3P7NA

Crystal structure of light activated transcription factor el222 from erythrobacter litoralis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
191
Chain Sequence
PAQWVLDLIEASPIASVVSDPRLADNPLIAINQAFTDLTGYSEEECVGRNCRFLAGSGTEPWLTDKIRQGVREHKPVLVEILNYKKDGTPFRNAVLVAPIYDDDDELLYFLGSQVEVGMARRERAAEMLKTLSPRQLEVTTLVASGLRNKEVAARLGLSEKTVKMHRGLVMEKLNLKTSADLVRIAVEAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase
publication title Structural basis of photosensitivity in a bacterial light-oxygen-voltage/helix-turn-helix (LOV-HTH) DNA-binding protein.
pubmed doi rcsb
source organism Erythrobacter litoralis
molecule tags Dna binding protein
total genus 62
structure length 191
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p7nA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p7nA01
3VFZA 1S66L 3ZQ5A 4IPAA 5LGNA 2VXZA 3DFGA 4R3AA 2V1UA 5A8BA 4NXFA 2JN7A 1R36A 3FM3A 1ZHFA 3L09A 4O5VA 4WL9A 3LIEA 2X4HA 2XAFA 3GFJA 2ISYA 4L9EA 3FWEA 2H09A 2QWSA 1MJBA 1CF7B 5CJ9A 1P0ZA 4WX9A 1STZA 2HS5A 1TS8A 2PQ8A 2KDKA 4ESFA 1L3LA 4KMUX 2UXNA 3K0LA 2Z33A 1TW2A 1T19A 2ZKZA 1IRFA 3M7GA 2HOEA 1YQAA 4HP4A 2BBYA 2XKPA 2X0LA 4RB0A 4EVIA 3KZZA 2V79A 4HW0A 2AS5F 1OJGA 2V9VA 4R6LA 1KGSA 2QJ7A 1XGOA 2IJLA 2O3FA 1MD0A 5CVVA 3IRQA 2V1DA 2OWJA 5JHUA 1ON2A 2A6EF 1XMAA 3D5LA 1LSWA 1P4WA 3ERED 1FP2A 3EQLF 2H27A 3JAMZ 2ZCWA 2LF8A 5HLHA 4AIJA 1MZBA 4M6YA 2HTJA 4KUOA 3QPHA 3E4PA 3M9AA 1JGSA 2EV5A 2CQKA 4EM0B 2IP2A 2G9WA 4UV9A 4U88A 2A24B 3ICYA 5DKLA 4L0ZB 1S7OA 2L4AA 5FO5A 1F5TA 3GFIA 5LHGA 1WWXA 1Z6TA 5H20A 4WF0A 4HNBA 3GEZA 1TS6A 2F2EA 3FXQA 3L00A 2OZ6A 2A07F 2K7SA 1PP7U 2FNAA 2VEAA 4S05A 3F1NB 4LK1F 1P4AA 1IN8A 4EJTA 2KX6A 5E1WA 3F8FA 3TOAA 2QBYB 1TS7A 1OR7A 1KQ8A 2K4BA 3ULQB 3F72A 1CGPA 4U0VA 1HSJA 2PFBA 1U3EM 4ON0A 3P9CA 4I38A 4U7BA 3KZYA 3F8NA 4LG0B 2GA1A 3W6JB 2GIVA 5LHHA 3TDUC 4B9OA 3LAJA 2UZKA 3BJAA 3ZN0A 2DPUA 3M8EA 4HAMA 2MC3A 5CYVA 2DQRA 1FYKA 1BJAA 1KA8A 3GF2A 3UMEA 1BM9A 1G6NA 1D3YA 3HTSB 4BBTA 4KICA 4XLNF 2KIUA 4LD5A 3SZPA 4H0EA 1EW0A 1KYWA 5ICEA 3F8MA 3HOTA 2OQRA 3E4QA 1CF7A 1ZAOA 5G4ZA 2BGCA 5E8IA 2NRAC 3K2ZA 4MTEA 4ZYHA 2O61A 3LYXA 1A04A 1S29A 2DI3A 2K4JA 3C18A 2ACJA 3CAXA 3LWFA 3MCZA 5AONA 3MAJA 1P4XA 3Q5FA 3UB6A 1Z91A 3JTGA 1HSTA 5EFWA 5BS6A 4M73A 1V9YA 4ZYEA 3MR0A 3TOBA 1LL8A 2E1NA 2A69F 2DPDA 1KOUA 2AXLA 3LIFA 4B8XA 3M1EA 3ZMDA 1XFQA 4HH2A 3VE3A 4KN4X 1BC8C 1UHWA 2F5EA 2IA2A 4RGRA 1B9NA 4WCGA 3SFZA 3EEHA 3FMRA 1G3WA 1B4AA 3KP5A 2VT2A 3HTUA 3KP7A 4ZH4F 5HSQA 1XSDA 4MEYF 1B6AA 2PBIA 1I1SA 1XD7A 3F8BA 2CYYA 4AWXB 3AAFA 4HF2A 4Y15A 4UUVA 3TDZC 1J2XA 3RI4A 2RQPA 2OQGA 2PYRA 3CUQC 1Z1DA 2QKPA 4WUJA 2PHYA 2VC1A 3HRSA 2PLYA 4NB5A 2HFHA 1J5YA 1F98A 3GDIA 4YFNF 1G3SA 1V9ZA 1RUNA 2RVCA 2P7CB 2D01A 3DPTA 3WGGA 4LRZE 1BOAA 1YW7A 3K3CA 1DP8A 4YG2F 3F1NA 1P2FA 3S2WA 4JGOA 3V8JA 4PKYG 1RNLA 2PN6A 2JPCA 2XAHA 4CXFA 2QBYA 3U2RA 2VBWA 4BHPA 3LA3A 2WKRA 2F5FA 4I98B 2EA4A 2O0YA 2STWA 3J80Z 3BPXA 5ILUA 4YFXF 4KN7X 2Z6DA 3KP4A 4JQFA 2QLZA 1QBJA 4EJUA 2NNYA 4ETSA 3BDDA 1HKQA 1HW2A 2FA5A 1YO5C 1O3RA 3A0RA 4RAYA 1ONVA 2QQBA 2IW5A 3I58A 1T1AA 4DJ3A 3V7RA 1KU7A 1SFXA 2QZ8A 1ZH5A 4RGXA 2L4RA 3ZPLA 4DQ2A 3F1OB 2Z9OA 2K86A 1X3UA 4WXDA 1BIBA 2WKQA 3VODA 3LA2A 4GCZA 2QM3A 3IHUA 3GWZA 4KYWA 2ZMEB 3RKYA 4I0AA 5ICCA 2FBIA 4LB5A 5AVFA 2W85A 3KP6A 3E4OA 5DD8A 4LGWA 3KE2A 5FD6A 1R22A 3UMDA 1DP6A 4OMZA 5LRSA 4WLAA 2ADUA 2FEZA 3F21A 3C8CA 2PJPA 3TO6A 2L1MA 4M72A 1OT9A 1MJAA 1TW3A 5E1XA 5BOXA 3UE6A 4QWQA 5ED4A 3WU1B 1XGMA 1MDMB 3CLOA 2MLKA 1W5SA 3A0SA 1FLIA 1WI9A 4Z2YA 4BYYA 2PYPA 2DU9A 3CO7C 1GXPA 2XV4S 4A6DA 2E7WA 1EV7A 1USTA 4JGPA 4MGRA 1XJ6A 3ECHA 3R60A 3F6OA 2VV8A 1EH8A 2F5DA 5TBMB 4L0YB 3K1PA 2UXXA 2L3DA 4L9NA 2CGPA 3HRTA 2FMYA 2COMA 4M74A 5L3FA 3O3KA 3Q9SA 2R7DA 4LLNA 4MHGA 2J5PA 4KIGA 1OTAA 1ZGAA 3GXOA 1V3FA 2LDUA 3BJOA 3WTVC 3GECA 4F3LB 5LGUA 1XJ2A 1JXSA 3HHHA 5J8FA 3GLXA 1YLFA 3ZQ7A 1V4RA 1OMIA 3QAHA 4LK0F 1GHCA 3WU0A 3UB8A 2QVOA 5L3DA 3IRRA 4EERA 1XJ3A 5ICFA 5F5YA 3CUOA 3BROA 2DT5A 4I01A 5D5XB 2XUBA 4I3JA 1R1UA 2J5OA 1QPMA 4IHSA 4KT5C 4HLYA 3GVAA 2IA0A 5IU1A 3VE4A 2VT3A 4EV0A 5G4YA 2DFIA 1XSVA 2FF4A 1T38A 5E20A 5FGMA 1TTYA 5HDNA 2XAGA 3DPLC 1DP9A 1FSEA 4CO8A 2YKHA 1K79A 4YFKF 3QU3A 1WRJA 2Z3YA 3QRFF 2YKFA 5L3EA 2FBHA 3RKXA 2MLGA 1YTYA 1T1CA 4ENMA 2EFQA 3HIFA 2L0WA 4E70A 1DP7P 3BJ6A 3I54A 4A0ZA 5EEHA 3GX4X 5DUKA 3HUGA 1FYMA 1XDSA 4XBFA 4XSXF 2NNNA 4HZFA 4BHBA 1ZGJA 3F1OA 2H28A 2VOPA 5J4EA 4N9HA 3ABUA 3JSOA 2ZMEA 5BPDA 2NAZA 1OT6A 5FB2A 4FHTA 3E3VA 3VEPA 3U1DA 4JK1X 2VV7A 2A5YB 1LSVA 2ZXJA 2M45A 3HSEA 4M9SA 4CICA 1JHHA 2TDXA 5F64A 2WC2A 2ZBBA 4G7HF 5D5WB 3K69A 3LI9A 3IWFA 1QZYA 4FX0A 3V8KA 2XIGA 3E5QA 2JT1A 1MDMA 2MH2A 3GW2A 4WXCA 2E1CA 2L54A 4Y17A 1XN7A 1I6XA 1HKSA 4A2UA 2UWMA 3I0TA 5HS8A 4EXOA 2MA3A 1W7PD 2V0WA 3JSPA 2YX4A 4HDVA 5TBMA 3QU6A 2K02A 1EH7A 2P5LC 4M9XA 4MEXF 1OTBA 4PDKA 2QJ5A 4GYGA 1R23A 4HDUA 1BYWA 4F3LA 5TJJA 4R70A 1RZ4A 1FBUA 3MWMA 1Y28A 1GXQA 1BBYA 2R78A 1RI7A 2XGXA 3V4GA 5DUIA 1MJ9A 2PI0A 4ENNA 2K7LA 1OTEA 2YX7A 1ZRFA 3IKTA 2JRTA 3OLOA 4EJWA 3E6BA 3ELKA 2CMNA 2Z6CA 2V6CA 1FP1D 1R1TA 4OIRF 2EJRA 2MBFA 1U78A 1VB6A 3DQVC 2EV6A 2XVCA 1R5GA 2V0UA 1R7JA 4G6QA 5L3CA 2STTA 5BPIA 1UCRA 3WG9A 4BAYA 4HOIA 2QHKA 5IT9K 4LLOB 3WE3A 1S67L 3NHQA 3EYYA 2YPRA 3E5UA 3TO7A 4PGHA 3RH8B 5LEKA 2ZNZA 3R0AA 2BEOA 2INWA 3WTSC 2A6HF 1YW8A 4R38A 1B9MA 3FZVA 4YWZA 3RYPA 4AIHA 4HA8A 1P92A 3BP8A 5H6RA 5DV5A 3GFLA 5HDKA 1G4DA 1P6RA 4RS8A 3LIBA 4I02A 3RYRA 2EWNA 2XAQA 1USSA 3TGNA 3KETA 4RB3C 3B33A 5JR3A 4LLLA 4G7OF 1TS0A 5HOOA 4MQ9F 4CZZA 4A5MA 1WQ2A 2VODA 2H6CA 1B1BA 1PUEE 1JNUA 1OTIA 3KX0X 2R7FA 3RPQA 1XJ4A 5DJUA 2EK5A 1WA9A 4L9FA 4AD9A 2EV0A 2KIMA 1SMYF 2VLGA 3LAPA 4XRFA 3WODF 4HJ3A 1FBQA 3RIRA 4RGUA 1LNWA 4I0BA 4P5OA 4I5SA 4BQAA 4OU0A 4BNCA 3WTTC 2EA9A 3ZMVA 3ZMUA 2V1BA 5K5QA 1IUYA 2P7JA 3HRUA 4G9YA 4PCQA 1REPC 4M4XA 1YS6A 3SXYA 1ZN2A 1J59A 2PD8A 1D5VA 4IRIA 2ZFWA 2W24A 2HZTA 1HQCA 1LJ9A 5K1YA 4KNYA 2RNJA 3C1DA 3GUDA 4RQ9A 2LSOA 2ZBKA 5L3GA 5LGTA 5JVTA 2O8XA 3KP3A 4XSZF 1YG2A 3F3XA 3FXUA 1T18A 4I3AA 2XRNA 5F68A 4HY8A 5IT9Z 1R58A 4HQMA 4EM2A 1XGSA 2FE3A 2Y48A 1Z05A 3FMSA 3JW4A 3EDPA 3K1NA 5HDCA 1YYVA 3OV8A 4WN5A 4KIBA 3ZMZA 2P5KA 4N9IA 3EWKA 2PR5A 1LDDA 5L3BA 5D8KB 4EGYA 2VONA 4Q5SF 5CLSA 5BQTA 1GVJA 3FHZA 2P4WA 1W7PB 4WK8F 1ODDA 4IHTA 2EFNA 5F1RA 1UFMA 2H6BA 2ZO4A 2YR2A 1S3JA 3CTAA 5F6AA 5DCFA 3TKYA 3O6BB 4N0BA 4UVAA 1P97A 3BWGA 4A6EA 2W27A 2HYGD 2MH9A 2WWYA 3RTRA 2IA1A 1ODVA 1S8NA 3LFKA 3P9KA 3T0YA 4TV7A 5E8GA 4BXUA 4P96A 2D45A 3PQJA 5DYMA 1T6SA 3IL2A 1XFNA 2A3SA 1S4SA 1K6OA 1N9LA 3FC7A 3VOLA 4NXEA 2Y0MA 2P6TA 4RAZA 3DP7A 5FFXA 5HWWA 2HKXA 2OBPA 5D5VB 2L4MA 4P9UA 2K27A 1DRMA 5AIPA 3LIDA 4HP9A 3FF5A 2YSRA 1HW1A 1TLHB 2Y75A 4OINF 3DF8A 3E5XA 4HHDA 2GA2A 4GCVA 1FSHA 3UB7A 3NOPC 4EQQA 4RB2C 3COAC 3HOSA 4KUMA 5J6XA 3MFKA 1K7AA 2DTRA 3O2PE 4BBVA 1DDNA 2C6YA 2L01A 4O6JA 2RGVA 1SD6A 2BYVE 4P9FA 1AWCA 1J0RA 1L0OC 3HHGA 3K1MA 4L9GA 4PGGA 1J9IA 3WTUC 2CFXA 2VV6A 2EFWA 5H6QA 3G73A 1IAWA 2ESNA 3I71A 1LEBA 2FNPA 2ESHA 3RPUA 2VE8A 4UVCA 4ENKA 5HDSA 2HQNA 4Y13A 2IRFG 5F6FA 3E97A 1OTDA 5K5OA 3KLNA 2CWEA 4EJVA 3T1BA 3H3ZA 2GZWA 3I5UA 4XT2B 3GO5A 5LBQA 2G7UA 3B02A 2NYXA 3J81K 2HTSA 3NRVA 1J7KA 3LA7A 3QP6A 1LDJA 2EFPA 4MQVA 2PMHA 4B09A 1VTNC 4G94A 4KDPA 2Z99A 3I59B 3IBRA 1QQIA 4LJZF 3DKWA 4K2EA 3REOA 3ROUA 1IRGA 1SD4A 3A0VA 1WSUA 2O6GE 1F4KA 5CVJA 5HD3A 1ZRDA 1LEAA 2W57A 4OOIA 3KCCA 4HJ4A 3HJKA 1IN4A 2R3SA 5CVRA 1QGPA 4M6XA 1UWNX 4O3MA 2BASA 2P6SA 3RKWA 3GZ6A 2QENA 3IS2B 3F6VA 4BBUA 4EW7A 2BV6A 2FU4A 2G7HA 1ZREA 1W7PA 2ZOHA 1U5TB 1FYLA 4EJOA 2V1XA 3BOQA 5DJTA 3WGIA 2HQRA 1U6GA 2FOKA 3WGHA 2VN2A 3V7CA 4U7DA 2XKOA 1SD5A 4L9TA 3GZ5A 1FNNA 1BIAA 1DPUA 5D6FA 1MGTA 4GGGA 2OOLA 1KQ0A 2JHEA 3C3WA 2W25A 2DK8A 4HOBA 2IVMA 2DW4A 1I5ZA 4HX8A 1KYZA 3HSRA 2PD7A 1H9GA 3SZTA 4MTDA 3N97A 4ASNA 1ZG5A 2O03A 4PZJA 1B59A 1O3SA 5D5UB 1TQPA 4A12A 2LKPA 2XROA 1UWPX 1XB4A 1Z6RA 3BPVA 1LB2A 3D0SA 4IVNA 4DNCA 3MZHA 3J81Z 1LQ1A 3SHFA 4RB1A 2D1VA 1Y0UA 1N9OA 3MFXA 1NWZA 1FWZA 2VBZA 4P55A 5JI6A 2ZJ2A 4BHCA 2FMLA 2PEXA 4FT8A 2HR3A 1Q1HA 1IN7A 2LF7A 1HXDA 3KEOA 2IPQX 1S4RA 2FBKA 2QQ9A 4HQAA 3NOUC 5E1ZB 2W84A 4IRHA 3E6CC 2FXAA 4RGSA 4G6DA 4WF2A 4A0XA 1BN5A 4XT2A 2D1HA 1F9IA 1O3TA 1FY7A 3RTYA 4EEUA 2KJCA 3GFMA 4HF1A 2OD5A 2DQLA 3M8FA 5HLGA 1D8KA 4S04A 1W4MA 1DUXC 3BZ6A 3I59A 3PHYA 4Q48A 2PDRA 3BWLA 1EH6A 5LRRA 3T50A 4IF4A 2DO7A 4NQWA 4LPZA 4R79A 3H82B 4L9JA 3JTHA 3H7WB 5HDDA 4U0YA 4HV6A 4KUKA 4LRXC 3LQQA 3ZN1A 2GXBA 3FMQA 4HBLA 3GYHX 4ZZDA 5IT3A 5I5LA 3LIAA 1G3TA 2FQ3A 2VC0A 1GSWA 2Q2EA 3G3ZA 2EFOA 4L5JA 4OIQF 4ESJA 1KU3A 4UHTA 2RKHA 3DXJF 5HLIA 3L7WA 2OWHA 2F5CA 2KIFA 3IS2A 1U5TC 3CUQB 2CG4A 5KK1A 5TRDA 4ZZLA 1Z9CA 2V1AA 1ULYA 1O57A 1U5TA 2JTVA 3UB9A 1D06A 2DBBA 3EETA 4UXNA 4WWCA 2RN7A 1KQ9A 5FLXK 2RV8A 1LT0A 5LHIA 1RUOA 3ISPA 1OKRA 2I9VA 3HSFA 2ZOIA 3P9IA 5LLQA 2E7XA 1SMTA 1YFHA 3KEQA 1IF1A 1IW7F 2CW0F 1YW9A 2FSWA 3TQNA 2HGCA 2JPBA 4AIKA 1I1GA 5LEJA 4GYIA 2NS0A 2M30A 1FT9A 4ZYGA 2BE5F 3G6OA 2HWVA 2OU2A 2M8EA 3LUQA 1RIOH 3ZP5A 5DCMB 4A5NA 5JFRA 3C7JA 4JGRA 3IKVA 5HZHA 5HDGA 4HYEA 6PAXA 3F1PB 3B73A 2CSOA 4DJ2A 3BY9A 4MNUA 2WKPA 4HJ6A 5CVUA 2WTEA 1QO0D 3KP2A 4ZYDA 5DKKA 2V9AA 3CWFA 5ILVA 3ULFA 1SFEA 3QOPA 2P8TA 3H92A 1T1BA 3U9GA 4GHIB 3E6MA 4OIOF 1XGNA 4GS9B 1O3QA 1FBSA 4ENJA 4R1HA 2EB7A 3J80K 1XCBA 1ZLKA 5FD5A 3BY6A 1UGUA 4EESA 2EA2A 1UHMA 1TQMA 4JGQA 1BI2A 3ABTA 2GXGA 4KQDA 1JHFA 3L9FA 2HEOA 4LB6B 3K9TA 1XSXA 1OYWA 1ZYRF 3DV8A 2OAZA 4CHUA 4I7HA 2RDPA 3I53A 5IS1A 2Q8KA 1F9NA 1O7LA 3TO9A 4PKYA 2PR6A 3NQOA 3WTYC 1ON1A 4M71A 1TNTA 1D8JA 3WTZA 3LQRA 1W5TA 3FXRA 2LNBA 3Q9VA 4U0WA 3LSTA 3KFWX 4A0YA 3NEUA 3R61A 1IXRC 1H9TA 3H82A 5HS9A 4JBAA 4UNOA 3H7WA 4MN6A 4NXGA 2KJBA 2HDCA 5FLXZ 2YU3A 4HI4A 5DD4A 3WTXC 2DK5A 1ZLJA 1G3YA 4HQEA 5E17F 4H6JB 1HKTA 4Q4ZF 1ZARA 3ECOA 2WV0A 5K5RA 2A24A 3IC7A 1ZG1A 1DPRA 2GAUA 5CVIA 4I09A 2PG4A 4HF0A 3CUQA 4MN5A 5AIQA 1R5HA 1T2KA 5HWVA 1XDUA 4I39A 3ZMSA 5J7EA 5AVEA 1FPQA 2XASA 3J7AO 3H9WA 3HRMA 3N4MA 1IXSB 4R8HA 2M5WA 1U8RA 5A2QK 3FM5A 4LFUA 3VB2A 2Q0OA 1G28A 2B02A 1ZG3A 2CO5A 5FFZA 4LLGF 4K08A 2IT0A 3MJQA 5ILSA 5BMZA 3NOTC 3H3UA 4LMYA 4HIAA 3NJAA 1K78B 3F22A 2D02A 1GSVA 5DCMA 4GW9A 1TBXA 2ZNYA 4HV5A 1SFUA 3FX3A 3F1PA 4YIIA 2D2WA 1SAXA 2HYFA 5HWTA 4QLCU 3E6DA 2HV1A 4LG0A 2GJ3A 5KVRA 2DLLA 1C0WA 2GWRA 4OMYA 3RDIA 5DDGA 3RJPA 3CJNA 4IJAA 3I64A 1YS7A 5D8LB 4KMFA 1HBXG 4IRGA 3BY8A 4GHIA 3F23A 1XCVA 3K3DA 4HX4A 4GS9A 1QZZA 1D7EA 3P7NA 2KKOA 5KIZA 4CGZA 1GSXA 4CDGA 1MZUA 1OPCA 3L2CA 1S7AA 2M87A 4BH9A 4L9VA 1MKMA 4CYDA 2FRHA 3EYIA 2QYOA 1UB9A 2VE9A 1O7FA 4LRYC 5DEQA 1J75A 4GO1A 1TQIA 1X0OA 3T8TA 3SQNA 1E2XA 2GQQA 2RC4A 3T5XA 3R6SA 3PFIA 4EGZA 1BC7C 3D72A 1QNTA 4D0PA 3IWZA 1OYIA 1R00A 1IZ1A 2P5VA 4E04A 1WKMA 1HW5A 2XHKA 2ELHA 3WTWC 2VBYA 5J3WA 1T98A 1YIOA 1R1VA 2L02A 5D6EA 1KU2A 2QWWA 3VOEA 2J80A 1FX7A 1ZRCA 1U2WA 3R4KA 3MEXA 1PDNC 2OZUA 3W6KB 2W0NA 4EETB 2PMUA 3MXQA 1AOYA 2Z5UA 1Z7UA 4F7ZA 3PYPA 4GXOA 3I4PA 3OOPA 1E17A 1KU9A 5HD5A 4L18B 2KRFA 4ESBA 4HLXA 5D4RA 1IN6A 1LVAA 2VBXA 5EEGA 1S6LA 3DEUA 4HX7A 2H94A 5A2QZ 3PQKA 5F69A 4NHJA 1BI1A 1I27A 4H6JA 3QPTA 5HVQC 3CO6C 4FX4A 2OA4A 4M9ZA 4HH3A 4UV8A 3ZMTA 1NHAA 3MQ0A 5HS7A 2P7VB 2QUFA 3KLOA 4NXBA 2XAJA 3LI8A 2M1CA 4WXHA 4XLPF 4L5IA 2MD5A 3C2WA 1S1ZA 1SD7A 3F8CA 1FZPB 3JAMK 3QP5A 4KIFA 4EMSA 1FC3A 5E18F 4OIPF 3T8RA 1LDKB 1LSXA 1JE8A 3ML6A 1BI0A 4EM1A 3R0JA 2A68F 3CDHA 1S1YA 2ISZA 1FOKA 1IXCA 1OJ5A 2HKOA 2QQAA 4EEPA 4AVPA 1K78A 1T0FA 4I2OA 4Q47A 2DAOA 3EUHA 2M1BA 2JSCA 4UVBA 1BI3A 3MZYA 1PP8F 1OYYA 3V8LA 4IXAA 4KA4A 3V7SA 1IN5A 5J8CA 4KFCA 2VOOA 4EQ1A 5ERIA 3HJIA 2B0LA 1F1ZA 1T39A 4I3IA 5ICGA 1H0MA 3HYIA 2A61A 3SW1A 1XMKA 3LICA 1TNSA 2ETHA 3FG8A 4G8XA 5D4SA 3WE2A 2JZYA 4YIFA 4G7ZF 3MQQA 1N9NA 3MQOA
chains in the Genus database with same CATH superfamily
2FJ1A 1ERDA 3Q7VB 3VFZA 5EOOA 1S66L 3HUNA 3S1RJ 3K4BA 2R7QA 4IPAA 1CI9A 4O01A 3ZQ5A 3EEAA 4EBLA 5LGNA 2X9DA 2VXZA 3DFGA 3OIQA 2BY0A 4R3AA 2OLUA 3D72A 2LKSA 2R93J 2V1UA 4ARZA 5A8BA 2CUFA 2DMWA 4NXFA 4XNFA 2JN7A 1R36A 3FM3A 1ZHFA 1BR1A 1RPWA 3K4MA 3IHBA 3L09A 2DXIA 1LFUP 2X6XA 4O5VA 3L2UA 1N9BA 3LIEA 2X4HA 4WL9A 3HZJA 2XAFA 3GFJA 1ZQ3P 2ISYA 4L9EA 2AXTC 3FK7A 3W2ZA 3FWEA 4C3IJ 2LY9A 3ABMH 5EYRA 2E2JJ 2G2UA 4IEJA 3D4FA 3HG9A 2H09A 2K5CA 1MJBA 2QWSA 1CF7B 2ZC4B 1Z67A 1SANA 5CJ9A 1SHVA 2PT7A 1P0ZA 2ZL1A 4FH2A 4XOTA 4ZTKA 4WX9A 1STZA 2MW8A 1QMEA 2HS5A 1TS8A 2JJ7A 2PQ8A 3LSPA 4RLQA 3G31A 1ENHA 2KDKA 4ESFA 4B1RA 1L3LA 4AYBA 5FKNA 4KMUX 2UXNA 3K0LA 2XGNA 4IHVA 2Z33A 2KZGA 3WS2A 1OISA 1TW2A 3HOXJ 5HODA 5IOYA 1T19A 4WEKA 2ZKZA 2HOAA 1IRFA 1MW7A 3M7GA 2HOEA 1YQAA 4HP4A 1KE3A 2X6WA 4B4ZA 1PWDA 1WJCA 2BBYA 2XKPA 2X0LA 4RB0A 4EVIA 1WYBA 5FASA 2DA5A 4DZPA 3KZZA 3BQZA 2V79A 3FISA 4HW0A 2AS5F 5F1GA 3CCUI 3TP0A 4EATA 2NXNB 1ITYA 1OJGA 4BENA 2V9VA 4R6LA 1OCRH 1WJBA 1KGSA 2QJ7A 3Q82A 5A92A 3JRBA 2JKTM 3TL4X 1PZPA 3CF5F 1S5LC 1XGOA 2IJLA 2IS6A 1LL5A 2ZC3B 2O3FA 2O9CA 1H8ZA 1MD0A 5CVVA 5FI6A 1IYPA 4YFMA 3IRQA 1EI5A 2V1DA 2OWJA 5JHUA 4DKIA 1ON2A 3DTIA 1K4EA 1PNEA 2A6EF 3FV7A 1M40A 1QHHD 3O8GA 4BE0A 1XMAA 5CTMA 3D5LA 2CUJA 1LSWA 1P4WA 4P0MA 3ERED 1KDSA 5EGOB 1FP2A 3BEBA 1W5DA 5M3MJ 3HUOA 3EQLF 2H27A 3BFFA 3JAMZ 2DA4A 5AQBA 5KZHA 2ZCWA 3TW8A 2LF8A 5HLHA 3PBOA 1RR8C 2ZQDA 4AIJA 3F9KA 1F36A 4MIMA 2Y2HA 1MZBA 4ZJZA 4QWOA 4M6YA 5TR7A 4FTHA 2GOXB 2HTJA 1WHUA 5C4JJ 1AWIA 2HQ5A 4QD4A 3A3FA 2G0EA 3F0CA 3QPHA 3E4PA 4KUOA 1ERQA 4OONA 1PWCA 2PMZN 5FDHA 3UE0A 1ESUA 4DXCA 4JXGA 3CJMA 3VDXA 4ANJA 3M9AA 3DWKA 1JGSA 3MMHA 2EV5A 1YSQA 2XAUA 2CQKA 4EM0B 2IP2A 2G9WA 3PO2J 1M6KA 2LB5A 2H1KA 4UV9A 3PBRA 4U88A 4MO7A 5FRNA 2R7ZJ 1NLYA 2A24B 3ICYA 5DKLA 2TRTA 4KZBA 4L0ZB 1S7OA 2J7VA 2W1RA 2L4AA 5FO5A 3LR4A 1F5TA 1BLSA 3GFIA 2Y2IA 3LMMA 5J8XA 5LHGA 3LSIA 3Q07A 1L0FA 1L0DA 3E7LA 4LOCA 3S7OA 3BRMA 1WWXA 3MF0A 2DYSH 1Z6TA 1GHIA 5MC7A 1YHQI 5H20A 4WF0A 2QGUA 1LHYA 2Y2KA 4HNBA 1OQYA 1VQ8I 1YMSA 2XFSA 5EJCA 3VSLA 2WGWA 3QPLA 3GEZA 4BKXA 5F83A 3M1CA 5CXWA 2EH3A 3OY9A 3BZCA 4E3KA 1TS6A 2DT6A 2F2EA 5GHYA 3FXQA 2R5ZA 3R7WB 5IOZA 2ZC2A 3L00A 2OZ6A 1IYQA 4PHTA 2A07F 3NECA 2IWDA 2LB9A 2K7SA 1PP7U 3ZGKA 2FNAA 4GN2A 1OR7C 2VEAA 4S05A 1E25A 3F1NB 4RVAA 4LK1F 1TL8A 3BR6A 1P4AA 1IN8A 3OYGA 2MABA 3JRHA 4EJTA 1YLPA 2KX6A 4J00A 4NNJA 4KITB 5E1WA 3DTKA 4LENA 2R7TA 5C4XJ 3F8FA 3TOAA 2QBYB 3QYFA 1TS7A 1OR7A 1YX5A 2EIKH 2YUSA 1LL9A 1FR1A 3PM1A 3ZQGA 3NWSA 3ZOBA 3ZQQA 1KQ8A 2K4BA 3D3OA 2LG4A 3QPSA 1HLVA 3S2DJ 4S2NA 2Y69H 3ULQB 2HOTA 5M1AA 3F72A 4IL6C 2KT0A 3BR3A 4XLHA 1CGPA 9ANTA 4U0VA 1HSJA 1RR7A 2PFBA 1U3EM 4ON0A 3AKZA 3BW6A 2UUZA 1K6RA 4G6TB 2WAQA 3P9CA 3HOZJ 1ES2A 4I38A 4U7BA 3KZYA 2OTLI 1I3AA 4ZTJA 2E60A 5GPAA 1U9OA 3F8NA 4LG0B 5EUAA 2GA1A 3W6JB 2L1MA 2P9VB 1Y54A 5FAQA 2IAIA 3LL7A 3BG9A 2QZ6A 1OMEA 2GIVA 5DF8A 2DMUA 5LHHA 3TDUC 1YLZA 2WK0A 4B9OA 3VYTB 3SDBA 3LAJA 1YOVB 2UZKA 4BE1A 3BJAA 3ZN0A 1MSEC 2DPUA 3CQZJ 1G2HA 1JTGA 1JI8A 3M8EA 4HAMA 2O9AA 2ZQ7A 3Q7VA 1YIJI 1N25A 2MC3A 5CYVA 1GHMA 2VQGA 3PBTA 2DQRA 3EUKL 1MNEA 2CRGA 3HOYJ 1CK3A 2XA7M 1FYKA 1ZR2A 3T4JA 1BJAA 2JA2A 1KA8A 3RQIA 3HKZN 2BW3B 3GF2A 2MJ6A 5D3OA 2AVXA 1BM9A 3UMEA 1G6NA 1D3YA 1XG1A 2IGMA 3HTSB 4BBTA 4KICA 4BUPA 4XLNF 2KIUA 4D7NA 4LD5A 3SZPA 4H0EA 5J1YA 1KYWA 5ICEA 1JKRC 3F8MA 1EW0A 3CCEI 3HOTA 3CP2A 5M18A 2OQRA 3IXGA 3E4QA 1CF7A 3KSGA 5HPIA 1ZAOA 5G4ZA 3UY6A 4OOLA 2BGCA 5E8IA 4D60A 2NRAC 3K2ZA 4MTEA 4ZYHA 1GHPA 2HDUA 2O61A 2DODA 3LYXA 2WGIA 3WU2C 1A04A 1S29A 2DI3A 2K4JA 3C18A 3W2WA 2VQCA 4F52A 2DA6A 2ACJA 1A31A 2WY7Q 3LWFA 3MCZA 5AONA 3DAVA 2FX0A 3MAJA 5CEDA 1P4XA 4S2MA 3Q5FA 4BACA 3UB6A 1Z91A 3OR1C 3JTGA 1HSTA 3EQUA 5EFWA 5BS6A 4M73A 2ME6A 1H89C 1V9YA 5IT5A 4WMCA 1IRZA 2DDAA 4ZYEA 2Y9ZA 1JKOC 3MR0A 3TOBA 4U3TA 2VX8A 2TCTA 2IWBA 4M3EA 4E3IA 2Q1ZB 1O7EA 1LL8A 2E1NA 2A69F 2DPDA 1TF1A 1FCOA 1KOUA 4R1GA 2AXLA 3JCUC 3LIFA 4B8XA 3OSFA 3ZCOA 3M1EA 3IHAA 1RCJA 2MFZA 5FEFA 1H8MA 4AU7A 4ABZA 1R71A 2P04A 5HX9A 4KT6A 1E3HA 2M0MA 3C38A 2J9PA 2Y2QA 4ZJ3A 1ESIA 1FIKA 1D1BA 3ZMDA 1BJZA 4EEFG 1G5UA 1RETA 1XFQA 2KRCA 3S15J 5GLDA 3PJRA 5GLCA 4HH2A 3VE3A 4KN4X 1BC8C 1UHWA 4XIDA 2F5EA 2V1ZA 2IA2A 3T4SA 4RGRA 4KZ4A 1B9NA 3HJEA 1YKDA 1ZGWA 3BQ8A 5EGOA 1PI5A 4E7ZA 1V55H 4WCGA 1O07A 2GZAA 3SFZA 3MKLA 1ONGA 3RJUA 3EEHA 4LV2A 3FMRA 3FPVA 4V2FA 4B44A 2QKMB 4NC7A 1G3WA 1B4AA 3KP5A 4BXFA 1TC3C 2L7MP 2VT2A 2K31A 3HTUA 4S2KA 3W4OA 3KP7A 4B4CA 4ZH4F 2CV1A 1KGGA 5HSQA 1XSDA 2B63J 4MEYF 3FXMA 1B6AA 3AG3H 4Y52J 3CCMI 2PBIA 1I1SA 1QVTA 1QZEA 1XD7A 3HM5A 2Y2NA 2EBIA 3F8BA 2CYYA 4AWXB 3AAFA 2XD1A 3CMMA 2D5VA 4HF2A 4Y15A 3NI9A 4UUVA 4BJPA 3DU5A 3TDZC 3V39A 1J2XA 1F5MA 2K3FA 3RI4A 4H8RA 2P08A 3BC8A 2RQPA 2OQGA 4E6KG 2PYRA 2H0TA 3CUQC 4II2A 4UB6C 1Z1DA 2QKPA 3DEWA 4WUJA 2PHYA 2VC1A 3HRSA 2IGKA 3DBAA 3CMYA 1ZC2A 1K83J 2PLYA 2QSFX 1NRFA 4NETA 4QPQA 5CGSA 4NB5A 2HFHA 2PBDP 4XLAA 1J5YA 3JREA 1F98A 3X2QH 3OPHA 3GDIA 4YFNF 2QYBA 4DBQA 3G32A 1G3SA 3E2KA 3KPHA 4O7DA 4MCWA 3CAXA 2DA2A 5GADJ 1V9ZA 4AYBN 2RVCA 1RUNA 2R7OA 4UY8I 4PUSA 2P7CB 1WPKA 3DPTA 2D01A 2P81A 1RC9A 2BVLA 4ITVA 3WGGA 4IBXA 3CDIA 1YLWA 5FATA 2XLNA 1HZOA 2EZKA 2MGQA 3CJTB 4M3BA 2LBFB 2FZ0A 4LRZE 1IV6A 4A3LJ 3R7WA 1BOAA 1K6SA 1YW7A 1J09A 1JGGA 2XB0X 4GD6A 3H5AA 1ZG6A 1T08B 4F91B 2I72A 5GP9A 2LY2A 4YG2F 1DP8A 1P2FA 5B66C 3F1NA 3S2WA 4JGOA 3OCLA 3EUAA 3V8JA 4PKYG 4FTXA 5CEBA 1RNLA 3OYMA 2PN6A 2JPCA 3HLEA 4XUZA 2XAHA 4CXFA 2QBYA 5FEGA 2FH5A 1CEGA 3U2RA 1T56A 2VBWA 2W3GA 3SS4A 3S1QJ 3B6AA 2M4KA 4E7LA 4MLLA 3Q81A 4BHPA 5EVEA 5LFAA 5JYOA 3QP1A 3LA3A 2WKRA 2F5FA 3Q0VA 4I98B 3E2LA 2EA4A 4XKCA 3S3NA 2O0YA 2STWA 3J80Z 3BPXA 5ILUA 2B9SA 3W8KA 4YFXF 3WHBA 4F3QA 1X1PA 4KN7X 4D5FA 1IFQA 2Z6DA 2ZC5B 3KP4A 4JQFA 5CQEA 4Y3IA 2QLZA 4RBOA 2WZXA 1QBJA 4WMCD 4AVZA 4QHCA 4EJUA 5KSHA 3QWLA 2NNYA 3QHYA 4ETSA 3BDDA 4NK3A 3IWIA 1GV2A 1HKQA 1YITI 3J7AY 4KZ9A 3PBSA 4LV1A 5DTTA 1HW2A 1WE4A 1FJLA 2FA5A 1YO5C 2P9VA 3IWQA 4P6BA 1W8YA 3V5MA 1V5EA 1O3RA 3A0RA 4CLCD 3OYDA 2OPTA 2BY3A 3IWOA 4RAYA 1ONVA 1PZOA 2QQBA 2IW5A 2H8RA 3I58A 5B1AH 1HC8A 4DN0A 1T1AA 4DJ3A 2ELJA 3HUGB 5EZGA 2OAP1 3G71I 3FDYA 3V7RA 1KU7A 4DZJA 3SJMA 1SFXA 3LY3A 2QZ8A 1ZH5A 2NS7A 3BR2A 1XC5A 3BG5A 4RGXA 2L4RA 3KO6A 3ZPLA 1V5GA 2NVYJ 4DQ2A 3F1OB 2Z9OA 2K86A 1X3UA 4OVDA 2B7EA 2BW3A 2IXSA 4WXDA 3ZVTA 1BIBA 2WKQA 5KAFC 3V50A 3OS1A 1YPRA 3VODA 3V3SA 3WRTA 3LA2A 2E2IJ 4PM5A 4GCZA 2BY1A 2QM3A 3IHUA 2R0QC 3GWZA 4KYWA 2ZMEB 2JRMA 3RKYA 4WZ5C 4I0AA 4OP5A 5ICCA 3KSIA 2BXZA 2M2EA 2FBIA 3OYHA 4HRIA 4LB5A 4XRSG 1MMGA 1X19A 2VKSA 5AVFA 1SCWA 2W85A 3H0GJ 4JX5A 3IH2A 1KGEA 3KP6A 3B47A 3E4OA 4W1UA 4II3A 4CYCB 5DD8A 1CJFA 2E36A 2ZMVA 4WZ5A 4LGWA 3KE2A 4BEHB 4J01A 4GRIA 5FD6A 1O4XA 4DXBA 1R22A 1MMAA 1DP6A 3UMDA 2W1OA 4S2LA 2Y8HA 4JLFA 1E3OC 2P74A 4OMZA 3H36A 5LRSA 1I50J 4WLAA 2ADUA 2FEZA 3F21A 2JE5A 3C8CA 3SS3A 1TVFA 2JWTA 3TO6A 2PJPA 1K55C 1WH5A 1NYYA 1UMQA 3QQAA 1R4MB 4M72A 1OT9A 2VGLS 1MJAA 2KRHA 4AUXA 3UB5P 4F3LB 4F94A 1TW3A 5E1XA 1ACFA 5BOXA 3UE6A 4QWQA 5ED4A 2X6OA 3WU1B 1K55A 4RA2A 2H0YA 1XGMA 1MDMB 2BY2A 3BYDA 5FAPA 2J3TC 3CLOA 2DCEA 5K5BA 3LR0A 2MLKA 1UJ8A 2DNSA 1W5SA 3A0SA 4PM8A 4RM3A 1WI9A 4Z2YA 4BYYA 1I6HJ 1FLIA 4OQGA 5EVIA 2PYPA 1AHDP 2DU9A 4N92A 3CO7C 4OPYA 1GXPA 2XV4S 4C30A 4A6DA 3JRFA 1R4NB 5FLMJ 2JKTI 2EX9A 4XLCA 5E3LA 2JVHA 3MBZA 3QYEA 2KDZA 2HDSA 2E7WA 4CZCA 3FZCA 4FASD 1EV7A 2ZD8A 1USTA 1Y1VJ 2IGNA 4MGRA 4JGPA 1YLTA 1XJ6A 3ECHA 3IX4A 3OYNA 3R60A 3F6OA 2VV8A 1EH8A 3LEQA 2F5DA 4GZBA 5TBMB 4NKPA 2BLSA 2JUGA 4L0YB 3K1PA 3E0YA 2JN6A 2LK2A 2UXXA 2R9XA 2L3DA 4L9NA 2CGPA 2VZWA 1LFPA 2KDOA 3HRTA 3GRJA 2FMYA 1LI9A 2FOWA 2COMA 2KPMA 4M74A 1NZUA 5L3FA 3AGDA 4M3FA 5CQGA 3DPUA 3O3KA 3Q9SA 3P98A 3C2BA 3CD6I 2R7DA 5F0CA 2WUQA 5FQQA 4ZTFA 4LLNA 1YM1A 4MHGA 4S2NC 1RKWA 2J5PA 1PIOA 4KIGA 2PRFA 1OTAA 3RKQA 1ZGAA 3GXOA 4XMYA 1V3FA 4DOZA 4IZZA 2LDUA 2WAFA 3BJOA 3WTVC 3TP3A 1PI4A 2ZC6B 3OIOA 5LGUA 1R49A 1XJ2A 1JXSA 3GECA 3HHHA 5J8FA 4MBHA 3GLXA 4A3JJ 5FDSA 3U1KA 4Y7PA 1YLFA 1RGZA 3LSHA 1MWSA 3CUEA 3A3EA 3ZQ7A 4NBQA 1V4RA 1OMIA 3QAHA 3A01A 1WCMJ 4PPRA 3OL3A 4LK0F 1GHCA 4IOCF 1R9TJ 2M8GX 2KQRA 3WU0A 1D0YA 2QVOA 3UB8A 3RXWA 5L3DA 3IRRA 2NVXJ 1XJ3A 3CJRB 3GSGA 5DTSA 4EERA 3S1NJ 5ICFA 4UUTA 5F5YA 5FJ8J 3CUOA 1JUMA 3BROA 4DJAA 2V2FF 1PW1A 3A3DA 2OCCH 2VKVA 1TZLA 1ETYA 2LBFA 3CCVI 3C4PA 2VK3A 2DT5A 3U4LP 4I01A 5L09A 4B93A 4MBFA 5D5XB 2XUBA 3CZ6A 2HPBA 4I3JA 1R1UA 2J5OA 3TOIA 1QPMA 4IHSA 1PWGA 4KT5C 1OCZH 2X48A 3HGGA 3C30A 4HLYA 3GVAA 1BUEA 1K4TA 2IA0A 4IHQA 2PX9A 5IU1A 3VE4A 2VT3A 1W7FA 4EV0A 2A2LA 1DU0A 5G4YA 2DMQA 3N8LA 2DFIA 2R7VA 1XSVA 2FF4A 1T38A 3GV9A 5E20A 3T4OA 5FGMA 1TTYA 4CCOA 2XAGA 5HDNA 2HOSA 1SVOA 3DPLC 1DP9A 3AG4H 1ALQA 4XR6A 4LITA 2DMPA 2CC1A 1FSEA 3WHCA 1LFBA 1LLBA 4Q0IA 5FKLA 2H5SA 4CO8A 2YKHA 3MZDA 2ZMAA 2Z2SB 1K79A 4YFKF 4C2UA 2E71A 3QU3A 1WRJA 2Z3YA 4XQFA 3QRFF 3S14J 2HGVA 3C7VA 3CITA 2YKFA 4QB8A 5L3EA 1FSWA 2FBHA 3RKXA 2MLGA 5C44J 3CPTB 4X0GA 4XM3A 1YTYA 3DBRB 4XORA 1T1CA 3HREA 2QA4I 4ENMA 3S7NA 2EFQA 3HIFA 4UB8C 2L0WA 3GBGA 4E70A 1DP7P 1ES3A 2VPLA 3RPUD 3BJ6A 1G8XA 3I54A 4CCNA 1YJWI 3BLMA 4C3QA 4A0ZA 5EEHA 5E2GA 3GX4X 5DUKA 3CCYA 5EVID 3HUGA 4PJLA 2ZLYA 3TSGA 2Y4AA 2JA5J 2Y2GA 1FYMA 1XDSA 4ZC3A 5M5YJ 1D0ZA 4XBFA 1VQOI 1U9NA 3ZG9B 3RSNA 1IELA 1MC0A 4XSXF 5GTHC 4BL0B 2EFUA 3G30A 2DFFA 4QTRA 3CZDA 2NNNA 4HZFA 4BHBA 1ZGJA 1K38A 4UHUA 5HNFA 3L9KA 1Y0NA 3F1OA 4UUSB 2H28A 4KZ5A 2VOPA 4GD8A 3JPUA 4DYRA 3FKWA 3HLBA 2L7ZA 2ZMEC 4D5CA 2QEXI 3LY4A 3OPRA 2H1LA 5J4EA 4N9HA 1K0KA 3ABUA 3SZGA 1ZR4A 2NUTC 5DFYA 3W3CA 5L07A 2XR0A 3JSOA 1ORKA 4U87A 2ZMEA 5HAQA 3FIWA 5BPDA 2NAZA 3BFDA 1OT6A 2ZB9A 5FB2A 3QP4A 4FHTA 4IQ4A 3PUFA 2M3AA 3E3VA 3VEPA 3U1DA 4JK1X 2VV7A 1VF9A 2A5YB 3UKGA 1LSVA 4G3KA 2WBMA 4U0XA 2ZXJA 4CYCA 2HU9A 2M45A 3TBIA 3HSEA 3WG7H 4M9SA 4CICA 4BEHA 3A03A 2X6YA 2DJNA 1E4DA 4C2TA 2NVUB 1JHHA 4JP0A 4LIVA 4QIWN 2XD5A 2TDXA 1ERMA 3G2BA 3BTCA 5F64A 2WC2A 3PNYA 1SKOA 1T95A 1Q2QA 2ZBBA 2W48A 2KIQA 2R4GA 4G7HF 1A0KA 5I94A 5D5WB 3ZQLA 1DJAA 3K69A 1UG2A 2LR8A 3UDIA 3LI9A 3IWFA 3CMZA 1BW6A 3ASOH 1QZYA 1XKZA 5EE8A 3JRDA 2EPFA 3UE3A 3I7JA 4FX0A 2XQZA 3V8KA 2XIGA 3E5QA 3M6BA 3ESWB 2JT1A 5GHXA 1U8BA 4FETA 3CC2I 1SZVA 4QY5A 4AIDA 5EEAA 1MDMA 1W63M 5FKKA 2MH2A 1BR4A 3GW2A 2IS1A 3B42A 1JJ8C 4WXCA 4CLCB 4BBRJ 2L54A 2E1CA 3NDEA 3H9JA 4Y17A 4IUKA 2C5WB 1XN7A 1BOBA 4HPQA 4JPMA 3FBNB 4DYCA 1YJ9I 1I6XA 1HKSA 4A2UA 2HVRA 2UWMA 4JYKA 3I0TA 5HS8A 5TFQA 4E4HA 1KVMA 4EXOA 2MA3A 4BQMA 3S7PA 2KP6A 1W7PD 1SEUA 2V0WA 3JSPA 2DN0A 3CP8A 3GZNB 3SYTA 1VM1A 1TWGJ 3GTLJ 4LV0A 2YX4A 4HDVA 5TBMA 3BR5A 1Y8QB 5E2HA 1HOMA 1S6RA 3LSGA 3P09A 4BBSJ 4F55A 3VOZA 3L1PA 4XONA 4HSRA 5F08A 2OAQ1 3L2WA 1ZKJA 3UO9A 3QU6A 4K0XA 5CTNA 3SH7A 3TJZC 2A49A 1QPIA 2HDRA 1FOWA 2J3WA 2E5ZA 2K02A 2K9QA 1EH7A 2E8IA 5CHJA 2P5LC 5DM6F 4M9XA 4BJTA 2KZVA 3MVPA 5J4VA 3MKWB 3M6HA 3Q0WA 1D0XA 1K56D 4MEXF 1OTBA 1ZK8A 4PDKA 4KZ8A 1JTYA 3K3CA 4KZ6A 2QJ5A 4OPZA 1SFKA 1ZG4A 2LOOA 2ZSIB 4XKVA 4GYGA 1R23A 2Y31A 4HDUA 3S16J 1EKEA 1BYWA 2R9WA 4F3LA 5TJJA 4R70A 3NWTA 3GTGJ 4QY6A 1RZ4A 1GUUA 4PFOA 4Q8IA 1FBUA 3MWMA 2K3PA 1GXQA 1Y28A 4D7MA 1BW5A 1P7JA 1BBYA 2R78A 1RI7A 2A6TA 2XGXA 3V4GA 3ZR8X 5DUIA 1MJ9A 1J9MA 4XL9A 2PI0A 4ENNA 1MMNA 4WYYA 2K7LA 4X6TA 2ELKA 1OTEA 2YX7A 3DWZA 3MMYB 1ZRFA 3U2AA 5AQ9A 2ICWG 4P87A 1RESA 2M7UA 3IKTA 2JRTA 3S3OA 3KYEA 4EWFA 5TGTA 2ZMFA 3OLOA 3WS1A 4EJWA 3E6BA 3ELKA 1QRYA 2CMNA 4RX2A 2Z6CA 1SVLA 2V6CA 1FP1D 1K4SA 4A5RA 2J8YA 4X69A 1R1TA 4OIRF 2ME0A 2XEPA 1FMWA 2EJRA 3GTMJ 4E6XA 2MBFA 1U78A 1VB6A 1E3PA 5DTDA 2R7WA 3DQVC 4JF5A 3T1SA 2EV6A 4V19K 4GB7A 4ME4A 4MDZA 2XVCA 2VKHA 1KDWA 2V8FA 1GLNA 4X55A 3T4QA 3ZG0A 1R5GA 3CDLA 2EZHA 4FE4A 2V0UA 1R7JA 4ZYAA 4G6QA 5L3CA 5L8MA 2STTA 1QVUA 5BPIA 2XA7S 5AJGA 1UCRA 1IKGA 1JKQC 3CC7I 2HI3A 1HA8A 2DMTA 3WG9A 2L7FP 4BAYA 3HVFA 4HOIA 2F48A 4CUGA 2GIZA 2VUMJ 3HL2A 2QHKA 5FQMA 5IT9K 1FSYA 1DGWY 1VQMI 4LLOB 4E3LA 5FROA 4YNRA 2Y2ZA 4KG2A 3K4JA 2GDNA 3ZNYA 3WE3A 1S67L 4IKFA 3NHQA 4X53A 3EYYA 4X56A 2YPRA 1VI0A 2ZM2A 5AQAA 3E5UA 3CPTA 3OS2A 3CCJI 4OOYA 3OWTA 3TO7A 1WH7A 4PGHA 3RH8B 2BTFP 2V1NA 5LEKA 1BLHA 2ZNZA 4PM9A 5FI2A 3R0AA 2BEOA 2INWA 3WTSC 2A6HF 1YW8A 3G4SI 4R38A 1B9MA 3FZVA 3CCSI 1VQ9I 1Z7LA 2NOGA 1VQQA 4OOMA 4YWZA 4RLFA 3W2AA 4EBNA 3BLYA 5JLXA 3RYPA 5IP7J 4AIHA 1F2KA 4DGWB 4HA8A 4GJ4A 1P92A 3OSGA 4PSWA 2FQ4A 5EG0B 2ACGA 3BG6A 3BP8A 1Y39A 1N4OA 2HJ9C 3IQAA 4OPQA 5H6RA 5DV5A 3GFLA 5KSCA 5HDKA 3OYJA 2XDVA 1G4DA 1P6RA 2JSPA 2JA7J 1I2WA 4C6YA 2F4MB 4UQIM 4RS8A 3LIBA 4I02A 3RYRA 3JR9A 2EWNA 5FKOA 1IO2A 2XAQA 1USSA 3TGNA 4UUSA 4RB3C 3PSFA 3KETA 1MMSA 3B33A 5JR3A 3EQVA 1I2SA 4LLLA 4G7OF 1TWAJ 1TS0A 5HOOA 4XUXA 4MQ9F 1HD8A 4CZZA 2JVGA 3HLDA 3WS0A 4A5MA 1WQ2A 2VODA 4Q0HA 2H6CA 1B1BA 3J7ZI 1UHSA 2QKLB 1PUEE 1JNUA 3T1QB 1MIJA 3G35A 3M3YJ 5E43A 5K7FA 1ES5A 1OTIA 3KX0X 2R7FA 1NG6A 2K85A 3RPQA 1W0TA 5F82A 3FHNA 1MY8A 3OR2C 1XJ4A 1WJFA 2VJIA 3IH3A 5DJUA 3T1XA 2EK5A 1RKTA 1VQLI 3OC2A 4FQGA 1WA9A 1GA0A 4AD9A 4L9FA 2EV0A 2KIMA 2LTPA 3W4QA 3SH9A 1SMYF 2VLGA 1W8QA 2QMIA 3LAPA 4XRFA 3WODF 3GR2A 4BS9A 4HJ3A 3IF5A 4CH7A 1NG7A 4CLCE 3ZQHA 3NDGA 4KZ3A 1FBQA 3OOUA 2R92J 3RIRA 4RGUA 1S0WA 3BFEA 4ZRRA 5EOEA 1LNWA 4I0BA 4PSXA 4AFIA 1WJEA 2XF7A 1K4FA 4P5OA 4CLCC 4UA9A 4I5SA 2L9VA 3JRGA 4BQAA 5KAIC 5HLTA 1Y6IA 4OU0A 1GT0C 1NRJA 4BNCA 2V9KA 2UWXA 3TMOA 3A3JA 4R0QA 2EXBA 1XA7A 3WTTC 4CLCA 2EA9A 3ZMVA 3ZMUA 2V1BA 3NARA 5K5QA 2IGOA 3GMEA 1IUYA 3BG3A 4EBPA 2O9BA 2HZ5A 5EVIB 1H3QA 2P7JA 3HUMA 4R4SA 3HRUA 3ZVWA 4G9YA 1CEFA 4IJGA 3JYIA 4PCQA 1REPC 2LFBA 4M4XA 1YS6A 4F92B 4WELA 2CUZA 2HP5A 5A91A 2DMNA 3SXYA 2ZQ8A 2DFEA 2WKHA 4CCKA 4JF6A 2R7RA 3RQ4A 4A69C 1ZN2A 2XGCA 1Z09A 4U0TA 1J59A 4OLDA 2PD8A 1D5VA 2R7UA 3DWLE 4KQQA 1KONA 1S9HA 4IRIA 4EV4A 5KMWA 3OYEA 3O88A 2ZFWA 2W24A 4KQRA 4UEYA 5CHMA 2HZTA 1MWTA 1HQCA 1LJ9A 1NTCA 5K1YA 3M07A 2LVSA 2V20A 1KE4A 5AQ7A 1IJWC 1MBGA 2XC7A 4KNYA 2WKEA 3K4NA 1YT4A 3NBLA 2DYRH 4LCMA 2HVQA 5CKTA 2DDBA 2RNJA 3PFYA 4LCLA 3C1DA 1E0EA 3GUDA 1HF0A 3MZFA 4RQ9A 2LSOA 1VEUB 2ZBKA 1IOUA 5L3GA 5LGTA 3C2GA 2H8WA 5JVTA 3MKEA 4Y0UA 3ZG5A 2O8XA 4RAFA 3UN7A 3KP3A 2JKRM 4RDUA 3CJQB 1DY6A 4XSZF 1MKIA 1YG2A 4HNUA 3JRAA 3F3XA 3GTQJ 2HDQA 4KZ7A 5CECA 3FXUA 4MLOA 1T18A 4Y4RA 4I3AA 4IEDA 3T4LA 2DRWA 2XRNA 5F68A 3S3MA 4A3CJ 1PW8A 1ZHHB 5IT9Z 2OSUA 1S7EA 1R58A 1G6AA 4HY8A 5F1FA 4Z6YA 4HQMA 4EM2A 2BG1A 2EX8A 1XGSA 3M8JA 3QYBA 1PVEA 2FE3A 2XPVA 2N8GA 3A01B 1X3ZB 2Y48A 1Z05A 1LI0A 3FMSA 5C5KA 2LC2A 4ZDLA 3JW4A 4GDNA 3EDPA 3K1NA 3SH8A 3BT9A 5HDCA 1JT6A 1YYVA 3OV8A 4WN5A 4ID4A 3UR3C 1OFCX 4KIBA 4BWIA 3ZMZA 4KZAA 1N75A 2M0CA 2P5KA 2KISA 5DVAA 2W1TB 3NULA 3OMYA 4N9IA 3EWKA 2BVMA 2PR5A 1OJLA 1LDDA 5L3BA 5D8KB 3LCEA 1KE0A 4EGYA 4FH4A 4QU3A 4PFPA 2VONA 4Q5SF 5CLSA 3RZDJ 2V9PA 4K0WA 1P9QC 5BQTA 5IY5H 3JRCA 1GVJA 2WA0A 2P4WA 3FHZA 3ABKH 1W7PB 2Y2LA 4WK8F 4FSFA 1ODDA 4IHTA 2DOAA 5LBRA 1XX5A 4PJ0C 2EFNA 4Y7NJ 5F1RA 2Q9NA 1UFMA 2H6BA 2PJRB 1NYMA 4JXSA 4OQ0A 2ZO4A 1IEMA 1IYOA 2YR2A 1S3JA 3AG2H 4NUBA 2A05A 2UV1A 2CQNA 1L0EA 3CTAA 3Q1FA 5F6AA 4FISA 5DCFA 3CC4I 3A02A 2WY8Q 3TKYA 3O6BB 2VGJA 3SEQA 4N0BA 2DFHA 4UVAA 2OV7A 1AXBA 4A3IJ 1P97A 3BWGA 2NVTJ 4A6EA 1IYSA 5K7HA 1T33A 1W0UA 1GCEA 2MG4A 2W4SA 1MNDA 3MXSA 2W27A 2HYGD 4I6ZA 2IWCA 2MH9A 4A3MJ 2CV2A 3QNBA 5M3FJ 2WWYA 3RTRA 2IA1A 1H8AC 4HEFA 3CCRI 3FXJA 2EIMH 3GTPJ 3PSIA 1ODVA 1S8NA 3LFKA 3P9KA 3T0YA 2VJWA 3D9YA 4TV7A 3HLCA 5E8GA 4EU0A 2F4IA 4BXUA 4P96A 2D45A 3A2KA 4C3HJ 4O8GA 2K9MA 4E7SA 4IOAF 3PQJA 1ETKA 3RCOA 5DYMA 1Y56A 1QU3A 1K61A 1HCRA 2F5VA 3GTOJ 1T6SA 4LIUA 2Y79A 2KLOA 3ZNTA 3VP0A 3IL2A 1XFNA 2A3SA 2FFYA 4BGDA 3DW0A 5IHVA 5EG0A 1S4SA 3O86A 3PBNA 2MD0A 3T4KA 1K6OA 1H5XA 1N9LA 3FC7A 4NXEA 1ZTUA 2Y0MA 3VOLA 3QP2A 2P6TA 2LLKA 4RAZA 2HDWA 3DP7A 3KYDB 3OYLA 2HPIA 5FFXA 5HWWA 2HKXA 3A4CA 1NH3A 3IXDA 2OBPA 5D5VB 5DTKA 2L4MA 3G2ZA 4P9UA 2K27A 5CERA 3PNVA 3VWBA 1P9RA 4PJNA 1DRMA 3OCNA 4MMNA 4PM7A 2XF3A 5AIPA 2HF6A 3LIDA 4HP9A 1AKHB 3S1MJ 2HQAA 3FF5A 2YSRA 3HOUJ 2PBYA 4N4OB 5LD2C 1HW1A 1TLHB 2Y75A 4OINF 4LG3A 3S17J 3SS5A 3DF8A 4KJZA 3D1NI 3E5XA 4HHDA 2GA2A 4GCVA 5FLVA 1FSHA 5EVLA 4Y0OA 3UB7A 4R4RA 4BE2A 2VL8A 3NOPC 5KCMA 5K7ZA 2O99A 2I10A 3T4TA 4PJJA 1TWFJ 4EQQA 5EM1A 3WRZA 3SFIA 4RB2C 5M19A 4K91A 2V7FA 2CQ7A 3MZEA 1D5YA 1FTTA 3COAC 2K2NA 3HOSA 3HBRA 2M4GA 4KUMA 5A90A 4AM3A 5J6XA 1Z6FA 3MFKA 1K7AA 4CSWA 3GTJJ 2DTRA 3O2PE 3BECA 2O7OA 5KHDA 1SKOB 3NAUA 4JOMA 4BBVA 1DDNA 2C6YA 4OP8A 2L01A 2VXDA 2E5NA 4O6JA 2RGVA 2WGVA 1TD5A 1SD6A 2BYVE 4P9FA 1AWCA 1J0RA 3VP2A 1L0OC 1HVBA 2XB5A 3HL9A 3HHGA 3K1MA 4L9GA 4PGGA 2PU4A 1LE8B 5EDNA 1MWUA 4UA6A 1J9IA 3WTUC 3FWLA 2CFXA 1KVLA 1YE9A 2EFWA 5H6QA 3G73A 1WYCA 1IAWA 2VV6A 5EVIC 2ESNA 3I71A 2M9HA 5IYCJ 1LEBA 2FNPA 4WBGA 1NZOA 2ESHA 3RPUA 3G6EI 2WADA 3BCAA 3OPPA 4PM6A 5CGWA 1IC8A 4A3GJ 1A36A 1ETQA 2VE8A 4UVCA 2WAQN 2E19A 2HQNA 4Y13A 4ENKA 1K54C 5HDSA 4EUZA 3OYKA 2CH0A 5F6FA 2IRFG 3E97A 1OTDA 5K5OA 1Z0XA 4FD8A 3H0DA 3KLNA 2CWEA 4EJVA 3T1BA 3H3ZA 1K54A 4IHXA 1VZ0A 2GZWA 3I5UA 4X1EA 4XT2B 4OLGA 1M1EB 2V26A 3GO5A 5C3EJ 1Z3YA 5LBQA 4GOGA 2G7UA 3B02A 2NYXA 3J81K 2KHMA 4ZDOA 2HTSA 2VGKA 3NRVA 1J7KA 3LA7A 3HDDA 3QP6A 1LDJA 4B48A 2O9LA 1D1CA 2EFPA 3QNCA 4MQVA 1JTDA 3FYZA 2PMHA 4B09A 1VTNC 4G94A 4FE7A 4B47A 1SDNA 3ZG7B 4OQHA 4KDPA 2Z99A 5F1JA 3I59B 4L0LA 3IBRA 1QQIA 4LJZF 4A3EJ 1LKXA 2FUG2 1MNMC 3DKWA 4K2EA 3REOA 1IG7A 4BD0A 2EZLA 3ROUA 1IRGA 1IV8A 1VEUA 1SD4A 4YIRX 3PUBA 3A0VA 1WSUA 4NQWB 3O3VA 4QPRA 1Q2PA 4S2OA 4M3DA 1FIAA 2O6GE 4BL3A 1F4KA 5CVJA 5HD3A 1ZRDA 1LEAA 2W57A 2XRLA 3IXHA 2Y2MA 4XKBA 4OOIA 3KCCA 3GLLA 3HXLA 1IGNA 3C7UA 2KMUA 4E7KA 3LSMA 1I39A 1X58A 4HJ4A 3HJKA 2ID3A 1IN4A 3ZG8B 2R3SA 4CCLA 3OYFA 1NLZA 2O8KA 4A3FJ 1YX3A 5CVRA 3MFDA 1JWVA 2HVSA 1QGPA 2DA3A 3TRCA 1U0JA 4D2OA 2Q2EB 1I3QJ 4X1MA 4ZJ2A 4XLFA 3MZ8A 3BFGA 4M6XA 3KIOA 3BR1A 1UWNX 1CQAA 1EJ9A 2W1TA 4O3MA 2BASA 5JYPA 1SKFA 1RRJA 3H3VK 4X25A 2P6SA 5DS9A 2Y2JA 1A6IA 5J1UA 1X4PA 2W7NA 3BQYA 3RKWA 4IO9F 1YMXA 1PYVA 3GZ6A 1TEMA 3MN2A 1XX2A 2VA0A 2QENA 3IS2B 3F6VA 1K25A 4BBUA 1RGYA 1TWCJ 3PIPF 2BV6A 2FU4A 2HP6A 4EW7A 2G7HA 5GHZA 4DMZA 2OCEA 1N77A 1ZREA 1IKIA 3AG1H 1MBLA 3IF6B 1W7PA 2ZOHA 4JF4A 1DJCA 4MNRA 2ID6A 1U5TB 4C3JJ 4YINA 1FYLA 4EJOA 2V1XA 2PJRA 3BOQA 5M5WJ 2QSGX 4IBRA 1JWPA 5DJTA 2CJJA 5HL1A 3UPPA 1ETWA 1SAUA 3WGIA 2HQRA 5DF9A 5DFXA 1U6GA 3I56I 2FOKA 3VFFA 3WGHA 2VN2A 1VETB 4XOPA 3HLGA 3V7CA 3IAM2 4U7DA 2NOJB 4GKUA 2XKOA 3K6GA 1SD5A 5BNGA 1X2NA 4CA0A 3IBJA 5EV0A 5J3LA 3CI6A 4RM2A 4B3XA 3ZQCA 4L9TA 1MBJA 3LO7A 1XPXA 3GZ5A 3S22A 1FNNA 1BIAA 1OCCH 3K2AA 5D6FA 4I99C 1DPUA 1WJ5A 1MGTA 1BULA 1K57C 1K56A 5F0FA 5TISC 4G3VA 4N9KA 4GGGA 2OOLA 1KQ0A 2Z2MB 2JC7A 1K57A 5TGFA 2VQHA 1OCTC 4M3KA 2RCXA 5DF7A 2JHEA 1SDEA 2A5WA 5E3MA 3VSKA 4G12A 3C3WA 2W25A 1JKPC 2DK8A 4HOBA 2DA1A 3SOIA 2IVMA 3D5RC 1YRNB 2ZM8A 2DW4A 4P6ZM 3TW6A 2Y2OA 4NC6A 1VQNI 2CW8A 3PTEA 2LKXA 2MSYA 4YRVA 2JKFA 1A5JA 1I5ZA 1KYZA 3HSRA 3LSJA 4HX8A 4XLEA 2PD7A 1H9GA 3DCFA 3SZTA 4MTDA 4EQIA 2XPWA 3KSFA 3N97A 2LD5A 4ASNA 3K70D 4BDZA 1ZG5A 3H5NA 4LV3A 2O03A 4PZJA 3EGDC 1B59A 1NY0A 1O3SA 5FAOA 2VKDA 4ETZA 2Y0SA 3IXBA 4R3JA 5D5UB 2ECBA 1AKHA 2J9OA 1TQPA 4BD1A 2BHZA 2GX5A 4A12A 2LKPA 2XROA 4GDFA 2Y91A 1ACIA 4M3GA 4KG5A 1UWPX 1YLJA 1XB4A 2XK1A 1Z6RA 3EGXC 4XXRA 4I76A 4QSHA 1W36D 3ITBA 4B3AA 4BQNA 3BPVA 3HCYA 1VQPI 3HC7A 1B72B 3H9QA 3D0SA 4IVNA 1LB2A 3ONQA 3L7HA 4HBTA 4DNCA 3MZHA 4OPRA 4GFBA 1XXMA 2E2HJ 3J81Z 1H8YA 3CUEC 2K9NA 4Y0TA 2VI6A 1LQ1A 1HTZA 5J1RA 3SHFA 3KZIC 4RB1A 3EOIA 2OV5A 3G1MA 4BJ6C 2D1VA 4DDYA 1FTZA 1Y0UA 1N9OA 2EFXA 1QA6A 1LPQA 2CS3A 3HEFA 1OPXA 4JXVA 2HPMA 2LP0A 4IHWA 3BM6A 5GTIC 4BQOA 3MFXA 1LVKA 1FWZA 2VBZA 3H1CA 3MD2A 2DA7A 4P55A 5JI6A 1NWZA 2ZJ2A 1AA7A 5BOHA 4BHCA 2FMLA 1CF0A 2PEXA 3W6VA 2Z1DA 4GDBA 1LE8A 4FT8A 5DM7F 2HR3A 2GXAA 1Q1HA 1X4OA 1IN7A 4BJ5C 4S2JA 3HOWJ 4N9LA 2LF7A 1HXDA 3DKYA 3KEOA 5JVGF 2IPQX 1S4RA 3TW7A 3H9GA 1XP4A 2FBKA 2E1MB 3UPOA 2O5RA 3ZHHA 1FMVA 1WJAA 2W3DA 3N6IA 2QQ9A 4HQAA 5FQ9A 3NOUC 5FSRA 5E1ZB 2W84A 4IRHA 3E6CC 2FXAA 3UNWA 1GVDA 4RGSA 5FI7A 4G6DA 4WF2A 3FXKA 4A0XA 2E34A 3MSHA 4RX3A 2I8DA 1BN5A 3SDGA 4XT2A 2D1HA 1F9IA 2XSSA 1XPBA 4C9YA 1O3TA 2B5RA 3VFHA 4WZ4A 1FY7A 3UDFA 5FA7A 3RTYA 2KJCA 1VHMA 4EEUA 3GFMA 4HF1A 5HPFA 2OD5A 1SFOJ 4JXWA 2CUEA 2DQLA 3M8FA 2JQ7A 5HLGA 1D8KA 4S04A 2EWVA 2EILH 1W4MA 2RREA 5HNHA 1DUXC 3PXPA 4IQJA 3BZ6A 3I59A 3PHYA 4E7HA 1X3WB 2XF6A 4Q48A 5E3OA 2PDRA 3BWLA 3OZHA 4DE2A 3B3XA 1NXYA 1EH6A 4L5EA 5EM0A 3ERMA 1LUJB 5LRRA 3T50A 3HBLA 4IF4A 2DO7A 4NQWA 1L2SA 4LPZA 3WS5A 2NVQJ 4R79A 4CCJA 3H82B 3VP4A 1APLC 2VPRA 4L9JA 5HFOA 3JTHA 3H7WB 1DQUA 5H2FC 3N8RA 4U0YA 3ZQFA 3OYAA 5HDDA 4HV6A 2M7VA 4KUKA 4BXXJ 3LQQA 4LRXC 3ZN1A 5IYBJ 2GXBA 3OOVA 3FMQA 4HBLA 2JKRI 3GYHX 1L0GA 3IAS2 4ZZDA 4X1LA 5IT3A 5I5LA 3LIAA 4X68A 1G3TA 5KNLA 3LR5A 3HLWA 2OF7A 3AFHA 3CMEI 1X2MA 1XMXA 2FQ3A 2VC0A 1GSWA 2X85A 1W5CC 2Q2EA 3G3ZA 3PBQA 1FR6A 1R6RA 4IX7A 4NG2A 2L7KA 2EFOA 4L5JA 4OIQF 4ESJA 1KU3A 4UHTA 2RKHA 1YQSA 2X71A 3DXJF 5HLIA 3L7WA 2OWHA 3IF6C 5GLAA 5M5XJ 3WWXA 2F5CA 2KIFA 1Y1WJ 3FK6A 1D1JA 3IS2A 1XGIA 1U5TC 3MKFA 2JA6J 2XH9A 3CUQB 5IPAA 2CG4A 5KK1A 5TRDA 5HARA 4BY7J 3IF6A 4ZZLA 1Z9CA 1ZELA 3VYUB 5HW3A 2R7SA 2V1AA 1ULYA 2K9SA 1E3UD 1O57A 1U5TA 1W1WE 2JTVA 2PAVP 4UQIS 3UB9A 1D06A 3H35A 3BFCA 3E1SA 2DBBA 3EETA 4UXNA 4WWCA 1PJRA 3S4XA 3VMAA 2W00A 2RN7A 4ZAMA 2XF5A 1KQ9A 5FLXK 2RV8A 1LT0A 4CJNA 3VV4A 5LHIA 1RUOA 3ISPA 1OKRA 5E79C 3HSFA 1VETA 2I9VA 2ZOIA 3P9IA 5LLQA 3PAEA 3DEEA 4UA7A 2E7XA 1Q1VA 3N8SA 1SMTA 2VJ4A 3KEQA 1YFHA 1IF1A 2P0WA 2BZTA 1IW7F 2CW0F 1YW9A 4NEED 2FSWA 4P85A 4RYEA 3ZYTA 3VP3A 3TQNA 2HGCA 1MH3A 2JPBA 4AIKA 1I1GA 5LEJA 2VB6A 1W63Q 4GYIA 2NS0A 3OL4A 2M30A 1FT9A 2Y59A 4ZYGA 3AGFA 2M7AA 1TDGA 1ETVA 2BE5F 3G6OA 5E3NA 3DLLF 1UAAA 2HWVA 2OU2A 2M8EA 3LUQA 2GOMA 3OYIA 1RIOH 5U47A 3ZP5A 5DCMB 1JVJA 4A5NA 2X1DA 4HSTA 5JFRA 5B5EC 1BL0A 2LMDA 3NIAA 3C7JA 4JGRA 3IKVA 2L9NA 3I9V2 4CCMA 1YAXA 3CF2A 2QPNA 2JBFA 4OWRB 1YRNA 5HZHA 2JUCA 2B18A 4S2IA 1KGFA 1MBHA 2ZQCA 1WVRA 5HDGA 4HYEA 6PAXA 3HGYA 3F1PB 4RA7A 4ESPA 1TT0A 3B73A 3HPHA 3PO3J 1ES4A 2ZJ9A 4QPOA 2Y2PA 2CSOA 3GQZA 3MXRA 1ETXA 4DJ2A 3BY9A 4MNUA 4BU2A 1N78A 2W82A 2XGDA 2NS8A 2K9LA 3PIOF 3CHWP 3RXXA 3ISGA 5IP9J 3KYZA 2IEKA 2WKPA 4HJ6A 5JHFA 3ZCZA 5CVUA 1OCPA 2WTEA 1BLPA 4UAAA 4H4KC 1GA9A 1QO0D 3ABLH 3KP2A 4ZYDA 5DKKA 5JLWA 3V3RA 3K4KA 1WI3A 3FXOA 2V9AA 3CWFA 4C75A 5ILVA 4HBUA 3ULFA 2RL3A 1IDZA 1IUFA 1SFEA 3QOPA 2P8TA 3H92A 3S8PA 3T1RA 1T1BA 3U9GA 1X1AA 1ZKGA 3JRIA 2G2WA 3LEZA 4GHIB 3FBIB 1PRQA 1B72A 3E6MA 5GAEJ 4OIOF 4F93B 4CQHA 4DYQA 3UE1A 4YOFA 3LSKA 1XGNA 2M7BA 4GS9B 1O3QA 1FBSA 2ECCA 3L2QA 4IHYA 4ENJA 3K4LA 1QMFA 3A3IA 4R1HA 2COBA 3C5AA 2EB7A 5CGXA 3J80K 1XCBA 1ZLKA 5FD5A 3BY6A 1VFCA 4A93J 1C3BA 3LFUA 4Q0JA 3O5YA 1UGUA 1A35A 4EESA 2ZXIA 2ZFUA 1SVMA 2EA2A 3BTLA 2ZJPF 2E8JA 1UHMA 4ZDPA 2XSDC 1FCNA 4IVIA 1TQMA 1FEXA 2LH9A 1JJ6C 1BI2A 4JGQA 2XDMA 2E1MC 3ABTA 1Z21A 3MS6A 1AU7A 3K4CA 2K40A 2R5YB 2GXGA 4N4NB 4KQDA 1V54H 1MBFA 4IVKA 1JHFA 1B8IB 3L9FA 4JKTA 1FILA 3N4IA 2HEOA 5FQKA 4RMNA 3TE8A 2JA8J 4LB6B 2AQEA 2VLAA 1PFLA 3GCMA 3TG9A 3K9TA 1FIPA 1XSXA 3L2RA 1VQ7I 1OYWA 1ZYRF 3DV8A 2OAZA 5FL3A 1UG0A 3KSHA 4CHUA 1JTXA 2JKGA 4I7HA 5B3SH 1ONHA 2KLIA 5GLBA 2RDPA 2V4JC 3I53A 5IS1A 2WB1A 2Q8KA 4BDYA 4Z9QA 1F9NA 3AL0B 1O7LA 3TO9A 5L2FA 4PKYA 4A3BJ 4B43A 2HZDA 3FKJA 2PR6A 1Z3XA 3NQOA 1ON1A 2VKEA 4M71A 3WTYC 1TNTA 3Q3SA 1RP5A 2CW7A 3IP4B 4E7JA 1S72I 1D8JA 1H88C 2EX2A 2HP9A 3M2JA 4R23A 5GPCA 2EINH 4A3DJ 3WTZA 4KQOA 3LQRA 1W5TA 3FXRA 2LREA 2L2OA 4KENB 2LNBA 3VYRB 2C6WB 3DTEA 2WKIA 3Q9VA 4XK4A 4U0WA 3RZOJ 1YI2I 3LSTA 4JBFA 4HG2A 2OC6A 3KFWX 4A0YA 3NEUA 3R61A 2Y0SN 1IXRC 2QQ8A 3ZRGA 2WYXA 1H9TA 4ZJ1A 3H82A 5HS9A 4JBAA 1BR2A 4UNOA 3H7WA 4MN6A 4NXGA 2KJBA 2HDCA 3UDXA 2HDDA 1JT0A 2AO9A 3QODA 5FLXZ 2PU2A 4Y3OA 2WZZA 2X01A 2YU3A 3U21A 5DD4A 3CCQI 4HI4A 3LR3A 2E1OA 4OKPA 3WTXC 3Q7ZA 4J19A 2DK5A 2QSHX 1ZLJA 1G3YA 4HQEA 2Q9MA 2HYJA 5E17F 2W3FA 4H6JB 3ZXSA 1FOYA 4Q4ZF 5F04A 1HKTA 2EX6A 4OAYA 1HDPA 1ZARA 3PL8A 3ECOA 1WFXA 2WV0A 4BQQA 5K5RA 2A24A 1GV5A 5CHUA 3IC7A 2YU9J 4OQIA 1EF4A 3FPWA 1ZG1A 1EA3A 1DPRA 2GAUA 5CVIA 1UZCA 3SEZA 4I09A 3LNQA 1BLCA 1I5QA 2PG4A 1VQKI 2IS4A 4ZDXA 2X1EA 4HF0A 5IP6A 3CUQA 3BTJA 1PUFB 4E3OA 4MN5A 4D9JA 1U60A 5AIQA 1R5HA 2CMPA 3FKIJ 1TP4A 1T2KA 5HWVA 5GAHJ 1XTAA 3L2VA 2CV0A 4JX4A 1XDUA 4XRSA 2KFDA 4DIQA 1WGXA 3AGEA 3ZMSA 2CU7A 2VJ5A 4I39A 5J4YA 4E3NA 5J7EA 5AVEA 1FPQA 2XASA 3IT9A 1YJNI 5L10A 2GBYA 1NK2P 3J7AO 1HLUP 3H9WA 1BSGA 5B1BH 3HRMA 3N4MA 2MYSA 2OLVA 1IXSB 4R8HA 2GLOA 2M5WA 1U8RA 3BLSA 5A2QK 2QCOA 3FM5A 2LY1A 2Q0OA 4LFUA 3VB2A 1BT5A 3JVVA 5F27A 3P01A 4B88A 2AHQA 1G28A 2BHYA 2HXOA 2B02A 3QOEA 3GTKJ 1ZG3A 2CO5A 5FFZA 4LLGF 4K08A 1D1AA 2IT0A 3I4MJ 3MJQA 1X1DA 5ILSA 5FQIA 1UELB 2F6CA 3HPGA 5BMZA 3NOTC 3H3UA 5J47A 4LMYA 4DE1A 4HIAA 2EQRA 3ITAA 3NJAA 2IBDA 3DBHB 2JK3A 1YSPA 2CFOA 1K78B 4MN7A 4N1XA 3F22A 2CQXA 3DU6A 2EIJH 2X51A 4PK4A 1GSVA 2D02A 5DCMA 3OIPA 1G68A 4OH0A 4GW9A 2R7XA 2EWWA 2QF7A 4HNTA 5J40A 1TBXA 2ZNYA 3HLFA 1ETOA 2Z16A 3C2HA 2ZJQF 4HV5A 4KG6A 1SFUA 1FCMA 2IS2A 2OJED 3LSRA 2W3HA 3FX3A 4G3WA 4M6VA 3F1PA 4YIIA 1WJDA 2D2WA 2FFFB 4HNVA 4HESA 1SAXA 1Z77A 4O0PA 3M2KA 2HYFA 3OYBA 4MBKA 3ASNH 2DOFA 5HWTA 3G2YA 3ZFZA 4QLCU 3E6DA 2HV1A 4LG0A 2GJ3A 2UV0E 5KVRA 3IH4A 4B4XA 4XN3A 4XRMA 2DLLA 1C0WA 2GWRA 3W2VA 4OMYA 3GVBA 3RDIA 1MSFC 3G34A 4BLMA 5DDGA 3RJPA 2YS9A 3CJNA 4PAUA 4KISA 4IJAA 3I64A 3CCLI 4Y5FA 1YS7A 2L9SA 5D8LB 4KMFA 2Z2LB 3E98A 1MXOA 3UPNA 1HBXG 2HJEA 1VQ6I 4IRGA 1DU6A 3GTCA 3K7AJ 1MPLA 1G59A 2EXAA 4X6AJ 3BCBA 1MBEA 3KEYA 3BY8A 4GHIA 3F23A 4Y2FA 5HL6A 4E6WA 2CQQA 2AQFA 4N1HA 2RQQA 4DW6A 1IDYA 1XCVA 2X1CA 2Y30A 4HX4A 3VPRA 2PMZA 1QZZA 1FOFA 3K3DA 1D7EA 4GS9A 3P7NA 4MEZA 4ARZB 2KKOA 2VASA 4YELA 5KIZA 4FOFA 3GMWA 4CGZA 4E3JA 3ZDJA 2KL4A 4CDGA 1DJBA 1GSXA 3JVUA 1MZUA 1OPCA 5FQJA 2DCFA 2HXIA 3L2CA 2ZSHB 1S7AA 3TEDA 2M87A 3VYSB 4BH9A 4Z1WA 4L9VA 3ZQIA 3I4NJ 1WZ2A 1MMDA 1MKMA 1TWHJ 2E35A 4CYDA 2ZL1B 2ZM0A 2FRHA 3QP8A 5EPHA 1BA5A 3EYIA 2QYOA 2KOIA 1UB9A 3V42A 2VE9A 1O7FA 4DE0A 3G1OA 4LRYC 5DEQA 2R5YA 1J75A 4GO1A 1TQIA 1X0OA 1MWRA 3C4OA 3PAGA 2FD5A 1B8IA 4HEA2 3T8TA 4ZBEA 3DKXA 1DP3A 3SQNA 1E2XA 1W79A 4IUHA 4S2PA 3S93A 2GQQA 2RC4A 2RNGA 3T5XA 3AL0C 1GDTA 2ZQAA 3BR0A 3R6SA 3S32A 3PR6A 3PFIA 3BZKA 4EGZA 4E7IA 1BC7C 1DGRM 1PYYA 1QNTA 4D0PA 3K70C 3IWZA 1OYIA 1VQ4I 3IV5A 1R00A 1XA1A 1IZ1A 2P5VA 1TDLA 3J7YJ 2X02A 3IH9A 2VJJA 1J3WA 4E04A 3O87A 1WKMA 2ZXHA 2Y9YA 1HW5A 2XHKA 4R3BA 4QJGA 4II7A 1JWZA 4ETXA 2EZIA 2ELHA 3WTWC 2VBYA 2ZJRF 1T98A 3IX3A 1YIOA 5J3WA 1R5ID 1R1VA 3OYCA 3K2NA 2L02A 5D6EA 1KU2A 4MFDA 2QWWA 1OCOH 3VOEA 2J80A 2XSJC 1W36C 1Y4OA 1FX7A 4DDSA 1ZRCA 1U2WA 3Q0UA 3R4KA 2GNXA 1JUSA 2DOEA 3MEXA 1VNDA 3I3LA 2ZC7A 5CX7A 3EPZA 1CI8A 1G6OA 1PDNC 3KYQA 3KX2A 2OZUA 3W6KB 2W0NA 3B6CA 2PMUA 4EETB 3DTMA 1AOYA 2Z5UA 1Z7UA 4F7ZA 1X1CA 3OS0A 3MXQA 3BG7A 3PYPA 4GXOA 3I4PA 3W4PA 4DRTA 2F4OB 3OOPA 1E17A 3MKYB 1SC7A 1KU9A 5HD5A 1CQTA 3IUOA 3O8HA 3DBLB 1K6YA 3PNTA 2KRFA 2LYCA 4ESBA 3KYLA 4HLXA 4L18B 1IRXA 1FQGA 4GLQA 5FKMA 3D5SC 5D4RA 1IN6A 1LVAA 2VBXA 5EEGA 5E2EA 3S7QA 3VP1A 1S6LA 3DEUA 4HX7A 4BY1J 2H94A 3IH8A 4XN0A 4CPKA 1JUPA 5A2QZ 3RFBA 3PQKA 1V5FA 5GAGJ 1YLYA 4MFEA 5CRFA 3FKVA 1P9WA 5F69A 4NHJA 2JCHA 1BI1A 1I27A 2VGLM 4H6JA 3QPTA 1X1BA 2M34A 3A0BC 5HVQC 5G18A 4BL2A 3CO6C 1ZTRA 5CPRB 5A93A 4FX4A 2H10A 2I5UA 2OA4A 4M9ZA 2ZQ9A 3OPLA 4FCFA 4HH3A 4UV8A 3ZMTA 2GM4A 4P1WA 2XFTA 5EECA 1NHAA 1POGA 1QHGA 3MQ0A 1MH4A 1TT5B 2P7VB 2QUFA 3KLOA 5HS7A 4FCYA 4NXBA 4GNUA 4Y33A 3ZGAB 2XAJA 2WAEA 1BZAA 3CG5A 3LI8A 2NUPC 2M1CA 4WXHA 1PUFA 2RAEA 4D1QA 4P6ZS 4XLPF 3HKZA 3MKZA 2VQLA 3LOCA 5F0HA 4L5IA 1T8IA 3CESA 4XICA 2B95A 2MD5A 4NDLA 3C2WA 3WS4A 1S1ZA 5GL9A 1SD7A 3A0HC 2DJIA 3F8CA 3G1LA 4RAGA 2L5QA 1FZPB 1F43A 5IYDJ 4C2MJ 3JAMK 3QP5A 4KIFA 2HNHA 3BJNA 3I55I 3G4PA 3VOYA 3P5JA 1FC3A 4EMSA 2WGWB 3V67A 5E18F 4OIPF 3CLQA 2BOLA 3T8RA 1LDKB 1NK3P 1LSXA 1JE8A 2A3UA 3NC8A 2WB1N 4AC0A 3CMAI 1OLTA 3ML6A 2R5ZB 3IX8A 3HB9A 2W3EA 2L9RA 5HAIA 5HAPA 1BI0A 4DE3A 4YEJA 4XKWA 4W97A 2XGEA 3S2HJ 3NY4A 3E0JB 4WM9A 1T0FC 2LRDA 3EUHC 2XPUA 4JX6A 4EM1A 3R0JA 1EWZA 2A68F 3CDHA 1S1YA 4PMAA 2ISZA 1FOKA 1IXCA 1OJ5A 2HKOA 1XGJA 2QQAA 4V2GA 4AVPA 4EEPA 4DF6A 1K78A 4NC8A 1T0FA 1XS9A 4I2OA 4Q47A 1KZHA 2OTJI 2DAOA 3EUHA 3FXLA 2JMWA 1P7IA 2V8CA 2M1BA 2JSCA 4BMWA 4UVBA 1BI3A 5EF6A 2V6EA 3MZYA 1PP8F 4S0HB 2VIXA 5E2FA 1OYYA 4PJMA 3BQAA 3V8LA 4IXAA 5EZHA 4KA4A 4E3MA 3V7SA 3LFVA 3HOVJ 1IN5A 1Y8RB 1VQ5I 2L0KA 3UNGC 1MBKA 5J8CA 3A1YA 4KFCA 1FOXA 1HDDC 2VOOA 2DT7B 4WEJA 4EUVA 3T12B 4EQ1A 5ERIA 2ZXWH 4DBRA 3M4OJ 1NJ4A 3BTIA 3HJIA 2OUMA 2B0LA 1F1ZA 2DTZA 2MC4A 2WV1A 1T39A 4I3IA 3KYCB 5ICGA 2BXYA 3N7WA 1EROA 4OAZA 1H0MA 3HYIA 4A3KJ 1BTLA 2A61A 3SW1A 1XMKA 4FUWA 3OBFA 3LICA 2Y55A 1TNSA 3N05A 3S1YA 3NCKA 2ETHA 3H5RA 3FG8A 2J3TD 4G8XA 5D4SA 3WE2A 3LGOA 1A6QA 2JZYA 4YIFA 5FRMA 3DLAA 4G7ZF 1E3UA 3MQQA 1N9NA 3K10A 3MQOA
chains in the Genus database with same CATH topology
3VFZA 1S66L 3ZQ5A 4IPAA 4O01A 3EEAA 5LGNA 2VXZA 3DFGA 4R3AA 4ARZA 2V1UA 5A8BA 2DMWA 4NXFA 2JN7A 1R36A 3FM3A 1ZHFA 3L09A 4O5VA 4WL9A 3LIEA 2X4HA 2XAFA 3GFJA </