LIB A;  1T19 A;  2PD8 A;  3C2W A;  5KSH A;  1N9L A;  1UWN X;  4R70 A;  3H7W B;  4I3I A;  1OT6 A;  4NXE A;  2EA9 A;  1H3Q A;  4CLC E;  1TD5 A;  3A0R A;  4HHD A;  1T1B A;  2ZMF A;  4I39 A;  3NOT C;  3T4Q A;  3UB7 A;  2Y8H A;  3W2Z A;  4EES A;  3BW6 A;  3E4O A;  1NLY A;  3C8C A;  3RFB A;  4B93 A;  2XRN A;  4LLO B;  4MN7 A;  1WA9 A;  4NKP A;  3K3D A;  3S7O A;  4DN0 A;  1BYW A;  1P97 A;  2A24 A;  3U2A A;  1H8M A;  1OTD A;  4KUO A;  4EXO A;  3LR3 A;  3OCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...