3P7NA

Crystal structure of light activated transcription factor el222 from erythrobacter litoralis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
191
Chain Sequence
PAQWVLDLIEASPIASVVSDPRLADNPLIAINQAFTDLTGYSEEECVGRNCRFLAGSGTEPWLTDKIRQGVREHKPVLVEILNYKKDGTPFRNAVLVAPIYDDDDELLYFLGSQVEVGMARRERAAEMLKTLSPRQLEVTTLVASGLRNKEVAARLGLSEKTVKMHRGLVMEKLNLKTSADLVRIAVEAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of photosensitivity in a bacterial light-oxygen-voltage/helix-turn-helix (LOV-HTH) DNA-binding protein.
pubmed doi rcsb
source organism Erythrobacter litoralis
molecule tags Dna binding protein
molecule keywords Sensor histidine kinase
total genus 62
structure length 191
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p7nA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p7nA01
4IVNA 3WTXC 5AIPA 4HZFA 4WXCA 2W24A 2V1XA 1OTIA 2A6HF 3ZMVA 4GCVA 4PDKA 5DKKA 2QLZA 2LKPA 4HX7A 2XASA 5HDGA 1G28A 3ZPLA 1XGMA 2RV8A 3E6BA 1IW7F 4BAYA 5D5UB 4L9EA 2VV6A 4I09A 3FHZA 3E4OA 1G3WA 3MJQA 3H7WB 1EH8A 4HLYA 1P0ZA 1HSTA 2IA1A 5FFZA 4JGPA 1MGTA 3W6JB 2HEOA 5DYMA 3RPUA 4CO8A 1DPUA 5F69A 2KRFA 3LA2A 5F64A 4HHDA 3UMEA 3WTWC 4BBVA 4UVAA 3Q5FA 3TKYA 1TQMA 4H0EA 1T38A 2ACJA 4FX4A 5DEQA 3E6CC 4YIFA 3HRUA 2W85A 1KU3A 4KYWA 4WXDA 2H27A 1JNUA 3DXJF 1USSA 3IKTA 1SFUA 1MJBA 3LUQA 2OD5A 2GAUA 1VTNC 3J81K 3IL2A 1TS0A 1BIAA 5E17F 3KZZA 1S7OA 4HY8A 2JT1A 4H6JB 4N9IA 1FNNA 1ZYRF 3ULQB 3FX3A 4NXFA 4UVCA 3M8EA 3RKXA 3ERED 4KIBA 3CAXA 4WX9A 2EA4A 1TQPA 4M6YA 3I54A 5J8CA 1Z6TA 5EFWA 3ZP5A 1PP8F 2EV0A 3MWMA 2RQPA 5HDSA 3JW4A 5ICEA 5LRRA 3E3VA 3O3KA 3HUGA 3GWZA 3EQLF 3GFJA 3JAMK 4LRYC 2EFPA 2D1HA 3F8BA 1BIBA 1XFNA 1FSHA 1EH7A 2EWNA 2FF4A 1DP6A 4I39A 1D8JA 4RS8A 3R4KA 1E2XA 3U1DA 5L3EA 4BYYA 3IBRA 2RKHA 1TS8A 4EM0B 1P4XA 4A12A 3KETA 1RNLA 3C3WA 3GEZA 1FYKA 4WWCA 1SMYF 2ZBKA 1OTAA 3GDIA 1NHAA 3F1NA 4U0VA 2COMA 1YW8A 4I0AA 2OWHA 4HLXA 4LK0F 3GUDA 4YFKF 5LGTA 4R8HA 4MEXF 3F1OB 3HSEA 3J80Z 3JAMZ 2EFQA 1GSVA 3E5UA 1T6SA 3QPTA 4EESA 3CUQB 3E97A 4LLLA 3LSTA 3HSRA 2JTVA 2KJCA 4KA4A 1J5YA 4HF1A 2GA2A 4O5VA 3SFZA 4CHUA 3FXQA 1LEBA 2DK8A 4NQWA 4BXUA 2YSRA 4OMZA 3HYIA 2JZYA 2F2EA 1YTYA 2K7LA 2ZKZA 5LBQA 2DW4A 2BGCA 5TBMB 2INWA 5G4ZA 5K5RA 1BI2A 3NQOA 5LEKA 2L02A 5DKLA 1I1SA 5JVTA 1D3YA 2HR3A 2PJPA 3IS2A 3KP5A 3I5UA 2XAHA 4I0BA 2XRNA 1N9LA 5HDNA 2HQNA 3C18A 3KZYA 2H6CA 4BBTA 2NRAC 2UWMA 1S7AA 2QYOA 3KX0X 2XV4S 4MGRA 4A0ZA 3ECOA 4HX4A 2D01A 2E1NA 4KIFA 2ZFWA 2KKOA 5LGNA 1ZREA 2RNJA 1WQ2A 3C2WA 3BY8A 1XMKA 3H3ZA 1Y28A 5K5OA 5FGMA 3VFZA 3BWLA 5CVUA 3GW2A 1R36A 2HTSA 5BMZA 4K08A 2K86A 5F68A 5DJUA 2H94A 3MZYA 4EW7A 3E6DA 3BJ6A 3IS2B 1O57A 4FHTA 2HZTA 1O3QA 5DUKA 1T1BA 1UWNX 2UZKA 3REOA 3LIFA 1N9NA 3RTYA 1BI0A 1FY7A 1HW5A 2IVMA 2V0UA 1UHWA 4L0YB 1FP2A 5A2QZ 1T1CA 2IA2A 4NXBA 5G4YA 4R3AA 1S3JA 4NXGA 3O6BB 5JHUA 1FBSA 2Y0MA 1NWZA 2P4WA 2VT3A 5DJTA 1P97A 5L3CA 3FMQA 1ONVA 2O8XA 1MD0A 3WTVC 1U5TA 4H6JA 3TOBA 3HSFA 2ZO4A 1LL8A 2Z33A 3LIAA 2BE5F 3F1OA 2HKXA 1QNTA 1YS6A 1OT9A 1ZLJA 2DTRA 3R0AA 2MC3A 4ZYEA 4AIHA 4MTDA 1OR7A 3E5XA 5E8IA 1K78A 4L5JA 3L00A 2ZBBA 1W4MA 1L3LA 2QWWA 2W57A 3IWFA 2STWA 5HLIA 2PLYA 4HF0A 1FYLA 4G94A 1DDNA 3WU1B 4HJ6A 4ZZDA 1KU2A 1UCRA 2A3SA 4RGUA 3I0TA 5H6QA 1LEAA 1R58A 1T1AA 3DQVC 4G6QA 2VBWA 2K27A 3IC7A 3BOQA 2XKPA 2D1VA 3F6OA 4HX8A 4WL9A 2F5FA 2ZCWA 3LYXA 1T98A 1XGSA 4MQ9F 4UXNA 1MZBA 3NRVA 5LHGA 1R22A 4G7ZF 5BQTA 2XUBA 1QQIA 2P6SA 4P9UA 4NXEA 2PN6A 3GZ5A 4JQFA 4GO1A 1ZGJA 1U6GA 1YYVA 5HOOA 3MFKA 2FA5A 3ELKA 1AOYA 1USTA 2Z3YA 5FLXZ 5AVEA 1TW3A 2M30A 4HDVA 3NHQA 5CVRA 3U2RA 3I58A 3HIFA 2HOEA 4A0XA 5EEGA 2KX6A 4ZZLA 1FBQA 4ENMA 1Y0UA 4I98B 2K4JA 1GSXA 4KUOA 2FBHA 3M9AA 5ICGA 1STZA 1WWXA 4M9SA 4IJAA 3C7JA 1YS7A 3BP8A 1ZLKA 4R38A 3N97A 2V1UA 2GXBA 4Z2YA 1IZ1A 1JXSA 2A24B 3CWFA 4WF2A 2DAOA 3IRQA 2OU2A 3QPHA 1J75A 1FSEA 5HS9A 1MKMA 2GWRA 3TO9A 5D5WB 3WGIA 2IA0A 3F1NB 4B8XA 1A04A 2K7SA 5LHHA 4GCZA 4EMSA 1R5HA 3AAFA 5K5QA 5HVQC 3T1BA 4YFXF 1FT9A 1LDKB 1V3FA 1ZG1A 3F8FA 1SMTA 1KQ8A 1LDJA 3LA7A 4XLPF 3ML6A 1YFHA 3LI9A 1GXPA 4EGYA 2OAZA 2ZNZA 1G3YA 2G7HA 3V8LA 3C1DA 1TTYA 1BJAA 4BHCA 1XB4A 2F5EA 4AIKA 1YW7A 4CZZA 2OQGA 2ZMEB 1LQ1A 1T0FA 1L0OC 4AIJA 1HXDA 4JGRA 3ZMZA 1RZ4A 2RC4A 2WC2A 2PMUA 4S04A 3A0RA 3DV8A 3GFLA 3DFGA 5HD3A 3ISPA 2YKHA 1F4KA 2WKQA 4Q48A 3L2CA 2XIGA 1D5VA 1LJ9A 2E1CA 1UGUA 4XSXF 1Q1HA 4FX0A 3ABUA 4B9OA 3TGNA 4HP4A 1UFMA 4L9TA 1S66L 2L4AA 3F8MA 4R1HA 5FFXA 3CO6C 4PGGA 4IRGA 1LNWA 2FE3A 2AXLA 3G73A 4PKYG 3BPXA 1XMAA 1J2XA 2PYRA 1O3SA 1PDNC 5DDGA 5HZHA 1IXSB 1HQCA 1J0RA 5D8LB 3L09A 2L01A 2Z5UA 3SZPA 3LQRA 1J59A 3A0SA 1O7LA 1F9NA 1IRFA 3BROA 3IWZA 2CW0F 3FM5A 4MNUA 2YR2A 5D6FA 1G3TA 3COAC 2V0WA 1EH6A 1ZAOA 4XRFA 1V4RA 5CVIA 3EDPA 3LIDA 1HW1A 1WI9A 1DP7P 3WG9A 3MXQA 3GFIA 3EYYA 4I5SA 4LG0B 3QRFF 1XDSA 3WE3A 2Z99A 2O61A 1MJ9A 5DD8A 1F9IA 3V7RA 5HD5A 3K3CA 1ZH5A 1H9TA 3F22A 2VOOA 2PG4A 2I9VA 3DPLC 1SD7A 3E4PA 5JI6A 1SAXA 4OIPF 3D0SA 2P7VB 4GYIA 4ZYHA 2E7WA 3DEUA 4P96A 5LEJA 3LI8A 3RPQA 1C0WA 3UB8A 1IN6A 2CQKA 4S05A 1KQ9A 1FPQA 3ULFA 1XN7A 2DK5A 1KGSA 5J7EA 4L9JA 3BPVA 5IT3A 4MEYF 3MQ0A 5F6FA 2P7CB 4P5OA 3W6KB 3QAHA 1IN4A 4OIOF 2VOPA 1R1UA 5DV5A 4RB1A 3IHUA 2QJ5A 3ROUA 3RYRA 2PYPA 4MN6A 1YG2A 2ESNA 1T18A 1KYWA 2L1MA 1T19A 1XCBA 2L3DA 4CICA 1EV7A 3OV8A 1QO0D 3HTUA 5D8KB 2AS5F 5IT9Z 2VXZA 3F6VA 2A69F 3I59A 5CVJA 2JN7A 5FLXK 3WGHA 2VLGA 5AVFA 4HV5A 4MQVA 4YFNF 1QPMA 2OWJA 3EUHA 4IF4A 4M9XA 2FRHA 2RDPA 3GXOA 1XCVA 2JHEA 2QM3A 1B59A 5ILVA 3OLOA 2ESHA 1N9OA 3G6OA 3GECA 4EV0A 1Z6RA 1D7EA 2PFBA 1R23A 2MLGA 3B73A 4KMUX 4RGSA 2VEAA 3VODA 2PMHA 2QQAA 2V6CA 2EB7A 3CTAA 2XAFA 1CF7B 4U0YA 5HLHA 3P7NA 3KP6A 3H92A 1CF7A 1R1VA 4U0WA 3FWEA 2Z9OA 3UMDA 2OOLA 1ZG5A 2P5LC 4QLCU 2LF7A 3CUQA 3L9FA 5DCMA 2FNPA 3NOTC 1HKSA 4HH2A 5L3FA 2KDKA 1U5TB 3K0LA 3ABTA 3R61A 2M8EA 3T5XA 3JSPA 3CLOA 1DP8A 5L3GA 1HSJA 4N0BA 4KMFA 1FWZA 4G8XA 5F1RA 5KK1A 2F5CA 2D2WA 4RAYA 4U88A 2G9WA 3PQKA 2V9VA 3TO7A 5BPIA 2FSWA 4RAZA 3FMRA 3K1NA 1P4WA 2EJRA 2WWYA 5D5VB 2B02A 4EXOA 3IKVA 2CSOA 1KU9A 2O03A 2A24A 3DF8A 1EW0A 1LVAA 2H6BA 1S67L 2QJ7A 5HDDA 4YG2F 1V9YA 1B4AA 3BZ6A 3GF2A 1TNTA 4M73A 4MTEA 2E7XA 2STTA 1YO5C 2CGPA 2WKRA 3RJPA 2FMLA 5D6EA 5JR3A 2VE8A 1O3RA 4KUKA 4XBFA 2VV7A 2FQ3A 1ZRFA 2M1BA 1O7FA 1OT6A 1LT0A 3BDDA 4L9NA 5HSQA 1FX7A 4BNCA 3S2WA 1XDUA 4WLAA 3V8JA 2R7DA 4RB2C 1BYWA 2LF8A 1T39A 2QHKA 3FC7A 4I38A 3F8NA 2PR6A 4KUMA 2CMNA 4LD5A 4AD9A 3GVAA 4EQ1A 2VN2A 3M7GA 3BWGA 2OA4A 1DP9A 2FEZA 3TO6A 2YPRA 2J5PA 3B33A 2O3FA 1PP7U 2IJLA 1K6OA 1Z05A 3DP7A 1G6NA 1XSXA 4AVPA 4P55A 4K2EA 1JHFA 1H9GA 3GLXA 2BYVE 3ZMUA 3T0YA 4DNCA 5FD6A 1Z91A 1UWPX 5KVRA 2V1DA 3RKYA 3EYIA 2A5YB 4XSZF 2FBIA 1YIOA 4FT8A 4O3MA 4O6JA 3RYPA 4KNYA 4KQDA 1FZPB 2PHYA 3WODF 3J80K 1OYWA 1MJAA 4LPZA 1KOUA 3KEQA 4IHSA 4Q4ZF 2JPBA 4DJ3A 3HOSA 2PEXA 4L9FA 4RB3C 2Z6CA 4YIIA 3LQQA 5HLGA 3I71A 3LAPA 1MDMA 3T50A 2H09A 3LIEA 1Z1DA 1VB6A 5F6AA 2HV1A 4I3AA 3ICYA 2G7UA 4JGOA 1IXCA 3K69A 1R1TA 1ODDA 1J9IA 3KLOA 1ULYA 1W5SA 2XVCA 3J81Z 1GXQA 2FNAA 5DUIA 3HRTA 3R0JA 1IXRC 1IAWA 2A07F 2HKOA 2IT0A 2W84A 2QQBA 1OTEA 2EFOA 5EEHA 5ERIA 5D4RA 2HGCA 2DLLA 1UHMA 2XAQA 3JTGA 1QBJA 4L0ZB 1FBUA 3V8KA 1HW2A 3VE4A 4HV6A 2ZMEA 2QBYA 3F1PB 1W7PA 4D0PA 1U5TC 4EJTA 1TS6A 3GYHX 5E1ZB 1FC3A 3K3DA 5TBMA 5HDCA 5CLSA 5K1YA 4IRHA 1Z7UA 1S4SA 3B02A 4PKYA 3GFMA 4ZH4F 2V9AA 2DPUA 2XKOA 1LSXA 2UXNA 4HF2A 1MZUA 5LRSA 2EA2A 2GQQA 2W27A 1K79A 3HOTA 1REPC 3R6SA 5JFRA 2VT2A 1SFEA 2QZ8A 3SQNA 5D4SA 5E18F 2CO5A 4EJUA 1W5TA 1F1ZA 3M1EA 1U78A 2Z6DA 3FMSA 2O6GE 2R7FA 4F3LA 1X0OA 3LFKA 2IP2A 5E20A 4G7OF 4EEUA 2DT5A 1TNSA 2PQ8A 1IN5A 4UHTA 1K78B 4E04A 5A8BA 2QENA 3JSOA 1I27A 2VODA 4L5IA 2LSOA 1DUXC 2L4MA 2MH9A 2JPCA 1HKQA 2PDRA 3QP5A 4ENJA 4TV7A 4EEPA 4ON0A 2OZ6A 3M8FA 3PQJA 4G9YA 1SD5A 2KJBA 4EM2A 2ELHA 1DRMA 3MQOA 1RUNA 1OJGA 3WE2A 5HS7A 2ISYA 5DCMB 3LIBA 2OBPA 3UB6A 4LRZE 4NB5A 1W7PB 2GJ3A 4XLNF 4ASNA 4Y17A 2XAGA 1P2FA 1OMIA 2XAJA 4E70A 2HYFA 4I3JA 4ESJA 2WTEA 3R60A 5LHIA 1YLFA 5FO5A 4RGXA 3HRSA 4WF0A 3VOEA 3D5LA 4HJ3A 1R00A 4M74A 4UVBA 5FD5A 3WGGA 4GHIA 2P5VA 3VE3A 2EFWA 4BH9A 3MR0A 1B6AA 3ZN0A 1XGOA 1QZYA 2YKFA 4DQ2A 1ZN2A 2A61A 1JHHA 5DD4A 2NNNA 2BASA 3K1PA 5E1XA 1BI1A 4EM1A 2PD7A 3K9TA 2J5OA 3U9GA 4EGZA 1LSWA 5HDKA 1XJ6A 6PAXA 4I7HA 4I01A 2L54A 2YX7A 3ZQ5A 1TLHB 2DBBA 3MAJA 3CJNA 4JGQA 1U8RA 2Y48A 2ZNYA 2F5DA 3LA3A 1BM9A 3BY6A 1PUEE 3TDUC 3MEXA 3D72A 3CDHA 2GA1A 1WSUA 1S4RA 1IF1A 3ZMDA 4A0YA 4R79A 2M5WA 1RI7A 2IRFG 3TOAA 4LJZF 1CGPA 2Q0OA 1ZARA 1XSDA 4BHBA 2VV8A 5LLQA 5D5XB 4N9HA 3KP3A 5FB2A 3RIRA 1LB2A 2H28A 2GXGA 4A5NA 2M45A 1P4AA 3KEOA 2R3SA 2Y75A 5ICFA 4HOBA 3RI4A 2GZWA 5KIZA 4UV9A 2ZJ2A 5ILSA 1JGSA 2EFNA 3H82B 4ETSA 2XROA 5L3BA 1HKTA 5J6XA 2M1CA 4WN5A 2J80A 3V7SA 5IU1A 3OOPA 1RIOH 3DKWA 1OYYA 2YX4A 4JK1X 3WTSC 4A6DA 1OYIA 2ZOHA 1QZZA 3C8CA 4LB5A 1BBYA 4RQ9A 1TW2A 5HS8A 5TRDA 3QOPA 3F21A 2W25A 4OU0A 1XJ4A 4PZJA 1WRJA 2Q2EA 4LLNA 4HNBA 1BI3A 1KA8A 2X0LA 4WK8F 3WTTC 3BJAA 4GW9A 4I2OA 1QGPA 2QKPA 4HP9A 2R78A 2PD8A 3QU6A 3NOUC 3LICA 3VOLA 1ZGAA 4LLGF 3KLNA 2P8TA 4G6DA 2DU9A 2A68F 3RDIA 1LSVA 1S8NA 4LFUA 4KFCA 3FZVA 4LB6B 2V1BA 5J4EA 1KQ0A 4L9VA 1OKRA 3LAJA 3FM3A 2PI0A 4OINF 5DCFA 4GHIB 2VBZA 4I02A 1I5ZA 1UB9A 2OZUA 4WCGA 1IRGA 3WTUC 4DJ2A 2HWVA 1WA9A 4GS9A 2VBXA 4CXFA 3T8TA 4LMYA 2CG4A 3FXUA 1XFQA 3FXRA 3KE2A 4L9GA 3ZMTA 4Q5SF 4HYEA 3PYPA 2UXXA 4UV8A 4HQEA 4OIRF 5ED4A 3HTSB 3BJOA 3QU3A 3NEUA 3P9IA 3H7WA 1SFXA 2YU3A 3ZN1A 5HWTA 2BEOA 3P9KA 4CGZA 4KT5C 1HBXG 2KIFA 2O0YA 3UB7A 2EA9A 2DQLA 2IW5A 3EETA 2KIMA 2DPDA 2EV6A 1GVJA 4HDUA 3KP2A 1G4DA 1ODVA 5BPDA 1BN5A 3GX4X 2EK5A 3I53A 2K4BA 5E8GA 2D45A 1TS7A 3V4GA 2QUFA 1SD6A 1IUYA 5AONA 3CO7C 5H20A 2HYGD 2VONA 3FF5A 1S1ZA 3UE6A 1LDDA 4LRXC 2Q8KA 4LK1F 2MA3A 4M71A 4HAMA 4PGHA 1J7KA 3HHGA 1P92A 3KP4A 3CUOA 2CFXA 1YW9A 1KU7A 1B9NA 2FBKA 4R70A 1FLIA 3E5QA 3F72A 4HQAA 4KDPA 2DI3A 1ON1A 3G3ZA 4AWXB 4BBUA 2RVCA 3ECHA 2NAZA 2HQRA 5BS6A 1R5GA 1IN8A 2ADUA 2B0LA 1FYMA 4F7ZA 1ZRCA 4UUVA 2FOKA 3WU0A 1GHCA 3DPTA 3O2PE 4HJ4A 1MDMB 3NJAA 3SZTA 2A6EF 3TQNA 3RH8B 1ZRDA 2NYXA 5LGUA 4HQMA 4KN7X 2W0NA 1OTDA 4CYDA 4IHTA 3L7WA 4ESFA 3MCZA 2QWSA 4EJWA 5IT9K 2VC1A 2MLKA 3MFXA 1ZG3A 2P6TA 4ENNA 2V1AA 4EJVA 1YQAA 4GGGA 1XGNA 4OMYA 1F5TA 2XGXA 5ICCA 3NOPC 4OIQF 2CWEA 4MHGA 1OPCA 5L3DA 1B1BA 2MH2A 3KCCA 4NHJA 4Y13A 2ISZA 4EQQA 3Q9VA 4WUJA 1P6RA 3F8CA 4GS9B 2PR5A 2L4RA 5J3WA 4A5MA 3IRRA 1G3SA 3SW1A 2D02A 4M72A 2DO7A 4GYGA 1E17A 4LGWA 4G7HF 1H0MA 5IS1A 2HDCA 2DFIA 4HA8A 3GO5A 4L18B 1V9ZA 2TDXA 3FG8A 2RN7A 4IRIA 3WTZA 3UB9A 1B9MA 2LDUA 2QVOA 4HI4A 1WKMA 4PCQA 5H6RA 2FU4A 1T2KA 2VBYA 4HBLA 3MQQA 2FXAA 4LG0A 4OOIA 4M9ZA 1BC7C 2X4HA 3SXYA 3JTHA 1JE8A 2P7JA 3ZMSA 1FOKA 1FP1D 4XT2A 4F3LB 4RGRA 1XD7A 3HHHA 3RTRA 3K2ZA 3TDZC 2OQRA 4BQAA 4GXOA 3PHYA 2ZXJA 1XSVA 1K7AA 1R7JA 3RKWA 5J8FA 4P9FA 3EWKA 4KICA 3MZHA 4HH3A 1I1GA 1U2WA 4WXHA 3I59B 3I64A 4ZYDA 2HTJA 4KIGA 5CJ9A 1OTBA 1I6XA 5CVVA 1DPRA 5ILUA 1D06A 2WKPA 5I5LA 1BC8C 3ZQ7A 4Q47A 2LNBA 2NNYA 4QWQA 2L0WA 1BOAA 4U7DA 4R6LA 2M87A 3P9CA 1RUOA 2MBFA 2HS5A 4Y15A 2K02A 3J7AO 4M6XA 2JSCA 3I4PA 2EV5A 3VB2A 2DQRA 4EJOA 3GZ6A 2BV6A 5BOXA 2VC0A 4UNOA 4ENKA 4HOIA 3SHFA 3HRMA 3F23A 3BY9A 1X3UA 5CYVA 2QQ9A 4RB0A 3KFWX 2MD5A 3F3XA 2HFHA 4HW0A 3T8RA 3EEHA 2ETHA 2P5KA 1F98A 3E4QA 3QP6A 2KIUA 1XJ3A 2VE9A 2C6YA 2BBYA 3HJKA 3VEPA 1ZHFA 4IPAA 1GSWA 2QBYB 3F1PA 4KN4X 1SD4A 3H9WA 1Z9CA 2RGVA 5HWVA 1ON2A 1S1YA 1U3EM 5HWWA 2CYYA 4LLOB 4I3IA 4ESBA 4IXAA 2V79A 1OJ5A 2JRTA 4BHPA 4CDGA 3HJIA 1IN7A 1AWCA 3H3UA 3LWFA 4B09A 4JBAA 3PFIA 2FMYA 5F5YA 4YWZA 1D8KA 4EVIA 4EERA 5A2QK 5TJJA 3Q9SA 1XJ2A 2NS0A 3V7CA 4M4XA 3A0VA 4XT2B 5E1WA 1S29A 1TQIA 3CUQC 3E6MA 2XHKA 3WTYC 4EETB 2GIVA 2ZOIA 3KP7A 4ZYGA 1O3TA 3N4MA 1KYZA 1W7PD 4MN5A 4HIAA 2IPQX 4A2UA 2WV0A 5AIQA 2PBIA 4A6EA 3K1MA 1TBXA 4U7BA 3H82A 1S6LA
chains in the Genus database with same CATH superfamily
4IVNA 5B1AH 3WTXC 3E0JB 2DA3A 3OS0A 4Z9QA 5AIPA 5L10A 5TR7A 4V2FA 4HZFA 4FSFA 1Y56A 1GV5A 4WXCA 2W24A 2VLAA 2Y2NA 1GHIA 2FJ1A 2V1XA 1OTIA 3OZHA 3W4OA 2A6HF 2DMTA 3ZMVA 4GCVA 4PDKA 3LR4A 1HF0A 5IYDJ 5DKKA 4Y4RA 2QLZA 2LKPA 4XNFA 1N4OA 4HX7A 1WCMJ 2XASA 2ZD8A 4DGWB 4KISA 3WWXA 1TVFA 4IQ4A 1J3WA 5HDGA 1G28A 4C30A 3ZPLA 3BFCA 1ESIA 1P9QC 5M3FJ 1LLBA 4NQWB 1XGMA 2RV8A 3E6BA 1IW7F 4BAYA 1ORKA 2EIJH 5D5UB 2L7KA 4L9EA 5DTKA 1ETXA 2VV6A 3DCFA 1WJ5A 1FR6A 3MZDA 4I09A 3VYTB 3FHZA 3E4OA 4J00A 1G3WA 5HNHA 3NAUA 3H7WB 2E60A 2DA5A 3MJQA 3BG3A 3T4JA 5KSHA 4NC6A 1B8IB 3HBRA 3V39A 1EH8A 4HLYA 1P0ZA 3L9KA 4EWFA 1QHHD 4WZ4A 1HSTA 2IA1A 5FFZA 1MSFC 5GLBA 4JGPA 3DKXA 1MGTA 3W6JB 4BJ5C 2HEOA 5DYMA 3RPUA 4CO8A 1R6RA 1DPUA 2KRFA 3LA2A 2R7RA 2J7VA 2XFTA 2E1MC 1ACIA 2J9PA 3C4OA 5F64A 4PM6A 1EJ9A 4BL2A 4HHDA 2Y2GA 3UMEA 2Y79A 4LCMA 3WTWC 1MWSA 1K6YA 1UELB 4UVAA 2IS4A 3IH8A 1ETOA 4BBVA 4NK3A 1XGIA 2XF6A 3DLAA 4MO7A 3Q5FA 2Y2PA 1F36A 3TKYA 1FIAA 1TQMA 2H0TA 4H0EA 3LR0A 5F69A 1T38A 3M3YJ 2ACJA 1VF9A 2X85A 4FX4A 5DEQA 2LH9A 4UA6A 3GSGA 3MKWB 1VNDA 3FPWA 2Y2ZA 4M3FA 3E6CC 3A3JA 5IHVA 3W3CA 4GDBA 1WHUA 2ZMEC 4LIVA 4YIFA 1U0JA 3HRUA 2W85A 1KU3A 3BW6A 4KYWA 3T4TA 4WXDA 2H27A 3S1RJ 3DXJF 1JNUA 1USSA 3IKTA 3NC8A 2K2NA 1SFUA 4ME4A 1MJBA 3ZXSA 2ZJPF 2OD5A 3LUQA 4DN0A 1ENHA 2GAUA 2L7ZA 1UMQA 1VTNC 3CC4I 3J81K 3IL2A 2K40A 1L0FA 2X6XA 2J8YA 1TS0A 3DPUA 1BIAA 5FASA 2HZDA 5E17F 1IDYA 3KZZA 1S7OA 1X3ZB 3VOZA 1FJLA 2QSHX 4II2A 5FQJA 2LR8A 4HY8A 3PAGA 2JT1A 3MSHA 4ETZA 1MH4A 3KEYA 3ZDJA 1A31A 4H6JB 3GTLJ 4N9IA 1FNNA 4FISA 4QD4A 1YMSA 4QY6A 1ZYRF 2XPVA 3ULQB 4A3BJ 1X4OA 3FX3A 2GLOA 2DRWA 3OS1A 2OJED 4EEFG 1NY0A 2GOXB 4UVCA 3M8EA 4NXFA 1XXMA 5I94A 3UB5P 1W1WE 2ZSIB 3RKXA 2FD5A 4KIBA 3ERED 1BW6A 3JYIA 4II7A 3CAXA 1BT5A 3JRGA 1RETA 4WX9A 5EG0B 3RJUA 3BZCA 2EA4A 1TQPA 2WB1N 4M6YA 3I54A 5J8CA 1Z6TA 5EFWA 3MBZA 3ZP5A 1PP8F 4BDYA 2EV0A 5EVID 3MWMA 1ZHHB 1RP5A 2RQPA 1LFUP 3BLSA 2L9NA 2MG4A 3IXHA 3OIPA 5HDSA 3JW4A 4UUSB 2ZFUA 5ICEA 5LRRA 3HLDA 2NUPC 3E3VA 3O3KA 3HUGA 1G68A 3GWZA 3EQLF 4E7HA 3HDDA 1SCWA 1PWGA 3GFJA 3JAMK 5FRMA 2EFPA 1IKGA 1T56A 3HLFA 4LRYC 5CEDA 5LFAA 2E8IA 5EEAA 2D1HA 5GHZA 1H8YA 1K25A 3F8BA 3D4FA 1YLTA 3A3FA 2WAFA 3LSGA 1BIBA 2W82A 2Z2SB 1XFNA 2OLUA 4E3LA 3CJQB 1YX3A 3J7AY 1FSHA 3IAS2 1EH7A 2EWNA 2FF4A 1DP6A 4B47A 1XKZA 3TOIA 2MJ6A 5JHFA 4I39A 1FMVA 3BR3A 3LSHA 4RS8A 1D8JA 3R4KA 1E2XA 3U1DA 5L3EA 3V3RA 4YELA 2HDQA 2R7OA 4BYYA 1BA5A 2G0EA 4FETA 3SFIA 1DU6A 2HDWA 2R4GA 2WKIA 5TFQA 3IBRA 2RKHA 3Q81A 2EZIA 3A03A 2DJIA 1TS8A 1YRNA 4EM0B 1P4XA 4Y3OA 3CCLI 4ZDOA 3KETA 4A12A 1RNLA 3C3WA 3GEZA 1FYKA 4WWCA 1IDZA 5EVIB 1SMYF 2ZBKA 3CCUI 4IJGA 2ZC2A 3DEEA 4AU7A 1LHYA 3ABKH 1OTAA 1MSEC 4LV3A 3UKGA 2YUSA 3GDIA 4OQIA 1NHAA 2WUQA 2JKRI 3F1NA 4U0VA 2COMA 1YW8A 4I0AA 4E4HA 2CV1A 2J3TD 4WEKA 4YEJA 2OCEA 1O4XA 3CJMA 3BTLA 1FOWA 1QHGA 2FUG2 1IC8A 1GA0A 2OWHA 4HLXA 1SDNA 4Y2FA 3HL2A 4LK0F 2K9QA 3GUDA 4YFKF 4R8HA 5LGTA 4MEXF 1ACFA 3D3OA 3F1OB 2X1CA 5EGOB 2Z2MB 3HSEA 3J80Z 3L2UA 3JAMZ 1FTTA 2EX9A 4RX3A 3K4BA 4BQQA 2EFQA 2ZQ9A 1GSVA 3E5UA 1T6SA 3QPTA 4EESA 4D1QA 3CUQB 2LBFB 3CMEI 3E97A 4LLLA 3LSTA 2E34A 1VEUA 4BWIA 3HSRA 3HBLA 2F6CA 2JTVA 2KJCA 3DWKA 4KA4A 3EQUA 5FI7A 1J5YA 1XX5A 3OL4A 4HF1A 2Y69H 1A5JA 3KSFA 2X6YA 1PZOA 2OSUA 2GA2A 4XL9A 4M3DA 3WS5A 4DF6A 3NDGA 4O5VA 2X9DA 3PNYA 4RLFA 3SFZA 1X1BA 2OAP1 1RC9A 4BXXJ 4CHUA 3HGGA 3JRHA 3FXQA 1EROA 2Y59A 1LEBA 4CCOA 3G4SI 2DK8A 4BUPA 2V8CA 1K83J 4NQWA 4BXUA 3PO3J 1N78A 1VQKI 1R9TJ 4X56A 2I5UA 3B3XA 4CCKA 4Y7NJ 4P0MA 2YSRA 3T4SA 4OMZA 3HG9A 2IXSA 2XSJC 3HYIA 3AL0C 4DE3A 2JZYA 5HW3A 2F2EA 2HNHA 3NULA 4KJZA 3MF0A 1YTYA 4XRMA 4G3WA 4DYQA 1R4MB 2K7LA 2ZKZA 5LBQA 2BGCA 2DW4A 1T8IA 5TBMB 3H9GA 2INWA 5G4ZA 5K5RA 1BI2A 2CW7A 5EOEA 2ZMVA 4PM9A 3NQOA 2HP9A 3W6VA 1WJFA 5B1BH 5LEKA 2L02A 5DKLA 1I1SA 5JVTA 4F91B 2XDMA 5IT5A 2HZ5A 4A3MJ 4ZC3A 3ZG5A 1D3YA 5J8XA 1VI0A 2HR3A 2CUFA 2PJPA 3IS2A 3KP5A 4HEFA 4MFEA 3I5UA 2XAHA 4I0BA 2ID6A 3KIOA 2XRNA 3PUBA 1N9LA 3QPSA 4CLCB 5HDNA 4HSRA 2HQNA 2VUMJ 3C18A 3KZYA 2H6CA 4BBTA 1D1JA 2H0YA 1TC3C 2NRAC 2UWMA 4PJ0C 1S7AA 1IGNA 2QYOA 3KX0X 2XV4S 4D7MA 4MGRA 4A0ZA 3L2VA 2W1TB 3ECOA 4HX4A 1YMXA 1U8BA 1YM1A 2D01A 2E1NA 4KIFA 4JX4A 2ZFWA 4D5FA 2ME0A 2W48A 1HOMA 3ASOH 4X68A 2KKOA 1BZAA 2M7AA 1Y54A 2JKFA 5LGNA 3W4PA 1ZREA 1H89C 5LD2C 4C3HJ 3S16J 2ZQCA 4PFOA 3QP2A 2DA7A 3S7NA 2RNJA 1WQ2A 3LNQA 3C2WA 3BY8A 3CC2I 3AL0B 4U87A 1K56A 2HGVA 1XMKA 2Y8HA 2PMZN 3H3ZA 1Y28A 1G6AA 2IWCA 2R7UA 2GZAA 5K5OA 2ZXWH 5FGMA 4B88A 3T1RA 3S3NA 4CJNA 2DMNA 4F55A 3VFZA 4DYRA 3SJMA 3PUFA 3DEWA 1U9NA 2WK0A 2YU9J 3BWLA 1X4PA 4QU3A 1YPRA 4HSTA 3SH9A 5CVUA 3GW2A 1R36A 2HTSA 5BMZA 4K08A 2K86A 5F68A 5D3OA 5DJUA 5K7FA 2H94A 5FQQA 3BFEA 4JXWA 4C6YA 3MZYA 3GTGJ 1Y8QB 2VJWA 1K57C 4B44A 3KYQA 4EW7A 4S2KA 1QA6A 3E6DA 3BJ6A 3S32A 3I4MJ 3IBJA 3IS2B 1O57A 4FHTA 2HZTA 3TMOA 1O3QA 5DUKA 1T1BA 3N8SA 2F4MB 3LY3A 1UWNX 2UZKA 4BL3A 4F3QA 5C3EJ 3REOA 2GBYA 3KSHA 3LIFA 4N1XA 1QZEA 3B6CA 3VP1A 1R5ID 1JWVA 4ARZA 2R7TA 1KVLA 1N9NA 1W79A 3RTYA 2KPMA 1BI0A 1FY7A 1HW5A 2IVMA 3KYDB 1RGZA 1MNDA 3TP3A 2V0UA 4NEED 2BG1A 3VSLA 1UHWA 3E2KA 5EECA 3SYTA 3HUMA 2OV7A 4L0YB 1FP2A 5A2QZ 1BLPA 1T1CA 4JOMA 3O8GA 3GVBA 1IG7A 2IA2A 9ANTA 4NXBA 5G4YA 4EATA 4R3AA 3L2QA 3FYZA 4ZAMA 1S3JA 2H8RA 1J09A 4MMNA 4NXGA 3O6BB 5JHUA 1FBSA 5E3OA 4KZ3A 4S2PA 2Y0MA 1NWZA 2P4WA 2VT3A 5DFYA 4KZ4A 5DJTA 2DOAA 1P97A 3LSKA 2R5ZA 4WZ5C 2CQQA 5CKTA 1PNEA 5L3CA 3FMQA 1RGYA 1ONVA 3OYDA 1RKWA 2LC2A 3AG4H 1X19A 3ZQLA 3NIAA 2JA5J 4ID4A 2MC4A 3UDXA 1W7FA 2O8XA 5F0CA 3G1MA 1MD0A 4S2MA 4WM9A 3LR5A 1ZTRA 3F0CA 3WTVC 5A90A 3OYNA 1U5TA 1YIJI 3IWQA 4QPQA 5H2FC 4H6JA 4N4OB 3TOBA 3HSFA 2ZO4A 1LL8A 3UN7A 3HXLA 1Y0NA 2HDDA 2Z33A 4XLFA 2WKEA 4QTRA 4FCFA 4N9KA 3LIAA 2BE5F 3F1OA 4KZ5A 1MBFA 2HKXA 2K31A 1YLPA 3VSKA 1QNTA 3IWOA 1L0GA 1YS6A 1OT9A 1TP4A 1ZLJA 2DTRA 3R0AA 3HUGB 4C2UA 1UZCA 2MC3A 2VQCA 5BNGA 4ZYEA 4LV0A 2E2HJ 4AIHA 4MTDA 1WJAA 1OR7A 3E5XA 5E8IA 1JUSA 1K78A 4L5JA 1ZK8A 1P9RA 2CQ7A 2VKDA 3L00A 2ZBBA 1W5DA 3HOXJ 4PSXA 1W4MA 1L3LA 1IYOA 1WPKA 2QWWA 2W57A 3A0HC 4BJPA 3IWFA 2STWA 3ZVWA 1MNMC 3H5RA 4JXGA 3JRDA 5HLIA 2PLYA 4FTXA 4HF0A 4XIDA 4G94A 1FYLA 1H8ZA 2IEKA 1DDNA 1H5XA 3CESA 2LVSA 3WU1B 4HJ6A 4ZZDA 1KVMA 1NK2P 1KU2A 3V5MA 3G34A 1SVOA 3B6AA 1Z09A 3N8RA 1UCRA 2A3SA 4RGUA 2HVSA 1FSYA 3WG7H 3BG9A 3I0TA 5KHDA 5H6QA 2J3TC 3GCMA 2M8GX 4EV4A 1LEAA 2F5VA 4E7IA 4X6AJ 4KZBA 1R58A 1VQLI 2JMWA 1RCJA 2O9LA 5GL9A 1T1AA 1S7EA 3JVUA 2HQ5A 3DQVC 4G6QA 2VBWA 2K27A 2WBMA 1YX5A 3D5RC 3IC7A 3BOQA 3ITBA 2DODA 2GOMA 4S0HB 4KZ6A 2XKPA 1TZLA 2D1VA 3BECA 3F6OA 4HX8A 3BT9A 4WL9A 1XA1A 2F5FA 2ZCWA 3LYXA 1T98A 2VJJA 2Y2QA 1XGSA 3GLLA 4MQ9F 4IO9F 4UXNA 3RPUD 1MZBA 5GLDA 2R5YB 2EX8A 3NRVA 5LHGA 1R22A 4G7ZF 4A3JJ 2XUBA 1QQIA 2P6SA 3SDGA 5BQTA 2VL8A 1R49A 3GTMJ 3CCQI 2IS1A 4AFIA 2FX0A 2COBA 4P9UA 4NXEA 2PN6A 3T4QA 3GZ5A 2PU2A 2K3PA 1TWGJ 2P9VA 1H8MA 4JQFA 5GTHC 4GO1A 1I6HJ 1BOBA 4KITB 3MKFA 2RNGA 2WAEA 3OYEA 2QA4I 1B72A 4E7LA 3V67A 2KHMA 1ZGJA 4JX5A 2VPLA 3Q82A 1U6GA 1YYVA 3D5SC 2K9MA 5HOOA 2FA5A 3MFKA 3ELKA 3T4KA 4JBFA 1AOYA 1Z3YA 2RAEA 1SAUA 1USTA 4NETA 2Z3YA 5FLXZ 5AVEA 1TW3A 2M30A 4HDVA 4A93J 1E3OC 3NHQA 3K70C 5CVRA 5F0FA 3U2RA 3JPUA 4KENB 3I58A 2IWBA 2QKLB 4PJNA 3HIFA 2HOEA 2ZMAA 4UB8C 4O01A 3G35A 3LCEA 2M4KA 4A0XA 3Q7ZA 5EEGA 2VPRA 2DYSH 1VQ9I 1ESUA 1I3AA 3CMYA 2KX6A 4ZZLA 4HG2A 5MC7A 3OYKA 1FBQA 4ENMA 2XLNA 1Y0UA 4I98B 2K4JA 5M5XJ 2X01A 2DT7B 3PAEA 5G18A 2ZB9A 5C4XJ 3PO2J 1GSXA 4XQFA 4ZJZA 4XICA 3M6HA 4KUOA 4BQNA 2FBHA 3HL9A 4Y3IA 2DCEA 3M9AA 1M1EB 3FBNB 5DTSA 5ICGA 1STZA 3L2WA 2R7QA 1WWXA 5EF6A 2HJ9C 1MNEA 3S15J 5F82A 4M9SA 1LL5A 4IJAA 3C7JA 1KZHA 5E3LA 1YS7A 3BP8A 3MD2A 5KAFC 2XSDC 3QOEA 1ZLKA 4R38A 5HARA 3N97A 2X1DA 5FDSA 5EDNA 2GM4A 2V1UA 2GXBA 3K4KA 5EZGA 2K85A 2KISA 4Z2YA 5M5YJ 1IZ1A 1JXSA 2A49A 3FKWA 2A24B 3CWFA 3ASNH 3SEZA 4F94A 3HM5A 4ZTFA 1SEUA 1NYYA 4JXVA 3UE1A 4ZTKA 4WF2A 2DAOA 3IRQA 1I2SA 1EA3A 2OU2A 2EIMH 4YINA 3QPHA 2HYJA 1FSEA 1J75A 1FEXA 4GKUA 5HS9A 1MKMA 2GWRA 3TO9A 4PM5A 5D5WB 3WGIA 2IA0A 4NBQA 5E3MA 1FIKA 3F1NB 4B8XA 4S2NA 1A04A 2K7SA 5LHHA 2CV0A 4GCZA 4EMSA 1R5HA 5FEGA 3AAFA 1QU3A 1UJ8A 2M0CA 4DYCA 5K5QA 5HVQC 2E5ZA 3T1BA 4GJ4A 4JLFA 1N75A 4DOZA 2E8JA 1DGRM 4YFXF 1T95A 5F0HA 3E2LA 2P0WA 1VHMA 1FT9A 1LDKB 2DA2A 3S17J 3HLEA 1V3FA 3UDIA 1MPLA 1ZG1A 3F8FA 1PUFB 1FCOA 1SMTA 2L0KA 2L7FP 1KQ8A 1LDJA 3CQZJ 3LA7A 4XLPF 3N7WA 3BG7A 3ML6A 1CEFA 3N8LA 3CMMA 3Q0UA 1YFHA 3P09A 2O8KA 2QMIA 4WMCD 3LI9A 1GXPA 1J9MA 4EGYA 4BBSJ 2OAZA 4C2MJ 4IVKA 4CLCE 2ZNZA 1G3YA 1V5EA 2G7HA 5FROA 3V8LA 3C1DA 2LD5A 2EINH 1RRJA 3OPPA 1TTYA 2XGEA 1BJAA 4BHCA 1S0WA 1XB4A 2IGOA 1TL8A 2F5EA 5J1RA 2JC7A 1CEGA 3MXRA 5FQKA 4AIKA 3PIPF 3JCUC 2IWDA 4OONA 1YW7A 1ETWA 4CZZA 3S3OA 2OQGA 1Z7LA 2ZMEB 1LQ1A 3SEQA 3HOVJ 1T0FA 1L0OC 4AIJA 1HXDA 4BDZA 2OC6A 1R71A 1W36C 3IH2A 2NVTJ 1CQAA 3CMAI 2V1NA 4JX6A 4JGRA 3MQOA 3ZMZA 1RZ4A 1X58A 2RC4A 4W97A 2WC2A 1P9WA 2PMUA 4S04A 1K55A 2O9CA 3M6BA 3S7PA 1LE8A 3O5YA 2M34A 3A0RA 3DV8A 3U2AA 3G32A 4BKXA 1ZR2A 3BFFA 3GFLA 2R0QC 1IV6A 3DFGA 5HD3A 3ISPA 2YKHA 4YRVA 2EZHA 2XB0X 2LKSA 1F4KA 2WKQA 2Y0SA 3UNWA 3W4QA 1HTZA 4Q48A 5C4JJ 3L2CA 4MNRA 4BEHA 4ZBEA 2XIGA 4BQMA 1VFCA 1D5VA 1LJ9A 3CDLA 4LIUA 5DFXA 3M4OJ 2E1CA 1UGUA 4R0QA 1ZTUA 4DE0A 4XSXF 3PR6A 3IF6C 3T1QB 3HC7A 1Q1HA 4FX0A 4GZBA 2XF7A 3ABUA 3TGNA 4MFDA 4B9OA 3QPLA 4HP4A 1MIJA 1UFMA 4LENA 1RPWA 3FXLA 3G1LA 4L9TA 1AKHA 1F5MA 1S66L 2L4AA 1GUUA 3F8MA 1DQUA 4R1HA 5FFXA 3CO6C 3BR5A 1NZOA 3ZQFA 2R5ZB 4PGGA 3MN2A 4IRGA 1LNWA 2FE3A 2AXLA 3G73A 1O07A 3BPXA 2DNSA 2Y2HA 1XMAA 4PKYG 3V50A 1J2XA 2PYRA 5IOYA 3ZFZA 1O3SA 3E7LA 1PDNC 2QPNA 4YIRX 1NH3A 4G3VA 3VP4A 5DDGA 5HZHA 1IXSB 1HQCA 1J0RA 2PU4A 5CTNA 5D8LB 3L09A 2L01A 2Z5UA 3SZPA 3LQRA 2EFUA 4H8RA 1J59A 5J40A 3A0SA 4FH2A 3BQAA 1HLVA 1O7LA 2J9OA 4B4XA 2JKTM 1K55C 2A3UA 1IO2A 1F9NA 1IRFA 2IAIA 3BROA 3IWZA 2ZLYA 4RX2A 5FLVA 4RM3A 2VB6A 2C6WB 3LSIA 4CSWA 2E2JJ 4X1LA 2CW0F 3FM5A 4MNUA 2D5VA 1IJWC 1BW5A 2B18A 4KZ7A 1GV2A 2YR2A 5D6FA 4N1HA 5FRNA 1G3TA 2OUMA 3COAC 2V0WA 1VM1A 3Q7VB 4XN3A 1EH6A 4M3GA 4LITA 1RR8C 1ZAOA 1HVBA 5FQ9A 4ZTJA 4XRFA 3CD6I 1V4RA 5CVIA 3EDPA 3LIDA 1HW1A 2HDRA 1WI9A 4B4ZA 5F1FA 1DP7P 2KL4A 1D0YA 3PFYA 3AG3H 2VKVA 1PZPA 3WG9A 2Y2KA 4DRTA 1SANA 3MXQA 4YFMA 3GFIA 2XD1A 2Y0SN 3EYYA 3ZR8X 5HAIA 4I5SA 4LG0B 4O0PA 5E2FA 3QRFF 2WA0A 1SVMA 2W1RA 2XA7M 3ZNTA 4DW6A 3OL3A 1XDSA 2IBDA 3WE3A 2Z99A 3S1MJ 3C38A 2O61A 4CLCA 1MJ9A 5DD8A 1F9IA 1BR2A 1YT4A 2LMDA 2XAUA 3KX2A 5J1UA 3V7RA 2NVQJ 1YAXA 2PRFA 5HD5A 3K3CA 3MKEA 4RA2A 4XLEA 1BLSA 1GCEA 5GPCA 3ITAA 1ZH5A 5GLAA 2JCHA 1H9TA 3F22A 2VOOA 3OMYA 3ZQGA 1MBLA 2PG4A 2I9VA 2M7BA 3G71I 3DPLC 1SD7A 2KDOA 3E4PA 4OQ0A 5JI6A 4G12A 3HOWJ 5GLCA 1SAXA 2ZXHA 3OCNA 4OIPF 3LEQA 3D0SA 2P7VB 3PNVA 4R4RA 4GYIA 3IUOA 4ZYHA 2E7WA 3DEUA 4P96A 5LEJA 4ABZA 1JJ8C 3LI8A 4GNUA 2M7VA 2PBYA 3RPQA 2KFDA 1C0WA 3UB8A 5IYCJ 1IN6A 2CQKA 2CQXA 4S05A 3IT9A 3ZRGA 4KQOA 3TRCA 4PHTA 1KQ9A 1FPQA 4NDLA 3G30A 4RAGA 1PI5A 3MMYB 3ULFA 1XN7A 2H10A 2DK5A 2DMQA 1KGSA 3CZ6A 3IV5A 3N05A 3S2HJ 4V2GA 3OYAA 2ZC4B 4AVZA 1O7EA 2O9BA 5J7EA 2Y55A 4L9JA 1D0ZA 1SDEA 2WZXA 4X1MA 3BPVA 5A93A 5IT3A 4U0TA 4MEYF 5CX7A 3K7AJ 3MQ0A 4I99C 5F6FA 2P7CB 3OYFA 4P5OA 3W6KB 3DTIA 3QAHA 1IN4A 3VDXA 2ECBA 1APLC 4BGDA 4OIOF 2VOPA 1R1UA 2JA6J 1X1DA 5DV5A 2QKMB 4AYBA 1XX2A 3Q1FA 4RB1A 3IHUA 2QJ5A 3ROUA 1A0KA 4OAYA 3BR0A 3RYRA 2K9NA 2PYPA 4MN6A 1A36A 1B8IA 1QRYA 4Q0IA 1YG2A 5IPAA 1IRZA 2DA1A 2MD0A 2OPTA 4HNVA 2ESNA 1T18A 1KYWA 4OOMA 2HVRA 2GX5A 2L1MA 1T19A 1XCBA 3CUEA 2L3DA 4CICA 3HOUJ 3IXGA 1PFLA 3LSMA 1EV7A 2V26A 1GDTA 3LL7A 3OV8A 4D7NA 1QO0D 3HTUA 2H1KA 1HDPA 2EZKA 5D8KB 2AS5F 5IT9Z 2VXZA 5L09A 2X6WA 1V55H 2A69F 3F6VA 2NVXJ 2EZLA 3I59A 3BQZA 3EUAA 5CVJA 2JN7A 2XQZA 4ZJ2A 5FLXK 3WGHA 2VLGA 5AVFA 4HV5A 1WYCA 2R93J 4MQVA 4YFNF 2LOOA 1AWIA 1DP3A 1QMEA 3OS2A 1QPMA 4L5EA 2OWJA 3CDIA 3N6IA 3EUHA 1WJEA 4IF4A 4M9XA 2FRHA 2RDPA 3GXOA 1XCVA 2BVMA 1JJ6C 2JHEA 2TRTA 3OWTA 2QM3A 3IH9A 2EXAA 4X53A 1YLWA 1AKHB 1B59A 2Q2EB 4XLHA 1XS9A 3ZHHA 5ILVA 3OLOA 1EWZA 2ESHA 1N9OA 5CGSA 3U4LP 2Y31A 3WRTA 3G6OA 2V6EA 2ZM0A 4EV0A 3GECA 2J3WA 1Z6RA 1D7EA 2QGUA 1IELA 2PMZA 4P85A 2PFBA 3PNTA 1R23A 1JTYA 3LO7A 1OISA 2MLGA 3B73A 4KMUX 4RGSA 3NBLA 2M7UA 1K6SA 4FE7A 5GAHJ 1IFQA 2VEAA 4S2IA 3S1NJ 3SOIA 3VODA 1VQ7I 2PMHA 2QQAA 2V6CA 4ZDLA 1IOUA 2EB7A 2KP6A 3QWLA 2R5YA 2Q9NA 1OCZH 3CTAA 2XAFA 1CF7B 3CG5A 4U0YA 5HLHA 4IHQA 5EPHA 5K5BA 2HF6A 3P7NA 3OSFA 2DFFA 2JVHA 5FEFA 1TDGA 2VK3A 4UA7A 4A3IJ 1VQOI 3HPHA 3KP6A 3H92A 5E2GA 2I10A 3PJRA 4EUVA 2VJ4A 1CF7A 1R1VA 1HD8A 3KO6A 2BXYA 4U0WA 3FWEA 3IH4A 2Z9OA 5L8MA 2HOSA 3KSGA 3UMDA 3KYZA 3DU5A 2VKHA 2OOLA 3CF5F 1TD5A 3EOIA 2NUTC 3LGOA 2XB5A 2VX8A 1PYVA 2KRCA 1LPQA 3AGEA 3Q7VA 1ZG5A 4UQIM 2P5LC 2EWWA 4GD8A 1JTDA 5EVEA 4QLCU 2LF7A 4DKIA 3CUQA 3L9FA 5DCMA 2FNPA 3C2HA 3GTOJ 3C7VA 3NOTC 1HKSA 4HH2A 5L3FA 2KDKA 2LKXA 3S22A 1U5TB 3K0LA 2ZL1A 2DDBA 2KIQA 4UY8I 1E3HA 1ERMA 3ABTA 1V5GA 3R61A 3S7OA 2M8EA 3T5XA 3PBQA 2MYSA 2Y2OA 1TEMA 3SDBA 3CLOA 3JSPA 1DP8A 5L3GA 1JWZA 3C5AA 1HSJA 2ID3A 4N0BA 1YHQI 3TBIA 4KMFA 2R7SA 1FWZA 4G8XA 1X1PA 5F1RA 5KK1A 4QJGA 2F5CA 2D2WA 3BTIA 1EKEA 2OF7A 4RAYA 3PSIA 3VYSB 4BE1A 1MKIA 4R4SA 4U88A 2G9WA 4BD1A 3PQKA 2V9VA 4FASD 3TO7A 1KE4A 3HJEA 5GAGJ 5BPIA 1WGXA 2FSWA 3OPHA 4LV2A 4RAZA 3FMRA 5EG0A 2JN6A 2L9SA 2Y2MA 3UE3A 3K1NA 3GV9A 1P4WA 1EI5A 4G6TB 1SZVA 2EJRA 3EQVA 2WWYA 5D5VB 3H0DA 2B02A 1HCRA 2UV0E 4EXOA 3IKVA 2DDAA 2CSOA 1KU9A 3MVPA 1A35A 2HOTA 5TISC 2B5RA 1Y6IA 1WJCA 4F93B 3BTCA 2HPBA 2O03A 2A24A 1JWPA 4WZ5A 4B3XA 5GAEJ 3DF8A 1X1CA 1EW0A 1LVAA 2H6BA 3HOYJ 1S67L 2QJ7A 2WV1A 1BSGA 2KZVA 5AQ7A 5HDDA 4YG2F 1ZQ3P 2CV2A 2WZZA 1XTAA 1V9YA 3RXWA 4OP8A 1B4AA 3BZ6A 3GF2A 1TNTA 4M73A 1PW8A 2O99A 4OQHA 4MTEA 1C3BA 2VGKA 2V2FF 4Q0JA 2E7XA 2AO9A 1SC7A 3GR2A 2STTA 1YO5C 2CGPA 4C3JJ 1RR7A 1OCPA 1WZ2A 2WKRA 3FV7A 3MS6A 3RJPA 2FMLA 4E6WA 2BOLA 5D6EA 5JR3A 3LMMA 1SVLA 2E35A 2VE8A 3OYGA 1O3RA 1DJBA 3Q07A 3PBOA 1UG0A 4KUKA 1Q1VA 2BVLA 4XBFA 2VV7A 2FQ3A 3VOYA 1ZRFA 2M1BA 1O7FA 1L0EA 1OT6A 5HFOA 2ZC6B 4HEA2 4NUBA 1OCRH 1LT0A 3BDDA 4L9NA 2X6OA 1FX7A 3GTKJ 4BNCA 2XK1A 3S2WA 1XDUA 3TE8A 3OYMA 5HSQA 2HDSA 2XF3A 1YJWI 3V8JA 2R7DA 2YS9A 4RB2C 1K61A 4RYEA 4WLAA 1BYWA 4FD8A 2LF8A 1JKOC 2EX6A 3DBAA 1SKFA 1T39A 2P81A 3K6GA 4E7SA 3JRIA 2QHKA 1GVDA 4O8GA 3FC7A 3ZCZA 2JA7J 1KE0A 4I38A 3F8NA 2NXNB 4IHYA 2JKTI 2PR6A 2JBFA 4KUMA 5CECA 2ZXIA 2CMNA 3TW8A 4LD5A 1V5FA 4AD9A 3GVAA 2E19A 1NRFA 1YSQA 2BLSA 2V4JC 1ETQA 2VN2A 3M7GA 3BWGA 4R23A 4EQ1A 2OA4A 3OOVA 5AQ9A 5FAPA 1DP9A 3BQ8A 4Z6YA 2XA7S 2M0MA 2FEZA 3TO6A 1FMWA 2XGNA 3BLMA 2YPRA 4JF5A 4XKBA 2J5PA 2JRMA 2G2UA 1LVKA 2VZWA 4CZCA 3B33A 2O3FA 1PP7U 2IJLA 3HKZN 3BCBA 2LLKA 2XEPA 4MLLA 5HPIA 1K6OA 3JRAA 1G6OA 3UE0A 3VMAA 3Q0VA 4CH7A 2DMUA 1Z05A 4RA7A 3ZVTA 5FA7A 3DP7A 3IWIA 1G6NA 1XSXA 3X2QH 4AVPA 4P55A 3TW6A 4K2EA 3SH7A 3BJNA 2XGCA 1PW1A 3VFFA 1JHFA 1H9GA 1ONGA 3JR9A 1ES4A 3BC8A 5FKMA 4PK4A 3GLXA 5F1JA 2BYVE 4EU0A 3ZMUA 4KG5A 2HXIA 4XUZA 4A3EJ 2JJ7A 3T0YA 4DNCA 5FD6A 1Z91A 1UWPX 3V3SA 1MWTA 5KVRA 1MWUA 3CCJI 5KMWA 3A2KA 2V1DA 3BCAA 1ONHA 2VGLS 4F52A 4QPRA 1L2SA 4X6TA 2QYBA 3C2GA 3RKYA 4BJ6C 3M2KA 1KDWA 3EYIA 2A5YB 5KSCA 3IAM2 1E3UA 3TSGA 4XSZF 1MW7A 2FBIA 5FJ8J 2CFOA 1YIOA 4FT8A 4O3MA 4O6JA 3RYPA 5JVGF 4KNYA 4KQDA 2CMPA 1FZPB 3UY6A 4BLMA 1VQMI 1RESA 3WODF 3ZQIA 3J80K 1FTZA 2PHYA 3I56I 5J1YA 3O88A 2BTFP 1OYWA 5CPRB 5FKOA 3W2AA 1XPXA 2P74A 2NS7A 1MJAA 2KRHA 3IQAA 4LPZA 1KOUA 3SZGA 3KEQA 4IHSA 1SHVA 1LFBA 2LREA 2JPBA 4Q4ZF 4J01A 2BW3B 3HOSA 3I7JA 5DF8A 2PEXA 2VIXA 4L9FA 4DJ3A 2Z16A 4RB3C 2Z6CA 3S3MA 4YIIA 4HPQA 3LQQA 5HLGA 3I71A 2W3FA 3H9JA 3BTJA 1CQTA 2K5CA 3LAPA 2F4IA 1MDMA 3T50A 4DMZA 4JP0A 1H88C 2H09A 3LIEA 1Z1DA 1VB6A 3S1QJ 2FH5A 1D0XA 1I3QJ 1VQ5I 4WELA 1POGA 5F6AA 1MWRA 2HV1A 3BQYA 3M1CA 4I3AA 4PM8A 3ICYA 2G7UA 2A2LA 4F92B 3AGDA 4JGOA 5AQAA 1IXCA 3K69A 1W63M 3LFVA 1R1TA 1ODDA 1B72B 1J9IA 3KLOA 1ULYA 4HBTA 4MBFA 1W5SA 2XVCA 1MH3A 5DTDA 5HNFA 3J81Z 5M5WJ 3QODA 4XORA 4PM7A 4XRSG 1GXQA 4FTHA 2FNAA 5DUIA 1IYSA 2W3EA 5FI6A 1G2HA 3WU2C 2FFFB 4M3KA 5M3MJ 1E3PA 1X2MA 3HRTA 3NI9A 3DLLF 3R0JA 1BL0A 5A91A 3RFBA 5JYOA 1IXRC 2VXDA 1IAWA 2ZM8A 4CYCA 2VQLA 2ZQ8A 4OLDA 2A07F 2L9VA 2HKOA 3A1YA 5B5EC 3I4NJ 4B43A 4P87A 3MKYB 2IT0A 3L7HA 2OV5A 2CUEA 2W84A 2QQBA 1EF4A 2EFOA 5EEHA 1OTEA 3EGDC 2P08A 5ERIA 3NWSA 1GHMA 5D4RA 5HL6A 2HGCA 1ETYA 2DLLA 1UHMA 3VP2A 2R7VA 3DWLE 3E0YA 5E2HA 4RDUA 5U47A 2XAQA 4P6ZS 3JTGA 3ZG7B 1IKIA 3HREA 1LKXA 2I8DA 1A6QA 1QBJA 4XOTA 4XKVA 3W2VA 1FBUA 4L0ZB 4MBHA 4IL6C 3V8KA 3DBRB 2CRGA 3UNGC 1HW2A 2P9VB 1U9OA 3PSFA 2AXTC 3K4LA 4HV6A 2ZQ7A 3OYIA 2ZMEA 1VQPI 4GOGA 2QBYA 4DIQA 1W7PA 3F1PB 4NC8A 3ISGA 4D0PA 1IUFA 1U5TC 3D1NI 3K4JA 3WRZA 1M6KA 4EJTA 3PTEA 4Y5FA 1TS6A 1BJZA 2M3AA 5E79C 1XMXA 3GYHX 2VGLM 3LEZA 1MBGA 5E1ZB 1FC3A 2DXIA 1FSWA 3K3DA 5CLSA 1JUMA 4BE0A 5K1YA 2EIKH 4DZJA 3MMHA 2XFSA 5HDCA 3VFHA 4IRHA 1Z7UA 1S4SA 2VJ5A 4IX7A 4B3AA 1BR1A 2HOAA 4NC7A 3B02A 4PKYA 1D1AA 2WYXA 3GFMA 4BY7J 4GD6A 4ZH4F 1NRJA 2V9AA 2DPUA 4ZRRA 2LY9A 2MGQA 2XKOA 2WY7Q 1LSXA 2UXNA 2VKEA 3BLYA 4UUSA 1Y39A 4HF2A 4XLAA 4BS9A 1WVRA 1MZUA 5LRSA 2EA2A 2GQQA 2CW8A 2KQRA 3GMWA 2W3GA 2W27A 4DE2A 3T1XA 2ME6A 1QMFA 3CCEI 4P6ZM 3OY9A 2KOIA 1K79A 4OP5A 3HOTA 3PIOF 1FR1A 1REPC 1BLCA 3R6SA 5JFRA 5CHJA 2VT2A 1SFEA 4L0LA 5FSRA 3WS2A 2XDVA 2QZ8A 2GDNA 3SQNA 5AJGA 3FKIJ 5D4SA 1YOVB 3DBHB 1XA7A 5E18F 2NVUB 5CEBA 2CO5A 3SH8A 4EJUA 1AXBA 1W5TA 1F2KA 4D60A 1FOYA 5HAPA 2PT7A 5GHYA 1F1ZA 3M1EA 1U78A 3ESWB 4ESPA 1R4NB 2Z6DA 3FMSA 3S8PA 2Y4AA 2O6GE 1VQ6I 4G3KA 4NG2A 1CK3A 3GTCA 2R7FA 5F83A 1PWCA 4F3LA 1X0OA 3LFKA 5DTTA 3S93A 2LY2A 3HLBA 2IP2A 3NDEA 4D9JA 1HA8A 4HNUA 1DJAA 1YQSA 1W63Q 3HOZJ 5TGFA 5E20A 4XK4A 4G7OF 4EEUA 2DT5A 1TNSA 2PQ8A 1IN5A 4UHTA 1K78B 4E04A 2XSSA 1YRNB 2H5SA 2QENA 2ZSHB 3JSOA 3O3VA 1I27A 4OLGA 4BD0A 5A8BA 1TF1A 2VODA 1K56D 1S5LC 2TCTA 2LSOA 4L5IA 4DXBA 1DUXC 2L4MA 2MH9A 3ZGAB 4W1UA 4IHWA 4XMYA 4B93A 2JPCA 1T33A 3CHWP 1HKQA 3BFDA 2PDRA 3QP5A 4ENJA 4TV7A 3B47A 4EEPA 3QHYA 4ON0A 2OZ6A 3M8FA 3PQJA 2XC7A 2VI6A 1SD5A 2KJBA 4G9YA 2ELHA 4EM2A 1DRMA 1RUNA 2LY1A 2B7EA 2MW8A 1OJGA 3IX8A 3HPGA 3QP8A 4E7ZA 2CC1A 2HPIA 3WE2A 5HS7A 2ISYA 4BY1J 1VZ0A 5DCMB 3LIBA 2GXAA 2OBPA 1OPXA 1T0FC 3O87A 3UB6A 4LRZE 4NB5A 1W7PB 2WAQN 1BR4A 4XLNF 3RZOJ 2GJ3A 2I72A 4CQHA 5KZHA 2V8FA 5TBMA 3RKQA 4ASNA 3W8KA 1S6RA 4Y17A 2XAGA 3OC2A 3PBNA 4IBXA 3DBLB 4WYYA 1P2FA 1XG1A 3G31A 5GPAA 1OMIA 3IF5A 2XAJA 4E70A 2RL3A 2X02A 2HQAA 5A92A 2HYFA 2QSFX 4I3JA 4R3BA 4ESJA 2WTEA 3R60A 1I2WA 5LHIA 1YLFA 5FO5A 1K54A 2BW3A 5DVAA 4RGXA 1D1CA 4A3LJ 3F9KA 3HRSA 5CQGA 1ALQA 1IYQA 5CQEA 2EH3A 3VOEA 4WF0A 3D5LA 4CYCB 1ERQA 4FH4A 2DFEA 1WE4A 4HJ3A 2V9KA 1K4TA 4E3KA 1R00A 4M74A 4UVBA 3V42A 4LCLA 3UO9A 2Y2JA 1HLUP 5FD5A 2V20A 3WGGA 3RCOA 2P5VA 1X2NA 3ZGKA 2OLVA 3K2NA 4GHIA 3VE3A 4LG3A 3R7WA 3I3LA 2EFWA 4BH9A 1CJFA 1MBHA 1KGEA 3MR0A 1B6AA 2L2OA 1N9BA 4OQGA 5E43A 3ZN0A 1XGOA 4DZPA 2FZ0A 4LV1A 1QZYA 4D5CA 2YKFA 4DQ2A 1E3UD 3EEAA 4CLCC 1ZN2A 2A61A 5IOZA 3HCYA 2LBFA 1JHHA 5DD4A 3G1OA 2NNNA 2KDZA 4CCJA 2BASA 1X1AA 2DN0A 3OYJA 1NG6A 3RSNA 5B66C 2CUJA 2KLIA 3K1PA 5E1XA 1OFCX 2OTLI 1BI1A 4MCWA 1DGWY 4HRIA 1Y1VJ 2QQ8A 3O8HA 3BZKA 4EM1A 1JKPC 2PD7A 3BFGA 3K9TA 2WGWB 4C3IJ 2JWTA 4X1EA 1L0DA 4OOLA 2J5OA 1SFOJ 3U9GA 1OQYA 4EGZA 3UPPA 3MKZA 1LSWA 2WKHA 5HDKA 1XJ6A 2AHQA 6PAXA 5FATA 3IHBA 4I7HA 1I39A 4I01A 2V1ZA 2L54A 3K2AA 3CCSI 2YX7A 2GNXA 2V7FA 2XR0A 1OCTC 4XR6A 3ZQ5A 2PBDP 2XF5A 2LG4A 5HODA 1PYYA 5HLTA 1TLHB 2DBBA 3MAJA 4B48A 1JT0A 3CJNA 4JGQA 2ZM2A 3NY4A 1U8RA 5EVIC 2KT0A 2QCOA 2Y48A 2ZNYA 1K38A 2NVYJ 2F5DA 3LA3A 1ZR4A 5TGTA 1BM9A 1TWHJ 3BY6A 3G2ZA 4OOYA 1PUEE 2XPUA 3AFHA 5KAIC 3TDUC 3MEXA 3D72A 3QP1A 1OCCH 2HP5A 3RZDJ 3CDHA 3LSPA 1NZUA 2GA1A 4KZ8A 1YE9A 3H35A 1WSUA 1S4RA 5AQBA 2JVGA 5EM1A 2QZ6A 1IF1A 3ZMDA 4A0YA 4R79A 4IBRA 4A3FJ 4E6XA 2M5WA 2AQFA 4N4NB 2VJIA 3TW7A 1RI7A 2NOJB 2IRFG 4GFBA 2W3HA 4KQRA 3TOAA 4KT6A 4LJZF 1CGPA 4U0XA 4UHUA 2Q0OA 4XOPA 1ZARA 5EM0A 1XSDA 2EQRA 1E0EA 4BHBA 2DMPA 2VV8A 4ETXA 2MABA 2ZQAA 5LLQA 5D5XB 4N9HA 3OYBA 2KZGA 2WY8Q 3KP3A 5FB2A 3LSRA 2Q9MA 1XP4A 4OPZA 5CXWA 4U3TA 2WADA 3RIRA 4BENA 1Z67A 1T08B 2VKSA 2CUZA 1LB2A 2H28A 1SKOB 2GXGA 4A5NA 2M45A 4FOFA 1P4AA 3GMEA 3PXPA 1JGGA 3KEOA 2A5WA 2R3SA 2Y75A 5ICFA 2EX2A 3OYLA 4OPRA 4HOBA 3RI4A 2GZWA 1XPBA 4KZ9A 5KIZA 1TWAJ 4C75A 1W36D 3DTEA 4UV9A 4ARZB 4RBOA 2ZJ2A 5ILSA 1JGSA 2EFNA 4M6VA 1ETVA 2M4GA 3H82B 4ETSA 2XROA 5L3BA 3HUNA 1HKTA 5J6XA 4DBQA 2R7ZJ 1P7IA 1ZG4A 2M1CA 4JF4A 4WN5A 4OKPA 2K3FA 3AGFA 2J80A 4P6BA 3V7SA 2JA2A 3B42A 4Y33A 4OH0A 5IU1A 4BU2A 3OOPA 4BE2A 1RIOH 3DKWA 1OYYA 2WB1A 2YX4A 4JK1X 4ITVA 3WTSC 3T4LA 4A6DA 4UQIS 4PJLA 1OYIA 3UPNA 3C7UA 4MIMA 2ZOHA 4GDFA 4IVIA 1QZZA 2GIZA 3MZEA 3TJZC 3C8CA 3EUKL 3FZCA 1TT5B 3VV4A 3H1CA 4LB5A 2ZMFA 2VQHA 1BBYA 4UB6C 3T4OA 4RQ9A 4EBNA 3A02A 1TW2A 3J7ZI 2R9XA 5HX9A 3S7QA 4PPRA 3VYRB 3DWZA 3I9V2 1ERDA 4BXFA 5HS8A 3S4XA 3K4NA 1W0TA 1VEUB 5CHMA 3CCRI 5TRDA 5FQMA 5CTMA 1UAAA 3HEFA 3QOPA 1XGJA 3S14J 4DDYA 1ES2A 3F21A 4R1GA 2VGJA 2W25A 4OU0A 3H36A 2CQNA 5EYRA 3LY4A 4D2OA 4PJMA 3QNBA 2K9SA 1XJ4A 4ZJ1A 4PZJA 1WRJA 2Q2EA 4WBGA 5L07A 4LLNA 4N9LA 3PBSA 3C2BA 5LBRA 4HNBA 1BI3A 1S9HA 1KA8A 2X0LA 3PM1A 5FKLA 5CRFA 4CCLA 4WK8F 3WTTC 4IEDA 4BMWA 1KDSA 2W7NA 3BJAA 5EZHA 4GW9A 5M19A 4IHXA 4I2OA 3FISA 1QGPA 2QKPA 1D1BA 3BM6A 3CITA 4HP9A 2R78A 2PD8A 3G2BA 3QU6A 2HI3A 3NOUC 1I50J 3LICA 2AVXA 1ZGAA 3VOLA 5EUAA 3EUHC 1UG2A 2HP6A 2RREA 4LLGF 1LI9A 1W8YA 4JF6A 3KLNA 4IOAF 4OPQA 1FQGA 1G5UA 3CJTB 2P8TA 4G6DA 5FDHA 4C2TA 2OTJI 4Y0UA 2DU9A 3RXXA 3CMZA 1MMNA 2A68F 3OR2C 1XC5A 3QYFA 3RDIA 3FDYA 1LSVA 4IUHA 4IHVA 2JA8J 2WGWA 1S8NA 4LFUA 4KFCA 1FOXA 3FZVA 2F4OB 4LB6B 4CCMA 1NG7A 3VYUB 1BULA 2E1MB 2V1BA 2HVQA 4DDSA 5J4EA 1WYBA 4RMNA 1JTGA 1KQ0A 4L9VA 5FLMJ 3A0BC 3MZFA 3ZQHA 1OKRA 2NS8A 1PRQA 5EOOA 1N25A 4ZDPA 1HZOA 3O86A 3LAJA 3FM3A 2PI0A 2BZTA 4EBLA 3SS5A 2JKGA 4OINF 1AA7A 5DCFA 1G59A 1QVTA 2KMUA 4CPKA 4GHIB 4QIWN 1ZGWA 2DTZA 2VBZA 1SKOA 1YLYA 4I02A 4K0WA 1PUFA 4Y7PA 1ETKA 4IQJA 1I5ZA 3A4CA 1UB9A 2OZUA 3ZCOA 4WCGA 3FIWA 1LE8B 4OAZA 1IRGA 3ZG8B 3W2ZA 3WTUC 4DJ2A 2HWVA 1WA9A 4GS9A 5C44J 2VBXA 3FK7A 4FCYA 4BQOA 2F48A 2E5NA 3TP0A 5FAOA 2ELJA 4CXFA 4BACA 3IP4B 4A3KJ 3CZDA 3T8TA 1FCNA 4LMYA 1BTLA 2CG4A 4GN2A 3S1YA 3FXUA 3KZIC 1XFQA 2ZC5B 1OCOH 3FXRA 5IP9J 3A01A 3KE2A 3G6EI 3MZ8A 4L9GA 4K0XA 3ZMTA 4Q5SF 1LL9A 5EE8A 4HYEA 3GTPJ 2X1EA 3PYPA 2UXXA 4UV8A 4XKCA 4ANJA 4HQEA 3VWBA 3S2DJ 1Q2QA 5JYPA 3CP2A 3K70D 2HPMA 2DYRH 2LTPA 5F04A 4OIRF 5ED4A 2XPWA 3MKLA 1JKQC 4YNRA 4E3IA 4XKWA 1RKTA 1MBJA 3HTSB 2UWXA 3FXMA 3T12B 3BJOA 3QU3A 1E4DA 3NEUA 3CPTA 3P9IA 2ZJ9A 3OIQA 3H7WA 1SFXA 1WJBA 3WS0A 2YU3A 2PX9A 3ZN1A 5DF7A 3OSGA 5HWTA 3HKZA 4B1RA 2EXBA 5K7ZA 2BEOA 3P9KA 3ZG0A 1HBXG 4KT5C 4CGZA 2Y9YA 5FAQA 2KIFA 1TWCJ 3IH3A 1K4FA 2LB5A 2O0YA 2W1TA 4DE1A 2E1OA 3UB7A 2EA9A 4E3JA 3HLCA 2C5WB 2DQLA 2A6TA 2IW5A 2LYCA 5GP9A 1WFXA 3EETA 3BRMA 2QF7A 3ABMH 2KIMA 2DPDA 1IV8A 2EV6A 3VPRA 2HDUA 4ZYAA 1GVJA 4HDUA 3KP2A 1G4DA 3KYEA 1ODVA 2QEXI 2W1OA 4Y0TA 1NJ4A 5BPDA 1BN5A 3GX4X 2EK5A 2JQ7A 2BY2A 4AUXA 4N92A 2QSGX 3I53A 4II3A 3GBGA 2K4BA 3QYBA 5E8GA 3BR1A 5IY5H 2OCCH 4A69C 2D45A 1OR7C 1S72I 5FKKA 1TS7A 3V4GA 5EV0A 2QUFA 3FBIB 3WS4A 4PAUA 1K0KA 2FFYA 1SD6A 2EPFA 1IUYA 3SS3A 5AONA 3CO7C 5H20A 3H5NA 1ES3A 2HYGD 3ZQQA 2VONA 3FF5A 1S1ZA 4FQGA 2EILH 1PIOA 3UE6A 4O7DA 5J4VA 2RCXA 1GLNA 3BG5A 4S2OA 4E3OA 1LDDA 4LRXC 2Q8KA 4WEJA 4LK1F 2W3DA 2MA3A 4IUKA 4M71A 4HAMA 4PGHA 1J7KA 3OOUA 3HHGA 4BJTA 1OJLA 1P7JA 1JVJA 1P92A 1MC0A 3KP4A 3CUOA 2CFXA 4QB8A 1YW9A 5FQIA 3UR3C 1KU7A 1B9NA 2FBKA 2ZC3B 4R70A 5IP6A 1IRXA 3RQIA 1FLIA 1KE3A 1LI0A 5DM7F 1NLYA 3E5QA 4ZDXA 2ZJQF 1FILA 3IHAA 3F72A 3CCYA 2JK3A 4HQAA 2Z1DA 3AG1H 3K4CA 4KDPA 3CCVI 4OPYA 2DI3A 2N8GA 1ON1A 2IGMA 3G3ZA 4AWXB 4BBUA 1F43A 2RVCA 5F08A 4KG6A 3ECHA 2BXZA 2IGNA 2NAZA 2HQRA 5BS6A 1R5GA 4EQIA 1IN8A 2KLOA 4EUZA 1AU7A 1AHDP 2ADUA 2B95A 1JKRC 2ZL1B 2WAQA 3LFUA 5E3NA 2DJNA 5BOHA 2B0LA 1GT0C 4A3CJ 4UAAA 4OWRB 1FYMA 3G2YA 4GLQA 3DTKA 2XD5A 1SFKA 3BEBA 4XONA 4E7JA 3MFDA 2V9PA 3FHNA 4F7ZA 4BBRJ 2EFXA 2WGVA 1DU0A 1ZRCA 4QPOA 4UUVA 2R7WA 1WJDA 5GTIC 2FOKA 3WU0A 1GHCA 1YKDA 3DPTA 3FXKA 3O2PE 3TEDA 1QPIA 4MBKA 4HJ4A 2VASA 1MDMB 5DS9A 2Y2IA 3JVVA 3FXOA 5GHXA 4MDZA 1MMDA 3HB9A 3NJAA 3SZTA 1N77A 2JUGA 2A6EF 3TQNA 1IEMA 3RH8B 3GRJA 4S2LA 1D5YA 2NYXA 5LGUA 4HQMA 2LK2A 1ZRDA 4KN7X 5EJCA 2G2WA 4A5RA 2W0NA 1PWDA 1OTDA 2ACGA 4CYDA 2BHYA 4IHTA 3L7WA 4JXSA 1MMAA 3HVFA 4ESFA 3MCZA 3IF6B 2QWSA 2PAVP 3ERMA 3H0GJ 4EJWA 3I55I 5IT9K 3ZOBA 2VC1A 1MMGA 2BHZA 2R92J 5K7HA 3BYDA 2MLKA 3Q3SA 3MFXA 5B3SH 1ZG3A 2P6TA 2Q1ZB 4X0GA 1VQQA 4ENNA 1YSPA 2V1AA 3DKYA 2DMWA 4EJVA 3L1PA 3ZYTA 1MBEA 1YQAA 4GGGA 4B4CA 4H4KC 4RM2A 1XGNA 4NNJA 4OMYA 1F5TA 2ELKA 1JI8A 2WGIA 4KZAA 3RQ4A 5CGXA 2XGXA 5ICCA 3NOPC 4OIQF 5HAQA 4PSWA 2CWEA 2X48A 1OPCA 2BY1A 4MHGA 5EGOA 1Y1WJ 1YITI 4AC0A 1IYPA 5L3DA 4GDNA 4AYBN 2H8WA 2L7MP 4BEHB 3AG2H 1BLHA 1NYMA 5FKNA 3OPLA 3A3DA 1B1BA 2MH2A 3KPHA 3QYEA 5JLXA 3R7WB 3OR1C 3KCCA 3KSIA 4NHJA 3KYCB 4XRSA 4K91A 1ES5A 1CI9A 5FL3A 4Y13A 1V54H 2ISZA 4EQQA 3JRBA 3P98A 2IGKA 3Q9VA 3CLQA 4WUJA 2JKRM 3GQZA 1P6RA 1YJNI 1GA9A 3F8CA 4GS9B 2PR5A 2OAQ1 2L4RA 5J3WA 4A5MA 1ZC2A 4ZJ3A 3ZNYA 3P01A 3IRRA 5F1GA 2B9SA 1G3SA 4GRIA 3PBTA 3SW1A 3K4MA 2D02A 4HESA 4M72A 1X3WB 2FQ4A 2L5QA 4KQQA 4EBPA 1KGFA 2DO7A 1M40A 3CPTB 4GYGA 1KONA 1E17A 3ABLH 4LGWA 4G7HF 1H0MA 5IS1A 1K4SA 2HDCA 1PJRA 2DFIA 3FKJA 4HA8A 3GO5A 4L18B 2R9WA 3E98A 1V9ZA 1K4EA 3HZJA 3CI6A 4QSHA 5KNLA 2TDXA 3FG8A 1Z3XA 1QVUA 2RN7A 1TWFJ 2RQQA 2FOWA 2LRDA 4FE4A 3H3VK 3Q0WA 4MEZA 2K9LA 4IRIA 3WTZA 3T1SA 4LOCA 4XM3A 2O9AA 3UB9A 4Z1WA 4PUSA 1B9MA 2LDUA 1PI4A 2QVOA 1Q2PA 4HI4A 1WKMA 2W4SA 4XN0A 2IS6A 4PCQA 4RLQA 4C3QA 2R7XA 4A3GJ 3M8JA 2BY3A 1FIPA 5H6RA 3OCLA 2CU7A 2FU4A 2Y30A 1T2KA 2VBYA 3OIOA 4A3DJ 4HBLA 3MQQA 4KG2A 2FXAA 4LG0A 4OOIA 3FPVA 1WI3A 2A05A 4M9ZA 1MY8A 2ECCA 3LR3A 4Y0OA 1BC7C 1K6RA 2X4HA 3SXYA 1OMEA 3JTHA 2DT6A 2PJRB 4AM3A 3QP4A 4PJJA 4FUWA 5M18A 1JUPA 2XRLA 1JE8A 2P7JA 3ZMSA 1FOKA 2H1LA 1FP1D 3OYCA 1NTCA 4AIDA 2Z2LB 3IXDA 2VQGA 3QQAA 3FK6A 4XT2A 4F3LB 3C4PA 1LUJB 4RGRA 1XD7A 3ZQCA 4PFPA 3HGYA 4NKPA 3HHHA 4S2JA 1CI8A 3RTRA 1Z6FA 3UDFA 4OVDA 4DXCA 3K2ZA 3TDZC 5J47A 2OQRA 3HLGA 5CERA 5GADJ 3VP3A 3D9YA 3ONQA 4BQAA 4GXOA 3PHYA 5DF9A 2ZXJA 1XSVA 2M2EA 1K7AA 1W5CC 1R7JA 4RAFA 3RKWA 5J8FA 2PJRA 2Y2LA 4MN7A 5E2EA 5L2FA 4P9FA 3EWKA 4KICA 3IX4A 3EGXC 3MZHA 3WHCA 4HH3A 3IX3A 1I1GA 1U2WA 2DOEA 4WXHA 4S2NC 2EWVA 3I59B 3IF6A 3I64A 3NWTA 4ZYDA 2BY0A 3U21A 2HTJA 2DFHA 1CF0A 5EVIA 3LSJA 1MMSA 4QY5A 4KIGA 5CJ9A 2ZJRF 1OTBA 4HBUA 2JUCA 1VQ4I 3H9QA 1I6XA 4XXRA 4J19A 1H3QA 5CVVA 1DPRA 5ILUA 3A3IA 2DA6A 4P1WA 2LB9A 3FWLA 1D06A 1JTXA 2WKPA 4IOCF 1BC8C 5I5LA 3GTJJ 3DAVA 3ZQ7A 2UV1A 2P04A 4V19K 1W8QA 4Q47A 3A3EA 3J7YJ 1K57A 2LNBA 2CS3A 2NNYA 3BR2A 3G4PA 3PBRA 4QWQA 2Y9ZA 5IP7J 4YOFA 4E3MA 2L0WA 1BOAA 4U7DA 3GTQJ 2M87A 3P9CA 4R6LA 1RUOA 2MBFA 2HS5A 4E3NA 1GHPA 4Y15A 1ZELA 3M07A 2K02A 2DCFA 3J7AO 4M6XA 3WS1A 2JSCA 2UUZA 3I4PA 2EV5A 3CC7I 3VB2A 2DQRA 4EJOA 3GZ6A 3HLWA 4DBRA 2X51A 5FI2A 4PMAA 3WHBA 2BV6A 5BOXA 3FXJA 2VC0A 3P5JA 2MFZA 4UNOA 4ENKA 4E6KG 4Q8IA 4IKFA 2Y91A 1H8AC 3C30A 4HOIA 3SHFA 2JE5A 3HRMA 3CUEC 3F23A 1VETB 3BY9A 2HXOA 4IEJA 1YI2I 1X3UA 3M2JA 3OPRA 2DOFA 5CYVA 3U1KA 2QQ9A 4RB0A 1MXOA 3VP0A 3KFWX 2MD5A 4IZZA 3TL4X 5HPFA 3F3XA 2HFHA 1Y4OA 4HW0A 3T8RA 4DJAA 3EEHA 4UA9A 3IXBA 2ETHA 2P5KA 1F98A 3E4QA 3N4IA 2VA0A 3QP6A 2KIUA 1XJ3A 5KCMA 2XH9A 3OYHA 1TDLA 5M1AA 2X71A 2VE9A 3BG6A 2C6YA 2EBIA 4E7KA 2BBYA 3HJKA 3VEPA 1ZHFA 4IPAA 4CUGA 3KYLA 3NECA 3OBFA 1GSWA 2QBYB 3F1PA 4KN4X 4X55A 3QNCA 1Z0XA 1W0UA 4MLOA 3FKVA 2LP0A 1SD4A 2M9HA 1OLTA 5J3LA 3H9WA 3DW0A 2JSPA 5EVLA 1NLZA 1MBKA 1LFPA 1Z9CA 2W00A 2RGVA 3NARA 4M3BA 4JKTA 4CA0A 1NXYA 4I6ZA 5HL1A 5HWVA 2MSYA 5F27A 1ON2A 2B63J 1S1YA 1U3EM 1ZKJA 4XLCA 2O7OA 3CJRB 3AKZA 2E2IJ 4QWOA 1KGGA 4Q0HA 5HWWA 3EPZA 2CYYA 1NK3P 4LLOB 4BL0B 4UUTA 4I3IA 2E71A 3H5AA 1YJ9I 1Z21A 4JPMA 4ESBA 4X69A 4IXAA 2V79A 1OJ5A 2JRTA 4BHPA 3CF2A 1ZKGA 1BUEA 4CDGA 3NCKA 2CJJA 1DY6A 1FOFA 1WH7A 2ZQDA 3HJIA 1IN7A 4HNTA 2E36A 1AWCA 3H3UA 1DJCA 2ZC7A 1WH5A 4WMCA 4QHCA 1Y8RB 3LWFA 4Y52J 4B09A 2L9RA 2O5RA 1YLZA 1JT6A 4JBAA 3PFIA 2FMYA 5F5YA 4YWZA 1D8KA 3GZNB 4EVIA 1K54C 5CGWA 4XUXA 4EERA 3BR6A 1A6IA 5A2QK 1E25A 5TJJA 3VE4A 3Q9SA 3CCMI 1VQNI 3JREA 1XJ2A 2ICWG 3ZG9B 2NS0A 2NOGA 4M3EA 4I76A 3V7CA 1HDDC 2IS2A 5E1WA 3A0VA 1S29A 4M4XA 1TQIA 4XT2B 3CUQC 3E1SA 4R3JA 3E6MA 2XHKA 3WTYC 3A01B 2AQEA 3DTMA 1ZG6A 3PL8A 4EETB 4GB7A 3DU6A 2GIVA 3JRCA 4JYKA 1ITYA 2ZOIA 5CHUA 3KP7A 4ZYGA 1I5QA 1O3TA 4X25A 2DA4A 1VETA 3N4MA 1VQ8I 1G8XA 1KYZA 3HUOA 1W7PD 3SS4A 1YLJA 4MN5A 5C5KA 5JLWA 4HIAA 1PVEA 2CH0A 2IPQX 4A2UA 3LOCA 3W2WA 5J4YA 2HU9A 3TG9A 4CCNA 1UHSA 1FCMA 3CP8A 4RVAA 3JRFA 2WV0A 5AIQA 2PBIA 5IYBJ 4A6EA 2HJEA 3MXSA 5DM6F 4UEYA 3UPOA 1Z77A 3L2RA 3K1MA 1U60A 4CLCD 1TBXA 4C9YA 2LFBA 2XGDA 4U7BA 3K10A 1HC8A 1S6LA 3H82A 1TT0A
chains in the Genus database with same CATH topology
4IVNA 3WTXC 5AIPA 4HZFA 4FSFA 4WXCA 2W24A 2V1XA 1OTIA 2A6HF 3ZMVA 4GCVA 4PDKA 3LR4A 5DKKA 2QLZA 2LKPA 4HX7A 2XASA 5HDGA 1G28A 3ZPLA 1XGMA 2RV8A 3E6BA 1IW7F