1T1AA

Late intermediate il1 from time-resolved crystallography of the e46q mutant of pyp
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title A Structural Pathway for Signaling in the E46Q Mutant of Photoactive Yellow Protein
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Photoreceptor
total genus 33
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2004-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1t1aA00
1BYWA 1DP9A 3LUQA 4L9EA 2KDKA 1DP6A 1S67L 1OTBA 4LPZA 1S1YA 3NJAA 1OTEA 5HDDA 1N9LA 3H7WB 3UB6A 4DJ2A 1DP8A 2JHEA 4NXGA 2QJ5A 4I38A 4NXEA 4L9FA 2PD7A 4JGRA 1OJ5A 4R6LA 4WUJA 4KQDA 5HDSA 5IS1A 1Y28A 2VEAA 5IU1A 3A0RA 4PKYG 4HP4A 4R3AA 5F69A 3SW1A 1TS7A 2YKHA 1XJ2A 3A0VA 1UGUA 3IBRA 4B9OA 1OT6A 4MN5A 5F68A 4L9GA 4GS9B 4F3LA 1MZUA 5AVEA 3UB7A 4M4XA 3MQQA 2V0UA 4HOIA 3LIBA 5F6AA 4HJ3A 4LLOB 3E4QA 1LSXA 2PHYA 1F9IA 2JN7A 3RTYA 5J4EA 1OJGA 2WKRA 3EWKA 3GDIA 5KIZA 3CLOA 3F1PB 4H6JB 3UMDA 3RH8B 2ZBBA 4BBVA 3HJIA 4E04A 4XT2B 5J3WA 5HSQA 3IS2B 2VLGA 3PHYA 5DJUA 3UMEA 1N9OA 2PYPA 1XJ4A 1GSVA 2INWA 4MN6A 2Z6CA 4JGPA 5A8BA 4HIAA 1OT9A 2WKQA 2GJ3A 2A24B 4DJ3A 3FC7A 3NOPC 2B02A 3VE3A 4I3IA 3UE6A 3MR0A 1G28A 1LSVA 3LICA 1D7EA 4EQ1A 2V0WA 2OWJA 3BY9A 3F1NB 3LIAA 5DJTA 4EEPA 3PYPA 3E4PA 2PR5A 1P0ZA 4HH2A 1KOUA 2V1AA 1TS8A 3F1OA 1NWZA 3HJKA 3MJQA 3ICYA 4LRZE 4GHIA 4PKYA 2P7JA 4I3JA 2L0WA 2L1MA 3H82A 2OWHA 3CAXA 3NHQA 1UWPX 4I39A 2W0NA 2PYRA 2VV8A 1T1CA 3LIDA 4KUOA 2ZOIA 5TBMA 2H28A 3C2WA 3LIFA 1OTDA 3VOLA 2ZOHA 2VV7A 5F5YA 4I5SA 5HD3A 4LRYC 2D01A 2VV6A 3OLOA 5AVFA 4LRXC 1EW0A 5J7EA 3C8CA 3LIEA 3VE4A 1VB6A 4JGOA 3FG8A 5DKLA 3E4OA 1LSWA 3UB8A 2QWSA 5G4YA 4F3LB 4I3AA 3F1PA 4H6JA 4NXFA 4EESA 3A0SA 2OOLA 2Z6DA 1X0OA 4GCZA 1JNUA 3H9WA 1S66L 1XFQA 5HZHA 3LYXA 2YKFA 4NXBA 3KX0X 4WN5A 4K08A 4EETB 1S4SA 3G6OA 3ZQ5A 1GSWA 3BWLA 3NOUC 4GW9A 4HNBA 3NOTC 4WLAA 1V9YA 4HH3A 1TS6A 3B33A 5HWWA 4HHDA 4R38A 3MQOA 4KUKA 3CWFA 1S4RA 5EFWA 3H7WA 2D02A 4WL9A 1T19A 4RQ9A 4WF0A 2BASA 4R70A 1LL8A 4EW7A 5I5LA 3ULFA 3MXQA 2V1BA 4HP9A 3MFXA 2M1CA 1WA9A 1S1ZA 3UB9A 1OTAA 2K7SA 1N9NA 4JGQA 5HDCA 4HJ6A 1XJ3A 3F1OB 2V9AA 4HY8A 3D72A 4GS9A 4GHIB 5HD5A 3K3DA 4HQAA 2J80A 3H82B 1T1BA 4BBUA 2EA9A 1LT0A 1P97A 5TBMB 3BY8A 3LI8A 3GECA 2PR6A 2CMNA 2I9VA 4EERA 1UWNX 2PDRA 1OTIA 4XT2A 4YWZA 3IS2A 4EEUA 2QHKA 3K3CA 1ODVA 4BBTA 3LI9A 5HWTA 2R78A 2A24A 1XFNA 5HWVA 1D06A 3T50A 5G4ZA 1T18A 1F98A 2HV1A 1V9ZA 3P7NA 4EXOA 1XJ6A 2QKPA 5DKKA 3F1NA 2W27A 1T1AA 4HI4A 1GSXA 2QJ7A 1TS0A 3EEHA 2WKPA 4HJ4A 1DRMA 2PD8A 2L4RA 2KX6A
chains in the Genus database with same CATH superfamily
3VSKA 1CI8A 1K4EA 4Z1WA 1NRJA 5GL9A 3IH9A 4II7A 2HGVA 3JVVA 1MC0A 1G68A 3CJMA 2WADA 1E3UD 1DP8A 1W79A 1FCNA 3LO7A 3T4SA 2HDSA 3TRCA 3ITAA 5HAPA 2QJ5A 3LCEA 1K56D 2ZMVA 1F2KA 1YLPA 2ZQ8A 2M7VA 4Y15A 1Y28A 2FZ0A 3ZG8B 2EXBA 4WM9A 2ZC6B 2A49A 1JTGA 4S2LA 4R3BA 1TEMA 5GLDA 2W1TA 1TS7A 3SZTA 1OT6A 4MN5A 2O9AA 1ESUA 4L9GA 3VFFA 2P9VA 1CQAA 3LR3A 4K0XA 1PW8A 3GV9A 4OP5A 3S4XA 3SH7A 1G6OA 1LLBA 4G3VA 3RJUA 3LEQA 4OKPA 2EFUA 2V0UA 3E0YA 3LY4A 1K54A 1PWDA 5KSHA 3W8KA 2JN7A 4FD8A 1OJGA 3T4LA 2WKRA 2KOIA 3EWKA 5KIZA 3CLOA 3PAGA 2Y4AA 1K54C 2XD5A 5FAQA 3F1PB 5HL6A 2R9WA 3OPRA 1DJAA 1RGYA 3Q82A 1H3QA 2ZBBA 3MXRA 5DVAA 2XFTA 4OP8A 1BSGA 2J9PA 2OAQ1 5CECA 2NUPC 5DJUA 4CLCC 3UO9A 1P9RA 3E98A 4KZ6A 4S2IA 4ZAMA 1XGJA 3SS3A 2WYXA 1K4FA 3IWIA 2WGIA 4MN7A 3FC7A 3NOPC 1LL5A 3R7WB 4NEED 4Y7PA 2B02A 1AXBA 3NCKA 1G28A 2A2LA 1PI5A 1D7EA 4EQ1A 1PYYA 3CZDA 3ZCZA 2OWJA 1TF1A 3F1NB 4IBXA 5DJTA 1ERMA 3BJNA 5KMWA 3TW8A 3PYPA 4S2JA 1NRFA 5CGWA 5A91A 1S0WA 1KOUA 3MBZA 1OMEA 1NY0A 3O87A 3F1OA 4QD4A 3HJKA 3MJQA 1NZOA 5AQ9A 3CG5A 2Z2MB 3G30A 3IF5A 2L1MA 3S1YA 2VK3A 1KDWA 4DF6A 2VX8A 3PBTA 2W0NA 2V2FF 2VV8A 2Y2MA 4KUOA 5HARA 4QHCA 1O7EA 3LIFA 4CPKA 2Y2HA 1OTDA 4GZBA 4JF4A 5F5YA 1SZVA 4GD8A 2D01A 1W63Q 5TJJA 2PU2A 5FQJA 3FV7A 1EW0A 1K57A 1TDLA 5J7EA 1IYPA 2Z2LB 3IF6B 3VE4A 1L2SA 3FG8A 3MQ0A 3UB8A 3G31A 2Q9NA 2QWSA 2W3DA 4PM8A 1VEUA 2UWXA 1SKOA 3ZNYA 4PM6A 3HUMA 4WZ4A 1YLJA 4ZDXA 5DFYA 1KE3A 2MJ6A 4NXFA 4S2PA 5CEDA 4AFIA 3DTIA 2FH5A 4GNUA 2J8YA 4Y0UA 3UE3A 1S66L 3DTMA 1YSPA 1FIKA 3LYXA 5CTMA 4NXBA 1KE0A 4MDZA 2XQZA 1ALQA 1Q2QA 1LL9A 2ZL1A 2HF6A 4PM9A 4DRTA 3NOTC 3S7NA 5CHUA 1K0KA 1QMEA 5HWWA 2HP5A 1JTDA 3RXWA 4R38A 3MQOA 1NXYA 4BLMA 5EFWA 3LEZA 2D02A 1T19A 4RQ9A 4IEDA 4WF0A 2ZM2A 4RX3A 3ZG0A 4E3IA 4R70A 1NYMA 3AGDA 4KG6A 2EX8A 3HLCA 1Q2PA 1ACFA 1MPLA 3SH8A 3ULFA 3MXQA 1EWZA 2XROA 1KVLA 3KYEA 4IUKA 3T4OA 3HCYA 4RA7A 3PBNA 1RGZA 1PFLA 3MFDA 2K7SA 2PAVP 4HJ6A 5EOOA 2V9AA 2IWBA 2R9XA 3ZG9B 1KGFA 3KYQA 5KZHA 1W8YA 4DMZA 3V39A 2LB5A 3IT9A 2ZMFA 3UDXA 3H82B 4BL2A 4CLCD 4BBUA 1TVFA 5EECA 1E3UA 2W1TB 5FI2A 1LT0A 1BLCA 1P97A 2PBDP 3IHBA 1K56A 3GECA 2VGLM 2J3TD 4N9LA 4OQIA 2Y2KA 1MY8A 1J9MA 2W3GA 1ES5A 1HTZA 1VHMA 2WZZA 3ZG5A 1OTIA 1HZOA 5EUAA 1TDGA 4YWZA 2JE5A 3K3CA 5DTSA 3UY6A 3BRMA 1I2WA 2OLUA 3OCNA 3V67A 1ODVA 3ZVTA 4P6BA 2OLVA 3EOIA 1IYOA 3CUEA 2R78A 4E6XA 1XFNA 3UE1A 2WAFA 3R7WA 4CLCB 5TR7A 3CUEC 1MXOA 1T18A 4UHUA 4UQIS 5CGXA 3VP0A 4O01A 5GLCA 2GX5A 4S2MA 3DTEA 3QP4A 3IXDA 3ZDJA 3F1NA 1T1AA 2FFYA 4ZBEA 4OH0A 1GSXA 1WYCA 4NETA 3MXSA 4R1GA 1PRQA 3IH8A 4NKPA 4ARZB 1BLPA 2PD8A 3HLBA 2KX6A 5FATA 3DWKA 2EX9A 5FDSA 4H8RA 2HDQA 3WRZA 4JXGA 1S6RA 4GOGA 4YFMA 3M6HA 3H7WB 4DJ2A 3BM6A 1MKIA 1XX2A 4OVDA 5L10A 2IWDA 4NXGA 1BLSA 2M7UA 1STZA 4L9FA 2JKGA 5EVEA 4N92A 1BTLA 4GD6A 4MLLA 4E6WA 5HDSA 3C30A 2VEAA 1XPBA 3LR0A 5IU1A 2O9BA 5F69A 3B42A 3IF6A 4WEJA 2XR0A 3A0VA 4KZ8A 3IF6C 2DMWA 5F68A 2W3FA 4R23A 3EGXC 5AVEA 4P87A 3UB7A 4X69A 1IYSA 5HPFA 2C5WB 3ISGA 5FL3A 4S2OA 3A3EA 4HOIA 1FILA 3VP2A 4Y5FA 3E4QA 2JBFA 3RFBA 1YLTA 3N8RA 1Y4OA 1MWSA 1K6RA 2PT7A 2Q0OA 4MBHA 1VEUB 3PBOA 5HX9A 1JWPA 3IBJA 3QHYA 3QNCA 3FWLA 3HJIA 4QU3A 1LI9A 5J3WA 3HBRA 2W3HA 2B5RA 2WGWB 1YLWA 4DXBA 1IKGA 1GSVA 1BUEA 4JGPA 3NBLA 4S2NA 4ZJ1A 4OONA 3HLDA 2GJ3A 3IXHA 4KG2A 4S2NC 5EVLA 3L9KA 4I3IA 3ZFZA 5DTTA 1K25A 1LSVA 2XK1A 2ZLYA 5BOHA 3IX3A 4PHTA 1F5MA 5HPIA 2LB9A 3VP4A 4WELA 1NJ4A 3T4TA 2PR5A 2IWCA 2EWWA 4CJNA 2ZC7A 3OPHA 5F1FA 3OOVA 3PR6A 4DN0A 1YAXA 4LFUA 1PW1A 4WBGA 2JKTI 2P7JA 2Y8HA 3SH9A 4R3JA 3FKWA 3G35A 3H82A 2OWHA 4EWFA 3NHQA 2PYRA 1T1CA 3UPNA 3T4KA 4IVIA 3GMWA 3V3RA 4ME4A 3JYIA 2H28A 5DF7A 2Y2NA 4UAAA 3VOLA 3GTCA 1NYYA 4I5SA 1ES3A 4BD1A 4LRYC 3OLOA 1W63M 3Q7VB 4LRXC 4WMCD 1GA9A 3LIEA 4A5RA 5JYOA 1XXMA 3FYZA 5DKLA 3E4OA 2FFFB 1L0EA 1J3WA 4CLCE 4I3AA 4DE2A 4EBPA 1ONGA 3O88A 2WK0A 4F94A 2BTFP 4KZ9A 3B47A 1YPRA 3BEBA 4C75A 4N1HA 4EESA 3O3VA 4KZBA 1N9BA 4CLCA 4Y17A 2Y59A 4B4ZA 1JNUA 3KSHA 3P98A 4GLQA 4EUVA 1K55A 2WZXA 3W2ZA 2Y2LA 2JKTM 5E2FA 1K55C 4K08A 3MZFA 3T1SA 1GSWA 1FR6A 4ARZA 2J3TC 3OC2A 2XA7M 3BWLA 3OCLA 3PBRA 3NDEA 1WE4A 3D3OA 4HH3A 1TS6A 3NULA 3EGDC 4FOFA 1KE4A 4HHDA 3WS2A 3BFFA 1GHMA 2ZJ9A 3H7WA 3QP6A 4OOLA 5EVIC 4OQ0A 4BJPA 3S22A 5AQAA 2BASA 4E3JA 1JWZA 3VP1A 3S7QA 3HVFA 1I2SA 1LL8A 2NUTC 4X68A 1GCEA 5HL1A 5EM1A 3Q7ZA 3Q81A 3LR4A 3S7PA 1N4OA 5TFQA 5CXWA 4FH2A 1ZHHB 3MFXA 4Y13A 4MMNA 1ESIA 3MZDA 1N9NA 4JGQA 5CEBA 4KQOA 1PWCA 3TE8A 1I5QA 4WYYA 4GHIB 3CPTA 3LGOA 3K3DA 3N4IA 2WKIA 4PAUA 4KG5A 5M1AA 2C6WB 2ZQ7A 3P01A 3BLSA 2EFXA 5GHXA 4LGWA 2V8CA 2PR6A 3VOYA 3MKEA 3CITA 5FQIA 4IHQA 2H5SA 1BT5A 3BFEA 2PDRA 4QPRA 3T1RA 4EUZA 2WGWA 5AQBA 3QP2A 4BBTA 3IX8A 1DY6A 3LI9A 1YMXA 5HWTA 1NLZA 4IBRA 3MZEA 1D06A 5HWVA 3WS5A 2Y2QA 5G4ZA 5M18A 2XLNA 4ZRRA 1F98A 2VZWA 1V9ZA 2P08A 1KGGA 2QKPA 5E2HA 4XXRA 2RCXA 2W27A 5HAIA 4LV0A 2Y55A 1FCOA 2QJ7A 1TS0A 3EEHA 1YT4A 2WKPA 3P09A 4KQRA 4HJ4A 1DRMA 3M2JA 2XSSA 1BYWA 1DP9A 5AJGA 4QB8A 1S67L 3WS1A 1OTBA 4UA7A 4Z9QA 1XGIA 4PPRA 3NJAA 3ZNTA 1MWTA 1OTEA 5HDDA 1N9LA 3UB6A 3WWXA 2BLSA 2HDRA 2ZC4B 2ZQ9A 3NC8A 4NXEA 1KVMA 3W4QA 2WUQA 2PD7A 2PU4A 3VSLA 5AQ7A 5HFOA 3A3FA 4LV2A 4WUJA 4FCFA 4OQHA 1IEMA 4X6TA 1M40A 4ID4A 5DF8A 2Y2PA 1BLHA 3Q7VA 4X53A 4PKYG 4ZJ3A 3SW1A 2YKHA 2XGNA 4YINA 3IBRA 2XH9A 4B9OA 5FAOA 1MZUA 4LCLA 5HW3A 1YMSA 4ESPA 1FSYA 3LFVA 3MQQA 2GDNA 3NIAA 5F6AA 4HJ3A 1FR1A 2VGLS 1IKIA 5I94A 2HP6A 5C5KA 2PHYA 5J4EA 3V3SA 4WZ5A 4KZ3A 5EVID 4ZTKA 3DAVA 1U60A 1W7FA 2Y2OA 4PM7A 2XFSA 4WZ5C 1G5UA 2X71A 4P6ZM 3RH8B 5A93A 3RXXA 4PM5A 1LHYA 4E04A 1H8MA 4WEKA 3AGEA 4WMCA 4C3QA 3IS2B 4BENA 3PHYA 3UMEA 3VMAA 2PYPA 4DXCA 2I72A 4GN2A 2K31A 5A8BA 5FQKA 1OT9A 3T1QB 4BWIA 2WKQA 5MC7A 4DE0A 1SDEA 5G18A 1CEGA 4N1XA 2V0WA 3BY9A 3M2KA 2E8IA 5EVIB 3LIAA 5FQ9A 3HREA 2ZD8A 2WKHA 2V8FA 3KSFA 3BW6A 4FTXA 3E4PA 4JKTA 2ZC3B 3D9YA 4KZ5A 4EQIA 4JXVA 2AVXA 1KDSA 4Y2FA 5L09A 4HH2A 2V1AA 1RP5A 2ACGA 1TS8A 1A0KA 2JKRI 1NWZA 2IA2A 3MSHA 3S7OA 3UNWA 1SCWA 4LRZE 3ZVWA 4GHIA 4PKYA 4I3JA 1MWRA 4DKIA 3CAXA 3ZYTA 1K6SA 2JKFA 5CHMA 2ZOIA 2VKSA 3OBFA 4CQHA 4EV4A 3HLFA 3QP8A 2ZQAA 3WS0A 2OSUA 5FSRA 3BFGA 2X01A 3CPTB 3O5YA 2ZOHA 1FSWA 3E2LA 5CHJA 2PBYA 3N6IA 2VGJA 1PZPA 5A90A 4HBTA 5K5BA 3NDGA 4GDBA 4U0TA 3BLMA 4OPZA 4E3KA 1ZG4A 2ZQDA 3IWQA 1CK3A 1PIOA 1VB6A 2A3UA 3TJZC 3NI9A 3QNBA 5G4YA 4F3LB 2G7UA 3A3DA 3VFHA 4H6JA 5F1GA 3SOIA 5EPHA 1FOFA 2P04A 4B93A 3C4OA 3C4PA 3A3JA 2ZM8A 2OOLA 5L07A 1GHIA 4MBKA 3VOZA 3N7WA 2JKRM 3DWZA 3H9WA 3M6BA 4BD0A 1XFQA 5HZHA 2EWVA 2YKFA 4GDNA 4UA9A 3FPWA 3KX0X 2HJ9C 5EV0A 3ZQ5A 3NOUC 4GW9A 4HNBA 3IQAA 5FI6A 3EEAA 5GLBA 3ZGAB 5TGFA 3TOIA 4BQMA 4Y3IA 4WLAA 3V5MA 1VETB 1ZKJA 3HLGA 1NZUA 1S4RA 4UA6A 4D60A 4WL9A 4KZ4A 1L0FA 4GJ4A 3KSGA 4JLFA 2HJEA 5DF9A 4OOMA 4L0LA 3ITBA 5GHYA 2RL3A 4MBFA 4FSFA 4E3LA 2QZ6A 3FKVA 4B88A 5CTNA 2M1CA 2E8JA 1FCMA 3C7VA 3W4PA 1OTAA 2O99A 5HDCA 1XJ3A 2H10A 5U47A 2WAEA 4E3OA 1L0DA 3QP1A 4EBLA 3GR2A 4N9KA 4HQAA 3IWOA 3BFCA 1MWUA 1M6KA 1T1BA 2QPNA 1YLZA 1RCJA 3UPOA 5FDHA 1MBLA 3UDFA 2X02A 5TBMB 2WGVA 1XA1A 2W1RA 3LI8A 4YNRA 3HUOA 3OZHA 2CC1A 4DDSA 4IUHA 4XUZA 3C7UA 2CMNA 1BZAA 4JXSA 4EERA 1UWNX 3LR5A 1D1JA 3Q07A 3CHWP 2GZAA 2UV0E 3K2NA 3IS2A 4EEUA 4R4RA 2QHKA 3C38A 1PWGA 3BECA 3N8LA 1GA0A 5M19A 1YLYA 2HPBA 1SHVA 4HESA 3UE0A 1HLUP 3T50A 1H8YA 5L2FA 3SS4A 4OPYA 2HV1A 4NK3A 1XJ6A 1HD8A 3DW0A 5DKKA 5EVIA 3GSGA 2XA7S 2O0YA 1DJCA 1ZG6A 4KZAA 2EXAA 2QMIA 4OLDA 3G2ZA 3EQVA 5CGSA 3LUQA 5CX7A 4L9EA 2KDKA 1DP6A 1YM1A 4LPZA 1S1YA 5F82A 2XEPA 3I7JA 1E4DA 3G4PA 4YOFA 1HVBA 1MKMA 1VQQA 5JYPA 2JHEA 2BG1A 1IYQA 4B4XA 2J9OA 4Q0IA 3KO6A 5E43A 4I38A 4FH4A 4ETZA 4JGRA 1OJ5A 4KZ7A 4R6LA 1EROA 3BYDA 1XP4A 3DTKA 4KQDA 5FEFA 5IS1A 5FASA 1QMFA 1AWIA 2G2UA 3A0RA 4R3AA 4HP4A 3T4QA 2DNSA 1XJ2A 2H0YA 1UGUA 3R4KA 1Y54A 4OPRA 3KYZA 3T4JA 1PZOA 1VM1A 4GS9B 4F3LA 2J3WA 3TG9A 4LV1A 3E2KA 5CRFA 1SDNA 4M4XA 4Q8IA 1OPXA 2B95A 1IELA 2XF3A 1G6AA 3WRTA 3FZCA 3LIBA 4LV3A 4LLOB 1CF0A 4MNRA 5DTKA 4JF5A 3MKFA 1K57C 1LSXA 2K2NA 4Q0HA 1F9IA 5EOEA 3RTYA 3UDIA 5E2EA 3GDIA 4U0XA 4OQGA 4H6JB 3UMDA 3V50A 4R4SA 3VP3A 3PBQA 4OOYA 4BBVA 1YKDA 1IFQA 4E3MA 4XT2B 5HSQA 2VLGA 3DBAA 3TSGA 1N9OA 1VETA 1XJ4A 4ZJ2A 2INWA 4MN6A 2Y2IA 2Z6CA 4HIAA 1P9WA 2A24B 4DJ3A 3MS6A 1EI5A 2ZM0A 2H0TA 4QY6A 3VE3A 3UE6A 3MR0A 1NLYA 3LICA 2Y79A 3BFDA 3N8SA 1W5DA 1H5XA 4EEPA 3G34A 2HZ5A 2W3EA 3U4LP 5IT5A 2EX2A 2Y91A 4Q0JA 1P0ZA 4PMAA 1TD5A 1ONHA 2VA0A 5GHZA 3PXPA 1XKZA 4P85A 5A92A 3HLEA 3AGFA 2JCHA 2HDUA 1YQSA 3D4FA 3ICYA 4OPQA 2ZC5B 5FQMA 4XUXA 3W4OA 3UB5P 3A3IA 4IVKA 2L0WA 3PAEA 1CEFA 3BQAA 2QYBA 3LY3A 1UWPX 3T1XA 4I39A 3LIDA 3HL9A 1JWVA 5FAPA 5TBMA 2Y2JA 1PI4A 3C2WA 2VV7A 1KGEA 4LENA 5HD3A 4P0MA 2VV6A 5AVFA 1ES2A 5FA7A 5FQQA 4M3KA 2DRWA 4JF6A 3OPLA 2KLIA 3C8CA 4JGOA 1H8ZA 4MCWA 1SKFA 1LSWA 4RX2A 1DJBA 5FI7A 4R0QA 2P9VB 2J7VA 3BQ8A 3F1PA 3OPPA 2HP9A 5HAQA 3O86A 3G32A 5CERA 4FUWA 5E2GA 4GB7A 2ZMAA 4JXWA 3ZHHA 3A0SA 4K91A 4E3NA 1WYBA 4DE1A 4UEYA 2Z6DA 3C5AA 4OLGA 1X0OA 3JVUA 4HEFA 4GCZA 4LCMA 1Z09A 1L3LA 4P6ZS 3IHAA 5EM0A 4O7DA 4UQIM 4WN5A 4EETB 1S4SA 3MF0A 4KENB 3G6OA 4NG2A 4X1LA 3HLWA 4X56A 4HBUA 1V9YA 1CI9A 3B33A 1XA7A 1FQGA 5J8XA 3IX4A 3VV4A 4KUKA 2WKEA 3CWFA 5FEGA 3UPPA 3KSIA 3B3XA 3EQUA 4MEZA 3NY4A 3Q1FA 2V1ZA 4JPMA 4RYEA 4IJGA 4EW7A 4QY5A 2PRFA 4BMWA 4BL3A 1YSQA 5I5LA 2P74A 5EE8A 2V1BA 1ERQA 3FPVA 4HP9A 5LBRA 4DE3A 4KQQA 1WA9A 4X25A 1S1ZA 3UB9A 1GHPA 5KSCA 3F1OB 1IOUA 1ES4A 1O07A 3GVBA 3PBSA 4HY8A 1C3BA 3D72A 2Q9MA 3CMZA 2VJWA 4GS9A 3G2YA 4RVAA 5HD5A 3IXBA 4D2OA 2ZQCA 2J80A 3T12B 1LI0A 5DFXA 4G3WA 2G2WA 2EA9A 4G3KA 5GLAA 1ZC2A 2DCFA 2EX6A 3BY8A 1K38A 1Z6FA 3PTEA 3U2AA 2Y2GA 4JBFA 4X1MA 4EBNA 3CI6A 3UN7A 1W8QA 1E25A 4QJGA 5F83A 3ZG7B 3JPUA 5L8MA 4X55A 2I9VA 3GRJA 1L0GA 4Y0TA 1PNEA 2B18A 1H0MA 2XDMA 4Y0OA 4O0PA 4XT2A 1ZTUA 2O9CA 3SS5A 3QP5A 2XRNA 2GNXA 3NECA 1SKOB 4QWOA 5IHVA 3HUNA 2VGKA 3WS4A 1BULA 4U3TA 5D3OA 4ETXA 3IXGA 4EU0A 1JVJA 2OV5A 2A24A 3L7HA 1CJFA 2XD1A 4K0WA 3P7NA 4EXOA 4GKUA 2OAP1 4C6YA 3GQZA 4HI4A 4DDYA 2V20A 4O8GA 4S2KA 3MMHA 2L4RA 2ZL1B 2JC7A
chains in the Genus database with same CATH topology
1BYWA 4Z1WA 3EQVA 1DP9A 1NRJA 3LUQA 5CX7A 5AJGA 4L9EA 2KDKA 1DP6A 1S67L 4II7A 1OTBA 4LPZA 1S1YA 3NJAA 2HGVA 3JVVA 1MC0A 1OTEA 5HDDA 1N9LA 3H7WB 4YOFA 3UB6A 4DJ2A 1MKMA 1DP8A 2JHEA 3T4SA 3TRCA 4Q0IA 4NXGA 3KO6A 2QJ5A 4I38A 1STZA 4NXEA 2M7UA 2ZMVA 4L9FA 2PD7A 4ETZA 4JGRA 1OJ5A 4R6LA 4WUJA 4KQDA 2M7VA 5HDSA 3C30A 5IS1A 1Y28A 2FZ0A 2VEAA 3LR0A 5IU1A 3A0RA 2O9BA 4PKYG 4HP4A 3B42A 4R3AA 5F69A 3T4QA 2W1TA 1TS7A 2YKHA 3SW1A 4WEJA 1XJ2A 3A0VA 1UGUA 3IBRA 4B9OA 3R4KA 1OT6A 4MN5A 2DMWA 5F68A 2O9AA 2W3FA 3KYZA 3T4JA 4L9GA 4GS9B 4F3LA 2J3WA 3LR3A 1MZUA 3EGXC 5AVEA 3UB7A 4M4XA 1OPXA 1G6OA 4G3VA 3LFVA 3MQQA 5HPFA 5FL3A 2V0UA 3E0YA 4HOIA 3LIBA 5F6AA 4HJ3A 4LLOB 2VGLS 4Y5FA 3E4QA 1LSXA 5C5KA 3RFBA 2K2NA 2PHYA 1F9IA 2JN7A 4Q0HA 3RTYA 5J4EA 5KSHA 1OJGA 3T4LA 2WKRA 2KOIA 3EWKA 2PT7A 3GDIA 5KIZA 3CLOA 3PBOA 3F1PB 5HL6A 4H6JB 3UMDA 4P6ZM 3IBJA 3RH8B 3PBQA 1H3QA 2ZBBA 1YKDA 4BBVA 1IFQA 3HJIA 4E04A 1H8MA 4WEKA 4XT2B 5J3WA 2OAQ1 5HSQA 3IS2B 2VLGA 3PHYA 2W3HA 2NUPC 5DJUA 3UMEA 3DBAA 4CLCC 1P9RA 3E98A 1N9OA 2PYPA 1XJ4A 1GSVA 2INWA 4MN6A 2K31A 2Z6CA 4JGPA 5A8BA 4HIAA 1P9WA 1OT9A 4BWIA 2WKQA 2GJ3A 2A24B 4MN7A 4DJ3A 5MC7A 3FC7A 3NOPC 3R7WB 4NEED 2B02A 3VE3A 4I3IA 3UE6A 3MR0A 1G28A 2A2LA 1LSVA 1NLYA 3LICA 1D7EA 4EQ1A 2V0WA 2Y79A 2OWJA 3BY9A 4PHTA 1F5MA 1TF1A 3F1NB 3LIAA 5DJTA 5HPIA 4EEPA 2LB9A 3BJNA 3KSFA 2W3EA 3TW8A 3PYPA 3BW6A 5IT5A 3E4PA 4WELA 3T4TA 4Q0JA 2PR5A 1P0ZA 1TD5A 4Y2FA 2VA0A 4HH2A 1KOUA 2V1AA 3PXPA 1TS8A 2JKRI 2EWWA 3F1OA 1NWZA 3HJKA 2IA2A 3MJQA 3OOVA 3PR6A 1YAXA 3S7OA 4DN0A 3ICYA 4LRZE 4GHIA 4PKYA 2JKTI 2P7JA 2Y8HA 4I3JA 2L0WA 2L1MA 3H82A 2OWHA 3BQAA 2QYBA 3CAXA 3NHQA 2VX8A 3ZYTA 3PBTA 1UWPX 4I39A 2W0NA 2PYRA 2VV8A 1T1CA 3LIDA 4KUOA 2ZOIA 5TBMA 2VKSA 3OBFA 3T4KA 4ME4A 4CQHA 2H28A 3C2WA 3LIFA 1OTDA 3VOLA 3O5YA 2ZOHA 2VV7A 5F5YA 4I5SA 5HD3A 4LRYC 2D01A 2VV6A 3OLOA 1W63Q 5K5BA 1W63M 5TJJA 5AVFA 4LRXC 1EW0A 2KLIA 5J7EA 3C8CA 3LIEA 3VE4A 1VB6A 4JGOA 3FG8A 4MCWA 5DKLA 3E4OA 3TJZC 3MQ0A 1LSWA 3UB8A 2QWSA 5G4YA 2W3DA 4CLCE 4F3LB 2G7UA 4I3AA 3BQ8A 3F1PA 4H6JA 2P04A 4B93A 3B47A 5DFYA 2MJ6A 4NXFA 4EESA 3A0SA 2OOLA 4AFIA 4UEYA 4CLCA 2Z6DA 2FH5A 1X0OA 3JVUA 2JKRM 4GCZA 1JNUA 3KSHA 3H9WA 4GLQA 3UE3A 1S66L 1XFQA 4P6ZS 4EUVA 1YSPA 2EWVA 3LYXA 5HZHA 2YKFA 4NXBA 3FPWA 3W2ZA 2JKTM 3KX0X 4UQIM 4WN5A 2HJ9C 4K08A 4EETB 4MDZA 1S4SA 3MF0A 3G6OA 3ZQ5A 1GSWA 4ARZA 2J3TC 3OC2A 2XA7M 3BWLA 3NOUC 4GW9A 4HNBA 3EEAA 2HF6A 3OCLA 3PBRA 3NOTC 4Y3IA 4WLAA 3D3OA 1V9YA 4HH3A 3S7NA 1TS6A 3B33A 3EGDC 5HWWA 4FOFA 4HHDA 4R38A 3MQOA 3VV4A 4KUKA 3CWFA 1S4RA 5EFWA 3H7WA 4OOLA 2D02A 4WL9A 4GJ4A 4BJPA 1T19A 3KSIA 4RQ9A 3KSGA 4WF0A 2HJEA 5DF9A 4OOMA 4L0LA 2BASA 3S7QA 3EQUA 4R70A 1LL8A 2NUTC 4IJGA 4EW7A 4BMWA 1YSQA 5I5LA 4FSFA 3ULFA 3LR4A 3MXQA 2V1BA 3FPVA 3S7PA 4HP9A 5LBRA 4IUKA 3T4OA 2XROA 1ZHHB 3HCYA 3MFXA 2M1CA 1WA9A 3PBNA 4MMNA 1S1ZA 3UB9A 1OTAA 2K7SA 2O99A 1N9NA 4JGQA 5HDCA 4HJ6A 1XJ3A 3F1OB 1IOUA 4KQOA 2V9AA 3PBSA 4HY8A 3TE8A 3D72A 2VJWA 4GS9A 4GHIB 5HD5A 3KYQA 4DMZA 3K3DA 2LB5A 4PAUA 4HQAA 2ZMFA 2J80A 3H82B 1T1BA 5DFXA 4CLCD 4G3WA 4BBUA 2EA9A 2W1TB 3P01A 1LT0A 4G3KA 1P97A 5TBMB 2W1RA 3BY8A 3LI8A 4YNRA 3U2AA 3GECA 2VGLM 2PR6A 2J3TD 3CI6A 4IUHA 2W3GA 3CITA 5L8MA 2CMNA 4IHQA 1VHMA 2I9VA 4EERA 1UWNX 2B18A 3LR5A 2PDRA 1OTIA 4O0PA 2GZAA 4XT2A 4QPRA 1ZTUA 2O9CA 3IS2A 3K2NA 2XRNA 4YWZA 4EEUA 2QHKA 3K3CA 3C38A 2GNXA 3OCNA 3V67A 1ODVA 4BBTA 3LI9A 3EOIA 5HWTA 1NLZA 4ETXA 3CUEA 4EU0A 2R78A 2A24A 1XFNA 5HWVA 1D06A 3R7WA 4CLCB 3CUEC 3T50A 5G4ZA 4ZRRA 1T18A 4UQIS 1F98A 2VZWA 2HV1A 4O01A 2GX5A 1V9ZA 3P7NA 2P08A 4EXOA 1XJ6A 2QKPA 5DKKA 2OAP1 3F1NA 2W27A 2XA7S 2O0YA 1T1AA 4HI4A 1GSXA 2QJ7A 1TS0A 3EEHA 4ARZB 4NKPA 2WKPA 4HJ4A 4O8GA 1DRMA 2PD8A 3MMHA 2L4RA 2XSSA 2KX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BYW A;  1DP9 A;  3LUQ A;  4L9E A;  2KDK A;  1DP6 A;  1S67 L;  1OTB A;  4LPZ A;  1S1Y A;  3NJA A;  1OTE A;  5HDD A;  1N9L A;  3H7W B;  3UB6 A;  4DJ2 A;  1DP8 A;  2JHE A;  4NXG A;  2QJ5 A;  4I38 A;  4NXE A;  4L9F A;  2PD7 A;  4JGR A;  1OJ5 A;  4R6L A;  4WUJ A;  4KQD A;  5HDS A;  5IS1 A;  1Y28 A;  2VEA A;  5IU1 A;  3A0R A;  4PKY G;  4HP4 A;  4R3A A;  5F69 A;  3SW1 A;  1TS7 A;  2YKH A;  1XJ2 A;  3A0V A;  1UGU A;  3IBR A;  4B9O A;  1OT6 A;  4MN5 A;  5F68 A;  4L9G A;  4GS9 B;  4F3L A;  1MZU A;  5AVE A;  3UB7 A;  4M4X A;  3MQQ A;  2V0U A;  4HOI A;  3LIB A;  5F6A A;  4HJ3 A;  4LLO B;  3E4Q A;  1LSX A;  2PHY A;  1F9I A;  2JN7 A;  3RTY A;  5J4E A;  1OJG A;  2WKR A;  3EWK A;  3GDI A;  5KIZ A;  3CLO A;  3F1P B;  4H6J B;  3UMD A;  3RH8 B;  2ZBB A;  4BBV A;  3HJI A;  4E04 A;  4XT2 B;  5J3W A;  5HSQ A;  3IS2 B;  2VLG A;  3PHY A;  5DJU A;  3UME A;  1N9O A;  2PYP A;  1XJ4 A;  1GSV A;  2INW A;  4MN6 A;  2Z6C A;  4JGP A;  5A8B A;  4HIA A;  1OT9 A;  2WKQ A;  2GJ3 A;  2A24 B;  4DJ3 A;  3FC7 A;  3NOP C;  2B02 A;  3VE3 A;  4I3I A;  3UE6 A;  3MR0 A;  1G28 A;  1LSV A;  3LIC A;  1D7E A;  4EQ1 A;  2V0W A;  2OWJ A;  3BY9 A;  3F1N B;  3LIA A;  5DJT A;  4EEP A;  3PYP A;  3E4P A;  2PR5 A;  1P0Z A;  4HH2 A;  1KOU A;  2V1A A;  1TS8 A;  3F1O A;  1NWZ A;  3HJK A;  3MJQ A;  3ICY A;  4LRZ E;  4GHI A;  4PKY A;  2P7J A;  4I3J A;  2L0W A;  2L1M A;  3H82 A;  2OWH A;  3CAX A;  3NHQ A;  1UWP X;  4I39 A;  2W0N A;  2PYR A;  2VV8 A;  1T1C A;  3LID A;  4KUO A;  2ZOI A;  5TBM A;  2H28 A;  3C2W A;  3LIF A;  1OTD A;  3VOL A;  2ZOH A;  2VV7 A;  5F5Y A;  4I5S A;  5HD3 A;  4LRY C;  2D01 A;  2VV6 A;  3OLO A;  5AVF A;  4LRX C;  1EW0 A;  5J7E A;  3C8C A;  3LIE A;  3VE4 A;  1VB6 A;  4JGO A;  3FG8 A;  5DKL A;  3E4O A;  1LSW A;  3UB8 A;  2QWS A;  5G4Y A;  4F3L B;  4I3A A;  3F1P A;  4H6J A;  4NXF A;  4EES A;  3A0S A;  2OOL A;  2Z6D A;  1X0O A;  4GCZ A;  1JNU A;  3H9W A;  1S66 L;  1XFQ A;  5HZH A;  3LYX A;  2YKF A;  4NXB A;  3KX0 X;  4WN5 A;  4K08 A;  4EET B;  1S4S A;  3G6O A;  3ZQ5 A;  1GSW A;  3BWL A;  3NOU C;  4GW9 A;  4HNB A;  3NOT C;  4WLA A;  1V9Y A;  4HH3 A;  1TS6 A;  3B33 A;  5HWW A;  4HHD A;  4R38 A;  3MQO A;  4KUK A;  3CWF A;  1S4R A;  5EFW A;  3H7W A;  2D02 A;  4WL9 A;  1T19 A;  4RQ9 A;  4WF0 A;  2BAS A;  4R70 A;  1LL8 A;  4EW7 A;  5I5L A;  3ULF A;  3MXQ A;  2V1B A;  4HP9 A;  3MFX A;  2M1C A;  1WA9 A;  1S1Z A;  3UB9 A;  1OTA A;  2K7S A;  1N9N A;  4JGQ A;  5HDC A;  4HJ6 A;  1XJ3 A;  3F1O B;  2V9A A;  4HY8 A;  3D72 A;  4GS9 A;  4GHI B;  5HD5 A;  3K3D A;  4HQA A;  2J80 A;  3H82 B;  1T1B A;  4BBU A;  2EA9 A;  1LT0 A;  1P97 A;  5TBM B;  3BY8 A;  3LI8 A;  3GEC A;  2PR6 A;  2CMN A;  2I9V A;  4EER A;  1UWN X;  2PDR A;  1OTI A;  4XT2 A;  4YWZ A;  3IS2 A;  4EEU A;  2QHK A;  3K3C A;  1ODV A;  4BBT A;  3LI9 A;  5HWT A;  2R78 A;  2A24 A;  1XFN A;  5HWV A;  1D06 A;  3T50 A;  5G4Z A;  1T18 A;  1F98 A;  2HV1 A;  1V9Z A;  3P7N A;  4EXO A;  1XJ6 A;  2QKP A;  5DKK A;  3F1N A;  2W27 A;  1T1A A;  4HI4 A;  1GSX A;  2QJ7 A;  1TS0 A;  3EEH A;  2WKP A;  4HJ4 A;  1DRM A;  2PD8 A;  2L4R A;  2KX6 A; 
#chains in the Genus database with same CATH topology
 3VSK A;  1CI8 A;  1K4E A;  4Z1W A;  1NRJ A;  5GL9 A;  3IH9 A;  4II7 A;  2HGV A;  3JVV A;  1MC0 A;  1G68 A;  3CJM A;  2WAD A;  1E3U D;  1DP8 A;  1W79 A;  1FCN A;  3LO7 A;  3T4S A;  2HDS A;  3TRC A;  3ITA A;  5HAP A;  2QJ5 A;  3LCE A;  1K56 D;  2ZMV A;  1F2K A;  1YLP A;  2ZQ8 A;  2M7V A;  4Y15 A;  1Y28 A;  2FZ0 A;  3ZG8 B;  2EXB A;  4WM9 A;  2ZC6 B;  2A49 A;  1JTG A;  4S2L A;  4R3B A;  1TEM A;  5GLD A;  2W1T A;  1TS7 A;  3SZT A;  1OT6 A;  4MN5 A;  2O9A A;  1ESU A;  4L9G A;  3VFF A;  2P9V A;  1CQA A;  3LR3 A;  4K0X A;  1PW8 A;  3GV9 A;  4OP5 A;  3S4X A;  3SH7 A;  1G6O A;  1LLB A;  4G3V A;  3RJU A;  3LEQ A;  4OKP A;  2EFU A;  2V0U A;  3E0Y A;  3LY4 A;  1K54 A;  1PWD A;  5KSH A;  3W8K A;  2JN7 A;  4FD8 A;  1OJG A;  3T4L A;  2WKR A;  2KOI A;  3EWK A;  5KIZ A;  3CLO A;  3PAG A;  2Y4A A;  1K54 C;  2XD5 A;  5FAQ A;  3F1P B;  5HL6 A;  2R9W A;  3OPR A;  1DJA A;  1RGY A;  3Q82 A;  1H3Q A;  2ZBB A;  3MXR A;  5DVA A;  2XFT A;  4OP8 A;  1BSG A;  2J9P A;  2OAQ 1;  5CEC A;  2NUP C;  5DJU A;  4CLC C;  3UO9 A;  1P9R A;  3E98 A;  4KZ6 A;  4S2I A;  4ZAM A;  1XGJ A;  3SS3 A;  2WYX A;  1K4F A;  3IWI A;  2WGI A;  4MN7 A;  3FC7 A;  3NOP C;  1LL5 A;  3R7W B;  4NEE D;  4Y7P A;  2B02 A;  1AXB A;  3NCK A;  1G28 A;  2A2L A;  1PI5 A;  1D7E A;  4EQ1 A;  1PYY A;  3CZD A;  3ZCZ A;  2OWJ A;  1TF1 A;  3F1N B;  4IBX A;  5DJT A;  1ERM A;  3BJN A;  5KMW A;  3TW8 A;  3PYP A;  4S2J A;  1NRF A;  5CGW A;  5A91 A;  1S0W A;  1KOU A;  3MBZ A;  1OME A;  1NY0 A;  3O87 A;  3F1O A;  4QD4 A;  3HJK A;  3MJQ A;  1NZO A;  5AQ9 A;  3CG5 A;  2Z2M B;  3G30 A;  3IF5 A;  2L1M A;  3S1Y A;  2VK3 A;  1KDW A;  4DF6 A;  2VX8 A;  3PBT A;  2W0N A;  2V2F F;  2VV8 A;  2Y2M A;  4KUO A;  5HAR A;  4QHC A;  1O7E A;  3LIF A;  4CPK A;  2Y2H A;  1OTD A;  4GZB A;  4JF4 A;  5F5Y A;  1SZV A;  4GD8 A;  2D01 A;  1W63 Q;  5TJJ A;  2PU2 A;  5FQJ A;  3FV7 A;  1EW0 A;  1K57 A;  1TDL A;  5J7E A;  1IYP A;  2Z2L B;  3IF6 B;  3VE4 A;  1L2S A;  3FG8 A;  3MQ0 A;  3UB8 A;  3G31 A;  2Q9N A;  2QWS A;  2W3D A;  4PM8 A;  1VEU A;  2UWX A;  1SKO A;  3ZNY A;  4PM6 A;  3HUM A;  4WZ4 A;  1YLJ A;  4ZDX A;  5DFY A;  1KE3 A;  2MJ6 A;  4NXF A;  4S2P A;  5CED A;  4AFI A;  3DTI A;  2FH5 A;  4GNU A;  2J8Y A;  4Y0U A;  3UE3 A;  1S66 L;  3DTM A;  1YSP A;  1FIK A;  3LYX A;  5CTM A;  4NXB A;  1KE0 A;  4MDZ A;  2XQZ A;  1ALQ A;  1Q2Q A;  1LL9 A;  2ZL1 A;  2HF6 A;  4PM9 A;  4DRT A;  3NOT C;  3S7N A;  5CHU A;  1K0K A;  1QME A;  5HWW A;  2HP5 A;  1JTD A;  3RXW A;  4R38 A;  3MQO A;  1NXY A;  4BLM A;  5EFW A;  3LEZ A;  2D02 A;  1T19 A;  4RQ9 A;  4IED A;  4WF0 A;  2ZM2 A;  4RX3 A;  3ZG0 A;  4E3I A;  4R70 A;  1NYM A;  3AGD A;  4KG6 A;  2EX8 A;  3HLC A;  1Q2P A;  1ACF A;  1MPL A;  3SH8 A;  3ULF A;  3MXQ A;  1EWZ A;  2XRO A;  1KVL A;  3KYE A;  4IUK A;  3T4O A;  3HCY A;  4RA7 A;  3PBN A;  1RGZ A;  1PFL A;  3MFD A;  2K7S A;  2PAV P;  4HJ6 A;  5EOO A;  2V9A A;  2IWB A;  2R9X A;  3ZG9 B;  1KGF A;  3KYQ A;  5KZH A;  1W8Y A;  4DMZ A;  3V39 A;  2LB5 A;  3IT9 A;  2ZMF A;  3UDX A;  3H82 B;  4BL2 A;  4CLC D;  4BBU A;  1TVF A;  5EEC A;  1E3U A;  2W1T B;  5FI2 A;  1LT0 A;  1BLC A;  1P97 A;  2PBD P;  3IHB A;  1K56 A;  3GEC A;  2VGL M;  2J3T D;  4N9L A;  4OQI A;  2Y2K A;  1MY8 A;  1J9M A;  2W3G A;  1ES5 A;  1HTZ A;  1VHM A;  2WZZ A;  3ZG5 A;  1OTI A;  1HZO A;  5EUA A;  1TDG A;  4YWZ A;  2JE5 A;  3K3C A;  5DTS A;  3UY6 A;  3BRM A;  1I2W A;  2OLU A;  3OCN A;  3V67 A;  1ODV A;  3ZVT A;  4P6B A;  2OLV A;  3EOI A;  1IYO A;  3CUE A;  2R78 A;  4E6X A;  1XFN A;  3UE1 A;  2WAF A;  3R7W A;  4CLC B;  5TR7 A;  3CUE C;  1MXO A;  1T18 A;  4UHU A;  4UQI S;  5CGX A;  3VP0 A;  4O01 A;  5GLC A;  2GX5 A;  4S2M A;  3DTE A;  3QP4 A;  3IXD A;  3ZDJ A;  3F1N A;  1T1A A;  2FFY A;  4ZBE A;  4OH0 A;  1GSX A;  1WYC A;  4NET A;  3MXS A;  4R1G A;  1PRQ A;  3IH8 A;  4NKP A;  4ARZ B;  1BLP A;  2PD8 A;  3HLB A;  2KX6 A;  5FAT A;  3DWK A;  2EX9 A;  5FDS A;  4H8R A;  2HDQ A;  3WRZ A;  4JXG A;  1S6R A;  4GOG A;  4YFM A;  3M6H A;  3H7W B;  4DJ2 A;  3BM6 A;  1MKI A;  1XX2 A;  4OVD A;  5L10 A;  2IWD A;  4NXG A;  1BLS A;  2M7U A;  1STZ A;  4L9F A;  2JKG A;  5EVE A;  4N92 A;  1BTL A;  4GD6 A;  4MLL A;  4E6W A;  5HDS A;  3C30 A;  2VEA A;  1XPB A;  3LR0 A;  5IU1 A;  2O9B A;  5F69 A;  3B42 A;  3IF6 A;  4WEJ A;  2XR0 A;  3A0V A;  4KZ8 A;  3IF6 C;  2DMW A;  5F68 A;  2W3F A;  4R23 A;  3EGX C;  5AVE A;  4P87 A;  3UB7 A;  4X69 A;  1IYS A;  5HPF A;  2C5W B;  3ISG A;  5FL3 A;  4S2O A;  3A3E A;  4HOI A;  1FIL A;  3VP2 A;  4Y5F A;  3E4Q A;  2JBF A;  3RFB A;  1YLT A;  3N8R A;  1Y4O A;  1MWS A;  1K6R A;  2PT7 A;  2Q0O A;  4MBH A;  1VEU B;  3PBO A;  5HX9 A;  1JWP A;  3IBJ A;  3QHY A;  3QNC A;  3FWL A;  3HJI A;  4QU3 A;  1LI9 A;  5J3W A;  3HBR A;  2W3H A;  2B5R A;  2WGW B;  1YLW A;  4DXB A;  1IKG A;  1GSV A;  1BUE A;  4JGP A;  3NBL A;  4S2N A;  4ZJ1 A;  4OON A;  3HLD A;  2GJ3 A;  3IXH A;  4KG2 A;  4S2N C;  5EVL A;  3L9K A;  4I3I A;  3ZFZ A;  5DTT A;  1K25 A;  1LSV A;  2XK1 A;  2ZLY A;  5BOH A;  3IX3 A;  4PHT A;  1F5M A;  5HPI A;  2LB9 A;  3VP4 A;  4WEL A;  1NJ4 A;  3T4T A;  2PR5 A;  2IWC A;  2EWW A;  4CJN A;  2ZC7 A;  3OPH A;  5F1F A;  3OOV A;  3PR6 A;  4DN0 A;  1YAX A;  4LFU A;  1PW1 A;  4WBG A;  2JKT I;  2P7J A;  2Y8H A;  3SH9 A;  4R3J A;  3FKW A;  3G35 A;  3H82 A;  2OWH A;  4EWF A;  3NHQ A;  2PYR A;  1T1C A;  3UPN A;  3T4K A;  4IVI A;  3GMW A;  3V3R A;  4ME4 A;  3JYI A;  2H28 A;  5DF7 A;  2Y2N A;  4UAA A;  3VOL A;  3GTC A;  1NYY A;  4I5S A;  1ES3 A;  4BD1 A;  4LRY C;  3OLO A;  1W63 M;  3Q7V B;  4LRX C;  4WMC D;  1GA9 A;  3LIE A;  4A5R A;  5JYO A;  1XXM A;  3FYZ A;  5DKL A;  3E4O A;  2FFF B;  1L0E A;  1J3W A;  4CLC E;  4I3A A;  4DE2 A;  4EBP A;  1ONG A;  3O88 A;  2WK0 A;  4F94 A;  2BTF P;  4KZ9 A;  3B47 A;  1YPR A;  3BEB A;  4C75 A;  4N1H A;  4EES A;  3O3V A;  4KZB A;  1N9B A;  4CLC A;  4Y17 A;  2Y59 A;  4B4Z A;  1JNU A;  3KSH A;  3P98 A;  4GLQ A;  4EUV A;  1K55 A;  2WZX A;  3W2Z A;  2Y2L A;  2JKT M;  5E2F A;  1K55 C;  4K08 A;  3MZF A;  3T1S A;  1GSW A;  1FR6 A;  4ARZ A;  2J3T C;  3OC2 A;  2XA7 M;  3BWL A;  3OCL A;  3PBR A;  3NDE A;  1WE4 A;  3D3O A;  4HH3 A;  1TS6 A;  3NUL A;  3EGD C;  4FOF A;  1KE4 A;  4HHD A;  3WS2 A;  3BFF A;  1GHM A;  2ZJ9 A;  3H7W A;  3QP6 A;  4OOL A;  5EVI C;  4OQ0 A;  4BJP A;  3S22 A;  5AQA A;  2BAS A;  4E3J A;  1JWZ A;  3VP1 A;  3S7Q A;  3HVF A;  1I2S A;  1LL8 A;  2NUT C;  4X68 A;  1GCE A;  5HL1 A;  5EM1 A;  3Q7Z A;  3Q81 A;  3LR4 A;  3S7P A;  1N4O A;  5TFQ A;  5CXW A;  4FH2 A;  1ZHH B;  3MFX A;  4Y13 A;  4MMN A;  1ESI A;  3MZD A;  1N9N A;  4JGQ A;  5CEB A;  4KQO A;  1PWC A;  3TE8 A;  1I5Q A;  4WYY A;  4GHI B;  3CPT A;  3LGO A;  3K3D A;  3N4I A;  2WKI A;  4PAU A;  4KG5 A;  5M1A A;  2C6W B;  2ZQ7 A;  3P01 A;  3BLS A;  2EFX A;  5GHX A;  4LGW A;  2V8C A;  2PR6 A;  3VOY A;  3MKE A;  3CIT A;  5FQI A;  4IHQ A;  2H5S A;  1BT5 A;  3BFE A;  2PDR A;  4QPR A;  3T1R A;  4EUZ A;  2WGW A;  5AQB A;  3QP2 A;  4BBT A;  3IX8 A;  1DY6 A;  3LI9 A;  1YMX A;  5HWT A;  1NLZ A;  4IBR A;  3MZE A;  1D06 A;  5HWV A;  3WS5 A;  2Y2Q A;  5G4Z A;  5M18 A;  2XLN A;  4ZRR A;  1F98 A;  2VZW A;  1V9Z A;  2P08 A;  1KGG A;  2QKP A;  5E2H A;  4XXR A;  2RCX A;  2W27 A;  5HAI A;  4LV0 A;  2Y55 A;  1FCO A;  2QJ7 A;  1TS0 A;  3EEH A;  1YT4 A;  2WKP A;  3P09 A;  4KQR A;  4HJ4 A;  1DRM A;  3M2J A;  2XSS A;  1BYW A;  1DP9 A;  5AJG A;  4QB8 A;  1S67 L;  3WS1 A;  1OTB A;  4UA7 A;  4Z9Q A;  1XGI A;  4PPR A;  3NJA A;  3ZNT A;  1MWT A;  1OTE A;  5HDD A;  1N9L A;  3UB6 A;  3WWX A;  2BLS A;  2HDR A;  2ZC4 B;  2ZQ9 A;  3NC8 A;  4NXE A;  1KVM A;  3W4Q A;  2WUQ A;  2PD7 A;  2PU4 A;  3VSL A;  5AQ7 A;  5HFO A;  3A3F A;  4LV2 A;  4WUJ A;  4FCF A;  4OQH A;  1IEM A;  4X6T A;  1M40 A;  4ID4 A;  5DF8 A;  2Y2P A;  1BLH A;  3Q7V A;  4X53 A;  4PKY G;  4ZJ3 A;  3SW1 A;  2YKH A;  2XGN A;  4YIN A;  3IBR A;  2XH9 A;  4B9O A;  5FAO A;  1MZU A;  4LCL A;  5HW3 A;  1YMS A;  4ESP A;  1FSY A;  3LFV A;  3MQQ A;  2GDN A;  3NIA A;  5F6A A;  4HJ3 A;  1FR1 A;  2VGL S;  1IKI A;  5I94 A;  2HP6 A;  5C5K A;  2PHY A;  5J4E A;  3V3S A;  4WZ5 A;  4KZ3 A;  5EVI D;  4ZTK A;  3DAV A;  1U60 A;  1W7F A;  2Y2O A;  4PM7 A;  2XFS A;  4WZ5 C;  1G5U A;  2X71 A;  4P6Z M;  3RH8 B;  5A93 A;  3RXX A;  4PM5 A;  1LHY A;  4E04 A;  1H8M A;  4WEK A;  3AGE A;  4WMC A;  4C3Q A;  3IS2 B;  4BEN A;  3PHY A;  3UME A;  3VMA A;  2PYP A;  4DXC A;  2I72 A;  4GN2 A;  2K31 A;  5A8B A;  5FQK A;  1OT9 A;  3T1Q B;  4BWI A;  2WKQ A;  5MC7 A;  4DE0 A;  1SDE A;  5G18 A;  1CEG A;  4N1X A;  2V0W A;  3BY9 A;  3M2K A;  2E8I A;  5EVI B;  3LIA A;  5FQ9 A;  3HRE A;  2ZD8 A;  2WKH A;  2V8F A;  3KSF A;  3BW6 A;  4FTX A;  3E4P A;  4JKT A;  2ZC3 B;  3D9Y A;  4KZ5 A;  4EQI A;  4JXV A;  2AVX A;  1KDS A;  4Y2F A;  5L09 A;  4HH2 A;  2V1A A;  1RP5 A;  2ACG A;  1TS8 A;  1A0K A;  2JKR I;  1NWZ A;  2IA2 A;  3MSH A;  3S7O A;  3UNW A;  1SCW A;  4LRZ E;  3ZVW A;  4GHI A;  4PKY A;  4I3J A;  1MWR A;  4DKI A;  3CAX A;  3ZYT A;  1K6S A;  2JKF A;  5CHM A;  2ZOI A;  2VKS A;  3OBF A;  4CQH A;  4EV4 A;  3HLF A;  3QP8 A;  2ZQA A;  3WS0 A;  2OSU A;  5FSR A;  3BFG A;  2X01 A;  3CPT B;  3O5Y A;  2ZOH A;  1FSW A;  3E2L A;  5CHJ A;  2PBY A;  3N6I A;  2VGJ A;  1PZP A;  5A90 A;  4HBT A;  5K5B A;  3NDG A;  4GDB A;  4U0T A;  3BLM A;  4OPZ A;  4E3K A;  1ZG4 A;  2ZQD A;  3IWQ A;  1CK3 A;  1PIO A;  1VB6 A;  2A3U A;  3TJZ C;  3NI9 A;  3QNB A;  5G4Y A;  4F3L B;  2G7U A;  3A3D A;  3VFH A;  4H6J A;  5F1G A;  3SOI A;  5EPH A;  1FOF A;  2P04 A;  4B93 A;  3C4O A;  3C4P A;  3A3J A;  2ZM8 A;  2OOL A;  5L07 A;  1GHI A;  4MBK A;  3VOZ A;  3N7W A;  2JKR M;  3DWZ A;  3H9W A;  3M6B A;  4BD0 A;  1XFQ A;  5HZH A;  2EWV A;  2YKF A;  4GDN A;  4UA9 A;  3FPW A;  3KX0 X;  2HJ9 C;  5EV0 A;  3ZQ5 A;  3NOU C;  4GW9 A;  4HNB A;  3IQA A;  5FI6 A;  3EEA A;  5GLB A;  3ZGA B;  5TGF A;  3TOI A;  4BQM A;  4Y3I A;  4WLA A;  3V5M A;  1VET B;  1ZKJ A;  3HLG A;  1NZU A;  1S4R A;  4UA6 A;  4D60 A;  4WL9 A;  4KZ4 A;  1L0F A;  4GJ4 A;  3KSG A;  4JLF A;  2HJE A;  5DF9 A;  4OOM A;  4L0L A;  3ITB A;  5GHY A;  2RL3 A;  4MBF A;  4FSF A;  4E3L A;  2QZ6 A;  3FKV A;  4B88 A;  5CTN A;  2M1C A;  2E8J A;  1FCM A;  3C7V A;  3W4P A;  1OTA A;  2O99 A;  5HDC A;  1XJ3 A;  2H10 A;  5U47 A;  2WAE A;  4E3O A;  1L0D A;  3QP1 A;  4EBL A;  3GR2 A;  4N9K A;  4HQA A;  3IWO A;  3BFC A;  1MWU A;  1M6K A;  1T1B A;  2QPN A;  1YLZ A;  1RCJ A;  3UPO A;  5FDH A;  1MBL A;  3UDF A;  2X02 A;  5TBM B;  2WGV A;  1XA1 A;  2W1R A;  3LI8 A;  4YNR A;  3HUO A;  3OZH A;  2CC1 A;  4DDS A;  4IUH A;  4XUZ A;  3C7U A;  2CMN A;  1BZA A;  4JXS A;  4EER A;  1UWN X;  3LR5 A;  1D1J A;  3Q07 A;  3CHW P;  2GZA A;  2UV0 E;  3K2N A;  3IS2 A;  4EEU A;  4R4R A;  2QHK A;  3C38 A;  1PWG A;  3BEC A;  3N8L A;  1GA0 A;  5M19 A;  1YLY A;  2HPB A;  1SHV A;  4HES A;  3UE0 A;  1HLU P;  3T50 A;  1H8Y A;  5L2F A;  3SS4 A;  4OPY A;  2HV1 A;  4NK3 A;  1XJ6 A;  1HD8 A;  3DW0 A;  5DKK A;  5EVI A;  3GSG A;  2XA7 S;  2O0Y A;  1DJC A;  1ZG6 A;  4KZA A;  2EXA A;  2QMI A;  4OLD A;  3G2Z A;  3EQV A;  5CGS A;  3LUQ A;  5CX7 A;  4L9E A;  2KDK A;  1DP6 A;  1YM1 A;  4LPZ A;  1S1Y A;  5F82 A;  2XEP A;  3I7J A;  1E4D A;  3G4P A;  4YOF A;  1HVB A;  1MKM A;  1VQQ A;  5JYP A;  2JHE A;  2BG1 A;  1IYQ A;  4B4X A;  2J9O A;  4Q0I A;  3KO6 A;  5E43 A;  4I38 A;  4FH4 A;  4ETZ A;  4JGR A;  1OJ5 A;  4KZ7 A;  4R6L A;  1ERO A;  3BYD A;  1XP4 A;  3DTK A;  4KQD A;  5FEF A;  5IS1 A;  5FAS A;  1QMF A;  1AWI A;  2G2U A;  3A0R A;  4R3A A;  4HP4 A;  3T4Q A;  2DNS A;  1XJ2 A;  2H0Y A;  1UGU A;  3R4K A;  1Y54 A;  4OPR A;  3KYZ A;  3T4J A;  1PZO A;  1VM1 A;  4GS9 B;  4F3L A;  2J3W A;  3TG9 A;  4LV1 A;  3E2K A;  5CRF A;  1SDN A;  4M4X A;  4Q8I A;  1OPX A;  2B95 A;  1IEL A;  2XF3 A;  1G6A A;  3WRT A;  3FZC A;  3LIB A;  4LV3 A;  4LLO B;  1CF0 A;  4MNR A;  5DTK A;  4JF5 A;  3MKF A;  1K57 C;  1LSX A;  2K2N A;  4Q0H A;  1F9I A;  5EOE A;  3RTY A;  3UDI A;  5E2E A;  3GDI A;  4U0X A;  4OQG A;  4H6J B;  3UMD A;  3V50 A;  4R4S A;  3VP3 A;  3PBQ A;  4OOY A;  4BBV A;  1YKD A;  1IFQ A;  4E3M A;  4XT2 B;  5HSQ A;  2VLG A;  3DBA A;  3TSG A;  1N9O A;  1VET A;  1XJ4 A;  4ZJ2 A;  2INW A;  4MN6 A;  2Y2I A;  2Z6C A;  4HIA A;  1P9W A;  2A24 B;  4DJ3 A;  3MS6 A;  1EI5 A;  2ZM0 A;  2H0T A;  4QY6 A;  3VE3 A;  3UE6 A;  3MR0 A;  1NLY A;  3LIC A;  2Y79 A;  3BFD A;  3N8S A;  1W5D A;  1H5X A;  4EEP A;  3G34 A;  2HZ5 A;  2W3E A;  3U4L P;  5IT5 A;  2EX2 A;  2Y91 A;  4Q0J A;  1P0Z A;  4PMA A;  1TD5 A;  1ONH A;  2VA0 A;  5GHZ A;  3PXP A;  1XKZ A;  4P85 A;  5A92 A;  3HLE A;  3AGF A;  2JCH A;  2HDU A;  1YQS A;  3D4F A;  3ICY A;  4OPQ A;  2ZC5 B;  5FQM A;  4XUX A;  3W4O A;  3UB5 P;  3A3I A;  4IVK A;  2L0W A;  3PAE A;  1CEF A;  3BQA A;  2QYB A;  3LY3 A;  1UWP X;  3T1X A;  4I39 A;  3LID A;  3HL9 A;  1JWV A;  5FAP A;  5TBM A;  2Y2J A;  1PI4 A;  3C2W A;  2VV7 A;  1KGE A;  4LEN A;  5HD3 A;  4P0M A;  2VV6 A;  5AVF A;  1ES2 A;  5FA7 A;  5FQQ A;  4M3K A;  2DRW A;  4JF6 A;  3OPL A;  2KLI A;  3C8C A;  4JGO A;  1H8Z A;  4MCW A;  1SKF A;  1LSW A;  4RX2 A;  1DJB A;  5FI7 A;  4R0Q A;  2P9V B;  2J7V A;  3BQ8 A;  3F1P A;  3OPP A;  2HP9 A;  5HAQ A;  3O86 A;  3G32 A;  5CER A;  4FUW A;  5E2G A;  4GB7 A;  2ZMA A;  4JXW A;  3ZHH A;  3A0S A;  4K91 A;  4E3N A;  1WYB A;  4DE1 A;  4UEY A;  2Z6D A;  3C5A A;  4OLG A;  1X0O A;  3JVU A;  4HEF A;  4GCZ A;  4LCM A;  1Z09 A;  1L3L A;  4P6Z S;  3IHA A;  5EM0 A;  4O7D A;  4UQI M;  4WN5 A;  4EET B;  1S4S A;  3MF0 A;  4KEN B;  3G6O A;  4NG2 A;  4X1L A;  3HLW A;  4X56 A;  4HBU A;  1V9Y A;  1CI9 A;  3B33 A;  1XA7 A;  1FQG A;  5J8X A;  3IX4 A;  3VV4 A;  4KUK A;  2WKE A;  3CWF A;  5FEG A;  3UPP A;  3KSI A;  3B3X A;  3EQU A;  4MEZ A;  3NY4 A;  3Q1F A;  2V1Z A;  4JPM A;  4RYE A;  4IJG A;  4EW7 A;  4QY5 A;  2PRF A;  4BMW A;  4BL3 A;  1YSQ A;  5I5L A;  2P74 A;  5EE8 A;  2V1B A;  1ERQ A;  3FPV A;  4HP9 A;  5LBR A;  4DE3 A;  4KQQ A;  1WA9 A;  4X25 A;  1S1Z A;  3UB9 A;  1GHP A;  5KSC A;  3F1O B;  1IOU A;  1ES4 A;  1O07 A;  3GVB A;  3PBS A;  4HY8 A;  1C3B A;  3D72 A;  2Q9M A;  3CMZ A;  2VJW A;  4GS9 A;  3G2Y A;  4RVA A;  5HD5 A;  3IXB A;  4D2O A;  2ZQC A;  2J80 A;  3T12 B;  1LI0 A;  5DFX A;  4G3W A;  2G2W A;  2EA9 A;  4G3K A;  5GLA A;  1ZC2 A;  2DCF A;  2EX6 A;  3BY8 A;  1K38 A;  1Z6F A;  3PTE A;  3U2A A;  2Y2G A;  4JBF A;  4X1M A;  4EBN A;  3CI6 A;  3UN7 A;  1W8Q A;  1E25 A;  4QJG A;  5F83 A;  3ZG7 B;  3JPU A;  5L8M A;  4X55 A;  2I9V A;  3GRJ A;  1L0G A;  4Y0T A;  1PNE A;  2B18 A;  1H0M A;  2XDM A;  4Y0O A;  4O0P A;  4XT2 A;  1ZTU A;  2O9C A;  3SS5 A;  3QP5 A;  2XRN A;  2GNX A;  3NEC A;  1SKO B;  4QWO A;  5IHV A;  3HUN A;  2VGK A;  3WS4 A;  1BUL A;  4U3T A;  5D3O A;  4ETX A;  3IXG A;  4EU0 A;  1JVJ A;  2OV5 A;  2A24 A;  3L7H A;  1CJF A;  2XD1 A;  4K0W A;  3P7N A;  4EXO A;  4GKU A;  2OAP 1;  4C6Y A;  3GQZ A;  4HI4 A;  4DDY A;  2V20 A;  4O8G A;  4S2K A;  3MMH A;  2L4R A;  2ZL1 B;  2JC7 A; 
#chains in the Genus database with same CATH homology
 1BYW A;  4Z1W A;  3EQV A;  1DP9 A;  1NRJ A;  3LUQ A;  5CX7 A;  5AJG A;  4L9E A;  2KDK A;  1DP6 A;  1S67 L;  4II7 A;  1OTB A;  4LPZ A;  1S1Y A;  3NJA A;  2HGV A;  3JVV A;  1MC0 A;  1OTE A;  5HDD A;  1N9L A;  3H7W B;  4YOF A;  3UB6 A;  4DJ2 A;  1MKM A;  1DP8 A;  2JHE A;  3T4S A;  3TRC A;  4Q0I A;  4NXG A;  3KO6 A;  2QJ5 A;  4I38 A;  1STZ A;  4NXE A;  2M7U A;  2ZMV A;  4L9F A;  2PD7 A;  4ETZ A;  4JGR A;  1OJ5 A;  4R6L A;  4WUJ A;  4KQD A;  2M7V A;  5HDS A;  3C30 A;  5IS1 A;  1Y28 A;  2FZ0 A;  2VEA A;  3LR0 A;  5IU1 A;  3A0R A;  2O9B A;  4PKY G;  4HP4 A;  3B42 A;  4R3A A;  5F69 A;  3T4Q A;  2W1T A;  1TS7 A;  2YKH A;  3SW1 A;  4WEJ A;  1XJ2 A;  3A0V A;  1UGU A;  3IBR A;  4B9O A;  3R4K A;  1OT6 A;  4MN5 A;  2DMW A;  5F68 A;  2O9A A;  2W3F A;  3KYZ A;  3T4J A;  4L9G A;  4GS9 B;  4F3L A;  2J3W A;  3LR3 A;  1MZU A;  3EGX C;  5AVE A;  3UB7 A;  4M4X A;  1OPX A;  1G6O A;  4G3V A;  3LFV A;  3MQQ A;  5HPF A;  5FL3 A;  2V0U A;  3E0Y A;  4HOI A;  3LIB A;  5F6A A;  4HJ3 A;  4LLO B;  2VGL S;  4Y5F A;  3E4Q A;  1LSX A;  5C5K A;  3RFB A;  2K2N A;  2PHY A;  1F9I A;  2JN7 A;  4Q0H A;  3RTY A;  5J4E A;  5KSH A;  1OJG A;  3T4L A;  2WKR A;  2KOI A;  3EWK A;  2PT7 A;  3GDI A;  5KIZ A;  3CLO A;  3PBO A;  3F1P B;  5HL6 A;  4H6J B;  3UMD A;  4P6Z M;  3IBJ A;  3RH8 B;  3PBQ A;  1H3Q A;  2ZBB A;  1YKD A;  4BBV A;  1IFQ A;  3HJI A;  4E04 A;  1H8M A;  4WEK A;  4XT2 B;  5J3W A;  2OAQ 1;  5HSQ A;  3IS2 B;  2VLG A;  3PHY A;  2W3H A;  2NUP C;  5DJU A;  3UME A;  3DBA A;  4CLC C;  1P9R A;  3E98 A;  1N9O A;  2PYP A;  1XJ4 A;  1GSV A;  2INW A;  4MN6 A;  2K31 A;  2Z6C A;  4JGP A;  5A8B A;  4HIA A;  1P9W A;  1OT9 A;  4BWI A;  2WKQ A;  2GJ3 A;  2A24 B;  4MN7 A;  4DJ3 A;  5MC7 A;  3FC7 A;  3NOP C;  3R7W B;  4NEE D;  2B02 A;  3VE3 A;  4I3I A;  3UE6 A;  3MR0 A;  1G28 A;  2A2L A;  1LSV A;  1NLY A;  3LIC A;  1D7E A;  4EQ1 A;  2V0W A;  2Y79 A;  2OWJ A;  3BY9 A;  4PHT A;  1F5M A;  1TF1 A;  3F1N B;  3LIA A;  5DJT A;  5HPI A;  4EEP A;  2LB9 A;  3BJN A;  3KSF A;  2W3E A;  3TW8 A;  3PYP A;  3BW6 A;  5IT5 A;  3E4P A;  4WEL A;  3T4T A;  4Q0J A;  2PR5 A;  1P0Z A;  1TD5 A;  4Y2F A;  2VA0 A;  4HH2 A;  1KOU A;  2V1A A;  3PXP A;  1TS8 A;  2JKR I;  2EWW A;  3F1O A;  1NWZ A;  3HJK A;  2IA2 A;  3MJQ A;  3OOV A;  3PR6 A;  1YAX A;  3S7O A;  4DN0 A;  3ICY A;  4LRZ E;  4GHI A;  4PKY A;  2JKT I;  2P7J A;  2Y8H A;  4I3J A;  2L0W A;  2L1M A;  3H82 A;  2OWH A;  3BQA A;  2QYB A;  3CAX A;  3NHQ A;  2VX8 A;  3ZYT A;  3PBT A;  1UWP X;  4I39 A;  2W0N A;  2PYR A;  2VV8 A;  1T1C A;  3LID A;  4KUO A;  2ZOI A;  5TBM A;  2VKS A;  3OBF A;  3T4K A;  4ME4 A;  4CQH A;  2H28 A;  3C2W A;  3LIF A;  1OTD A;  3VOL A;  3O5Y A;  2ZOH A;  2VV7 A;  5F5Y A;  4I5S A;  5HD3 A;  4LRY C;  2D01 A;  2VV6 A;  3OLO A;  1W63 Q;  5K5B A;  1W63 M;  5TJJ A;  5AVF A;  4LRX C;  1EW0 A;  2KLI A;  5J7E A;  3C8C A;  3LIE A;  3VE4 A;  1VB6 A;  4JGO A;  3FG8 A;  4MCW A;  5DKL A;  3E4O A;  3TJZ C;  3MQ0 A;  1LSW A;  3UB8 A;  2QWS A;  5G4Y A;  2W3D A;  4CLC E;  4F3L B;  2G7U A;  4I3A A;  3BQ8 A;  3F1P A;  4H6J A;  2P04 A;  4B93 A;  3B47 A;  5DFY A;  2MJ6 A;  4NXF A;  4EES A;  3A0S A;  2OOL A;  4AFI A;  4UEY A;  4CLC A;  2Z6D A;  2FH5 A;  1X0O A;  3JVU A;  2JKR M;  4GCZ A;  1JNU A;  3KSH A;  3H9W A;  4GLQ A;  3UE3 A;  1S66 L;  1XFQ A;  4P6Z S;  4EUV A;  1YSP A;  2EWV A;  3LYX A;  5HZH A;  2YKF A;  4NXB A;  3FPW A;  3W2Z A;  2JKT M;  3KX0 X;  4UQI M;  4WN5 A;  2HJ9 C;  4K08 A;  4EET B;  4MDZ A;  1S4S A;  3MF0 A;  3G6O A;  3ZQ5 A;  1GSW A;  4ARZ A;  2J3T C;  3OC2 A;  2XA7 M;  3BWL A;  3NOU C;  4GW9 A;  4HNB A;  3EEA A;  2HF6 A;  3OCL A;  3PBR A;  3NOT C;  4Y3I A;  4WLA A;  3D3O A;  1V9Y A;  4HH3 A;  3S7N A;  1TS6 A;  3B33 A;  3EGD C;  5HWW A;  4FOF A;  4HHD A;  4R38 A;  3MQO A;  3VV4 A;  4KUK A;  3CWF A;  1S4R A;  5EFW A;  3H7W A;  4OOL A;  2D02 A;  4WL9 A;  4GJ4 A;  4BJP A;  1T19 A;  3KSI A;  4RQ9 A;  3KSG A;  4WF0 A;  2HJE A;  5DF9 A;  4OOM A;  4L0L A;  2BAS A;  3S7Q A;  3EQU A;  4R70 A;  1LL8 A;  2NUT C;  4IJG A;  4EW7 A;  4BMW A;  1YSQ A;  5I5L A;  4FSF A;  3ULF A;  3LR4 A;  3MXQ A;  2V1B A;  3FPV A;  3S7P A;  4HP9 A;  5LBR A;  4IUK A;  3T4O A;  2XRO A;  1ZHH B;  3HCY A;  3MFX A;  2M1C A;  1WA9 A;  3PBN A;  4MMN A;  1S1Z A;  3UB9 A;  1OTA A;  2K7S A;  2O99 A;  1N9N A;  4JGQ A;  5HDC A;  4HJ6 A;  1XJ3 A;  3F1O B;  1IOU A;  4KQO A;  2V9A A;  3PBS A;  4HY8 A;  3TE8 A;  3D72 A;  2VJW A;  4GS9 A;  4GHI B;  5HD5 A;  3KYQ A;  4DMZ A;  3K3D A;  2LB5 A;  4PAU A;  4HQA A;  2ZMF A;  2J80 A;  3H82 B;  1T1B A;  5DFX A;  4CLC D;  4G3W A;  4BBU A;  2EA9 A;  2W1T B;  3P01 A;  1LT0 A;  4G3K A;  1P97 A;  5TBM B;  2W1R A;  3BY8 A;  3LI8 A;  4YNR A;  3U2A A;  3GEC A;  2VGL M;  2PR6 A;  2J3T D;  3CI6 A;  4IUH A;  2W3G A;  3CIT A;  5L8M A;  2CMN A;  4IHQ A;  1VHM A;  2I9V A;  4EER A;  1UWN X;  2B18 A;  3LR5 A;  2PDR A;  1OTI A;  4O0P A;  2GZA A;  4XT2 A;  4QPR A;  1ZTU A;  2O9C A;  3IS2 A;  3K2N A;  2XRN A;  4YWZ A;  4EEU A;  2QHK A;  3K3C A;  3C38 A;  2GNX A;  3OCN A;  3V67 A;  1ODV A;  4BBT A;  3LI9 A;  3EOI A;  5HWT A;  1NLZ A;  4ETX A;  3CUE A;  4EU0 A;  2R78 A;  2A24 A;  1XFN A;  5HWV A;  1D06 A;  3R7W A;  4CLC B;  3CUE C;  3T50 A;  5G4Z A;  4ZRR A;  1T18 A;  4UQI S;  1F98 A;  2VZW A;  2HV1 A;  4O01 A;  2GX5 A;  1V9Z A;  3P7N A;  2P08 A;  4EXO A;  1XJ6 A;  2QKP A;  5DKK A;  2OAP 1;  3F1N A;  2W27 A;  2XA7 S;  2O0Y A;  1T1A A;  4HI4 A;  1GSX A;  2QJ7 A;  1TS0 A;  3EEH A;  4ARZ B;  4NKP A;  2WKP A;  4HJ4 A;  4O8G A;  1DRM A;  2PD8 A;  3MMH A;  2L4R A;  2XSS A;  2KX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...