4BD0A

X-ray structure of a perdeuterated toho-1 r274n r276n double mutant beta-lactamase in complex with a fully deuterated boronic acid (bzb)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE TOHO-1
publication title Neutron and X-Ray Crystal Structures of a Perdeuterated Enzyme Inhibitor Complex Reveal the Catalytic Proton Network of the Toho-1 Beta-Lactamase for the Acylation Reaction.
pubmed doi rcsb
source organism Escherichia coli bl21
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4bd0A00
1K56A 2Y2QA 2IWCA 4FH2A 2V1ZA 2ZJ9A 4OLGA 3BM6A 3IHBA 1PWDA 4DKIA 5M18A 4S2IA 2HP6A 3G2YA 3WWXA 1MWSA 4IBRA 1GA0A 1K57A 1VQQA 4ZBEA 2V2FF 4X55A 5BOHA 3S1YA 4GB7A 1CEGA 3PAEA 1YT4A 2XFTA 1DJCA 3IXDA 4WELA 3CZDA 2X01A 3TG9A 2UWXA 3Q07A 4LV1A 1PIOA 3UNWA 3VOYA 5EPHA 3ISGA 1RGZA 1ZG6A 3N8LA 3AGFA 5E2EA 3ZG5A 4F94A 3ZG9B 3OC2A 4KZ8A 5IHVA 3OCLA 5EVIA 3IH8A 4Q8IA 3OCNA 4KZ3A 3GTCA 1N4OA 2XGNA 5HX9A 2Q9MA 5FSRA 4OH0A 3S22A 3IF6B 3NI9A 4P0MA 4DXBA 3IH9A 2ZQ8A 3HREA 4R3JA 5EVLA 3TOIA 2H5SA 1L0DA 3UDFA 1LHYA 3P98A 3SS5A 1JWVA 1L0GA 1SDEA 5CHMA 4L0LA 1YQSA 1NY0A 3NCKA 2XQZA 3FZCA 3MXRA 4RX2A 1L2SA 4DDSA 1XA1A 3IXBA 1I5QA 5HL1A 3DTMA 1SKFA 3N7WA 3A3DA 1PWCA 3IXGA 1RGYA 4KENB 2XR0A 3VP3A 3C4PA 5F1GA 3ZG0A 1ZKJA 3UPPA 3Q7VA 5J8XA 5TFQA 1AXBA 5GHXA 1K4FA 1W5DA 4IBXA 4PM9A 1IYPA 2JC7A 5GLDA 2Y2IA 5FI2A 1GCEA 1H8YA 2J9OA 5E2HA 4GDBA 4GN2A 1FR1A 1IELA 5DTKA 3ZDJA 3ZFZA 1KE3A 3FKVA 4FCFA 3HLFA 3PAGA 4EBNA 4NETA 4EBLA 5AQ7A 2H10A 2Y2LA 3A3EA 4LV2A 3PBTA 5EUAA 4C3QA 5AQ9A 1NYMA 4QB8A 1LI9A 1OMEA 1LLBA 2B5RA 2WUQA 3NC8A 3N8SA 3VOZA 3PBSA 4E6XA 1WYCA 3IWIA 1PI5A 1O7EA 1S0WA 3FKWA 3Q7VB 4PM5A 3HLBA 4KQQA 2DNSA 3OPHA 4S2KA 4UA6A 4HBTA 3W4PA 4KZ4A 3V50A 4PMAA 1YLTA 4R1GA 4XUZA 4DXCA 1K4EA 1XKZA 1XP4A 1ONGA 2XH9A 2Y91A 5GHYA 3NDGA 3ZVTA 3Q81A 4R4RA 4S2PA 4GD6A 4DE0A 1H5XA 1MPLA 3BRMA 1LI0A 4UHUA 1J9MA 3VP1A 2C5WB 4JBFA 1KGGA 4LV0A 3VFFA 4PM8A 3HLCA 4LCMA 3O88A 3GVBA 4P6BA 1IYSA 4ZDXA 4BJPA 1MWRA 1W79A 1K55C 3ZG7B 2X71A 3M2JA 4E3OA 1MBLA 5FQKA 1PW8A 1ESIA 4GZBA 5A92A 3DWZA 2Y2KA 1E3UD 4M3KA 4WM9A 4E6WA 5KMWA 3SH9A 2ZC3B 4MLLA 4JF5A 2WZXA 4OONA 4Y7PA 4C75A 5I94A 3Q1FA 1HD8A 1PZPA 1KDWA 2WGWA 2WK0A 4KG5A 4ZJ1A 4S2JA 1YLZA 2JBFA 1GHIA 1MY8A 1PI4A 3GRJA 4IEDA 4JF4A 4R0QA 3OPPA 3UDIA 4B4XA 3C4OA 2P9VA 3N4IA 1FSYA 3WRZA 3CJMA 3ZGAB 3SS4A 1K6SA 2XDMA 2Y2HA 1CI9A 2EFXA 4EQIA 4QU3A 2ZM0A 5FQMA 3VFHA 2WAEA 4K0XA 1BLPA 5CXWA 5DTTA 4HBUA 1IKGA 4OP5A 5GL9A 4GOGA 1EROA 3V39A 3ZCZA 2J8YA 3UY6A 4OPQA 3MZFA 2WGWB 4GDNA 1XPBA 2I72A 1BUEA 4KZ9A 2HP5A 4OOYA 2J9PA 1L0EA 4S2OA 4JXSA 1XA7A 2Y2PA 4LCLA 2Z2LB 4N9KA 1ESUA 1Q2PA 5CECA 5DTSA 4QHCA 2H0YA 3WS5A 1L0FA 4S2MA 2A49A 1YLYA 5FA7A 5M1AA 1DJAA 3P09A 1FQGA 5A93A 2Y2MA 1KVLA 1K54C 1GHPA 2HDQA 1FCNA 3BYDA 2P74A 5CTNA 2IWDA 3SOIA 3OZHA 3EQVA 5GHZA 1PW1A 1K25A 2EFUA 3G31A 5DF7A 4E3MA 5JYPA 1SDNA 4P85A 3LO7A 1E3UA 1BSGA 4A5RA 4WZ5C 1DY6A 3HBRA 3WS0A 4C6YA 4FD8A 1FCOA 3W4QA 2DCFA 1JVJA 1JWPA 1Z6FA 4YINA 4K91A 1VM1A 5EVIB 3W4OA 4RA7A 1ES5A 3PBQA 4HESA 3VSKA 5FAOA 3Q82A 4BD1A 4Y0TA 4OOLA 1NZOA 3IXHA 4MEZA 4BL3A 1KE4A 2WADA 1HVBA 1BZAA 5GLAA 5DVAA 3UN7A 1CEFA 1K55A 5CEDA 2XD5A 2WGVA 5AQBA 1NJ4A 1H8ZA 3RXXA 2BG1A 4OVDA 2PU2A 4WZ4A 1W7FA 2EX2A 2OSUA 3IF6C 4FH4A 4E3NA 5CHUA 1IYOA 1S6RA 2Y2NA 1TVFA 3O87A 1TDLA 4ZAMA 4R4SA 4D2OA 3C5AA 1XXMA 2WKIA 4OQ0A 5HW3A 1K57C 1IEMA 4X56A 5EOOA 5HAIA 1NZUA 3WS2A 3DW0A 4OQIA 2H0TA 1ES4A 2ZC7A 3HLEA 2WAFA 1YMXA 3MZEA 2XK1A 3BFDA 4RYEA 2FFFB 3NBLA 4JPMA 4S2NC 4E3KA 3UPNA 2WKHA 3O3VA 4BL2A 5CGWA 5G18A 1DJBA 3C7VA 4UA7A 3PBOA 3HLWA 5FI7A 3LCEA 5FAQA 4EV4A 1ZC2A 1IYQA 5L2FA 3PBNA 3ZVWA 5KZHA 3ZG8B 1G6AA 2ZQ9A 3EQUA 2CC1A 3QHYA 3HLGA 4MBFA 1KGEA 4N9LA 4JXWA 4X68A 5HARA 2G2UA 3FV7A 1ERQA 3LY4A 2Y2JA 2JCHA 5CGXA 5F82A 3I7JA 2EX9A 3LY3A 3VMAA 4QJGA 4OKPA 4Y0UA 4WYYA 4JXVA 4Y0OA 2EXAA 3SH7A 4OQGA 2G2WA 4PM6A 4X69A 5GLBA 4DDYA 4LENA 3RJUA 1QMFA 5HFOA 3UE1A 2ZLYA 5HAQA 3G32A 2IWBA 4GNUA 1K54A 2PU4A 4KZBA 2HP9A 3E2LA 4FSFA 3D4FA 5DF9A 1E25A 3WS4A 4KQRA 1ZG4A 4DRTA 4NK3A 1BLCA 3SH8A 4EUZA 3C7UA 3A3JA 4R3BA 5FATA 5EE8A 1RCJA 2GDNA 5E2GA 3CG5A 3AGEA 1Q2QA 4RVAA 3UO9A 1CI8A 2ZQ7A 5FQ9A 2VGJA 3OPLA 1HTZA 1SCWA 5M19A 1C3BA 4MNRA 1GHMA 3FWLA 5CHJA 2FFYA 5TGFA 3VP2A 4E3IA 3ITAA 2XLNA 4X6TA 3MKEA 4QY5A 2WKEA 4WBGA 5CRFA 3QNBA 3IHAA 2PBYA 3VP0A 1KDSA 3ZHHA 2C6WB 2P9VB 3LEZA 3NDEA 4E3LA 1FSWA 4N1XA 1FR6A 3IWOA 3RXWA 4PPRA 2X02A 2XFSA 2OV5A 4ZJ3A 2EX8A 4HEFA 3HUMA 2ZC6B 3G2ZA 1PZOA 3IF6A 3MKFA 4MBHA 5GLCA 3V3SA 1O07A 1XGIA 2XEPA 5EOEA 2Y4AA 4IVIA 3BFCA 5E43A 1NRFA 2XF3A 2ZMAA 1XX2A 4XUXA 3BEBA 3NY4A 2ZQAA 5FDHA 3JYIA 3E2KA 3M6BA 2QPNA 4KZ5A 1SHVA 4KZ6A 3BECA 2ZQDA 3AGDA 4LV3A 5CTMA 2R9WA 2ZC4B 1LL9A 3V3RA 3V5MA 3BLMA 4KG2A 1PWGA 4Z9QA 1ES2A 1HZOA 4K0WA 4WMCD 3TSGA 4CPKA 1K38A 3MBZA 4S2NA 3VSLA 1ERMA 2QZ6A 2V20A 1NYYA 2XD1A 1IKIA 3HL9A 3BLSA 4X53A 4OPYA 5F83A 3UE0A 3G35A 1EI5A 1W8YA 4DF6A 1BT5A 4KZAA 4IVKA 3Q7ZA 3BFFA 1YLJA 4EBPA 2VGKA 2R9XA 2ZM2A 3UE3A 5FASA 3GQZA 2OLVA 1JTGA 4BQMA 3G34A 2HDUA 4KG6A 4N1HA 1PYYA 5EECA 5FQIA 1MXOA 1I2SA 3A3IA 5AQAA 3VP4A 3UPOA 3IF5A 4OP8A 2RCXA 1ES3A 4RX3A 2E8IA 4BD0A 3MFDA 1E4DA 1XGJA 3OPRA 4O7DA 4U3TA 4DE1A 3HUOA 1TEMA 4QD4A 3NIAA 3ZNYA 3BFEA 5F1FA 3GMWA 2WYXA 3G30A 1BULA 2QMIA 2Q9NA 3MZDA 2HPBA 5CEBA 1RP5A 3PBRA 4JLFA 1ONHA 4S2LA 1YMSA 4CJNA 2ZC5B 2WZZA 4UA9A 3W8KA 5EVIC 4GKUA 2ZD8A 5FQJA 4H8RA 4U0XA 2HDSA 4JXGA 1K56D 4BLMA 1K6RA 3N6IA 4KQOA 3M6HA 2EX6A 4KZ7A 4WEJA 2J7VA 1BLSA 3IQAA 1JWZA 1WE4A 5FQQA 5U47A 5A91A 1G68A 4OPZA 3SS3A 4UAAA 3GR2A 4ZJ2A 5JYOA 4DE2A 4GD8A 3N8RA 3MXSA 3DWKA 1EWZA 2JE5A 3IWQA 4WMCA 1TDGA 4QY6A 3IT9A 3GV9A 1MKIA 4PM7A 1WYBA 1FOFA 1BTLA 1I2WA 5EVID 3ITBA 1KE0A 3QNCA 3A3FA 1MWTA 2A3UA 5CERA 5KSCA 1LL5A 2Y2OA 5DF8A 3S4XA 1BLHA 2Z2MB 1MWUA 1W8QA 5HAPA 2ZM8A 5KSHA 5D3OA 4JKTA 2HDRA 1GA9A 2OLUA 1QMEA 4OQHA 1ALQA 3HUNA 3BFGA 4YFMA 4EWFA 4B4ZA 5CGSA 4ID4A 2Y55A 1NXYA 3WRTA 3B3XA 1U60A 4N92A 2Y2GA 3G4PA 4ZTKA 5FI6A 4BENA 4E3JA 4JF6A 5TR7A 3CMZA 2DRWA 4OOMA 4P87A 4MBKA 4WZ5A 1Y54A 2Y59A 4OLDA 1N9BA 4R23A 5FAPA 3FYZA 1YM1A 1YLPA 3M2KA 2WGIA 3HVFA 2BLSA 4XXRA 1YLWA 3UDXA 3O86A 5E2FA 4WEKA 3GSGA 1KGFA 4B88A 4U0TA 2EXBA 2ZQCA 3ZNTA 4DE3A 1FCMA 1CK3A 2RL3A 1M6KA 3PTEA 1M40A 5A90A 3WS1A 3HLDA 1JTDA 4OPRA 1KVMA
chains in the Genus database with same CATH superfamily
5IT5A 1K56A 2HP6A 3WWXA 3E4QA 4Y17A 3CPTB 1OT6A 4ZBEA 5BOHA 1TS7A 4H6JB 2UWXA 3MXQA 3QP4A 4LV1A 5EPHA 5KIZA 4GW9A 3K3CA 2DMWA 2W3HA 3S22A 2I9VA 3IF6B 3IH9A 3UDFA 4UQIS 1L0GA 3F1PB 3EGXC 1RGYA 4KENB 1H8MA 3ZG0A 3UPPA 5GHXA 1NLYA 1W5DA 2W3EA 3E98A 3NULA 3LIBA 5GLDA 1GCEA 1H8YA 4GN2A 4IUHA 4ETXA 1LSWA 4NETA 2H10A 5LBRA 4C3QA 4HP4A 2VV8A 3PBSA 4O01A 3IBJA 3Q7VB 1O7EA 1S0WA 4PM5A 2PBDP 4HBTA 4R1GA 1XKZA 2XH9A 2Y91A 3NDGA 4KUKA 1MPLA 2HF6A 3BRMA 1LI0A 2C5WB 3VE4A 4JBFA 3S7PA 4PM8A 4HI4A 4MMNA 3GVBA 3T12B 3ZG7B 1HLUP 3SW1A 5A92A 3DWZA 1E3UD 5KMWA 2WZXA 4WLAA 4Y7PA 4ESPA 1HD8A 2XA7S 2WGWA 4KG5A 5HPFA 4R0QA 4B4XA 3ZGAB 5HDDA 5AJGA 4HY8A 1YKDA 2K2NA 3LI8A 2WAEA 4K0XA 1BLPA 5DTTA 4EETB 3UMDA 4GOGA 1EROA 3V39A 3UY6A 4F3LA 3UMEA 5TBMA 2HP5A 4HJ4A 4LCLA 5CECA 2H0YA 3WS5A 4S2MA 1LT0A 5FA7A 1FQGA 2FZ0A 2Y2MA 1GHPA 3ZQ5A 1OJGA 5GHZA 2M7UA 3NOPC 3D3OA 4E3MA 4P85A 2VLGA 3MMHA 4FD8A 1JWPA 1VM1A 2JN7A 3PBQA 3T4KA 4HESA 4BD1A 5F5YA 4WF0A 4MEZA 1BZAA 5GLAA 5CEDA 1F2KA 3MSHA 4OVDA 4WZ4A 5DJUA 1S6RA 4D2OA 3C5AA 2J3WA 3T50A 4CQHA 5C5KA 5HAIA 4WN5A 5IU1A 1ES4A 3D72A 1YMXA 3FG8A 3BFDA 4II7A 1YSQA 3NBLA 3T4TA 4E3KA 3UPNA 2WKHA 2O99A 3KYQA 2MJ6A 4EV4A 5L2FA 1T19A 1S66L 4EEUA 2ZQ9A 1VHMA 3T1SA 1KGEA 4N9LA 4X68A 2Y2JA 1J3WA 5F82A 4OKPA 4Y0UA 2EXAA 2G2WA 4PM6A 2KX6A 4GNUA 2PU4A 3HJKA 1D1JA 4FSFA 3WS4A 1XJ4A 1FILA 1ZG4A 3SH8A 5EE8A 1RCJA 3UB8A 3EOIA 3O5YA 5E2GA 1Q2QA 5HL6A 5AVEA 3OPLA 3H9WA 4MNRA 1GHMA 3FWLA 2XLNA 3MKEA 4WBGA 5CRFA 2IA2A 3QNBA 3KSIA 1KDSA 1FR6A 3IWOA 2X02A 5GLCA 2ZC6B 2VEAA 2XEPA 1SKOB 1S1ZA 5EOEA 1W63Q 3BFCA 1NRFA 4F3LB 2ZQAA 5FDHA 3E2KA 5TBMB 3BECA 4LV3A 5CTMA 3V3RA 1PWGA 4Z9QA 3FC7A 4CPKA 5L09A 3S7QA 3U2AA 3T4OA 1IKIA 3BLSA 4BWIA 4EEPA 3H7WA 3Q7ZA 1P97A 1YAXA 3K2NA 4BQMA 3R7WA 5FQIA 1SZVA 4GS9A 5AQAA 5HWTA 2PDRA 3IX3A 2RCXA 3DTKA 2E8IA 1E4DA 1XGJA 1TEMA 1LL8A 4QD4A 3VE3A 3BFEA 2VV6A 1RP5A 2XRNA 1ONHA 4JLFA 2EWWA 1Y4OA 2UV0E 5EVIC 2ZD8A 2W0NA 1P9RA 1K56D 4BLMA 3N6IA 4KQOA 4WEJA 3C2WA 3HCYA 1WE4A 2HGVA 4OPZA 3GR2A 1TDGA 3IT9A 1WYBA 3OBFA 1FOFA 1BTLA 1KOUA 3A3FA 4K08A 1MWTA 2A3UA 2Y2OA 5EV0A 1W8QA 2HDRA 1YSPA 1QMEA 1ALQA 2L0WA 2Z6CA 4YFMA 4KQDA 4B4ZA 3MF0A 2Y55A 1DP8A 2QJ5A 2OAQ1 4R23A 3FYZA 1W63M 1H3QA 3CPTA 3M2KA 2WGIA 3MQQA 2ZL1A 4XXRA 1PFLA 4WEKA 4B88A 4U0TA 3A0RA 3PTEA 1M40A 5L07A 1JTDA 3L7HA 2Z6DA 3KX0X 3G2YA 1K57A 3C38A 1AWIA 5DJTA 1CEGA 3IS2B 1OPXA 1DJCA 3CZDA 2Q0OA 5DKKA 3UNWA 3VOYA 1Z09A 1PIOA 3N8LA 1RGZA 5E2EA 4F94A 3QP8A 3L9KA 4KZ8A 5IHVA 4Q8IA 3OCNA 4G3KA 2ZMVA 1N4OA 3GTCA 2QYBA 1N9LA 4OH0A 4Y15A 1IOUA 2EA9A 4YOFA 2Y8HA 2VZWA 3FPVA 1L2SA 3A3DA 1PWCA 2EWVA 4MDZA 3Q7VA 5J8XA 1LSVA 5L8MA 1BYWA 1K4FA 4JGOA 4PM9A 2JC7A 5EVEA 4X25A 4ZRRA 3H7WB 1ACFA 1GSVA 2BTFP 5HPIA 5AQ7A 2Y2LA 4LV2A 5AQ9A 1OMEA 4PKYG 3N8SA 3VOZA 4GS9B 1WYCA 3IWIA 3HLBA 2W3DA 4KZ4A 2P7JA 3V50A 4PMAA 1XJ6A 1X0OA 1XP4A 1ONGA 3ZVTA 3B42A 4R4RA 4DE0A 1J9MA 3VP1A 4EESA 1V9ZA 1TD5A 4LCMA 4EERA 4EU0A 1IYSA 1K55C 4E3OA 3M2JA 1MBLA 1TS0A 5FQKA 1NLZA 3KYZA 4MLLA 5J4EA 4R6LA 3Q1FA 2J3TD 1LSXA 1PZPA 2OAP1 2WK0A 4ZJ1A 2JKTI 2JBFA 1PI4A 3OPPA 1L3LA 2P9VA 3N4IA 1FSYA 5FEGA 2QHKA 4I3AA 4EQIA 3TE8A 3VOLA 5CXWA 4LPZA 3ZCZA 2J8YA 4OPQA 2V9AA 3MZFA 4GDNA 1BUEA 3JVVA 2NUPC 2ZL1B 1MZUA 4GCZA 4S2OA 3F1NA 1CF0A 3TJZC 4RQ9A 4QHCA 2A49A 1YLYA 4HH3A 1KVLA 3BYDA 2P74A 4NXGA 2W1TA 2KLIA 1PW1A 3G31A 5DF7A 5JYPA 3LO7A 1BSGA 3HBRA 4C6YA 1FCOA 3W4QA 5HWVA 4K91A 3W4OA 4RA7A 4MN6A 4L9FA 4D60A 2JKTM 5FAOA 3NJAA 2PRFA 4BL3A 1KE4A 3CHWP 2XD5A 2WGVA 1H8ZA 3RXXA 2BG1A 4JGQA 3IF6C 4FH4A 4E3NA 1IYOA 4R4SA 1XXMA 5HW3A 1K57C 1DP6A 5EOOA 4MN5A 3WS2A 2B18A 3K3DA 2H0TA 4OQIA 5FDSA 3MZEA 2YKFA 2FFFB 5HDCA 5F69A 4S2NC 3O3VA 5CGWA 4QPRA 5G18A 4UA7A 5G4YA 3HLWA 5FI7A 3LCEA 3DTEA 1IYQA 3ZVWA 3TRCA 3ZG8B 1OTBA 2CC1A 3QHYA 3HLGA 1ZTUA 5HARA 2G2UA 5HD3A 2OOLA 2JCHA 3LY3A 3VMAA 3G6OA 4Y0OA 4JXVA 4Y13A 4DDYA 4LENA 3UE1A 4Q0IA 2LB5A 4I3IA 1K54A 3CITA 3E2LA 4NK3A 4BBVA 1F9IA 4EUZA 4R3BA 3PYPA 5TJJA 3U4LP 2GDNA 3CUEC 4RVAA 1SKOA 3UO9A 2ZQ7A 3C30A 4HHDA 5M19A 3ITAA 3KO6A 3IHAA 3VP0A 1XJ2A 2D01A 5HD5A 2P9VB 4HIAA 3LEZA 4B93A 4E3LA 4ZJ3A 1XGIA 2XF3A 1XX2A 1OJ5A 4IJGA 2OWHA 3JYIA 3RFBA 2QPNA 1SHVA 1F5MA 4JGRA 3BLMA 3F1NB 1ES2A 1HZOA 4MCWA 3R4KA 2V1BA 3MBZA 3VSLA 5EFWA 1ERMA 2V1AA 2XD1A 4X53A 4OPYA 1K0KA 3FPWA 1TS8A 2W1TB 2INWA 4EBPA 2R9XA 3PR6A 2ZM2A 4M4XA 1JTGA 3G34A 4DN0A 1PYYA 3QP1A 3UPOA 1I2SA 3A3IA 3IF5A 4OP8A 4RX3A 3OPRA 1A0KA 3HUOA 2K7SA 4HH2A 3ZNYA 5F1FA 3GMWA 2WYXA 3G30A 2GNXA 4CJNA 2V0WA 2XSSA 3T4QA 2ZC5B 4O0PA 4UA9A 3W8KA 4GKUA 2HDSA 1K6RA 3M6HA 3IQAA 5U47A 5A91A 1G68A 3UE6A 4UAAA 4ZJ2A 5JYOA 4LLOB 4IUKA 4DE2A 3UB9A 4HJ6A 3N8RA 3IWQA 4WMCA 4QY6A 4PM7A 2B02A 3ITBA 3MJQA 3QNCA 4EUVA 5CERA 1LL5A 3LIDA 5DF8A 1BLHA 1MC0A 2Z2MB 4JKTA 3W2ZA 2OLUA 4OQHA 5DFYA 2B95A 3BFGA 4EWFA 1WA9A 3GECA 4Q0HA 5CGSA 4IHQA 2Y2GA 5TR7A 4WZ5A 2Y59A 1N9BA 5FAPA 5F6AA 1YLPA 3IS2A 4CLCB 4I5SA 3LIAA 5G4ZA 2RL3A 2O9AA 3V67A 3LIFA 2VX8A 4OPRA 2Y2QA 2IWCA 2V1ZA 4OLGA 3NOUC 4FTXA 3IHBA 1PWDA 4DKIA 3A0VA 1MWSA 3E4OA 5J7EA 4LGWA 3S1YA 4GB7A 3EGDC 4MN7A 4X1LA 2WKRA 5J3WA 2X01A 3T4SA 3Q07A 1ZG6A 3ZG5A 3AGFA 4CLCE 3OC2A 3OCLA 3IH8A 4KZ3A 3LYXA 5FSRA 2W3FA 4P0MA 3NI9A 2PAVP 4G3WA 2ZQ8A 5EVLA 3TOIA 1L0DA 1LHYA 1JWVA 2VK3A 3NCKA 4GJ4A 3FZCA 3ICYA 3MXRA 4DJ2A 4RX2A 3IXBA 3DTMA 1SKFA 3IXGA 3RH8B 5F1GA 1OTAA 5TFQA 2WKPA 3OLOA 3IX8A 1IYPA 3LGOA 4R38A 2Y2IA 5FI2A 2GJ3A 2J9OA 5E2HA 3S7NA 1FR1A 1IELA 3ZDJA 3FKVA 4FCFA 3PAGA 4EBLA 3LR4A 5CX7A 3CI6A 3PBTA 3LEQA 1NYMA 3NOTC 4QB8A 1LI9A 1TF1A 3EEHA 4NKPA 4E6XA 5HDSA 3FKWA 4S2KA 2DNSA 4I39A 3W4PA 4XUZA 1K4EA 3LR5A 1VETB 4S2PA 4GD6A 4BBUA 1H5XA 1NRJA 4LV0A 2J3TC 3HLCA 5EM0A 3O88A 2H28A 4UEYA 4ZDXA 4BJPA 1MWRA 3VV4A 1W79A 4DJ3A 4Y2FA 2XROA 1ESIA 1T18A 4GZBA 2Y2KA 4E6WA 4M3KA 2ACGA 3SH9A 2D02A 2ZC3B 4JF5A 4OONA 4C75A 3D9YA 5I94A 1KDWA 4B9OA 4YNRA 4S2JA 1YLZA 1GHIA 3GRJA 4JF4A 3UDIA 3C4OA 1VB6A 3WRZA 3CJMA 2XDMA 2JKGA 2EFXA 2V8CA 1T1AA 4QU3A 5FQMA 3S7OA 3LR0A 4HBUA 2QWSA 5L10A 1D06A 3LICA 4LRZE 1XPBA 4KZ9A 2PR5A 2J9PA 4JXSA 1XA7A 4I3JA 3LIEA 4N9KA 1EW0A 1L0FA 5M1AA 3P09A 5A93A 2HDQA 4NXFA 1XFNA 1PNEA 1VEUB 1YPRA 3OZHA 1G6OA 3EQVA 2Y79A 2EFUA 1SDNA 4WZ5C 1DY6A 2W1RA 3WS0A 4L9GA 2CMNA 2DCFA 1Z6FA 1T1CA 1ES5A 4LRYC 3VSKA 3Q82A 4HP9A 4OOLA 1NZOA 1CEFA 5DFXA 1OTDA 5AQBA 1XFQA 2OSUA 3PXPA 5CHUA 4HOIA 2Y2NA 3O87A 2J80A 4OQ0A 3DTIA 2VGLM 2A24B 4X56A 1NZUA 1Y28A 2PYPA 3BQ8A 3HLEA 2ZC7A 4Q0JA 2WAFA 1IFQA 3LI9A 2XK1A 2FH5A 4NEED 4BL2A 1T1BA 3PBOA 5FAQA 2YKHA 3PBNA 2PR6A 3MQ0A 5KZHA 4PAUA 1G6AA 3BW6A 3EQUA 4JXWA 5CGXA 5F68A 2EX9A 1OT9A 3EEAA 5GLBA 1QMFA 2OWJA 4NG2A 1PRQA 5HAQA 2IWBA 4KZBA 2HP9A 3D4FA 1E25A 4KQRA 4DRTA 3UB7A 1BLCA 3C7UA 3A3JA 5FATA 3B33A 3CG5A 5FL3A 5HZHA 1HTZA 4AFIA 2NUTC 3E0YA 2GZAA 3OOVA 5CHJA 2FFYA 5TGFA 3VP2A 4E3IA 4X6TA 4WUJA 1S67L 2WKEA 5I5LA 3P01A 3ZHHA 2C6WB 4N1XA 2P08A 2XFSA 3JPUA 2OV5A 2WKQA 4HEFA 5A8BA 3MKFA 1PZOA 2PD8A 1O07A 1GSXA 2Y4AA 4IVIA 5E43A 4XUXA 3PHYA 3M6BA 3IBRA 4KZ6A 3AGDA 4G3VA 2O9CA 2ZC4B 4KG2A 4K0WA 4WMCD 3TSGA 3LUQA 4P6ZM 2QZ6A 5F83A 1EI5A 1W8YA 3ULFA 2AVXA 1YLJA 3UE3A 3GQZA 2OLVA 2HDUA 2VGLS 4KG6A 1MXOA 2PHYA 4BD0A 3MFDA 4U3TA 4BMWA 4S2LA 1S4SA 4O8GA 3GDIA 3NHQA 3QP5A 3T1XA 2EX6A 4EXOA 4KZ7A 2O0YA 2J7VA 1JWZA 4X1MA 5EM1A 4NXEA 2VA0A 1EWZA 2JKRI 1ZHHB 3GV9A 1V9YA 1I2WA 1KE0A 2ZOHA 4CLCA 1MWUA 5HAPA 5KSHA 2ZM8A 2ZMFA 3NECA 3CAXA 3HUNA 4ARZA 2W3GA 3KSGA 1NXYA 3WRTA 4BENA 4ZTKA 3MFXA 4XT2B 2DRWA 1S4RA 3CWFA 4MBKA 1CQAA 4OOMA 4OLDA 1YM1A 5FEFA 3LR3A 3UDXA 3O86A 3GSGA 1KGFA 2EXBA 2ZQCA 4DE3A 1FCMA 4R3AA 5A90A 5IS1A 3WS1A 3HLDA 1KVMA 2JKFA 4FH2A 2ZJ9A 3BM6A 4LRXC 5M18A 4S2IA 4L9EA 4IBRA 1GA0A 1VQQA 2V0UA 2V2FF 4X55A 3PAEA 1YT4A 2XFTA 3IXDA 4WELA 2GX5A 4P6ZS 3TG9A 2JKRM 2VV7A 3ISGA 2BASA 3ZG9B 3F1OA 5EVIA 1UWNX 2XGNA 5HX9A 2Q9MA 4DXBA 4WL9A 4R3JA 3HREA 2ZOIA 2H5SA 1N9NA 3P98A 3SS5A 2W27A 1SDEA 3T1QB 3MQOA 3MS6A 5CHMA 4L0LA 1YQSA 1NY0A 2XQZA 5HL1A 4DDSA 1XA1A 1I5QA 3N7WA 2XR0A 3VP3A 3C4PA 1ZKJA 1AXBA 4IBXA 3E4PA 1P0ZA 2VKSA 4GDBA 1VETA 5DTKA 3ZFZA 1KE3A 1JNUA 3HLFA 4EBNA 3A3EA 3KSHA 5EUAA 1LLBA 2B5RA 2WUQA 3NC8A 3UB6A 4PHTA 1PI5A 4KQQA 3OPHA 4UA6A 3BY8A 2KDKA 1YLTA 4QWOA 4DXCA 5GHYA 3Q81A 4BBTA 4UHUA 1DP9A 3QP2A 1KGGA 3VFFA 3MR0A 1UWPX 4P6BA 3T4JA 3A0SA 3C8CA 1GSWA 2X71A 1PW8A 1XJ3A 4WM9A 4NXBA 2PYRA 1F98A 2M1CA 3BWLA 4GHIA 1MY8A 4IEDA 5AVFA 4FUWA 3SS4A 1K6SA 2E8JA 2Y2HA 4ARZB 1CI9A 4Z1WA 3SZTA 2ZM0A 3VFHA 2P04A 1FIKA 1P9WA 1IKGA 4OP5A 5GL9A 1VEUA 1H0MA 3JVUA 1OTEA 2WGWB 2I72A 3TW8A 4OOYA 2HZ5A 1L0EA 2PT7A 4HNBA 3H82A 2Y2PA 2Z2LB 1ESUA 1Q2PA 4ME4A 5DTSA 4JGPA 1DJAA 1K54C 4CLCC 1FCNA 5CTNA 2IWDA 3SOIA 4PKYA 1K25A 2LB9A 1E3UA 1MKMA 4YWZA 4A5RA 4Y3IA 1JVJA 4YINA 2A24A 3F1OB 4HJ3A 5EVIB 2JHEA 4FOFA 4Y0TA 3IXHA 2WADA 1HVBA 5DVAA 3UN7A 1K55A 1NJ4A 2PU2A 1W7FA 4I38A 2EX2A 1N9OA 2HJEA 4ZAMA 1TVFA 1TDLA 1TS6A 2WKIA 2QKPA 1IEMA 3DW0A 3KYEA 4RYEA 4JPMA 3T1RA 1DJBA 2A2LA 3C7VA 2L4RA 1ZC2A 4EQ1A 2QJ7A 1UGUA 5DKLA 4ETZA 4MBFA 3FV7A 1ERQA 3LY4A 2PD7A 3I7JA 4EW7A 4QJGA 2HJ9C 4WYYA 3SH7A 4OQGA 4X69A 3RJUA 5HFOA 1DRMA 2ZLYA 3G32A 5DF9A 3HJIA 3AGEA 1CI8A 5FQ9A 2VGJA 1SCWA 1C3BA 4QY5A 4H6JA 4GHIB 2PBYA 1G28A 4R70A 3NDEA 1FSWA 3RXWA 4PPRA 1ODVA 4DMZA 3RTYA 2EX8A 2O9BA 3HUMA 3G2ZA 3IF6A 4MBHA 4LFUA 3V3SA 2ZMAA 3BEBA 3NY4A 3F1PA 3P7NA 4KZ5A 2L1MA 2ZQDA 2R9WA 2R78A 1LL9A 1OTIA 3V5MA 3H82B 2G7UA 1K38A 4S2NA 2V20A 1NYYA 3HL9A 3UE0A 3G35A 4DF6A 1BT5A 4CLCD 4Y5FA 4KZAA 4IVKA 3BFFA 2VGKA 5FASA 4UQIM 4HQAA 4N1HA 5EECA 3VP4A 1ES3A 4DE1A 4O7DA 4KUOA 3NIAA 2VJWA 1BULA 2QMIA 3BY9A 2Q9NA 3MZDA 2HPBA 5CEBA 3PBRA 3BJNA 3EWKA 1YMSA 5HSQA 3LFVA 2WZZA 1D7EA 5FQJA 3DAVA 3B47A 5K5BA 4H8RA 4U0XA 3R7WB 3CLOA 4JXGA 3CUEA 1BLSA 5FQQA 4GLQA 3SS3A 2K31A 2M7VA 4GD8A 3MXSA 3DWKA 2JE5A 4XT2A 3DBAA 1MKIA 5EVID 2V8FA 1G5UA 5KSCA 3UB5P 3S4XA 1NWZA 5D3OA 1GA9A 3QP6A 3IX4A 1S1YA 2HV1A 3T4LA 1STZA 3ZYTA 4E04A 4ID4A 3B3XA 1U60A 4N92A 3G4PA 5FI6A 4E3JA 4JF6A 3CMZA 4P87A 1Y54A 3HVFA 2BLSA 3BQAA 5HWWA 5MC7A 2XA7M 1YLWA 5E2FA 2KOIA 3ZNTA 1CK3A 1M6KA 2ZBBA 1CJFA 3KSFA
chains in the Genus database with same CATH topology
1K56A 2Y2QA 2IWCA 4FH2A 2V1ZA 2ZJ9A 4OLGA 3BM6A 3IHBA 1PWDA 4DKIA 5M18A 4S2IA 2HP6A 3G2YA 3WWXA 1MWSA 4IBRA 1GA0A 1K57A 1VQQA 4ZBEA 2V2FF 4X55A 5BOHA 3S1YA 4GB7A 1CEGA 3PAEA 1YT4A 2XFTA 1DJCA 3IXDA 4WELA 3CZDA 2X01A 3TG9A 2UWXA 3Q07A 4LV1A 1PIOA 3UNWA 3VOYA 5EPHA 3ISGA 1RGZA 1ZG6A 3N8LA 3AGFA 5E2EA 3ZG5A 4F94A 3ZG9B 3OC2A 4KZ8A 5IHVA 3OCLA 5EVIA 3IH8A 4Q8IA 3OCNA 4KZ3A 3GTCA 1N4OA 2XGNA 5HX9A 2Q9MA 5FSRA 4OH0A 3S22A 3IF6B 3NI9A 4P0MA 4DXBA 3IH9A 2ZQ8A 3HREA 4R3JA 5EVLA 3TOIA 2H5SA 1L0DA 3UDFA 1LHYA 3P98A 3SS5A 1JWVA 1L0GA 1SDEA 5CHMA 4L0LA 1YQSA 1NY0A 3NCKA 2XQZA 3FZCA 3MXRA 4RX2A 1L2SA 4DDSA 1XA1A 3IXBA 1I5QA 5HL1A 3DTMA 1SKFA 3N7WA 3A3DA 1PWCA 3IXGA 1RGYA 4KENB 2XR0A 3VP3A 3C4PA 5F1GA 3ZG0A 1ZKJA 3UPPA 3Q7VA 5J8XA 5TFQA 1AXBA 5GHXA 1K4FA 1W5DA 4IBXA 4PM9A 1IYPA 2JC7A 5GLDA 2Y2IA 5FI2A 1GCEA 1H8YA 2J9OA 5E2HA 4GDBA 4GN2A 1FR1A 1IELA 5DTKA 3ZDJA 3ZFZA 1KE3A 3FKVA 4FCFA 3HLFA 3PAGA 4EBNA 4NETA 4EBLA 5AQ7A 2H10A 2Y2LA 3A3EA 4LV2A 3PBTA 5EUAA 4C3QA 5AQ9A 1NYMA 4QB8A 1LI9A 1OMEA 1LLBA 2B5RA 2WUQA 3NC8A 3N8SA 3VOZA 3PBSA 4E6XA 1WYCA 3IWIA 1PI5A 1O7EA 1S0WA 3FKWA 3Q7VB 4PM5A 3HLBA 4KQQA 2DNSA 3OPHA 4S2KA 4UA6A 4HBTA 3W4PA 4KZ4A 3V50A 4PMAA 1YLTA 4R1GA 4XUZA 4DXCA 1K4EA 1XKZA 1XP4A 1ONGA 2XH9A 2Y91A 5GHYA 3NDGA 3ZVTA 3Q81A 4R4RA 4S2PA 4GD6A 4DE0A 1H5XA 1MPLA 3BRMA 1LI0A 4UHUA 1J9MA 3VP1A 2C5WB 4JBFA 1KGGA 4LV0A 3VFFA 4PM8A 3HLCA 4LCMA 3O88A 3GVBA 4P6BA 1IYSA 4ZDXA 4BJPA 1MWRA 1W79A 1K55C 3ZG7B 2X71A 3M2JA 4E3OA 1MBLA 5FQKA 1PW8A 1ESIA 4GZBA 5A92A 3DWZA 2Y2KA 1E3UD 4M3KA 4WM9A 4E6WA 5KMWA 3SH9A 2ZC3B 4MLLA 4JF5A 2WZXA 4OONA 4Y7PA 4C75A 5I94A 3Q1FA 1HD8A 1PZPA 1KDWA 2WGWA 2WK0A 4KG5A 4ZJ1A 4S2JA 1YLZA 2JBFA 1GHIA 1MY8A 1PI4A 3GRJA 4IEDA 4JF4A 4R0QA 3OPPA 3UDIA 4B4XA 3C4OA 2P9VA 3N4IA 1FSYA 3WRZA 3CJMA 3ZGAB 3SS4A 1K6SA 2XDMA 2Y2HA 1CI9A 2EFXA 4EQIA 4QU3A 2ZM0A 5FQMA 3VFHA 2WAEA 4K0XA 1BLPA 5CXWA 5DTTA 4HBUA 1IKGA 4OP5A 5GL9A 4GOGA 1EROA 3V39A 3ZCZA 2J8YA 3UY6A 4OPQA 3MZFA 2WGWB 4GDNA 1XPBA 2I72A 1BUEA 4KZ9A 2HP5A 4OOYA 2J9PA 1L0EA 4S2OA 4JXSA 1XA7A 2Y2PA 4LCLA 2Z2LB 4N9KA 1ESUA 1Q2PA 5CECA 5DTSA 4QHCA 2H0YA 3WS5A 1L0FA 4S2MA 2A49A 1YLYA 5FA7A 5M1AA 1DJAA 3P09A 1FQGA 5A93A 2Y2MA 1KVLA 1K54C 1GHPA 2HDQA 1FCNA 3BYDA 2P74A 5CTNA 2IWDA 3SOIA 3OZHA 3EQVA 5GHZA 1PW1A 1K25A 2EFUA 3G31A 5DF7A 4E3MA 5JYPA 1SDNA 4P85A 3LO7A 1E3UA 1BSGA 4A5RA 4WZ5C 1DY6A 3HBRA 3WS0A 4C6YA 4FD8A 1FCOA 3W4QA 2DCFA 1JVJA 1JWPA 1Z6FA 4YINA 4K91A 1VM1A 5EVIB 3W4OA 4RA7A 1ES5A 3PBQA 4HESA 3VSKA 5FAOA 3Q82A 4BD1A 4Y0TA 4OOLA 1NZOA 3IXHA 4MEZA 4BL3A 1KE4A 2WADA 1HVBA 1BZAA 5GLAA 5DVAA 3UN7A 1CEFA 1K55A 5CEDA 2XD5A 2WGVA 5AQBA 1NJ4A 1H8ZA 3RXXA 2BG1A 4OVDA 2PU2A 4WZ4A 1W7FA 2EX2A 2OSUA 3IF6C 4FH4A 4E3NA 5CHUA 1IYOA 1S6RA 2Y2NA 1TVFA 3O87A 1TDLA 4ZAMA 4R4SA 4D2OA 3C5AA 1XXMA 2WKIA 4OQ0A 5HW3A 1K57C 1IEMA 4X56A 5EOOA 5HAIA 1NZUA 3WS2A 3DW0A 4OQIA 2H0TA 1ES4A 2ZC7A 3HLEA 2WAFA 1YMXA 3MZEA 2XK1A 3BFDA 4RYEA 2FFFB 3NBLA 4JPMA 4S2NC 4E3KA 3UPNA 2WKHA 3O3VA 4BL2A 5CGWA 5G18A 1DJBA 3C7VA 4UA7A 3PBOA 3HLWA 5FI7A 3LCEA 5FAQA 4EV4A 1ZC2A 1IYQA 5L2FA 3PBNA 3ZVWA 5KZHA 3ZG8B 1G6AA 2ZQ9A 3EQUA 2CC1A 3QHYA 3HLGA 4MBFA 1KGEA 4N9LA 4JXWA 4X68A 5HARA 2G2UA 3FV7A 1ERQA 3LY4A 2Y2JA 2JCHA 5CGXA 5F82A 3I7JA 2EX9A 3LY3A 3VMAA 4QJGA 4OKPA 4Y0UA 4WYYA 4JXVA 4Y0OA 2EXAA 3SH7A 4OQGA 2G2WA 4PM6A 4X69A 5GLBA 4DDYA 4LENA 3RJUA 1QMFA 5HFOA 3UE1A 2ZLYA 5HAQA 3G32A 2IWBA 4GNUA 1K54A 2PU4A 4KZBA 2HP9A 3E2LA 4FSFA 3D4FA 5DF9A 1E25A 3WS4A 4KQRA 1ZG4A 4DRTA 4NK3A 1BLCA 3SH8A 4EUZA 3C7UA 3A3JA 4R3BA 5FATA 5EE8A 1RCJA 2GDNA 5E2GA 3CG5A 3AGEA 1Q2QA 4RVAA 3UO9A 1CI8A 2ZQ7A 5FQ9A 2VGJA 3OPLA 1HTZA 1SCWA 5M19A 1C3BA 4MNRA 1GHMA 3FWLA 5CHJA 2FFYA 5TGFA 3VP2A 4E3IA 3ITAA 2XLNA 4X6TA 3MKEA 4QY5A 2WKEA 4WBGA 5CRFA 3QNBA 3IHAA 2PBYA 3VP0A 1KDSA 3ZHHA 2C6WB 2P9VB 3LEZA 3NDEA 4E3LA 1FSWA 4N1XA 1FR6A 3IWOA 3RXWA 4PPRA 2X02A 2XFSA 2OV5A 4ZJ3A 2EX8A 4HEFA 3HUMA 2ZC6B 3G2ZA 1PZOA 3IF6A 3MKFA 4MBHA 5GLCA 3V3SA 1O07A 1XGIA 2XEPA 5EOEA 2Y4AA 4IVIA 3BFCA 5E43A 1NRFA 2XF3A 2ZMAA 1XX2A 4XUXA 3BEBA 3NY4A 2ZQAA 5FDHA 3JYIA 3E2KA 3M6BA 2QPNA 4KZ5A 1SHVA 4KZ6A 3BECA 2ZQDA 3AGDA 4LV3A 5CTMA 2R9WA 2ZC4B 1LL9A 3V3RA 3V5MA 3BLMA 4KG2A 1PWGA 4Z9QA 1ES2A 1HZOA 4K0WA 4WMCD 3TSGA 4CPKA 1K38A 3MBZA 4S2NA 3VSLA 1ERMA 2QZ6A 2V20A 1NYYA 2XD1A 1IKIA 3HL9A 3BLSA 4X53A 4OPYA 5F83A 3UE0A 3G35A 1EI5A 1W8YA 4DF6A 1BT5A 4KZAA 4IVKA 3Q7ZA 3BFFA 1YLJA 4EBPA 2VGKA 2R9XA 2ZM2A 3UE3A 5FASA 3GQZA 2OLVA 1JTGA 4BQMA 3G34A 2HDUA 4KG6A 4N1HA 1PYYA 5EECA 5FQIA 1MXOA 1I2SA 3A3IA 5AQAA 3VP4A 3UPOA 3IF5A 4OP8A 2RCXA 1ES3A 4RX3A 2E8IA 4BD0A 3MFDA 1E4DA 1XGJA 3OPRA 4O7DA 4U3TA 4DE1A 3HUOA 1TEMA 4QD4A 3NIAA 3ZNYA 3BFEA 5F1FA 3GMWA 2WYXA 3G30A 1BULA 2QMIA 2Q9NA 3MZDA 2HPBA 5CEBA 1RP5A 3PBRA 4JLFA 1ONHA 4S2LA 1YMSA 4CJNA 2ZC5B 2WZZA 4UA9A 3W8KA 5EVIC 4GKUA 2ZD8A 5FQJA 4H8RA 4U0XA 2HDSA 4JXGA 1K56D 4BLMA 1K6RA 3N6IA 4KQOA 3M6HA 2EX6A 4KZ7A 4WEJA 2J7VA 1BLSA 3IQAA 1JWZA 1WE4A 5FQQA 5U47A 5A91A 1G68A 4OPZA 3SS3A 4UAAA 3GR2A 4ZJ2A 5JYOA 4DE2A 4GD8A 3N8RA 3MXSA 3DWKA 1EWZA 2JE5A 3IWQA 4WMCA 1TDGA 4QY6A 3IT9A 3GV9A 1MKIA 4PM7A 1WYBA 1FOFA 1BTLA 1I2WA 5EVID 3ITBA 1KE0A 3QNCA 3A3FA 1MWTA 2A3UA 5CERA 5KSCA 1LL5A 2Y2OA 5DF8A 3S4XA 1BLHA 2Z2MB 1MWUA 1W8QA 5HAPA 2ZM8A 5KSHA 5D3OA 4JKTA 2HDRA 1GA9A 2OLUA 1QMEA 4OQHA 1ALQA 3HUNA 3BFGA 4YFMA 4EWFA 4B4ZA 5CGSA 4ID4A 2Y55A 1NXYA 3WRTA 3B3XA 1U60A 4N92A 2Y2GA 3G4PA 4ZTKA 5FI6A 4BENA 4E3JA 4JF6A 5TR7A 3CMZA 2DRWA 4OOMA 4P87A 4MBKA 4WZ5A 1Y54A 2Y59A 4OLDA 1N9BA 4R23A 5FAPA 3FYZA 1YM1A 1YLPA 3M2KA 2WGIA 3HVFA 2BLSA 4XXRA 1YLWA 3UDXA 3O86A 5E2FA 4WEKA 3GSGA 1KGFA 4B88A 4U0TA 2EXBA 2ZQCA 3ZNTA 4DE3A 1FCMA 1CK3A 2RL3A 1M6KA 3PTEA 1M40A 5A90A 3WS1A 3HLDA 1JTDA 4OPRA 1KVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K56 A;  2Y2Q A;  2IWC A;  4FH2 A;  2V1Z A;  2ZJ9 A;  4OLG A;  3BM6 A;  3IHB A;  1PWD A;  4DKI A;  5M18 A;  4S2I A;  2HP6 A;  3G2Y A;  3WWX A;  1MWS A;  4IBR A;  1GA0 A;  1K57 A;  1VQQ A;  4ZBE A;  2V2F F;  4X55 A;  5BOH A;  3S1Y A;  4GB7 A;  1CEG A;  3PAE A;  1YT4 A;  2XFT A;  1DJC A;  3IXD A;  4WEL A;  3CZD A;  2X01 A;  3TG9 A;  2UWX A;  3Q07 A;  4LV1 A;  1PIO A;  3UNW A;  3VOY A;  5EPH A;  3ISG A;  1RGZ A;  1ZG6 A;  3N8L A;  3AGF A;  5E2E A;  3ZG5 A;  4F94 A;  3ZG9 B;  3OC2 A;  4KZ8 A;  5IHV A;  3OCL A;  5EVI A;  3IH8 A;  4Q8I A;  3OCN A;  4KZ3 A;  3GTC A;  1N4O A;  2XGN A;  5HX9 A;  2Q9M A;  5FSR A;  4OH0 A;  3S22 A;  3IF6 B;  3NI9 A;  4P0M A;  4DXB A;  3IH9 A;  2ZQ8 A;  3HRE A;  4R3J A;  5EVL A;  3TOI A;  2H5S A;  1L0D A;  3UDF A;  1LHY A;  3P98 A;  3SS5 A;  1JWV A;  1L0G A;  1SDE A;  5CHM A;  4L0L A;  1YQS A;  1NY0 A;  3NCK A;  2XQZ A;  3FZC A;  3MXR A;  4RX2 A;  1L2S A;  4DDS A;  1XA1 A;  3IXB A;  1I5Q A;  5HL1 A;  3DTM A;  1SKF A;  3N7W A;  3A3D A;  1PWC A;  3IXG A;  1RGY A;  4KEN B;  2XR0 A;  3VP3 A;  3C4P A;  5F1G A;  3ZG0 A;  1ZKJ A;  3UPP A;  3Q7V A;  5J8X A;  5TFQ A;  1AXB A;  5GHX A;  1K4F A;  1W5D A;  4IBX A;  4PM9 A;  1IYP A;  2JC7 A;  5GLD A;  2Y2I A;  5FI2 A;  1GCE A;  1H8Y A;  2J9O A;  5E2H A;  4GDB A;  4GN2 A;  1FR1 A;  1IEL A;  5DTK A;  3ZDJ A;  3ZFZ A;  1KE3 A;  3FKV A;  4FCF A;  3HLF A;  3PAG A;  4EBN A;  4NET A;  4EBL A;  5AQ7 A;  2H10 A;  2Y2L A;  3A3E A;  4LV2 A;  3PBT A;  5EUA A;  4C3Q A;  5AQ9 A;  1NYM A;  4QB8 A;  1LI9 A;  1OME A;  1LLB A;  2B5R A;  2WUQ A;  3NC8 A;  3N8S A;  3VOZ A;  3PBS A;  4E6X A;  1WYC A;  3IWI A;  1PI5 A;  1O7E A;  1S0W A;  3FKW A;  3Q7V B;  4PM5 A;  3HLB A;  4KQQ A;  2DNS A;  3OPH A;  4S2K A;  4UA6 A;  4HBT A;  3W4P A;  4KZ4 A;  3V50 A;  4PMA A;  1YLT A;  4R1G A;  4XUZ A;  4DXC A;  1K4E A;  1XKZ A;  1XP4 A;  1ONG A;  2XH9 A;  2Y91 A;  5GHY A;  3NDG A;  3ZVT A;  3Q81 A;  4R4R A;  4S2P A;  4GD6 A;  4DE0 A;  1H5X A;  1MPL A;  3BRM A;  1LI0 A;  4UHU A;  1J9M A;  3VP1 A;  2C5W B;  4JBF A;  1KGG A;  4LV0 A;  3VFF A;  4PM8 A;  3HLC A;  4LCM A;  3O88 A;  3GVB A;  4P6B A;  1IYS A;  4ZDX A;  4BJP A;  1MWR A;  1W79 A;  1K55 C;  3ZG7 B;  2X71 A;  3M2J A;  4E3O A;  1MBL A;  5FQK A;  1PW8 A;  1ESI A;  4GZB A;  5A92 A;  3DWZ A;  2Y2K A;  1E3U D;  4M3K A;  4WM9 A;  4E6W A;  5KMW A;  3SH9 A;  2ZC3 B;  4MLL A;  4JF5 A;  2WZX A;  4OON A;  4Y7P A;  4C75 A;  5I94 A;  3Q1F A;  1HD8 A;  1PZP A;  1KDW A;  2WGW A;  2WK0 A;  4KG5 A;  4ZJ1 A;  4S2J A;  1YLZ A;  2JBF A;  1GHI A;  1MY8 A;  1PI4 A;  3GRJ A;  4IED A;  4JF4 A;  4R0Q A;  3OPP A;  3UDI A;  4B4X A;  3C4O A;  2P9V A;  3N4I A;  1FSY A;  3WRZ A;  3CJM A;  3ZGA B;  3SS4 A;  1K6S A;  2XDM A;  2Y2H A;  1CI9 A;  2EFX A;  4EQI A;  4QU3 A;  2ZM0 A;  5FQM A;  3VFH A;  2WAE A;  4K0X A;  1BLP A;  5CXW A;  5DTT A;  4HBU A;  1IKG A;  4OP5 A;  5GL9 A;  4GOG A;  1ERO A;  3V39 A;  3ZCZ A;  2J8Y A;  3UY6 A;  4OPQ A;  3MZF A;  2WGW B;  4GDN A;  1XPB A;  2I72 A;  1BUE A;  4KZ9 A;  2HP5 A;  4OOY A;  2J9P A;  1L0E A;  4S2O A;  4JXS A;  1XA7 A;  2Y2P A;  4LCL A;  2Z2L B;  4N9K A;  1ESU A;  1Q2P A;  5CEC A;  5DTS A;  4QHC A;  2H0Y A;  3WS5 A;  1L0F A;  4S2M A;  2A49 A;  1YLY A;  5FA7 A;  5M1A A;  1DJA A;  3P09 A;  1FQG A;  5A93 A;  2Y2M A;  1KVL A;  1K54 C;  1GHP A;  2HDQ A;  1FCN A;  3BYD A;  2P74 A;  5CTN A;  2IWD A;  3SOI A;  3OZH A;  3EQV A;  5GHZ A;  1PW1 A;  1K25 A;  2EFU A;  3G31 A;  5DF7 A;  4E3M A;  5JYP A;  1SDN A;  4P85 A;  3LO7 A;  1E3U A;  1BSG A;  4A5R A;  4WZ5 C;  1DY6 A;  3HBR A;  3WS0 A;  4C6Y A;  4FD8 A;  1FCO A;  3W4Q A;  2DCF A;  1JVJ A;  1JWP A;  1Z6F A;  4YIN A;  4K91 A;  1VM1 A;  5EVI B;  3W4O A;  4RA7 A;  1ES5 A;  3PBQ A;  4HES A;  3VSK A;  5FAO A;  3Q82 A;  4BD1 A;  4Y0T A;  4OOL A;  1NZO A;  3IXH A;  4MEZ A;  4BL3 A;  1KE4 A;  2WAD A;  1HVB A;  1BZA A;  5GLA A;  5DVA A;  3UN7 A;  1CEF A;  1K55 A;  5CED A;  2XD5 A;  2WGV A;  5AQB A;  1NJ4 A;  1H8Z A;  3RXX A;  2BG1 A;  4OVD A;  2PU2 A;  4WZ4 A;  1W7F A;  2EX2 A;  2OSU A;  3IF6 C;  4FH4 A;  4E3N A;  5CHU A;  1IYO A;  1S6R A;  2Y2N A;  1TVF A;  3O87 A;  1TDL A;  4ZAM A;  4R4S A;  4D2O A;  3C5A A;  1XXM A;  2WKI A;  4OQ0 A;  5HW3 A;  1K57 C;  1IEM A;  4X56 A;  5EOO A;  5HAI A;  1NZU A;  3WS2 A;  3DW0 A;  4OQI A;  2H0T A;  1ES4 A;  2ZC7 A;  3HLE A;  2WAF A;  1YMX A;  3MZE A;  2XK1 A;  3BFD A;  4RYE A;  2FFF B;  3NBL A;  4JPM A;  4S2N C;  4E3K A;  3UPN A;  2WKH A;  3O3V A;  4BL2 A;  5CGW A;  5G18 A;  1DJB A;  3C7V A;  4UA7 A;  3PBO A;  3HLW A;  5FI7 A;  3LCE A;  5FAQ A;  4EV4 A;  1ZC2 A;  1IYQ A;  5L2F A;  3PBN A;  3ZVW A;  5KZH A;  3ZG8 B;  1G6A A;  2ZQ9 A;  3EQU A;  2CC1 A;  3QHY A;  3HLG A;  4MBF A;  1KGE A;  4N9L A;  4JXW A;  4X68 A;  5HAR A;  2G2U A;  3FV7 A;  1ERQ A;  3LY4 A;  2Y2J A;  2JCH A;  5CGX A;  5F82 A;  3I7J A;  2EX9 A;  3LY3 A;  3VMA A;  4QJG A;  4OKP A;  4Y0U A;  4WYY A;  4JXV A;  4Y0O A;  2EXA A;  3SH7 A;  4OQG A;  2G2W A;  4PM6 A;  4X69 A;  5GLB A;  4DDY A;  4LEN A;  3RJU A;  1QMF A;  5HFO A;  3UE1 A;  2ZLY A;  5HAQ A;  3G32 A;  2IWB A;  4GNU A;  1K54 A;  2PU4 A;  4KZB A;  2HP9 A;  3E2L A;  4FSF A;  3D4F A;  5DF9 A;  1E25 A;  3WS4 A;  4KQR A;  1ZG4 A;  4DRT A;  4NK3 A;  1BLC A;  3SH8 A;  4EUZ A;  3C7U A;  3A3J A;  4R3B A;  5FAT A;  5EE8 A;  1RCJ A;  2GDN A;  5E2G A;  3CG5 A;  3AGE A;  1Q2Q A;  4RVA A;  3UO9 A;  1CI8 A;  2ZQ7 A;  5FQ9 A;  2VGJ A;  3OPL A;  1HTZ A;  1SCW A;  5M19 A;  1C3B A;  4MNR A;  1GHM A;  3FWL A;  5CHJ A;  2FFY A;  5TGF A;  3VP2 A;  4E3I A;  3ITA A;  2XLN A;  4X6T A;  3MKE A;  4QY5 A;  2WKE A;  4WBG A;  5CRF A;  3QNB A;  3IHA A;  2PBY A;  3VP0 A;  1KDS A;  3ZHH A;  2C6W B;  2P9V B;  3LEZ A;  3NDE A;  4E3L A;  1FSW A;  4N1X A;  1FR6 A;  3IWO A;  3RXW A;  4PPR A;  2X02 A;  2XFS A;  2OV5 A;  4ZJ3 A;  2EX8 A;  4HEF A;  3HUM A;  2ZC6 B;  3G2Z A;  1PZO A;  3IF6 A;  3MKF A;  4MBH A;  5GLC A;  3V3S A;  1O07 A;  1XGI A;  2XEP A;  5EOE A;  2Y4A A;  4IVI A;  3BFC A;  5E43 A;  1NRF A;  2XF3 A;  2ZMA A;  1XX2 A;  4XUX A;  3BEB A;  3NY4 A;  2ZQA A;  5FDH A;  3JYI A;  3E2K A;  3M6B A;  2QPN A;  4KZ5 A;  1SHV A;  4KZ6 A;  3BEC A;  2ZQD A;  3AGD A;  4LV3 A;  5CTM A;  2R9W A;  2ZC4 B;  1LL9 A;  3V3R A;  3V5M A;  3BLM A;  4KG2 A;  1PWG A;  4Z9Q A;  1ES2 A;  1HZO A;  4K0W A;  4WMC D;  3TSG A;  4CPK A;  1K38 A;  3MBZ A;  4S2N A;  3VSL A;  1ERM A;  2QZ6 A;  2V20 A;  1NYY A;  2XD1 A;  1IKI A;  3HL9 A;  3BLS A;  4X53 A;  4OPY A;  5F83 A;  3UE0 A;  3G35 A;  1EI5 A;  1W8Y A;  4DF6 A;  1BT5 A;  4KZA A;  4IVK A;  3Q7Z A;  3BFF A;  1YLJ A;  4EBP A;  2VGK A;  2R9X A;  2ZM2 A;  3UE3 A;  5FAS A;  3GQZ A;  2OLV A;  1JTG A;  4BQM A;  3G34 A;  2HDU A;  4KG6 A;  4N1H A;  1PYY A;  5EEC A;  5FQI A;  1MXO A;  1I2S A;  3A3I A;  5AQA A;  3VP4 A;  3UPO A;  3IF5 A;  4OP8 A;  2RCX A;  1ES3 A;  4RX3 A;  2E8I A;  4BD0 A;  3MFD A;  1E4D A;  1XGJ A;  3OPR A;  4O7D A;  4U3T A;  4DE1 A;  3HUO A;  1TEM A;  4QD4 A;  3NIA A;  3ZNY A;  3BFE A;  5F1F A;  3GMW A;  2WYX A;  3G30 A;  1BUL A;  2QMI A;  2Q9N A;  3MZD A;  2HPB A;  5CEB A;  1RP5 A;  3PBR A;  4JLF A;  1ONH A;  4S2L A;  1YMS A;  4CJN A;  2ZC5 B;  2WZZ A;  4UA9 A;  3W8K A;  5EVI C;  4GKU A;  2ZD8 A;  5FQJ A;  4H8R A;  4U0X A;  2HDS A;  4JXG A;  1K56 D;  4BLM A;  1K6R A;  3N6I A;  4KQO A;  3M6H A;  2EX6 A;  4KZ7 A;  4WEJ A;  2J7V A;  1BLS A;  3IQA A;  1JWZ A;  1WE4 A;  5FQQ A;  5U47 A;  5A91 A;  1G68 A;  4OPZ A;  3SS3 A;  4UAA A;  3GR2 A;  4ZJ2 A;  5JYO A;  4DE2 A;  4GD8 A;  3N8R A;  3MXS A;  3DWK A;  1EWZ A;  2JE5 A;  3IWQ A;  4WMC A;  1TDG A;  4QY6 A;  3IT9 A;  3GV9 A;  1MKI A;  4PM7 A;  1WYB A;  1FOF A;  1BTL A;  1I2W A;  5EVI D;  3ITB A;  1KE0 A;  3QNC A;  3A3F A;  1MWT A;  2A3U A;  5CER A;  5KSC A;  1LL5 A;  2Y2O A;  5DF8 A;  3S4X A;  1BLH A;  2Z2M B;  1MWU A;  1W8Q A;  5HAP A;  2ZM8 A;  5KSH A;  5D3O A;  4JKT A;  2HDR A;  1GA9 A;  2OLU A;  1QME A;  4OQH A;  1ALQ A;  3HUN A;  3BFG A;  4YFM A;  4EWF A;  4B4Z A;  5CGS A;  4ID4 A;  2Y55 A;  1NXY A;  3WRT A;  3B3X A;  1U60 A;  4N92 A;  2Y2G A;  3G4P A;  4ZTK A;  5FI6 A;  4BEN A;  4E3J A;  4JF6 A;  5TR7 A;  3CMZ A;  2DRW A;  4OOM A;  4P87 A;  4MBK A;  4WZ5 A;  1Y54 A;  2Y59 A;  4OLD A;  1N9B A;  4R23 A;  5FAP A;  3FYZ A;  1YM1 A;  1YLP A;  3M2K A;  2WGI A;  3HVF A;  2BLS A;  4XXR A;  1YLW A;  3UDX A;  3O86 A;  5E2F A;  4WEK A;  3GSG A;  1KGF A;  4B88 A;  4U0T A;  2EXB A;  2ZQC A;  3ZNT A;  4DE3 A;  1FCM A;  1CK3 A;  2RL3 A;  1M6K A;  3PTE A;  1M40 A;  5A90 A;  3WS1 A;  3HLD A;  1JTD A;  4OPR A;  1KVM A; 
#chains in the Genus database with same CATH topology
 5IT5 A;  1K56 A;  2HP6 A;  3WWX A;  3E4Q A;  4Y17 A;  3CPT B;  1OT6 A;  4ZBE A;  5BOH A;  1TS7 A;  4H6J B;  2UWX A;  3MXQ A;  3QP4 A;  4LV1 A;  5EPH A;  5KIZ A;  4GW9 A;  3K3C A;  2DMW A;  2W3H A;  3S22 A;  2I9V A;  3IF6 B;  3IH9 A;  3UDF A;  4UQI S;  1L0G A;  3F1P B;  3EGX C;  1RGY A;  4KEN B;  1H8M A;  3ZG0 A;  3UPP A;  5GHX A;  1NLY A;  1W5D A;  2W3E A;  3E98 A;  3NUL A;  3LIB A;  5GLD A;  1GCE A;  1H8Y A;  4GN2 A;  4IUH A;  4ETX A;  1LSW A;  4NET A;  2H10 A;  5LBR A;  4C3Q A;  4HP4 A;  2VV8 A;  3PBS A;  4O01 A;  3IBJ A;  3Q7V B;  1O7E A;  1S0W A;  4PM5 A;  2PBD P;  4HBT A;  4R1G A;  1XKZ A;  2XH9 A;  2Y91 A;  3NDG A;  4KUK A;  1MPL A;  2HF6 A;  3BRM A;  1LI0 A;  2C5W B;  3VE4 A;  4JBF A;  3S7P A;  4PM8 A;  4HI4 A;  4MMN A;  3GVB A;  3T12 B;  3ZG7 B;  1HLU P;  3SW1 A;  5A92 A;  3DWZ A;  1E3U D;  5KMW A;  2WZX A;  4WLA A;  4Y7P A;  4ESP A;  1HD8 A;  2XA7 S;  2WGW A;  4KG5 A;  5HPF A;  4R0Q A;  4B4X A;  3ZGA B;  5HDD A;  5AJG A;  4HY8 A;  1YKD A;  2K2N A;  3LI8 A;  2WAE A;  4K0X A;  1BLP A;  5DTT A;  4EET B;  3UMD A;  4GOG A;  1ERO A;  3V39 A;  3UY6 A;  4F3L A;  3UME A;  5TBM A;  2HP5 A;  4HJ4 A;  4LCL A;  5CEC A;  2H0Y A;  3WS5 A;  4S2M A;  1LT0 A;  5FA7 A;  1FQG A;  2FZ0 A;  2Y2M A;  1GHP A;  3ZQ5 A;  1OJG A;  5GHZ A;  2M7U A;  3NOP C;  3D3O A;  4E3M A;  4P85 A;  2VLG A;  3MMH A;  4FD8 A;  1JWP A;  1VM1 A;  2JN7 A;  3PBQ A;  3T4K A;  4HES A;  4BD1 A;  5F5Y A;  4WF0 A;  4MEZ A;  1BZA A;  5GLA A;  5CED A;  1F2K A;  3MSH A;  4OVD A;  4WZ4 A;  5DJU A;  1S6R A;  4D2O A;  3C5A A;  2J3W A;  3T50 A;  4CQH A;  5C5K A;  5HAI A;  4WN5 A;  5IU1 A;  1ES4 A;  3D72 A;  1YMX A;  3FG8 A;  3BFD A;  4II7 A;  1YSQ A;  3NBL A;  3T4T A;  4E3K A;  3UPN A;  2WKH A;  2O99 A;  3KYQ A;  2MJ6 A;  4EV4 A;  5L2F A;  1T19 A;  1S66 L;  4EEU A;  2ZQ9 A;  1VHM A;  3T1S A;  1KGE A;  4N9L A;  4X68 A;  2Y2J A;  1J3W A;  5F82 A;  4OKP A;  4Y0U A;  2EXA A;  2G2W A;  4PM6 A;  2KX6 A;  4GNU A;  2PU4 A;  3HJK A;  1D1J A;  4FSF A;  3WS4 A;  1XJ4 A;  1FIL A;  1ZG4 A;  3SH8 A;  5EE8 A;  1RCJ A;  3UB8 A;  3EOI A;  3O5Y A;  5E2G A;  1Q2Q A;  5HL6 A;  5AVE A;  3OPL A;  3H9W A;  4MNR A;  1GHM A;  3FWL A;  2XLN A;  3MKE A;  4WBG A;  5CRF A;  2IA2 A;  3QNB A;  3KSI A;  1KDS A;  1FR6 A;  3IWO A;  2X02 A;  5GLC A;  2ZC6 B;  2VEA A;  2XEP A;  1SKO B;  1S1Z A;  5EOE A;  1W63 Q;  3BFC A;  1NRF A;  4F3L B;  2ZQA A;  5FDH A;  3E2K A;  5TBM B;  3BEC A;  4LV3 A;  5CTM A;  3V3R A;  1PWG A;  4Z9Q A;  3FC7 A;  4CPK A;  5L09 A;  3S7Q A;  3U2A A;  3T4O A;  1IKI A;  3BLS A;  4BWI A;  4EEP A;  3H7W A;  3Q7Z A;  1P97 A;  1YAX A;  3K2N A;  4BQM A;  3R7W A;  5FQI A;  1SZV A;  4GS9 A;  5AQA A;  5HWT A;  2PDR A;  3IX3 A;  2RCX A;  3DTK A;  2E8I A;  1E4D A;  1XGJ A;  1TEM A;  1LL8 A;  4QD4 A;  3VE3 A;  3BFE A;  2VV6 A;  1RP5 A;  2XRN A;  1ONH A;  4JLF A;  2EWW A;  1Y4O A;  2UV0 E;  5EVI C;  2ZD8 A;  2W0N A;  1P9R A;  1K56 D;  4BLM A;  3N6I A;  4KQO A;  4WEJ A;  3C2W A;  3HCY A;  1WE4 A;  2HGV A;  4OPZ A;  3GR2 A;  1TDG A;  3IT9 A;  1WYB A;  3OBF A;  1FOF A;  1BTL A;  1KOU A;  3A3F A;  4K08 A;  1MWT A;  2A3U A;  2Y2O A;  5EV0 A;  1W8Q A;  2HDR A;  1YSP A;  1QME A;  1ALQ A;  2L0W A;  2Z6C A;  4YFM A;  4KQD A;  4B4Z A;  3MF0 A;  2Y55 A;  1DP8 A;  2QJ5 A;  2OAQ 1;  4R23 A;  3FYZ A;  1W63 M;  1H3Q A;  3CPT A;  3M2K A;  2WGI A;  3MQQ A;  2ZL1 A;  4XXR A;  1PFL A;  4WEK A;  4B88 A;  4U0T A;  3A0R A;  3PTE A;  1M40 A;  5L07 A;  1JTD A;  3L7H A;  2Z6D A;  3KX0 X;  3G2Y A;  1K57 A;  3C38 A;  1AWI A;  5DJT A;  1CEG A;  3IS2 B;  1OPX A;  1DJC A;  3CZD A;  2Q0O A;  5DKK A;  3UNW A;  3VOY A;  1Z09 A;  1PIO A;  3N8L A;  1RGZ A;  5E2E A;  4F94 A;  3QP8 A;  3L9K A;  4KZ8 A;  5IHV A;  4Q8I A;  3OCN A;  4G3K A;  2ZMV A;  1N4O A;  3GTC A;  2QYB A;  1N9L A;  4OH0 A;  4Y15 A;  1IOU A;  2EA9 A;  4YOF A;  2Y8H A;  2VZW A;  3FPV A;  1L2S A;  3A3D A;  1PWC A;  2EWV A;  4MDZ A;  3Q7V A;  5J8X A;  1LSV A;  5L8M A;  1BYW A;  1K4F A;  4JGO A;  4PM9 A;  2JC7 A;  5EVE A;  4X25 A;  4ZRR A;  3H7W B;  1ACF A;  1GSV A;  2BTF P;  5HPI A;  5AQ7 A;  2Y2L A;  4LV2 A;  5AQ9 A;  1OME A;  4PKY G;  3N8S A;  3VOZ A;  4GS9 B;  1WYC A;  3IWI A;  3HLB A;  2W3D A;  4KZ4 A;  2P7J A;  3V50 A;  4PMA A;  1XJ6 A;  1X0O A;  1XP4 A;  1ONG A;  3ZVT A;  3B42 A;  4R4R A;  4DE0 A;  1J9M A;  3VP1 A;  4EES A;  1V9Z A;  1TD5 A;  4LCM A;  4EER A;  4EU0 A;  1IYS A;  1K55 C;  4E3O A;  3M2J A;  1MBL A;  1TS0 A;  5FQK A;  1NLZ A;  3KYZ A;  4MLL A;  5J4E A;  4R6L A;  3Q1F A;  2J3T D;  1LSX A;  1PZP A;  2OAP 1;  2WK0 A;  4ZJ1 A;  2JKT I;  2JBF A;  1PI4 A;  3OPP A;  1L3L A;  2P9V A;  3N4I A;  1FSY A;  5FEG A;  2QHK A;  4I3A A;  4EQI A;  3TE8 A;  3VOL A;  5CXW A;  4LPZ A;  3ZCZ A;  2J8Y A;  4OPQ A;  2V9A A;  3MZF A;  4GDN A;  1BUE A;  3JVV A;  2NUP C;  2ZL1 B;  1MZU A;  4GCZ A;  4S2O A;  3F1N A;  1CF0 A;  3TJZ C;  4RQ9 A;  4QHC A;  2A49 A;  1YLY A;  4HH3 A;  1KVL A;  3BYD A;  2P74 A;  4NXG A;  2W1T A;  2KLI A;  1PW1 A;  3G31 A;  5DF7 A;  5JYP A;  3LO7 A;  1BSG A;  3HBR A;  4C6Y A;  1FCO A;  3W4Q A;  5HWV A;  4K91 A;  3W4O A;  4RA7 A;  4MN6 A;  4L9F A;  4D60 A;  2JKT M;  5FAO A;  3NJA A;  2PRF A;  4BL3 A;  1KE4 A;  3CHW P;  2XD5 A;  2WGV A;  1H8Z A;  3RXX A;  2BG1 A;  4JGQ A;  3IF6 C;  4FH4 A;  4E3N A;  1IYO A;  4R4S A;  1XXM A;  5HW3 A;  1K57 C;  1DP6 A;  5EOO A;  4MN5 A;  3WS2 A;  2B18 A;  3K3D A;  2H0T A;  4OQI A;  5FDS A;  3MZE A;  2YKF A;  2FFF B;  5HDC A;  5F69 A;  4S2N C;  3O3V A;  5CGW A;  4QPR A;  5G18 A;  4UA7 A;  5G4Y A;  3HLW A;  5FI7 A;  3LCE A;  3DTE A;  1IYQ A;  3ZVW A;  3TRC A;  3ZG8 B;  1OTB A;  2CC1 A;  3QHY A;  3HLG A;  1ZTU A;  5HAR A;  2G2U A;  5HD3 A;  2OOL A;  2JCH A;  3LY3 A;  3VMA A;  3G6O A;  4Y0O A;  4JXV A;  4Y13 A;  4DDY A;  4LEN A;  3UE1 A;  4Q0I A;  2LB5 A;  4I3I A;  1K54 A;  3CIT A;  3E2L A;  4NK3 A;  4BBV A;  1F9I A;  4EUZ A;  4R3B A;  3PYP A;  5TJJ A;  3U4L P;  2GDN A;  3CUE C;  4RVA A;  1SKO A;  3UO9 A;  2ZQ7 A;  3C30 A;  4HHD A;  5M19 A;  3ITA A;  3KO6 A;  3IHA A;  3VP0 A;  1XJ2 A;  2D01 A;  5HD5 A;  2P9V B;  4HIA A;  3LEZ A;  4B93 A;  4E3L A;  4ZJ3 A;  1XGI A;  2XF3 A;  1XX2 A;  1OJ5 A;  4IJG A;  2OWH A;  3JYI A;  3RFB A;  2QPN A;  1SHV A;  1F5M A;  4JGR A;  3BLM A;  3F1N B;  1ES2 A;  1HZO A;  4MCW A;  3R4K A;  2V1B A;  3MBZ A;  3VSL A;  5EFW A;  1ERM A;  2V1A A;  2XD1 A;  4X53 A;  4OPY A;  1K0K A;  3FPW A;  1TS8 A;  2W1T B;  2INW A;  4EBP A;  2R9X A;  3PR6 A;  2ZM2 A;  4M4X A;  1JTG A;  3G34 A;  4DN0 A;  1PYY A;  3QP1 A;  3UPO A;  1I2S A;  3A3I A;  3IF5 A;  4OP8 A;  4RX3 A;  3OPR A;  1A0K A;  3HUO A;  2K7S A;  4HH2 A;  3ZNY A;  5F1F A;  3GMW A;  2WYX A;  3G30 A;  2GNX A;  4CJN A;  2V0W A;  2XSS A;  3T4Q A;  2ZC5 B;  4O0P A;  4UA9 A;  3W8K A;  4GKU A;  2HDS A;  1K6R A;  3M6H A;  3IQA A;  5U47 A;  5A91 A;  1G68 A;  3UE6 A;  4UAA A;  4ZJ2 A;  5JYO A;  4LLO B;  4IUK A;  4DE2 A;  3UB9 A;  4HJ6 A;  3N8R A;  3IWQ A;  4WMC A;  4QY6 A;  4PM7 A;  2B02 A;  3ITB A;  3MJQ A;  3QNC A;  4EUV A;  5CER A;  1LL5 A;  3LID A;  5DF8 A;  1BLH A;  1MC0 A;  2Z2M B;  4JKT A;  3W2Z A;  2OLU A;  4OQH A;  5DFY A;  2B95 A;  3BFG A;  4EWF A;  1WA9 A;  3GEC A;  4Q0H A;  5CGS A;  4IHQ A;  2Y2G A;  5TR7 A;  4WZ5 A;  2Y59 A;  1N9B A;  5FAP A;  5F6A A;  1YLP A;  3IS2 A;  4CLC B;  4I5S A;  3LIA A;  5G4Z A;  2RL3 A;  2O9A A;  3V67 A;  3LIF A;  2VX8 A;  4OPR A;  2Y2Q A;  2IWC A;  2V1Z A;  4OLG A;  3NOU C;  4FTX A;  3IHB A;  1PWD A;  4DKI A;  3A0V A;  1MWS A;  3E4O A;  5J7E A;  4LGW A;  3S1Y A;  4GB7 A;  3EGD C;  4MN7 A;  4X1L A;  2WKR A;  5J3W A;  2X01 A;  3T4S A;  3Q07 A;  1ZG6 A;  3ZG5 A;  3AGF A;  4CLC E;  3OC2 A;  3OCL A;  3IH8 A;  4KZ3 A;  3LYX A;  5FSR A;  2W3F A;  4P0M A;  3NI9 A;  2PAV P;  4G3W A;  2ZQ8 A;  5EVL A;  3TOI A;  1L0D A;  1LHY A;  1JWV A;  2VK3 A;  3NCK A;  4GJ4 A;  3FZC A;  3ICY A;  3MXR A;  4DJ2 A;  4RX2 A;  3IXB A;  3DTM A;  1SKF A;  3IXG A;  3RH8 B;  5F1G A;  1OTA A;  5TFQ A;  2WKP A;  3OLO A;  3IX8 A;  1IYP A;  3LGO A;  4R38 A;  2Y2I A;  5FI2 A;  2GJ3 A;  2J9O A;  5E2H A;  3S7N A;  1FR1 A;  1IEL A;  3ZDJ A;  3FKV A;  4FCF A;  3PAG A;  4EBL A;  3LR4 A;  5CX7 A;  3CI6 A;  3PBT A;  3LEQ A;  1NYM A;  3NOT C;  4QB8 A;  1LI9 A;  1TF1 A;  3EEH A;  4NKP A;  4E6X A;  5HDS A;  3FKW A;  4S2K A;  2DNS A;  4I39 A;  3W4P A;  4XUZ A;  1K4E A;  3LR5 A;  1VET B;  4S2P A;  4GD6 A;  4BBU A;  1H5X A;  1NRJ A;  4LV0 A;  2J3T C;  3HLC A;  5EM0 A;  3O88 A;  2H28 A;  4UEY A;  4ZDX A;  4BJP A;  1MWR A;  3VV4 A;  1W79 A;  4DJ3 A;  4Y2F A;  2XRO A;  1ESI A;  1T18 A;  4GZB A;  2Y2K A;  4E6W A;  4M3K A;  2ACG A;  3SH9 A;  2D02 A;  2ZC3 B;  4JF5 A;  4OON A;  4C75 A;  3D9Y A;  5I94 A;  1KDW A;  4B9O A;  4YNR A;  4S2J A;  1YLZ A;  1GHI A;  3GRJ A;  4JF4 A;  3UDI A;  3C4O A;  1VB6 A;  3WRZ A;  3CJM A;  2XDM A;  2JKG A;  2EFX A;  2V8C A;  1T1A A;  4QU3 A;  5FQM A;  3S7O A;  3LR0 A;  4HBU A;  2QWS A;  5L10 A;  1D06 A;  3LIC A;  4LRZ E;  1XPB A;  4KZ9 A;  2PR5 A;  2J9P A;  4JXS A;  1XA7 A;  4I3J A;  3LIE A;  4N9K A;  1EW0 A;  1L0F A;  5M1A A;  3P09 A;  5A93 A;  2HDQ A;  4NXF A;  1XFN A;  1PNE A;  1VEU B;  1YPR A;  3OZH A;  1G6O A;  3EQV A;  2Y79 A;  2EFU A;  1SDN A;  4WZ5 C;  1DY6 A;  2W1R A;  3WS0 A;  4L9G A;  2CMN A;  2DCF A;  1Z6F A;  1T1C A;  1ES5 A;  4LRY C;  3VSK A;  3Q82 A;  4HP9 A;  4OOL A;  1NZO A;  1CEF A;  5DFX A;  1OTD A;  5AQB A;  1XFQ A;  2OSU A;  3PXP A;  5CHU A;  4HOI A;  2Y2N A;  3O87 A;  2J80 A;  4OQ0 A;  3DTI A;  2VGL M;  2A24 B;  4X56 A;  1NZU A;  1Y28 A;  2PYP A;  3BQ8 A;  3HLE A;  2ZC7 A;  4Q0J A;  2WAF A;  1IFQ A;  3LI9 A;  2XK1 A;  2FH5 A;  4NEE D;  4BL2 A;  1T1B A;  3PBO A;  5FAQ A;  2YKH A;  3PBN A;  2PR6 A;  3MQ0 A;  5KZH A;  4PAU A;  1G6A A;  3BW6 A;  3EQU A;  4JXW A;  5CGX A;  5F68 A;  2EX9 A;  1OT9 A;  3EEA A;  5GLB A;  1QMF A;  2OWJ A;  4NG2 A;  1PRQ A;  5HAQ A;  2IWB A;  4KZB A;  2HP9 A;  3D4F A;  1E25 A;  4KQR A;  4DRT A;  3UB7 A;  1BLC A;  3C7U A;  3A3J A;  5FAT A;  3B33 A;  3CG5 A;  5FL3 A;  5HZH A;  1HTZ A;  4AFI A;  2NUT C;  3E0Y A;  2GZA A;  3OOV A;  5CHJ A;  2FFY A;  5TGF A;  3VP2 A;  4E3I A;  4X6T A;  4WUJ A;  1S67 L;  2WKE A;  5I5L A;  3P01 A;  3ZHH A;  2C6W B;  4N1X A;  2P08 A;  2XFS A;  3JPU A;  2OV5 A;  2WKQ A;  4HEF A;  5A8B A;  3MKF A;  1PZO A;  2PD8 A;  1O07 A;  1GSX A;  2Y4A A;  4IVI A;  5E43 A;  4XUX A;  3PHY A;  3M6B A;  3IBR A;  4KZ6 A;  3AGD A;  4G3V A;  2O9C A;  2ZC4 B;  4KG2 A;  4K0W A;  4WMC D;  3TSG A;  3LUQ A;  4P6Z M;  2QZ6 A;  5F83 A;  1EI5 A;  1W8Y A;  3ULF A;  2AVX A;  1YLJ A;  3UE3 A;  3GQZ A;  2OLV A;  2HDU A;  2VGL S;  4KG6 A;  1MXO A;  2PHY A;  4BD0 A;  3MFD A;  4U3T A;  4BMW A;  4S2L A;  1S4S A;  4O8G A;  3GDI A;  3NHQ A;  3QP5 A;  3T1X A;  2EX6 A;  4EXO A;  4KZ7 A;  2O0Y A;  2J7V A;  1JWZ A;  4X1M A;  5EM1 A;  4NXE A;  2VA0 A;  1EWZ A;  2JKR I;  1ZHH B;  3GV9 A;  1V9Y A;  1I2W A;  1KE0 A;  2ZOH A;  4CLC A;  1MWU A;  5HAP A;  5KSH A;  2ZM8 A;  2ZMF A;  3NEC A;  3CAX A;  3HUN A;  4ARZ A;  2W3G A;  3KSG A;  1NXY A;  3WRT A;  4BEN A;  4ZTK A;  3MFX A;  4XT2 B;  2DRW A;  1S4R A;  3CWF A;  4MBK A;  1CQA A;  4OOM A;  4OLD A;  1YM1 A;  5FEF A;  3LR3 A;  3UDX A;  3O86 A;  3GSG A;  1KGF A;  2EXB A;  2ZQC A;  4DE3 A;  1FCM A;  4R3A A;  5A90 A;  5IS1 A;  3WS1 A;  3HLD A;  1KVM A;  2JKF A;  4FH2 A;  2ZJ9 A;  3BM6 A;  4LRX C;  5M18 A;  4S2I A;  4L9E A;  4IBR A;  1GA0 A;  1VQQ A;  2V0U A;  2V2F F;  4X55 A;  3PAE A;  1YT4 A;  2XFT A;  3IXD A;  4WEL A;  2GX5 A;  4P6Z S;  3TG9 A;  2JKR M;  2VV7 A;  3ISG A;  2BAS A;  3ZG9 B;  3F1O A;  5EVI A;  1UWN X;  2XGN A;  5HX9 A;  2Q9M A;  4DXB A;  4WL9 A;  4R3J A;  3HRE A;  2ZOI A;  2H5S A;  1N9N A;  3P98 A;  3SS5 A;  2W27 A;  1SDE A;  3T1Q B;  3MQO A;  3MS6 A;  5CHM A;  4L0L A;  1YQS A;  1NY0 A;  2XQZ A;  5HL1 A;  4DDS A;  1XA1 A;  1I5Q A;  3N7W A;  2XR0 A;  3VP3 A;  3C4P A;  1ZKJ A;  1AXB A;  4IBX A;  3E4P A;  1P0Z A;  2VKS A;  4GDB A;  1VET A;  5DTK A;  3ZFZ A;  1KE3 A;  1JNU A;  3HLF A;  4EBN A;  3A3E A;  3KSH A;  5EUA A;  1LLB A;  2B5R A;  2WUQ A;  3NC8 A;  3UB6 A;  4PHT A;  1PI5 A;  4KQQ A;  3OPH A;  4UA6 A;  3BY8 A;  2KDK A;  1YLT A;  4QWO A;  4DXC A;  5GHY A;  3Q81 A;  4BBT A;  4UHU A;  1DP9 A;  3QP2 A;  1KGG A;  3VFF A;  3MR0 A;  1UWP X;  4P6B A;  3T4J A;  3A0S A;  3C8C A;  1GSW A;  2X71 A;  1PW8 A;  1XJ3 A;  4WM9 A;  4NXB A;  2PYR A;  1F98 A;  2M1C A;  3BWL A;  4GHI A;  1MY8 A;  4IED A;  5AVF A;  4FUW A;  3SS4 A;  1K6S A;  2E8J A;  2Y2H A;  4ARZ B;  1CI9 A;  4Z1W A;  3SZT A;  2ZM0 A;  3VFH A;  2P04 A;  1FIK A;  1P9W A;  1IKG A;  4OP5 A;  5GL9 A;  1VEU A;  1H0M A;  3JVU A;  1OTE A;  2WGW B;  2I72 A;  3TW8 A;  4OOY A;  2HZ5 A;  1L0E A;  2PT7 A;  4HNB A;  3H82 A;  2Y2P A;  2Z2L B;  1ESU A;  1Q2P A;  4ME4 A;  5DTS A;  4JGP A;  1DJA A;  1K54 C;  4CLC C;  1FCN A;  5CTN A;  2IWD A;  3SOI A;  4PKY A;  1K25 A;  2LB9 A;  1E3U A;  1MKM A;  4YWZ A;  4A5R A;  4Y3I A;  1JVJ A;  4YIN A;  2A24 A;  3F1O B;  4HJ3 A;  5EVI B;  2JHE A;  4FOF A;  4Y0T A;  3IXH A;  2WAD A;  1HVB A;  5DVA A;  3UN7 A;  1K55 A;  1NJ4 A;  2PU2 A;  1W7F A;  4I38 A;  2EX2 A;  1N9O A;  2HJE A;  4ZAM A;  1TVF A;  1TDL A;  1TS6 A;  2WKI A;  2QKP A;  1IEM A;  3DW0 A;  3KYE A;  4RYE A;  4JPM A;  3T1R A;  1DJB A;  2A2L A;  3C7V A;  2L4R A;  1ZC2 A;  4EQ1 A;  2QJ7 A;  1UGU A;  5DKL A;  4ETZ A;  4MBF A;  3FV7 A;  1ERQ A;  3LY4 A;  2PD7 A;  3I7J A;  4EW7 A;  4QJG A;  2HJ9 C;  4WYY A;  3SH7 A;  4OQG A;  4X69 A;  3RJU A;  5HFO A;  1DRM A;  2ZLY A;  3G32 A;  5DF9 A;  3HJI A;  3AGE A;  1CI8 A;  5FQ9 A;  2VGJ A;  1SCW A;  1C3B A;  4QY5 A;  4H6J A;  4GHI B;  2PBY A;  1G28 A;  4R70 A;  3NDE A;  1FSW A;  3RXW A;  4PPR A;  1ODV A;  4DMZ A;  3RTY A;  2EX8 A;  2O9B A;  3HUM A;  3G2Z A;  3IF6 A;  4MBH A;  4LFU A;  3V3S A;  2ZMA A;  3BEB A;  3NY4 A;  3F1P A;  3P7N A;  4KZ5 A;  2L1M A;  2ZQD A;  2R9W A;  2R78 A;  1LL9 A;  1OTI A;  3V5M A;  3H82 B;  2G7U A;  1K38 A;  4S2N A;  2V20 A;  1NYY A;  3HL9 A;  3UE0 A;  3G35 A;  4DF6 A;  1BT5 A;  4CLC D;  4Y5F A;  4KZA A;  4IVK A;  3BFF A;  2VGK A;  5FAS A;  4UQI M;  4HQA A;  4N1H A;  5EEC A;  3VP4 A;  1ES3 A;  4DE1 A;  4O7D A;  4KUO A;  3NIA A;  2VJW A;  1BUL A;  2QMI A;  3BY9 A;  2Q9N A;  3MZD A;  2HPB A;  5CEB A;  3PBR A;  3BJN A;  3EWK A;  1YMS A;  5HSQ A;  3LFV A;  2WZZ A;  1D7E A;  5FQJ A;  3DAV A;  3B47 A;  5K5B A;  4H8R A;  4U0X A;  3R7W B;  3CLO A;  4JXG A;  3CUE A;  1BLS A;  5FQQ A;  4GLQ A;  3SS3 A;  2K31 A;  2M7V A;  4GD8 A;  3MXS A;  3DWK A;  2JE5 A;  4XT2 A;  3DBA A;  1MKI A;  5EVI D;  2V8F A;  1G5U A;  5KSC A;  3UB5 P;  3S4X A;  1NWZ A;  5D3O A;  1GA9 A;  3QP6 A;  3IX4 A;  1S1Y A;  2HV1 A;  3T4L A;  1STZ A;  3ZYT A;  4E04 A;  4ID4 A;  3B3X A;  1U60 A;  4N92 A;  3G4P A;  5FI6 A;  4E3J A;  4JF6 A;  3CMZ A;  4P87 A;  1Y54 A;  3HVF A;  2BLS A;  3BQA A;  5HWW A;  5MC7 A;  2XA7 M;  1YLW A;  5E2F A;  2KOI A;  3ZNT A;  1CK3 A;  1M6K A;  2ZBB A;  1CJF A;  3KSF A; 
#chains in the Genus database with same CATH homology
 1K56 A;  2Y2Q A;  2IWC A;  4FH2 A;  2V1Z A;  2ZJ9 A;  4OLG A;  3BM6 A;  3IHB A;  1PWD A;  4DKI A;  5M18 A;  4S2I A;  2HP6 A;  3G2Y A;  3WWX A;  1MWS A;  4IBR A;  1GA0 A;  1K57 A;  1VQQ A;  4ZBE A;  2V2F F;  4X55 A;  5BOH A;  3S1Y A;  4GB7 A;  1CEG A;  3PAE A;  1YT4 A;  2XFT A;  1DJC A;  3IXD A;  4WEL A;  3CZD A;  2X01 A;  3TG9 A;  2UWX A;  3Q07 A;  4LV1 A;  1PIO A;  3UNW A;  3VOY A;  5EPH A;  3ISG A;  1RGZ A;  1ZG6 A;  3N8L A;  3AGF A;  5E2E A;  3ZG5 A;  4F94 A;  3ZG9 B;  3OC2 A;  4KZ8 A;  5IHV A;  3OCL A;  5EVI A;  3IH8 A;  4Q8I A;  3OCN A;  4KZ3 A;  3GTC A;  1N4O A;  2XGN A;  5HX9 A;  2Q9M A;  5FSR A;  4OH0 A;  3S22 A;  3IF6 B;  3NI9 A;  4P0M A;  4DXB A;  3IH9 A;  2ZQ8 A;  3HRE A;  4R3J A;  5EVL A;  3TOI A;  2H5S A;  1L0D A;  3UDF A;  1LHY A;  3P98 A;  3SS5 A;  1JWV A;  1L0G A;  1SDE A;  5CHM A;  4L0L A;  1YQS A;  1NY0 A;  3NCK A;  2XQZ A;  3FZC A;  3MXR A;  4RX2 A;  1L2S A;  4DDS A;  1XA1 A;  3IXB A;  1I5Q A;  5HL1 A;  3DTM A;  1SKF A;  3N7W A;  3A3D A;  1PWC A;  3IXG A;  1RGY A;  4KEN B;  2XR0 A;  3VP3 A;  3C4P A;  5F1G A;  3ZG0 A;  1ZKJ A;  3UPP A;  3Q7V A;  5J8X A;  5TFQ A;  1AXB A;  5GHX A;  1K4F A;  1W5D A;  4IBX A;  4PM9 A;  1IYP A;  2JC7 A;  5GLD A;  2Y2I A;  5FI2 A;  1GCE A;  1H8Y A;  2J9O A;  5E2H A;  4GDB A;  4GN2 A;  1FR1 A;  1IEL A;  5DTK A;  3ZDJ A;  3ZFZ A;  1KE3 A;  3FKV A;  4FCF A;  3HLF A;  3PAG A;  4EBN A;  4NET A;  4EBL A;  5AQ7 A;  2H10 A;  2Y2L A;  3A3E A;  4LV2 A;  3PBT A;  5EUA A;  4C3Q A;  5AQ9 A;  1NYM A;  4QB8 A;  1LI9 A;  1OME A;  1LLB A;  2B5R A;  2WUQ A;  3NC8 A;  3N8S A;  3VOZ A;  3PBS A;  4E6X A;  1WYC A;  3IWI A;  1PI5 A;  1O7E A;  1S0W A;  3FKW A;  3Q7V B;  4PM5 A;  3HLB A;  4KQQ A;  2DNS A;  3OPH A;  4S2K A;  4UA6 A;  4HBT A;  3W4P A;  4KZ4 A;  3V50 A;  4PMA A;  1YLT A;  4R1G A;  4XUZ A;  4DXC A;  1K4E A;  1XKZ A;  1XP4 A;  1ONG A;  2XH9 A;  2Y91 A;  5GHY A;  3NDG A;  3ZVT A;  3Q81 A;  4R4R A;  4S2P A;  4GD6 A;  4DE0 A;  1H5X A;  1MPL A;  3BRM A;  1LI0 A;  4UHU A;  1J9M A;  3VP1 A;  2C5W B;  4JBF A;  1KGG A;  4LV0 A;  3VFF A;  4PM8 A;  3HLC A;  4LCM A;  3O88 A;  3GVB A;  4P6B A;  1IYS A;  4ZDX A;  4BJP A;  1MWR A;  1W79 A;  1K55 C;  3ZG7 B;  2X71 A;  3M2J A;  4E3O A;  1MBL A;  5FQK A;  1PW8 A;  1ESI A;  4GZB A;  5A92 A;  3DWZ A;  2Y2K A;  1E3U D;  4M3K A;  4WM9 A;  4E6W A;  5KMW A;  3SH9 A;  2ZC3 B;  4MLL A;  4JF5 A;  2WZX A;  4OON A;  4Y7P A;  4C75 A;  5I94 A;  3Q1F A;  1HD8 A;  1PZP A;  1KDW A;  2WGW A;  2WK0 A;  4KG5 A;  4ZJ1 A;  4S2J A;  1YLZ A;  2JBF A;  1GHI A;  1MY8 A;  1PI4 A;  3GRJ A;  4IED A;  4JF4 A;  4R0Q A;  3OPP A;  3UDI A;  4B4X A;  3C4O A;  2P9V A;  3N4I A;  1FSY A;  3WRZ A;  3CJM A;  3ZGA B;  3SS4 A;  1K6S A;  2XDM A;  2Y2H A;  1CI9 A;  2EFX A;  4EQI A;  4QU3 A;  2ZM0 A;  5FQM A;  3VFH A;  2WAE A;  4K0X A;  1BLP A;  5CXW A;  5DTT A;  4HBU A;  1IKG A;  4OP5 A;  5GL9 A;  4GOG A;  1ERO A;  3V39 A;  3ZCZ A;  2J8Y A;  3UY6 A;  4OPQ A;  3MZF A;  2WGW B;  4GDN A;  1XPB A;  2I72 A;  1BUE A;  4KZ9 A;  2HP5 A;  4OOY A;  2J9P A;  1L0E A;  4S2O A;  4JXS A;  1XA7 A;  2Y2P A;  4LCL A;  2Z2L B;  4N9K A;  1ESU A;  1Q2P A;  5CEC A;  5DTS A;  4QHC A;  2H0Y A;  3WS5 A;  1L0F A;  4S2M A;  2A49 A;  1YLY A;  5FA7 A;  5M1A A;  1DJA A;  3P09 A;  1FQG A;  5A93 A;  2Y2M A;  1KVL A;  1K54 C;  1GHP A;  2HDQ A;  1FCN A;  3BYD A;  2P74 A;  5CTN A;  2IWD A;  3SOI A;  3OZH A;  3EQV A;  5GHZ A;  1PW1 A;  1K25 A;  2EFU A;  3G31 A;  5DF7 A;  4E3M A;  5JYP A;  1SDN A;  4P85 A;  3LO7 A;  1E3U A;  1BSG A;  4A5R A;  4WZ5 C;  1DY6 A;  3HBR A;  3WS0 A;  4C6Y A;  4FD8 A;  1FCO A;  3W4Q A;  2DCF A;  1JVJ A;  1JWP A;  1Z6F A;  4YIN A;  4K91 A;  1VM1 A;  5EVI B;  3W4O A;  4RA7 A;  1ES5 A;  3PBQ A;  4HES A;  3VSK A;  5FAO A;  3Q82 A;  4BD1 A;  4Y0T A;  4OOL A;  1NZO A;  3IXH A;  4MEZ A;  4BL3 A;  1KE4 A;  2WAD A;  1HVB A;  1BZA A;  5GLA A;  5DVA A;  3UN7 A;  1CEF A;  1K55 A;  5CED A;  2XD5 A;  2WGV A;  5AQB A;  1NJ4 A;  1H8Z A;  3RXX A;  2BG1 A;  4OVD A;  2PU2 A;  4WZ4 A;  1W7F A;  2EX2 A;  2OSU A;  3IF6 C;  4FH4 A;  4E3N A;  5CHU A;  1IYO A;  1S6R A;  2Y2N A;  1TVF A;  3O87 A;  1TDL A;  4ZAM A;  4R4S A;  4D2O A;  3C5A A;  1XXM A;  2WKI A;  4OQ0 A;  5HW3 A;  1K57 C;  1IEM A;  4X56 A;  5EOO A;  5HAI A;  1NZU A;  3WS2 A;  3DW0 A;  4OQI A;  2H0T A;  1ES4 A;  2ZC7 A;  3HLE A;  2WAF A;  1YMX A;  3MZE A;  2XK1 A;  3BFD A;  4RYE A;  2FFF B;  3NBL A;  4JPM A;  4S2N C;  4E3K A;  3UPN A;  2WKH A;  3O3V A;  4BL2 A;  5CGW A;  5G18 A;  1DJB A;  3C7V A;  4UA7 A;  3PBO A;  3HLW A;  5FI7 A;  3LCE A;  5FAQ A;  4EV4 A;  1ZC2 A;  1IYQ A;  5L2F A;  3PBN A;  3ZVW A;  5KZH A;  3ZG8 B;  1G6A A;  2ZQ9 A;  3EQU A;  2CC1 A;  3QHY A;  3HLG A;  4MBF A;  1KGE A;  4N9L A;  4JXW A;  4X68 A;  5HAR A;  2G2U A;  3FV7 A;  1ERQ A;  3LY4 A;  2Y2J A;  2JCH A;  5CGX A;  5F82 A;  3I7J A;  2EX9 A;  3LY3 A;  3VMA A;  4QJG A;  4OKP A;  4Y0U A;  4WYY A;  4JXV A;  4Y0O A;  2EXA A;  3SH7 A;  4OQG A;  2G2W A;  4PM6 A;  4X69 A;  5GLB A;  4DDY A;  4LEN A;  3RJU A;  1QMF A;  5HFO A;  3UE1 A;  2ZLY A;  5HAQ A;  3G32 A;  2IWB A;  4GNU A;  1K54 A;  2PU4 A;  4KZB A;  2HP9 A;  3E2L A;  4FSF A;  3D4F A;  5DF9 A;  1E25 A;  3WS4 A;  4KQR A;  1ZG4 A;  4DRT A;  4NK3 A;  1BLC A;  3SH8 A;  4EUZ A;  3C7U A;  3A3J A;  4R3B A;  5FAT A;  5EE8 A;  1RCJ A;  2GDN A;  5E2G A;  3CG5 A;  3AGE A;  1Q2Q A;  4RVA A;  3UO9 A;  1CI8 A;  2ZQ7 A;  5FQ9 A;  2VGJ A;  3OPL A;  1HTZ A;  1SCW A;  5M19 A;  1C3B A;  4MNR A;  1GHM A;  3FWL A;  5CHJ A;  2FFY A;  5TGF A;  3VP2 A;  4E3I A;  3ITA A;  2XLN A;  4X6T A;  3MKE A;  4QY5 A;  2WKE A;  4WBG A;  5CRF A;  3QNB A;  3IHA A;  2PBY A;  3VP0 A;  1KDS A;  3ZHH A;  2C6W B;  2P9V B;  3LEZ A;  3NDE A;  4E3L A;  1FSW A;  4N1X A;  1FR6 A;  3IWO A;  3RXW A;  4PPR A;  2X02 A;  2XFS A;  2OV5 A;  4ZJ3 A;  2EX8 A;  4HEF A;  3HUM A;  2ZC6 B;  3G2Z A;  1PZO A;  3IF6 A;  3MKF A;  4MBH A;  5GLC A;  3V3S A;  1O07 A;  1XGI A;  2XEP A;  5EOE A;  2Y4A A;  4IVI A;  3BFC A;  5E43 A;  1NRF A;  2XF3 A;  2ZMA A;  1XX2 A;  4XUX A;  3BEB A;  3NY4 A;  2ZQA A;  5FDH A;  3JYI A;  3E2K A;  3M6B A;  2QPN A;  4KZ5 A;  1SHV A;  4KZ6 A;  3BEC A;  2ZQD A;  3AGD A;  4LV3 A;  5CTM A;  2R9W A;  2ZC4 B;  1LL9 A;  3V3R A;  3V5M A;  3BLM A;  4KG2 A;  1PWG A;  4Z9Q A;  1ES2 A;  1HZO A;  4K0W A;  4WMC D;  3TSG A;  4CPK A;  1K38 A;  3MBZ A;  4S2N A;  3VSL A;  1ERM A;  2QZ6 A;  2V20 A;  1NYY A;  2XD1 A;  1IKI A;  3HL9 A;  3BLS A;  4X53 A;  4OPY A;  5F83 A;  3UE0 A;  3G35 A;  1EI5 A;  1W8Y A;  4DF6 A;  1BT5 A;  4KZA A;  4IVK A;  3Q7Z A;  3BFF A;  1YLJ A;  4EBP A;  2VGK A;  2R9X A;  2ZM2 A;  3UE3 A;  5FAS A;  3GQZ A;  2OLV A;  1JTG A;  4BQM A;  3G34 A;  2HDU A;  4KG6 A;  4N1H A;  1PYY A;  5EEC A;  5FQI A;  1MXO A;  1I2S A;  3A3I A;  5AQA A;  3VP4 A;  3UPO A;  3IF5 A;  4OP8 A;  2RCX A;  1ES3 A;  4RX3 A;  2E8I A;  4BD0 A;  3MFD A;  1E4D A;  1XGJ A;  3OPR A;  4O7D A;  4U3T A;  4DE1 A;  3HUO A;  1TEM A;  4QD4 A;  3NIA A;  3ZNY A;  3BFE A;  5F1F A;  3GMW A;  2WYX A;  3G30 A;  1BUL A;  2QMI A;  2Q9N A;  3MZD A;  2HPB A;  5CEB A;  1RP5 A;  3PBR A;  4JLF A;  1ONH A;  4S2L A;  1YMS A;  4CJN A;  2ZC5 B;  2WZZ A;  4UA9 A;  3W8K A;  5EVI C;  4GKU A;  2ZD8 A;  5FQJ A;  4H8R A;  4U0X A;  2HDS A;  4JXG A;  1K56 D;  4BLM A;  1K6R A;  3N6I A;  4KQO A;  3M6H A;  2EX6 A;  4KZ7 A;  4WEJ A;  2J7V A;  1BLS A;  3IQA A;  1JWZ A;  1WE4 A;  5FQQ A;  5U47 A;  5A91 A;  1G68 A;  4OPZ A;  3SS3 A;  4UAA A;  3GR2 A;  4ZJ2 A;  5JYO A;  4DE2 A;  4GD8 A;  3N8R A;  3MXS A;  3DWK A;  1EWZ A;  2JE5 A;  3IWQ A;  4WMC A;  1TDG A;  4QY6 A;  3IT9 A;  3GV9 A;  1MKI A;  4PM7 A;  1WYB A;  1FOF A;  1BTL A;  1I2W A;  5EVI D;  3ITB A;  1KE0 A;  3QNC A;  3A3F A;  1MWT A;  2A3U A;  5CER A;  5KSC A;  1LL5 A;  2Y2O A;  5DF8 A;  3S4X A;  1BLH A;  2Z2M B;  1MWU A;  1W8Q A;  5HAP A;  2ZM8 A;  5KSH A;  5D3O A;  4JKT A;  2HDR A;  1GA9 A;  2OLU A;  1QME A;  4OQH A;  1ALQ A;  3HUN A;  3BFG A;  4YFM A;  4EWF A;  4B4Z A;  5CGS A;  4ID4 A;  2Y55 A;  1NXY A;  3WRT A;  3B3X A;  1U60 A;  4N92 A;  2Y2G A;  3G4P A;  4ZTK A;  5FI6 A;  4BEN A;  4E3J A;  4JF6 A;  5TR7 A;  3CMZ A;  2DRW A;  4OOM A;  4P87 A;  4MBK A;  4WZ5 A;  1Y54 A;  2Y59 A;  4OLD A;  1N9B A;  4R23 A;  5FAP A;  3FYZ A;  1YM1 A;  1YLP A;  3M2K A;  2WGI A;  3HVF A;  2BLS A;  4XXR A;  1YLW A;  3UDX A;  3O86 A;  5E2F A;  4WEK A;  3GSG A;  1KGF A;  4B88 A;  4U0T A;  2EXB A;  2ZQC A;  3ZNT A;  4DE3 A;  1FCM A;  1CK3 A;  2RL3 A;  1M6K A;  3PTE A;  1M40 A;  5A90 A;  3WS1 A;  3HLD A;  1JTD A;  4OPR A;  1KVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...