4BD0A

X-ray structure of a perdeuterated toho-1 r274n r276n double mutant beta-lactamase in complex with a fully deuterated boronic acid (bzb)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
261
structure length
261
Chain Sequence
NSVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTEPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE TOHO-1
publication title Neutron and X-Ray Crystal Structures of a Perdeuterated Enzyme Inhibitor Complex Reveal the Catalytic Proton Network of the Toho-1 Beta-Lactamase for the Acylation Reaction.
pubmed doi rcsb
source organism Escherichia coli bl21
molecule tags Hydrolase
total genus 88
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4bd0A00
4U0XA 4ZJ1A 3TG9A 3CJMA 4K0WA 2Y2MA 5GHZA 1AXBA 1TVFA 1YMSA 5FATA 5FAQA 2WZXA 1GA9A 3VFFA 1K55C 3ZHHA 4X69A 3WS2A 1NYMA 3SS4A 3ZG8B 2HP5A 3ZFZA 4E3OA 4KQOA 1GA0A 5FSRA 1FCNA 2IWCA 5D3OA 3SH8A 1YMXA 5CERA 3NCKA 4S2JA 2OV5A 4UA9A 4WEJA 1DJAA 5KSHA 3G35A 2Y2JA 1BLSA 3IQAA 4QU3A 5CHMA 5EOOA 4B4XA 2Y59A 1FSWA 4DRTA 2Y2QA 2WAFA 3IF5A 4UA7A 5DVAA 3E2LA 3O86A 2WZZA 5EVID 1KVLA 4Y0UA 1XA1A 5EOEA 2HP6A 3A3IA 2XH9A 5DF7A 3VP0A 3FV7A 4OLGA 5EPHA 4DE1A 2XLNA 4JXSA 3VSKA 1KE3A 1XGJA 5KSCA 5GLCA 4K0XA 1JTDA 2DRWA 4N1HA 2Y2NA 2J9OA 2PBYA 4O7DA 4C75A 3ITBA 4FD8A 5M19A 1ZKJA 1WE4A 4MBHA 1XP4A 4PPRA 2ZM2A 1K57C 1PYYA 4P87A 4ZJ2A 4GOGA 1QMEA 1ZG4A 4ZJ3A 3HUNA 3VOYA 3BM6A 4B88A 1NXYA 1KDWA 4E3JA 4PM9A 3V3SA 1RGYA 2XEPA 3HLEA 4GN2A 3LO7A 4LCMA 4OOMA 5GHXA 5A91A 4Y0TA 3N8LA 1ESUA 4JXVA 1JWVA 3O3VA 1KVMA 3O87A 4IEDA 4YFMA 5I94A 1K54C 3BYDA 4LENA 4NETA 4QY5A 4UAAA 1HTZA 4GD6A 3N4IA 5CXWA 2ZC7A 3WS0A 1I5QA 1LI0A 4JF5A 5TFQA 2J7VA 4EWFA 1FQGA 3WWXA 4Q8IA 3Q7ZA 1GHMA 5A93A 1TDGA 3PBSA 2Y91A 4OPYA 3UY6A 5U47A 1ES3A 1FCMA 1H8ZA 3PBOA 5GLBA 2OLUA 5GLAA 1W7FA 3MXSA 3VP3A 2WGWA 2X01A 2J8YA 1W5DA 5CHUA 3SS5A 3HVFA 4HBTA 5E2FA 4DKIA 4LCLA 5TGFA 5E2EA 3UE0A 4CJNA 3WS4A 1PIOA 3BFDA 1E3UD 4R4SA 1RGZA 1MKIA 5CGXA 2Y4AA 2DCFA 4QY6A 1K25A 3HL9A 1JVJA 2P9VA 3A3FA 3A3JA 1Z6FA 1TDLA 4BLMA 2ZQCA 5DF9A 2EFXA 5FQIA 1HD8A 1ONHA 1BLPA 3Q1FA 4C6YA 2QMIA 2V2FF 3HLCA 1PI4A 4RYEA 5HARA 2IWBA 2XR0A 5FDHA 1RCJA 2Z2MB 5E2HA 1YLYA 2XFSA 3N7WA 3WRTA 1M6KA 3VP1A 3ZVTA 2EX6A 2P74A 2XFTA 1SCWA 2Y2OA 3HLWA 1IEMA 3V5MA 4MNRA 3TOIA 4PM6A 4OPZA 3O88A 3UDIA 3BEBA 3GQZA 4WEKA 3MZDA 3SH9A 2ZM8A 1FOFA 2J9PA 1KE4A 5CTNA 5JYOA 4XXRA 5CECA 5FA7A 3BFEA 1KGFA 3HLDA 3BLSA 1PZPA 2Q9NA 3NDEA 4OLDA 2XQZA 1BUEA 3UNWA 4DE3A 3Q07A 2HP9A 3DW0A 4IBRA 5G18A 4BL3A 2HDRA 3OZHA 3BFCA 3G34A 2JBFA 3WS5A 4C3QA 4E3NA 4QJGA 2ZQAA 2B5RA 4OP5A 5CEBA 4KZ4A 4OQIA 1N9BA 2ZM0A 3GSGA 4PM7A 3UPPA 5CEDA 3EQUA 3SOIA 1H8YA 3C7VA 3SH7A 1K38A 3DWKA 2WGWB 2UWXA 4M3KA 1GCEA 2OSUA 1XA7A 3WS1A 1MWUA 1LI9A 3OC2A 4R23A 5M1AA 1S0WA 4NK3A 3IHAA 3HLGA 1M40A 3FWLA 3IXHA 4OPRA 4WZ4A 3S22A 1PWDA 1XGIA 4WYYA 2ZD8A 2EFUA 2RL3A 3W8KA 2WAEA 4KZ9A 2P9VB 4UHUA 1BLCA 4OVDA 4X6TA 2HDQA 1K6SA 2WADA 3G4PA 4FSFA 4A5RA 3M2JA 4QB8A 1NYYA 1XX2A 4BENA 1LLBA 2VGJA 1IYOA 3FYZA 4FH2A 3VSLA 4MBFA 4OOYA 4RX2A 1HZOA 3M6BA 3GMWA 1U60A 1XPBA 4S2NC 5HX9A 1IELA 3IXDA 3GTCA 1FR1A 4ZAMA 1L0DA 3JYIA 2V1ZA 2CC1A 1YLPA 1FSYA 3IXGA 1PW1A 3ITAA 3PBTA 4N1XA 5CTMA 4HEFA 4EV4A 5FQ9A 2ZMAA 3DTMA 2EX2A 2Q9MA 2XDMA 4DDSA 3UE1A 5KZHA 2PU2A 4GZBA 3AGFA 3CMZA 4PMAA 1ES2A 1NZUA 3HREA 4L0LA 3ZCZA 1DJCA 1EROA 1LL9A 3GRJA 1OMEA 4JF4A 5DF8A 2EX8A 3N8SA 3EQVA 5FQJA 4RX3A 4GD8A 4OKPA 3HLBA 5HL1A 4CPKA 1BTLA 2V20A 1XXMA 1KDSA 3HBRA 1FCOA 1CK3A 3VMAA 4QD4A 3LEZA 1NY0A 4HESA 4S2KA 1ZG6A 4EBPA 4OQ0A 1N4OA 4Y7PA 2XD1A 2Y2HA 3TSGA 3NDGA 3M2KA 3LCEA 3ZNYA 4EQIA 1CI8A 1CI9A 4BJPA 3PTEA 4N9KA 3HLFA 3G30A 5JYPA 4QHCA 4ZBEA 2FFYA 3OPHA 1ES4A 1LL5A 2R9WA 2WKHA 1PZOA 1ES5A 3UO9A 1GHIA 1K56D 4DF6A 1IYSA 2ZQ7A 3Q82A 4S2MA 3VP4A 2ZC3B 3PBNA 2WGIA 2Y2GA 3NI9A 4EBLA 4OPQA 3G32A 4BD0A 1IKIA 2C6WB 2JC7A 2G2UA 2JE5A 1G6AA 1QMFA 2H0YA 2EX9A 5F82A 3ZG0A 2GDNA 5DTTA 3IT9A 3GV9A 4R3BA 3ZNTA 3AGEA 3QNCA 2Y55A 5EECA 2ZQ9A 1ESIA 4S2LA 3G2YA 5M18A 1J9MA 3UDFA 5L2FA 4Y0OA 5E2GA 4U3TA 5FAPA 1MPLA 5IHVA 1JWPA 3D4FA 5GL9A 3I7JA 4JPMA 4B4ZA 4Z9QA 4S2NA 4KZBA 3Q7VA 4DE2A 5FASA 4LV2A 2ZC5B 3IH8A 5EVLA 3Q81A 4D2OA 4R0QA 1PW8A 4JXGA 4BL2A 3MXRA 1PWCA 3ZGAB 4JF6A 4WMCA 2BLSA 1KGGA 1NRFA 2H5SA 4WM9A 5CRFA 2ZQDA 4JLFA 4X55A 1YQSA 2X71A 5A90A 3RXWA 5A92A 4MBKA 1PWGA 5AQ9A 2Y2KA 1BULA 5FI7A 1VM1A 2EXBA 2PU4A 4KZ8A 4R3JA 3CG5A 5FQQA 1HVBA 1MBLA 1DY6A 5CHJA 4YINA 3FKVA 1KGEA 2ZC6B 2WUQA 2Y2PA 3IWIA 1K6RA 4OQGA 5GHYA 4FCFA 3P98A 1ERMA 2Z2LB 4GNUA 5F1FA 1MWTA 4E3IA 1ERQA 2XF3A 1YLJA 3ISGA 1YLWA 4GKUA 4XUXA 4PM5A 4LV0A 4ZTKA 3IWQA 3C4PA 3OCLA 1BT5A 3A3EA 4MLLA 5HAIA 1JWZA 5HAPA 3OPLA 1L0FA 1NZOA 3IHBA 4X68A 2OLVA 3VFHA 2E8IA 3PBQA 3MZFA 4GB7A 5EVIA 1I2WA 5DTSA 1ZC2A 3MZEA 4P85A 1S6RA 2Y2LA 3A3DA 3BLMA 2JCHA 2QPNA 3ZG7B 2H0TA 4OH0A 1ALQA 1EWZA 3BFGA 4MEZA 4WBGA 3W4QA 3BECA 4K91A 4P0MA 2BG1A 4XUZA 4LV1A 2A3UA 4KZ3A 1VQQA 2WK0A 3UN7A 1LHYA 2IWDA 1CEGA 5GLDA 3IF6A 2WKEA 1H5XA 3IWOA 1IKGA 4BQMA 5CGWA 2VGKA 4KENB 4WELA 4OOLA 3OPPA 5DTKA 5FQMA 1IYQA 3WRZA 4WZ5A 3Q7VB 2ZC4B 1L0EA 4DE0A 1BSGA 4KZ7A 4KG5A 3B3XA 3RXXA 4N92A 4X53A 3BFFA 3IXBA 4GDBA 3UE3A 4OQHA 4S2IA 2HDSA 3MBZA 2HPBA 3DWZA 3FKWA 2I72A 1L0GA 3ZG5A 3ZG9B 1MWRA 2FFFB 1DJBA 1SDNA 3NBLA 1Y54A 3NC8A 4U0TA 5FQKA 4HBUA 2DNSA 3BRMA 3C5AA 5F1GA 4ZDXA 4KG6A 1BLHA 5AQ7A 5AQAA 4JXWA 5FI6A 3VP2A 4JKTA 3N8RA 3ZVWA 5HFOA 5E43A 5FI2A 1SKFA 4E3LA 2G2WA 1O7EA 2XD5A 3V50A 4OP8A 3M6HA 1SDEA 3PBRA 3LY4A 1XKZA 1C3BA 5F83A 3S4XA 3AGDA 3OCNA 1I2SA 3G31A 5EVIC 3E2KA 4S2PA 1MWSA 4DXBA 1E3UA 3PAEA 3C7UA 3NIAA 1L2SA 5FAOA 3P09A 5TR7A 4EBNA 3V3RA 2ZQ8A 3MKFA 5EUAA 3MFDA 3UPOA 1JTGA 3FZCA 1BZAA 4H8RA 1Q2QA 1WYBA 1G68A 4KZ6A 1K56A 3G2ZA 4EUZA 1PI5A 1K55A 1SHVA 5EE8A 1E4DA 1GHPA 1K4FA 4X56A 5EVIB 3UDXA 3QNBA 4KZ5A 3LY3A 5J8XA 3PAGA 1CEFA 1MXOA 2C5WB 1W8YA 1E25A 3ZDJA 3MKEA 4KQQA 4DXCA 4E3KA 3IF6C 1YLZA 1IYPA 2X02A 4E6XA 2RCXA 2WYXA 5CGSA 1MY8A 2XGNA 2ZJ9A 3VOZA 4E3MA 4BD1A 3C4OA 1W79A 4F94A 4IVKA 4WZ5C 3QHYA 5HW3A 2XK1A 4JBFA 4P6BA 5KMWA 1O07A 1FR6A 3NY4A 4KG2A 3UPNA 3IF6B 4RA7A 3SS3A 2EXAA 4RVAA 1NJ4A 3S1YA 2R9XA 1RP5A 3HUOA 3IH9A 2QZ6A 4UA6A 3GVBA 3GR2A 3W4PA 4R4RA 1K57A 1TEMA 1YT4A 2ZLYA 4PM8A 3RJUA 2A49A 4FH4A 1EI5A 5AQBA 3V39A 2WKIA 4DDYA 4ID4A 1Q2PA 2HDUA 4WMCD 1K4EA 3HUMA 4N9LA 1YLTA 4S2OA 4IVIA 4E6WA 3W4OA 4LV3A 5BOHA 5HAQA 4R1GA 4GDNA 2H10A 2WGVA 1YM1A 3CZDA 4KZAA 4IBXA 1KE0A 3N6IA 1W8QA 4OONA 2Y2IA 1WYCA 1K54A 3OPRA 4KQRA 1ONGA
chains in the Genus database with same CATH superfamily
4U0XA 4ZJ1A 3TG9A 1GA9A 3ZHHA 4X69A 2VX8A 1OTAA 3ZG8B 2HP5A 4E3OA 4KQOA 3DBAA 5FSRA 3T4OA 5D3OA 3T4JA 4UA9A 4WEJA 3G35A 4JGRA 1BLSA 3IQAA 3LUQA 1NRJA 1FSWA 4DRTA 2D02A 2WAFA 1T1CA 4Y0UA 2XH9A 4D60A 4JXSA 3E0YA 1WA9A 4X1MA 2Y2NA 2PBYA 1ZKJA 4MBHA 1XP4A 4P87A 4ZJ2A 4GOGA 1QMEA 1ZG4A 4ZJ3A 5K5BA 4B88A 3HCYA 3BM6A 1NXYA 4Z1WA 1RGYA 4L9GA 3IBJA 3N8LA 3O3VA 1K54C 3BYDA 4NETA 1YAXA 3N4IA 3WS0A 1I5QA 5TFQA 4EWFA 2JKTM 3WWXA 5A93A 2Y91A 1TF1A 5HWWA 1H8ZA 2V1BA 5GLAA 3C30A 2X01A 2J8YA 3ZYTA 5CHUA 3CI6A 3HVFA 4LCLA 3UE0A 3MJQA 2W1RA 1E3UD 4R4SA 1RGZA 5CGXA 1J3WA 2Y4AA 1SKOB 1JVJA 3A0VA 5EVEA 1Z6FA 4BLMA 4BWIA 2QMIA 3HLCA 2IWBA 5FDHA 3DTKA 1YLYA 3JPUA 1M6KA 1S4SA 2XFTA 3D3OA 4MNRA 3VE3A 2AVXA 3DTEA 4G3WA 4OPZA 3EEHA 3MZDA 2B02A 2VZWA 5CTNA 4XXRA 3TRCA 1FILA 1KGFA 2VKSA 3NULA 4DE3A 3UNWA 2HP9A 3PHYA 3E4QA 4E3NA 2ZQAA 1LL8A 3R7WA 2ZM0A 3EQUA 3SH7A 4M3KA 1MWUA 1LI9A 3OC2A 4I38A 1S0WA 3KSHA 3IHAA 3HLGA 4NK3A 4CLCC 1M40A 3IX8A 4OPRA 1YSQA 4R70A 5AVFA 4JGPA 5AVEA 2P9VB 2HDQA 3G4PA 1XX2A 3F1PA 2JHEA 1T1BA 1EW0A 3GMWA 1XPBA 3T1QB 3IXDA 3C2WA 3LR5A 2CC1A 1FSYA 3UB8A 5FQ9A 4LFUA 2EX2A 2Q9MA 4DDSA 3CAXA 3NOUC 5KZHA 3BQAA 4GZBA 3IS2A 3MQOA 3UE6A 5FQJA 4CPKA 1BTLA 4NXFA 1KDSA 1S1YA 1Z09A 4QD4A 3A0SA 4EETB 1NY0A 1ZG6A 4OQ0A 5DJTA 1GSVA 3S7QA 4P6ZM 5F6AA 3ZNYA 1CI8A 5HDSA 1CI9A 3PTEA 4N9KA 3L7HA 4HOIA 3G30A 5HZHA 4ZBEA 3OBFA 2QYBA 1ES5A 1GHIA 5F69A 4DJ2A 3PBNA 2Y2GA 4OPQA 4BD0A 1IKIA 2G2UA 2JE5A 2PDRA 2UV0E 2EX9A 1T19A 2KLIA 2GDNA 1LT0A 2ZOIA 3G2YA 1J9MA 3TE8A 5DFXA 2J3TC 5GL9A 3I7JA 5HD3A 4LV2A 2ZC5B 3LIDA 5HPFA 4R0QA 4BL2A 1PWCA 5L8MA 3ZGAB 1LSXA 3NOPC 5CRFA 3E4PA 4JLFA 5A90A 4MBKA 2KX6A 5AQ9A 2Y2KA 3G6OA 4R3JA 3CG5A 2W1TB 1DY6A 2HGVA 3IWIA 2Y2PA 4FCFA 2Z2LB 4MN5A 1MWTA 3QP4A 4GKUA 4GHIA 4ZTKA 3OCLA 4MN6A 5HAPA 3TW8A 2JN7A 4IUKA 1YKDA 2QPNA 2PYRA 3HJKA 5TBMB 2V0UA 2QKPA 1MZUA 4MEZA 4WBGA 4K91A 2JKRI 2VK3A 4KZ3A 5LBRA 4PAUA 3UN7A 1CEGA 5GLDA 3SW1A 1IKGA 4OOLA 4IHQA 3LEQA 4LLOB 2OAP1 1L0EA 4DE0A 4KZ7A 4N92A 3MS6A 3MR0A 4Y17A 1SDNA 3S7NA 1Y54A 5F1GA 2VEAA 4ZDXA 5AQAA 5F68A 4E3LA 3C38A 3QP5A 3T1RA 4WL9A 3MSHA 1UWPX 3ICYA 3S4XA 3F1NB 5EVIC 1E3UA 1L2SA 4EBNA 3S7OA 2ZQ8A 5EUAA 3MFDA 1JTGA 3FZCA 1Q2QA 4KZ6A 1K56A 3CITA 3NHQA 3LY3A 1MXOA 2C5WB 1E25A 4DXCA 2BTFP 3T4LA 5DJUA 4E3MA 4BD1A 3LR4A 4WZ5C 5KMWA 1FR6A 4KG2A 3IF6B 1KOUA 2XROA 4YNRA 3HUOA 2QZ6A 4UA6A 3GVBA 3GR2A 3W4PA 1K57A 2ZLYA 3RJUA 3K3DA 2A49A 4FH4A 3V39A 3P7NA 4WMCD 4N9LA 4IVIA 3W4OA 2B95A 5BOHA 4G3KA 2WGVA 2P7JA 1YM1A 4KZAA 2Y2IA 3BWLA 4K0WA 4M4XA 4BBUA 1TVFA 5FATA 2WZXA 4HHDA 3VFFA 1K55C 3WS2A 2IWCA 3SH8A 4WN5A 5C5KA 5CERA 1F2KA 3NCKA 1SKOA 2Y2JA 3CLOA 4B4XA 5EOOA 2Y79A 3LI9A 2CMNA 3O86A 1XA1A 2HP6A 3RH8B 5EPHA 4DE1A 1P9RA 1KE3A 2O9CA 1V9YA 4G3VA 1JTDA 2DRWA 3F1OA 4BBVA 4QPRA 4O7DA 3ITBA 4FD8A 3JVUA 4NEED 3KX0X 1WE4A 4H6JB 4PPRA 2ZM2A 1PYYA 3LIFA 5MC7A 3VOYA 4KQDA 2JKFA 4E3JA 2XEPA 3DAVA 1CF0A 3HLEA 3LO7A 5GHXA 5A91A 1KVMA 1F98A 4LENA 1XJ2A 4MDZA 2O99A 5HSQA 1OJ5A 1HLUP 3B42A 4Q8IA 3LI8A 2INWA 3FPWA 3PBSA 1FCMA 4GHIB 1VB6A 3PBOA 4HQAA 3MXSA 3VP3A 1MKMA 1W5DA 3SS5A 2VGLS 4HBTA 5E2FA 4ETXA 3MQ0A 2M7UA 1MKIA 1NLYA 3VV4A 1K25A 2P9VA 4UQIS 3A3JA 3H7WB 5J7EA 1P0ZA 1BLPA 2ACGA 2V2FF 4RYEA 1RCJA 2Z2MB 5E2HA 1IOUA 3VP1A 4PHTA 2EX6A 1SCWA 5TJJA 4GJ4A 4NXGA 3HLWA 1IEMA 3V5MA 3TOIA 3BEBA 4WEKA 2ZM8A 3QP8A 5JYOA 4IUHA 5CECA 3NJAA 5FA7A 1DP6A 5EV0A 3HLDA 2Q9NA 2FH5A 1OTEA 4YOFA 3OZHA 1G6OA 3G34A 2JBFA 3WS5A 4QJGA 2JKGA 4OP5A 4KZ4A 5CEDA 3UPPA 3C7VA 1K38A 2Y8HA 3BW6A 1GCEA 2QWSA 3WS1A 1T18A 5M1AA 2IA2A 2XA7M 3FWLA 3IXHA 1PWDA 5DFYA 2WAEA 1BLCA 2GJ3A 4OVDA 4B93A 1K6SA 5A8BA 4A5RA 5G4ZA 4BENA 1IYOA 3FYZA 5EM1A 4R3AA 5HWVA 3LYXA 1HZOA 3GTCA 4ZAMA 3JYIA 3IXGA 3PBTA 1PW1A 3ITAA 2XDMA 4PMAA 1NZUA 3HREA 4GLQA 4L0LA 5DF8A 4JF4A 4DN0A 2EX8A 3EQVA 2W1TA 4OKPA 1XXMA 1FCOA 1CK3A 2W0NA 2EA9A 3HJIA 3M2KA 4EQIA 1H0MA 5FEFA 4QHCA 2QJ5A 1ES4A 1LL5A 3UO9A 1K56D 4DF6A 2ZQ7A 3Q82A 2OWHA 2ZC3B 2WGIA 3NI9A 4EBLA 5TBMA 2JC7A 4EU0A 1NWZA 2K2NA 2OWJA 5DTTA 3F1OB 1GSWA 2VJWA 4MMNA 3LFVA 4S2LA 5M18A 5E2GA 4U3TA 3H9WA 2W3HA 4JPMA 4HIAA 4B4ZA 4KZBA 4DE2A 4D2OA 5EVLA 3Q81A 4JXGA 3EEAA 4JF6A 4WMCA 1KGGA 1NRFA 2H5SA 4WM9A 5DKKA 4DJ3A 5FI7A 2EXBA 4I3IA 4KZ8A 4YINA 4OQGA 1K6RA 4EW7A 3F1NA 5F1FA 4E3IA 2XF3A 3ISGA 3T4KA 1VEUB 1BT5A 3A3EA 1TS0A 1L0FA 3VFHA 2E8IA 4GB7A 1I2WA 2O9AA 2J80A 3A3DA 3BLMA 4K08A 2JCHA 2PR5A 4OH0A 1FIKA 2BG1A 2A3UA 2WK0A 1XFNA 1LHYA 3IF6A 3UMDA 3D9YA 5CGWA 4KENB 2HJEA 1OPXA 3Q7VB 2NUTC 2ZC4B 2W27A 3RXXA 3IXBA 4OQHA 4S2IA 2HPBA 3ZG9B 1MWRA 4EERA 5FQKA 2DNSA 2VV8A 5AQ7A 5FI6A 5HFOA 2XD5A 3V50A 4OP8A 3UB9A 4FTXA 3V67A 2ZBBA 3PBRA 1C3BA 5F83A 3E2KA 4DXBA 4EUVA 2WKRA 5FAOA 4DMZA 5TR7A 3V3RA 3BY9A 3UPOA 4H8RA 4EUZA 1PI5A 3PR6A 1E4DA 4JGQA 4KZ5A 5J8XA 1CEFA 1W8YA 4E3KA 1Y4OA 1YLZA 3NECA 5CGSA 4XT2A 3NOTC 1GSXA 2E8JA 4H6JA 1TS7A 4IVKA 4F94A 4JBFA 2Z6CA 1O07A 1OT6A 1W63M 3UPNA 2VV6A 1NJ4A 3T1SA 5FL3A 1V9ZA 1YT4A 5AQBA 4AFIA 4DDYA 1Q2PA 2HDUA 3HUMA 4S2OA 3CWFA 4E6WA 4EEUA 4YWZA 3CZDA 2WKQA 4OONA 4KQRA 1AXBA 1SZVA 1YMSA 5FAQA 3OLOA 1K0KA 3SS4A 1FCNA 4S2JA 2OV5A 5J3WA 5KSHA 2Y59A 3IF5A 3H7WA 4UA7A 5DVAA 3PXPA 3MFXA 3E2LA 3A3IA 3VP0A 3FV7A 1T1AA 1G28A 1YPRA 1XGJA 5KSCA 5GLCA 4EQ1A 4N1HA 1K57C 3EGXC 1KDWA 5DKLA 1TS6A 3GDIA 5HDCA 4GN2A 4OOMA 1JNUA 4Y0TA 5I94A 1AWIA 4QY5A 1STZA 2ZC7A 1LI0A 4JF5A 3T4QA 2J7VA 1GHMA 1TDGA 4OPYA 3UY6A 5U47A 2OLUA 4DKIA 4I5SA 5TGFA 5E2EA 1XJ6A 3DTIA 2M7VA 4ME4A 5IS1A 2DCFA 4QY6A 3HL9A 4O0PA 3A3FA 2PHYA 5DF9A 5FQIA 1HD8A 1ONHA 3U4LP 3BJNA 4C6YA 1PI4A 2XR0A 2XFSA 3WRTA 2JKTI 3CUEA 2P74A 2Y2OA 2GZAA 4PM6A 3O88A 4HJ4A 3GQZA 3S7PA 3K2NA 2PAVP 1FOFA 4B9OA 2HJ9C 4MN7A 1PZPA 2XQZA 1BUEA 3Q07A 3DW0A 4IBRA 1YSPA 2B5RA 2ZMFA 4WLAA 4OQIA 3GSGA 3LR3A 2VLGA 3DWKA 2WGWB 3KYEA 2UWXA 2WKPA 4L9FA 5HWTA 4BMWA 2OSUA 5FEGA 4R23A 4QWOA 3IBRA 4WZ4A 1XGIA 3B33A 1LSWA 2EFUA 5FDSA 2V8CA 4CLCE 1ZHHB 4KZ9A 4XT2B 4Y15A 4FSFA 1XJ4A 4FH2A 4MBFA 4OOYA 4HH3A 3E98A 1L3LA 4RX2A 2DMWA 1U60A 4S2NC 1IELA 4FOFA 1X0OA 1CJFA 1L0DA 4Y3IA 2V1ZA 5CTMA 1YLPA 2FZ0A 4HEFA 4L9EA 3UB5P 3DTMA 2L0WA 2W3FA 3CMZA 1ES2A 3ZCZA 1DJCA 1LL9A 3GRJA 4RX3A 4GD8A 2V20A 5KIZA 3HBRA 3VMAA 4HJ3A 3LEZA 2OOLA 2VV7A 2XRNA 4HESA 4EBPA 1VEUA 2Y2HA 1S67L 3T4TA 4BJPA 2YKHA 3HLFA 1OT9A 2J3WA 4Y2FA 3CPTA 1PZOA 3IX3A 1QMFA 2H0YA 3ZG0A 5F82A 3IT9A 4R3BA 2K31A 1IFQA 2PD7A 5EECA 1ESIA 4Y13A 3UDFA 5L2FA 3L9KA 4Y0OA 5FAPA 1N9NA 1MPLA 1JWPA 5I5LA 4Z9QA 4S2NA 5FASA 3Q7VA 1PW8A 1MC0A 3MXRA 5A92A 1PWGA 2JKRM 1VM1A 4WF0A 4X25A 1DP8A 4HJ6A 5FQQA 1HVBA 5CHJA 1KGEA 2ZC6B 2B18A 1ERMA 4GNUA 3P01A 5HL6A 3FG8A 1ERQA 1YLJA 1YLWA 4PM5A 2ZL1B 1XJ3A 3IWQA 4Q0IA 3RTYA 3LICA 5HAIA 1JWZA 3OPLA 1NZOA 2OLVA 2VGLM 2A2LA 1ZC2A 1S6RA 2Y2LA 3MF0A 3C8CA 1P97A 1S66L 3ZG7B 1D1JA 1ALQA 1P9WA 2ZOHA 3EOIA 4UQIM 3W4QA 3BECA 4P0MA 4CQHA 4I39A 1VQQA 2ZMVA 1BYWA 2V8FA 2WKEA 4LRZE 3IWOA 4BQMA 1G5UA 2VGKA 4WELA 2L1MA 5DTKA 5FQMA 3WRZA 3PYPA 2A24B 2HDSA 3MBZA 3FKWA 2J3TD 4ARZA 4FUWA 3NBLA 1DJBA 3LIAA 4HNBA 3NC8A 4HBUA 3C5AA 3VP2A 4JXWA 4JKTA 3N8RA 3M6HA 1SDEA 3LY4A 1XKZA 2QJ7A 1I2SA 3G31A 4S2PA 1MWSA 2NUPC 3W2ZA 3NIAA 3ULFA 3MKFA 1BZAA 1ODVA 3G2ZA 1SHVA 5EE8A 4X56A 3UDXA 5EVIB 3RFBA 3LIEA 3PAGA 3KSIA 3MKEA 3IF6C 1IYPA 3H82B 4F3LB 2ZJ9A 3VOZA 3B47A 3C4OA 1W79A 3EGDC 4HI4A 5HW3A 3QHYA 4P6BA 3VE4A 4RA7A 4RVAA 3S1YA 2OAQ1 2R9XA 3QP6A 1RP5A 5EFWA 3IH9A 1OJGA 4O01A 1TEMA 4PM8A 2WKIA 3UMEA 3BQ8A 1K4EA 4R6LA 4R1GA 2H10A 1KE0A 1W8QA 4P6ZS 4Q0HA 1WYCA 1K54A 3MMHA 1VETB 2BASA 3CJMA 2GX5A 2Y2MA 4PKYG 3ZQ5A 3T1XA 5GHZA 1DP9A 3ZFZA 1NYMA 5HPIA 1GA0A 3CPTB 1YMXA 1DJAA 4QU3A 5CHMA 5L07A 2Y2QA 2WZZA 5EVID 1KVLA 5EOEA 3TJZC 5DF7A 4OLGA 2XLNA 3VSKA 4K0XA 2HV1A 2J9OA 2P04A 4C75A 5M19A 1ACFA 4HH2A 3HUNA 4PM9A 3V3SA 3T12B 4LCMA 1ESUA 4JXVA 1JWVA 1S1ZA 3R4KA 4YFMA 3O87A 4IEDA 4LGWA 4UAAA 1HTZA 4GD6A 5CXWA 4ZRRA 1FQGA 3Q7ZA 2D01A 4NXBA 1ES3A 3LR0A 5GLBA 3UB7A 1W7FA 2WGWA 3SZTA 1LSVA 4CJNA 3WS4A 1PIOA 3BFDA 4KUKA 4HP9A 4LPZA 3QP2A 2Z6DA 1TDLA 2ZQCA 2EFXA 2PRFA 2KOIA 4CLCA 3Q1FA 5EM0A 5HARA 3N7WA 3OOVA 3U2AA 3ZVTA 5HD5A 1N9LA 3E4OA 3UDIA 3FC7A 1F5MA 4EESA 2HZ5A 3SH9A 4JGOA 2J9PA 1DRMA 1KE4A 2L4RA 2LB5A 4ARZB 4LRXC 3BFEA 1Y28A 1N9OA 3BLSA 3NDEA 4OLDA 2R78A 4BL3A 5G18A 1XFQA 2HDRA 2G7UA 3BFCA 4C3QA 3IX4A 4I3JA 1TS8A 2H28A 2Q0OA 4PKYA 5CEBA 1N9BA 2LB9A 4PM7A 2O0YA 3SOIA 1H8YA 4MCWA 4GS9A 1XA7A 3LGOA 4IJGA 4I3AA 4O8GA 1NLZA 5J4EA 3S22A 3KSFA 4WYYA 2ZD8A 2RL3A 3W8KA 2O9BA 3CUEC 4UHUA 4X6TA 2WADA 3T50A 3M2JA 4QB8A 1NYYA 1LLBA 1PRQA 2VGJA 4EEPA 3VSLA 3T4SA 3M6BA 1PFLA 5HX9A 3FPVA 4X1LA 1FR1A 4N1XA 4EV4A 2K7SA 3LIBA 2ZMAA 3UE1A 2GNXA 2PU2A 3AGFA 1EROA 2HF6A 1OMEA 4GW9A 3N8SA 3HLBA 5HL1A 4UEYA 2PBDP 5L09A 4Q0JA 2ZL1A 4S2KA 3R7WB 1N4OA 4Y7PA 4RQ9A 2XD1A 3TSGA 3NDGA 3GECA 3LCEA 2P08A 5JYPA 2FFYA 3OPHA 4HP4A 2R9WA 2WKHA 1IYSA 4S2MA 3VP4A 3G32A 2C6WB 1G6AA 1CQAA 3GV9A 3ZNTA 3AGEA 3QNCA 3KYZA 2Y55A 2ZQ9A 1PNEA 3F1PB 5IHVA 3D4FA 3JVVA 1UGUA 3IH8A 3KYQA 5IU1A 2A24A 2BLSA 2ZQDA 4X55A 1YQSA 2X71A 3RXWA 3IS2B 1BULA 5G4YA 2PU4A 1MBLA 3FKVA 3KO6A 2WUQA 5GHYA 3P98A 2PD8A 1F9IA 4XUXA 2W3EA 4LV0A 3C4PA 4MLLA 3IHBA 4X68A 3MXQA 1VHMA 1H3QA 3PBQA 3MZFA 5EVIA 1OTIA 5DTSA 3MZEA 4P85A 3K3CA 4NXEA 4CLCB 3H82A 4F3LA 4ETZA 2H0TA 4NG2A 1EWZA 4EXOA 3BFGA 5F5YA 4XUZA 4LV1A 3UB6A 2EWVA 2PYPA 2IWDA 1H5XA 2QHKA 3OPPA 1S4RA 4ESPA 1IYQA 4WZ5A 1H8MA 4NKPA 4BBTA 2V9AA 3KSGA 1BSGA 4KG5A 3B3XA 2PT7A 4X53A 3BFFA 4GDBA 3UE3A 2EWWA 3DWZA 4HY8A 2I72A 1L0GA 3ZG5A 2FFFB 4II7A 1ZTUA 3QP1A 3CHWP 5L10A 4U0TA 3BRMA 4KG6A 1BLHA 2I9VA 3ZVWA 5E43A 2PR6A 1VETA 1SKFA 5FI2A 2G2WA 1O7EA 3A0RA 5AJGA 2XSSA 2KDKA 3AGDA 3OCNA 4GS9B 1D7EA 2XA7S 3C7UA 3PAEA 3P09A 1OTDA 3O5YA 4LRYC 2W3DA 4Y5FA 1OTBA 1TD5A 1WYBA 1G68A 4KUOA 5HDDA 1K55A 1GHPA 1K4FA 3QNBA 2W3GA 3ZDJA 4E04A 4CLCD 4KQQA 2V0WA 2X02A 4E6XA 2RCXA 2WYXA 2YKFA 1MY8A 2XGNA 2XK1A 4R38A 3NY4A 1W63Q 3D72A 2VA0A 5CX7A 3SS3A 2EXAA 1D06A 1UWNX 3VOLA 4R4RA 1EI5A 2M1CA 4ID4A 2V1AA 1YLTA 1A0KA 3MQQA 4GCZA 4LV3A 5HAQA 2MJ6A 4GDNA 4IBXA 3BY8A 3EWKA 3N6IA 5IT5A 4WUJA 3OPRA 1ONGA
chains in the Genus database with same CATH topology
4U0XA 4ZJ1A 3TG9A 3CJMA 4K0WA 2Y2MA 5GHZA 1AXBA 1TVFA 1YMSA 5FATA 5FAQA 2WZXA 1GA9A 3VFFA 1K55C 3ZHHA 4X69A 3WS2A 1NYMA 3SS4A 3ZG8B 2HP5A 3ZFZA 4E3OA 4KQOA 1GA0A 5FSRA 1FCNA 2IWCA 5D3OA 3SH8A 1YMXA 5CERA 3NCKA 4S2JA 2OV5A 4UA9A 4WEJA 1DJAA 5KSHA 3G35A 2Y2JA 1BLSA 3IQAA 4QU3A 5CHMA 5EOOA 4B4XA 2Y59A 1FSWA 4DRTA 2Y2QA 2WAFA 3IF5A 4UA7A 5DVAA 3E2LA 3O86A 2WZZA 5EVID 1KVLA 4Y0UA 1XA1A 5EOEA 2HP6A 3A3IA 2XH9A 5DF7A 3VP0A 3FV7A 4OLGA 5EPHA 4DE1A 2XLNA 4JXSA 3VSKA 1KE3A 1XGJA 5KSCA 5GLCA 4K0XA 1JTDA 2DRWA 4N1HA 2Y2NA 2J9OA 2PBYA 4O7DA 4C75A 3ITBA 4FD8A 5M19A 1ZKJA 1WE4A 4MBHA 1XP4A 4PPRA 2ZM2A 1K57C 1PYYA 4P87A 4ZJ2A 4GOGA 1QMEA 1ZG4A 4ZJ3A 3HUNA 3VOYA 3BM6A 4B88A 1NXYA 1KDWA 4E3JA 4PM9A 3V3SA 1RGYA 2XEPA 3HLEA 4GN2A 3LO7A 4LCMA 4OOMA 5GHXA 5A91A 4Y0TA 3N8LA 1ESUA 4JXVA 1JWVA 3O3VA 1KVMA 3O87A 4IEDA 4YFMA 5I94A 1K54C 3BYDA 4LENA 4NETA 4QY5A 4UAAA 1HTZA 4GD6A 3N4IA 5CXWA 2ZC7A 3WS0A 1I5QA 1LI0A 4JF5A 5TFQA 2J7VA 4EWFA 1FQGA 3WWXA 4Q8IA 3Q7ZA 1GHMA 5A93A 1TDGA 3PBSA 2Y91A 4OPYA 3UY6A 5U47A 1ES3A 1FCMA 1H8ZA 3PBOA 5GLBA 2OLUA 5GLAA 1W7FA 3MXSA 3VP3A 2WGWA 2X01A 2J8YA 1W5DA 5CHUA 3SS5A 3HVFA 4HBTA 5E2FA 4DKIA 4LCLA 5TGFA 5E2EA 3UE0A 4CJNA 3WS4A 1PIOA 3BFDA 1E3UD 4R4SA 1RGZA 1MKIA 5CGXA 2Y4AA 2DCFA 4QY6A 1K25A 3HL9A 1JVJA 2P9VA 3A3FA 3A3JA 1Z6FA 1TDLA 4BLMA 2ZQCA 5DF9A 2EFXA 5FQIA 1HD8A 1ONHA 1BLPA 3Q1FA 4C6YA 2QMIA 2V2FF 3HLCA 1PI4A 4RYEA 5HARA 2IWBA 2XR0A 5FDHA 1RCJA 2Z2MB 5E2HA 1YLYA 2XFSA 3N7WA 3WRTA 1M6KA 3VP1A 3ZVTA 2EX6A 2P74A 2XFTA 1SCWA 2Y2OA 3HLWA 1IEMA 3V5MA 4MNRA 3TOIA 4PM6A 4OPZA 3O88A 3UDIA 3BEBA 3GQZA 4WEKA 3MZDA 3SH9A 2ZM8A 1FOFA 2J9PA 1KE4A 5CTNA 5JYOA 4XXRA 5CECA 5FA7A 3BFEA 1KGFA 3HLDA 3BLSA 1PZPA 2Q9NA 3NDEA 4OLDA 2XQZA 1BUEA 3UNWA 4DE3A 3Q07A 2HP9A 3DW0A 4IBRA 5G18A 4BL3A 2HDRA 3OZHA 3BFCA 3G34A 2JBFA 3WS5A 4C3QA 4E3NA 4QJGA 2ZQAA 2B5RA 4OP5A 5CEBA 4KZ4A 4OQIA 1N9BA 2ZM0A 3GSGA 4PM7A 3UPPA 5CEDA 3EQUA 3SOIA 1H8YA 3C7VA 3SH7A 1K38A 3DWKA 2WGWB 2UWXA 4M3KA 1GCEA 2OSUA 1XA7A 3WS1A 1MWUA 1LI9A 3OC2A 4R23A 5M1AA 1S0WA 4NK3A 3IHAA 3HLGA 1M40A 3FWLA 3IXHA 4OPRA 4WZ4A 3S22A 1PWDA 1XGIA 4WYYA 2ZD8A 2EFUA 2RL3A 3W8KA 2WAEA 4KZ9A 2P9VB 4UHUA 1BLCA 4OVDA 4X6TA 2HDQA 1K6SA 2WADA 3G4PA 4FSFA 4A5RA 3M2JA 4QB8A 1NYYA 1XX2A 4BENA 1LLBA 2VGJA 1IYOA 3FYZA 4FH2A 3VSLA 4MBFA 4OOYA 4RX2A 1HZOA 3M6BA 3GMWA 1U60A 1XPBA 4S2NC 5HX9A 1IELA 3IXDA 3GTCA 1FR1A 4ZAMA 1L0DA 3JYIA 2V1ZA 2CC1A 1YLPA 1FSYA 3IXGA 1PW1A 3ITAA 3PBTA 4N1XA 5CTMA 4HEFA 4EV4A 5FQ9A 2ZMAA 3DTMA 2EX2A 2Q9MA 2XDMA 4DDSA 3UE1A 5KZHA 2PU2A 4GZBA 3AGFA 3CMZA 4PMAA 1ES2A 1NZUA 3HREA 4L0LA 3ZCZA 1DJCA 1EROA 1LL9A 3GRJA 1OMEA 4JF4A 5DF8A 2EX8A 3N8SA 3EQVA 5FQJA 4RX3A 4GD8A 4OKPA 3HLBA 5HL1A 4CPKA 1BTLA 2V20A 1XXMA 1KDSA 3HBRA 1FCOA 1CK3A 3VMAA 4QD4A 3LEZA 1NY0A 4HESA 4S2KA 1ZG6A 4EBPA 4OQ0A 1N4OA 4Y7PA 2XD1A 2Y2HA 3TSGA 3NDGA 3M2KA 3LCEA 3ZNYA 4EQIA 1CI8A 1CI9A 4BJPA 3PTEA 4N9KA 3HLFA 3G30A 5JYPA 4QHCA 4ZBEA 2FFYA 3OPHA 1ES4A 1LL5A 2R9WA 2WKHA 1PZOA 1ES5A 3UO9A 1GHIA 1K56D 4DF6A 1IYSA 2ZQ7A 3Q82A 4S2MA 3VP4A 2ZC3B 3PBNA 2WGIA 2Y2GA 3NI9A 4EBLA 4OPQA 3G32A 4BD0A 1IKIA 2C6WB 2JC7A 2G2UA 2JE5A 1G6AA 1QMFA 2H0YA 2EX9A 5F82A 3ZG0A 2GDNA 5DTTA 3IT9A 3GV9A 4R3BA 3ZNTA 3AGEA 3QNCA 2Y55A 5EECA 2ZQ9A 1ESIA 4S2LA 3G2YA 5M18A 1J9MA 3UDFA 5L2FA 4Y0OA 5E2GA 4U3TA 5FAPA 1MPLA 5IHVA 1JWPA 3D4FA 5GL9A 3I7JA 4JPMA 4B4ZA 4Z9QA 4S2NA 4KZBA 3Q7VA 4DE2A 5FASA 4LV2A 2ZC5B 3IH8A 5EVLA 3Q81A 4D2OA 4R0QA 1PW8A 4JXGA 4BL2A 3MXRA 1PWCA 3ZGAB 4JF6A 4WMCA 2BLSA 1KGGA 1NRFA 2H5SA 4WM9A 5CRFA 2ZQDA 4JLFA 4X55A 1YQSA 2X71A 5A90A 3RXWA 5A92A 4MBKA 1PWGA 5AQ9A 2Y2KA 1BULA 5FI7A 1VM1A 2EXBA 2PU4A 4KZ8A 4R3JA 3CG5A 5FQQA 1HVBA 1MBLA 1DY6A 5CHJA 4YINA 3FKVA 1KGEA 2ZC6B 2WUQA 2Y2PA 3IWIA 1K6RA 4OQGA 5GHYA 4FCFA 3P98A 1ERMA 2Z2LB 4GNUA 5F1FA 1MWTA 4E3IA 1ERQA 2XF3A 1YLJA 3ISGA 1YLWA 4GKUA 4XUXA 4PM5A 4LV0A 4ZTKA 3IWQA 3C4PA 3OCLA 1BT5A 3A3EA 4MLLA 5HAIA 1JWZA 5HAPA 3OPLA 1L0FA 1NZOA 3IHBA 4X68A 2OLVA 3VFHA 2E8IA 3PBQA 3MZFA 4GB7A 5EVIA 1I2WA 5DTSA 1ZC2A 3MZEA 4P85A 1S6RA 2Y2LA 3A3DA 3BLMA 2JCHA 2QPNA 3ZG7B 2H0TA 4OH0A 1ALQA 1EWZA 3BFGA 4MEZA 4WBGA 3W4QA 3BECA 4K91A 4P0MA 2BG1A 4XUZA 4LV1A 2A3UA 4KZ3A 1VQQA 2WK0A 3UN7A 1LHYA 2IWDA 1CEGA 5GLDA 3IF6A 2WKEA 1H5XA 3IWOA 1IKGA 4BQMA 5CGWA 2VGKA 4KENB 4WELA 4OOLA 3OPPA 5DTKA 5FQMA 1IYQA 3WRZA 4WZ5A 3Q7VB 2ZC4B 1L0EA 4DE0A 1BSGA 4KZ7A 4KG5A 3B3XA 3RXXA 4N92A 4X53A 3BFFA 3IXBA 4GDBA 3UE3A 4OQHA 4S2IA 2HDSA 3MBZA 2HPBA 3DWZA 3FKWA 2I72A 1L0GA 3ZG5A 3ZG9B 1MWRA 2FFFB 1DJBA 1SDNA 3NBLA 1Y54A 3NC8A 4U0TA 5FQKA 4HBUA 2DNSA 3BRMA 3C5AA 5F1GA 4ZDXA 4KG6A 1BLHA 5AQ7A 5AQAA 4JXWA 5FI6A 3VP2A 4JKTA 3N8RA 3ZVWA 5HFOA 5E43A 5FI2A 1SKFA 4E3LA 2G2WA 1O7EA 2XD5A 3V50A 4OP8A 3M6HA 1SDEA 3PBRA 3LY4A 1XKZA 1C3BA 5F83A 3S4XA 3AGDA 3OCNA 1I2SA 3G31A 5EVIC 3E2KA 4S2PA 1MWSA 4DXBA 1E3UA 3PAEA 3C7UA 3NIAA 1L2SA 5FAOA 3P09A 5TR7A 4EBNA 3V3RA 2ZQ8A 3MKFA 5EUAA 3MFDA 3UPOA 1JTGA 3FZCA 1BZAA 4H8RA 1Q2QA 1WYBA 1G68A 4KZ6A 1K56A 3G2ZA 4EUZA 1PI5A 1K55A 1SHVA 5EE8A 1E4DA 1GHPA 1K4FA 4X56A 5EVIB 3UDXA 3QNBA 4KZ5A 3LY3A 5J8XA 3PAGA 1CEFA 1MXOA 2C5WB 1W8YA 1E25A 3ZDJA 3MKEA 4KQQA 4DXCA 4E3KA 3IF6C 1YLZA 1IYPA 2X02A 4E6XA 2RCXA 2WYXA 5CGSA 1MY8A 2XGNA 2ZJ9A 3VOZA 4E3MA 4BD1A 3C4OA 1W79A 4F94A 4IVKA 4WZ5C 3QHYA 5HW3A 2XK1A 4JBFA 4P6BA 5KMWA 1O07A 1FR6A 3NY4A 4KG2A 3UPNA 3IF6B 4RA7A 3SS3A 2EXAA 4RVAA 1NJ4A 3S1YA 2R9XA 1RP5A 3HUOA 3IH9A 2QZ6A 4UA6A 3GVBA 3GR2A 3W4PA 4R4RA 1K57A 1TEMA 1YT4A 2ZLYA 4PM8A 3RJUA 2A49A 4FH4A 1EI5A 5AQBA 3V39A 2WKIA 4DDYA 4ID4A 1Q2PA 2HDUA 4WMCD 1K4EA 3HUMA 4N9LA 1YLTA 4S2OA 4IVIA 4E6WA 3W4OA 4LV3A 5BOHA 5HAQA 4R1GA 4GDNA 2H10A 2WGVA 1YM1A 3CZDA 4KZAA 4IBXA 1KE0A 3N6IA 1W8QA 4OONA 2Y2IA 1WYCA 1K54A 3OPRA 4KQRA 1ONGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0X A;  4ZJ1 A;  3TG9 A;  3CJM A;  4K0W A;  2Y2M A;  5GHZ A;  1AXB A;  1TVF A;  1YMS A;  5FAT A;  5FAQ A;  2WZX A;  1GA9 A;  3VFF A;  1K55 C;  3ZHH A;  4X69 A;  3WS2 A;  1NYM A;  3SS4 A;  3ZG8 B;  2HP5 A;  3ZFZ A;  4E3O A;  4KQO A;  1GA0 A;  5FSR A;  1FCN A;  2IWC A;  5D3O A;  3SH8 A;  1YMX A;  5CER A;  3NCK A;  4S2J A;  2OV5 A;  4UA9 A;  4WEJ A;  1DJA A;  5KSH A;  3G35 A;  2Y2J A;  1BLS A;  3IQA A;  4QU3 A;  5CHM A;  5EOO A;  4B4X A;  2Y59 A;  1FSW A;  4DRT A;  2Y2Q A;  2WAF A;  3IF5 A;  4UA7 A;  5DVA A;  3E2L A;  3O86 A;  2WZZ A;  5EVI D;  1KVL A;  4Y0U A;  1XA1 A;  5EOE A;  2HP6 A;  3A3I A;  2XH9 A;  5DF7 A;  3VP0 A;  3FV7 A;  4OLG A;  5EPH A;  4DE1 A;  2XLN A;  4JXS A;  3VSK A;  1KE3 A;  1XGJ A;  5KSC A;  5GLC A;  4K0X A;  1JTD A;  2DRW A;  4N1H A;  2Y2N A;  2J9O A;  2PBY A;  4O7D A;  4C75 A;  3ITB A;  4FD8 A;  5M19 A;  1ZKJ A;  1WE4 A;  4MBH A;  1XP4 A;  4PPR A;  2ZM2 A;  1K57 C;  1PYY A;  4P87 A;  4ZJ2 A;  4GOG A;  1QME A;  1ZG4 A;  4ZJ3 A;  3HUN A;  3VOY A;  3BM6 A;  4B88 A;  1NXY A;  1KDW A;  4E3J A;  4PM9 A;  3V3S A;  1RGY A;  2XEP A;  3HLE A;  4GN2 A;  3LO7 A;  4LCM A;  4OOM A;  5GHX A;  5A91 A;  4Y0T A;  3N8L A;  1ESU A;  4JXV A;  1JWV A;  3O3V A;  1KVM A;  3O87 A;  4IED A;  4YFM A;  5I94 A;  1K54 C;  3BYD A;  4LEN A;  4NET A;  4QY5 A;  4UAA A;  1HTZ A;  4GD6 A;  3N4I A;  5CXW A;  2ZC7 A;  3WS0 A;  1I5Q A;  1LI0 A;  4JF5 A;  5TFQ A;  2J7V A;  4EWF A;  1FQG A;  3WWX A;  4Q8I A;  3Q7Z A;  1GHM A;  5A93 A;  1TDG A;  3PBS A;  2Y91 A;  4OPY A;  3UY6 A;  5U47 A;  1ES3 A;  1FCM A;  1H8Z A;  3PBO A;  5GLB A;  2OLU A;  5GLA A;  1W7F A;  3MXS A;  3VP3 A;  2WGW A;  2X01 A;  2J8Y A;  1W5D A;  5CHU A;  3SS5 A;  3HVF A;  4HBT A;  5E2F A;  4DKI A;  4LCL A;  5TGF A;  5E2E A;  3UE0 A;  4CJN A;  3WS4 A;  1PIO A;  3BFD A;  1E3U D;  4R4S A;  1RGZ A;  1MKI A;  5CGX A;  2Y4A A;  2DCF A;  4QY6 A;  1K25 A;  3HL9 A;  1JVJ A;  2P9V A;  3A3F A;  3A3J A;  1Z6F A;  1TDL A;  4BLM A;  2ZQC A;  5DF9 A;  2EFX A;  5FQI A;  1HD8 A;  1ONH A;  1BLP A;  3Q1F A;  4C6Y A;  2QMI A;  2V2F F;  3HLC A;  1PI4 A;  4RYE A;  5HAR A;  2IWB A;  2XR0 A;  5FDH A;  1RCJ A;  2Z2M B;  5E2H A;  1YLY A;  2XFS A;  3N7W A;  3WRT A;  1M6K A;  3VP1 A;  3ZVT A;  2EX6 A;  2P74 A;  2XFT A;  1SCW A;  2Y2O A;  3HLW A;  1IEM A;  3V5M A;  4MNR A;  3TOI A;  4PM6 A;  4OPZ A;  3O88 A;  3UDI A;  3BEB A;  3GQZ A;  4WEK A;  3MZD A;  3SH9 A;  2ZM8 A;  1FOF A;  2J9P A;  1KE4 A;  5CTN A;  5JYO A;  4XXR A;  5CEC A;  5FA7 A;  3BFE A;  1KGF A;  3HLD A;  3BLS A;  1PZP A;  2Q9N A;  3NDE A;  4OLD A;  2XQZ A;  1BUE A;  3UNW A;  4DE3 A;  3Q07 A;  2HP9 A;  3DW0 A;  4IBR A;  5G18 A;  4BL3 A;  2HDR A;  3OZH A;  3BFC A;  3G34 A;  2JBF A;  3WS5 A;  4C3Q A;  4E3N A;  4QJG A;  2ZQA A;  2B5R A;  4OP5 A;  5CEB A;  4KZ4 A;  4OQI A;  1N9B A;  2ZM0 A;  3GSG A;  4PM7 A;  3UPP A;  5CED A;  3EQU A;  3SOI A;  1H8Y A;  3C7V A;  3SH7 A;  1K38 A;  3DWK A;  2WGW B;  2UWX A;  4M3K A;  1GCE A;  2OSU A;  1XA7 A;  3WS1 A;  1MWU A;  1LI9 A;  3OC2 A;  4R23 A;  5M1A A;  1S0W A;  4NK3 A;  3IHA A;  3HLG A;  1M40 A;  3FWL A;  3IXH A;  4OPR A;  4WZ4 A;  3S22 A;  1PWD A;  1XGI A;  4WYY A;  2ZD8 A;  2EFU A;  2RL3 A;  3W8K A;  2WAE A;  4KZ9 A;  2P9V B;  4UHU A;  1BLC A;  4OVD A;  4X6T A;  2HDQ A;  1K6S A;  2WAD A;  3G4P A;  4FSF A;  4A5R A;  3M2J A;  4QB8 A;  1NYY A;  1XX2 A;  4BEN A;  1LLB A;  2VGJ A;  1IYO A;  3FYZ A;  4FH2 A;  3VSL A;  4MBF A;  4OOY A;  4RX2 A;  1HZO A;  3M6B A;  3GMW A;  1U60 A;  1XPB A;  4S2N C;  5HX9 A;  1IEL A;  3IXD A;  3GTC A;  1FR1 A;  4ZAM A;  1L0D A;  3JYI A;  2V1Z A;  2CC1 A;  1YLP A;  1FSY A;  3IXG A;  1PW1 A;  3ITA A;  3PBT A;  4N1X A;  5CTM A;  4HEF A;  4EV4 A;  5FQ9 A;  2ZMA A;  3DTM A;  2EX2 A;  2Q9M A;  2XDM A;  4DDS A;  3UE1 A;  5KZH A;  2PU2 A;  4GZB A;  3AGF A;  3CMZ A;  4PMA A;  1ES2 A;  1NZU A;  3HRE A;  4L0L A;  3ZCZ A;  1DJC A;  1ERO A;  1LL9 A;  3GRJ A;  1OME A;  4JF4 A;  5DF8 A;  2EX8 A;  3N8S A;  3EQV A;  5FQJ A;  4RX3 A;  4GD8 A;  4OKP A;  3HLB A;  5HL1 A;  4CPK A;  1BTL A;  2V20 A;  1XXM A;  1KDS A;  3HBR A;  1FCO A;  1CK3 A;  3VMA A;  4QD4 A;  3LEZ A;  1NY0 A;  4HES A;  4S2K A;  1ZG6 A;  4EBP A;  4OQ0 A;  1N4O A;  4Y7P A;  2XD1 A;  2Y2H A;  3TSG A;  3NDG A;  3M2K A;  3LCE A;  3ZNY A;  4EQI A;  1CI8 A;  1CI9 A;  4BJP A;  3PTE A;  4N9K A;  3HLF A;  3G30 A;  5JYP A;  4QHC A;  4ZBE A;  2FFY A;  3OPH A;  1ES4 A;  1LL5 A;  2R9W A;  2WKH A;  1PZO A;  1ES5 A;  3UO9 A;  1GHI A;  1K56 D;  4DF6 A;  1IYS A;  2ZQ7 A;  3Q82 A;  4S2M A;  3VP4 A;  2ZC3 B;  3PBN A;  2WGI A;  2Y2G A;  3NI9 A;  4EBL A;  4OPQ A;  3G32 A;  4BD0 A;  1IKI A;  2C6W B;  2JC7 A;  2G2U A;  2JE5 A;  1G6A A;  1QMF A;  2H0Y A;  2EX9 A;  5F82 A;  3ZG0 A;  2GDN A;  5DTT A;  3IT9 A;  3GV9 A;  4R3B A;  3ZNT A;  3AGE A;  3QNC A;  2Y55 A;  5EEC A;  2ZQ9 A;  1ESI A;  4S2L A;  3G2Y A;  5M18 A;  1J9M A;  3UDF A;  5L2F A;  4Y0O A;  5E2G A;  4U3T A;  5FAP A;  1MPL A;  5IHV A;  1JWP A;  3D4F A;  5GL9 A;  3I7J A;  4JPM A;  4B4Z A;  4Z9Q A;  4S2N A;  4KZB A;  3Q7V A;  4DE2 A;  5FAS A;  4LV2 A;  2ZC5 B;  3IH8 A;  5EVL A;  3Q81 A;  4D2O A;  4R0Q A;  1PW8 A;  4JXG A;  4BL2 A;  3MXR A;  1PWC A;  3ZGA B;  4JF6 A;  4WMC A;  2BLS A;  1KGG A;  1NRF A;  2H5S A;  4WM9 A;  5CRF A;  2ZQD A;  4JLF A;  4X55 A;  1YQS A;  2X71 A;  5A90 A;  3RXW A;  5A92 A;  4MBK A;  1PWG A;  5AQ9 A;  2Y2K A;  1BUL A;  5FI7 A;  1VM1 A;  2EXB A;  2PU4 A;  4KZ8 A;  4R3J A;  3CG5 A;  5FQQ A;  1HVB A;  1MBL A;  1DY6 A;  5CHJ A;  4YIN A;  3FKV A;  1KGE A;  2ZC6 B;  2WUQ A;  2Y2P A;  3IWI A;  1K6R A;  4OQG A;  5GHY A;  4FCF A;  3P98 A;  1ERM A;  2Z2L B;  4GNU A;  5F1F A;  1MWT A;  4E3I A;  1ERQ A;  2XF3 A;  1YLJ A;  3ISG A;  1YLW A;  4GKU A;  4XUX A;  4PM5 A;  4LV0 A;  4ZTK A;  3IWQ A;  3C4P A;  3OCL A;  1BT5 A;  3A3E A;  4MLL A;  5HAI A;  1JWZ A;  5HAP A;  3OPL A;  1L0F A;  1NZO A;  3IHB A;  4X68 A;  2OLV A;  3VFH A;  2E8I A;  3PBQ A;  3MZF A;  4GB7 A;  5EVI A;  1I2W A;  5DTS A;  1ZC2 A;  3MZE A;  4P85 A;  1S6R A;  2Y2L A;  3A3D A;  3BLM A;  2JCH A;  2QPN A;  3ZG7 B;  2H0T A;  4OH0 A;  1ALQ A;  1EWZ A;  3BFG A;  4MEZ A;  4WBG A;  3W4Q A;  3BEC A;  4K91 A;  4P0M A;  2BG1 A;  4XUZ A;  4LV1 A;  2A3U A;  4KZ3 A;  1VQQ A;  2WK0 A;  3UN7 A;  1LHY A;  2IWD A;  1CEG A;  5GLD A;  3IF6 A;  2WKE A;  1H5X A;  3IWO A;  1IKG A;  4BQM A;  5CGW A;  2VGK A;  4KEN B;  4WEL A;  4OOL A;  3OPP A;  5DTK A;  5FQM A;  1IYQ A;  3WRZ A;  4WZ5 A;  3Q7V B;  2ZC4 B;  1L0E A;  4DE0 A;  1BSG A;  4KZ7 A;  4KG5 A;  3B3X A;  3RXX A;  4N92 A;  4X53 A;  3BFF A;  3IXB A;  4GDB A;  3UE3 A;  4OQH A;  4S2I A;  2HDS A;  3MBZ A;  2HPB A;  3DWZ A;  3FKW A;  2I72 A;  1L0G A;  3ZG5 A;  3ZG9 B;  1MWR A;  2FFF B;  1DJB A;  1SDN A;  3NBL A;  1Y54 A;  3NC8 A;  4U0T A;  5FQK A;  4HBU A;  2DNS A;  3BRM A;  3C5A A;  5F1G A;  4ZDX A;  4KG6 A;  1BLH A;  5AQ7 A;  5AQA A;  4JXW A;  5FI6 A;  3VP2 A;  4JKT A;  3N8R A;  3ZVW A;  5HFO A;  5E43 A;  5FI2 A;  1SKF A;  4E3L A;  2G2W A;  1O7E A;  2XD5 A;  3V50 A;  4OP8 A;  3M6H A;  1SDE A;  3PBR A;  3LY4 A;  1XKZ A;  1C3B A;  5F83 A;  3S4X A;  3AGD A;  3OCN A;  1I2S A;  3G31 A;  5EVI C;  3E2K A;  4S2P A;  1MWS A;  4DXB A;  1E3U A;  3PAE A;  3C7U A;  3NIA A;  1L2S A;  5FAO A;  3P09 A;  5TR7 A;  4EBN A;  3V3R A;  2ZQ8 A;  3MKF A;  5EUA A;  3MFD A;  3UPO A;  1JTG A;  3FZC A;  1BZA A;  4H8R A;  1Q2Q A;  1WYB A;  1G68 A;  4KZ6 A;  1K56 A;  3G2Z A;  4EUZ A;  1PI5 A;  1K55 A;  1SHV A;  5EE8 A;  1E4D A;  1GHP A;  1K4F A;  4X56 A;  5EVI B;  3UDX A;  3QNB A;  4KZ5 A;  3LY3 A;  5J8X A;  3PAG A;  1CEF A;  1MXO A;  2C5W B;  1W8Y A;  1E25 A;  3ZDJ A;  3MKE A;  4KQQ A;  4DXC A;  4E3K A;  3IF6 C;  1YLZ A;  1IYP A;  2X02 A;  4E6X A;  2RCX A;  2WYX A;  5CGS A;  1MY8 A;  2XGN A;  2ZJ9 A;  3VOZ A;  4E3M A;  4BD1 A;  3C4O A;  1W79 A;  4F94 A;  4IVK A;  4WZ5 C;  3QHY A;  5HW3 A;  2XK1 A;  4JBF A;  4P6B A;  5KMW A;  1O07 A;  1FR6 A;  3NY4 A;  4KG2 A;  3UPN A;  3IF6 B;  4RA7 A;  3SS3 A;  2EXA A;  4RVA A;  1NJ4 A;  3S1Y A;  2R9X A;  1RP5 A;  3HUO A;  3IH9 A;  2QZ6 A;  4UA6 A;  3GVB A;  3GR2 A;  3W4P A;  4R4R A;  1K57 A;  1TEM A;  1YT4 A;  2ZLY A;  4PM8 A;  3RJU A;  2A49 A;  4FH4 A;  1EI5 A;  5AQB A;  3V39 A;  2WKI A;  4DDY A;  4ID4 A;  1Q2P A;  2HDU A;  4WMC D;  1K4E A;  3HUM A;  4N9L A;  1YLT A;  4S2O A;  4IVI A;  4E6W A;  3W4O A;  4LV3 A;  5BOH A;  5HAQ A;  4R1G A;  4GDN A;  2H10 A;  2WGV A;  1YM1 A;  3CZD A;  4KZA A;  4IBX A;  1KE0 A;  3N6I A;  1W8Q A;  4OON A;  2Y2I A;  1WYC A;  1K54 A;  3OPR A;  4KQR A;  1ONG A; 
#chains in the Genus database with same CATH topology
 4U0X A;  4ZJ1 A;  3TG9 A;  1GA9 A;  3ZHH A;  4X69 A;  2VX8 A;  1OTA A;  3ZG8 B;  2HP5 A;  4E3O A;  4KQO A;  3DBA A;  5FSR A;  3T4O A;  5D3O A;  3T4J A;  4UA9 A;  4WEJ A;  3G35 A;  4JGR A;  1BLS A;  3IQA A;  3LUQ A;  1NRJ A;  1FSW A;  4DRT A;  2D02 A;  2WAF A;  1T1C A;  4Y0U A;  2XH9 A;  4D60 A;  4JXS A;  3E0Y A;  1WA9 A;  4X1M A;  2Y2N A;  2PBY A;  1ZKJ A;  4MBH A;  1XP4 A;  4P87 A;  4ZJ2 A;  4GOG A;  1QME A;  1ZG4 A;  4ZJ3 A;  5K5B A;  4B88 A;  3HCY A;  3BM6 A;  1NXY A;  4Z1W A;  1RGY A;  4L9G A;  3IBJ A;  3N8L A;  3O3V A;  1K54 C;  3BYD A;  4NET A;  1YAX A;  3N4I A;  3WS0 A;  1I5Q A;  5TFQ A;  4EWF A;  2JKT M;  3WWX A;  5A93 A;  2Y91 A;  1TF1 A;  5HWW A;  1H8Z A;  2V1B A;  5GLA A;  3C30 A;  2X01 A;  2J8Y A;  3ZYT A;  5CHU A;  3CI6 A;  3HVF A;  4LCL A;  3UE0 A;  3MJQ A;  2W1R A;  1E3U D;  4R4S A;  1RGZ A;  5CGX A;  1J3W A;  2Y4A A;  1SKO B;  1JVJ A;  3A0V A;  5EVE A;  1Z6F A;  4BLM A;  4BWI A;  2QMI A;  3HLC A;  2IWB A;  5FDH A;  3DTK A;  1YLY A;  3JPU A;  1M6K A;  1S4S A;  2XFT A;  3D3O A;  4MNR A;  3VE3 A;  2AVX A;  3DTE A;  4G3W A;  4OPZ A;  3EEH A;  3MZD A;  2B02 A;  2VZW A;  5CTN A;  4XXR A;  3TRC A;  1FIL A;  1KGF A;  2VKS A;  3NUL A;  4DE3 A;  3UNW A;  2HP9 A;  3PHY A;  3E4Q A;  4E3N A;  2ZQA A;  1LL8 A;  3R7W A;  2ZM0 A;  3EQU A;  3SH7 A;  4M3K A;  1MWU A;  1LI9 A;  3OC2 A;  4I38 A;  1S0W A;  3KSH A;  3IHA A;  3HLG A;  4NK3 A;  4CLC C;  1M40 A;  3IX8 A;  4OPR A;  1YSQ A;  4R70 A;  5AVF A;  4JGP A;  5AVE A;  2P9V B;  2HDQ A;  3G4P A;  1XX2 A;  3F1P A;  2JHE A;  1T1B A;  1EW0 A;  3GMW A;  1XPB A;  3T1Q B;  3IXD A;  3C2W A;  3LR5 A;  2CC1 A;  1FSY A;  3UB8 A;  5FQ9 A;  4LFU A;  2EX2 A;  2Q9M A;  4DDS A;  3CAX A;  3NOU C;  5KZH A;  3BQA A;  4GZB A;  3IS2 A;  3MQO A;  3UE6 A;  5FQJ A;  4CPK A;  1BTL A;  4NXF A;  1KDS A;  1S1Y A;  1Z09 A;  4QD4 A;  3A0S A;  4EET B;  1NY0 A;  1ZG6 A;  4OQ0 A;  5DJT A;  1GSV A;  3S7Q A;  4P6Z M;  5F6A A;  3ZNY A;  1CI8 A;  5HDS A;  1CI9 A;  3PTE A;  4N9K A;  3L7H A;  4HOI A;  3G30 A;  5HZH A;  4ZBE A;  3OBF A;  2QYB A;  1ES5 A;  1GHI A;  5F69 A;  4DJ2 A;  3PBN A;  2Y2G A;  4OPQ A;  4BD0 A;  1IKI A;  2G2U A;  2JE5 A;  2PDR A;  2UV0 E;  2EX9 A;  1T19 A;  2KLI A;  2GDN A;  1LT0 A;  2ZOI A;  3G2Y A;  1J9M A;  3TE8 A;  5DFX A;  2J3T C;  5GL9 A;  3I7J A;  5HD3 A;  4LV2 A;  2ZC5 B;  3LID A;  5HPF A;  4R0Q A;  4BL2 A;  1PWC A;  5L8M A;  3ZGA B;  1LSX A;  3NOP C;  5CRF A;  3E4P A;  4JLF A;  5A90 A;  4MBK A;  2KX6 A;  5AQ9 A;  2Y2K A;  3G6O A;  4R3J A;  3CG5 A;  2W1T B;  1DY6 A;  2HGV A;  3IWI A;  2Y2P A;  4FCF A;  2Z2L B;  4MN5 A;  1MWT A;  3QP4 A;  4GKU A;  4GHI A;  4ZTK A;  3OCL A;  4MN6 A;  5HAP A;  3TW8 A;  2JN7 A;  4IUK A;  1YKD A;  2QPN A;  2PYR A;  3HJK A;  5TBM B;  2V0U A;  2QKP A;  1MZU A;  4MEZ A;  4WBG A;  4K91 A;  2JKR I;  2VK3 A;  4KZ3 A;  5LBR A;  4PAU A;  3UN7 A;  1CEG A;  5GLD A;  3SW1 A;  1IKG A;  4OOL A;  4IHQ A;  3LEQ A;  4LLO B;  2OAP 1;  1L0E A;  4DE0 A;  4KZ7 A;  4N92 A;  3MS6 A;  3MR0 A;  4Y17 A;  1SDN A;  3S7N A;  1Y54 A;  5F1G A;  2VEA A;  4ZDX A;  5AQA A;  5F68 A;  4E3L A;  3C38 A;  3QP5 A;  3T1R A;  4WL9 A;  3MSH A;  1UWP X;  3ICY A;  3S4X A;  3F1N B;  5EVI C;  1E3U A;  1L2S A;  4EBN A;  3S7O A;  2ZQ8 A;  5EUA A;  3MFD A;  1JTG A;  3FZC A;  1Q2Q A;  4KZ6 A;  1K56 A;  3CIT A;  3NHQ A;  3LY3 A;  1MXO A;  2C5W B;  1E25 A;  4DXC A;  2BTF P;  3T4L A;  5DJU A;  4E3M A;  4BD1 A;  3LR4 A;  4WZ5 C;  5KMW A;  1FR6 A;  4KG2 A;  3IF6 B;  1KOU A;  2XRO A;  4YNR A;  3HUO A;  2QZ6 A;  4UA6 A;  3GVB A;  3GR2 A;  3W4P A;  1K57 A;  2ZLY A;  3RJU A;  3K3D A;  2A49 A;  4FH4 A;  3V39 A;  3P7N A;  4WMC D;  4N9L A;  4IVI A;  3W4O A;  2B95 A;  5BOH A;  4G3K A;  2WGV A;  2P7J A;  1YM1 A;  4KZA A;  2Y2I A;  3BWL A;  4K0W A;  4M4X A;  4BBU A;  1TVF A;  5FAT A;  2WZX A;  4HHD A;  3VFF A;  1K55 C;  3WS2 A;  2IWC A;  3SH8 A;  4WN5 A;  5C5K A;  5CER A;  1F2K A;  3NCK A;  1SKO A;  2Y2J A;  3CLO A;  4B4X A;  5EOO A;  2Y79 A;  3LI9 A;  2CMN A;  3O86 A;  1XA1 A;  2HP6 A;  3RH8 B;  5EPH A;  4DE1 A;  1P9R A;  1KE3 A;  2O9C A;  1V9Y A;  4G3V A;  1JTD A;  2DRW A;  3F1O A;  4BBV A;  4QPR A;  4O7D A;  3ITB A;  4FD8 A;  3JVU A;  4NEE D;  3KX0 X;  1WE4 A;  4H6J B;  4PPR A;  2ZM2 A;  1PYY A;  3LIF A;  5MC7 A;  3VOY A;  4KQD A;  2JKF A;  4E3J A;  2XEP A;  3DAV A;  1CF0 A;  3HLE A;  3LO7 A;  5GHX A;  5A91 A;  1KVM A;  1F98 A;  4LEN A;  1XJ2 A;  4MDZ A;  2O99 A;  5HSQ A;  1OJ5 A;  1HLU P;  3B42 A;  4Q8I A;  3LI8 A;  2INW A;  3FPW A;  3PBS A;  1FCM A;  4GHI B;  1VB6 A;  3PBO A;  4HQA A;  3MXS A;  3VP3 A;  1MKM A;  1W5D A;  3SS5 A;  2VGL S;  4HBT A;  5E2F A;  4ETX A;  3MQ0 A;  2M7U A;  1MKI A;  1NLY A;  3VV4 A;  1K25 A;  2P9V A;  4UQI S;  3A3J A;  3H7W B;  5J7E A;  1P0Z A;  1BLP A;  2ACG A;  2V2F F;  4RYE A;  1RCJ A;  2Z2M B;  5E2H A;  1IOU A;  3VP1 A;  4PHT A;  2EX6 A;  1SCW A;  5TJJ A;  4GJ4 A;  4NXG A;  3HLW A;  1IEM A;  3V5M A;  3TOI A;  3BEB A;  4WEK A;  2ZM8 A;  3QP8 A;  5JYO A;  4IUH A;  5CEC A;  3NJA A;  5FA7 A;  1DP6 A;  5EV0 A;  3HLD A;  2Q9N A;  2FH5 A;  1OTE A;  4YOF A;  3OZH A;  1G6O A;  3G34 A;  2JBF A;  3WS5 A;  4QJG A;  2JKG A;  4OP5 A;  4KZ4 A;  5CED A;  3UPP A;  3C7V A;  1K38 A;  2Y8H A;  3BW6 A;  1GCE A;  2QWS A;  3WS1 A;  1T18 A;  5M1A A;  2IA2 A;  2XA7 M;  3FWL A;  3IXH A;  1PWD A;  5DFY A;  2WAE A;  1BLC A;  2GJ3 A;  4OVD A;  4B93 A;  1K6S A;  5A8B A;  4A5R A;  5G4Z A;  4BEN A;  1IYO A;  3FYZ A;  5EM1 A;  4R3A A;  5HWV A;  3LYX A;  1HZO A;  3GTC A;  4ZAM A;  3JYI A;  3IXG A;  3PBT A;  1PW1 A;  3ITA A;  2XDM A;  4PMA A;  1NZU A;  3HRE A;  4GLQ A;  4L0L A;  5DF8 A;  4JF4 A;  4DN0 A;  2EX8 A;  3EQV A;  2W1T A;  4OKP A;  1XXM A;  1FCO A;  1CK3 A;  2W0N A;  2EA9 A;  3HJI A;  3M2K A;  4EQI A;  1H0M A;  5FEF A;  4QHC A;  2QJ5 A;  1ES4 A;  1LL5 A;  3UO9 A;  1K56 D;  4DF6 A;  2ZQ7 A;  3Q82 A;  2OWH A;  2ZC3 B;  2WGI A;  3NI9 A;  4EBL A;  5TBM A;  2JC7 A;  4EU0 A;  1NWZ A;  2K2N A;  2OWJ A;  5DTT A;  3F1O B;  1GSW A;  2VJW A;  4MMN A;  3LFV A;  4S2L A;  5M18 A;  5E2G A;  4U3T A;  3H9W A;  2W3H A;  4JPM A;  4HIA A;  4B4Z A;  4KZB A;  4DE2 A;  4D2O A;  5EVL A;  3Q81 A;  4JXG A;  3EEA A;  4JF6 A;  4WMC A;  1KGG A;  1NRF A;  2H5S A;  4WM9 A;  5DKK A;  4DJ3 A;  5FI7 A;  2EXB A;  4I3I A;  4KZ8 A;  4YIN A;  4OQG A;  1K6R A;  4EW7 A;  3F1N A;  5F1F A;  4E3I A;  2XF3 A;  3ISG A;  3T4K A;  1VEU B;  1BT5 A;  3A3E A;  1TS0 A;  1L0F A;  3VFH A;  2E8I A;  4GB7 A;  1I2W A;  2O9A A;  2J80 A;  3A3D A;  3BLM A;  4K08 A;  2JCH A;  2PR5 A;  4OH0 A;  1FIK A;  2BG1 A;  2A3U A;  2WK0 A;  1XFN A;  1LHY A;  3IF6 A;  3UMD A;  3D9Y A;  5CGW A;  4KEN B;  2HJE A;  1OPX A;  3Q7V B;  2NUT C;  2ZC4 B;  2W27 A;  3RXX A;  3IXB A;  4OQH A;  4S2I A;  2HPB A;  3ZG9 B;  1MWR A;  4EER A;  5FQK A;  2DNS A;  2VV8 A;  5AQ7 A;  5FI6 A;  5HFO A;  2XD5 A;  3V50 A;  4OP8 A;  3UB9 A;  4FTX A;  3V67 A;  2ZBB A;  3PBR A;  1C3B A;  5F83 A;  3E2K A;  4DXB A;  4EUV A;  2WKR A;  5FAO A;  4DMZ A;  5TR7 A;  3V3R A;  3BY9 A;  3UPO A;  4H8R A;  4EUZ A;  1PI5 A;  3PR6 A;  1E4D A;  4JGQ A;  4KZ5 A;  5J8X A;  1CEF A;  1W8Y A;  4E3K A;  1Y4O A;  1YLZ A;  3NEC A;  5CGS A;  4XT2 A;  3NOT C;  1GSX A;  2E8J A;  4H6J A;  1TS7 A;  4IVK A;  4F94 A;  4JBF A;  2Z6C A;  1O07 A;  1OT6 A;  1W63 M;  3UPN A;  2VV6 A;  1NJ4 A;  3T1S A;  5FL3 A;  1V9Z A;  1YT4 A;  5AQB A;  4AFI A;  4DDY A;  1Q2P A;  2HDU A;  3HUM A;  4S2O A;  3CWF A;  4E6W A;  4EEU A;  4YWZ A;  3CZD A;  2WKQ A;  4OON A;  4KQR A;  1AXB A;  1SZV A;  1YMS A;  5FAQ A;  3OLO A;  1K0K A;  3SS4 A;  1FCN A;  4S2J A;  2OV5 A;  5J3W A;  5KSH A;  2Y59 A;  3IF5 A;  3H7W A;  4UA7 A;  5DVA A;  3PXP A;  3MFX A;  3E2L A;  3A3I A;  3VP0 A;  3FV7 A;  1T1A A;  1G28 A;  1YPR A;  1XGJ A;  5KSC A;  5GLC A;  4EQ1 A;  4N1H A;  1K57 C;  3EGX C;  1KDW A;  5DKL A;  1TS6 A;  3GDI A;  5HDC A;  4GN2 A;  4OOM A;  1JNU A;  4Y0T A;  5I94 A;  1AWI A;  4QY5 A;  1STZ A;  2ZC7 A;  1LI0 A;  4JF5 A;  3T4Q A;  2J7V A;  1GHM A;  1TDG A;  4OPY A;  3UY6 A;  5U47 A;  2OLU A;  4DKI A;  4I5S A;  5TGF A;  5E2E A;  1XJ6 A;  3DTI A;  2M7V A;  4ME4 A;  5IS1 A;  2DCF A;  4QY6 A;  3HL9 A;  4O0P A;  3A3F A;  2PHY A;  5DF9 A;  5FQI A;  1HD8 A;  1ONH A;  3U4L P;  3BJN A;  4C6Y A;  1PI4 A;  2XR0 A;  2XFS A;  3WRT A;  2JKT I;  3CUE A;  2P74 A;  2Y2O A;  2GZA A;  4PM6 A;  3O88 A;  4HJ4 A;  3GQZ A;  3S7P A;  3K2N A;  2PAV P;  1FOF A;  4B9O A;  2HJ9 C;  4MN7 A;  1PZP A;  2XQZ A;  1BUE A;  3Q07 A;  3DW0 A;  4IBR A;  1YSP A;  2B5R A;  2ZMF A;  4WLA A;  4OQI A;  3GSG A;  3LR3 A;  2VLG A;  3DWK A;  2WGW B;  3KYE A;  2UWX A;  2WKP A;  4L9F A;  5HWT A;  4BMW A;  2OSU A;  5FEG A;  4R23 A;  4QWO A;  3IBR A;  4WZ4 A;  1XGI A;  3B33 A;  1LSW A;  2EFU A;  5FDS A;  2V8C A;  4CLC E;  1ZHH B;  4KZ9 A;  4XT2 B;  4Y15 A;  4FSF A;  1XJ4 A;  4FH2 A;  4MBF A;  4OOY A;  4HH3 A;  3E98 A;  1L3L A;  4RX2 A;  2DMW A;  1U60 A;  4S2N C;  1IEL A;  4FOF A;  1X0O A;  1CJF A;  1L0D A;  4Y3I A;  2V1Z A;  5CTM A;  1YLP A;  2FZ0 A;  4HEF A;  4L9E A;  3UB5 P;  3DTM A;  2L0W A;  2W3F A;  3CMZ A;  1ES2 A;  3ZCZ A;  1DJC A;  1LL9 A;  3GRJ A;  4RX3 A;  4GD8 A;  2V20 A;  5KIZ A;  3HBR A;  3VMA A;  4HJ3 A;  3LEZ A;  2OOL A;  2VV7 A;  2XRN A;  4HES A;  4EBP A;  1VEU A;  2Y2H A;  1S67 L;  3T4T A;  4BJP A;  2YKH A;  3HLF A;  1OT9 A;  2J3W A;  4Y2F A;  3CPT A;  1PZO A;  3IX3 A;  1QMF A;  2H0Y A;  3ZG0 A;  5F82 A;  3IT9 A;  4R3B A;  2K31 A;  1IFQ A;  2PD7 A;  5EEC A;  1ESI A;  4Y13 A;  3UDF A;  5L2F A;  3L9K A;  4Y0O A;  5FAP A;  1N9N A;  1MPL A;  1JWP A;  5I5L A;  4Z9Q A;  4S2N A;  5FAS A;  3Q7V A;  1PW8 A;  1MC0 A;  3MXR A;  5A92 A;  1PWG A;  2JKR M;  1VM1 A;  4WF0 A;  4X25 A;  1DP8 A;  4HJ6 A;  5FQQ A;  1HVB A;  5CHJ A;  1KGE A;  2ZC6 B;  2B18 A;  1ERM A;  4GNU A;  3P01 A;  5HL6 A;  3FG8 A;  1ERQ A;  1YLJ A;  1YLW A;  4PM5 A;  2ZL1 B;  1XJ3 A;  3IWQ A;  4Q0I A;  3RTY A;  3LIC A;  5HAI A;  1JWZ A;  3OPL A;  1NZO A;  2OLV A;  2VGL M;  2A2L A;  1ZC2 A;  1S6R A;  2Y2L A;  3MF0 A;  3C8C A;  1P97 A;  1S66 L;  3ZG7 B;  1D1J A;  1ALQ A;  1P9W A;  2ZOH A;  3EOI A;  4UQI M;  3W4Q A;  3BEC A;  4P0M A;  4CQH A;  4I39 A;  1VQQ A;  2ZMV A;  1BYW A;  2V8F A;  2WKE A;  4LRZ E;  3IWO A;  4BQM A;  1G5U A;  2VGK A;  4WEL A;  2L1M A;  5DTK A;  5FQM A;  3WRZ A;  3PYP A;  2A24 B;  2HDS A;  3MBZ A;  3FKW A;  2J3T D;  4ARZ A;  4FUW A;  3NBL A;  1DJB A;  3LIA A;  4HNB A;  3NC8 A;  4HBU A;  3C5A A;  3VP2 A;  4JXW A;  4JKT A;  3N8R A;  3M6H A;  1SDE A;  3LY4 A;  1XKZ A;  2QJ7 A;  1I2S A;  3G31 A;  4S2P A;  1MWS A;  2NUP C;  3W2Z A;  3NIA A;  3ULF A;  3MKF A;  1BZA A;  1ODV A;  3G2Z A;  1SHV A;  5EE8 A;  4X56 A;  3UDX A;  5EVI B;  3RFB A;  3LIE A;  3PAG A;  3KSI A;  3MKE A;  3IF6 C;  1IYP A;  3H82 B;  4F3L B;  2ZJ9 A;  3VOZ A;  3B47 A;  3C4O A;  1W79 A;  3EGD C;  4HI4 A;  5HW3 A;  3QHY A;  4P6B A;  3VE4 A;  4RA7 A;  4RVA A;  3S1Y A;  2OAQ 1;  2R9X A;  3QP6 A;  1RP5 A;  5EFW A;  3IH9 A;  1OJG A;  4O01 A;  1TEM A;  4PM8 A;  2WKI A;  3UME A;  3BQ8 A;  1K4E A;  4R6L A;  4R1G A;  2H10 A;  1KE0 A;  1W8Q A;  4P6Z S;  4Q0H A;  1WYC A;  1K54 A;  3MMH A;  1VET B;  2BAS A;  3CJM A;  2GX5 A;  2Y2M A;  4PKY G;  3ZQ5 A;  3T1X A;  5GHZ A;  1DP9 A;  3ZFZ A;  1NYM A;  5HPI A;  1GA0 A;  3CPT B;  1YMX A;  1DJA A;  4QU3 A;  5CHM A;  5L07 A;  2Y2Q A;  2WZZ A;  5EVI D;  1KVL A;  5EOE A;  3TJZ C;  5DF7 A;  4OLG A;  2XLN A;  3VSK A;  4K0X A;  2HV1 A;  2J9O A;  2P04 A;  4C75 A;  5M19 A;  1ACF A;  4HH2 A;  3HUN A;  4PM9 A;  3V3S A;  3T12 B;  4LCM A;  1ESU A;  4JXV A;  1JWV A;  1S1Z A;  3R4K A;  4YFM A;  3O87 A;  4IED A;  4LGW A;  4UAA A;  1HTZ A;  4GD6 A;  5CXW A;  4ZRR A;  1FQG A;  3Q7Z A;  2D01 A;  4NXB A;  1ES3 A;  3LR0 A;  5GLB A;  3UB7 A;  1W7F A;  2WGW A;  3SZT A;  1LSV A;  4CJN A;  3WS4 A;  1PIO A;  3BFD A;  4KUK A;  4HP9 A;  4LPZ A;  3QP2 A;  2Z6D A;  1TDL A;  2ZQC A;  2EFX A;  2PRF A;  2KOI A;  4CLC A;  3Q1F A;  5EM0 A;  5HAR A;  3N7W A;  3OOV A;  3U2A A;  3ZVT A;  5HD5 A;  1N9L A;  3E4O A;  3UDI A;  3FC7 A;  1F5M A;  4EES A;  2HZ5 A;  3SH9 A;  4JGO A;  2J9P A;  1DRM A;  1KE4 A;  2L4R A;  2LB5 A;  4ARZ B;  4LRX C;  3BFE A;  1Y28 A;  1N9O A;  3BLS A;  3NDE A;  4OLD A;  2R78 A;  4BL3 A;  5G18 A;  1XFQ A;  2HDR A;  2G7U A;  3BFC A;  4C3Q A;  3IX4 A;  4I3J A;  1TS8 A;  2H28 A;  2Q0O A;  4PKY A;  5CEB A;  1N9B A;  2LB9 A;  4PM7 A;  2O0Y A;  3SOI A;  1H8Y A;  4MCW A;  4GS9 A;  1XA7 A;  3LGO A;  4IJG A;  4I3A A;  4O8G A;  1NLZ A;  5J4E A;  3S22 A;  3KSF A;  4WYY A;  2ZD8 A;  2RL3 A;  3W8K A;  2O9B A;  3CUE C;  4UHU A;  4X6T A;  2WAD A;  3T50 A;  3M2J A;  4QB8 A;  1NYY A;  1LLB A;  1PRQ A;  2VGJ A;  4EEP A;  3VSL A;  3T4S A;  3M6B A;  1PFL A;  5HX9 A;  3FPV A;  4X1L A;  1FR1 A;  4N1X A;  4EV4 A;  2K7S A;  3LIB A;  2ZMA A;  3UE1 A;  2GNX A;  2PU2 A;  3AGF A;  1ERO A;  2HF6 A;  1OME A;  4GW9 A;  3N8S A;  3HLB A;  5HL1 A;  4UEY A;  2PBD P;  5L09 A;  4Q0J A;  2ZL1 A;  4S2K A;  3R7W B;  1N4O A;  4Y7P A;  4RQ9 A;  2XD1 A;  3TSG A;  3NDG A;  3GEC A;  3LCE A;  2P08 A;  5JYP A;  2FFY A;  3OPH A;  4HP4 A;  2R9W A;  2WKH A;  1IYS A;  4S2M A;  3VP4 A;  3G32 A;  2C6W B;  1G6A A;  1CQA A;  3GV9 A;  3ZNT A;  3AGE A;  3QNC A;  3KYZ A;  2Y55 A;  2ZQ9 A;  1PNE A;  3F1P B;  5IHV A;  3D4F A;  3JVV A;  1UGU A;  3IH8 A;  3KYQ A;  5IU1 A;  2A24 A;  2BLS A;  2ZQD A;  4X55 A;  1YQS A;  2X71 A;  3RXW A;  3IS2 B;  1BUL A;  5G4Y A;  2PU4 A;  1MBL A;  3FKV A;  3KO6 A;  2WUQ A;  5GHY A;  3P98 A;  2PD8 A;  1F9I A;  4XUX A;  2W3E A;  4LV0 A;  3C4P A;  4MLL A;  3IHB A;  4X68 A;  3MXQ A;  1VHM A;  1H3Q A;  3PBQ A;  3MZF A;  5EVI A;  1OTI A;  5DTS A;  3MZE A;  4P85 A;  3K3C A;  4NXE A;  4CLC B;  3H82 A;  4F3L A;  4ETZ A;  2H0T A;  4NG2 A;  1EWZ A;  4EXO A;  3BFG A;  5F5Y A;  4XUZ A;  4LV1 A;  3UB6 A;  2EWV A;  2PYP A;  2IWD A;  1H5X A;  2QHK A;  3OPP A;  1S4R A;  4ESP A;  1IYQ A;  4WZ5 A;  1H8M A;  4NKP A;  4BBT A;  2V9A A;  3KSG A;  1BSG A;  4KG5 A;  3B3X A;  2PT7 A;  4X53 A;  3BFF A;  4GDB A;  3UE3 A;  2EWW A;  3DWZ A;  4HY8 A;  2I72 A;  1L0G A;  3ZG5 A;  2FFF B;  4II7 A;  1ZTU A;  3QP1 A;  3CHW P;  5L10 A;  4U0T A;  3BRM A;  4KG6 A;  1BLH A;  2I9V A;  3ZVW A;  5E43 A;  2PR6 A;  1VET A;  1SKF A;  5FI2 A;  2G2W A;  1O7E A;  3A0R A;  5AJG A;  2XSS A;  2KDK A;  3AGD A;  3OCN A;  4GS9 B;  1D7E A;  2XA7 S;  3C7U A;  3PAE A;  3P09 A;  1OTD A;  3O5Y A;  4LRY C;  2W3D A;  4Y5F A;  1OTB A;  1TD5 A;  1WYB A;  1G68 A;  4KUO A;  5HDD A;  1K55 A;  1GHP A;  1K4F A;  3QNB A;  2W3G A;  3ZDJ A;  4E04 A;  4CLC D;  4KQQ A;  2V0W A;  2X02 A;  4E6X A;  2RCX A;  2WYX A;  2YKF A;  1MY8 A;  2XGN A;  2XK1 A;  4R38 A;  3NY4 A;  1W63 Q;  3D72 A;  2VA0 A;  5CX7 A;  3SS3 A;  2EXA A;  1D06 A;  1UWN X;  3VOL A;  4R4R A;  1EI5 A;  2M1C A;  4ID4 A;  2V1A A;  1YLT A;  1A0K A;  3MQQ A;  4GCZ A;  4LV3 A;  5HAQ A;  2MJ6 A;  4GDN A;  4IBX A;  3BY8 A;  3EWK A;  3N6I A;  5IT5 A;  4WUJ A;  3OPR A;  1ONG A; 
#chains in the Genus database with same CATH homology
 4U0X A;  4ZJ1 A;  3TG9 A;  3CJM A;  4K0W A;  2Y2M A;  5GHZ A;  1AXB A;  1TVF A;  1YMS A;  5FAT A;  5FAQ A;  2WZX A;  1GA9 A;  3VFF A;  1K55 C;  3ZHH A;  4X69 A;  3WS2 A;  1NYM A;  3SS4 A;  3ZG8 B;  2HP5 A;  3ZFZ A;  4E3O A;  4KQO A;  1GA0 A;  5FSR A;  1FCN A;  2IWC A;  5D3O A;  3SH8 A;  1YMX A;  5CER A;  3NCK A;  4S2J A;  2OV5 A;  4UA9 A;  4WEJ A;  1DJA A;  5KSH A;  3G35 A;  2Y2J A;  1BLS A;  3IQA A;  4QU3 A;  5CHM A;  5EOO A;  4B4X A;  2Y59 A;  1FSW A;  4DRT A;  2Y2Q A;  2WAF A;  3IF5 A;  4UA7 A;  5DVA A;  3E2L A;  3O86 A;  2WZZ A;  5EVI D;  1KVL A;  4Y0U A;  1XA1 A;  5EOE A;  2HP6 A;  3A3I A;  2XH9 A;  5DF7 A;  3VP0 A;  3FV7 A;  4OLG A;  5EPH A;  4DE1 A;  2XLN A;  4JXS A;  3VSK A;  1KE3 A;  1XGJ A;  5KSC A;  5GLC A;  4K0X A;  1JTD A;  2DRW A;  4N1H A;  2Y2N A;  2J9O A;  2PBY A;  4O7D A;  4C75 A;  3ITB A;  4FD8 A;  5M19 A;  1ZKJ A;  1WE4 A;  4MBH A;  1XP4 A;  4PPR A;  2ZM2 A;  1K57 C;  1PYY A;  4P87 A;  4ZJ2 A;  4GOG A;  1QME A;  1ZG4 A;  4ZJ3 A;  3HUN A;  3VOY A;  3BM6 A;  4B88 A;  1NXY A;  1KDW A;  4E3J A;  4PM9 A;  3V3S A;  1RGY A;  2XEP A;  3HLE A;  4GN2 A;  3LO7 A;  4LCM A;  4OOM A;  5GHX A;  5A91 A;  4Y0T A;  3N8L A;  1ESU A;  4JXV A;  1JWV A;  3O3V A;  1KVM A;  3O87 A;  4IED A;  4YFM A;  5I94 A;  1K54 C;  3BYD A;  4LEN A;  4NET A;  4QY5 A;  4UAA A;  1HTZ A;  4GD6 A;  3N4I A;  5CXW A;  2ZC7 A;  3WS0 A;  1I5Q A;  1LI0 A;  4JF5 A;  5TFQ A;  2J7V A;  4EWF A;  1FQG A;  3WWX A;  4Q8I A;  3Q7Z A;  1GHM A;  5A93 A;  1TDG A;  3PBS A;  2Y91 A;  4OPY A;  3UY6 A;  5U47 A;  1ES3 A;  1FCM A;  1H8Z A;  3PBO A;  5GLB A;  2OLU A;  5GLA A;  1W7F A;  3MXS A;  3VP3 A;  2WGW A;  2X01 A;  2J8Y A;  1W5D A;  5CHU A;  3SS5 A;  3HVF A;  4HBT A;  5E2F A;  4DKI A;  4LCL A;  5TGF A;  5E2E A;  3UE0 A;  4CJN A;  3WS4 A;  1PIO A;  3BFD A;  1E3U D;  4R4S A;  1RGZ A;  1MKI A;  5CGX A;  2Y4A A;  2DCF A;  4QY6 A;  1K25 A;  3HL9 A;  1JVJ A;  2P9V A;  3A3F A;  3A3J A;  1Z6F A;  1TDL A;  4BLM A;  2ZQC A;  5DF9 A;  2EFX A;  5FQI A;  1HD8 A;  1ONH A;  1BLP A;  3Q1F A;  4C6Y A;  2QMI A;  2V2F F;  3HLC A;  1PI4 A;  4RYE A;  5HAR A;  2IWB A;  2XR0 A;  5FDH A;  1RCJ A;  2Z2M B;  5E2H A;  1YLY A;  2XFS A;  3N7W A;  3WRT A;  1M6K A;  3VP1 A;  3ZVT A;  2EX6 A;  2P74 A;  2XFT A;  1SCW A;  2Y2O A;  3HLW A;  1IEM A;  3V5M A;  4MNR A;  3TOI A;  4PM6 A;  4OPZ A;  3O88 A;  3UDI A;  3BEB A;  3GQZ A;  4WEK A;  3MZD A;  3SH9 A;  2ZM8 A;  1FOF A;  2J9P A;  1KE4 A;  5CTN A;  5JYO A;  4XXR A;  5CEC A;  5FA7 A;  3BFE A;  1KGF A;  3HLD A;  3BLS A;  1PZP A;  2Q9N A;  3NDE A;  4OLD A;  2XQZ A;  1BUE A;  3UNW A;  4DE3 A;  3Q07 A;  2HP9 A;  3DW0 A;  4IBR A;  5G18 A;  4BL3 A;  2HDR A;  3OZH A;  3BFC A;  3G34 A;  2JBF A;  3WS5 A;  4C3Q A;  4E3N A;  4QJG A;  2ZQA A;  2B5R A;  4OP5 A;  5CEB A;  4KZ4 A;  4OQI A;  1N9B A;  2ZM0 A;  3GSG A;  4PM7 A;  3UPP A;  5CED A;  3EQU A;  3SOI A;  1H8Y A;  3C7V A;  3SH7 A;  1K38 A;  3DWK A;  2WGW B;  2UWX A;  4M3K A;  1GCE A;  2OSU A;  1XA7 A;  3WS1 A;  1MWU A;  1LI9 A;  3OC2 A;  4R23 A;  5M1A A;  1S0W A;  4NK3 A;  3IHA A;  3HLG A;  1M40 A;  3FWL A;  3IXH A;  4OPR A;  4WZ4 A;  3S22 A;  1PWD A;  1XGI A;  4WYY A;  2ZD8 A;  2EFU A;  2RL3 A;  3W8K A;  2WAE A;  4KZ9 A;  2P9V B;  4UHU A;  1BLC A;  4OVD A;  4X6T A;  2HDQ A;  1K6S A;  2WAD A;  3G4P A;  4FSF A;  4A5R A;  3M2J A;  4QB8 A;  1NYY A;  1XX2 A;  4BEN A;  1LLB A;  2VGJ A;  1IYO A;  3FYZ A;  4FH2 A;  3VSL A;  4MBF A;  4OOY A;  4RX2 A;  1HZO A;  3M6B A;  3GMW A;  1U60 A;  1XPB A;  4S2N C;  5HX9 A;  1IEL A;  3IXD A;  3GTC A;  1FR1 A;  4ZAM A;  1L0D A;  3JYI A;  2V1Z A;  2CC1 A;  1YLP A;  1FSY A;  3IXG A;  1PW1 A;  3ITA A;  3PBT A;  4N1X A;  5CTM A;  4HEF A;  4EV4 A;  5FQ9 A;  2ZMA A;  3DTM A;  2EX2 A;  2Q9M A;  2XDM A;  4DDS A;  3UE1 A;  5KZH A;  2PU2 A;  4GZB A;  3AGF A;  3CMZ A;  4PMA A;  1ES2 A;  1NZU A;  3HRE A;  4L0L A;  3ZCZ A;  1DJC A;  1ERO A;  1LL9 A;  3GRJ A;  1OME A;  4JF4 A;  5DF8 A;  2EX8 A;  3N8S A;  3EQV A;  5FQJ A;  4RX3 A;  4GD8 A;  4OKP A;  3HLB A;  5HL1 A;  4CPK A;  1BTL A;  2V20 A;  1XXM A;  1KDS A;  3HBR A;  1FCO A;  1CK3 A;  3VMA A;  4QD4 A;  3LEZ A;  1NY0 A;  4HES A;  4S2K A;  1ZG6 A;  4EBP A;  4OQ0 A;  1N4O A;  4Y7P A;  2XD1 A;  2Y2H A;  3TSG A;  3NDG A;  3M2K A;  3LCE A;  3ZNY A;  4EQI A;  1CI8 A;  1CI9 A;  4BJP A;  3PTE A;  4N9K A;  3HLF A;  3G30 A;  5JYP A;  4QHC A;  4ZBE A;  2FFY A;  3OPH A;  1ES4 A;  1LL5 A;  2R9W A;  2WKH A;  1PZO A;  1ES5 A;  3UO9 A;  1GHI A;  1K56 D;  4DF6 A;  1IYS A;  2ZQ7 A;  3Q82 A;  4S2M A;  3VP4 A;  2ZC3 B;  3PBN A;  2WGI A;  2Y2G A;  3NI9 A;  4EBL A;  4OPQ A;  3G32 A;  4BD0 A;  1IKI A;  2C6W B;  2JC7 A;  2G2U A;  2JE5 A;  1G6A A;  1QMF A;  2H0Y A;  2EX9 A;  5F82 A;  3ZG0 A;  2GDN A;  5DTT A;  3IT9 A;  3GV9 A;  4R3B A;  3ZNT A;  3AGE A;  3QNC A;  2Y55 A;  5EEC A;  2ZQ9 A;  1ESI A;  4S2L A;  3G2Y A;  5M18 A;  1J9M A;  3UDF A;  5L2F A;  4Y0O A;  5E2G A;  4U3T A;  5FAP A;  1MPL A;  5IHV A;  1JWP A;  3D4F A;  5GL9 A;  3I7J A;  4JPM A;  4B4Z A;  4Z9Q A;  4S2N A;  4KZB A;  3Q7V A;  4DE2 A;  5FAS A;  4LV2 A;  2ZC5 B;  3IH8 A;  5EVL A;  3Q81 A;  4D2O A;  4R0Q A;  1PW8 A;  4JXG A;  4BL2 A;  3MXR A;  1PWC A;  3ZGA B;  4JF6 A;  4WMC A;  2BLS A;  1KGG A;  1NRF A;  2H5S A;  4WM9 A;  5CRF A;  2ZQD A;  4JLF A;  4X55 A;  1YQS A;  2X71 A;  5A90 A;  3RXW A;  5A92 A;  4MBK A;  1PWG A;  5AQ9 A;  2Y2K A;  1BUL A;  5FI7 A;  1VM1 A;  2EXB A;  2PU4 A;  4KZ8 A;  4R3J A;  3CG5 A;  5FQQ A;  1HVB A;  1MBL A;  1DY6 A;  5CHJ A;  4YIN A;  3FKV A;  1KGE A;  2ZC6 B;  2WUQ A;  2Y2P A;  3IWI A;  1K6R A;  4OQG A;  5GHY A;  4FCF A;  3P98 A;  1ERM A;  2Z2L B;  4GNU A;  5F1F A;  1MWT A;  4E3I A;  1ERQ A;  2XF3 A;  1YLJ A;  3ISG A;  1YLW A;  4GKU A;  4XUX A;  4PM5 A;  4LV0 A;  4ZTK A;  3IWQ A;  3C4P A;  3OCL A;  1BT5 A;  3A3E A;  4MLL A;  5HAI A;  1JWZ A;  5HAP A;  3OPL A;  1L0F A;  1NZO A;  3IHB A;  4X68 A;  2OLV A;  3VFH A;  2E8I A;  3PBQ A;  3MZF A;  4GB7 A;  5EVI A;  1I2W A;  5DTS A;  1ZC2 A;  3MZE A;  4P85 A;  1S6R A;  2Y2L A;  3A3D A;  3BLM A;  2JCH A;  2QPN A;  3ZG7 B;  2H0T A;  4OH0 A;  1ALQ A;  1EWZ A;  3BFG A;  4MEZ A;  4WBG A;  3W4Q A;  3BEC A;  4K91 A;  4P0M A;  2BG1 A;  4XUZ A;  4LV1 A;  2A3U A;  4KZ3 A;  1VQQ A;  2WK0 A;  3UN7 A;  1LHY A;  2IWD A;  1CEG A;  5GLD A;  3IF6 A;  2WKE A;  1H5X A;  3IWO A;  1IKG A;  4BQM A;  5CGW A;  2VGK A;  4KEN B;  4WEL A;  4OOL A;  3OPP A;  5DTK A;  5FQM A;  1IYQ A;  3WRZ A;  4WZ5 A;  3Q7V B;  2ZC4 B;  1L0E A;  4DE0 A;  1BSG A;  4KZ7 A;  4KG5 A;  3B3X A;  3RXX A;  4N92 A;  4X53 A;  3BFF A;  3IXB A;  4GDB A;  3UE3 A;  4OQH A;  4S2I A;  2HDS A;  3MBZ A;  2HPB A;  3DWZ A;  3FKW A;  2I72 A;  1L0G A;  3ZG5 A;  3ZG9 B;  1MWR A;  2FFF B;  1DJB A;  1SDN A;  3NBL A;  1Y54 A;  3NC8 A;  4U0T A;  5FQK A;  4HBU A;  2DNS A;  3BRM A;  3C5A A;  5F1G A;  4ZDX A;  4KG6 A;  1BLH A;  5AQ7 A;  5AQA A;  4JXW A;  5FI6 A;  3VP2 A;  4JKT A;  3N8R A;  3ZVW A;  5HFO A;  5E43 A;  5FI2 A;  1SKF A;  4E3L A;  2G2W A;  1O7E A;  2XD5 A;  3V50 A;  4OP8 A;  3M6H A;  1SDE A;  3PBR A;  3LY4 A;  1XKZ A;  1C3B A;  5F83 A;  3S4X A;  3AGD A;  3OCN A;  1I2S A;  3G31 A;  5EVI C;  3E2K A;  4S2P A;  1MWS A;  4DXB A;  1E3U A;  3PAE A;  3C7U A;  3NIA A;  1L2S A;  5FAO A;  3P09 A;  5TR7 A;  4EBN A;  3V3R A;  2ZQ8 A;  3MKF A;  5EUA A;  3MFD A;  3UPO A;  1JTG A;  3FZC A;  1BZA A;  4H8R A;  1Q2Q A;  1WYB A;  1G68 A;  4KZ6 A;  1K56 A;  3G2Z A;  4EUZ A;  1PI5 A;  1K55 A;  1SHV A;  5EE8 A;  1E4D A;  1GHP A;  1K4F A;  4X56 A;  5EVI B;  3UDX A;  3QNB A;  4KZ5 A;  3LY3 A;  5J8X A;  3PAG A;  1CEF A;  1MXO A;  2C5W B;  1W8Y A;  1E25 A;  3ZDJ A;  3MKE A;  4KQQ A;  4DXC A;  4E3K A;  3IF6 C;  1YLZ A;  1IYP A;  2X02 A;  4E6X A;  2RCX A;  2WYX A;  5CGS A;  1MY8 A;  2XGN A;  2ZJ9 A;  3VOZ A;  4E3M A;  4BD1 A;  3C4O A;  1W79 A;  4F94 A;  4IVK A;  4WZ5 C;  3QHY A;  5HW3 A;  2XK1 A;  4JBF A;  4P6B A;  5KMW A;  1O07 A;  1FR6 A;  3NY4 A;  4KG2 A;  3UPN A;  3IF6 B;  4RA7 A;  3SS3 A;  2EXA A;  4RVA A;  1NJ4 A;  3S1Y A;  2R9X A;  1RP5 A;  3HUO A;  3IH9 A;  2QZ6 A;  4UA6 A;  3GVB A;  3GR2 A;  3W4P A;  4R4R A;  1K57 A;  1TEM A;  1YT4 A;  2ZLY A;  4PM8 A;  3RJU A;  2A49 A;  4FH4 A;  1EI5 A;  5AQB A;  3V39 A;  2WKI A;  4DDY A;  4ID4 A;  1Q2P A;  2HDU A;  4WMC D;  1K4E A;  3HUM A;  4N9L A;  1YLT A;  4S2O A;  4IVI A;  4E6W A;  3W4O A;  4LV3 A;  5BOH A;  5HAQ A;  4R1G A;  4GDN A;  2H10 A;  2WGV A;  1YM1 A;  3CZD A;  4KZA A;  4IBX A;  1KE0 A;  3N6I A;  1W8Q A;  4OON A;  2Y2I A;  1WYC A;  1K54 A;  3OPR A;  4KQR A;  1ONG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...