1T1AA

Late intermediate il1 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photoreceptor
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
total genus 33
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t1aA00
1UGUA 1OTDA 2M1CA 1NWZA 4MN6A 2P7JA 1TS7A 3NOUC 4EERA 1S67L 5HWVA 1LSXA 1GSXA 1OJ5A 3BY9A 1ODVA 3CAXA 2K7SA 2KX6A 1OTEA 4EEPA 4KQDA 4BBUA 4JGQA 1DP8A 3MFXA 3MXQA 2OOLA 2PYPA 3SW1A 1TS8A 3UB8A 5G4ZA 3E4QA 3EWKA 3E4PA 3G6OA 4H6JA 4HOIA 3K3CA 4E04A 3IS2B 2V9AA 3LI9A 2B02A 1KOUA 2INWA 5HWTA 3RH8B 4LRYC 4WLAA 4MN5A 1BYWA 4F3LB 1S1YA 2OWHA 1LSVA 3LIBA 2V1BA 3F1OB 3NHQA 4WN5A 4I38A 4HH3A 2PR5A 2YKFA 4NXFA 3LI8A 2PD8A 4LRXC 4EESA 3NOTC 3VE3A 2A24B 1S1ZA 2JHEA 3F1PA 1UWPX 2VV8A 4B9OA 4I5SA 3UMEA 5F68A 4GS9A 5J7EA 2VV7A 1D7EA 2Z6CA 3LIEA 3ULFA 5I5LA 5TBMA 2PR6A 1TS6A 4HP4A 4I39A 5KIZA 3BY8A 4XT2A 3PHYA 5HSQA 1OT6A 1XFQA 4HHDA 5IS1A 2I9VA 2QJ7A 4YWZA 4EEUA 3H82A 1XJ3A 4I3IA 4EQ1A 1MZUA 3UB6A 1OTAA 1X0OA 3HJKA 2WKQA 3D72A 5AVFA 1OT9A 2PYRA 1F98A 4BBTA 2BASA 4GW9A 3LYXA 1DP9A 1P0ZA 2ZBBA 1S4SA 3P7NA 2V0WA 2QWSA 2PD7A 3C2WA 5J3WA 4L9GA 4NXGA 4K08A 4KUKA 2WKPA 4GHIA 4HY8A 4NXBA 4WUJA 1DP6A 3KX0X 3BWLA 1T1AA 4R38A 3MQOA 1G28A 3PYPA 5EFWA 1JNUA 4PKYA 2VV6A 1OJGA 1EW0A 3E4OA 1XJ2A 1S66L 1UWNX 1LL8A 3HJIA 4LRZE 4JGOA 5J4EA 1OTBA 4WL9A 5DKLA 4HJ6A 2KDKA 1LSWA 4EW7A 1T1BA 4XT2B 3NOPC 1DRMA 3CLOA 1N9LA 2QKPA 3LUQA 5DJUA 4R3AA 3FG8A 4I3JA 3IS2A 1XJ4A 1VB6A 4PKYG 4HP9A 3UB9A 5HD3A 3F1NA 4F3LA 2V0UA 5G4YA 1Y28A 4LPZA 3IBRA 3B33A 2QJ5A 1D06A 3F1OA 3LIAA 1V9ZA 3H9WA 3EEHA 1LT0A 3LIFA 3UMDA 5HDDA 2A24A 1S4RA 5A8BA 3GECA 3MR0A 2ZOIA 4GCZA 2W27A 2HV1A 2EA9A 1TS0A 3A0VA 2WKRA 2L1MA 3H7WA 4HIAA 1P97A 4HJ4A 4H6JB 4DJ2A 4R6LA 1F9IA 4GHIB 3A0RA 3NJAA 4JGPA 2H28A 2QHKA 5HD5A 5HDCA 1XJ6A 2D02A 2ZOHA 2W0NA 3GDIA 2YKHA 2JN7A 2PHYA 4I3AA 1T1CA 2Z6DA 2CMNA 1T19A 3LICA 2L4RA 4DJ3A 5IU1A 4HQAA 2VLGA 3ZQ5A 2J80A 1N9NA 3FC7A 4LLOB 5F6AA 4NXEA 2V1AA 4R70A 3F1PB 3OLOA 3ICYA 1GSWA 4RQ9A 4GS9B 3VE4A 4EXOA 4HJ3A 2VEAA 5TBMB 3F1NB 2OWJA 1XFNA 2D01A 4JGRA 3RTYA 1V9YA 5DKKA 1N9OA 3H82B 3T50A 2PDRA 5F69A 4EETB 3A0SA 3UB7A 2R78A 1WA9A 3UE6A 5HZHA 3K3DA 4KUOA 5F5YA 2GJ3A 4HI4A 2L0WA 5HWWA 4BBVA 4WF0A 1T18A 3MQQA 3H7WB 4HH2A 5AVEA 3LIDA 3CWFA 3C8CA 4L9EA 4L9FA 1OTIA 5HDSA 4HNBA 3MJQA 3VOLA 5DJTA 4M4XA 1GSVA
chains in the Genus database with same CATH superfamily
4Q0JA 3ZNTA 2ACGA 3TOIA 4UAAA 1KDSA 1PWGA 1NWZA 2P7JA 4OKPA 3WS2A 1BZAA 2IA2A 2LB9A 1S67L 3KO6A 2PBYA 3G35A 4CJNA 4PM5A 3IH8A 5HWVA 1ES5A 1YLTA 4MEZA 2WZXA 4K0WA 4MCWA 2V20A 1KDWA 4OVDA 4P6ZS 5IT5A 1OTEA 1EI5A 3Q1FA 4EBPA 2ZMAA 4BBUA 2W1RA 3V39A 4JGQA 3QNCA 1E4DA 3QP2A 3EQUA 3NBLA 2HDQA 4CLCC 3VFHA 5HPIA 3C5AA 2DCFA 1TS8A 3UB8A 3LEZA 3L7HA 5G4ZA 4KZBA 1PI4A 2ZC5B 3P09A 3HCYA 3E4PA 4OP8A 2Y2QA 4DRTA 3ISGA 2ZMFA 1XA7A 3HLDA 3LI9A 3LY3A 2DMWA 5JYPA 4N9KA 4BL2A 3ZFZA 1QMEA 1BYWA 4MMNA 2J9PA 3S22A 3DAVA 2V1BA 3T12B 3NHQA 3RJUA 3ZVWA 1YMXA 4QY6A 3NY4A 5KSHA 4HH3A 4S2OA 1ZKJA 5F83A 4JF5A 4LRXC 4BENA 2LB5A 1S1ZA 5FAOA 5L09A 3WS4A 2VV8A 4GS9A 5J7EA 1W8YA 5FDSA 1VETB 2Z6CA 4KG6A 1CEGA 2W3EA 4NEED 2PR6A 1JVJA 1TS6A 5KIZA 3BY8A 3LR5A 5TJJA 3HLEA 2WZZA 1XFQA 3KYEA 1K57A 2G7UA 2HJ9C 3HUNA 2FFYA 3TW8A 4OPRA 2V1ZA 3UN7A 4Y17A 4G3KA 2ZC3B 2IWBA 4YWZA 4Y7PA 1XJ3A 4EQ1A 2ZM0A 3QHYA 3DTMA 3T4QA 2DNSA 5AQBA 3WRTA 1FR1A 3MFDA 3OPHA 3G2ZA 5AVFA 1OT9A 4OQIA 4BBTA 2P08A 4GW9A 4WZ5A 4EU0A 3LYXA 5TR7A 1TD5A 1VHMA 4PM8A 2E8IA 3C4OA 3DTIA 1ONHA 3PAEA 4IBXA 5K5BA 5FQIA 4QD4A 2PBDP 3UY6A 5CECA 2K31A 3BW6A 5DF9A 2EFXA 1XKZA 4R23A 2WGWA 5J3WA 3NI9A 3IT9A 3E2KA 2OAP1 1DJBA 3KSFA 3TG9A 1MY8A 3FYZA 3KX0X 1GHIA 3ZDJA 1PRQA 3PBNA 1SDNA 4ME4A 1T1AA 5CEBA 4BJPA 3C7VA 2WAEA 3BYDA 4PKYA 1EW0A 2HDSA 2ZQDA 4DE2A 4BQMA 4LV0A 4JKTA 2JKGA 4JGOA 1OTBA 4WL9A 5DKLA 2ZC6B 2B95A 3D9YA 2FFFB 1NYMA 3EGXC 4HJ6A 4UHUA 1I2SA 2XA7M 1LSWA 3HLGA 1TF1A 3DW0A 3CLOA 2O99A 2QKPA 5KSCA 5DJUA 3BFCA 4FUWA 4I3JA 5J8XA 2XLNA 4LGWA 4KZAA 1FQGA 5M1AA 2VGLS 2Y2JA 3QNBA 3MMHA 4KZ4A 1BLHA 3UE3A 3F1NA 1IYSA 4U0XA 3AGFA 1ZC2A 1D06A 4LFUA 5EECA 3PTEA 3LIAA 3IXGA 3H9WA 5FI2A 4EBNA 3DWKA 4Q0IA 1P9RA 4FH2A 3VOZA 3MS6A 5HDDA 4WZ4A 5M19A 4JXSA 2EX6A 2EX2A 1FCMA 4N1XA 4RX3A 1SZVA 4DDSA 1HTZA 4EUZA 2UWXA 3O87A 1VETA 2W3FA 3IF6B 1TS0A 2GX5A 3FZCA 3TJZC 1D1JA 3IF5A 5CTMA 3H7WA 3NECA 4H6JB 2M7UA 3MZDA 2Y2NA 4GHIB 3C38A 4MBHA 5FSRA 3IXDA 5FASA 1K56A 1PZOA 1SKOB 3A3JA 3HLCA 5F82A 5CERA 3VFFA 4DDYA 5CEDA 2W0NA 1N4OA 2JN7A 1JWPA 4I3AA 4X1MA 4GKUA 5GLAA 4JPMA 4D60A 3E2LA 4JF6A 2CMNA 1NRJA 3JPUA 5EVIB 4IUKA 2VLGA 3CG5A 3ZQ5A 4DMZA 4IJGA 1G6AA 3ITBA 3V50A 4EWFA 4OP5A 2GDNA 4R70A 3PXPA 1LL5A 4RQ9A 2ZQAA 4PM9A 4EXOA 4CPKA 3C7UA 2M7VA 2ZL1B 5TBMB 4LCLA 1K54C 3FV7A 3Q7VB 4HBTA 5FQMA 3AGDA 3NDEA 3ZG8B 2D01A 3BFEA 4XUXA 1V9YA 1IYQA 4R0QA 1KE3A 2VZWA 3LO7A 4S2NA 2W3DA 3H82B 2Z2MB 2ZQ8A 5F69A 4G3VA 4EETB 5FAQA 1ALQA 2GZAA 3FPVA 1ESUA 3K3DA 4FH4A 4MNRA 4N1HA 2HJEA 2GJ3A 2Y2HA 5DFYA 4S2JA 3IXBA 2L0WA 4KQOA 2XQZA 4ZJ1A 1E3UD 2V8CA 4WEJA 1ZHHB 3VSLA 1SKFA 2W3HA 4L9FA 4DN0A 4Q8IA 3ZG5A 3MSHA 1YM1A 4HNBA 3MJQA 4E3NA 3IWQA 3VMAA 3QP8A 1HZOA 1UGUA 3NULA 1OTDA 2Y2MA 1Y54A 1G68A 1NJ4A 2Y8HA 2CC1A 2OAQ1 5FI7A 4OQGA 5E2EA 4UA6A 3E0YA 2JKFA 5DTTA 3IHBA 3IF6A 4QY5A 3EQVA 3MXQA 2XA7S 4IBRA 3N6IA 1CI9A 1AXBA 2PYPA 1U60A 1W8QA 3E4QA 1YSPA 4H6JA 1K6RA 3ITAA 4HOIA 5IHVA 3K3CA 4E04A 2X02A 3CPTB 1BLPA 1SKOA 3V5MA 2Q0OA 2WK0A 3CJMA 1KOUA 2H0TA 5L10A 5HWTA 3RH8B 4X68A 3G2YA 1CJFA 2OWHA 4EBLA 3LIBA 3R4KA 4YNRA 3VOYA 2Y59A 4I38A 2Y2LA 5EVIA 2ZQCA 5EOEA 3IWIA 3V3SA 5EVLA 4NXFA 4GLQA 1Y4OA 3BEBA 1H0MA 2HZ5A 1KVLA 2V8FA 3L9KA 4KZ7A 3LR0A 5FA7A 1PYYA 1XP4A 4X69A 4B93A 3UMEA 4YINA 3WWXA 3GVBA 2OSUA 3ZCZA 3N4IA 3SH9A 3JVUA 1ES2A 1LI9A 4DE3A 5TBMA 4F94A 4I39A 2O9AA 3Q7VA 4XT2A 3PHYA 1OT6A 4WELA 4A5RA 3KYQA 3FKWA 4S2KA 5GHZA 4Q0HA 2XF3A 1G5UA 2QJ7A 3BECA 2ZC4B 3C30A 5TFQA 3H82A 3OPRA 2J7VA 1ACFA 1ERQA 1MZUA 3UB6A 2W1TA 1MXOA 1OTAA 3SS4A 2VGKA 4XUZA 5GHXA 3D72A 1FIKA 1L0DA 1NY0A 1F98A 4OOMA 2VK3A 3IX8A 1K57C 2WKHA 5FQ9A 2EX9A 3KSIA 5L8MA 4E3IA 1VEUB 3PBRA 1P0ZA 2JKRI 1S4SA 1K4EA 4IHQA 2JKTI 2R9WA 2HP6A 3GQZA 2WKIA 4MLLA 5L07A 5C5KA 5HFOA 3UPOA 3Q81A 2JBFA 4CLCE 3S7OA 3W4OA 4KUKA 2WKPA 1PIOA 4NXBA 3ZG9B 1DP6A 3CUEA 2EFUA 3BWLA 1XGIA 3VV4A 5A92A 3MQOA 3ZGAB 5CHJA 2XR0A 5EFWA 3E4OA 3VP2A 3IQAA 3V67A 1O07A 3W2ZA 5HX9A 2HGVA 2PT7A 3HJIA 3MZFA 4LRZE 1F2KA 4KQRA 4MDZA 2P74A 1K0KA 4FTXA 4E6XA 1T1BA 3KSHA 1QMFA 5U47A 3UE1A 4II7A 3N8SA 4S2MA 1XA1A 1MWTA 4OONA 3FG8A 1Q2QA 4UEYA 3JVVA 4X55A 3GSGA 3CPTA 1KGGA 3R7WA 1BUEA 3FKVA 4RA7A 1I5QA 5EVEA 3UB9A 3UNWA 4KZ6A 1BTLA 1Y28A 5EUAA 3IBRA 4NKPA 3MF0A 2QJ5A 3ZVTA 2XD5A 2MJ6A 1LT0A 1S6RA 2Y55A 1KGEA 5AQ7A 3KSGA 5A8BA 2HP9A 2H10A 3GECA 2ZOIA 4PM6A 3D3OA 3HUMA 2WADA 5A93A 2Y4AA 4EUVA 2WKRA 1FSYA 2L1MA 1MWUA 1W79A 4HIAA 4NETA 4B4XA 4DJ2A 1G6OA 5FL3A 1YLYA 3A0RA 3MZEA 4LENA 5GHYA 3A3FA 4R3JA 1C3BA 4RYEA 5HD5A 5HDCA 2ZOHA 4QB8A 1W63M 4R1GA 1T1CA 2Z6DA 4S2LA 3M2JA 3QP1A 3W4PA 4JXWA 5DTSA 2J80A 4MBFA 1GA9A 4Y0OA 3NC8A 5DTKA 4X53A 2V1AA 2AVXA 1FILA 1VEUA 3MXSA 2XROA 1YKDA 4FCFA 4HJ3A 3OBFA 2RL3A 3OCLA 1K38A 3MBZA 4XXRA 4DXCA 2G2UA 2EX8A 3WS0A 3QP6A 3O86A 1MC0A 3OPLA 3T4JA 3RTYA 2Y2OA 2ZD8A 1J9MA 5DKKA 4HBUA 1N9OA 4PMAA 1NZOA 4C3QA 3T50A 5F1FA 3A0SA 1LL9A 1AWIA 3OZHA 2R78A 5HZHA 1YLZA 3K2NA 4KUOA 1IELA 4ZBEA 3G30A 1XXMA 3G32A 2KLIA 2PU2A 3BQ8A 1Q2PA 3MQQA 2C5WB 3MKFA 1PNEA 3MKEA 3FPWA 3SS3A 5HW3A 3LIDA 3PBQA 2A3UA 4BLMA 5HDSA 2ZQ7A 1FR6A 1L3LA 4N92A 1K6SA 3EGDC 5DJTA 1I2WA 5I94A 3W8KA 1GSVA 3HLBA 3PBOA 4BWIA 3FWLA 3O88A 4LV3A 2M1CA 4Z9QA 4MN6A 1WYBA 4GZBA 4EERA 3SH7A 1FCOA 1M6KA 5E2GA 4RX2A 1GSXA 5DF7A 1OJ5A 5DVAA 3BY9A 1K55A 3U2AA 4QHCA 4KQDA 4BD0A 1RGZA 3IH9A 5GLCA 2RCXA 1H8MA 2JCHA 4R3BA 4WEKA 3G4PA 2WKEA 2OOLA 2BLSA 5GLBA 3CZDA 2XFTA 2W3GA 4JXGA 4OOYA 3CHWP 3IS2B 1TDLA 3N8LA 4EV4A 3UB5P 2B02A 4IVIA 3NDGA 2B5RA 5EVID 4LRYC 4WLAA 4F3LB 3NIAA 3T4SA 4P6ZM 1S1YA 5CX7A 1LSVA 2NUPC 5HAIA 1JTGA 3OOVA 3M6HA 4DKIA 4WN5A 1L0EA 1L2SA 2YKFA 3LI8A 1PW1A 3HL9A 4EESA 1KE4A 2PRFA 4GOGA 3NOTC 4GNUA 1H8ZA 4ETZA 2ZLYA 1UWPX 1W63Q 1YQSA 3A3IA 2J3WA 3IBJA 4QU3A 2HDRA 5CGXA 1D7EA 2O9BA 2XSSA 3B47A 5EPHA 5I5LA 2VX8A 4IVKA 4HP4A 1CI8A 4O0PA 1YMSA 4UQIM 2WUQA 5HSQA 3EOIA 1TEMA 5IS1A 3PBSA 4ETXA 1XGJA 4KENB 2HF6A 3VP4A 3O3VA 1HD8A 2Q9NA 3MXRA 5EVIC 4QPRA 1P9WA 2H0YA 2JE5A 1PZPA 4X6TA 3QP5A 4I3IA 4X1LA 5M18A 3GTCA 5CGWA 3S7NA 2OLUA 3S4XA 4E3MA 2XEPA 3NCKA 1VM1A 4MBKA 2WKQA 1NRFA 1EWZA 4P6BA 1YT4A 4Y3IA 3BLMA 2O0YA 4Y0UA 4PM7A 3M2KA 2A49A 3B3XA 3UPNA 2ZBBA 2V0WA 1YLPA 2XFSA 4Y13A 1NLYA 4KZ8A 2PD7A 4WM9A 1OPXA 4L9GA 2NUTC 3TE8A 4GHIA 4WUJA 3T1QB 3RXXA 3U4LP 5FATA 4ID4A 2G2WA 1NZUA 5MC7A 4R38A 1G28A 3GRJA 4P0MA 1H8YA 4KQQA 1ZTUA 1JNUA 2IWCA 1OJGA 4OQ0A 1XJ2A 4PAUA 1OMEA 2E8JA 1PW8A 4Y2FA 4G3WA 5J4EA 4FSFA 1XX2A 5EM0A 3SH8A 3GMWA 2DRWA 2HPBA 4JLFA 2ZMVA 4FD8A 1S0WA 3IS2A 1IYOA 2EXAA 3CUEC 1VB6A 4PKYG 3B42A 1L0GA 4LCMA 2ZL1A 4E3OA 5G18A 4CLCB 5HD3A 4F3LA 2V0UA 5G4YA 4R4SA 1XPBA 5AQAA 1E25A 3KYZA 1BSGA 3LIFA 3UDFA 2EXBA 4KZ3A 5EOOA 4C75A 4LV2A 1BLSA 4ZRRA 2GNXA 4QJGA 3MR0A 1VQQA 4GCZA 2FZ0A 3LY4A 2HV1A 2EA9A 1E3UA 2VGLM 4UA9A 4ZJ3A 2WGWB 4JF4A 1P97A 1NXYA 1BULA 1PWDA 3NJAA 4Z1WA 4OQHA 3RFBA 4R4RA 4O01A 1CK3A 3HUOA 1XJ6A 1CEFA 3GR2A 4ZTKA 4AFIA 1GHMA 2PHYA 5DFXA 5HAQA 5KMWA 2ZM8A 3OCNA 4DXBA 3LICA 4HQAA 2WAFA 4RVAA 1JWZA 4BD1A 3WRZA 1CQAA 1IFQA 5AJGA 4CQHA 3M6BA 4WZ5C 5F6AA 3QP4A 5E2FA 3F1PB 3OLOA 4S2PA 3EEAA 3P98A 5FI6A 2PU4A 3VE4A 5CRFA 1W7FA 4UQIS 3SS5A 3F1NB 1ERMA 1XFNA 4ZJ2A 4K0XA 2XGNA 4P85A 4ARZB 4YFMA 4JGRA 1MKIA 3WS1A 4OLGA 3BFGA 4JXVA 2Y79A 2PDRA 2OV5A 4Y15A 3LCEA 4OLDA 1WA9A 4H8RA 3BLSA 5CTNA 2J3TD 4NK3A 3A3EA 5HWWA 1YLWA 3H7WB 2P9VB 5CHUA 1FOFA 4L9EA 1GA0A 2BG1A 4CLCA 3N8RA 3VOLA 5KZHA 4WMCA 5FEGA 1DY6A 3UO9A 4IUHA 3IHAA 4E6WA 3HLFA 1K56D 1N9BA 4D2OA 4WYYA 1TS7A 3NOUC 3ZG7B 3G34A 4PHTA 2ZQ9A 2X01A 4U3TA 1TVFA 3E98A 2P04A 1IOUA 3HBRA 1LSXA 3HREA 1ODVA 3TRCA 3CAXA 2K7SA 1ZG4A 2KX6A 3T1SA 4EEPA 2J3TC 3IXHA 5D3OA 5FEFA 1DP8A 3T4KA 4N9LA 3MFXA 3MQ0A 1IKIA 2JKRM 3SW1A 2JKTM 4QWOA 3D4FA 2VKSA 4OPZA 3EWKA 2EWVA 3G6OA 2JC7A 3Q07A 1BT5A 2V9AA 5DF8A 2VJWA 1ES4A 3LR3A 4MN7A 4HEFA 2INWA 2Y91A 1K55C 3LFVA 4MN5A 1YAXA 3LGOA 5E2HA 3F1OB 4EQIA 1KGFA 2PR5A 1LI0A 4ZAMA 1H5XA 5TGFA 2PD8A 3VE3A 2Q9MA 2A24B 2JHEA 3F1PA 1JTDA 1Z09A 4B9OA 4I5SA 5F68A 1ESIA 3W4QA 2VV7A 4PPRA 1MKMA 2KOIA 1O7EA 3T4OA 3LIEA 5L2FA 3ULFA 2V2FF 1TDGA 1HLUP 5FQQA 4HESA 2C6WB 4HHDA 3DTKA 1DJCA 4ARZA 1BLCA 3VP3A 1DJAA 2X71A 2I9VA 3T4TA 3T1RA 3OC2A 4E3KA 3VP1A 4OPQA 4EEUA 3TSGA 4S2NC 1YLJA 2HDUA 4C6YA 4E3JA 1WYCA 3UDXA 3IWOA 3RXWA 4OOLA 1X0OA 3OPPA 5HL6A 3HJKA 5F1GA 5HPFA 2QPNA 3A3DA 3V3RA 2Y2GA 4ESPA 2PYRA 2BASA 3N7WA 1DP9A 2P9VA 5FQKA 2O9CA 1PFLA 3BQAA 2R9XA 3ZG0A 3Q7ZA 3DWZA 3P7NA 3G31A 3WS5A 4U0TA 2QWSA 3S7PA 4DE0A 4X56A 3C2WA 4GN2A 4KZ9A 5FAPA 1ZG6A 4NXGA 4K08A 4HY8A 1WE4A 2XDMA 3GV9A 1ES3A 2ZC7A 4UA7A 4LV1A 5LBRA 1K25A 1A0KA 2B18A 3P01A 3T1XA 5CXWA 3PYPA 4GD6A 3LR4A 2VV6A 4BMWA 1S66L 1UWNX 2WGIA 1RGYA 1LL8A 3IF6C 5A91A 4OPYA 2H5SA 4GDBA 2HP5A 1IEMA 2K2NA 3PR6A 3CMZA 1J3WA 3PAGA 2KDKA 4EW7A 4KG5A 4XT2B 3NOPC 1DRMA 1N9LA 3SZTA 3LUQA 2I72A 3DBAA 4R3AA 1LLBA 1IYPA 1CF0A 1FCNA 1XJ4A 1MWSA 3ZYTA 3S1YA 4HP9A 4O8GA 3BFFA 2PAVP 3HLWA 5CHMA 2WYXA 4LPZA 5AQ9A 5FQJA 3B33A 3O5YA 2BTFP 2W1TB 3F1OA 1HVBA 2IWDA 1V9ZA 3EEHA 4E3LA 4GD8A 5JYOA 2VGJA 3UDIA 3UMDA 2WGVA 2OLVA 2A24A 1K4FA 1MWRA 1LHYA 1S4RA 3BFDA 2UV0E 1F5MA 3PBTA 1KE0A 2W27A 1MPLA 2Y2PA 5CGSA 3A0VA 4B88A 3IX3A 1SCWA 2ZM2A 4HJ4A 4Y0TA 4R6LA 5GL9A 4WBGA 1KVMA 1F9IA 4O7DA 4DE1A 2FH5A 1STZA 4GB7A 4JGPA 2H28A 1RP5A 2QHKA 1NLZA 4IEDA 3SOIA 2D02A 1K54A 1MBLA 2XH9A 3GDIA 5E43A 1YPRA 2YKHA 1JWVA 3CI6A 4M3KA 1EROA 3T4LA 1L0FA 1T19A 4BL3A 2L4RA 4DJ3A 5IU1A 1W5DA 3ZNYA 2ZJ9A 5FDHA 1GCEA 2QZ6A 1N9NA 3FC7A 4LLOB 3UPPA 2XD1A 4DF6A 4GDNA 5EE8A 4P87A 4NXEA 3HVFA 1M40A 3UE0A 3S7QA 3Q82A 3ICYA 5A90A 5HAPA 1GSWA 1PI5A 4GS9B 2Y2IA 3LEQA 4KZ5A 3R7WB 5EV0A 1PWCA 3IX4A 2Z2LB 2VEAA 2J9OA 2QMIA 5BOHA 1RCJA 3CITA 2EWWA 2QYBA 2OWJA 4S2IA 1NYYA 3C4PA 4Y5FA 5GLDA 3VSKA 5EM1A 3AGEA 1SHVA 4OH0A 4NG2A 1ONGA 5HARA 4FOFA 4X25A 4ZDXA 3DTEA 4B4ZA 2XK1A 1GHPA 3UB7A 2Y2KA 4JBFA 3BM6A 3UE6A 3BJNA 1IKGA 5F5YA 4HI4A 3JYIA 2XRNA 1YSQA 1H3QA 2VA0A 4BBVA 4WF0A 1T18A 4GJ4A 3ZHHA 4CLCD 3BRMA 4HH2A 4WMCD 5AVEA 1Z6FA 3CWFA 1FSWA 2J8YA 4YOFA 4KG2A 3C8CA 2A2LA 1OTIA 5HL1A 4K91A 3I7JA 3VP0A 4M4XA 4L0LA 1SDEA
chains in the Genus database with same CATH topology
1UGUA 4Q0JA 3PBOA 4BWIA 1OTDA 2M1CA 1NWZA 4MN6A 2P7JA 1TS7A 3NOUC 4EERA 4PHTA 2IA2A 2LB9A 1S67L 3KO6A 3E98A 2Y8HA 2P04A 5HWVA 1IOUA 1LSXA 1GSXA 1OJ5A 2OAQ1 3BY9A 1ODVA 4MCWA 3TRCA 4P6ZS 3U2AA 5IT5A 3CAXA 2K7SA 2KX6A 1OTEA 4EEPA 4KQDA 2J3TC 4BBUA 2W1RA 3E0YA 1H8MA 4JGQA 4WEKA 1DP8A 3T4KA 3EQUA 3EQVA 3MFXA 3MQ0A 3MXQA 2OOLA 4CLCC 2XA7S 5HPIA 2JKRM 2PYPA 3SW1A 1TS8A 2JKTM 3UB8A 5G4ZA 2VKSA 3E4QA 1YSPA 3EWKA 3HCYA 2EWVA 3E4PA 3G6OA 4H6JA 4HOIA 3K3CA 2W3GA 4E04A 3IS2B 2V9AA 2VJWA 2ZMFA 3LR3A 3LI9A 4MN7A 2B02A 1KOUA 2DMWA 2INWA 3LFVA 5HWTA 3RH8B 4LRYC 4WLAA 4MN5A 1BYWA 1YAXA 4F3LB 4MMNA 3T4SA 4P6ZM 1S1YA 2OWHA 5CX7A 1LSVA 3LIBA 3R4KA 2NUPC 3OOVA 4YNRA 2V1BA 3F1OB 3NHQA 4WN5A 4I38A 5KSHA 4HH3A 2PR5A 2YKFA 4NXFA 4GLQA 3LI8A 2PD8A 4LRXC 4EESA 3LR0A 3NOTC 3VE3A 4ETZA 2A24B 2LB5A 1S1ZA 2JHEA 3F1PA 1UWPX 1W63Q 2VV8A 4B93A 4B9OA 4I5SA 3UMEA 5F68A 2J3WA 4GS9A 5J7EA 2VV7A 3IBJA 1D7EA 1MKMA 2O9BA 2KOIA 2Z6CA 2XSSA 3T4OA 3LIEA 3B47A 3JVUA 3ULFA 5I5LA 2W3EA 4NEED 2VX8A 5TBMA 2PR6A 1TS6A 4HP4A 4I39A 5KIZA 2O9AA 3BY8A 3LR5A 4XT2A 3PHYA 5TJJA 4O0PA 4UQIM 5HSQA 1OT6A 1XFQA 3EOIA 4HHDA 4WELA 3KYQA 5IS1A 3PBSA 4ETXA 2G7UA 2HJ9C 4ARZA 2HF6A 3TW8A 4Q0HA 2I9VA 4QPRA 2QJ7A 4G3KA 3T4TA 3OC2A 3C30A 1P9WA 4YWZA 4EEUA 3H82A 1XJ3A 4I3IA 4EQ1A 1MZUA 3UB6A 2W1TA 1OTAA 4OOLA 1X0OA 3S7NA 5HL6A 3T4QA 3HJKA 5HPFA 2WKQA 3D72A 5AVFA 1OT9A 2PYRA 1F98A 4OOMA 4BBTA 2P08A 2BASA 4Y3IA 2O0YA 4GW9A 4EU0A 3LYXA 1DP9A 3KSIA 2O9CA 5L8MA 1TD5A 1VHMA 3BQAA 3PBRA 1P0ZA 2JKRI 1S4SA 2ZBBA 5K5BA 3P7NA 2V0WA 4IHQA 2JKTI 1NLYA 2QWSA 3S7PA 2K31A 3BW6A 2PD7A 5DF9A 3C2WA 5C5KA 5J3WA 1OPXA 4L9GA 2NUTC 4CLCE 3S7OA 4NXGA 4K08A 2OAP1 3TE8A 4KUKA 2WKPA 4GHIA 4HY8A 3KSFA 4NXBA 4WUJA 1DP6A 3CUEA 3KX0X 3BWLA 5LBRA 3VV4A 3PBNA 2B18A 3P01A 4ME4A 5MC7A 1T1AA 4R38A 3MQOA 1G28A 4BJPA 3PYPA 1ZTUA 5EFWA 1JNUA 3LR4A 4PKYA 2VV6A 1OJGA 1EW0A 3E4OA 1XJ2A 3V67A 4BMWA 1S66L 4PAUA 3W2ZA 2HGVA 2PT7A 1UWNX 1LL8A 4Y2FA 3HJIA 4LRZE 4G3WA 4JGOA 5J4EA 1OTBA 4FSFA 4WL9A 5DKLA 2K2NA 3PR6A 3EGXC 4HJ6A 4MDZA 2KDKA 2XA7M 1LSWA 4EW7A 1T1BA 3KSHA 4XT2B 2ZMVA 3NOPC 1DRMA 4II7A 1TF1A 3CLOA 2O99A 1N9LA 2QKPA 3LUQA 3DBAA 5DJUA 4R3AA 3FG8A 4I3JA 4UEYA 3IS2A 3JVVA 1XJ4A 3CUEC 1VB6A 3ZYTA 4PKYG 3B42A 3R7WA 4HP9A 2VGLS 4O8GA 3MMHA 4CLCB 3UB9A 3UE3A 5HD3A 3F1NA 4F3LA 2V0UA 5G4YA 1Y28A 4LPZA 3IBRA 4NKPA 3B33A 3MF0A 2QJ5A 3O5YA 1D06A 2W1TB 3F1OA 3LIAA 1V9ZA 3H9WA 3EEHA 3KYZA 2MJ6A 4Q0IA 1LT0A 1P9RA 3LIFA 3UMDA 5HDDA 2A24A 3KSGA 1S4RA 5A8BA 4ZRRA 2GNXA 3GECA 3MR0A 1F5MA 2ZOIA 4GCZA 3PBTA 2W3FA 2FZ0A 2W27A 3D3OA 2HV1A 2EA9A 1TS0A 2GX5A 3A0VA 3TJZC 2VGLM 4EUVA 2WKRA 2L1MA 3H7WA 4HIAA 1P97A 4HJ4A 4H6JB 2M7UA 4DJ2A 4R6LA 1G6OA 1F9IA 4GHIB 3C38A 2FH5A 5FL3A 1STZA 3A0RA 3NJAA 4Z1WA 4JGPA 3RFBA 2H28A 2QHKA 4O01A 1NLZA 5HD5A 5HDCA 1XJ6A 2D02A 2ZOHA 1W63M 3GDIA 2W0NA 4AFIA 2YKHA 2JN7A 2PHYA 4I3AA 5DFXA 1T1CA 3CI6A 2Z6DA 3T4LA 3OCNA 2CMNA 1NRJA 1T19A 3LICA 2L4RA 4DJ3A 5IU1A 4HQAA 4IUKA 2VLGA 3ZQ5A 4DMZA 2J80A 1N9NA 3FC7A 4IJGA 4LLOB 1IFQA 5AJGA 4CQHA 5F6AA 4NXEA 2V1AA 3S7QA 4R70A 3F1PB 3OLOA 3ICYA 3PXPA 3EEAA 1GSWA 4RQ9A 4GS9B 3VE4A 2XROA 1YKDA 4EXOA 3R7WB 4HJ3A 2M7VA 4UQIS 2VEAA 3OBFA 5TBMB 3OCLA 3CITA 2EWWA 2QYBA 3F1NB 2OWJA 4Y5FA 1XFNA 4ARZB 2D01A 4JGRA 1MC0A 3T4JA 3RTYA 4FOFA 1V9YA 5DKKA 2VZWA 2Y79A 1N9OA 2W3DA 3H82B 3T50A 2PDRA 5F69A 4G3VA 4EETB 3A0SA 3UB7A 2GZAA 3FPVA 2R78A 1WA9A 3UE6A 5HZHA 3K3DA 3K2NA 4KUOA 3BJNA 5F5YA 2J3TD 2HJEA 2GJ3A 5DFYA 4HI4A 2XRNA 1YSQA 2L0WA 1H3QA 5HWWA 2KLIA 3BQ8A 2VA0A 4KQOA 4BBVA 4WF0A 1T18A 4GJ4A 3MQQA 4CLCD 3H7WB 4HH2A 3FPWA 5AVEA 3LIDA 3CWFA 3PBQA 4WEJA 4YOFA 1ZHHB 2W3HA 3C8CA 4L9EA 2A2LA 4L9FA 4DN0A 1OTIA 5HDSA 4HNBA 3MJQA 4CLCA 3VOLA 3EGDC 5DJTA 4IUHA 4M4XA 4L0LA 1GSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGU A;  1OTD A;  2M1C A;  1NWZ A;  4MN6 A;  2P7J A;  1TS7 A;  3NOU C;  4EER A;  1S67 L;  5HWV A;  1LSX A;  1GSX A;  1OJ5 A;  3BY9 A;  1ODV A;  3CAX A;  2K7S A;  2KX6 A;  1OTE A;  4EEP A;  4KQD A;  4BBU A;  4JGQ A;  1DP8 A;  3MFX A;  3MXQ A;  2OOL A;  2PYP A;  3SW1 A;  1TS8 A;  3UB8 A;  5G4Z A;  3E4Q A;  3EWK A;  3E4P A;  3G6O A;  4H6J A;  4HOI A;  3K3C A;  4E04 A;  3IS2 B;  2V9A A;  3LI9 A;  2B02 A;  1KOU A;  2INW A;  5HWT A;  3RH8 B;  4LRY C;  4WLA A;  4MN5 A;  1BYW A;  4F3L B;  1S1Y A;  2OWH A;  1LSV A;  3LIB A;  2V1B A;  3F1O B;  3NHQ A;  4WN5 A;  4I38 A;  4HH3 A;  2PR5 A;  2YKF A;  4NXF A;  3LI8 A;  2PD8 A;  4LRX C;  4EES A;  3NOT C;  3VE3 A;  2A24 B;  1S1Z A;  2JHE A;  3F1P A;  1UWP X;  2VV8 A;  4B9O A;  4I5S A;  3UME A;  5F68 A;  4GS9 A;  5J7E A;  2VV7 A;  1D7E A;  2Z6C A;  3LIE A;  3ULF A;  5I5L A;  5TBM A;  2PR6 A;  1TS6 A;  4HP4 A;  4I39 A;  5KIZ A;  3BY8 A;  4XT2 A;  3PHY A;  5HSQ A;  1OT6 A;  1XFQ A;  4HHD A;  5IS1 A;  2I9V A;  2QJ7 A;  4YWZ A;  4EEU A;  3H82 A;  1XJ3 A;  4I3I A;  4EQ1 A;  1MZU A;  3UB6 A;  1OTA A;  1X0O A;  3HJK A;  2WKQ A;  3D72 A;  5AVF A;  1OT9 A;  2PYR A;  1F98 A;  4BBT A;  2BAS A;  4GW9 A;  3LYX A;  1DP9 A;  1P0Z A;  2ZBB A;  1S4S A;  3P7N A;  2V0W A;  2QWS A;  2PD7 A;  3C2W A;  5J3W A;  4L9G A;  4NXG A;  4K08 A;  4KUK A;  2WKP A;  4GHI A;  4HY8 A;  4NXB A;  4WUJ A;  1DP6 A;  3KX0 X;  3BWL A;  1T1A A;  4R38 A;  3MQO A;  1G28 A;  3PYP A;  5EFW A;  1JNU A;  4PKY A;  2VV6 A;  1OJG A;  1EW0 A;  3E4O A;  1XJ2 A;  1S66 L;  1UWN X;  1LL8 A;  3HJI A;  4LRZ E;  4JGO A;  5J4E A;  1OTB A;  4WL9 A;  5DKL A;  4HJ6 A;  2KDK A;  1LSW A;  4EW7 A;  1T1B A;  4XT2 B;  3NOP C;  1DRM A;  3CLO A;  1N9L A;  2QKP A;  3LUQ A;  5DJU A;  4R3A A;  3FG8 A;  4I3J A;  3IS2 A;  1XJ4 A;  1VB6 A;  4PKY G;  4HP9 A;  3UB9 A;  5HD3 A;  3F1N A;  4F3L A;  2V0U A;  5G4Y A;  1Y28 A;  4LPZ A;  3IBR A;  3B33 A;  2QJ5 A;  1D06 A;  3F1O A;  3LIA A;  1V9Z A;  3H9W A;  3EEH A;  1LT0 A;  3LIF A;  3UMD A;  5HDD A;  2A24 A;  1S4R A;  5A8B A;  3GEC A;  3MR0 A;  2ZOI A;  4GCZ A;  2W27 A;  2HV1 A;  2EA9 A;  1TS0 A;  3A0V A;  2WKR A;  2L1M A;  3H7W A;  4HIA A;  1P97 A;  4HJ4 A;  4H6J B;  4DJ2 A;  4R6L A;  1F9I A;  4GHI B;  3A0R A;  3NJA A;  4JGP A;  2H28 A;  2QHK A;  5HD5 A;  5HDC A;  1XJ6 A;  2D02 A;  2ZOH A;  2W0N A;  3GDI A;  2YKH A;  2JN7 A;  2PHY A;  4I3A A;  1T1C A;  2Z6D A;  2CMN A;  1T19 A;  3LIC A;  2L4R A;  4DJ3 A;  5IU1 A;  4HQA A;  2VLG A;  3ZQ5 A;  2J80 A;  1N9N A;  3FC7 A;  4LLO B;  5F6A A;  4NXE A;  2V1A A;  4R70 A;  3F1P B;  3OLO A;  3ICY A;  1GSW A;  4RQ9 A;  4GS9 B;  3VE4 A;  4EXO A;  4HJ3 A;  2VEA A;  5TBM B;  3F1N B;  2OWJ A;  1XFN A;  2D01 A;  4JGR A;  3RTY A;  1V9Y A;  5DKK A;  1N9O A;  3H82 B;  3T50 A;  2PDR A;  5F69 A;  4EET B;  3A0S A;  3UB7 A;  2R78 A;  1WA9 A;  3UE6 A;  5HZH A;  3K3D A;  4KUO A;  5F5Y A;  2GJ3 A;  4HI4 A;  2L0W A;  5HWW A;  4BBV A;  4WF0 A;  1T18 A;  3MQQ A;  3H7W B;  4HH2 A;  5AVE A;  3LID A;  3CWF A;  3C8C A;  4L9E A;  4L9F A;  1OTI A;  5HDS A;  4HNB A;  3MJQ A;  3VOL A;  5DJT A;  4M4X A;  1GSV A; 
#chains in the Genus database with same CATH topology
 4Q0J A;  3ZNT A;  2ACG A;  3TOI A;  4UAA A;  1KDS A;  1PWG A;  1NWZ A;  2P7J A;  4OKP A;  3WS2 A;  1BZA A;  2IA2 A;  2LB9 A;  1S67 L;  3KO6 A;  2PBY A;  3G35 A;  4CJN A;  4PM5 A;  3IH8 A;  5HWV A;  1ES5 A;  1YLT A;  4MEZ A;  2WZX A;  4K0W A;  4MCW A;  2V20 A;  1KDW A;  4OVD A;  4P6Z S;  5IT5 A;  1OTE A;  1EI5 A;  3Q1F A;  4EBP A;  2ZMA A;  4BBU A;  2W1R A;  3V39 A;  4JGQ A;  3QNC A;  1E4D A;  3QP2 A;  3EQU A;  3NBL A;  2HDQ A;  4CLC C;  3VFH A;  5HPI A;  3C5A A;  2DCF A;  1TS8 A;  3UB8 A;  3LEZ A;  3L7H A;  5G4Z A;  4KZB A;  1PI4 A;  2ZC5 B;  3P09 A;  3HCY A;  3E4P A;  4OP8 A;  2Y2Q A;  4DRT A;  3ISG A;  2ZMF A;  1XA7 A;  3HLD A;  3LI9 A;  3LY3 A;  2DMW A;  5JYP A;  4N9K A;  4BL2 A;  3ZFZ A;  1QME A;  1BYW A;  4MMN A;  2J9P A;  3S22 A;  3DAV A;  2V1B A;  3T12 B;  3NHQ A;  3RJU A;  3ZVW A;  1YMX A;  4QY6 A;  3NY4 A;  5KSH A;  4HH3 A;  4S2O A;  1ZKJ A;  5F83 A;  4JF5 A;  4LRX C;  4BEN A;  2LB5 A;  1S1Z A;  5FAO A;  5L09 A;  3WS4 A;  2VV8 A;  4GS9 A;  5J7E A;  1W8Y A;  5FDS A;  1VET B;  2Z6C A;  4KG6 A;  1CEG A;  2W3E A;  4NEE D;  2PR6 A;  1JVJ A;  1TS6 A;  5KIZ A;  3BY8 A;  3LR5 A;  5TJJ A;  3HLE A;  2WZZ A;  1XFQ A;  3KYE A;  1K57 A;  2G7U A;  2HJ9 C;  3HUN A;  2FFY A;  3TW8 A;  4OPR A;  2V1Z A;  3UN7 A;  4Y17 A;  4G3K A;  2ZC3 B;  2IWB A;  4YWZ A;  4Y7P A;  1XJ3 A;  4EQ1 A;  2ZM0 A;  3QHY A;  3DTM A;  3T4Q A;  2DNS A;  5AQB A;  3WRT A;  1FR1 A;  3MFD A;  3OPH A;  3G2Z A;  5AVF A;  1OT9 A;  4OQI A;  4BBT A;  2P08 A;  4GW9 A;  4WZ5 A;  4EU0 A;  3LYX A;  5TR7 A;  1TD5 A;  1VHM A;  4PM8 A;  2E8I A;  3C4O A;  3DTI A;  1ONH A;  3PAE A;  4IBX A;  5K5B A;  5FQI A;  4QD4 A;  2PBD P;  3UY6 A;  5CEC A;  2K31 A;  3BW6 A;  5DF9 A;  2EFX A;  1XKZ A;  4R23 A;  2WGW A;  5J3W A;  3NI9 A;  3IT9 A;  3E2K A;  2OAP 1;  1DJB A;  3KSF A;  3TG9 A;  1MY8 A;  3FYZ A;  3KX0 X;  1GHI A;  3ZDJ A;  1PRQ A;  3PBN A;  1SDN A;  4ME4 A;  1T1A A;  5CEB A;  4BJP A;  3C7V A;  2WAE A;  3BYD A;  4PKY A;  1EW0 A;  2HDS A;  2ZQD A;  4DE2 A;  4BQM A;  4LV0 A;  4JKT A;  2JKG A;  4JGO A;  1OTB A;  4WL9 A;  5DKL A;  2ZC6 B;  2B95 A;  3D9Y A;  2FFF B;  1NYM A;  3EGX C;  4HJ6 A;  4UHU A;  1I2S A;  2XA7 M;  1LSW A;  3HLG A;  1TF1 A;  3DW0 A;  3CLO A;  2O99 A;  2QKP A;  5KSC A;  5DJU A;  3BFC A;  4FUW A;  4I3J A;  5J8X A;  2XLN A;  4LGW A;  4KZA A;  1FQG A;  5M1A A;  2VGL S;  2Y2J A;  3QNB A;  3MMH A;  4KZ4 A;  1BLH A;  3UE3 A;  3F1N A;  1IYS A;  4U0X A;  3AGF A;  1ZC2 A;  1D06 A;  4LFU A;  5EEC A;  3PTE A;  3LIA A;  3IXG A;  3H9W A;  5FI2 A;  4EBN A;  3DWK A;  4Q0I A;  1P9R A;  4FH2 A;  3VOZ A;  3MS6 A;  5HDD A;  4WZ4 A;  5M19 A;  4JXS A;  2EX6 A;  2EX2 A;  1FCM A;  4N1X A;  4RX3 A;  1SZV A;  4DDS A;  1HTZ A;  4EUZ A;  2UWX A;  3O87 A;  1VET A;  2W3F A;  3IF6 B;  1TS0 A;  2GX5 A;  3FZC A;  3TJZ C;  1D1J A;  3IF5 A;  5CTM A;  3H7W A;  3NEC A;  4H6J B;  2M7U A;  3MZD A;  2Y2N A;  4GHI B;  3C38 A;  4MBH A;  5FSR A;  3IXD A;  5FAS A;  1K56 A;  1PZO A;  1SKO B;  3A3J A;  3HLC A;  5F82 A;  5CER A;  3VFF A;  4DDY A;  5CED A;  2W0N A;  1N4O A;  2JN7 A;  1JWP A;  4I3A A;  4X1M A;  4GKU A;  5GLA A;  4JPM A;  4D60 A;  3E2L A;  4JF6 A;  2CMN A;  1NRJ A;  3JPU A;  5EVI B;  4IUK A;  2VLG A;  3CG5 A;  3ZQ5 A;  4DMZ A;  4IJG A;  1G6A A;  3ITB A;  3V50 A;  4EWF A;  4OP5 A;  2GDN A;  4R70 A;  3PXP A;  1LL5 A;  4RQ9 A;  2ZQA A;  4PM9 A;  4EXO A;  4CPK A;  3C7U A;  2M7V A;  2ZL1 B;  5TBM B;  4LCL A;  1K54 C;  3FV7 A;  3Q7V B;  4HBT A;  5FQM A;  3AGD A;  3NDE A;  3ZG8 B;  2D01 A;  3BFE A;  4XUX A;  1V9Y A;  1IYQ A;  4R0Q A;  1KE3 A;  2VZW A;  3LO7 A;  4S2N A;  2W3D A;  3H82 B;  2Z2M B;  2ZQ8 A;  5F69 A;  4G3V A;  4EET B;  5FAQ A;  1ALQ A;  2GZA A;  3FPV A;  1ESU A;  3K3D A;  4FH4 A;  4MNR A;  4N1H A;  2HJE A;  2GJ3 A;  2Y2H A;  5DFY A;  4S2J A;  3IXB A;  2L0W A;  4KQO A;  2XQZ A;  4ZJ1 A;  1E3U D;  2V8C A;  4WEJ A;  1ZHH B;  3VSL A;  1SKF A;  2W3H A;  4L9F A;  4DN0 A;  4Q8I A;  3ZG5 A;  3MSH A;  1YM1 A;  4HNB A;  3MJQ A;  4E3N A;  3IWQ A;  3VMA A;  3QP8 A;  1HZO A;  1UGU A;  3NUL A;  1OTD A;  2Y2M A;  1Y54 A;  1G68 A;  1NJ4 A;  2Y8H A;  2CC1 A;  2OAQ 1;  5FI7 A;  4OQG A;  5E2E A;  4UA6 A;  3E0Y A;  2JKF A;  5DTT A;  3IHB A;  3IF6 A;  4QY5 A;  3EQV A;  3MXQ A;  2XA7 S;  4IBR A;  3N6I A;  1CI9 A;  1AXB A;  2PYP A;  1U60 A;  1W8Q A;  3E4Q A;  1YSP A;  4H6J A;  1K6R A;  3ITA A;  4HOI A;  5IHV A;  3K3C A;  4E04 A;  2X02 A;  3CPT B;  1BLP A;  1SKO A;  3V5M A;  2Q0O A;  2WK0 A;  3CJM A;  1KOU A;  2H0T A;  5L10 A;  5HWT A;  3RH8 B;  4X68 A;  3G2Y A;  1CJF A;  2OWH A;  4EBL A;  3LIB A;  3R4K A;  4YNR A;  3VOY A;  2Y59 A;  4I38 A;  2Y2L A;  5EVI A;  2ZQC A;  5EOE A;  3IWI A;  3V3S A;  5EVL A;  4NXF A;  4GLQ A;  1Y4O A;  3BEB A;  1H0M A;  2HZ5 A;  1KVL A;  2V8F A;  3L9K A;  4KZ7 A;  3LR0 A;  5FA7 A;  1PYY A;  1XP4 A;  4X69 A;  4B93 A;  3UME A;  4YIN A;  3WWX A;  3GVB A;  2OSU A;  3ZCZ A;  3N4I A;  3SH9 A;  3JVU A;  1ES2 A;  1LI9 A;  4DE3 A;  5TBM A;  4F94 A;  4I39 A;  2O9A A;  3Q7V A;  4XT2 A;  3PHY A;  1OT6 A;  4WEL A;  4A5R A;  3KYQ A;  3FKW A;  4S2K A;  5GHZ A;  4Q0H A;  2XF3 A;  1G5U A;  2QJ7 A;  3BEC A;  2ZC4 B;  3C30 A;  5TFQ A;  3H82 A;  3OPR A;  2J7V A;  1ACF A;  1ERQ A;  1MZU A;  3UB6 A;  2W1T A;  1MXO A;  1OTA A;  3SS4 A;  2VGK A;  4XUZ A;  5GHX A;  3D72 A;  1FIK A;  1L0D A;  1NY0 A;  1F98 A;  4OOM A;  2VK3 A;  3IX8 A;  1K57 C;  2WKH A;  5FQ9 A;  2EX9 A;  3KSI A;  5L8M A;  4E3I A;  1VEU B;  3PBR A;  1P0Z A;  2JKR I;  1S4S A;  1K4E A;  4IHQ A;  2JKT I;  2R9W A;  2HP6 A;  3GQZ A;  2WKI A;  4MLL A;  5L07 A;  5C5K A;  5HFO A;  3UPO A;  3Q81 A;  2JBF A;  4CLC E;  3S7O A;  3W4O A;  4KUK A;  2WKP A;  1PIO A;  4NXB A;  3ZG9 B;  1DP6 A;  3CUE A;  2EFU A;  3BWL A;  1XGI A;  3VV4 A;  5A92 A;  3MQO A;  3ZGA B;  5CHJ A;  2XR0 A;  5EFW A;  3E4O A;  3VP2 A;  3IQA A;  3V67 A;  1O07 A;  3W2Z A;  5HX9 A;  2HGV A;  2PT7 A;  3HJI A;  3MZF A;  4LRZ E;  1F2K A;  4KQR A;  4MDZ A;  2P74 A;  1K0K A;  4FTX A;  4E6X A;  1T1B A;  3KSH A;  1QMF A;  5U47 A;  3UE1 A;  4II7 A;  3N8S A;  4S2M A;  1XA1 A;  1MWT A;  4OON A;  3FG8 A;  1Q2Q A;  4UEY A;  3JVV A;  4X55 A;  3GSG A;  3CPT A;  1KGG A;  3R7W A;  1BUE A;  3FKV A;  4RA7 A;  1I5Q A;  5EVE A;  3UB9 A;  3UNW A;  4KZ6 A;  1BTL A;  1Y28 A;  5EUA A;  3IBR A;  4NKP A;  3MF0 A;  2QJ5 A;  3ZVT A;  2XD5 A;  2MJ6 A;  1LT0 A;  1S6R A;  2Y55 A;  1KGE A;  5AQ7 A;  3KSG A;  5A8B A;  2HP9 A;  2H10 A;  3GEC A;  2ZOI A;  4PM6 A;  3D3O A;  3HUM A;  2WAD A;  5A93 A;  2Y4A A;  4EUV A;  2WKR A;  1FSY A;  2L1M A;  1MWU A;  1W79 A;  4HIA A;  4NET A;  4B4X A;  4DJ2 A;  1G6O A;  5FL3 A;  1YLY A;  3A0R A;  3MZE A;  4LEN A;  5GHY A;  3A3F A;  4R3J A;  1C3B A;  4RYE A;  5HD5 A;  5HDC A;  2ZOH A;  4QB8 A;  1W63 M;  4R1G A;  1T1C A;  2Z6D A;  4S2L A;  3M2J A;  3QP1 A;  3W4P A;  4JXW A;  5DTS A;  2J80 A;  4MBF A;  1GA9 A;  4Y0O A;  3NC8 A;  5DTK A;  4X53 A;  2V1A A;  2AVX A;  1FIL A;  1VEU A;  3MXS A;  2XRO A;  1YKD A;  4FCF A;  4HJ3 A;  3OBF A;  2RL3 A;  3OCL A;  1K38 A;  3MBZ A;  4XXR A;  4DXC A;  2G2U A;  2EX8 A;  3WS0 A;  3QP6 A;  3O86 A;  1MC0 A;  3OPL A;  3T4J A;  3RTY A;  2Y2O A;  2ZD8 A;  1J9M A;  5DKK A;  4HBU A;  1N9O A;  4PMA A;  1NZO A;  4C3Q A;  3T50 A;  5F1F A;  3A0S A;  1LL9 A;  1AWI A;  3OZH A;  2R78 A;  5HZH A;  1YLZ A;  3K2N A;  4KUO A;  1IEL A;  4ZBE A;  3G30 A;  1XXM A;  3G32 A;  2KLI A;  2PU2 A;  3BQ8 A;  1Q2P A;  3MQQ A;  2C5W B;  3MKF A;  1PNE A;  3MKE A;  3FPW A;  3SS3 A;  5HW3 A;  3LID A;  3PBQ A;  2A3U A;  4BLM A;  5HDS A;  2ZQ7 A;  1FR6 A;  1L3L A;  4N92 A;  1K6S A;  3EGD C;  5DJT A;  1I2W A;  5I94 A;  3W8K A;  1GSV A;  3HLB A;  3PBO A;  4BWI A;  3FWL A;  3O88 A;  4LV3 A;  2M1C A;  4Z9Q A;  4MN6 A;  1WYB A;  4GZB A;  4EER A;  3SH7 A;  1FCO A;  1M6K A;  5E2G A;  4RX2 A;  1GSX A;  5DF7 A;  1OJ5 A;  5DVA A;  3BY9 A;  1K55 A;  3U2A A;  4QHC A;  4KQD A;  4BD0 A;  1RGZ A;  3IH9 A;  5GLC A;  2RCX A;  1H8M A;  2JCH A;  4R3B A;  4WEK A;  3G4P A;  2WKE A;  2OOL A;  2BLS A;  5GLB A;  3CZD A;  2XFT A;  2W3G A;  4JXG A;  4OOY A;  3CHW P;  3IS2 B;  1TDL A;  3N8L A;  4EV4 A;  3UB5 P;  2B02 A;  4IVI A;  3NDG A;  2B5R A;  5EVI D;  4LRY C;  4WLA A;  4F3L B;  3NIA A;  3T4S A;  4P6Z M;  1S1Y A;  5CX7 A;  1LSV A;  2NUP C;  5HAI A;  1JTG A;  3OOV A;  3M6H A;  4DKI A;  4WN5 A;  1L0E A;  1L2S A;  2YKF A;  3LI8 A;  1PW1 A;  3HL9 A;  4EES A;  1KE4 A;  2PRF A;  4GOG A;  3NOT C;  4GNU A;  1H8Z A;  4ETZ A;  2ZLY A;  1UWP X;  1W63 Q;  1YQS A;  3A3I A;  2J3W A;  3IBJ A;  4QU3 A;  2HDR A;  5CGX A;  1D7E A;  2O9B A;  2XSS A;  3B47 A;  5EPH A;  5I5L A;  2VX8 A;  4IVK A;  4HP4 A;  1CI8 A;  4O0P A;  1YMS A;  4UQI M;  2WUQ A;  5HSQ A;  3EOI A;  1TEM A;  5IS1 A;  3PBS A;  4ETX A;  1XGJ A;  4KEN B;  2HF6 A;  3VP4 A;  3O3V A;  1HD8 A;  2Q9N A;  3MXR A;  5EVI C;  4QPR A;  1P9W A;  2H0Y A;  2JE5 A;  1PZP A;  4X6T A;  3QP5 A;  4I3I A;  4X1L A;  5M18 A;  3GTC A;  5CGW A;  3S7N A;  2OLU A;  3S4X A;  4E3M A;  2XEP A;  3NCK A;  1VM1 A;  4MBK A;  2WKQ A;  1NRF A;  1EWZ A;  4P6B A;  1YT4 A;  4Y3I A;  3BLM A;  2O0Y A;  4Y0U A;  4PM7 A;  3M2K A;  2A49 A;  3B3X A;  3UPN A;  2ZBB A;  2V0W A;  1YLP A;  2XFS A;  4Y13 A;  1NLY A;  4KZ8 A;  2PD7 A;  4WM9 A;  1OPX A;  4L9G A;  2NUT C;  3TE8 A;  4GHI A;  4WUJ A;  3T1Q B;  3RXX A;  3U4L P;  5FAT A;  4ID4 A;  2G2W A;  1NZU A;  5MC7 A;  4R38 A;  1G28 A;  3GRJ A;  4P0M A;  1H8Y A;  4KQQ A;  1ZTU A;  1JNU A;  2IWC A;  1OJG A;  4OQ0 A;  1XJ2 A;  4PAU A;  1OME A;  2E8J A;  1PW8 A;  4Y2F A;  4G3W A;  5J4E A;  4FSF A;  1XX2 A;  5EM0 A;  3SH8 A;  3GMW A;  2DRW A;  2HPB A;  4JLF A;  2ZMV A;  4FD8 A;  1S0W A;  3IS2 A;  1IYO A;  2EXA A;  3CUE C;  1VB6 A;  4PKY G;  3B42 A;  1L0G A;  4LCM A;  2ZL1 A;  4E3O A;  5G18 A;  4CLC B;  5HD3 A;  4F3L A;  2V0U A;  5G4Y A;  4R4S A;  1XPB A;  5AQA A;  1E25 A;  3KYZ A;  1BSG A;  3LIF A;  3UDF A;  2EXB A;  4KZ3 A;  5EOO A;  4C75 A;  4LV2 A;  1BLS A;  4ZRR A;  2GNX A;  4QJG A;  3MR0 A;  1VQQ A;  4GCZ A;  2FZ0 A;  3LY4 A;  2HV1 A;  2EA9 A;  1E3U A;  2VGL M;  4UA9 A;  4ZJ3 A;  2WGW B;  4JF4 A;  1P97 A;  1NXY A;  1BUL A;  1PWD A;  3NJA A;  4Z1W A;  4OQH A;  3RFB A;  4R4R A;  4O01 A;  1CK3 A;  3HUO A;  1XJ6 A;  1CEF A;  3GR2 A;  4ZTK A;  4AFI A;  1GHM A;  2PHY A;  5DFX A;  5HAQ A;  5KMW A;  2ZM8 A;  3OCN A;  4DXB A;  3LIC A;  4HQA A;  2WAF A;  4RVA A;  1JWZ A;  4BD1 A;  3WRZ A;  1CQA A;  1IFQ A;  5AJG A;  4CQH A;  3M6B A;  4WZ5 C;  5F6A A;  3QP4 A;  5E2F A;  3F1P B;  3OLO A;  4S2P A;  3EEA A;  3P98 A;  5FI6 A;  2PU4 A;  3VE4 A;  5CRF A;  1W7F A;  4UQI S;  3SS5 A;  3F1N B;  1ERM A;  1XFN A;  4ZJ2 A;  4K0X A;  2XGN A;  4P85 A;  4ARZ B;  4YFM A;  4JGR A;  1MKI A;  3WS1 A;  4OLG A;  3BFG A;  4JXV A;  2Y79 A;  2PDR A;  2OV5 A;  4Y15 A;  3LCE A;  4OLD A;  1WA9 A;  4H8R A;  3BLS A;  5CTN A;  2J3T D;  4NK3 A;  3A3E A;  5HWW A;  1YLW A;  3H7W B;  2P9V B;  5CHU A;  1FOF A;  4L9E A;  1GA0 A;  2BG1 A;  4CLC A;  3N8R A;  3VOL A;  5KZH A;  4WMC A;  5FEG A;  1DY6 A;  3UO9 A;  4IUH A;  3IHA A;  4E6W A;  3HLF A;  1K56 D;  1N9B A;  4D2O A;  4WYY A;  1TS7 A;  3NOU C;  3ZG7 B;  3G34 A;  4PHT A;  2ZQ9 A;  2X01 A;  4U3T A;  1TVF A;  3E98 A;  2P04 A;  1IOU A;  3HBR A;  1LSX A;  3HRE A;  1ODV A;  3TRC A;  3CAX A;  2K7S A;  1ZG4 A;  2KX6 A;  3T1S A;  4EEP A;  2J3T C;  3IXH A;  5D3O A;  5FEF A;  1DP8 A;  3T4K A;  4N9L A;  3MFX A;  3MQ0 A;  1IKI A;  2JKR M;  3SW1 A;  2JKT M;  4QWO A;  3D4F A;  2VKS A;  4OPZ A;  3EWK A;  2EWV A;  3G6O A;  2JC7 A;  3Q07 A;  1BT5 A;  2V9A A;  5DF8 A;  2VJW A;  1ES4 A;  3LR3 A;  4MN7 A;  4HEF A;  2INW A;  2Y91 A;  1K55 C;  3LFV A;  4MN5 A;  1YAX A;  3LGO A;  5E2H A;  3F1O B;  4EQI A;  1KGF A;  2PR5 A;  1LI0 A;  4ZAM A;  1H5X A;  5TGF A;  2PD8 A;  3VE3 A;  2Q9M A;  2A24 B;  2JHE A;  3F1P A;  1JTD A;  1Z09 A;  4B9O A;  4I5S A;  5F68 A;  1ESI A;  3W4Q A;  2VV7 A;  4PPR A;  1MKM A;  2KOI A;  1O7E A;  3T4O A;  3LIE A;  5L2F A;  3ULF A;  2V2F F;  1TDG A;  1HLU P;  5FQQ A;  4HES A;  2C6W B;  4HHD A;  3DTK A;  1DJC A;  4ARZ A;  1BLC A;  3VP3 A;  1DJA A;  2X71 A;  2I9V A;  3T4T A;  3T1R A;  3OC2 A;  4E3K A;  3VP1 A;  4OPQ A;  4EEU A;  3TSG A;  4S2N C;  1YLJ A;  2HDU A;  4C6Y A;  4E3J A;  1WYC A;  3UDX A;  3IWO A;  3RXW A;  4OOL A;  1X0O A;  3OPP A;  5HL6 A;  3HJK A;  5F1G A;  5HPF A;  2QPN A;  3A3D A;  3V3R A;  2Y2G A;  4ESP A;  2PYR A;  2BAS A;  3N7W A;  1DP9 A;  2P9V A;  5FQK A;  2O9C A;  1PFL A;  3BQA A;  2R9X A;  3ZG0 A;  3Q7Z A;  3DWZ A;  3P7N A;  3G31 A;  3WS5 A;  4U0T A;  2QWS A;  3S7P A;  4DE0 A;  4X56 A;  3C2W A;  4GN2 A;  4KZ9 A;  5FAP A;  1ZG6 A;  4NXG A;  4K08 A;  4HY8 A;  1WE4 A;  2XDM A;  3GV9 A;  1ES3 A;  2ZC7 A;  4UA7 A;  4LV1 A;  5LBR A;  1K25 A;  1A0K A;  2B18 A;  3P01 A;  3T1X A;  5CXW A;  3PYP A;  4GD6 A;  3LR4 A;  2VV6 A;  4BMW A;  1S66 L;  1UWN X;  2WGI A;  1RGY A;  1LL8 A;  3IF6 C;  5A91 A;  4OPY A;  2H5S A;  4GDB A;  2HP5 A;  1IEM A;  2K2N A;  3PR6 A;  3CMZ A;  1J3W A;  3PAG A;  2KDK A;  4EW7 A;  4KG5 A;  4XT2 B;  3NOP C;  1DRM A;  1N9L A;  3SZT A;  3LUQ A;  2I72 A;  3DBA A;  4R3A A;  1LLB A;  1IYP A;  1CF0 A;  1FCN A;  1XJ4 A;  1MWS A;  3ZYT A;  3S1Y A;  4HP9 A;  4O8G A;  3BFF A;  2PAV P;  3HLW A;  5CHM A;  2WYX A;  4LPZ A;  5AQ9 A;  5FQJ A;  3B33 A;  3O5Y A;  2BTF P;  2W1T B;  3F1O A;  1HVB A;  2IWD A;  1V9Z A;  3EEH A;  4E3L A;  4GD8 A;  5JYO A;  2VGJ A;  3UDI A;  3UMD A;  2WGV A;  2OLV A;  2A24 A;  1K4F A;  1MWR A;  1LHY A;  1S4R A;  3BFD A;  2UV0 E;  1F5M A;  3PBT A;  1KE0 A;  2W27 A;  1MPL A;  2Y2P A;  5CGS A;  3A0V A;  4B88 A;  3IX3 A;  1SCW A;  2ZM2 A;  4HJ4 A;  4Y0T A;  4R6L A;  5GL9 A;  4WBG A;  1KVM A;  1F9I A;  4O7D A;  4DE1 A;  2FH5 A;  1STZ A;  4GB7 A;  4JGP A;  2H28 A;  1RP5 A;  2QHK A;  1NLZ A;  4IED A;  3SOI A;  2D02 A;  1K54 A;  1MBL A;  2XH9 A;  3GDI A;  5E43 A;  1YPR A;  2YKH A;  1JWV A;  3CI6 A;  4M3K A;  1ERO A;  3T4L A;  1L0F A;  1T19 A;  4BL3 A;  2L4R A;  4DJ3 A;  5IU1 A;  1W5D A;  3ZNY A;  2ZJ9 A;  5FDH A;  1GCE A;  2QZ6 A;  1N9N A;  3FC7 A;  4LLO B;  3UPP A;  2XD1 A;  4DF6 A;  4GDN A;  5EE8 A;  4P87 A;  4NXE A;  3HVF A;  1M40 A;  3UE0 A;  3S7Q A;  3Q82 A;  3ICY A;  5A90 A;  5HAP A;  1GSW A;  1PI5 A;  4GS9 B;  2Y2I A;  3LEQ A;  4KZ5 A;  3R7W B;  5EV0 A;  1PWC A;  3IX4 A;  2Z2L B;  2VEA A;  2J9O A;  2QMI A;  5BOH A;  1RCJ A;  3CIT A;  2EWW A;  2QYB A;  2OWJ A;  4S2I A;  1NYY A;  3C4P A;  4Y5F A;  5GLD A;  3VSK A;  5EM1 A;  3AGE A;  1SHV A;  4OH0 A;  4NG2 A;  1ONG A;  5HAR A;  4FOF A;  4X25 A;  4ZDX A;  3DTE A;  4B4Z A;  2XK1 A;  1GHP A;  3UB7 A;  2Y2K A;  4JBF A;  3BM6 A;  3UE6 A;  3BJN A;  1IKG A;  5F5Y A;  4HI4 A;  3JYI A;  2XRN A;  1YSQ A;  1H3Q A;  2VA0 A;  4BBV A;  4WF0 A;  1T18 A;  4GJ4 A;  3ZHH A;  4CLC D;  3BRM A;  4HH2 A;  4WMC D;  5AVE A;  1Z6F A;  3CWF A;  1FSW A;  2J8Y A;  4YOF A;  4KG2 A;  3C8C A;  2A2L A;  1OTI A;  5HL1 A;  4K91 A;  3I7J A;  3VP0 A;  4M4X A;  4L0L A;  1SDE A; 
#chains in the Genus database with same CATH homology
 1UGU A;  4Q0J A;  3PBO A;  4BWI A;  1OTD A;  2M1C A;  1NWZ A;  4MN6 A;  2P7J A;  1TS7 A;  3NOU C;  4EER A;  4PHT A;  2IA2 A;  2LB9 A;  1S67 L;  3KO6 A;  3E98 A;  2Y8H A;  2P04 A;  5HWV A;  1IOU A;  1LSX A;  1GSX A;  1OJ5 A;  2OAQ 1;  3BY9 A;  1ODV A;  4MCW A;  3TRC A;  4P6Z S;  3U2A A;  5IT5 A;  3CAX A;  2K7S A;  2KX6 A;  1OTE A;  4EEP A;  4KQD A;  2J3T C;  4BBU A;  2W1R A;  3E0Y A;  1H8M A;  4JGQ A;  4WEK A;  1DP8 A;  3T4K A;  3EQU A;  3EQV A;  3MFX A;  3MQ0 A;  3MXQ A;  2OOL A;  4CLC C;  2XA7 S;  5HPI A;  2JKR M;  2PYP A;  3SW1 A;  1TS8 A;  2JKT M;  3UB8 A;  5G4Z A;  2VKS A;  3E4Q A;  1YSP A;  3EWK A;  3HCY A;  2EWV A;  3E4P A;  3G6O A;  4H6J A;  4HOI A;  3K3C A;  2W3G A;  4E04 A;  3IS2 B;  2V9A A;  2VJW A;  2ZMF A;  3LR3 A;  3LI9 A;  4MN7 A;  2B02 A;  1KOU A;  2DMW A;  2INW A;  3LFV A;  5HWT A;  3RH8 B;  4LRY C;  4WLA A;  4MN5 A;  1BYW A;  1YAX A;  4F3L B;  4MMN A;  3T4S A;  4P6Z M;  1S1Y A;  2OWH A;  5CX7 A;  1LSV A;  3LIB A;  3R4K A;  2NUP C;  3OOV A;  4YNR A;  2V1B A;  3F1O B;  3NHQ A;  4WN5 A;  4I38 A;  5KSH A;  4HH3 A;  2PR5 A;  2YKF A;  4NXF A;  4GLQ A;  3LI8 A;  2PD8 A;  4LRX C;  4EES A;  3LR0 A;  3NOT C;  3VE3 A;  4ETZ A;  2A24 B;  2LB5 A;  1S1Z A;  2JHE A;  3F1P A;  1UWP X;  1W63 Q;  2VV8 A;  4B93 A;  4B9O A;  4I5S A;  3UME A;  5F68 A;  2J3W A;  4GS9 A;  5J7E A;  2VV7 A;  3IBJ A;  1D7E A;  1MKM A;  2O9B A;  2KOI A;  2Z6C A;  2XSS A;  3T4O A;  3LIE A;  3B47 A;  3JVU A;  3ULF A;  5I5L A;  2W3E A;  4NEE D;  2VX8 A;  5TBM A;  2PR6 A;  1TS6 A;  4HP4 A;  4I39 A;  5KIZ A;  2O9A A;  3BY8 A;  3LR5 A;  4XT2 A;  3PHY A;  5TJJ A;  4O0P A;  4UQI M;  5HSQ A;  1OT6 A;  1XFQ A;  3EOI A;  4HHD A;  4WEL A;  3KYQ A;  5IS1 A;  3PBS A;  4ETX A;  2G7U A;  2HJ9 C;  4ARZ A;  2HF6 A;  3TW8 A;  4Q0H A;  2I9V A;  4QPR A;  2QJ7 A;  4G3K A;  3T4T A;  3OC2 A;  3C30 A;  1P9W A;  4YWZ A;  4EEU A;  3H82 A;  1XJ3 A;  4I3I A;  4EQ1 A;  1MZU A;  3UB6 A;  2W1T A;  1OTA A;  4OOL A;  1X0O A;  3S7N A;  5HL6 A;  3T4Q A;  3HJK A;  5HPF A;  2WKQ A;  3D72 A;  5AVF A;  1OT9 A;  2PYR A;  1F98 A;  4OOM A;  4BBT A;  2P08 A;  2BAS A;  4Y3I A;  2O0Y A;  4GW9 A;  4EU0 A;  3LYX A;  1DP9 A;  3KSI A;  2O9C A;  5L8M A;  1TD5 A;  1VHM A;  3BQA A;  3PBR A;  1P0Z A;  2JKR I;  1S4S A;  2ZBB A;  5K5B A;  3P7N A;  2V0W A;  4IHQ A;  2JKT I;  1NLY A;  2QWS A;  3S7P A;  2K31 A;  3BW6 A;  2PD7 A;  5DF9 A;  3C2W A;  5C5K A;  5J3W A;  1OPX A;  4L9G A;  2NUT C;  4CLC E;  3S7O A;  4NXG A;  4K08 A;  2OAP 1;  3TE8 A;  4KUK A;  2WKP A;  4GHI A;  4HY8 A;  3KSF A;  4NXB A;  4WUJ A;  1DP6 A;  3CUE A;  3KX0 X;  3BWL A;  5LBR A;  3VV4 A;  3PBN A;  2B18 A;  3P01 A;  4ME4 A;  5MC7 A;  1T1A A;  4R38 A;  3MQO A;  1G28 A;  4BJP A;  3PYP A;  1ZTU A;  5EFW A;  1JNU A;  3LR4 A;  4PKY A;  2VV6 A;  1OJG A;  1EW0 A;  3E4O A;  1XJ2 A;  3V67 A;  4BMW A;  1S66 L;  4PAU A;  3W2Z A;  2HGV A;  2PT7 A;  1UWN X;  1LL8 A;  4Y2F A;  3HJI A;  4LRZ E;  4G3W A;  4JGO A;  5J4E A;  1OTB A;  4FSF A;  4WL9 A;  5DKL A;  2K2N A;  3PR6 A;  3EGX C;  4HJ6 A;  4MDZ A;  2KDK A;  2XA7 M;  1LSW A;  4EW7 A;  1T1B A;  3KSH A;  4XT2 B;  2ZMV A;  3NOP C;  1DRM A;  4II7 A;  1TF1 A;  3CLO A;  2O99 A;  1N9L A;  2QKP A;  3LUQ A;  3DBA A;  5DJU A;  4R3A A;  3FG8 A;  4I3J A;  4UEY A;  3IS2 A;  3JVV A;  1XJ4 A;  3CUE C;  1VB6 A;  3ZYT A;  4PKY G;  3B42 A;  3R7W A;  4HP9 A;  2VGL S;  4O8G A;  3MMH A;  4CLC B;  3UB9 A;  3UE3 A;  5HD3 A;  3F1N A;  4F3L A;  2V0U A;  5G4Y A;  1Y28 A;  4LPZ A;  3IBR A;  4NKP A;  3B33 A;  3MF0 A;  2QJ5 A;  3O5Y A;  1D06 A;  2W1T B;  3F1O A;  3LIA A;  1V9Z A;  3H9W A;  3EEH A;  3KYZ A;  2MJ6 A;  4Q0I A;  1LT0 A;  1P9R A;  3LIF A;  3UMD A;  5HDD A;  2A24 A;  3KSG A;  1S4R A;  5A8B A;  4ZRR A;  2GNX A;  3GEC A;  3MR0 A;  1F5M A;  2ZOI A;  4GCZ A;  3PBT A;  2W3F A;  2FZ0 A;  2W27 A;  3D3O A;  2HV1 A;  2EA9 A;  1TS0 A;  2GX5 A;  3A0V A;  3TJZ C;  2VGL M;  4EUV A;  2WKR A;  2L1M A;  3H7W A;  4HIA A;  1P97 A;  4HJ4 A;  4H6J B;  2M7U A;  4DJ2 A;  4R6L A;  1G6O A;  1F9I A;  4GHI B;  3C38 A;  2FH5 A;  5FL3 A;  1STZ A;  3A0R A;  3NJA A;  4Z1W A;  4JGP A;  3RFB A;  2H28 A;  2QHK A;  4O01 A;  1NLZ A;  5HD5 A;  5HDC A;  1XJ6 A;  2D02 A;  2ZOH A;  1W63 M;  3GDI A;  2W0N A;  4AFI A;  2YKH A;  2JN7 A;  2PHY A;  4I3A A;  5DFX A;  1T1C A;  3CI6 A;  2Z6D A;  3T4L A;  3OCN A;  2CMN A;  1NRJ A;  1T19 A;  3LIC A;  2L4R A;  4DJ3 A;  5IU1 A;  4HQA A;  4IUK A;  2VLG A;  3ZQ5 A;  4DMZ A;  2J80 A;  1N9N A;  3FC7 A;  4IJG A;  4LLO B;  1IFQ A;  5AJG A;  4CQH A;  5F6A A;  4NXE A;  2V1A A;  3S7Q A;  4R70 A;  3F1P B;  3OLO A;  3ICY A;  3PXP A;  3EEA A;  1GSW A;  4RQ9 A;  4GS9 B;  3VE4 A;  2XRO A;  1YKD A;  4EXO A;  3R7W B;  4HJ3 A;  2M7V A;  4UQI S;  2VEA A;  3OBF A;  5TBM B;  3OCL A;  3CIT A;  2EWW A;  2QYB A;  3F1N B;  2OWJ A;  4Y5F A;  1XFN A;  4ARZ B;  2D01 A;  4JGR A;  1MC0 A;  3T4J A;  3RTY A;  4FOF A;  1V9Y A;  5DKK A;  2VZW A;  2Y79 A;  1N9O A;  2W3D A;  3H82 B;  3T50 A;  2PDR A;  5F69 A;  4G3V A;  4EET B;  3A0S A;  3UB7 A;  2GZA A;  3FPV A;  2R78 A;  1WA9 A;  3UE6 A;  5HZH A;  3K3D A;  3K2N A;  4KUO A;  3BJN A;  5F5Y A;  2J3T D;  2HJE A;  2GJ3 A;  5DFY A;  4HI4 A;  2XRN A;  1YSQ A;  2L0W A;  1H3Q A;  5HWW A;  2KLI A;  3BQ8 A;  2VA0 A;  4KQO A;  4BBV A;  4WF0 A;  1T18 A;  4GJ4 A;  3MQQ A;  4CLC D;  3H7W B;  4HH2 A;  3FPW A;  5AVE A;  3LID A;  3CWF A;  3PBQ A;  4WEJ A;  4YOF A;  1ZHH B;  2W3H A;  3C8C A;  4L9E A;  2A2L A;  4L9F A;  4DN0 A;  1OTI A;  5HDS A;  4HNB A;  3MJQ A;  4CLC A;  3VOL A;  3EGD C;  5DJT A;  4IUH A;  4M4X A;  4L0L A;  1GSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...