3P7NA

Crystal structure of light activated transcription factor el222 from erythrobacter litoralis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
191
Chain Sequence
b'PAQWVLDLIEASPIASVVSDPRLADNPLIAINQAFTDLTGYSEEECVGRNCRFLAGSGTEPWLTDKIRQGVREHKPVLVEILNYKKDGTPFRNAVLVAPIYDDDDELLYFLGSQVEVGMARRERAAEMLKTLSPRQLEVTTLVASGLRNKEVAARLGLSEKTVKMHRGLVMEKLNLKTSADLVRIAVEAGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase
publication title Structural basis of photosensitivity in a bacterial light-oxygen-voltage/helix-turn-helix (LOV-HTH) DNA-binding protein.
pubmed doi rcsb
source organism Erythrobacter litoralis
molecule tags Dna binding protein
total genus 62
structure length 191
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p7nA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p7nA01
2QVOA 3SZPA 5K5OA 1IN6A 2XAQA 5D4SA 4GCVA 4GCZA 3KLOA 1JNUA 5ICGA 2Q8KA 4A5NA 6PAXA 3CAXA 4RQ9A 2ZBKA 3E5XA 4B09A 2Z6CA 2EV0A 4EJUA 3B33A 4RB2C 2O03A 4YFNF 5HWVA 2A61A 3SXYA 3ZMTA 3MQ0A 4HDUA 1S66L 3KEOA 4O5VA 3R4KA 1OTDA 4RAZA 3J81K 2OZ6A 1ZAOA 2EFNA 2G7HA 2L4AA 1TNTA 3PHYA 3BWGA 2O8XA 3HSRA 4LLOB 3IBRA 1F9NA 4BH9A 3JTGA 4GHIB 2DT5A 2YSRA 1CGPA 4EJTA 1KOUA 3LQQA 5HD3A 2PMUA 4HLXA 1JHHA 2GA2A 2R7DA 4G8XA 5DUKA 1LSWA 4EMSA 3KX0X 1CF7A 4HX4A 1B9NA 3E3VA 4BXUA 3DXJF 4L9EA 1YIOA 2VE8A 1IN4A 2PMHA 1MGTA 2XAFA 4BAYA 4LG0A 2Z6DA 4YIIA 2ISZA 4HV6A 2RC4A 3E5UA 1I1GA 3MR0A 3KCCA 4GO1A 1T1BA 2M87A 3HOTA 3F1PB 1XGNA 1T1CA 3I59B 1XGOA 4ZYHA 3TO7A 5IT3A 3REOA 5FLXZ 4PKYA 2L01A 3CUQC 2Z3YA 2D2WA 1LQ1A 3ELKA 1EH8A 3E4PA 3LIFA 3RTRA 2YKHA 1BC7C 3BP8A 3RI4A 1YO5C 2STTA 4WF0A 1D3YA 2RDPA 5AVEA 1G3SA 3F1NA 1Z6TA 4I2OA 1XSVA 4MN5A 5A2QZ 1H9TA 1XMAA 2OQGA 4CXFA 3TKYA 3HJIA 4M71A 4EV0A 3HRUA 4CICA 3GLXA 2DW4A 4ESFA 4EJOA 5AIPA 4KIFA 1HKQA 5CYVA 1K78A 2C6YA 4CHUA 4XRFA 4UVBA 1P6RA 3IKTA 2LKPA 5BS6A 2UZKA 1KYWA 2EA4A 3KFWX 4L9JA 4CZZA 1R58A 1WWXA 2KDKA 1OYYA 3V8LA 1L3LA 3HHGA 1B4AA 4WWCA 3EWKA 5CLSA 5K1YA 1PP8F 5F6AA 5E1WA 1XGMA 1BBYA 4ON0A 4R1HA 1YS6A 3LI9A 1T18A 3KP5A 3JAMZ 3HYIA 4L9VA 1UHMA 2V1BA 1U5TA 3WGGA 3V8KA 4BHPA 5BPDA 4HW0A 2MH9A 3R61A 4GS9A 2FBIA 4R6LA 1XGSA 4HJ6A 4BBUA 2K4BA 2KJCA 4GYGA 4XSZF 4EESA 2L0WA 5ED4A 1FBSA 3C2WA 5JHUA 4WXCA 3RJPA 4A6EA 1P97A 5F5YA 2PYPA 2MH2A 4Q5SF 3ABUA 3H7WA 3F8CA 1EV7A 1KGSA 2M1BA 1QGPA 2YX4A 2HZTA 2QLZA 3TO9A 1O3QA 1IRFA 5DJTA 1RI7A 1HKTA 1ZLKA 1R1VA 3I4PA 1XMKA 2VOOA 3EQLF 3L09A 4KN7X 1ODVA 3F1OA 4HDVA 1TS7A 4FX4A 3ZMDA 3GWZA 2EFOA 1XJ6A 1S4SA 1VB6A 3WGHA 1V3FA 1N9LA 2OWHA 1SD7A 3LI8A 1FOKA 4HF2A 2YU3A 3FG8A 2PEXA 2NNNA 4NXGA 4WK8F 1S8NA 2CMNA 3RKYA 2B0LA 1WRJA 1LVAA 1U8RA 2RV8A 2NAZA 1W5SA 3JTHA 4HYEA 2G7UA 4NB5A 1EW0A 2IRFG 2ELHA 2E7XA 1WA9A 4KMUX 3V8JA 2A07F 1ZH5A 1GHCA 3ZMZA 1LJ9A 4LLNA 2HEOA 4H6JA 4N0BA 3HOSA 4LLLA 2VONA 4Y15A 2OAZA 1K6OA 2ZMEB 2A68F 1Q1HA 2P7CB 5DD8A 4HIAA 1FC3A 2H09A 2CSOA 2A24B 1SMYF 3UB6A 1WI9A 5DKKA 1IW7F 3WTSC 1F4KA 3KEQA 1DP9A 4E04A 4A5MA 1U2WA 4A0ZA 3A0SA 3CUQB 5IS1A 5ILVA 2JZYA 2VLGA 1HW1A 3FM3A 1RUNA 2J80A 1ON2A 3KP7A 2RGVA 4HX7A 4L5IA 1W4MA 5HS9A 1I5ZA 1LEAA 4I39A 1ONVA 1O7LA 3MZYA 4EW7A 1XFQA 2M5WA 4LRZE 3RDIA 4EXOA 3MZHA 3Q5FA 2E7WA 1UWNX 2FBKA 3TO6A 3N4MA 4KNYA 2DBBA 4LPZA 2HWVA 1ZRFA 3B73A 2WWYA 2QWSA 3GZ6A 1BYWA 1XN7A 4U88A 4CGZA 1UWPX 1IRGA 4I3JA 4KDPA 2ETHA 4MEYF 3BZ6A 5F6FA 2QJ7A 2K7LA 2V9VA 2KX6A 3FXUA 4I98B 1FYMA 5LEJA 2P5LC 4RB3C 3GFMA 4M9ZA 2W85A 1Z7UA 1I6XA 3ISPA 1ZGJA 1P2FA 2CQKA 2DTRA 1USSA 3IC7A 1Z91A 3MFKA 3MWMA 3M8EA 2H94A 4UVAA 2P7JA 1LNWA 3O6BB 1OJGA 3I59A 2OD5A 3K1MA 5L3CA 2EFQA 4EM1A 1T39A 1YS7A 1PUEE 3P9CA 3FXQA 4L9TA 4A12A 4UVCA 2FA5A 3GXOA 3C3WA 4ESBA 4L0ZB 3DF8A 3I71A 3GEZA 4A6DA 3JAMK 4JBAA 5A8BA 2VE9A 2OQRA 4O6JA 4JGPA 4U7DA 5CVRA 3SW1A 3JSPA 4AIKA 2CFXA 1LT0A 2DPDA 1GXPA 3V4GA 1J59A 2GJ3A 5DCFA 4U7BA 4IF4A 3LYXA 1FBQA 4UHTA 1B6AA 1D8KA 2HFHA 3G6OA 4R8HA 1U6GA 3WU0A 3ECHA 3W6JB 3WTXC 4HH2A 4BBTA 1JHFA 2BASA 1XDSA 2CWEA 2Z9OA 1OR7A 4WF2A 1AOYA 2VBXA 4N9IA 1LEBA 5ICEA 1R5HA 1XB4A 4P96A 4ZH4F 5F1RA 4GW9A 5LGNA 4G6DA 1DPUA 3FXRA 5IT9K 2ZXJA 2W84A 3CUOA 3HRMA 5H6QA 3QPHA 4WCGA 2XAJA 4R70A 4OU0A 3F8NA 2DK8A 1XSDA 2GXBA 2MLKA 2AXLA 3IRQA 3BY6A 4NXFA 2QBYB 1FSHA 2HQRA 4EQQA 2ZBBA 2PD7A 3F23A 4R3AA 3FHZA 5DYMA 3CLOA 5D6FA 2DFIA 1G3TA 2WC2A 5E17F 2R3SA 3UMEA 2VOPA 2OWJA 3NEUA 3LQRA 4WL9A 4MN6A 1BM9A 4YWZA 4OOIA 1OTBA 4HH3A 3PFIA 2F5EA 5EFWA 4IPAA 1O7FA 4M4XA 2LSOA 3LIDA 3KP3A 1G6NA 3K1NA 3LIBA 2W25A 2Z99A 1D06A 1BI3A 5FO5A 2ADUA 2V79A 5CVJA 2ZCWA 2XGXA 5L3FA 2V1DA 1T38A 4QWQA 4M9XA 4AWXB 4EEPA 4HF1A 3BPXA 4JGQA 4WN5A 3ZMUA 3LAJA 5HLIA 3E4QA 4PGHA 4KA4A 3UB9A 1T2KA 4KT5C 3CO7C 1O3RA 2M30A 1X0OA 3DEUA 3G73A 5F64A 1BI2A 2GQQA 2IW5A 1IUYA 2E1NA 2DI3A 3DPTA 4DQ2A 4KFCA 3BROA 2D1HA 1MJ9A 1S3JA 2X0LA 3NQOA 3Q9SA 4HQAA 1G28A 5ILSA 5HZHA 3FM5A 5BPIA 1KU7A 2CGPA 2GIVA 2PN6A 1FT9A 1LSVA 3RH8B 2QENA 4N9HA 4ENMA 3H82B 2W27A 1QZZA 4BNCA 4MHGA 4G7HF 2X4HA 2IP2A 1DPRA 1W7PD 3A0RA 2VODA 2A69F 3Q9VA 4EEUA 2ACJA 3F3XA 3GFLA 4K2EA 4P9UA 2ZMEA 4DJ2A 2RN7A 2OU2A 4JQFA 3LIEA 4Y13A 2ZNZA 2A24A 2FRHA 3OOPA 3N97A 1V9YA 1K7AA 4K08A 1MZBA 4ENKA 4RB0A 5H20A 3NRVA 1XCVA 2PI0A 3IS2B 5DCMB 3CUQA 1TQMA 1TLHB 1ZRCA 5F69A 2FF4A 2WTEA 4B8XA 2IVMA 4IJAA 2HTJA 4G7ZF 2PFBA 1RUOA 4XT2A 2QZ8A 1XCBA 3KP2A 5LRRA 3TQNA 2A5YB 2JN7A 5KIZA 4XLNF 2QM3A 5J3WA 2V9AA 1JGSA 3WTZA 3LWFA 2COMA 3GFJA 4OMZA 4KMFA 5D4RA 1LDJA 4CDGA 1J9IA 2NNYA 3ERED 3WTYC 4I09A 1FY7A 4ETSA 2EWNA 4ZYDA 1R7JA 3P7NA 5D8LB 2DPUA 4I0BA 1ZLJA 3LFKA 4LFUA 3HTSB 4AD9A 2VBYA 2XRNA 1IXCA 5EEHA 2G9WA 3E4OA 3ML6A 2EA2A 2FU4A 4KN4X 1Y0UA 3D0SA 4ESJA 1IN5A 3I64A 4EGYA 3VEPA 2Q0OA 4U0YA 1ZRDA 2CO5A 4EGZA 3WTTC 2XIGA 1YFHA 5D5XB 4ZZLA 1TS0A 5BQTA 4KUOA 2MA3A 2ZFWA 3QRFF 3T50A 1KYZA 3L7WA 4F3LB 3KZZA 3H3ZA 3LSTA 3T8RA 5D5VB 2ZOIA 5AVFA 3FWEA 4I38A 2HKXA 2DK5A 2IA0A 3H3UA 4OIRF 3GECA 1YTYA 3GVAA 2JHEA 3NJAA 2DAOA 2GWRA 3DQVC 4UV9A 2QQAA 2PJPA 5G4ZA 4HLYA 3L2CA 4IRIA 3G3ZA 2QUFA 2ZO4A 1H9GA 1TS6A 4IHTA 4LRYC 1HSTA 5HLGA 4HP9A 3D5LA 1DUXC 1U5TC 2H6CA 4L0YB 3DKWA 3EUHA 5FFZA 3T5XA 4GGGA 5D6EA 4Z2YA 2YPRA 1OYWA 1ZG3A 3LA2A 3GO5A 1AWCA 5LEKA 3MQOA 2FOKA 3RTYA 2P7VB 3F72A 5FFXA 1QO0D 2D45A 4NXEA 3ULFA 2GXGA 3ZQ5A 4RGSA 2JTVA 4S05A 1FX7A 2WKPA 5JI6A 3J7AO 2P6TA 4MEXF 3K0LA 1VTNC 1IF1A 1HXDA 3DFGA 2QBYA 1U3EM 3W6KB 4M73A 2W57A 2HKOA 2JRTA 1TW2A 1KQ0A 3BPVA 3J80Z 3NOTC 2Z5UA 3F8BA 5TJJA 4BHCA 1FZPB 2QHKA 3VOLA 2KIFA 4P9FA 2EFWA 1OT6A 3E97A 5LHHA 1S1ZA 1RZ4A 3I0TA 1EH6A 2BGCA 1R23A 3ABTA 5TBMB 1S7OA 3FMSA 4BQAA 1N9NA 2Y0MA 1ON1A 2OBPA 2H27A 1GXQA 2ESNA 4H0EA 3K3DA 4UXNA 3SZTA 1OT9A 3TGNA 4HY8A 1DP6A 4WX9A 2D02A 1KA8A 2DU9A 1TNSA 2JPCA 2ZNYA 3RPUA 4IHSA 5HWWA 4HF0A 5HLHA 4HJ4A 2RNJA 4HBLA 3GDIA 1UFMA 2OZUA 2FNPA 4DJ3A 3BDDA 2P6SA 2XAGA 2FMYA 4HAMA 1OTIA 2PQ8A 1TQPA 5FLXK 5FD6A 3GW2A 3MFXA 3EETA 3WTVC 5EEGA 1J2XA 3QOPA 1J75A 1WKMA 1XD7A 5HD5A 1Z05A 1MKMA 4NHJA 3HSEA 1P92A 3KP4A 2L02A 3HRSA 1O3SA 4EM0B 3IRRA 2PD8A 2WV0A 1XSXA 3FMQA 1G4DA 4LGWA 3FF5A 3QP5A 1OYIA 2CYYA 2MBFA 5FGMA 3GX4X 1BIAA 5DD4A 1YYVA 2OOLA 1XJ4A 3F8FA 1FYLA 3LICA 1KQ9A 4GHIA 1W5TA 3C7JA 5A2QK 2O3FA 1UHWA 4Y17A 2EJRA 3RYRA 2STWA 3CTAA 4PDKA 1FSEA 5ICFA 3JW4A 2RQPA 5E8IA 4EETB 4RGXA 1IZ1A 1R1TA 5BMZA 2HYFA 2XUBA 2XHKA 1OTAA 3V7CA 3ZN0A 4LMYA 2FXAA 1XFNA 2FE3A 2EB7A 3MJQA 3IWZA 2P4WA 4LRXC 1UCRA 5ILUA 5KK1A 4JGOA 2DO7A 2Q2EA 1ODDA 2WKRA 2D1VA 2M8EA 5CVVA 3U9GA 3VFZA 3QP6A 3F1PA 1FLIA 4RAYA 1SFEA 1IXSB 5H6RA 4O3MA 3QU6A 4ENJA 2XVCA 5DCMA 3E6DA 3BJ6A 3WODF 4L9FA 4EM2A 4RS8A 2HDCA 2YKFA 4HX8A 5J8CA 1E17A 3F8MA 1OMIA 3VODA 1IN8A 2BBYA 1TBXA 2VT2A 4M74A 1EH7A 3ROUA 5D8KB 3KP6A 1U5TB 4M72A 1WSUA 3U1DA 1QPMA 3COAC 4HI4A 2VN2A 5HS7A 4B9OA 1O3TA 1BI1A 1T0FA 1KU9A 4JGRA 3MQQA 1STZA 5KVRA 1GVJA 5HDCA 2KRFA 3DV8A 2NRAC 2EFPA 2EA9A 4Q4ZF 1FNNA 2BE5F 3H7WB 3M9AA 4HJ3A 4UV8A 2HGCA 4YIFA 2P8TA 1S67L 2V0WA 1P4AA 5HDKA 1GSVA 5TRDA 2UXXA 2HV1A 1RIOH 1FP2A 2E1CA 4F3LA 5L3EA 4S04A 1SFXA 3IKVA 4LB5A 4NQWA 1XJ2A 2DQRA 5J4EA 1TW3A 5HOOA 4RGUA 5I5LA 3J80K 3T8TA 1DP7P 1HSJA 4P55A 4I5SA 2V1UA 3VOEA 1U78A 4JK1X 3ZP5A 3FMRA 1FYKA 1P0ZA 4A2UA 1J0RA 2B02A 3HRTA 3TOBA 1Z6RA 5IU1A 1S1YA 1H0MA 4BYYA 1W7PB 3S2WA 4FX0A 4E70A 5DV5A 2L4MA 4UNOA 2Z33A 1QBJA 1ZHFA 1REPC 2PG4A 4G94A 4LK0F 1LDDA 3OV8A 1YW8A 3NOUC 1HKSA 4EERA 1R36A 3H92A 2L1MA 2W24A 3BJOA 1MDMB 4TV7A 3A0VA 1R00A 2IA1A 5HDGA 1NWZA 2NYXA 2YX7A 4U0WA 5D5WB 2Y75A 4L18B 2UWMA 4IRGA 3VB2A 3GF2A 5LGTA 4ZZDA 3LUQA 3ZPLA 4ZYEA 5DEQA 4PKYG 3B02A 1FBUA 3PQKA 4HV5A 1P4WA 2M45A 3NHQA 1XDUA 2YR2A 1Z1DA 3WU1B 3V7RA 3TDUC 1K79A 2ESHA 3BJAA 5FD5A 2V1AA 2V6CA 5J6XA 5HDNA 3HHHA 2CG4A 2H6BA 1S29A 5L3DA 2XV4S 1ULYA 3F6OA 3MCZA 4IRHA 5TBMA 2L54A 1O57A 3F21A 1G3YA 3LIAA 3HSFA 3PQJA 3CJNA 2FEZA 4KYWA 3KLNA 3VE4A 2F5CA 4EVIA 4MGRA 3RYPA 3V7SA 2FBHA 4OIOF 2VV8A 2FSWA 2K86A 4OIQF 5LBQA 1HW5A 2RKHA 2PR6A 1YW9A 2ISYA 3EYYA 1BJAA 4UUVA 2XAHA 3L9FA 1F1ZA 1Z9CA 5BOXA 4RGRA 1B59A 2LF8A 3D72A 4HA8A 2MD5A 2QQBA 1F9IA 1TS8A 5AONA 2D01A 4L9GA 4OINF 2LF7A 1DP8A 3K1PA 3NOPC 4HP4A 4MNUA 2VV7A 4I7HA 3ULQB 1KU3A 2L3DA 3M7GA 1ZARA 1J7KA 4ASNA 1JXSA 4WLAA 2O0YA 2R78A 3KE2A 5DUIA 3UB7A 4BBVA 4HQMA 3UMDA 1MJAA 2J5OA 3R0AA 1MD0A 1R5GA 5E20A 5HS8A 3ZMVA 3E5QA 5LLQA 3K2ZA 1T1AA 5ERIA 5D5UB 5J8FA 2KIMA 2R7FA 4HHDA 2ZKZA 1OPCA 2OA4A 5K5QA 3T1BA 4I3IA 3VE3A 4RB1A 3C1DA 4I3AA 4R79A 3ZQ7A 3R6SA 1ZYRF 1B9MA 3FX3A 2IA2A 4KICA 2A3SA 2HYGD 2QJ5A 3I5UA 5LRSA 4YFKF 3GYHX 5F68A 3QU3A 2I9VA 3BY9A 4AIJA 3WG9A 5DDGA 1L0OC 2VC1A 3CO6C 3O3KA 3IWFA 1FP1D 2ZJ2A 3WGIA 3LA3A 2VXZA 1SD4A 2WKQA 5E1ZB 3CDHA 5J7EA 4KIGA 1HQCA 2GAUA 4GXOA 1TTYA 4YG2F 2AS5F 3F6VA 4QLCU 1A04A 3M1EA 2K4JA 2EV6A 2F5FA 2HTSA 4WXDA 5IT9Z 5L3BA 1B1BA 2CW0F 4L5JA 2K7SA 2FMLA 4XSXF 2VBWA 1HBXG 2PDRA 1D5VA 4FHTA 2QYOA 3MXQA 2GZWA 4LJZF 2BV6A 2PLYA 1MJBA 2A6HF 3GUDA 1LB2A 2ZOHA 1YG2A 3SFZA 4A0XA 3LA7A 1E2XA 3L00A 4G7OF 3RPQA 3GFIA 4OMYA 4OIPF 4LB6B 5JFRA 4M6XA 2JPBA 1ZG1A 3TOAA 5AIQA 1FWZA 3U2RA 4HOIA 1CF7B 2QWWA 3DPLC 1W7PA 1ZGAA 4F7ZA 5L3GA 4PZJA 3IL2A 4LG0B 4PGGA 2VC0A 4KUMA 3GZ5A 5HDDA 3JSOA 1DDNA 1QNTA 4G6QA 1D7EA 1MDMA 1J5YA 2XROA 3T0YA 3R60A 2QKPA 2PHYA 4CYDA 1RNLA 2UXNA 4BHBA 3AAFA 1OJ5A 3QPTA 1ZN2A 3KETA 3EDPA 3E6CC 2DLLA 1TQIA 2BEOA 4YFXF 3ZN1A 1USTA 2LDUA 1IN7A 2IPQX 2XKOA 4IVNA 4XBFA 3I54A 4XT2B 2HOEA 2JT1A 1I27A 4FT8A 1SD6A 4IXAA 5FB2A 3LAPA 1BC8C 2KJBA 3PYPA 1S6LA 2KKOA 3H82A 3EYIA 3J81Z 1YW7A 3O2PE 3QAHA 2F5DA 3F1NB 2QQ9A 1OKRA 4NXBA 4MQ9F 5HDSA 4HOBA 3WE3A 5E1XA 2HS5A 4CO8A 1T6SA 3WE2A 2TDXA 2RVCA 1KU2A 2NS0A 5HSQA 2BYVE 1R22A 4EQ1A 4ENNA 2HR3A 2IJLA 2VT3A 1S7AA 3UE6A 2PYRA 2HQNA 1OTEA 3K9TA 4Q47A 1LSXA 1K78B 1WQ2A 2W0NA 4KIBA 3WTWC 4EJVA 3C18A 5DKLA 4MQVA 5CJ9A 3IS2A 1SAXA 1R1UA 3H9WA 1G3WA 2M1CA 3UB8A 1FPQA 1I1SA 4LLGF 1SMTA 4DNCA 1P4XA 5CVUA 3EEHA 4ZYGA 1IAWA 3F22A 4WUJA 4M6YA 4MTDA 3KZYA 1XJ3A 2EK5A 2O6GE 2XKPA 5JVTA 3ICYA 2O61A 1GSXA 2K27A 2EV5A 1YQAA 4WXHA 1X3UA 3IHUA 2VV6A 1IXRC 2H28A 5K5RA 4XLPF 2INWA 1BOAA 1PP7U 5G4YA 5LHIA 2MC3A 4GS9B 3RIRA 1KQ8A 1QZYA 2V1XA 2J5PA 4I0AA 3HUGA 4M9SA 3MAJA 5LHGA 5ICCA 2VEAA 4HZFA 3E6MA 3SHFA 5DJUA 1T98A 3BWLA 3TDZC 4A0YA 1GSWA 2KIUA 1SD5A 1C0WA 1LL8A 3CWFA 1HW2A 1T19A 4EJWA 1YLFA 4P5OA 2V0UA 1NHAA 1QQIA 1N9OA 2VBZA 3WTUC 4LD5A 2FNAA 4D0PA 1F5TA 3M8FA 2K02A 3P9KA 2F2EA 4GYIA 1D8JA 3F1OB 1BN5A 5CVIA 3ZMSA 4KQDA 1UGUA 1BIBA 2A6EF 3BOQA 2L4RA 3DP7A 2FQ3A 3I53A 5JR3A 1LDKB 2P5KA 5E8GA 2DQLA 4HNBA 5HWTA 1V4RA 3I58A 4AVPA 3HTUA 1BI0A 3MEXA 4KUKA 2IT0A 4I02A 5HVQC 1ZG5A 4I01A 4L9NA 1V9ZA 3C8CA 4G9YA 1DRMA 1MZUA 3HIFA 1UB9A 4U0VA 4AIHA 3K3CA 3BY8A 5LGUA 3SQNA 4HQEA 1PDNC 2PBIA 3K69A 4R38A 3OLOA 2JSCA 4H6JB 3FC7A 1SFUA 3RKWA 4LK1F 3FZVA 2GA1A 3R0JA 2LNBA 1Y28A 2MLGA 5E18F 2Y48A 3HJKA 2PR5A 4PCQA 3RKXA 1F98A 1JE8A 3E6BA 3P9IA 1ZREA 4Q48A 3ECOA 2XASA 1S4RA 2P5VA 4MTEA
chains in the Genus database with same CATH superfamily
3PBRA 2QVOA 3SZPA 5K5OA 1MMDA 1IN6A 2XAQA 4P0MA 4MFEA 5D4SA 4GCVA 3A4CA 4GCZA 1XX2A 3KLOA 3CCUI 1JNUA 3VYSB 1W7FA 2DA1A 5ICGA 4MDZA 2Q8KA 4A5NA 3BTCA 2B5RA 5LFAA 6PAXA 3CAXA 3KZIC 3G34A 4RQ9A 3GTGJ 2R7SA 2BY0A 2ZBKA 1KVLA 3HOYJ 4HNTA 3W3CA 3E5XA 1V54H 2E60A 4B09A 3OCLA 4R3BA 2R7WA 2Z6CA 1UG0A 2EV0A 4EJUA 3S17J 1YLTA 4KG2A 3LY3A 3B33A 2BW3B 4RB2C 2O03A 3LSHA 4YFNF 2ZC4B 5HWVA 2OPTA 2A61A 3SXYA 3ZMTA 4UA9A 3MQ0A 4HDUA 2JUGA 1S66L 3KEOA 2I72A 2WADA 4O5VA 2W00A 4S0HB 3I9V2 3R4KA 2JUCA 4B44A 4WYYA 2E1MC 5M1AA 4XRSA 1IC8A 1OTDA 3H9GA 3LNQA 1N25A 4RAZA 3J7ZI 1UHSA 3J81K 1ONGA 2OZ6A 5DTTA 4E3KA 5FASA 2XD5A 1ZAOA 2WB1N 2EFNA 5M3FJ 2G7HA 2L4AA 1Y1WJ 1TNTA 1VQ8I 3BWGA 2XR0A 3EGXC 3PHYA 2O8XA 3JRFA 2V20A 3HSRA 2OUMA 2LH9A 4LLOB 3IBRA 1F9NA 1XMXA 4BH9A 3JTGA 2DT5A 2YSRA 1MWRA 4GHIB 4S2KA 1TT0A 4ZTFA 2R5ZA 2LTPA 3O5YA 1CGPA 2LOOA 4EJTA 3SH7A 1KOUA 5DS9A 2PU4A 3PM1A 3LQQA 1JVJA 3C5AA 1Z21A 5HD3A 2PMUA 4ARZB 4HLXA 4KZAA 3GSGA 1JHHA 2GA2A 2R7DA 4G8XA 5DUKA 2LKXA 1LSWA 4EMSA 2ZXIA 3KX0X 1PJRA 1CF7A 3FPWA 2V9KA 4HX4A 3HOUJ 2R7VA 1B9NA 3E3VA 4BXUA 4BJTA 2VLAA 3DXJF 3A3JA 3OC2A 4L9EA 1YIOA 2VE8A 2W3HA 5FI6A 1IN4A 3BTLA 2PMHA 1MGTA 2XAFA 4BAYA 2E2HJ 1HVBA 3KYZA 4LG0A 1DGRM 2Z6DA 5HFOA 1FSYA 2J3TD 1MNEA 4M3FA 4YIIA 3FK7A 2ISZA 4HV6A 4ZJZA 2RC4A 1JKQC 4RAFA 3GQZA 2ZMEC 3E5UA 3BFCA 5HAPA 2F6CA 2HPIA 2WAQA 2VGLS 1ETKA 1I1GA 3C7UA 4BL3A 1MW7A 2Y59A 3MR0A 1PWCA 3GTPJ 3H5AA 3KCCA 3OS0A 1TF1A 4NEED 4D60A 4GO1A 4XQFA 1T1BA 4FCYA 3HLEA 3OZHA 5MC7A 2M87A 3HOTA 3F1PB 1XGNA 1T1CA 3I59B 2Y2GA 1XGOA 4BENA 3ABKH 2CW7A 4ZYHA 1N9BA 1EROA 3OY9A 3TO7A 3RXWA 5IT3A 1NG6A 2VJIA 2M4GA 5JVGF 1X58A 1LL5A 1D1JA 3REOA 5FLXZ 4PKYA 2L01A 3CUQC 4O01A 5J1YA 4IBRA 2Z3YA 2QCOA 2D2WA 5JLWA 3KYLA 4GB7A 3OSGA 1LQ1A 4GRIA 3ELKA 1EH8A 3E4PA 1K83J 4XL9A 4EATA 3LIFA 1PYVA 2LLKA 2XPUA 3CF2A 3NULA 3RTRA 2YKHA 4JLFA 1PFLA 1BC7C 3HREA 3E2LA 3BP8A 1K0KA 3RI4A 4S2IA 4CLCA 2DCEA 3OIOA 1VHMA 3N6IA 2VI6A 1YO5C 2STTA 4FASD 2ZC3B 4WF0A 3CF5F 4DDSA 4N1XA 1D3YA 5DFYA 4WMCA 1S72I 2JN6A 5KAIC 2RDPA 1QHGA 5TISC 2ZQCA 3MFDA 4CLCE 3T4SA 2NXNB 1G3SA 5AVEA 5TR7A 3F1NA 4AIDA 1TVFA 3KSGA 1Z6TA 4I2OA 4EWFA 1XSVA 4MN5A 3UPNA 5A2QZ 4CCNA 1S0WA 4PSXA 4M3KA 2XF5A 1H9TA 4BQQA 1XMAA 2OQGA 5E79C 2ELKA 4CXFA 4EBLA 1K4FA 3FXOA 3TKYA 1BL0A 5EUAA 3CD6I 1IRXA 3M3YJ 2O99A 3HJIA 1BUEA 4M71A 3G32A 4EV0A 3HRUA 5FKOA 5HPFA 4X6TA 5GL9A 4J01A 2EXAA 2HP6A 4MBFA 4CICA 1FEXA 3QYEA 4HSRA 3OS2A 3GLXA 2EWWA 2DFEA 4YFMA 3LL7A 2DW4A 3GR2A 4ESFA 2EX6A 4EJOA 5AIPA 4KIFA 2LB9A 2X1EA 2W1RA 1HKQA 5CYVA 1K78A 2C6YA 4CHUA 4XRFA 3D3OA 4QSHA 3S7OA 2XAUA 2BHZA 4UVBA 2ZMFA 1M1EB 1SFKA 1P6RA 3IKTA 3IXGA 2LKPA 2QGUA 5BS6A 2UZKA 1A0KA 4BQMA 3ITAA 1KYWA 2CUEA 5FQIA 2EA4A 1EF4A 3KFWX 4L9JA 4DIQA 4CZZA 2K2NA 5M5XJ 1LFUP 1R58A 4R23A 5EZGA 3ONQA 5L8MA 1WWXA 2KDKA 2XK1A 1OYYA 3PBNA 3V8LA 1XX5A 3OYNA 2W1TB 4Y0UA 5DM7F 1XPXA 1L3LA 4DMZA 2ZSHB 2JMWA 3HHGA 1IV8A 3S15J 3ZG5A 1B4AA 4WWCA 3LEZA 2QEXI 4MNRA 4BJPA 1K54C 3MKYB 3IF6A 3EWKA 5CLSA 2K9LA 1XTAA 1FIPA 2NVUB 3BFGA 2MD0A 5K1YA 2Y69H 1H8MA 1UJ8A 3P5JA 1PP8F 5F6AA 2W7NA 5E1WA 1XGMA 1SDEA 1BBYA 4ON0A 4AFIA 3GCMA 4R1HA 5EDNA 1YS6A 1RKTA 3LI9A 2L9NA 3QYFA 3FXKA 5FLVA 4KQOA 1T18A 2W48A 3KP5A 3HYIA 4L9VA 1UHMA 3JAMZ 2CJJA 2V1BA 1U5TA 4P6ZM 4IBXA 3WGGA 2E1OA 3V8KA 2NVTJ 1ES4A 4BHPA 5BPDA 4HW0A 2MH9A 1Y8RB 2CUZA 2LR8A 3R61A 4UEYA 4GS9A 2FBIA 3TOIA 4KZ9A 4R6LA 1XGSA 1RGYA 1KGGA 4HJ6A 4BBUA 2K4BA 4Y7NJ 2KJCA 2VL8A 4GYGA 4XSZF 2R7RA 2H10A 4GKUA 4EESA 2L0WA 1NTCA 1FBSA 4E4HA 2AQEA 2BY1A 5JHUA 4WXCA 5ED4A 3C2WA 1TWAJ 3FV7A 1QHHD 3JR9A 4RA7A 1G6OA 1JUMA 3RJPA 4A6EA 1P97A 2X02A 2PYPA 3O87A 5F5YA 3UNWA 2MH2A 3IH2A 4Q5SF 2G0EA 3ABUA 3EUHC 1PZPA 4KG5A 4NDLA 3H7WA 3F8CA 1EV7A 4X56A 3OYBA 1KGSA 3FBNB 5EE8A 2M1BA 1QGPA 2YX4A 5EG0B 2PX9A 1TL8A 2HZTA 4CQHA 2ID3A 2QLZA 3AG4H 1ZR4A 3TO9A 3OYJA 1O3QA 1IRFA 5EF6A 3BG6A 2Y2QA 5DJTA 4FQGA 1RI7A 1HKTA 1ZLKA 1R1VA 1UG2A 4MIMA 1FMVA 4DZJA 3H9QA 3I4PA 3U2AA 1XMKA 2R4GA 3CJTB 4N4OB 3MKZA 2VOOA 3EQLF 3L09A 1P9RA 5B3SH 5C44J 1NJ4A 4KN7X 1IKIA 1PI4A 4F55A 1ODVA 1K4EA 4D7NA 4HDVA 1TS7A 3F1OA 5HL1A 1QPIA 4FX4A 1Z77A 2GXAA 2EX9A 3ZMDA 3GWZA 2EFOA 1XJ6A 1S4SA 5HAIA 1VB6A 5B5EC 3WGHA 2M4KA 1V3FA 1V5FA 2XF7A 1N9LA 5TGFA 2OWHA 4XLFA 3OYKA 2NS8A 1SD7A 2LFBA 1FOKA 3LI8A 3T4JA 4HF2A 2YU3A 3FG8A 4BU2A 2PEXA 2DA5A 2NNNA 2ZM0A 5E2FA 1Y0NA 2E1MB 1AU7A 1UAAA 4WK8F 4NXGA 2V7FA 5EM1A 1S8NA 5IP6A 2CMNA 3K7AJ 2G2UA 4QU3A 3RKYA 5EVID 2B0LA 1WRJA 4K0XA 3ZGAB 1LVAA 1U8RA 2RV8A 2NAZA 4F91B 3HLFA 3KIOA 3LFUA 5FKLA 1W5SA 4XOPA 3JTHA 4HYEA 2G7UA 3LFVA 3PXPA 4LV1A 2QYBA 5CQGA 5FLMJ 4UQIS 2ELJA 2KL4A 2W1OA 2IGNA 1NXYA 4NB5A 1EW0A 1A6IA 3BR3A 1MSFC 2QHKA 4HPQA 2M2EA 2IRFG 5FROA 2ELHA 3NBLA 2E7XA 4BY1J 2VUMJ 1WA9A 2NUTC 2KT0A 4KMUX 2WGIA 1BA5A 2PRFA 3V8JA 2A07F 2HXOA 4A3EJ 2K9QA 4KENB 1YITI 4ZDOA 3C4OA 1VQKI 1FOXA 2E8IA 1ZH5A 1GHCA 3ZMZA 1RKWA 4X25A 3ITBA 1LJ9A 4LLNA 3R7WB 2FFYA 3B42A 2HEOA 4H6JA 1YKDA 1BOBA 4I99C 4N0BA 1OPXA 3FXMA 3HOSA 1IJWC 4LLLA 2VONA 1N78A 4Y15A 3O3VA 2OAZA 3CCYA 1K6OA 2LMDA 1Q1HA 2A68F 2ZMEB 2P7CB 1NZOA 3DKYA 5FL3A 2UWXA 3DWZA 5DD8A 2XD1A 4HIAA 1FC3A 5FDSA 1Y1VJ 2RNGA 2J3TC 3HEFA 2E8JA 3ASNH 2H09A 4CZCA 2CSOA 3AKZA 2A24B 2XB0X 1SMYF 1NK3P 3UB6A 1CK3A 2X6YA 3K4LA 5D3OA 1WI9A 4CH7A 5DKKA 1IW7F 4DE2A 3OYCA 3WTSC 3K4NA 4XMYA 4BE2A 2A5WA 1F4KA 3MS6A 3KEQA 1DP9A 4PJLA 5FAPA 4HBUA 4DF6A 5J8XA 4E3LA 2VIXA 2K85A 1PZOA 4E04A 2R5YB 2DMQA 2VJ4A 4A5MA 2XSDC 4FH2A 4FOFA 1U2WA 4A0ZA 4ZTJA 3A0SA 3CUQB 5IS1A 5ILVA 2H5SA 2JZYA 2VLGA 3UE0A 4XLCA 1HW1A 3FM3A 4Y3OA 4E7KA 1RUNA 3S14J 2J80A 1ON2A 1OLTA 3GV9A 5GHYA 5EJCA 3KP7A 2DMNA 2H0YA 1I3AA 2Y2LA 2RGVA 4HX7A 4L5IA 1W4MA 3KYDB 5HS9A 3SEZA 4DYCA 2BY3A 2H8RA 1I5ZA 1LEAA 3TMOA 2VGKA 4I39A 3JRGA 1YLWA 1ONVA 2CMPA 3M2KA 3ZVWA 3WS4A 1O7LA 3MZYA 1NLYA 2PMZA 4OP8A 2H8WA 2M5WA 1XFQA 4EW7A 5F1FA 2BW3A 4LRZE 3RDIA 4E6XA 3IAS2 1TZLA 3MZHA 3Q5FA 3FISA 1W0UA 1MBJA 2E7WA 4B43A 4EXOA 1UWNX 4OWRB 2OSUA 4AU7A 4XIDA 2FBKA 4E3MA 3K4JA 3TO6A 3N4MA 4KNYA 2HU9A 2KP6A 2VK3A 2DBBA 2KISA 3JRCA 4C2TA 2HWVA 4LPZA 1ZRFA 5IYDJ 3B73A 2DYRH 1DY6A 5HPIA 1G8XA 4CYCB 2WWYA 2HJEA 2QWSA 1SC7A 3OPPA 4D2OA 3GZ6A 1BYWA 1J9MA 2ZC5B 1XN7A 2X6OA 2GZAA 4U88A 3CJMA 5EOEA 4CGZA 1UWPX 1RPWA 1IRGA 2DCFA 3PSIA 4KDPA 4CCKA 4I3JA 4U0XA 2ZB9A 2ETHA 4ARZA 5JHFA 5IP7J 4MEYF 1MWUA 1IO2A 3BZ6A 3GMEA 5F6FA 2Y0SA 4QPRA 3FBIB 2QJ7A 2K7LA 2V9VA 1LHYA 1EKEA 2KX6A 3GRJA 5CGXA 1YAXA 3FXUA 4Y4RA 4II7A 2WKIA 4BEHB 3HXLA 1ENHA 3OYLA 4G3WA 4I98B 1FCNA 5U47A 1FYMA 5LEJA 2EQRA 4ZYAA 3IV5A 4RB3C 2P5LC 1YJ9I 3GFMA 4DGWB 4M9ZA 2W85A 1Z7UA 1I6XA 2XA7S 3ISPA 4C9YA 4Q0JA 4OOMA 1OCRH 4JX4A 3H5NA 4OPZA 1ZGJA 3HL2A 3EUKL 1P2FA 3NECA 2EZLA 3HBRA 2CQKA 2DTRA 2QF7A 1FTTA 1USSA 1HDPA 3IC7A 3E0YA 1Z91A 3MFKA 1P9QC 3WWXA 3MWMA 1HLVA 3M8EA 1XGIA 4QY6A 1W36D 2H94A 1R5ID 4UVAA 2P7JA 1LNWA 2EIKH 3VP2A 1BR2A 3O6BB 4B48A 3CJQB 1OJGA 3I59A 2OD5A 3K1MA 4WZ4A 3ZDJA 3C4PA 5L3CA 2EFQA 4EM1A 3VYTB 2DMTA 1IV6A 2HZDA 1NY0A 2EWVA 1T39A 1YS7A 2UV0E 4OKPA 1PUEE 4CCLA 3T1SA 3P9CA 3FXQA 4ZC3A 5HARA 3B3XA 3PUFA 4L9TA 4UVCA 2FA5A 4A12A 3GTQJ 3WS2A 1D1BA 1R4NB 3GXOA 3C3WA 4ESBA 3D1NI 4L0ZB 3DF8A 4UY8I 3I71A 4C2MJ 1K57A 4FSFA 3GEZA 4LV2A 4A6DA 2LYCA 3NDEA 3JAMK 4JBAA 4XUXA 5A8BA 3TP3A 2VE9A 2OQRA 4O6JA 4JGPA 4U7DA 3JRAA 1C3BA 5CVRA 2CQXA 3SW1A 3JSPA 3DLLF 3IH8A 2M7AA 4J00A 3LR0A 4Z9QA 2ICWG 4C3HJ 4AIKA 2CFXA 1OFCX 2DPDA 1LT0A 3DU6A 4P1WA 4DZPA 1GXPA 4LV0A 5M5YJ 1IG7A 2JA7J 3V4GA 3G1OA 3FDYA 1J59A 5DCFA 1FOWA 2LY2A 4IF4A 4U7BA 2GJ3A 3LYXA 1FBQA 4CLCD 4UHTA 4AM3A 3JRHA 1XC5A 4K91A 1B6AA 4JOMA 2O9LA 3CZ6A 2X1DA 1W8YA 5F1GA 1LE8B 1D8KA 2HFHA 3S32A 3G6OA 3JYIA 4R8HA 4XOTA 1U6GA 2K3FA 3WU0A 1Z6FA 4RX3A 3ECHA 3W6JB 3WTXC 1I6HJ 4HH2A 2VB6A 1BLHA 1F2KA 3TRCA 1F36A 4BBTA 4OLDA 2E71A 4LV3A 1JHFA 2BASA 3WS0A 1XDSA 2CWEA 2XB5A 4FTHA 2LBFB 2F5VA 4ITVA 2Z9OA 1OR7A 2Y2ZA 2GNXA 4RLQA 1XA1A 3M8JA 5L07A 4DOZA 4WF2A 4IQJA 3OYHA 2VBXA 1AOYA 3IWQA 3D5SC 4N9IA 5IPAA 1IDZA 1LEBA 5ICEA 3M6BA 4A5RA 1R5HA 2IS2A 4OAYA 4BY7J 1XB4A 4P96A 4ZH4F 5F1RA 5F08A 1MBKA 1YJNI 2GDNA 1PI5A 4GW9A 5LGNA 5KCMA 4G6DA 1RCJA 1YM1A 2HPBA 1DPUA 2M3AA 3FXRA 1UMQA 5IT9K 2ZXJA 1EI5A 2W84A 3CUOA 3HRMA 5H6QA 2K3PA 3QPHA 5F1JA 4WCGA 2OLUA 2XAJA 2WAEA 4NUBA 5E3LA 5J3LA 1R4MB 4OU0A 4BKXA 5HLTA 1BJZA 3CCQI 2FOWA 1ONHA 4R70A 2MJ6A 4U3TA 3F8NA 3S1MJ 1CF0A 1H5XA 2J8YA 5FA7A 2DK8A 1IDYA 3DCFA 2X6XA 1XSDA 2GXBA 3K2NA 2MLKA 2KLIA 1YQSA 2AXLA 2Y2PA 4IUHA 3IRQA 1YI2I 3BY6A 1ACFA 4BDZA 4NXFA 5J1RA 2QBYB 1FSHA 3N8SA 2ZM8A 5FQ9A 2HQRA 4EQQA 4BBSJ 1ZTRA 4AC0A 2PD7A 3F23A 2W3DA 2ZBBA 4R3AA 5EPHA 3FHZA 5DYMA 3CLOA 1QVTA 4E6KG 3T1RA 5EVIC 1TWCJ 2VGLM 2PMZN 4A3LJ 5D6FA 2PAVP 3A3EA 2DFIA 1G3TA 2WC2A 3HPGA 5E17F 1JWPA 2QKMB 2R3SA 3UMEA 4YIRX 2VOPA 4IZZA 2KZGA 1A36A 1O4XA 3FKWA 4EUVA 2OWJA 3NEUA 3BFDA 3LQRA 4WL9A 1ETXA 2DA7A 4II3A 1ES5A 4MN6A 5F04A 1BM9A 1I50J 4YWZA 3HLCA 4OOIA 1D1AA 2DOAA 1OTBA 4HH3A 5C3EJ 3PFIA 2QQ8A 4YNRA 1WCMJ 4OPYA 2F5EA 4A3CJ 5EFWA 4M3BA 3JRBA 1L0GA 3A1YA 2EXBA 2RCXA 3EOIA 1YRNB 1YLPA 4IPAA 1O7FA 3V39A 4M4XA 2LSOA 2EINH 3LIDA 1VQ5I 2X1CA 4OQGA 3KP3A 2Y8HA 1G6NA 3K1NA 3LIBA 4IJGA 2HOSA 2Y2OA 2AHQA 2W25A 2Y0SN 2E35A 2Z99A 1HCRA 3I4MJ 1D06A 1E3OC 2J3WA 1BI3A 5FO5A 2EX8A 2ADUA 2V79A 5CVJA 2ZCWA 4KZ5A 2XGXA 5L3FA 5EG0A 2V1DA 2VJWA 3N7WA 3SH8A 1W1WE 1T38A 3L7HA 4QWQA 3PL8A 4M9XA 4AWXB 4EEPA 4HF1A 3LR5A 2XF6A 3BPXA 4JGQA 3O88A 4M6VA 1K6SA 3QP1A 3VP1A 3PAGA 4MBHA 5CGSA 4IX7A 4WN5A 3IAM2 3CCVI 2TCTA 3ZMUA 3LAJA 4FE7A 2GM4A 3IX3A 5HLIA 3E4QA 4S2OA 3RSNA 2MSYA 4PGHA 4KA4A 3UB9A 1T2KA 2BZTA 1VZ0A 1O07A 4KT5C 3CO7C 1O3RA 3BZKA 2M30A 4IO9F 1X0OA 3DEUA 3G73A 3MZ8A 1BI2A 5F64A 2JA8J 2GQQA 2LRDA 3S7QA 2IW5A 1IUYA 1R6RA 3Q1FA 5AQBA 4DE1A 4RX2A 2Q9MA 2E1NA 2HQAA 2DMUA 3HGGA 4B93A 2DI3A 3DPTA 4DQ2A 4KFCA 1ETYA 3BROA 1ERMA 2D1HA 3BQYA 1MJ9A 1PRQA 2XGCA 4P87A 1S3JA 2VQHA 4JF5A 2EIMH 2X0LA 3NQOA 3Q9SA 4XKVA 4HQAA 1SKOB 4BD0A 3IH4A 1G28A 1KE4A 3CC2I 5ILSA 3RCOA 2XSJC 2BTFP 2HDRA 2XQZA 1AXBA 5HZHA 3FM5A 2BVLA 5BPIA 1VQNI 5EEAA 1KU7A 2CGPA 2GIVA 4D7MA 5K7HA 3SEQA 3DAVA 3IXDA 4AYBA 2PN6A 2VGJA 4ZAMA 1FT9A 4Y2FA 4AUXA 3ZRGA 3BC8A 1MPLA 1LSVA 2OTLI 5FQMA 2QENA 4N9HA 3RH8B 2G2WA 1TP4A 4ENMA 1HTZA 2GLOA 2AXTC 3H82B 3BG9A 3BLSA 3B6CA 3D5RC 2W27A 2CU7A 5KZHA 3QPLA 2M9HA 5FKNA 5JLXA 4MMNA 1IKGA 1K61A 1QZZA 4BNCA 4R4SA 4MHGA 4G7HF 3MBZA 5AQ9A 2X4HA 1N75A 3UN7A 5GAGJ 2PBDP 3CCJI 3EUAA 5CTMA 2IP2A 3CJRB 4S2NA 1DPRA 1RESA 3VE4A 5L2FA 3R7WA 4XKCA 4DBRA 1W7PD 4A3DJ 4LCLA 4FISA 4F52A 1M40A 4E3NA 3A0RA 4A69C 2VODA 2A69F 3DTIA 3H9JA 3Q9VA 3C7VA 4EEUA 1VNDA 2ACJA 3S1NJ 2DDBA 3F3XA 3GFLA 2MW8A 5FRMA 4ZDPA 4K2EA 4P9UA 3NWTA 2ZMEA 5GHZA 2C5WB 1ZELA 2Q2EB 2A6TA 2RN7A 2CS3A 2OU2A 4BMWA 4DJ2A 3CZDA 4JQFA 2XH9A 2V8CA 2X51A 3DBHB 3S7NA 3LIEA 3VP3A 4Y13A 1FCOA 3PBOA 2ZNZA 3OR1C 4E7SA 3UKGA 1DU0A 4HG2A 2A24A 2DOEA 4KZ6A 2FRHA 1NLZA 3OOPA 4JX5A 4DJAA 2IWCA 3N97A 3H0DA 1V9YA 1K7AA 4NC7A 4K08A 5DF7A 3UDFA 3VV4A 3LGOA 1MZBA 4ENKA 3HLGA 4X6AJ 3NARA 3PUBA 3AG3H 4RB0A 4RMNA 1A5JA 5H20A 2R5YA 3NRVA 1XCVA 2PI0A 1GV2A 3A2KA 2ME6A 1W36C 4LIUA 3IS2B 1K56D 5DCMB 3VWBA 1MMAA 3LCEA 4I6ZA 3CUQA 1H88C 1TQMA 1TLHB 4X1MA 1ZRCA 5F69A 3FZCA 3ZYTA 2FF4A 1B72B 2WTEA 4B8XA 2IVMA 2CV1A 2R0QC 4B3XA 2WKEA 1K55C 4IJAA 2ZSIB 2HTJA 5IT5A 4G7ZF 2PFBA 2Q1ZB 5CKTA 1RUOA 2Z2LB 4XT2A 3IUOA 3HUOA 1K6YA 1XCBA 2QZ8A 4BDYA 1PWDA 3QHYA 5AQAA 4ZDXA 3KP2A 5LRRA 1ZTUA 3TQNA 3PR6A 2A5YB 4I76A 4PJNA 5HX9A 5FDHA 3RQIA 2JN7A 5KIZA 1F43A 4XLNF 2QM3A 5J3WA 4RVAA 2V9AA 3ZG7B 4PUSA 1JGSA 5CEDA 3C2BA 3WTZA 2VA0A 3MVPA 3LWFA 4DN0A 2COMA 1JJ8C 1CJFA 1YIJI 3GFJA 4OMZA 4DXCA 3TJZC 4CYCA 4KMFA 5D4RA 1LDJA 1WPKA 4CDGA 1EJ9A 1J9IA 1H8ZA 3QNCA 4PJJA 3MKEA 3G35A 2NNYA 3ZQGA 3ERED 4CLCC 3WTYC 1U8BA 4I09A 3AGEA 1FY7A 4ETSA 2EWNA 4ZYDA 1R7JA 3P7NA 5D8LB 3PTEA 2DPUA 2JC7A 4I0BA 1MSEC 4NK3A 1ZLJA 4ETXA 5EOOA 4EU0A 3LFKA 2XFSA 3OYDA 1OQYA 4LFUA 5GPAA 3VP0A 1BLCA 3HTSB 2ZQAA 4AD9A 2VBYA 1KE3A 5CRFA 2XRNA 1IXCA 1X2MA 4XNFA 2G9WA 5EEHA 3ML6A 3E4OA 3JREA 1WJBA 1PW1A 3BG3A 3L9KA 2EA2A 2FU4A 3UE3A 3OWTA 4XN3A 4KN4X 1Y0UA 3D0SA 4BEHA 3DU5A 3PFYA 3VSLA 4ESJA 1IN5A 3I64A 4RBOA 3VEPA 4EGYA 3S2HJ 2OC6A 3Q7VB 3MSHA 2Q0OA 2W4SA 2M0CA 3IHBA 4U0YA 3TBIA 1ZRDA 1FIKA 3BYDA 1MBGA 2CO5A 3NC8A 4EGZA 3DKXA 1PWGA 5IHVA 3WTTC 2XIGA 1YFHA 4PHTA 5D5XB 4ZZLA 1HD8A 1TS0A 3T4LA 5BQTA 2XF3A 4Y7PA 1IYPA 4K0WA 4KUOA 5CX7A 2MA3A 1MBEA 1SVOA 2ZFWA 4R4RA 2Q9NA 3BR0A 3QRFF 2TRTA 4B47A 3CCMI 2PJRB 3T50A 1KYZA 3L7WA 4JXSA 4F3LB 3KZZA 2V8FA 2X71A 3H3ZA 3LSTA 2Z16A 3T8RA 1DQUA 5D5VB 2ZOIA 1NG7A 4NQWB 3Q07A 5AVFA 4IL6C 4V2GA 4D5FA 2Y2IA 3RXXA 5EGOA 3FWEA 3TL4X 4I38A 2HKXA 3MMHA 1MKIA 3NI9A 1J09A 2DK5A 4BXFA 1A6QA 2IA0A 4NKPA 3H3UA 4OIRF 5FATA 3GECA 4CJNA 2KRHA 5KNLA 1GCEA 1ZR2A 2W3FA 1YTYA 3GVAA 3PNTA 2EZKA 2JHEA 3NJAA 4DE3A 1AWIA 3NY4A 2DAOA 3MMYB 3BFFA 2GWRA 3DQVC 4UV9A 2QQAA 4Z6YA 4F3QA 2PJPA 5G4ZA 2J9OA 4HLYA 2VX8A 3L2CA 1Y39A 4IRIA 4X53A 1Y6IA 3G3ZA 3WS5A 2QUFA 3AL0C 4PM7A 2KRCA 1DP3A 2ZO4A 1H9GA 3ABMH 1TS6A 1S7EA 4IHTA 3OS1A 4LRYC 4AYBN 1N77A 4E3OA 2NUPC 1HSTA 5DTKA 5HLGA 1TT5B 2F4IA 2RL3A 3HL9A 4HP9A 3D5LA 3L1PA 3CMZA 2Z2MB 1DUXC 1U5TC 2H6CA 4H8RA 4UUSB 4L0YB 3DKWA 3EUHA 5FFZA 1ACIA 2IXSA 1LE8A 3T5XA 3UY6A 1D0YA 2IGKA 4BLMA 2HDSA 2HNHA 1CQTA 2J7VA 2V6EA 3S93A 5DFXA 4GGGA 3CQZJ 1W5DA 5D6EA 2FUG2 4Z2YA 5C4JJ 2NS7A 2R7TA 4OQHA 2LBFA 1R9TJ 2YPRA 1OYWA 1AKHB 4DRTA 1ZG3A 3LA2A 5GADJ 3ZGKA 3SDBA 3GO5A 3CPTB 1AWCA 1U9OA 5LEKA 4OQ0A 2NVYJ 3MQOA 2FOKA 3QODA 3RTYA 2P7VB 4Y33A 3F72A 3PO2J 5FFXA 2H0TA 1QO0D 4LCMA 3E1SA 2D45A 4NXEA 2WAQN 3ULFA 2GXGA 3ZQ5A 2VQLA 1L0EA 2NOGA 1S5LC 3IHAA 4W97A 1HLUP 3VMAA 3SZGA 2QSFX 3NAUA 1MIJA 2HVQA 2DOFA 1POGA 1E25A 1XGJA 3ZG8B 4MFDA 4XKBA 3S16J 3S1QJ 2L5QA 4RGSA 5FI2A 2JTVA 1LL9A 5AJGA 3SOIA 3B6AA 4S05A 4HRIA 4JBFA 3TSGA 1MBHA 1FX7A 2VASA 2W82A 4A3IJ 2WKPA 5JI6A 1LVKA 3J7AO 1IOUA 2IWDA 2P6TA 4MEXF 3LSJA 2R92J 1HDDC 4G3VA 3VP4A 3W2VA 3K0LA 2XGEA 1VTNC 3OL3A 1IF1A 5A90A 1VQ6I 1HXDA 2Z1DA 4C75A 1X2NA 3DFGA 4N4NB 1VETB 2CQNA 4E7HA 2QBYA 3BLMA 4GNUA 4QIWN 4S2LA 2XA7M 3GBGA 1U3EM 3W6KB 4M73A 4WZ5A 2W57A 2CW8A 2HKOA 2JRTA 3HUMA 2X6WA 1E3UA 1TW2A 3DTEA 1KQ0A 3AFHA 2LY9A 3HM5A 2W3GA 3BPVA 3J80Z 1T08B 3CUEA 5LBRA 3V67A 2KDOA 1JT0A 1JTYA 1JUPA 3NOTC 3Q82A 1MBLA 3DLAA 2Z5UA 2KMUA 3F8BA 5TJJA 4BHCA 3QWLA 1FZPB 1BSGA 1G68A 1K38A 2KIFA 4P9FA 2JKRI 5HODA 2EFWA 2JKRM 1OT6A 3VOLA 1FCMA 2B95A 3E97A 5CERA 3E2KA 4OH0A 1SEUA 3KSFA 1X1AA 2P08A 5LHHA 1S1ZA 1RZ4A 1G5UA 3I0TA 2AQFA 4V2FA 1ES2A 3BECA 1EH6A 5H2FC 2R5ZB 3IX4A 2A3UA 2BGCA 3WG7H 1VQLI 3CI6A 1R23A 3ABTA 4MCWA 5TBMB 1S7OA 1PVEA 1ETWA 3FMSA 3UB5P 1RR8C 5E3OA 5G18A 4BQAA 1N9NA 1UELB 2KQRA 2VJ5A 1QU3A 2Y0MA 1YRNA 2ZJQF 1ON1A 2OBPA 3F9KA 1GXQA 1WJCA 2ESNA 2VKDA 4H0EA 2H27A 3K3DA 4UXNA 4IVIA 3OSFA 3SZTA 1OT9A 3TGNA 5HNFA 4YEJA 4HY8A 3W2WA 1DP6A 4WX9A 2H1LA 1KA8A 2DU9A 1TNSA 2M0MA 5DM6F 2L9VA 5J40A 2JPCA 1I2SA 3N8LA 2CRGA 2ZNYA 3RPUA 1I3QJ 4XM3A 1B8IB 4IHSA 5HWWA 4HF0A 1X4PA 1OISA 5HLHA 2IAIA 4IKFA 2XSSA 2COBA 1JKOC 3IH9A 1DJCA 2RNJA 2LY1A 4HBLA 3EEAA 3GDIA 4HJ4A 1UFMA 5A93A 2OZUA 2BLSA 1ERDA 2FNPA 3U4LP 2OV7A 4DJ3A 3GVBA 2XPVA 3BDDA 2P6SA 2XAGA 5E3NA 2WGWB 2FMYA 4HAMA 5GAEJ 1OTIA 2LREA 2PQ8A 1ETVA 1VM1A 3UDIA 3S3OA 1X4OA 3IWIA 1TQPA 2L7ZA 3ZOBA 5FLXK 3H0GJ 4OOYA 2DJIA 5JYPA 5FD6A 2JVHA 1H8AC 3GW2A 3MFXA 1KE0A 4Q0HA 3EETA 3WTVC 3A01B 4JXGA 4F93B 5EEGA 1J2XA 2OTJI 4QWOA 2IEKA 4HBTA 1Z0XA 3QOPA 4Y0TA 1Z09A 1J75A 1WKMA 1XD7A 4IEJA 4J19A 4XICA 5FKKA 3KYQA 3BRMA 5HD5A 1Z05A 4IEDA 3KSIA 1MKMA 4NHJA 2RAEA 3V50A 4X0GA 3HSEA 3MKWB 1P92A 2JA6J 3KP4A 1LI0A 2L02A 1MNDA 3HRSA 5GPCA 1O3SA 1XP4A 3OBFA 4EM0B 3IRRA 2PD8A 2WV0A 1M6KA 3AGFA 1XSXA 3FMQA 1G4DA 5IP9J 1SKOA 4LGWA 4M3EA 3FF5A 4BL0B 4OOLA 5E2HA 3QP5A 1OYIA 2CYYA 2MBFA 3CMYA 1JKRC 4PSWA 5FGMA 3WU2C 4P6BA 2AO9A 3A02A 3OYMA 2M7VA 3GX4X 1BIAA 5DD4A 1YYVA 1IELA 3T1QB 2OOLA 4N9LA 2ZXWH 1XJ4A 1XXMA 1T33A 3F8FA 4GDNA 1FYLA 3CDIA 3LICA 2WY7Q 3OYGA 1KQ9A 3LR4A 3V3SA 2O7OA 2BG1A 4CLCB 2E34A 1NH3A 2DRWA 1W5TA 4GHIA 3C7JA 5A2QK 2O3FA 1YE9A 1UHWA 3S1RJ 4LITA 4Y17A 2EJRA 3RYRA 2STWA 3K4CA 3CTAA 3IP4B 4PJ0C 3G71I 4E3IA 3K10A 1TWHJ 4PDKA 2WK0A 2O8KA 1FSEA 5ICFA 3JW4A 1GHMA 4MLLA 1CQAA 2WGVA 4HSTA 2RQPA 5E8IA 2JJ7A 3LSGA 4RGXA 1IZ1A 1X1PA 3CCEI 4EETB 1R1TA 2O5RA 2CQQA 2HYFA 2JWTA 2M34A 3BTJA 3K70D 2XUBA 5BMZA 1A31A 2XHKA 1OTAA 1ZG4A 3V7CA 3ZN0A 3OIQA 4LMYA 2FXAA 3HZJA 1OCTC 5FJ8J 2FE3A 3W2AA 1MY8A 1NRJA 2EB7A 1W8QA 1XFNA 3A3DA 3MJQA 2IBDA 3IWZA 2DTZA 5E2EA 2P4WA 4LRXC 3IXHA 5DF8A 1UCRA 1LUJB 5ILUA 5KK1A 4X1LA 1KDSA 3CDLA 1WYBA 3DWKA 4JGOA 1T95A 5EM0A 4ZBEA 3SS4A 2DT7B 2DO7A 2L7FP 4QPQA 2MYSA 2Q2EA 1ODDA 3IH3A 5TGTA 2HGVA 4L0LA 3CCSI 2WKRA 2D1VA 1YSQA 3JRDA 1WJDA 1JI8A 1ITYA 3D9YA 2M8EA 3BR2A 3ZQHA 5CVVA 2ZC7A 2WA0A 3A03A 3U9GA 5M5WJ 3VFZA 2JA5J 3QP6A 5M3MJ 3F1PA 4OPRA 4BE1A 1FLIA 5DF9A 4RAYA 2V9PA 4WBGA 1SFEA 4U0TA 1IXSB 5H6RA 4PK4A 1OCCH 1VEUB 4O3MA 5DTDA 2DMPA 5FEFA 3QU6A 4ENJA 2E2JJ 3JVUA 2V1NA 2XVCA 2K5CA 3X2QH 5DCMA 3E6DA 3BJ6A 3CP8A 3WODF 4BS9A 3CCRI 3GTMJ 1RRJA 4OP5A 4MLOA 3T4TA 2FQ4A 1ZKJA 4L9FA 4EM2A 2P9VB 4RS8A 1B72A 3LEQA 3UPPA 3MXSA 3HKZA 2HDCA 3FKVA 2YKFA 3ASOH 1GDTA 1F5MA 4C30A 4W1UA 3PNVA 2JKTI 2JKTM 2J9PA 4HX8A 5J8CA 1E17A 3AL0B 3HLWA 1JWZA 1T8IA 3F8MA 4DXBA 1OMIA 1P7JA 1IN8A 3VODA 4NETA 4PPRA 2BBYA 2WY8Q 2WYXA 1TBXA 2VT2A 5F83A 4M74A 2Y9YA 1EH7A 4KT6A 1FQGA 3ROUA 5GTHC 5D8KB 4UA7A 2HVRA 3KP6A 2DA2A 2FJ1A 1J3WA 2XGNA 5CPRB 1U5TB 2WAFA 4UB6C 3IF5A 1OJLA 4HNVA 3ZXSA 4M72A 1WSUA 1A35A 2EZHA 3U1DA 1QPMA 4WMCD 3SS3A 2R93J 4EBPA 5FI7A 3COAC 4HI4A 1QZEA 2VN2A 5HS7A 4B9OA 1O3TA 1BI1A 1T0FA 1KU9A 4JGRA 3MQQA 1JGGA 4GOGA 2UUZA 1EWZA 1FSWA 1STZA 2ZMVA 1Q1VA 5KVRA 1GVJA 2K40A 3N8RA 5HDCA 2KRFA 2HDUA 3DV8A 4GDBA 2NRAC 5EVLA 4BQOA 2ZJPF 4ZJ3A 3DWLE 1RGZA 2EFPA 2AVXA 2EA9A 4Q4ZF 1FNNA 2BE5F 3H7WB 5GHXA 3M9AA 2EFXA 1GA0A 1X1DA 2YUSA 3VSKA 1ZK8A 3U21A 2Y9ZA 1WZ2A 1SZVA 5E2GA 4HJ3A 4UV8A 3HJEA 2DODA 2HGCA 2XGDA 3KX2A 1S9HA 2F4OB 4Q8IA 3SYTA 1OR7C 5E43A 5FAOA 4YIFA 5CXWA 2P8TA 1WHUA 1S67L 2V0WA 2KIQA 3BG7A 1P4AA 5HDKA 4ZJ2A 1GSVA 3PBTA 5GLDA 4JX6A 4G12A 5TRDA 3ZVTA 1WI3A 2UXXA 1X1CA 2JA2A 3IBJA 2CQ7A 2HV1A 5GLAA 1RIOH 2ZL1B 4XKWA 1FP2A 2W1TA 3IWOA 3HBLA 2C6WB 2I8DA 1YLZA 4YINA 1PIOA 2EZIA 2E1CA 2PJRA 1K25A 2XLNA 2HZ5A 1G6AA 4F3LA 5L3EA 1PYYA 4S04A 1S6RA 2OCEA 1FOYA 1Z3XA 3I56I 1SFXA 1TWFJ 3IKVA 5GAHJ 4LB5A 1IEMA 4NQWA 1XJ2A 4BXXJ 2DQRA 2VXDA 3A0BC 5IY5H 3QPSA 1VQPI 3CCLI 3HLBA 4BJ6C 5J4EA 2A05A 3NWSA 2DA3A 2JKGA 1TW3A 1KGFA 1IYSA 1H89C 4XLAA 2NVXJ 3OYFA 5HOOA 4RGUA 2IS6A 2CV0A 5I5LA 3BW6A 4E3JA 3J80K 2CUJA 3T8TA 3TEDA 3EQVA 4S2MA 1DP7P 1HSJA 2FX0A 4P55A 2JVGA 4I5SA 4PM6A 2V1UA 3Q81A 4ESPA 4LG3A 3VOEA 1U78A 4JK1X 4R0QA 3OYAA 3ZP5A 3OYIA 2O9CA 3SH9A 1GV5A 3FMRA 3GZNB 2DFFA 3V42A 4XRSG 1FYKA 1P0ZA 4A2UA 2Y4AA 2DXIA 4GFBA 4U87A 1J0RA 1MMNA 3DEEA 3HRTA 2B02A 4ID4A 3TOBA 4IHYA 1Z6RA 1FIAA 1YMSA 2P04A 4JXWA 5IU1A 3DW0A 5KMWA 1S1YA 3FHNA 1H0MA 4BYYA 1XA7A 1W7PB 3W8KA 3S2WA 5EECA 2VZWA 4FX0A 4BACA 4E70A 1V55H 2R7QA 5DV5A 2L4MA 4UNOA 4UUSA 2Z33A 5F0HA 1QBJA 1ZHFA 4UHUA 5IYCJ 1REPC 1CI8A 4R1GA 2ZFUA 3S22A 2PG4A 4G94A 3GTOJ 4RLFA 4LK0F 2Y2MA 1LDDA 1Q2PA 2QA4I 3OV8A 1ERQA 3JRIA 1YW8A 2DJNA 3MZEA 1HKSA 3NOUC 4EERA 2R7XA 3E0JB 1R36A 2RQQA 4PJMA 1IRZA 4CCOA 2E5ZA 4A3KJ 4O0PA 4R3JA 3H92A 1Z67A 3UE1A 4CSWA 2L1MA 4RM3A 2W24A 3BJOA 1LFBA 1MDMB 3CPTA 2KFDA 5KHDA 3ZNTA 2UV1A 5CTNA 2VPRA 4PM5A 3LMMA 2F4MB 5FQJA 4TV7A 3A0VA 2MG4A 3KYCB 3PIPF 3CHWP 4H4KC 4D1QA 1SKFA 2Z2SB 1R00A 5BOHA 2LP0A 2IA1A 5HDGA 3N4IA 1NWZA 2NYXA 2YX7A 4U0WA 5D5WB 4OLGA 2Y75A 3QNBA 3FKJA 4L18B 2UWMA 3G2BA 4IRGA 1YLYA 3VB2A 1JJ6C 1TEMA 3GF2A 5LGTA 1W63M 4ZZDA 3LUQA 5B1AH 3ZPLA 5F82A 1E3HA 4N92A 4ZYEA 3PAEA 3CMAI 5DEQA 4PKYG 2EILH 2HOTA 4FUWA 3B02A 1FBUA 3PQKA 3PSFA 4HV5A 2KOIA 1D1CA 1P4WA 3W6VA 2M45A 3NHQA 2OCCH 1XDUA 1VETA 2YR2A 1Z1DA 3T1XA 3IX8A 3HKZN 3WU1B 3V7RA 3DEWA 3TDUC 1DJBA 1GUUA 3K6GA 3HOVJ 4MN7A 1VQQA 3G1MA 1K79A 2ESHA 3BJAA 5FD5A 1W63Q 3VYUB 3ZQQA 5EYRA 4QB8A 1YPRA 2KLOA 2V6CA 1E3UD 4X1EA 2V1AA 5HNHA 4DDYA 2R7UA 4B3AA 5J6XA 5HDNA 1EA3A 3HHHA 2CG4A 4C3IJ 2LD5A 2H6BA 3G2YA 3MKFA 5GP9A 4BD1A 1OCZH 1S29A 5L3DA 2HYJA 3K4MA 1WE4A 2XV4S 3O8GA 1ULYA 3BT9A 4YELA 3GMWA 2KHMA 2K9MA 2VPLA 3F6OA 3MCZA 3IT9A 4IRHA 5TBMA 2L54A 1O57A 1WYCA 5M19A 2OAP1 4DBQA 3F21A 3K70C 2OJED 1WH5A 1G3YA 1G2HA 1JWVA 3AGDA 5F27A 3LIAA 4Z1WA 4Y5FA 2I10A 3HSFA 5DVAA 2EBIA 2OF7A 2CV2A 3PQJA 3CJNA 2DA4A 2FEZA 4KYWA 3BCBA 3KLNA 3OMYA 1IFQA 2QZ6A 4E7LA 4A3JJ 3DBAA 2F5CA 4EVIA 4IVKA 1TDLA 4MGRA 3VPRA 2HPMA 4S2NC 3RYPA 3V7SA 2FBHA 4OIOF 5BNGA 4E7ZA 1PUFB 1U60A 2VV8A 2E19A 2FSWA 2K86A 2XDVA 4OIQF 5LBQA 1MC0A 1B8IA 1HW5A 2X85A 4KZ7A 5CHUA 2RKHA 2DMWA 3EGDC 2PR6A 4G3KA 4OQIA 1MMSA 4V19K 3RPUD 1YW9A 2ZJRF 3OCNA 4CCJA 4JF6A 3WS1A 2ISYA 3JCUC 2IS1A 3EYYA 1BJAA 5K7ZA 2WGWA 4JKTA 3W2ZA 4UUVA 3LSMA 2ZJ9A 1TWGJ 2P74A 2XAHA 3L9FA 1F1ZA 1E3PA 2HOAA 1ETQA 1WFXA 3G31A 1Z9CA 4OVDA 5GLBA 3C2GA 3EPZA 2HI3A 3A01A 3HGYA 5F0CA 2X9DA 1K55A 2HDQA 5BOXA 4HEFA 4FH4A 4RGRA 4XUZA 3S7PA 1B59A 3DBLB 4AVZA 3QOEA 2LF8A 3SJMA 5GTIC 3D72A 4HA8A 3CG5A 1AHDP 2MD5A 4BBRJ 1KZHA 2QQBA 1F9IA 4YOFA 5L09A 2GOMA 1SAUA 3C38A 1MXOA 1TS8A 5AONA 1KDWA 2D01A 4L9GA 4OINF 2LF7A 1DP8A 3K1PA 2V2FF 3CESA 1ZGWA 3NOPC 5TFQA 4FETA 4HP4A 1MNMC 2M7UA 4MNUA 2VV7A 5F0FA 2GIZA 2LK2A 3TP0A 3BR6A 4I7HA 3ULQB 3D4FA 3HUGB 1KU3A 1MH4A 2JSPA 1W5CC 2L3DA 1YJWI 1Z7LA 4GD8A 1BW5A 2XRLA 1FMWA 4KZ8A 4QD4A 3M7GA 1RC9A 4D9JA 1L0FA 3GLLA 1ZARA 2R7ZJ 4EV4A 1J7KA 5EV0A 5J4YA 5IYBJ 2ZD8A 4ASNA 1JXSA 4WLAA 4FE4A 1JTGA 4D5CA 2O0YA 3Q7ZA 3BJNA 2R78A 3KE2A 5DUIA 1KONA 3UB7A 4BBVA 4UQIM 1VQOI 1SVMA 3F0CA 4HQMA 3G6EI 3BR1A 3V5MA 1VI0A 2V4JC 1WJEA 1MJAA 3UMDA 2J5OA 5HL6A 3R0AA 1MD0A 1QA6A 1R5GA 4RYEA 2B9SA 2V26A 3W4OA 3KO6A 3LSPA 1MMGA 1N4OA 5E20A 2QSGX 3BEBA 5HS8A 5IOYA 3ZMVA 4HNUA 3E5QA 2VJJA 2VKHA 1BW6A 3PNYA 1WJFA 3K2ZA 4XK4A 5ERIA 5LLQA 1T1AA 1TD5A 3FXLA 1Y4OA 5D5UB 1I2WA 5J8FA 3PBSA 4BGDA 3GTJJ 4KISA 3L2QA 3O86A 3CLQA 2KIMA 2I5UA 2L9SA 9ANTA 1K54A 4DYRA 2R7FA 3FPVA 4HHDA 3L2WA 3TE8A 1BTLA 2ZKZA 3BCAA 1PW8A 2PT7A 1OPCA 4L5EA 4IOCF 2OA4A 5K5QA 3WRZA 3BR5A 1OCPA 1Y54A 3NDGA 5EVIB 1JTDA 3T1BA 1WVRA 1QVUA 4A93J 1VEUA 2CC1A 3Q0UA 1FR1A 2X48A 4I3IA 4NNJA 3VE3A 4RB1A 3C1DA 1HOMA 4PM9A 4I3AA 1YHQI 4R79A 4IHXA 3P01A 4CCMA 2QKLB 1LPQA 1NRFA 2P9VA 3DTKA 4UUTA 3ZQ7A 2WV1A 3R6SA 2LG4A 1ZYRF 3IF6C 2BVMA 3RJUA 1B9MA 3FX3A 5FRNA 5AQ7A 4E7JA 1JUSA 5CQEA 2IA2A 3BG5A 2VKEA 4KICA 4XR6A 3LSRA 3VFFA 2A3SA 1WJ5A 1E0EA 5FQQA 4MEZA 2HYGD 3AG2H 3SDGA 2HP9A 3HC7A 1GA9A 2QJ5A 4ANJA 2FFFB 4IUKA 1QMFA 3ZG0A 3FK6A 4PAUA 1H8YA 4KZ3A 1GLNA 4MBKA 3H3VK 1WJAA 1GT0C 1LFPA 3I5UA 3M07A 1LI9A 3VYRB 3DPUA 2K31A 5LRSA 4M3DA 2XEPA 4QPOA 4YFKF 2B18A 3KYEA 4QHCA 1CI9A 1YMXA 3GYHX 1VQ7I 3BTIA 5F68A 1BT5A 1BR1A 5FAQA 3QU3A 2WZZA 2I9VA 4XLHA 2EPFA 3BY9A 1QMEA 4AIJA 3WG9A 5GLCA 5DDGA 1L0OC 5KSHA 2NOJB 2VC1A 3CO6C 5FSRA 5EVEA 1XPBA 1U0JA 3O3KA 3WHBA 1YSPA 2OAQ1 1X3ZB 1WGXA 3IWFA 2X01A 1FP1D 1JTXA 2ZJ2A 3WGIA 3LA3A 3OYEA 2VXZA 1SD4A 2WKQA 4II2A 4PFOA 3CDHA 5E1ZB 4BJ5C 1TC3C 3MXRA 1BLSA 2E36A 4LENA 5J7EA 1D0XA 4KIGA 1HQCA 3PJRA 3ZQFA 2GAUA 1ESIA 2BY2A 4GXOA 3DTMA 5FKMA 1TTYA 2LVSA 1TDGA 3CC4I 5CECA 3G1LA 3N05A 4JF4A 1GHIA 2D5VA 2HF6A 1OMEA 4B1RA 4YG2F 1R49A 2M7BA 3F6VA 2AS5F 3HOWJ 3PO3J 4EEFG 1A04A 4QLCU 3HLDA 2MGQA 3M1EA 2K4JA 3RFBA 2F48A 2EV6A 2F5FA 2HTSA 3FKIJ 5E3MA 1BZAA 4WXDA 2XFTA 5IT9Z 5L3BA 4NC8A 2ZL1A 1B1BA 2CW0F 4L5JA 1FOFA 2FMLA 4XSXF 2D02A 2K7SA 2DA6A 2VBWA 3E7LA 3C30A 1MBFA 3OIPA 1HBXG 1RETA 4F92B 1VQMI 4WELA 3UDXA 4CA0A 4BWIA 4FCFA 2PDRA 3S8PA 2L2OA 1D5VA 4GZBA 4FHTA 2QYOA 4LIVA 2Y2HA 3MXQA 2GZWA 2O9BA 4DW6A 1L0DA 1IUFA 1L2SA 1GVDA 4LJZF 1FJLA 3GTLJ 2BV6A 2PLYA 1MJBA 2A6HF 2IGOA 3GUDA 1LB2A 2QMIA 1MWTA 4KQQA 1SANA 4KJZA 2ZOHA 3UNGC 5KSCA 1ZG6A 3FYZA 4IHWA 2MABA 3T4KA 4QJGA 2OLVA 1DGWY 1YG2A 3SFZA 1XS9A 4A0XA 3LA7A 4OAZA 1E2XA 3L00A 2P81A 2B63J 4G7OF 4IOAF 1ZQ3P 2HP5A 3RPQA 3GFIA 4BUPA 1DJAA 4OMYA 3A3IA 3QP4A 4OIPF 1E4DA 4WM9A 3ZR8X 2BXZA 1Y56A 4YRVA 4WZ5C 4LB6B 3B47A 5JFRA 1WH7A 4M6XA 3OPHA 2JPBA 1NYYA 3AG1H 1ZG1A 2LC2A 2ZLYA 3TW8A 2BHYA 3TOAA 3CUEC 4A3FJ 5AIQA 2VQCA 1FWZA 2EH3A 1XG1A 3U2RA 3MZDA 4HOIA 1CF7B 2QWWA 3MZFA 4B88A 3DPLC 1W7PA 1ZGAA 2DFHA 2GBYA 2GOXB 2ID6A 2WBMA 4F7ZA 5L3GA 2CFOA 4PZJA 4KITB 3ZCOA 2GX5A 4B4CA 3IL2A 1VF9A 3P98A 3C2HA 3GTKJ 1W79A 4LG0B 2K9NA 4PGGA 1CEFA 1DU6A 2VC0A 3CMMA 3I3LA 4KUMA 2JBFA 2PBYA 4BL2A 3GZ5A 2JE5A 5HDDA 2L7KA 4E6WA 4GDFA 3TW7A 3JSOA 5CGWA 4CUGA 2HQ5A 1APLC 1IYOA 1DDNA 1QNTA 4G6QA 1D7EA 1O7EA 1MDMA 1VQ9I 1J5YA 2WZXA 1V5GA 2XROA 3BQZA 1I5QA 3ISGA 2ZQDA 3BM6A 3T0YA 3HVFA 1SCWA 3R60A 1YOVB 1P9WA 2QKPA 4P6ZS 2PHYA 3P09A 4DKIA 4CYDA 3HG9A 2QSHX 1RNLA 4Y3IA 2UXNA 4BHBA 3AAFA 1OJ5A 2DYSH 4IHVA 1K56A 3QPTA 1ORKA 1JKPC 3M2JA 2IS4A 3FXJA 1FTZA 2JCHA 3A0HC 1NZUA 3ZHHA 2H1KA 5M18A 1ZN2A 2ZXHA 3KETA 1SHVA 3EDPA 3E6CC 2DLLA 1TQIA 3VFHA 2MC4A 2Y2NA 4B4ZA 2BEOA 1SFOJ 3QYBA 3L2RA 4YFXF 2W3EA 5A92A 1Y8QB 3ZN1A 1USTA 2LDUA 3RQ4A 1IN7A 2IPQX 2XKOA 4IVNA 2EIJH 4XBFA 5JYOA 3G4SI 1KGEA 2ZM2A 3I54A 4ME4A 4XT2B 2HOEA 1P7IA 2JT1A 1I27A 4FT8A 2DNSA 1SD6A 4IXAA 5FB2A 3LAPA 1NK2P 3CMEI 1BULA 4PFPA 4UAAA 1BC8C 4A3BJ 2LB5A 3LO7A 2OV5A 5I94A 4O8GA 2KJBA 3PYPA 1S6LA 3MKLA 5B66C 2KKOA 2FZ0A 3H82A 3EYIA 3J81Z 1YW7A 5K5BA 3O2PE 4RA2A 5CHJA 2L7MP 3QAHA 2F5DA 3I4NJ 3F1NB 3MF0A 3LSIA 2QQ9A 2ZC2A 1RP5A 1JT6A 1OKRA 4B4XA 1GHPA 2ZMAA 4NXBA 1ES3A 2E2IJ 4MQ9F 2IGMA 4HOBA 3WE3A 3ABLH 5HDSA 3T4OA 5E1XA 2HS5A 3UO9A 2V1ZA 4ABZA 2VQGA 2RREA 4CO8A 2QPNA 1T56A 2XDMA 4Y52J 1YX3A 1T6SA 5J47A 2Y30A 3SS5A 3WE2A 3VOYA 3ZFZA 4M3GA 2TDXA 1Q2QA 4GD6A 4E7IA 1LLBA 2RVCA 3LR3A 2ZQ8A 2DDAA 1KU2A 2NS0A 5HSQA 2BYVE 1R22A 1KVMA 4EQ1A 4ENNA 2EX2A 4N9KA 2HR3A 2IJLA 1LKXA 4C2UA 1CEGA 3JPUA 2VT3A 2NVQJ 3VDXA 4XXRA 4ZJ1A 1S7AA 4P85A 3UE6A 2PYRA 3W4PA 2HQNA 3HDDA 1OTEA 3K9TA 4Q47A 1LSXA 4BE0A 3KSHA 1K78B 3LSKA 2HDDA 1V5EA 2HVSA 1I39A 3TG9A 3ESWB 3WHCA 5IOZA 2KDZA 4GJ4A 1UZCA 1FILA 3M4OJ 1WQ2A 2W0NA 4KIBA 3WTWC 4EJVA 1PUFA 3PIOF 4X68A 3LY4A 4JPMA 4XORA 4N1HA 2ZC6B 3C18A 1K4SA 5DKLA 2WKHA 3M1CA 5HAQA 4MQVA 5CJ9A 3U1KA 3ZQLA 3RZOJ 3KEYA 3IS2A 3KPHA 4JXVA 1SAXA 1R1UA 4XONA 3IXBA 3GTCA 3H9WA 4RAGA 3LOCA 2M8GX 1G3WA 2XC7A 4MO7A 3SFIA 2M1CA 1H3QA 3UB8A 5DTSA 1FPQA 3ZCZA 1I1SA 4LLGF 4NBQA 3S3MA 3L2VA 3BQ8A 1SMTA 1D5YA 2R9WA 4DNCA 3H1CA 3QP2A 3IF6B 1P4XA 5CVUA 2B7EA 3EEHA 4ZYGA 1IAWA 3F22A 4WUJA 3HOZJ 1RR7A 4M6YA 1MWSA 5EGOB 3QP8A 4MTDA 3KZYA 1XJ3A 2EK5A 4X69A 3BLYA 3L2UA 2O6GE 5B1BH 2L0KA 3UR3C 3HUNA 3JVVA 2XKPA 3HB9A 5JVTA 3ICYA 2O61A 3S3NA 3G4PA 2VKVA 3S2DJ 4C3JJ 2K27A 4XLEA 1GSXA 2EV5A 1YQAA 4UB8C 1SDNA 3NIAA 2WB1A 2ECBA 2YS9A 4WXHA 3ZQCA 1FR6A 3BQAA 1X3UA 3IHUA 1K57C 2VV6A 1IXRC 3ERMA 2H28A 5K5RA 4GN2A 2DT6A 3H36A 4XLPF 1ZKGA 1K6RA 2INWA 4OONA 1BOAA 3UPOA 1PP7U 2HXIA 1VQ4I 5LHIA 1BLPA 2MC3A 1X1BA 5G4YA 1G59A 2ZQ9A 2JRMA 3RIRA 1KQ8A 4GS9B 3T4QA 1QZYA 2Y2KA 3RKQA 1IGNA 2V1XA 2J5PA 2Y55A 4I0AA 2DN0A 3HUGA 2A2LA 3G2ZA 2BXYA 4M9SA 5CEBA 4EQIA 3MAJA 1YT4A 5LHGA 4IHQA 4HESA 1U9NA 5ICCA 2JKFA 4WEJA 2VEAA 4HZFA 3E6MA 3SHFA 1K4TA 1T98A 5DJUA 3ZQIA 2JK3A 3TDZC 3BWLA 3OPRA 4DE0A 4XRMA 4A0YA 2HJ9C 1GSWA 2KIUA 1SD5A 3FIWA 1T0FC 2Y79A 4F94A 1C0WA 2YU9J 1LL8A 3CWFA 4ETZA 3Q7VA 1HW2A 1ALQA 1T19A 4EJWA 1YLFA 2KZVA 1AA7A 2ZQ7A 4P5OA 3ZNYA 1R71A 1NHAA 2V0UA 2PU2A 4FD8A 3QQAA 1ESUA 1QQIA 3OPLA 2VKSA 3V3RA 1N9OA 1MH3A 3CP2A 4ZTKA 2VBZA 3S4XA 3WTUC 4LD5A 4ZRRA 2FNAA 4D0PA 1X19A 2CH0A 1HA8A 4KZBA 1HZOA 4PMAA 1F5TA 3M8FA 2Y2JA 2K02A 4GLQA 3P9KA 2F2EA 4GYIA 5KAFC 2FD5A 1D8JA 1BN5A 3F1OB 3HPHA 5CVIA 3ZMSA 2R7OA 4KQDA 4KZ4A 1UGUA 1BIBA 4RDUA 4C6YA 2A6EF 3BOQA 2L4RA 4JYKA 3DP7A 2FQ3A 3I53A 5J4VA 4CPKA 5JR3A 3J7YJ 4Y0OA 1LDKB 5J1UA 2HDWA 2P5KA 5E8GA 3RZDJ 2CUFA 1ETOA 2DQLA 3A3FA 2BOLA 2KPMA 5EVIA 4HNBA 5HWTA 5A91A 3OL4A 1V4RA 3I58A 4AVPA 3S1YA 4HEA2 2O9AA 3PBQA 3HTUA 1BI0A 3BFEA 1SVLA 3MEXA 3Q3SA 2ACGA 2IT0A 4KUKA 4C3QA 4I02A 3HCYA 2P0WA 4FTXA 3I7JA 5HVQC 2R9XA 4ZDLA 4I01A 1ZG5A 2E5NA 2ME0A 1YLJA 2L9RA 4L9NA 1V9ZA 1ZC2A 5CHMA 4RM2A 4KQRA 5L10A 4S2JA 3H35A 3TW6A 2Y31A 3C8CA 1NYMA 4G9YA 1PNEA 5K7FA 1XKZA 1DRMA 5HW3A 4IQ4A 4XN0A 1HC8A 2WUQA 4QY5A 1MZUA 1D0ZA 3HIFA 1UB9A 2EFUA 4U0VA 3OOVA 4AIHA 3K3CA 4KG6A 3BY8A 2K9SA 3J7AY 4BQNA 1HF0A 2A49A 5LGUA 3SQNA 4LOCA 4A3MJ 4X55A 4NG2A 4HQEA 1PDNC 3VOZA 2XPWA 2PBIA 3K69A 3WRTA 3O8HA 1W0TA 4R38A 4EBNA 3OR2C 3W4QA 3OLOA 2JSCA 1QRYA 5LD2C 4H6JB 4A3GJ 1SFUA 3FC7A 2ECCA 4PM8A 4O7DA 3RKWA 4LK1F 4QTRA 2JQ7A 3FZVA 2GA1A 3K4KA 3MN2A 3EQUA 4WEKA 3ZG9B 5C4XJ 3R0JA 1ZHHB 2LNBA 1IYQA 3MD2A 1Z3YA 3M6HA 1Y28A 5FQKA 3DBRB 2MLGA 3OOUA 1X3WB 5E18F 2Y91A 2Y48A 3HJKA 3IQAA 2PR5A 5C5KA 3Q0VA 1AKHA 5EZHA 2IWBA 1OCOH 3FWLA 3G30A 5FEGA 4PCQA 3BZCA 2MFZA 4DYQA 3NCKA 3I55I 3CC7I 3Q0WA 4NC6A 3RKXA 1F98A 4UA6A 4EUZA 1JE8A 3E6BA 3T12B 1BR4A 3H5RA 3P9IA 1ZREA 4S2PA 2N8GA 4Q48A 2LKSA 3K4BA 4Q0IA 4OPQA 1VFCA 3ECOA 2XASA 4G6TB 4JP0A 1S4RA 1YX5A 3K2AA 2FH5A 2P5VA 3CITA 3HOXJ 4MTEA 3E98A
chains in the Genus database with same CATH topology
3PBRA 2QVOA 3SZPA 5K5OA 1IN6A 2XAQA 5D4SA 4GCVA 4GCZA 3KLOA 1JNUA 5ICGA 4MDZA 2Q8KA 4A5NA 6PAXA 3CAXA 4RQ9A 2ZBKA 3E5XA 4B09A 3OCLA 2Z6CA 2EV0A 4EJUA 3B33A