1T1AA

Late intermediate il1 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
total genus 33
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t1aA00
3UE6A 1XJ4A 2INWA 2D01A 4NXFA 3UB7A 1S67L 2R78A 2OOLA 2Z6DA 4L9GA 2OWHA 1GSVA 4HIAA 3P7NA 4GHIA 4M4XA 4MN5A 4PKYA 5J4EA 2A24A 2OWJA 3F1PA 4GW9A 1OTBA 3E4QA 2D02A 3LIEA 1LSXA 2W0NA 3H82B 1GSXA 1T18A 2V1AA 1T1AA 4JGQA 4KUOA 2BASA 5AVFA 5KIZA 2QHKA 1G28A 3D72A 3LIFA 4H6JA 1OJGA 3LI8A 4WL9A 2QJ5A 1T1BA 4XT2B 3FG8A 1OT9A 3C8CA 4HJ4A 3RTYA 4WF0A 3CWFA 3GDIA 2GJ3A 2B02A 3GECA 2JHEA 2KX6A 5J3WA 3PYPA 3LYXA 1S66L 5DKLA 1LSWA 2A24B 5HWVA 5DKKA 1D06A 3ZQ5A 2PR5A 4HHDA 5AVEA 4GS9A 5HDSA 1DP6A 3LICA 4JGPA 4EERA 4EESA 3CLOA 1F9IA 3A0VA 1OTEA 1S4RA 2YKFA 1N9NA 4WN5A 4GHIB 2PDRA 3LIBA 1LT0A 1DP9A 4I5SA 2VV7A 4L9FA 4EETB 5F5YA 5I5LA 2PR6A 4WUJA 3SW1A 1KOUA 3H82A 4HNBA 4EEPA 1XFNA 4L9EA 2CMNA 4HP9A 4K08A 2EA9A 4HOIA 3F1OB 4BBUA 3NHQA 3MJQA 2QJ7A 1V9YA 5HDCA 5IS1A 2QKPA 1GSWA 1WA9A 3MR0A 4I3IA 3LIAA 1DP8A 4I3JA 5HWTA 3H7WA 4R38A 1P0ZA 4EW7A 3LIDA 4LRYC 2V0WA 5HZHA 5HD3A 4B9OA 2V1BA 1XFQA 3VE3A 4DJ2A 1TS8A 4GCZA 4LRZE 1LSVA 1T1CA 5G4ZA 4NXBA 5TBMB 4R70A 3ICYA 5HWWA 4I38A 2M1CA 5HD5A 1OJ5A 3EWKA 3IS2A 3NOUC 1V9ZA 4KQDA 3K3CA 1OTAA 2PYPA 1UWPX 3F1NB 3LI9A 3MFXA 4LPZA 5HDDA 4YWZA 4BBVA 4BBTA 5J7EA 1LL8A 1N9OA 3UB6A 2P7JA 4LRXC 3NOPC 3F1PB 1NWZA 3PHYA 2Z6CA 1TS0A 4HI4A 4DJ3A 3E4OA 4R6LA 3VOLA 2PD8A 4HQAA 4PKYG 3UMDA 4JGRA 4E04A 1S4SA 4H6JB 2V9AA 1UWNX 3E4PA 3T50A 2VV8A 1JNUA 5EFWA 1OTDA 2WKPA 3IS2B 3MQOA 1MZUA 4NXGA 3G6OA 3CAXA 2VLGA 3ULFA 3EEHA 1S1ZA 4I3AA 4HJ3A 5HSQA 1X0OA 2H28A 5IU1A 1S1YA 5DJTA 2KDKA 1N9LA 4EQ1A 3BY8A 4F3LA 1DRMA 4KUKA 4EEUA 1BYWA 1Y28A 2PYRA 3A0SA 3BWLA 4JGOA 1VB6A 2W27A 1D7EA 5F69A 3UB8A 2L0WA 2L4RA 2ZOIA 3NJAA 1F98A 2PHYA 3C2WA 4HH3A 3HJKA 4WLAA 4XT2A 3H7WB 4NXEA 4GS9B 2PD7A 4EXOA 3OLOA 2VV6A 3LUQA 1XJ2A 2ZBBA 3BY9A 5DJUA 2V0UA 1TS6A 3HJIA 2J80A 3MQQA 1XJ3A 2JN7A 4I39A 5F68A 3K3DA 4F3LB 4MN6A 1XJ6A 4LLOB 3NOTC 3VE4A 1P97A 5G4YA 3F1NA 4HJ6A 2L1MA 2VEAA 3F1OA 1TS7A 3MXQA 1OTIA 2I9VA 3B33A 4HH2A 4RQ9A 5F6AA 2QWSA 3FC7A 3UMEA 5A8BA 1T19A 2HV1A 3A0RA 3RH8B 2YKHA 4R3AA 5TBMA 2WKRA 2K7SA 1UGUA 4HP4A 2ZOHA 3H9WA 3UB9A 3IBRA 4HY8A 3KX0X 1EW0A 1ODVA 2WKQA 1OT6A
chains in the Genus database with same CATH superfamily
2PU4A 4PAUA 4L9GA 2EXBA 4GOGA 4PKYA 1MXOA 2V1AA 3TG9A 5CEDA 1OT9A 3D9YA 5FEGA 4UQIM 2GNXA 3V67A 1ES3A 2VA0A 1XP4A 1KE4A 4RVAA 5AVEA 1BULA 1MKMA 2Q9NA 4KQOA 4UHUA 2B95A 5L2FA 3FPWA 2ZC6B 1YAXA 4NKPA 2ZMVA 3MR0A 3ZCZA 4KZ8A 5HD3A 3V5MA 3M6HA 1TS8A 2W3HA 2Y2QA 1NY0A 2X01A 4PPRA 3LI9A 5J7EA 3BJNA 2DRWA 4Q0JA 3UO9A 3IX3A 5HSQA 4DDYA 1X0OA 4KG6A 4Y5FA 4JXVA 1VB6A 4WEJA 1DJBA 2ZQDA 5M18A 1P9RA 3OPHA 2JBFA 1H8ZA 3IT9A 5EOEA 3T12B 4X69A 3SS5A 4Y13A 4QJGA 3B33A 1SKFA 1UGUA 1PZOA 3IXGA 3Q7ZA 2Y79A 2XLNA 3UE6A 1XJ4A 4BJPA 5CXWA 2J3TC 4KUOA 1WE4A 3D72A 4H6JA 3CPTB 4N1XA 4HJ4A 3CG5A 4JBFA 2FH5A 4L9FA 1DP9A 1VEUA 2VV7A 3DTMA 4HNBA 4HOIA 3UY6A 3G30A 4GNUA 3T1QB 3LIAA 1K6RA 3FZCA 3VFFA 1K56D 1W63Q 2IWBA 3SZTA 4NXBA 3S22A 4QPRA 1OJ5A 3G2YA 4N1HA 2PYPA 2RL3A 4GN2A 4ID4A 3MZFA 1N9OA 4LRXC 5HPIA 4K91A 3ZG0A 4IHQA 3GQZA 3SS3A 2V8CA 2W3GA 3NC8A 3M2JA 2Y2HA 3CAXA 1SCWA 2EXAA 2XRNA 2X02A 5FQJA 2H0TA 1HD8A 5C5KA 3IF6B 2W27A 5I5LA 2PHYA 3HLDA 3OLOA 4YOFA 4R3JA 3VSKA 5DJUA 4OQ0A 3UDFA 3NDGA 3K3DA 3BFEA 4LLOB 1H8YA 5EVIB 4RA7A 2XSSA 2ZC5B 4R3AA 4S2PA 4BWIA 2WKQA 4NXFA 1IYOA 4EV4A 2Y2KA 2W0NA 2JKGA 4MEZA 2O99A 3U2AA 2ZL1B 3JVVA 5FQQA 5FL3A 2XF3A 4Y0TA 3KSHA 4PM8A 4B4XA 4YNRA 3LYXA 4WZ4A 3Q81A 1LSWA 2A24B 3T1RA 1CK3A 3LICA 3CLOA 3A3IA 4E3MA 2PT7A 2PBYA 2YKFA 1YKDA 1XFNA 1ESIA 4R0QA 4K0WA 1H0MA 3BQAA 1M6KA 3G31A 4AFIA 4PM6A 5DFYA 4GZBA 1YLWA 2QYBA 2XQZA 1GA0A 4RX2A 4X55A 5U47A 1W8QA 4KZ9A 4R6LA 2HDRA 2B5RA 2DMWA 3QP8A 3C7VA 1K56A 5GLDA 3MMHA 1K25A 4Q0IA 3IS2B 1MZUA 4B88A 4CLCD 3HLFA 4PM5A 4KENB 5DTTA 4JF6A 3BY8A 2HP9A 3I7JA 1IELA 3G2ZA 3EQUA 3PBQA 4NXEA 3C4OA 1E3UA 3BW6A 1AXBA 2ZMAA 4P6ZS 2J7VA 5EM1A 4F3LB 4FCFA 1ZC2A 5F6AA 1LI0A 3UB6A 1NLYA 5AQBA 4NETA 1KVLA 1FILA 3HLEA 3NIAA 2K7SA 3PXPA 3IXBA 3CMZA 1E4DA 3DW0A 1KE3A 1OT6A 3ITAA 2VGJA 3UB7A 2JKFA 2R78A 1SHVA 3S7OA 2Z6DA 2R9XA 4HBUA 4GHIA 3V50A 3F1PA 1FCMA 3KYQA 3WS1A 2ZQ8A 2ZC4B 1NYYA 3C8CA 4X25A 4CLCA 3PAEA 1SDNA 1FR1A 3LEZA 4E3NA 2J8YA 4ZTKA 3WS2A 3OPRA 3VP1A 1Z09A 3P98A 3PBSA 4I5SA 4WUJA 1G6AA 4EEPA 5I94A 4HP9A 4MMNA 1TDGA 5FSRA 2J9PA 1IYPA 3SH8A 4CLCB 2KOIA 5FEFA 5HWWA 2M1CA 2OLVA 3T1SA 4LPZA 4GLQA 4R4RA 2DNSA 2IWDA 2Z6CA 3LCEA 1YMXA 2J9OA 2Z2LB 1SZVA 3ZVTA 4JXGA 3MZDA 3IBJA 4GJ4A 3G6OA 3DTEA 3ULFA 1LL5A 4MNRA 2Y2LA 1GHIA 1XA1A 3LR4A 4GD8A 5CECA 2JKTI 1K0KA 2PYRA 2C6WB 2HDSA 3AGEA 2PBDP 3S7QA 3SOIA 5FATA 1K4FA 5DF8A 4K0XA 2J80A 1N4OA 4IUHA 4S2KA 4HJ6A 1T19A 2HV1A 4HBTA 2O0YA 3H9WA 2I72A 4HY8A 3CPTA 1CJFA 2Y2IA 4KQQA 2E8JA 4FH4A 3UPPA 1L0FA 3P7NA 5LBRA 4JGQA 2P08A 1G28A 1OJGA 4QD4A 3C4PA 1ZG4A 3HCYA 1ES4A 1T1BA 3CWFA 2GJ3A 5FI2A 5L07A 3GTCA 4OPZA 2ZL1A 1Q2QA 1F9IA 1O07A 1ACFA 3ITBA 1DJCA 1RGYA 1KOUA 4L9EA 3PBNA 4PM7A 1SKOA 2Y55A 5HPFA 3G34A 2W1RA 3ICYA 1ONHA 3HUOA 3EWKA 5FQKA 3T4QA 3FV7A 5KZHA 3F1NB 5HDDA 3RJUA 4QY6A 2V1ZA 2WZXA 4OKPA 4UA9A 3F1PB 3PHYA 5AQ7A 3IQAA 3IX8A 1W7FA 4IEDA 4ARZA 4EXOA 4NXGA 4JLFA 3R7WA 3EEHA 3UPNA 1S1YA 3IXDA 5EVIA 5CEBA 1S0WA 1Y28A 2EWWA 4Q8IA 4WYYA 4C3QA 2ZOIA 1CI9A 1YM1A 1K57A 4JXSA 3T4KA 4R1GA 1XJ2A 4OH0A 3HJIA 3LO7A 5F68A 4DN0A 2QZ6A 4U0TA 1OTIA 5JYPA 3HL9A 3A0RA 4Z1WA 3EGDC 3CHWP 2JKTM 5E2HA 2ZOHA 1ERMA 1BLPA 3MXRA 1FOFA 2M7VA 2VGLS 1LHYA 2A24A 1OTBA 1LSXA 3N8SA 1K55C 2ZMFA 2V20A 2VK3A 4WELA 4D60A 4OP8A 5A90A 3VOYA 5EVIC 3DAVA 4NG2A 4LENA 2P9VB 3EOIA 3W4QA 3ZGAB 5FAPA 3BFDA 2IA2A 3LR0A 3QP2A 5FAOA 3F1OB 3FKVA 2UWXA 3O3VA 1GSWA 4PMAA 5E2FA 5F1GA 1JTGA 3A3FA 3VE3A 3W2ZA 4LRZE 4II7A 4E6WA 1V9ZA 1OTAA 2R9WA 1XGIA 2OAQ1 3JVUA 1H5XA 4ME4A 4MLLA 3ZNTA 1MPLA 4E6XA 1PRQA 1UWNX 2LB5A 1ZTUA 3UDIA 2OV5A 1Y4OA 4FOFA 3L9KA 3NECA 2QPNA 4F3LA 1MKIA 1NXYA 4XUXA 5GL9A 3D3OA 5CHUA 2XD1A 1K54C 4IUKA 2WAFA 3JPUA 2V0UA 4WBGA 2P74A 1TVFA 2JN7A 4KZ4A 3QP6A 3VE4A 1DJAA 5E2EA 3FC7A 1FQGA 4S2JA 3NBLA 3N8LA 3BLMA 1K38A 2KLIA 5A93A 2JKRM 1KVMA 4GD6A 4X53A 1PWGA 3WWXA 2ZLYA 3WS0A 4ARZB 5CHJA 1P9WA 3LI8A 2WZZA 4OPRA 3MS6A 2X71A 5J8XA 2Y2OA 1U60A 4CJNA 1L0EA 4EUVA 4N9LA 4F94A 3S7NA 4EERA 5AJGA 1RCJA 1TD5A 3OPLA 4IJGA 1W5DA 2PR6A 4IBXA 4LCLA 4KZ3A 3LIDA 4Y0OA 3IWIA 4B9OA 3LR5A 5DF7A 5TR7A 4EBNA 1XA7A 3V3RA 2ZQCA 2XFSA 4CLCE 1VEUB 1L0DA 4HI4A 2B18A 4HQAA 5F1FA 1Z6FA 1CQAA 4ZDXA 3E0YA 3T50A 4YINA 2HPBA 1YSPA 3BFCA 3GR2A 4S2IA 4O0PA 5F69A 4MCWA 1PW1A 1TDLA 3BLSA 1KGFA 4Y17A 5FA7A 1XJ3A 2W3FA 2OLUA 5EVLA 1ES2A 2ZC7A 3G32A 2QWSA 3PAGA 2GX5A 5CTMA 4NEED 3IF6A 3FYZA 1ODVA 1XX2A 2D01A 1W63M 3PBTA 4OOYA 3HBRA 5J4EA 3O86A 4HEFA 3MZEA 4OP5A 1T18A 4KG2A 4C75A 3O88A 2EFXA 2M7UA 2XDMA 4WF0A 2WKHA 3MKFA 2WUQA 2KX6A 2JKRI 1S66L 3WRTA 5FAQA 3ZDJA 3A3DA 1SKOB 1D06A 1NRJA 3KYEA 4WEKA 4KZ5A 1NRFA 3V3SA 2HDQA 3T4JA 4LFUA 5TBMB 1OPXA 3PR6A 2VKSA 1JWPA 3LGOA 3AGFA 4YWZA 2XEPA 5GLAA 4H6JB 2WGVA 3E4PA 1JNUA 2WKPA 3A3JA 2NUTC 4MBHA 5FQMA 1JVJA 3CI6A 3BWLA 4MN7A 3UB8A 3Q1FA 4HH3A 3MQ0A 3FWLA 3WRZA 3LY3A 1TS6A 4QHCA 5AQAA 1BLSA 1P97A 1PI4A 3F1NA 2L1MA 2VEAA 1YLTA 2ZC3B 2I9VA 1YLYA 1TF1A 5HAIA 2VJWA 3LEQA 4BENA 3L7HA 3UB9A 5MC7A 2XK1A 3KO6A 4G3VA 2ZQ9A 3T1XA 2W1TB 4WM9A 5L09A 4MN5A 5CERA 3H82B 2PRFA 2BLSA 3E2LA 2OAP1 3S7PA 1MC0A 1VQQA 1JWZA 2WK0A 4HESA 3NCKA 2Z2MB 3SH9A 4DF6A 1OTEA 1N9NA 1J3WA 2PDRA 4C6YA 4X56A 3CUEC 4IBRA 4BBUA 5M1AA 1YSQA 1ZG6A 5A91A 5IS1A 3H7WA 1XFQA 3OZHA 1LSVA 2Y2GA 1C3BA 1RGZA 5HL6A 3RFBA 1NWZA 1KE0A 3UMDA 4DE3A 3QHYA 5IU1A 2CC1A 4WMCA 1DRMA 3P09A 4DE0A 4KUKA 4QB8A 4OONA 4E3OA 1D7EA 4FTXA 1PIOA 2ZM0A 4O7DA 3VP2A 2HF6A 2HJEA 3LUQA 3ZFZA 4DXBA 4LCMA 5EPHA 3D4FA 2JE5A 4DE2A 1IKIA 2IWCA 4HH2A 3RXWA 1TS7A 1L2SA 3RH8B 5TBMA 3CITA 1PZPA 5TGFA 1BUEA 1HZOA 2G2WA 2RCXA 4E3LA 4HHDA 4KG5A 3MSHA 4GW9A 2D02A 4BL3A 2HP5A 5E43A 2BTFP 4M3KA 4KZ7A 1OMEA 2EWVA 2Y91A 5DKLA 4S2MA 2ZQ7A 4UA6A 4GS9A 4EESA 3BFGA 3O5YA 1S4RA 4WN5A 2ZM8A 1L3LA 4PM9A 2CMNA 1NLZA 2Y2MA 1LLBA 1PI5A 4FUWA 5A92A 2K31A 5CGSA 1T1CA 3S1YA 4B93A 3VSLA 4WZ5C 3A3EA 3NOUC 4KQDA 2FFFB 2ZM2A 4L0LA 1G5UA 2P7JA 3CJMA 1SDEA 3W4OA 1NZUA 1OTDA 1E3UD 4B4ZA 2H28A 4BQMA 4EQ1A 3OC2A 5CX7A 1O7EA 3DWZA 1I5QA 2HP6A 3VV4A 2VV6A 4LV1A 5HW3A 3KSIA 3TJZC 2A3UA 3JYIA 1ERQA 4LV0A 4JF5A 3R7WB 1K54A 4WMCD 3TSGA 4JXWA 4QY5A 4S2LA 4WZ5A 3W4PA 4Q0HA 3QP1A 5FASA 1RP5A 2INWA 4FSFA 3ISGA 1XXMA 5FQ9A 2XA7M 3PBRA 1YLZA 4NK3A 2EFUA 1GSXA 3U4LP 3ZVWA 5FI7A 4A5RA 1E25A 1ONGA 3GDIA 2B02A 1PW8A 2WADA 1G6OA 3BM6A 5HWVA 1MWUA 3HUNA 1G68A 3TW8A 1I2WA 3HREA 4P85A 3IH8A 4EBLA 1NJ4A 1N9BA 4I3JA 5EVID 1MWRA 4DJ2A 5JYOA 5D3OA 3ZG9B 1IEMA 1XKZA 5DF9A 2XA7S 1F2KA 1GA9A 3DWKA 1MWSA 3GV9A 4S2NA 2Y2PA 4RYEA 3E4OA 4IVKA 2H0YA 5IHVA 4BD0A 2VV8A 5HD5A 4JPMA 4HJ3A 2XR0A 3BRMA 5GLBA 2W3EA 3FKWA 2A2LA 1N9LA 3UE3A 1MBLA 4IVIA 1EWZA 2L0WA 2L4RA 2XH9A 3MKEA 4GS9B 2ZBBA 3BY9A 1YMSA 4KZ6A 3IX4A 3GMWA 4BD1A 1PWCA 5DKKA 3DBAA 2AVXA 4ZAMA 4ZBEA 5L10A 3WS4A 4CLCC 2K2NA 3VP3A 1XPBA 4CPKA 1EW0A 2XFTA 3EGXC 2ACGA 1S6RA 5EUAA 1GSVA 4MBKA 4HIAA 4M4XA 1CEGA 3IF6C 3G4PA 2JCHA 2BASA 4R3BA 3Q7VB 3UN7A 3RTYA 3LY4A 5GLCA 4R23A 3M2KA 1BZAA 2PR5A 5HDSA 5FQIA 4UAAA 3MBZA 4GHIB 2PAVP 4EETB 4YFMA 5F5YA 3OCLA 4OLGA 3SW1A 2BG1A 2WAEA 4UQIS 3T4SA 3ZYTA 4U0XA 4DXCA 1V9YA 4EU0A 1NYMA 1WA9A 5DVAA 3MF0A 1XGJA 4O8GA 3UNWA 2V8FA 3E2KA 3MFXA 4OVDA 4BBTA 1LL8A 3IF5A 3VP0A 2H5SA 1TS0A 4DJ3A 4G3KA 4XXRA 4XUZA 2XROA 4JGRA 3MXSA 3UB5P 3NDEA 1KDWA 1NZOA 1W8YA 3C7UA 1FCNA 3T4OA 2W3DA 5AQ9A 1KDSA 2KDKA 3N8RA 1HVBA 2WGWB 4UA7A 3N7WA 1IYQA 1BLHA 1STZA 3HJKA 3H7WB 3DTIA 4EBPA 1IFQA 4DE1A 4UEYA 1VHMA 1XJ6A 5G4YA 4DKIA 3F1OA 4RQ9A 1VETB 2EX8A 5A8BA 5F82A 3BQ8A 1EROA 1EI5A 1FSYA 2G2UA 2PU2A 3R4KA 4HP4A 1YLPA 3B3XA 4MBFA 3QNCA 1PWDA 3KX0X 3PTEA 1JWVA 4ESPA 2Y4AA 2Y2NA 3K2NA 4Y0UA 4Z9QA 2VGLM 1CI8A 4OQHA 4Y3IA 4R4SA 5FI6A 4OPYA 5L8MA 5KIZA 2QHKA 3IHAA 2QJ5A 3SH7A 4P0MA 3RXXA 3G35A 5J3WA 1K4EA 2GZAA 3OCNA 1DP6A 3PBOA 4JGPA 4LGWA 4E3JA 1J9MA 2MJ6A 3VP4A 1F5MA 2EA9A 3NHQA 5KSCA 3HLCA 1DP8A 4R38A 2V0WA 1WYBA 5EVEA 3CUEA 2QMIA 3OBFA 1KGGA 3DTKA 4BBVA 4E3KA 4U3TA 3ZNYA 3ZG7B 3HLGA 2HJ9C 2EX9A 3IH9A 1CF0A 3MQOA 3QP5A 2VLGA 2W1TA 3VMAA 4G3WA 2E8IA 1QMEA 2DCFA 3UE0A 2VX8A 3C5AA 3KSGA 5DFXA 1F98A 1GCEA 2O9CA 2PD7A 3C38A 4E3IA 1ES5A 4DMZA 1ZHHB 3MQQA 5KMWA 3C30A 2NUPC 3B42A 5DTSA 1VM1A 4OQIA 5HARA 2H10A 3GSGA 4OOMA 2G7UA 1BTLA 4X1LA 4MDZA 3E98A 5DTKA 3OPPA 4ZRRA 2OOLA 1K57C 1FIKA 2OWHA 3FPVA 1YQSA 3IWOA 5AVFA 4ZJ1A 3LIFA 4FH2A 4ZJ3A 2P04A 5CHMA 1WYCA 1K6SA 4Y2FA 2JHEA 1FSWA 3VOZA 5M19A 1CEFA 3ZQ5A 1FR6A 4KQRA 4P87A 1IOUA 4GB7A 4ETZA 1BT5A 3A0VA 3HUMA 4EQIA 5HX9A 2LB9A 3LIBA 3H82A 4ETXA 1K55A 5HDCA 3S4XA 5FDSA 5HZHA 3BFFA 4LRYC 2HGVA 5CGXA 3O87A 5GHYA 3IS2A 4PHTA 3K3CA 3M6BA 4EUZA 5CGWA 3BECA 2EX6A 3EQVA 5HAPA 2WKEA 3VOLA 1Y54A 2O9BA 2WGIA 1HLUP 1S1ZA 1TEMA 3LR3A 1ESUA 4S2NC 4D2OA 2J3WA 3A0SA 3B47A 2A49A 1YT4A 1JTDA 3HLWA 2Y2JA 4FD8A 1H3QA 3TE8A 5EV0A 3HLBA 3UMEA 1IKGA 4P6BA 2J3TD 1BSGA 2V2FF 3Q7VA 5HFOA 3ZG8B 1GHPA 4ZJ2A 1S67L 4GKUA 1AWIA 3OOVA 2OWJA 3E4QA 5IT5A 2Q0OA 3KSFA 5BOHA 3W8KA 2GDNA 4WL9A 4XT2B 2VZWA 1L0GA 3NY4A 3BEBA 3GECA 2UV0E 5TJJA 4BLMA 1MY8A 1FCOA 4BL2A 2ZJ9A 3GVBA 1D1JA 4LV2A 3UE1A 1LT0A 4X1MA 3BYDA 4K08A 3MJQA 2QJ7A 1LI9A 2QKPA 4I3IA 1P0ZA 2V1BA 5G4ZA 4R70A 4I38A 2WGWA 3NI9A 4LV3A 5EE8A 1YPRA 4JKTA 5F83A 3P01A 2XD5A 2WKIA 1HTZA 3NOPC 4OPQA 3EEAA 1A0KA 1I2SA 4OOLA 4PKYG 3IWQA 4DDSA 3UPOA 2V9AA 3GRJA 3N6IA 1LL9A 3VFHA 1H8MA 5EOOA 2HZ5A 2Q9MA 3IXHA 5CRFA 4EEUA 1BYWA 4H8RA 4JGOA 3QP4A 1VETA 3NJAA 4WLAA 4QU3A 3ZHHA 1BLCA 1PFLA 2WYXA 3LFVA 4MN6A 3NOTC 3MXQA 3V39A 2P9VA 3CZDA 1ALQA 3NULA 2YKHA 4S2OA 3KYZA 2VGKA 5HL1A 3IBRA 5G18A 3Q82A 5TFQA 5EM0A 3IHBA 5GHZA 5GHXA 3ZG5A 3TRCA 3LIEA 4EW7A 4DRTA 5K5BA 1T1AA 4GDNA 3WS5A 4CQHA 4OQGA 2Y59A 2C5WB 4EWFA 3UDXA 2HDUA 3FG8A 2FFYA 3PYPA 4N9KA 1YLJA 5EECA 1M40A 5FDHA 2JC7A 4KZAA 3MFDA 3QNBA 5HWTA 5E2GA 2ZD8A 4JF4A 4KZBA 4GCZA 4GDBA 1W79A 4Y7PA 4P6ZM 3SS4A 4BMWA 1UWPX 1MWTA 1DY6A 1GHMA 3T4LA 3AGDA 2PD8A 3N4IA 2FZ0A 4QWOA 4E04A 4O01A 1S4SA 1QMFA 1IYSA 5CTNA 2Y8HA 5EFWA 3HVFA 4OLDA 3TOIA 3Q07A 1ZKJA 4I3AA 4Y15A 5DJTA 1KGEA 4RX3A 4X68A 3C2WA 4XT2A 3T4TA 5HAQA 1Q2PA 4N92A 4I39A 2XGNA 1PNEA 1PYYA 4X6TA 5KSHA 2WKRA 2ZQAA 2EX2A 2O9AA 2OSUA
chains in the Genus database with same CATH topology
3KO6A 3K2NA 4G3VA 4PAUA 4L9GA 2VGLM 2W1TB 3P7NA 4Y3IA 4MN5A 4PKYA 5LBRA 3H82B 4JGQA 2V1AA 2P08A 2OAP1 5L8MA 2QHKA 1G28A 3S7PA 5KIZA 1OJGA 1MC0A 3HCYA 2QJ5A 1T1BA 1OT9A 4UQIM 3CWFA 2GJ3A 2GNXA 5J3WA 3V67A 2VA0A 2GZAA 3OCNA 5AVEA 1DP6A 3PBOA 4JGPA 1MKMA 1F9IA 1OTEA 4KQOA 1N9NA 2PDRA 3FPWA 3CUEC 2MJ6A 1KOUA 1YAXA 4NKPA 4L9EA 1F5MA 3PBNA 2ZMVA 2EA9A 4BBUA 1YSQA 3NHQA 5IS1A 5HPFA 3MR0A 1DP8A 3H7WA 4R38A 2V0WA 5HD3A 1XFQA 2W1RA 1TS8A 2W3HA 1LSVA 3CUEA 3ICYA 3OBFA 3EWKA 3T4QA 3F1NB 3LI9A 5HDDA 4BBVA 5J7EA 3BJNA 5HL6A 4Q0JA 3F1PB 3RFBA 1NWZA 3PHYA 2HJ9C 3UMDA 4ARZA 4EXOA 4NXGA 5HSQA 3MQOA 2VLGA 3R7WA 3EEHA 2W1TA 1X0OA 4G3WA 1S1YA 5IU1A 1DRMA 2VX8A 4KUKA 4Y5FA 1Y28A 3KSGA 1VB6A 2EWWA 4WEJA 1D7EA 5DFXA 2ZOIA 1F98A 1P9RA 2HF6A 2O9CA 2PD7A 3C38A 2HJEA 3LUQA 3T4KA 1XJ2A 4DMZA 1ZHHB 3HJIA 3MQQA 3C30A 2NUPC 5F68A 3B42A 4DN0A 4HH2A 1TS7A 1OTIA 3B33A 3A0RA 4Z1WA 3RH8B 4OOMA 3EGDC 5TBMA 2JKTM 3CITA 1UGUA 2G7UA 2ZOHA 4MDZA 3E98A 2Y79A 4HHDA 4ZRRA 3UE6A 1XJ4A 4BJPA 2OOLA 2M7VA 2VGLS 2OWHA 3FPVA 2A24A 4GW9A 1OTBA 2D02A 1LSXA 2J3TC 4KUOA 2ZMFA 5AVFA 3LIFA 3D72A 4H6JA 2P04A 4WELA 4HJ4A 4Y2FA 2JHEA 2EWVA 5DKLA 3ZQ5A 2FH5A 4GS9A 1IOUA 4ETZA 4EESA 3A0VA 3O5YA 3EOIA 1S4RA 4WN5A 2LB9A 3LIBA 4L9FA 1DP9A 2VV7A 3H82A 4HNBA 4ETXA 2IA2A 3LR0A 2CMNA 1NLZA 4HOIA 3F1OB 5HDCA 1GSWA 3LIAA 5HZHA 4LRYC 1W63Q 2HGVA 3VE3A 2K31A 3W2ZA 4LRZE 1T1CA 4NXBA 4B93A 4II7A 4QPRA 1OJ5A 3IS2A 3NOUC 4KQDA 1V9ZA 4PHTA 3K3CA 1OTAA 2PYPA 2OAQ1 4L0LA 1N9OA 2P7JA 4LRXC 5HPIA 3JVUA 3EQVA 4IHQA 4ME4A 3VOLA 1UWNX 2LB5A 1ZTUA 1OTDA 2W3GA 2O9BA 3CAXA 1S1ZA 4FOFA 2XRNA 2H28A 3LR3A 4EQ1A 4F3LA 3OC2A 5CX7A 5C5KA 2J3WA 3A0SA 2W27A 5I5LA 2PHYA 3D3OA 3B47A 3VV4A 4IUKA 3OLOA 4YOFA 2VV6A 5DJUA 3KSIA 2V0UA 3TJZC 2JN7A 1H3QA 3TE8A 3K3DA 4LLOB 3VE4A 3R7WB 2XSSA 3UMEA 3FC7A 4R3AA 2J3TD 4BWIA 2KLIA 2WKQA 2JKRM 4Q0HA 2INWA 4NXFA 1S67L 4FSFA 3OOVA 2XA7M 3PBRA 2OWJA 3E4QA 2W0NA 1GSXA 2O99A 3U2AA 4ARZB 5IT5A 3JVVA 3KSFA 1P9WA 5FL3A 3LI8A 4WL9A 4XT2B 2VZWA 3KSHA 3GECA 3GDIA 2B02A 5TJJA 4YNRA 3LYXA 1LSWA 1G6OA 2A24B 5HWVA 4EUVA 3TW8A 3S7NA 3LICA 4EERA 5AJGA 3CLOA 1TD5A 2PT7A 2YKFA 4IJGA 1LT0A 1YKDA 2PR6A 1XFNA 4K08A 3MJQA 2QJ7A 2QKPA 4I3IA 4I3JA 1P0ZA 3BQAA 3LIDA 4B9OA 4AFIA 2V1BA 5DFYA 4DJ2A 5G4ZA 4R70A 4I38A 2QYBA 3LR5A 5DF9A 2XA7S 3P01A 3NOPC 4CLCE 3EEAA 4HI4A 2B18A 3E4OA 4R6LA 4HQAA 4OOLA 4PKYG 2DMWA 2V9AA 3E0YA 3MMHA 2VV8A 3T50A 5HD5A 4Q0IA 3IS2B 1MZUA 4CLCD 4HJ3A 1H8MA 2W3EA 1YSPA 2A2LA 1N9LA 3BY8A 3UE3A 4EEUA 1BYWA 4JGOA 4O0PA 5F69A 2L0WA 2L4RA 3NJAA 3EQUA 4MCWA 3PBQA 4WLAA 4NXEA 4GS9B 3BW6A 2ZBBA 3BY9A 4P6ZS 1XJ3A 2W3FA 3LFVA 4F3LB 4MN6A 3NOTC 5DKKA 3MXQA 5F6AA 3UB6A 3DBAA 1NLYA 2QWSA 2YKHA 2GX5A 4CLCC 2K7SA 3KYZA 3PXPA 4NEED 2K2NA 3IBRA 3EGXC 1EW0A 1ODVA 1OT6A 3UB7A 2D01A 1W63M 2R78A 3S7OA 3PBTA 2Z6DA 1GSVA 4HIAA 4GHIA 4M4XA 5J4EA 3F1PA 3TRCA 3KYQA 3LIEA 4EW7A 5K5BA 1T18A 1T1AA 2BASA 4CQHA 2M7UA 3FG8A 3C8CA 3RTYA 4WF0A 2KX6A 4CLCA 2JKRI 3PYPA 1S66L 1D06A 2PR5A 1NRJA 5HDSA 4WEKA 4GHIB 3PBSA 4I5SA 4EETB 5F5YA 3OCLA 4WUJA 3SW1A 4EEPA 4HP9A 4MMNA 4UQIS 3T4SA 3ZYTA 1V9YA 4EU0A 1WA9A 5HWTA 3T4JA 3MF0A 4GCZA 4CLCB 2KOIA 5TBMB 5HWWA 1OPXA 3PR6A 4O8GA 2M1CA 4P6ZM 2VKSA 4BMWA 1UWPX 3MFXA 4LPZA 4YWZA 4BBTA 4GLQA 1LL8A 2Z6CA 3T4LA 1TS0A 4DJ3A 4G3KA 2PD8A 4E04A 2FZ0A 2XROA 4JGRA 4O01A 1S4SA 4H6JB 3E4PA 1JNUA 2Y8HA 5EFWA 2WKPA 3IBJA 4GJ4A 3G6OA 2NUTC 3ULFA 3T4OA 4I3AA 2W3DA 5DJTA 2KDKA 3LR4A 2JKTI 3CI6A 2PYRA 3BWLA 4MN7A 3UB8A 3S7QA 3C2WA 4HH3A 3HJKA 1STZA 3MQ0A 3H7WB 4XT2A 3T4TA 1IFQA 4UEYA 1TS6A 2J80A 4I39A 1VHMA 1XJ6A 1P97A 4IUHA 5G4YA 3F1NA 4HJ6A 2L1MA 2VEAA 3F1OA 4RQ9A 2I9VA 5A8BA 1TF1A 1T19A 2HV1A 3BQ8A 2VJWA 5KSHA 2WKRA 2O0YA 3R4KA 4HP4A 3H9WA 2O9AA 3UB9A 5MC7A 4HY8A 3KX0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UE6 A;  1XJ4 A;  2INW A;  2D01 A;  4NXF A;  3UB7 A;  1S67 L;  2R78 A;  2OOL A;  2Z6D A;  4L9G A;  2OWH A;  1GSV A;  4HIA A;  3P7N A;  4GHI A;  4M4X A;  4MN5 A;  4PKY A;  5J4E A;  2A24 A;  2OWJ A;  3F1P A;  4GW9 A;  1OTB A;  3E4Q A;  2D02 A;  3LIE A;  1LSX A;  2W0N A;  3H82 B;  1GSX A;  1T18 A;  2V1A A;  1T1A A;  4JGQ A;  4KUO A;  2BAS A;  5AVF A;  5KIZ A;  2QHK A;  1G28 A;  3D72 A;  3LIF A;  4H6J A;  1OJG A;  3LI8 A;  4WL9 A;  2QJ5 A;  1T1B A;  4XT2 B;  3FG8 A;  1OT9 A;  3C8C A;  4HJ4 A;  3RTY A;  4WF0 A;  3CWF A;  3GDI A;  2GJ3 A;  2B02 A;  3GEC A;  2JHE A;  2KX6 A;  5J3W A;  3PYP A;  3LYX A;  1S66 L;  5DKL A;  1LSW A;  2A24 B;  5HWV A;  5DKK A;  1D06 A;  3ZQ5 A;  2PR5 A;  4HHD A;  5AVE A;  4GS9 A;  5HDS A;  1DP6 A;  3LIC A;  4JGP A;  4EER A;  4EES A;  3CLO A;  1F9I A;  3A0V A;  1OTE A;  1S4R A;  2YKF A;  1N9N A;  4WN5 A;  4GHI B;  2PDR A;  3LIB A;  1LT0 A;  1DP9 A;  4I5S A;  2VV7 A;  4L9F A;  4EET B;  5F5Y A;  5I5L A;  2PR6 A;  4WUJ A;  3SW1 A;  1KOU A;  3H82 A;  4HNB A;  4EEP A;  1XFN A;  4L9E A;  2CMN A;  4HP9 A;  4K08 A;  2EA9 A;  4HOI A;  3F1O B;  4BBU A;  3NHQ A;  3MJQ A;  2QJ7 A;  1V9Y A;  5HDC A;  5IS1 A;  2QKP A;  1GSW A;  1WA9 A;  3MR0 A;  4I3I A;  3LIA A;  1DP8 A;  4I3J A;  5HWT A;  3H7W A;  4R38 A;  1P0Z A;  4EW7 A;  3LID A;  4LRY C;  2V0W A;  5HZH A;  5HD3 A;  4B9O A;  2V1B A;  1XFQ A;  3VE3 A;  4DJ2 A;  1TS8 A;  4GCZ A;  4LRZ E;  1LSV A;  1T1C A;  5G4Z A;  4NXB A;  5TBM B;  4R70 A;  3ICY A;  5HWW A;  4I38 A;  2M1C A;  5HD5 A;  1OJ5 A;  3EWK A;  3IS2 A;  3NOU C;  1V9Z A;  4KQD A;  3K3C A;  1OTA A;  2PYP A;  1UWP X;  3F1N B;  3LI9 A;  3MFX A;  4LPZ A;  5HDD A;  4YWZ A;  4BBV A;  4BBT A;  5J7E A;  1LL8 A;  1N9O A;  3UB6 A;  2P7J A;  4LRX C;  3NOP C;  3F1P B;  1NWZ A;  3PHY A;  2Z6C A;  1TS0 A;  4HI4 A;  4DJ3 A;  3E4O A;  4R6L A;  3VOL A;  2PD8 A;  4HQA A;  4PKY G;  3UMD A;  4JGR A;  4E04 A;  1S4S A;  4H6J B;  2V9A A;  1UWN X;  3E4P A;  3T50 A;  2VV8 A;  1JNU A;  5EFW A;  1OTD A;  2WKP A;  3IS2 B;  3MQO A;  1MZU A;  4NXG A;  3G6O A;  3CAX A;  2VLG A;  3ULF A;  3EEH A;  1S1Z A;  4I3A A;  4HJ3 A;  5HSQ A;  1X0O A;  2H28 A;  5IU1 A;  1S1Y A;  5DJT A;  2KDK A;  1N9L A;  4EQ1 A;  3BY8 A;  4F3L A;  1DRM A;  4KUK A;  4EEU A;  1BYW A;  1Y28 A;  2PYR A;  3A0S A;  3BWL A;  4JGO A;  1VB6 A;  2W27 A;  1D7E A;  5F69 A;  3UB8 A;  2L0W A;  2L4R A;  2ZOI A;  3NJA A;  1F98 A;  2PHY A;  3C2W A;  4HH3 A;  3HJK A;  4WLA A;  4XT2 A;  3H7W B;  4NXE A;  4GS9 B;  2PD7 A;  4EXO A;  3OLO A;  2VV6 A;  3LUQ A;  1XJ2 A;  2ZBB A;  3BY9 A;  5DJU A;  2V0U A;  1TS6 A;  3HJI A;  2J80 A;  3MQQ A;  1XJ3 A;  2JN7 A;  4I39 A;  5F68 A;  3K3D A;  4F3L B;  4MN6 A;  1XJ6 A;  4LLO B;  3NOT C;  3VE4 A;  1P97 A;  5G4Y A;  3F1N A;  4HJ6 A;  2L1M A;  2VEA A;  3F1O A;  1TS7 A;  3MXQ A;  1OTI A;  2I9V A;  3B33 A;  4HH2 A;  4RQ9 A;  5F6A A;  2QWS A;  3FC7 A;  3UME A;  5A8B A;  1T19 A;  2HV1 A;  3A0R A;  3RH8 B;  2YKH A;  4R3A A;  5TBM A;  2WKR A;  2K7S A;  1UGU A;  4HP4 A;  2ZOH A;  3H9W A;  3UB9 A;  3IBR A;  4HY8 A;  3KX0 X;  1EW0 A;  1ODV A;  2WKQ A;  1OT6 A; 
#chains in the Genus database with same CATH topology
 2PU4 A;  4PAU A;  4L9G A;  2EXB A;  4GOG A;  4PKY A;  1MXO A;  2V1A A;  3TG9 A;  5CED A;  1OT9 A;  3D9Y A;  5FEG A;  4UQI M;  2GNX A;  3V67 A;  1ES3 A;  2VA0 A;  1XP4 A;  1KE4 A;  4RVA A;  5AVE A;  1BUL A;  1MKM A;  2Q9N A;  4KQO A;  4UHU A;  2B95 A;  5L2F A;  3FPW A;  2ZC6 B;  1YAX A;  4NKP A;  2ZMV A;  3MR0 A;  3ZCZ A;  4KZ8 A;  5HD3 A;  3V5M A;  3M6H A;  1TS8 A;  2W3H A;  2Y2Q A;  1NY0 A;  2X01 A;  4PPR A;  3LI9 A;  5J7E A;  3BJN A;  2DRW A;  4Q0J A;  3UO9 A;  3IX3 A;  5HSQ A;  4DDY A;  1X0O A;  4KG6 A;  4Y5F A;  4JXV A;  1VB6 A;  4WEJ A;  1DJB A;  2ZQD A;  5M18 A;  1P9R A;  3OPH A;  2JBF A;  1H8Z A;  3IT9 A;  5EOE A;  3T12 B;  4X69 A;  3SS5 A;  4Y13 A;  4QJG A;  3B33 A;  1SKF A;  1UGU A;  1PZO A;  3IXG A;  3Q7Z A;  2Y79 A;  2XLN A;  3UE6 A;  1XJ4 A;  4BJP A;  5CXW A;  2J3T C;  4KUO A;  1WE4 A;  3D72 A;  4H6J A;  3CPT B;  4N1X A;  4HJ4 A;  3CG5 A;  4JBF A;  2FH5 A;  4L9F A;  1DP9 A;  1VEU A;  2VV7 A;  3DTM A;  4HNB A;  4HOI A;  3UY6 A;  3G30 A;  4GNU A;  3T1Q B;  3LIA A;  1K6R A;  3FZC A;  3VFF A;  1K56 D;  1W63 Q;  2IWB A;  3SZT A;  4NXB A;  3S22 A;  4QPR A;  1OJ5 A;  3G2Y A;  4N1H A;  2PYP A;  2RL3 A;  4GN2 A;  4ID4 A;  3MZF A;  1N9O A;  4LRX C;  5HPI A;  4K91 A;  3ZG0 A;  4IHQ A;  3GQZ A;  3SS3 A;  2V8C A;  2W3G A;  3NC8 A;  3M2J A;  2Y2H A;  3CAX A;  1SCW A;  2EXA A;  2XRN A;  2X02 A;  5FQJ A;  2H0T A;  1HD8 A;  5C5K A;  3IF6 B;  2W27 A;  5I5L A;  2PHY A;  3HLD A;  3OLO A;  4YOF A;  4R3J A;  3VSK A;  5DJU A;  4OQ0 A;  3UDF A;  3NDG A;  3K3D A;  3BFE A;  4LLO B;  1H8Y A;  5EVI B;  4RA7 A;  2XSS A;  2ZC5 B;  4R3A A;  4S2P A;  4BWI A;  2WKQ A;  4NXF A;  1IYO A;  4EV4 A;  2Y2K A;  2W0N A;  2JKG A;  4MEZ A;  2O99 A;  3U2A A;  2ZL1 B;  3JVV A;  5FQQ A;  5FL3 A;  2XF3 A;  4Y0T A;  3KSH A;  4PM8 A;  4B4X A;  4YNR A;  3LYX A;  4WZ4 A;  3Q81 A;  1LSW A;  2A24 B;  3T1R A;  1CK3 A;  3LIC A;  3CLO A;  3A3I A;  4E3M A;  2PT7 A;  2PBY A;  2YKF A;  1YKD A;  1XFN A;  1ESI A;  4R0Q A;  4K0W A;  1H0M A;  3BQA A;  1M6K A;  3G31 A;  4AFI A;  4PM6 A;  5DFY A;  4GZB A;  1YLW A;  2QYB A;  2XQZ A;  1GA0 A;  4RX2 A;  4X55 A;  5U47 A;  1W8Q A;  4KZ9 A;  4R6L A;  2HDR A;  2B5R A;  2DMW A;  3QP8 A;  3C7V A;  1K56 A;  5GLD A;  3MMH A;  1K25 A;  4Q0I A;  3IS2 B;  1MZU A;  4B88 A;  4CLC D;  3HLF A;  4PM5 A;  4KEN B;  5DTT A;  4JF6 A;  3BY8 A;  2HP9 A;  3I7J A;  1IEL A;  3G2Z A;  3EQU A;  3PBQ A;  4NXE A;  3C4O A;  1E3U A;  3BW6 A;  1AXB A;  2ZMA A;  4P6Z S;  2J7V A;  5EM1 A;  4F3L B;  4FCF A;  1ZC2 A;  5F6A A;  1LI0 A;  3UB6 A;  1NLY A;  5AQB A;  4NET A;  1KVL A;  1FIL A;  3HLE A;  3NIA A;  2K7S A;  3PXP A;  3IXB A;  3CMZ A;  1E4D A;  3DW0 A;  1KE3 A;  1OT6 A;  3ITA A;  2VGJ A;  3UB7 A;  2JKF A;  2R78 A;  1SHV A;  3S7O A;  2Z6D A;  2R9X A;  4HBU A;  4GHI A;  3V50 A;  3F1P A;  1FCM A;  3KYQ A;  3WS1 A;  2ZQ8 A;  2ZC4 B;  1NYY A;  3C8C A;  4X25 A;  4CLC A;  3PAE A;  1SDN A;  1FR1 A;  3LEZ A;  4E3N A;  2J8Y A;  4ZTK A;  3WS2 A;  3OPR A;  3VP1 A;  1Z09 A;  3P98 A;  3PBS A;  4I5S A;  4WUJ A;  1G6A A;  4EEP A;  5I94 A;  4HP9 A;  4MMN A;  1TDG A;  5FSR A;  2J9P A;  1IYP A;  3SH8 A;  4CLC B;  2KOI A;  5FEF A;  5HWW A;  2M1C A;  2OLV A;  3T1S A;  4LPZ A;  4GLQ A;  4R4R A;  2DNS A;  2IWD A;  2Z6C A;  3LCE A;  1YMX A;  2J9O A;  2Z2L B;  1SZV A;  3ZVT A;  4JXG A;  3MZD A;  3IBJ A;  4GJ4 A;  3G6O A;  3DTE A;  3ULF A;  1LL5 A;  4MNR A;  2Y2L A;  1GHI A;  1XA1 A;  3LR4 A;  4GD8 A;  5CEC A;  2JKT I;  1K0K A;  2PYR A;  2C6W B;  2HDS A;  3AGE A;  2PBD P;  3S7Q A;  3SOI A;  5FAT A;  1K4F A;  5DF8 A;  4K0X A;  2J80 A;  1N4O A;  4IUH A;  4S2K A;  4HJ6 A;  1T19 A;  2HV1 A;  4HBT A;  2O0Y A;  3H9W A;  2I72 A;  4HY8 A;  3CPT A;  1CJF A;  2Y2I A;  4KQQ A;  2E8J A;  4FH4 A;  3UPP A;  1L0F A;  3P7N A;  5LBR A;  4JGQ A;  2P08 A;  1G28 A;  1OJG A;  4QD4 A;  3C4P A;  1ZG4 A;  3HCY A;  1ES4 A;  1T1B A;  3CWF A;  2GJ3 A;  5FI2 A;  5L07 A;  3GTC A;  4OPZ A;  2ZL1 A;  1Q2Q A;  1F9I A;  1O07 A;  1ACF A;  3ITB A;  1DJC A;  1RGY A;  1KOU A;  4L9E A;  3PBN A;  4PM7 A;  1SKO A;  2Y55 A;  5HPF A;  3G34 A;  2W1R A;  3ICY A;  1ONH A;  3HUO A;  3EWK A;  5FQK A;  3T4Q A;  3FV7 A;  5KZH A;  3F1N B;  5HDD A;  3RJU A;  4QY6 A;  2V1Z A;  2WZX A;  4OKP A;  4UA9 A;  3F1P B;  3PHY A;  5AQ7 A;  3IQA A;  3IX8 A;  1W7F A;  4IED A;  4ARZ A;  4EXO A;  4NXG A;  4JLF A;  3R7W A;  3EEH A;  3UPN A;  1S1Y A;  3IXD A;  5EVI A;  5CEB A;  1S0W A;  1Y28 A;  2EWW A;  4Q8I A;  4WYY A;  4C3Q A;  2ZOI A;  1CI9 A;  1YM1 A;  1K57 A;  4JXS A;  3T4K A;  4R1G A;  1XJ2 A;  4OH0 A;  3HJI A;  3LO7 A;  5F68 A;  4DN0 A;  2QZ6 A;  4U0T A;  1OTI A;  5JYP A;  3HL9 A;  3A0R A;  4Z1W A;  3EGD C;  3CHW P;  2JKT M;  5E2H A;  2ZOH A;  1ERM A;  1BLP A;  3MXR A;  1FOF A;  2M7V A;  2VGL S;  1LHY A;  2A24 A;  1OTB A;  1LSX A;  3N8S A;  1K55 C;  2ZMF A;  2V20 A;  2VK3 A;  4WEL A;  4D60 A;  4OP8 A;  5A90 A;  3VOY A;  5EVI C;  3DAV A;  4NG2 A;  4LEN A;  2P9V B;  3EOI A;  3W4Q A;  3ZGA B;  5FAP A;  3BFD A;  2IA2 A;  3LR0 A;  3QP2 A;  5FAO A;  3F1O B;  3FKV A;  2UWX A;  3O3V A;  1GSW A;  4PMA A;  5E2F A;  5F1G A;  1JTG A;  3A3F A;  3VE3 A;  3W2Z A;  4LRZ E;  4II7 A;  4E6W A;  1V9Z A;  1OTA A;  2R9W A;  1XGI A;  2OAQ 1;  3JVU A;  1H5X A;  4ME4 A;  4MLL A;  3ZNT A;  1MPL A;  4E6X A;  1PRQ A;  1UWN X;  2LB5 A;  1ZTU A;  3UDI A;  2OV5 A;  1Y4O A;  4FOF A;  3L9K A;  3NEC A;  2QPN A;  4F3L A;  1MKI A;  1NXY A;  4XUX A;  5GL9 A;  3D3O A;  5CHU A;  2XD1 A;  1K54 C;  4IUK A;  2WAF A;  3JPU A;  2V0U A;  4WBG A;  2P74 A;  1TVF A;  2JN7 A;  4KZ4 A;  3QP6 A;  3VE4 A;  1DJA A;  5E2E A;  3FC7 A;  1FQG A;  4S2J A;  3NBL A;  3N8L A;  3BLM A;  1K38 A;  2KLI A;  5A93 A;  2JKR M;  1KVM A;  4GD6 A;  4X53 A;  1PWG A;  3WWX A;  2ZLY A;  3WS0 A;  4ARZ B;  5CHJ A;  1P9W A;  3LI8 A;  2WZZ A;  4OPR A;  3MS6 A;  2X71 A;  5J8X A;  2Y2O A;  1U60 A;  4CJN A;  1L0E A;  4EUV A;  4N9L A;  4F94 A;  3S7N A;  4EER A;  5AJG A;  1RCJ A;  1TD5 A;  3OPL A;  4IJG A;  1W5D A;  2PR6 A;  4IBX A;  4LCL A;  4KZ3 A;  3LID A;  4Y0O A;  3IWI A;  4B9O A;  3LR5 A;  5DF7 A;  5TR7 A;  4EBN A;  1XA7 A;  3V3R A;  2ZQC A;  2XFS A;  4CLC E;  1VEU B;  1L0D A;  4HI4 A;  2B18 A;  4HQA A;  5F1F A;  1Z6F A;  1CQA A;  4ZDX A;  3E0Y A;  3T50 A;  4YIN A;  2HPB A;  1YSP A;  3BFC A;  3GR2 A;  4S2I A;  4O0P A;  5F69 A;  4MCW A;  1PW1 A;  1TDL A;  3BLS A;  1KGF A;  4Y17 A;  5FA7 A;  1XJ3 A;  2W3F A;  2OLU A;  5EVL A;  1ES2 A;  2ZC7 A;  3G32 A;  2QWS A;  3PAG A;  2GX5 A;  5CTM A;  4NEE D;  3IF6 A;  3FYZ A;  1ODV A;  1XX2 A;  2D01 A;  1W63 M;  3PBT A;  4OOY A;  3HBR A;  5J4E A;  3O86 A;  4HEF A;  3MZE A;  4OP5 A;  1T18 A;  4KG2 A;  4C75 A;  3O88 A;  2EFX A;  2M7U A;  2XDM A;  4WF0 A;  2WKH A;  3MKF A;  2WUQ A;  2KX6 A;  2JKR I;  1S66 L;  3WRT A;  5FAQ A;  3ZDJ A;  3A3D A;  1SKO B;  1D06 A;  1NRJ A;  3KYE A;  4WEK A;  4KZ5 A;  1NRF A;  3V3S A;  2HDQ A;  3T4J A;  4LFU A;  5TBM B;  1OPX A;  3PR6 A;  2VKS A;  1JWP A;  3LGO A;  3AGF A;  4YWZ A;  2XEP A;  5GLA A;  4H6J B;  2WGV A;  3E4P A;  1JNU A;  2WKP A;  3A3J A;  2NUT C;  4MBH A;  5FQM A;  1JVJ A;  3CI6 A;  3BWL A;  4MN7 A;  3UB8 A;  3Q1F A;  4HH3 A;  3MQ0 A;  3FWL A;  3WRZ A;  3LY3 A;  1TS6 A;  4QHC A;  5AQA A;  1BLS A;  1P97 A;  1PI4 A;  3F1N A;  2L1M A;  2VEA A;  1YLT A;  2ZC3 B;  2I9V A;  1YLY A;  1TF1 A;  5HAI A;  2VJW A;  3LEQ A;  4BEN A;  3L7H A;  3UB9 A;  5MC7 A;  2XK1 A;  3KO6 A;  4G3V A;  2ZQ9 A;  3T1X A;  2W1T B;  4WM9 A;  5L09 A;  4MN5 A;  5CER A;  3H82 B;  2PRF A;  2BLS A;  3E2L A;  2OAP 1;  3S7P A;  1MC0 A;  1VQQ A;  1JWZ A;  2WK0 A;  4HES A;  3NCK A;  2Z2M B;  3SH9 A;  4DF6 A;  1OTE A;  1N9N A;  1J3W A;  2PDR A;  4C6Y A;  4X56 A;  3CUE C;  4IBR A;  4BBU A;  5M1A A;  1YSQ A;  1ZG6 A;  5A91 A;  5IS1 A;  3H7W A;  1XFQ A;  3OZH A;  1LSV A;  2Y2G A;  1C3B A;  1RGZ A;  5HL6 A;  3RFB A;  1NWZ A;  1KE0 A;  3UMD A;  4DE3 A;  3QHY A;  5IU1 A;  2CC1 A;  4WMC A;  1DRM A;  3P09 A;  4DE0 A;  4KUK A;  4QB8 A;  4OON A;  4E3O A;  1D7E A;  4FTX A;  1PIO A;  2ZM0 A;  4O7D A;  3VP2 A;  2HF6 A;  2HJE A;  3LUQ A;  3ZFZ A;  4DXB A;  4LCM A;  5EPH A;  3D4F A;  2JE5 A;  4DE2 A;  1IKI A;  2IWC A;  4HH2 A;  3RXW A;  1TS7 A;  1L2S A;  3RH8 B;  5TBM A;  3CIT A;  1PZP A;  5TGF A;  1BUE A;  1HZO A;  2G2W A;  2RCX A;  4E3L A;  4HHD A;  4KG5 A;  3MSH A;  4GW9 A;  2D02 A;  4BL3 A;  2HP5 A;  5E43 A;  2BTF P;  4M3K A;  4KZ7 A;  1OME A;  2EWV A;  2Y91 A;  5DKL A;  4S2M A;  2ZQ7 A;  4UA6 A;  4GS9 A;  4EES A;  3BFG A;  3O5Y A;  1S4R A;  4WN5 A;  2ZM8 A;  1L3L A;  4PM9 A;  2CMN A;  1NLZ A;  2Y2M A;  1LLB A;  1PI5 A;  4FUW A;  5A92 A;  2K31 A;  5CGS A;  1T1C A;  3S1Y A;  4B93 A;  3VSL A;  4WZ5 C;  3A3E A;  3NOU C;  4KQD A;  2FFF B;  2ZM2 A;  4L0L A;  1G5U A;  2P7J A;  3CJM A;  1SDE A;  3W4O A;  1NZU A;  1OTD A;  1E3U D;  4B4Z A;  2H28 A;  4BQM A;  4EQ1 A;  3OC2 A;  5CX7 A;  1O7E A;  3DWZ A;  1I5Q A;  2HP6 A;  3VV4 A;  2VV6 A;  4LV1 A;  5HW3 A;  3KSI A;  3TJZ C;  2A3U A;  3JYI A;  1ERQ A;  4LV0 A;  4JF5 A;  3R7W B;  1K54 A;  4WMC D;  3TSG A;  4JXW A;  4QY5 A;  4S2L A;  4WZ5 A;  3W4P A;  4Q0H A;  3QP1 A;  5FAS A;  1RP5 A;  2INW A;  4FSF A;  3ISG A;  1XXM A;  5FQ9 A;  2XA7 M;  3PBR A;  1YLZ A;  4NK3 A;  2EFU A;  1GSX A;  3U4L P;  3ZVW A;  5FI7 A;  4A5R A;  1E25 A;  1ONG A;  3GDI A;  2B02 A;  1PW8 A;  2WAD A;  1G6O A;  3BM6 A;  5HWV A;  1MWU A;  3HUN A;  1G68 A;  3TW8 A;  1I2W A;  3HRE A;  4P85 A;  3IH8 A;  4EBL A;  1NJ4 A;  1N9B A;  4I3J A;  5EVI D;  1MWR A;  4DJ2 A;  5JYO A;  5D3O A;  3ZG9 B;  1IEM A;  1XKZ A;  5DF9 A;  2XA7 S;  1F2K A;  1GA9 A;  3DWK A;  1MWS A;  3GV9 A;  4S2N A;  2Y2P A;  4RYE A;  3E4O A;  4IVK A;  2H0Y A;  5IHV A;  4BD0 A;  2VV8 A;  5HD5 A;  4JPM A;  4HJ3 A;  2XR0 A;  3BRM A;  5GLB A;  2W3E A;  3FKW A;  2A2L A;  1N9L A;  3UE3 A;  1MBL A;  4IVI A;  1EWZ A;  2L0W A;  2L4R A;  2XH9 A;  3MKE A;  4GS9 B;  2ZBB A;  3BY9 A;  1YMS A;  4KZ6 A;  3IX4 A;  3GMW A;  4BD1 A;  1PWC A;  5DKK A;  3DBA A;  2AVX A;  4ZAM A;  4ZBE A;  5L10 A;  3WS4 A;  4CLC C;  2K2N A;  3VP3 A;  1XPB A;  4CPK A;  1EW0 A;  2XFT A;  3EGX C;  2ACG A;  1S6R A;  5EUA A;  1GSV A;  4MBK A;  4HIA A;  4M4X A;  1CEG A;  3IF6 C;  3G4P A;  2JCH A;  2BAS A;  4R3B A;  3Q7V B;  3UN7 A;  3RTY A;  3LY4 A;  5GLC A;  4R23 A;  3M2K A;  1BZA A;  2PR5 A;  5HDS A;  5FQI A;  4UAA A;  3MBZ A;  4GHI B;  2PAV P;  4EET B;  4YFM A;  5F5Y A;  3OCL A;  4OLG A;  3SW1 A;  2BG1 A;  2WAE A;  4UQI S;  3T4S A;  3ZYT A;  4U0X A;  4DXC A;  1V9Y A;  4EU0 A;  1NYM A;  1WA9 A;  5DVA A;  3MF0 A;  1XGJ A;  4O8G A;  3UNW A;  2V8F A;  3E2K A;  3MFX A;  4OVD A;  4BBT A;  1LL8 A;  3IF5 A;  3VP0 A;  2H5S A;  1TS0 A;  4DJ3 A;  4G3K A;  4XXR A;  4XUZ A;  2XRO A;  4JGR A;  3MXS A;  3UB5 P;  3NDE A;  1KDW A;  1NZO A;  1W8Y A;  3C7U A;  1FCN A;  3T4O A;  2W3D A;  5AQ9 A;  1KDS A;  2KDK A;  3N8R A;  1HVB A;  2WGW B;  4UA7 A;  3N7W A;  1IYQ A;  1BLH A;  1STZ A;  3HJK A;  3H7W B;  3DTI A;  4EBP A;  1IFQ A;  4DE1 A;  4UEY A;  1VHM A;  1XJ6 A;  5G4Y A;  4DKI A;  3F1O A;  4RQ9 A;  1VET B;  2EX8 A;  5A8B A;  5F82 A;  3BQ8 A;  1ERO A;  1EI5 A;  1FSY A;  2G2U A;  2PU2 A;  3R4K A;  4HP4 A;  1YLP A;  3B3X A;  4MBF A;  3QNC A;  1PWD A;  3KX0 X;  3PTE A;  1JWV A;  4ESP A;  2Y4A A;  2Y2N A;  3K2N A;  4Y0U A;  4Z9Q A;  2VGL M;  1CI8 A;  4OQH A;  4Y3I A;  4R4S A;  5FI6 A;  4OPY A;  5L8M A;  5KIZ A;  2QHK A;  3IHA A;  2QJ5 A;  3SH7 A;  4P0M A;  3RXX A;  3G35 A;  5J3W A;  1K4E A;  2GZA A;  3OCN A;  1DP6 A;  3PBO A;  4JGP A;  4LGW A;  4E3J A;  1J9M A;  2MJ6 A;  3VP4 A;  1F5M A;  2EA9 A;  3NHQ A;  5KSC A;  3HLC A;  1DP8 A;  4R38 A;  2V0W A;  1WYB A;  5EVE A;  3CUE A;  2QMI A;  3OBF A;  1KGG A;  3DTK A;  4BBV A;  4E3K A;  4U3T A;  3ZNY A;  3ZG7 B;  3HLG A;  2HJ9 C;  2EX9 A;  3IH9 A;  1CF0 A;  3MQO A;  3QP5 A;  2VLG A;  2W1T A;  3VMA A;  4G3W A;  2E8I A;  1QME A;  2DCF A;  3UE0 A;  2VX8 A;  3C5A A;  3KSG A;  5DFX A;  1F98 A;  1GCE A;  2O9C A;  2PD7 A;  3C38 A;  4E3I A;  1ES5 A;  4DMZ A;  1ZHH B;  3MQQ A;  5KMW A;  3C30 A;  2NUP C;  3B42 A;  5DTS A;  1VM1 A;  4OQI A;  5HAR A;  2H10 A;  3GSG A;  4OOM A;  2G7U A;  1BTL A;  4X1L A;  4MDZ A;  3E98 A;  5DTK A;  3OPP A;  4ZRR A;  2OOL A;  1K57 C;  1FIK A;  2OWH A;  3FPV A;  1YQS A;  3IWO A;  5AVF A;  4ZJ1 A;  3LIF A;  4FH2 A;  4ZJ3 A;  2P04 A;  5CHM A;  1WYC A;  1K6S A;  4Y2F A;  2JHE A;  1FSW A;  3VOZ A;  5M19 A;  1CEF A;  3ZQ5 A;  1FR6 A;  4KQR A;  4P87 A;  1IOU A;  4GB7 A;  4ETZ A;  1BT5 A;  3A0V A;  3HUM A;  4EQI A;  5HX9 A;  2LB9 A;  3LIB A;  3H82 A;  4ETX A;  1K55 A;  5HDC A;  3S4X A;  5FDS A;  5HZH A;  3BFF A;  4LRY C;  2HGV A;  5CGX A;  3O87 A;  5GHY A;  3IS2 A;  4PHT A;  3K3C A;  3M6B A;  4EUZ A;  5CGW A;  3BEC A;  2EX6 A;  3EQV A;  5HAP A;  2WKE A;  3VOL A;  1Y54 A;  2O9B A;  2WGI A;  1HLU P;  1S1Z A;  1TEM A;  3LR3 A;  1ESU A;  4S2N C;  4D2O A;  2J3W A;  3A0S A;  3B47 A;  2A49 A;  1YT4 A;  1JTD A;  3HLW A;  2Y2J A;  4FD8 A;  1H3Q A;  3TE8 A;  5EV0 A;  3HLB A;  3UME A;  1IKG A;  4P6B A;  2J3T D;  1BSG A;  2V2F F;  3Q7V A;  5HFO A;  3ZG8 B;  1GHP A;  4ZJ2 A;  1S67 L;  4GKU A;  1AWI A;  3OOV A;  2OWJ A;  3E4Q A;  5IT5 A;  2Q0O A;  3KSF A;  5BOH A;  3W8K A;  2GDN A;  4WL9 A;  4XT2 B;  2VZW A;  1L0G A;  3NY4 A;  3BEB A;  3GEC A;  2UV0 E;  5TJJ A;  4BLM A;  1MY8 A;  1FCO A;  4BL2 A;  2ZJ9 A;  3GVB A;  1D1J A;  4LV2 A;  3UE1 A;  1LT0 A;  4X1M A;  3BYD A;  4K08 A;  3MJQ A;  2QJ7 A;  1LI9 A;  2QKP A;  4I3I A;  1P0Z A;  2V1B A;  5G4Z A;  4R70 A;  4I38 A;  2WGW A;  3NI9 A;  4LV3 A;  5EE8 A;  1YPR A;  4JKT A;  5F83 A;  3P01 A;  2XD5 A;  2WKI A;  1HTZ A;  3NOP C;  4OPQ A;  3EEA A;  1A0K A;  1I2S A;  4OOL A;  4PKY G;  3IWQ A;  4DDS A;  3UPO A;  2V9A A;  3GRJ A;  3N6I A;  1LL9 A;  3VFH A;  1H8M A;  5EOO A;  2HZ5 A;  2Q9M A;  3IXH A;  5CRF A;  4EEU A;  1BYW A;  4H8R A;  4JGO A;  3QP4 A;  1VET A;  3NJA A;  4WLA A;  4QU3 A;  3ZHH A;  1BLC A;  1PFL A;  2WYX A;  3LFV A;  4MN6 A;  3NOT C;  3MXQ A;  3V39 A;  2P9V A;  3CZD A;  1ALQ A;  3NUL A;  2YKH A;  4S2O A;  3KYZ A;  2VGK A;  5HL1 A;  3IBR A;  5G18 A;  3Q82 A;  5TFQ A;  5EM0 A;  3IHB A;  5GHZ A;  5GHX A;  3ZG5 A;  3TRC A;  3LIE A;  4EW7 A;  4DRT A;  5K5B A;  1T1A A;  4GDN A;  3WS5 A;  4CQH A;  4OQG A;  2Y59 A;  2C5W B;  4EWF A;  3UDX A;  2HDU A;  3FG8 A;  2FFY A;  3PYP A;  4N9K A;  1YLJ A;  5EEC A;  1M40 A;  5FDH A;  2JC7 A;  4KZA A;  3MFD A;  3QNB A;  5HWT A;  5E2G A;  2ZD8 A;  4JF4 A;  4KZB A;  4GCZ A;  4GDB A;  1W79 A;  4Y7P A;  4P6Z M;  3SS4 A;  4BMW A;  1UWP X;  1MWT A;  1DY6 A;  1GHM A;  3T4L A;  3AGD A;  2PD8 A;  3N4I A;  2FZ0 A;  4QWO A;  4E04 A;  4O01 A;  1S4S A;  1QMF A;  1IYS A;  5CTN A;  2Y8H A;  5EFW A;  3HVF A;  4OLD A;  3TOI A;  3Q07 A;  1ZKJ A;  4I3A A;  4Y15 A;  5DJT A;  1KGE A;  4RX3 A;  4X68 A;  3C2W A;  4XT2 A;  3T4T A;  5HAQ A;  1Q2P A;  4N92 A;  4I39 A;  2XGN A;  1PNE A;  1PYY A;  4X6T A;  5KSH A;  2WKR A;  2ZQA A;  2EX2 A;  2O9A A;  2OSU A; 
#chains in the Genus database with same CATH homology
 3KO6 A;  3K2N A;  4G3V A;  4PAU A;  4L9G A;  2VGL M;  2W1T B;  3P7N A;  4Y3I A;  4MN5 A;  4PKY A;  5LBR A;  3H82 B;  4JGQ A;  2V1A A;  2P08 A;  2OAP 1;  5L8M A;  2QHK A;  1G28 A;  3S7P A;  5KIZ A;  1OJG A;  1MC0 A;  3HCY A;  2QJ5 A;  1T1B A;  1OT9 A;  4UQI M;  3CWF A;  2GJ3 A;  2GNX A;  5J3W A;  3V67 A;  2VA0 A;  2GZA A;  3OCN A;  5AVE A;  1DP6 A;  3PBO A;  4JGP A;  1MKM A;  1F9I A;  1OTE A;  4KQO A;  1N9N A;  2PDR A;  3FPW A;  3CUE C;  2MJ6 A;  1KOU A;  1YAX A;  4NKP A;  4L9E A;  1F5M A;  3PBN A;  2ZMV A;  2EA9 A;  4BBU A;  1YSQ A;  3NHQ A;  5IS1 A;  5HPF A;  3MR0 A;  1DP8 A;  3H7W A;  4R38 A;  2V0W A;  5HD3 A;  1XFQ A;  2W1R A;  1TS8 A;  2W3H A;  1LSV A;  3CUE A;  3ICY A;  3OBF A;  3EWK A;  3T4Q A;  3F1N B;  3LI9 A;  5HDD A;  4BBV A;  5J7E A;  3BJN A;  5HL6 A;  4Q0J A;  3F1P B;  3RFB A;  1NWZ A;  3PHY A;  2HJ9 C;  3UMD A;  4ARZ A;  4EXO A;  4NXG A;  5HSQ A;  3MQO A;  2VLG A;  3R7W A;  3EEH A;  2W1T A;  1X0O A;  4G3W A;  1S1Y A;  5IU1 A;  1DRM A;  2VX8 A;  4KUK A;  4Y5F A;  1Y28 A;  3KSG A;  1VB6 A;  2EWW A;  4WEJ A;  1D7E A;  5DFX A;  2ZOI A;  1F98 A;  1P9R A;  2HF6 A;  2O9C A;  2PD7 A;  3C38 A;  2HJE A;  3LUQ A;  3T4K A;  1XJ2 A;  4DMZ A;  1ZHH B;  3HJI A;  3MQQ A;  3C30 A;  2NUP C;  5F68 A;  3B42 A;  4DN0 A;  4HH2 A;  1TS7 A;  1OTI A;  3B33 A;  3A0R A;  4Z1W A;  3RH8 B;  4OOM A;  3EGD C;  5TBM A;  2JKT M;  3CIT A;  1UGU A;  2G7U A;  2ZOH A;  4MDZ A;  3E98 A;  2Y79 A;  4HHD A;  4ZRR A;  3UE6 A;  1XJ4 A;  4BJP A;  2OOL A;  2M7V A;  2VGL S;  2OWH A;  3FPV A;  2A24 A;  4GW9 A;  1OTB A;  2D02 A;  1LSX A;  2J3T C;  4KUO A;  2ZMF A;  5AVF A;  3LIF A;  3D72 A;  4H6J A;  2P04 A;  4WEL A;  4HJ4 A;  4Y2F A;  2JHE A;  2EWV A;  5DKL A;  3ZQ5 A;  2FH5 A;  4GS9 A;  1IOU A;  4ETZ A;  4EES A;  3A0V A;  3O5Y A;  3EOI A;  1S4R A;  4WN5 A;  2LB9 A;  3LIB A;  4L9F A;  1DP9 A;  2VV7 A;  3H82 A;  4HNB A;  4ETX A;  2IA2 A;  3LR0 A;  2CMN A;  1NLZ A;  4HOI A;  3F1O B;  5HDC A;  1GSW A;  3LIA A;  5HZH A;  4LRY C;  1W63 Q;  2HGV A;  3VE3 A;  2K31 A;  3W2Z A;  4LRZ E;  1T1C A;  4NXB A;  4B93 A;  4II7 A;  4QPR A;  1OJ5 A;  3IS2 A;  3NOU C;  4KQD A;  1V9Z A;  4PHT A;  3K3C A;  1OTA A;  2PYP A;  2OAQ 1;  4L0L A;  1N9O A;  2P7J A;  4LRX C;  5HPI A;  3JVU A;  3EQV A;  4IHQ A;  4ME4 A;  3VOL A;  1UWN X;  2LB5 A;  1ZTU A;  1OTD A;  2W3G A;  2O9B A;  3CAX A;  1S1Z A;  4FOF A;  2XRN A;  2H28 A;  3LR3 A;  4EQ1 A;  4F3L A;  3OC2 A;  5CX7 A;  5C5K A;  2J3W A;  3A0S A;  2W27 A;  5I5L A;  2PHY A;  3D3O A;  3B47 A;  3VV4 A;  4IUK A;  3OLO A;  4YOF A;  2VV6 A;  5DJU A;  3KSI A;  2V0U A;  3TJZ C;  2JN7 A;  1H3Q A;  3TE8 A;  3K3D A;  4LLO B;  3VE4 A;  3R7W B;  2XSS A;  3UME A;  3FC7 A;  4R3A A;  2J3T D;  4BWI A;  2KLI A;  2WKQ A;  2JKR M;  4Q0H A;  2INW A;  4NXF A;  1S67 L;  4FSF A;  3OOV A;  2XA7 M;  3PBR A;  2OWJ A;  3E4Q A;  2W0N A;  1GSX A;  2O99 A;  3U2A A;  4ARZ B;  5IT5 A;  3JVV A;  3KSF A;  1P9W A;  5FL3 A;  3LI8 A;  4WL9 A;  4XT2 B;  2VZW A;  3KSH A;  3GEC A;  3GDI A;  2B02 A;  5TJJ A;  4YNR A;  3LYX A;  1LSW A;  1G6O A;  2A24 B;  5HWV A;  4EUV A;  3TW8 A;  3S7N A;  3LIC A;  4EER A;  5AJG A;  3CLO A;  1TD5 A;  2PT7 A;  2YKF A;  4IJG A;  1LT0 A;  1YKD A;  2PR6 A;  1XFN A;  4K08 A;  3MJQ A;  2QJ7 A;  2QKP A;  4I3I A;  4I3J A;  1P0Z A;  3BQA A;  3LID A;  4B9O A;  4AFI A;  2V1B A;  5DFY A;  4DJ2 A;  5G4Z A;  4R70 A;  4I38 A;  2QYB A;  3LR5 A;  5DF9 A;  2XA7 S;  3P01 A;  3NOP C;  4CLC E;  3EEA A;  4HI4 A;  2B18 A;  3E4O A;  4R6L A;  4HQA A;  4OOL A;  4PKY G;  2DMW A;  2V9A A;  3E0Y A;  3MMH A;  2VV8 A;  3T50 A;  5HD5 A;  4Q0I A;  3IS2 B;  1MZU A;  4CLC D;  4HJ3 A;  1H8M A;  2W3E A;  1YSP A;  2A2L A;  1N9L A;  3BY8 A;  3UE3 A;  4EEU A;  1BYW A;  4JGO A;  4O0P A;  5F69 A;  2L0W A;  2L4R A;  3NJA A;  3EQU A;  4MCW A;  3PBQ A;  4WLA A;  4NXE A;  4GS9 B;  3BW6 A;  2ZBB A;  3BY9 A;  4P6Z S;  1XJ3 A;  2W3F A;  3LFV A;  4F3L B;  4MN6 A;  3NOT C;  5DKK A;  3MXQ A;  5F6A A;  3UB6 A;  3DBA A;  1NLY A;  2QWS A;  2YKH A;  2GX5 A;  4CLC C;  2K7S A;  3KYZ A;  3PXP A;  4NEE D;  2K2N A;  3IBR A;  3EGX C;  1EW0 A;  1ODV A;  1OT6 A;  3UB7 A;  2D01 A;  1W63 M;  2R78 A;  3S7O A;  3PBT A;  2Z6D A;  1GSV A;  4HIA A;  4GHI A;  4M4X A;  5J4E A;  3F1P A;  3TRC A;  3KYQ A;  3LIE A;  4EW7 A;  5K5B A;  1T18 A;  1T1A A;  2BAS A;  4CQH A;  2M7U A;  3FG8 A;  3C8C A;  3RTY A;  4WF0 A;  2KX6 A;  4CLC A;  2JKR I;  3PYP A;  1S66 L;  1D06 A;  2PR5 A;  1NRJ A;  5HDS A;  4WEK A;  4GHI B;  3PBS A;  4I5S A;  4EET B;  5F5Y A;  3OCL A;  4WUJ A;  3SW1 A;  4EEP A;  4HP9 A;  4MMN A;  4UQI S;  3T4S A;  3ZYT A;  1V9Y A;  4EU0 A;  1WA9 A;  5HWT A;  3T4J A;  3MF0 A;  4GCZ A;  4CLC B;  2KOI A;  5TBM B;  5HWW A;  1OPX A;  3PR6 A;  4O8G A;  2M1C A;  4P6Z M;  2VKS A;  4BMW A;  1UWP X;  3MFX A;  4LPZ A;  4YWZ A;  4BBT A;  4GLQ A;  1LL8 A;  2Z6C A;  3T4L A;  1TS0 A;  4DJ3 A;  4G3K A;  2PD8 A;  4E04 A;  2FZ0 A;  2XRO A;  4JGR A;  4O01 A;  1S4S A;  4H6J B;  3E4P A;  1JNU A;  2Y8H A;  5EFW A;  2WKP A;  3IBJ A;  4GJ4 A;  3G6O A;  2NUT C;  3ULF A;  3T4O A;  4I3A A;  2W3D A;  5DJT A;  2KDK A;  3LR4 A;  2JKT I;  3CI6 A;  2PYR A;  3BWL A;  4MN7 A;  3UB8 A;  3S7Q A;  3C2W A;  4HH3 A;  3HJK A;  1STZ A;  3MQ0 A;  3H7W B;  4XT2 A;  3T4T A;  1IFQ A;  4UEY A;  1TS6 A;  2J80 A;  4I39 A;  1VHM A;  1XJ6 A;  1P97 A;  4IUH A;  5G4Y A;  3F1N A;  4HJ6 A;  2L1M A;  2VEA A;  3F1O A;  4RQ9 A;  2I9V A;  5A8B A;  1TF1 A;  1T19 A;  2HV1 A;  3BQ8 A;  2VJW A;  5KSH A;  2WKR A;  2O0Y A;  3R4K A;  4HP4 A;  3H9W A;  2O9A A;  3UB9 A;  5MC7 A;  4HY8 A;  3KX0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...