3P7NA

Crystal structure of light activated transcription factor el222 from erythrobacter litoralis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
191
Chain Sequence
PAQWVLDLIEASPIASVVSDPRLADNPLIAINQAFTDLTGYSEEECVGRNCRFLAGSGTEPWLTDKIRQGVREHKPVLVEILNYKKDGTPFRNAVLVAPIYDDDDELLYFLGSQVEVGMARRERAAEMLKTLSPRQLEVTTLVASGLRNKEVAARLGLSEKTVKMHRGLVMEKLNLKTSADLVRIAVEAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase
publication title Structural basis of photosensitivity in a bacterial light-oxygen-voltage/helix-turn-helix (LOV-HTH) DNA-binding protein.
pubmed doi rcsb
source organism Erythrobacter litoralis
molecule tags Dna binding protein
total genus 62
structure length 191
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p7nA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p7nA01
2V1UA 5L3GA 2GWRA 2J5OA 4KN4X 2CQKA 4EEUA 2Z33A 4RS8A 5ICFA 3ELKA 4MHGA 2LDUA 2HTSA 1S4RA 4NXEA 4PGHA 2QHKA 2OWJA 1E17A 5ILVA 4BXUA 2L02A 1HW2A 1DP8A 4DJ3A 3E4PA 4HAMA 3I5UA 3B33A 4GS9A 1YS6A 1G3YA 4PDKA 2ZXJA 2NYXA 2G7HA 4HF0A 3GFLA 1ZARA 4Z2YA 1GXPA 1KU3A 4HY8A 1ZRCA 1KYZA 4UNOA 3TO6A 1OT9A 4EETB 2H6BA 1BIAA 1WKMA 3COAC 2HV1A 2W57A 2Z99A 4RGXA 5HDKA 3CUQA 5E8GA 1TW3A 1STZA 2KIFA 1WWXA 2FMLA 3FHZA 1Q1HA 4NQWA 1XCBA 3V8JA 4M9XA 3LSTA 3UB8A 3AAFA 2PR6A 1HSJA 2VBXA 3ULFA 1HSTA 4A5MA 4HA8A 1I27A 2NS0A 2O61A 1CF7A 4HH2A 1F1ZA 2RDPA 1NWZA 1YW8A 1HQCA 2PI0A 5DCMB 4IJAA 3RKYA 4HJ4A 2EV5A 4RQ9A 4WXCA 5JVTA 1S7OA 2Z6CA 3CUOA 1BN5A 5CVUA 4HP9A 2CO5A 2M1BA 4IHSA 2QENA 3OOPA 3UMDA 4HX7A 2A24B 3O6BB 2M30A 5TRDA 1EH7A 2MH2A 4UV8A 3DPTA 2RQPA 3MXQA 2Y48A 3JAMK 2VV6A 1UWPX 3HRUA 1DP6A 2HWVA 3OLOA 4PKYA 2GA2A 4LB6B 4G6QA 5A2QK 4HZFA 2XASA 1DPUA 3BJAA 2XKOA 4GHIA 3BOQA 4S05A 4WF2A 1BJAA 5D8KB 3LI8A 1S1YA 3WU1B 2D45A 3BY9A 3TO7A 3ERED 4EMSA 2JN7A 5CVJA 5F5YA 3BP8A 2DO7A 1G28A 2EA2A 3N97A 1FC3A 1JHFA 2K7SA 1DP9A 2ADUA 1IRFA 3CLOA 4R8HA 2ZJ2A 4LLNA 2XAJA 1YW9A 3N4MA 2QJ7A 2ZBKA 4WF0A 2L0WA 1ZG1A 1R23A 4UUVA 2M45A 3C1DA 1UB9A 2Y0MA 1LSWA 3UB9A 3NOTC 1FSHA 4IXAA 3K69A 5BQTA 4F3LA 3CAXA 2FRHA 3RKWA 4KNYA 1FBQA 3OV8A 1ZN2A 2G9WA 4LGWA 3FM3A 4M9SA 3JAMZ 4A6DA 4LPZA 2V1XA 4KMUX 2VBZA 2PMUA 4HW0A 5DUIA 4EJTA 2BYVE 2STTA 5FLXZ 4KA4A 3F6OA 3GX4X 2FE3A 5BPIA 5KVRA 4GW9A 1IN8A 3GUDA 1WI9A 1IXSB 3LYXA 2ESNA 4EERA 1GSXA 4OIRF 3LIBA 2Q8KA 1TQPA 2WTEA 4R3AA 3RKXA 4B8XA 4K2EA 1EV7A 3J81Z 1XSXA 1U2WA 1BC7C 4UVAA 1D06A 4XT2A 2VV7A 4MTEA 5AONA 2VEAA 1RI7A 4CICA 2CSOA 2K27A 2DLLA 3K1PA 2HKXA 4HBLA 4HNBA 1H9GA 3WE3A 3JTHA 1FYLA 3RTYA 3E5UA 2QYOA 3SXYA 4WWCA 5ILUA 2FEZA 5IS1A 4M72A 5FD6A 3ZPLA 3VODA 2E7WA 1ODVA 5LEJA 2AXLA 2OZUA 2V9VA 2QWWA 2L4MA 2V1BA 3ECHA 4HX8A 5I5LA 2GXGA 3RI4A 1S7AA 1KQ9A 3R4KA 3IS2A 4F7ZA 1HKQA 4WK8F 1ZREA 3ULQB 3H92A 1LDDA 3H3UA 5HWWA 2OU2A 2D2WA 5H6QA 3NEUA 4ON0A 1J59A 4XBFA 1YW7A 2P5VA 5G4YA 3HRSA 4P96A 4LB5A 2VE8A 3I64A 1XGNA 3E6DA 5TBMB 3DEUA 1P0ZA 2LKPA 4XRFA 4KIBA 1FT9A 1WRJA 1EW0A 2UXNA 5E1WA 1USTA 2LF8A 3TOAA 1KOUA 1S1ZA 2VODA 2ETHA 4L5IA 3KP6A 3ZN1A 2M1CA 1LSXA 2PDRA 3BZ6A 3D72A 5L3FA 1IXRC 4DQ2A 3ROUA 3M8EA 1U5TB 2MBFA 3FXQA 3EEHA 1QQIA 3RDIA 3LAPA 1T98A 2A5YB 1ZGJA 1ZGAA 2GQQA 1TQIA 4NB5A 4KYWA 1PDNC 1P97A 3BJ6A 3NOUC 5D5XB 3G73A 2EV0A 1T2KA 2K4BA 1ZG3A 1GVJA 3FWEA 2P8TA 2V0WA 1OJ5A 2H6CA 2XAHA 1PP7U 2ELHA 2DTRA 3VOLA 1MDMB 3LQRA 4G7OF 2E7XA 5F6AA 5FO5A 1NHAA 1D5VA 1P2FA 2B0LA 3WTZA 1K6OA 4CDGA 4XSZF 1DRMA 1OTEA 3UE6A 4FHTA 3A0SA 3EYYA 3WE2A 1YQAA 5LGTA 1XN7A 4KQDA 5F6FA 3QP5A 1SFEA 1Z91A 4OIPF 2IRFG 3DV8A 3NQOA 2OZ6A 2XVCA 2ZMEB 2W85A 3BWGA 1ON2A 4GO1A 4EJVA 3DP7A 3LIFA 5DCFA 2CMNA 3CWFA 2MH9A 3QPHA 3HSFA 3RTRA 3I4PA 1C0WA 1X0OA 2J5PA 3GXOA 1TS7A 3EWKA 4I38A 3CUQC 2P7CB 1DP7P 4AD9A 4ZYEA 1MJAA 4PGGA 3LUQA 1S29A 1O7FA 4NXBA 5DV5A 1BI0A 4LK1F 5DKKA 1GHCA 3C8CA 4I09A 2EFWA 2BEOA 5LRSA 2VN2A 2K7LA 1JGSA 5D8LB 1D7EA 5DCMA 2JT1A 4G9YA 2GA1A 4OIOF 1R7JA 1OYIA 3ZMSA 4HOBA 1ULYA 1OTAA 2A24A 4UVBA 1QPMA 4HV5A 3E5XA 1R22A 3S2WA 4U7BA 2JZYA 3HYIA 3J80K 2K86A 2EV6A 1ON1A 2KIMA 4TV7A 2VOOA 2IPQX 4YWZA 1J75A 2PBIA 3TOBA 3GF2A 3R0JA 1FBSA 3I71A 3F1OB 3UB7A 4L9TA 4Y15A 1TS0A 3KFWX 4HF1A 5HWTA 5FGMA 3ZMUA 1ZLJA 4JGRA 4OIQF 5J8FA 1LL8A 2WWYA 4AWXB 2FF4A 1R36A 3KCCA 4I01A 4M73A 2FNPA 1OMIA 4G7ZF 2YX4A 3DQVC 1XDSA 3V7RA 2LF7A 4A5NA 3IL2A 4A12A 2QWSA 2ZNZA 1OYWA 3MJQA 1KYWA 3LA7A 4MTDA 3VB2A 1B1BA 3WGHA 5CYVA 1KQ0A 1Z6RA 1F98A 2R78A 4MGRA 2V1AA 2FXAA 3LIAA 2KJCA 1XCVA 5DJTA 3IKTA 1UGUA 3F23A 4I5SA 1R5HA 1SD4A 5IT9Z 3T0YA 1BYWA 4CGZA 4CHUA 3C18A 5L3EA 5LGNA 4P55A 3D5LA 2L3DA 2XAGA 3F6VA 1U6GA 4H0EA 3WG9A 3J80Z 4LLLA 4EGZA 2E1CA 4HOIA 1J7KA 2HYGD 2L01A 1L0OC 1CGPA 4JK1X 1TW2A 4G94A 3E6CC 3PQJA 3IWFA 2VC1A 3EQLF 1TNTA 4A0ZA 4NHJA 1A04A 4M4XA 3K0LA 1OPCA 4RB1A 2D1HA 1IN7A 1P4WA 3DF8A 2VT2A 4A6EA 4HQMA 2UWMA 2J80A 3UB6A 3KZYA 2QM3A 3HSRA 3IRRA 3BDDA 5D4RA 4FT8A 2ZOIA 3PHYA 2QQAA 5CLSA 3NOPC 2OQGA 1TS8A 1LT0A 2D01A 1WQ2A 4HH3A 3M9AA 4BAYA 1V4RA 2OAZA 3QOPA 4GXOA 4I02A 5A8BA 5BS6A 2HEOA 1UWNX 4ETSA 1W5SA 2DW4A 3RIRA 5E18F 1FBUA 3V8LA 1SAXA 1K7AA 4U7DA 4I0BA 3F8FA 5EFWA 2Q2EA 1O3QA 2HGCA 3WGGA 1IN6A 5LGUA 2IT0A 6PAXA 1XGMA 1USSA 4UVCA 1QBJA 1I1SA 3PQKA 2OA4A 2LSOA 4B9OA 1GXQA 3C3WA 5FLXK 2W84A 1IUYA 4WL9A 5FB2A 1T1CA 3T1BA 4LLOB 1BBYA 4ZZDA 2B02A 4L9FA 3CDHA 1J0RA 4BHPA 2E1NA 2QJ5A 2COMA 1QO0D 1YS7A 3DKWA 3P9IA 2EA9A 1QZYA 1T19A 5LEKA 3T5XA 5DDGA 5DD4A 4KMFA 3A0VA 1BIBA 5AIPA 3J81K 3WTWC 4JBAA 5K1YA 1FLIA 3GFMA 3F1PB 4WX9A 5AVEA 2DQLA 4M71A 2FSWA 1T38A 1RNLA 4PZJA 1FP1D 4P9FA 2Z6DA 4BNCA 4PKYG 2QUFA 2BBYA 4HJ3A 5LLQA 1YYVA 4N9IA 4G8XA 4ESFA 4LRXC 3CO7C 5ICCA 3WU0A 1J9IA 3MQQA 4AIHA 5JR3A 3FZVA 3HUGA 1OJGA 1RZ4A 2FBKA 2V1DA 5ED4A 2INWA 3KP4A 1MDMA 3Q9VA 2DPDA 4BQAA 3IHUA 5FFZA 3E4OA 1E2XA 4R6LA 4GS9B 1BI1A 3RJPA 2IW5A 3SQNA 5J8CA 4OOIA 2BASA 1BM9A 5TJJA 3W6JB 3R0AA 2QVOA 3QRFF 5HOOA 1QGPA 5BOXA 2Z5UA 4LMYA 2ZMEA 2P7VB 3TQNA 4EQQA 4ZYHA 1IW7F 2W25A 2QZ8A 4LJZF 2YKFA 2PYRA 5ICGA 3ISPA 2DQRA 4BBVA 1AWCA 5L3BA 2P6TA 2GAUA 1VB6A 1U8RA 2ISZA 4KN7X 1XD7A 2WKPA 4L9EA 2X0LA 4L9NA 3TDUC 2PD8A 2M5WA 1FZPB 1JNUA 3U9GA 5LHHA 4H6JB 3F21A 4BYYA 4S04A 3HJKA 2VLGA 2PR5A 4ENKA 2F5FA 2EK5A 2C6YA 4WXHA 4KIFA 4BHBA 3K3DA 2IJLA 1OTBA 5J7EA 5HSQA 5KK1A 5LHIA 5HDNA 2O8XA 1LQ1A 1QNTA 4XLNF 2RC4A 3A0RA 1TLHB 3KE2A 3K1NA 2QBYB 1LDJA 3RPQA 3Q9SA 1O3TA 4LK0F 2W27A 4QWQA 2YU3A 4ESBA 4HDVA 5H6RA 4WLAA 1XB4A 1TNSA 3J7AO 1S4SA 4JGPA 5D6FA 4E70A 3CO6C 3F1OA 4HYEA 2Z9OA 2GJ3A 2BE5F 2FOKA 1SMTA 3FXRA 4JGOA 3R60A 3K1MA 3T8TA 5HDSA 3K3CA 1IF1A 4I98B 4IF4A 2ZCWA 1W4MA 3ABTA 3SHFA 1JE8A 4EM0B 1G3WA 3SZPA 1H0MA 4BHCA 2DT5A 4A0YA 4BH9A 2DFIA 1XJ6A 1XGSA 1ZRFA 2DK5A 5HVQC 3P7NA 2FBIA 4RB0A 1LVAA 2XGXA 1D8JA 5HDCA 2DU9A 3FM5A 2KDKA 1YO5C 2WKQA 1DPRA 2FQ3A 3LWFA 4M6XA 2STWA 4MN6A 2H27A 1F5TA 1TQMA 4U0WA 3LQQA 3DFGA 4L9VA 5DJUA 2QLZA 2O6GE 3K2ZA 4O5VA 2DK8A 2IA2A 4Q47A 5DUKA 1P6RA 3WTXC 3FF5A 4CO8A 2F2EA 1PUEE 4LG0B 1FX7A 2RN7A 3ZMDA 5IU1A 1I5ZA 3T8RA 3LIEA 1IAWA 3E4QA 2HQRA 2OQRA 1ZLKA 3F8CA 3GVAA 1O3SA 2CYYA 1ZYRF 5EEHA 2UZKA 4GYIA 2VONA 2DI3A 2IP2A 3GFIA 4HJ6A 5FD5A 2XRNA 3WODF 3ABUA 1K78B 1O7LA 1R1UA 1OT6A 2BV6A 1IXCA 3ZP5A 3R61A 1KU7A 1KGSA 2QKPA 2CW0F 3ZMTA 3GWZA 1BI2A 2P5LC 3L9FA 1B6AA 3I54A 1ZRDA 1UFMA 4ENMA 2PD7A 2GIVA 2MC3A 2VXZA 2BGCA 4BBUA 2P7JA 3MQOA 4NXGA 3GO5A 2VBYA 3F8NA 4HQAA 4L0YB 2A07F 3E5QA 2UXXA 2MLGA 5HD3A 1I6XA 5F1RA 2NNYA 4AVPA 4R70A 1XJ3A 1V3FA 5CJ9A 5BMZA 4RGRA 1T18A 5LRRA 2ACJA 2IA0A 2EFPA 3HSEA 2D1VA 4EW7A 1F9NA 1YTYA 2MLKA 5IT9K 2JTVA 1ZH5A 2ZNYA 1T1AA 2F5CA 2CGPA 1LEBA 1B9NA 1EH6A 1P4XA 5ICEA 1W7PB 3MWMA 4I3JA 1LNWA 1YIOA 3EUHA 4D0PA 5IT3A 2XHKA 2JPCA 3BY6A 5K5OA 2K4JA 1Z1DA 1T39A 4NXFA 1W7PD 4MNUA 1SFUA 3B02A 1R5GA 2VT3A 4HX4A 2R7DA 3P9KA 1MJ9A 5D5WB 4LFUA 3H9WA 2F5DA 3F1NB 4RB2C 5K5QA 1JXSA 3NJAA 2XV4S 3VE3A 1X3UA 3WTVC 3F1PA 2Y75A 3P9CA 2PJPA 4Y13A 2IVMA 1W5TA 1PP8F 3L7WA 1RUOA 2V0UA 1IN4A 3LI9A 4KDPA 4YFXF 3LA3A 4HDUA 3TO9A 4HLXA 3GFJA 1O3RA 2OD5A 1R00A 3IC7A 2XAFA 1XDUA 1Y0UA 4MQ9F 1N9NA 2P6SA 3M1EA 4Q5SF 5DYMA 1LSVA 5D6EA 2YPRA 2ZBBA 4HLYA 3FXUA 3E6MA 1G6NA 1U5TC 1ONVA 3TKYA 1DUXC 2XUBA 3VFZA 1XSDA 4FX0A 4EQ1A 2MA3A 4P9UA 2V9AA 2ZKZA 4GCVA 3BY8A 2FU4A 3CJNA 3LIDA 2RNJA 3KEQA 1IRGA 4GGGA 3KLNA 2W24A 3ICYA 1N9OA 3UMEA 4HIAA 2CFXA 4HI4A 1UCRA 2OWHA 5DKLA 1SD6A 3QU3A 4N9HA 3BWLA 3MCZA 2JSCA 1G4DA 1GSWA 2K02A 4AIKA 1RUNA 2PLYA 4R1HA 2HFHA 2W0NA 3H82B 1XFNA 4LRYC 3I59B 3TDZC 3JW4A 4U88A 4OMYA 1BOAA 4KIGA 2YR2A 4ZZLA 2V79A 2TDXA 4IRGA 5HLGA 1S3JA 2HZTA 1Y28A 4R38A 4LLGF 3ZQ5A 1SD5A 2XKPA 1KA8A 2NRAC 4ZYGA 3KP3A 4PCQA 4H6JA 3BPXA 4RGSA 3HJIA 3PFIA 2EWNA 4UHTA 4EESA 1R1TA 2VC0A 5JHUA 4MQVA 3HOSA 2WC2A 2GZWA 2F5EA 4G6DA 3GW2A 1H9TA 4MEXF 2GXBA 3DPLC 5E17F 4EM2A 3F72A 3MQ0A 2QBYA 3KP7A 2R7FA 3ML6A 5D5VB 4MN5A 4WUJA 1HBXG 3F22A 1BI3A 3QAHA 4EJUA 3GZ6A 1WSUA 3O2PE 1EH8A 4ESJA 3ZMZA 4K08A 3L09A 3HHHA 2O0YA 3SW1A 3O3KA 5BPDA 3I53A 3RYRA 5L3DA 3MZHA 4IHTA 5TBMA 3HRMA 1D3YA 5CVVA 2HQNA 4EM1A 4DJ2A 2HS5A 4I39A 4EVIA 4UV9A 2Z3YA 3WTUC 2YKHA 4AIJA 3EDPA 5HDDA 5HS9A 4L0ZB 2RVCA 3LA2A 4IRHA 4CXFA 4CYDA 2HDCA 1GSVA 4L5JA 2PN6A 1IZ1A 3TGNA 4OU0A 1HKSA 1D8KA 4KUKA 3M8FA 3KP2A 1U5TA 5D5UB 2D02A 3H7WB 2O3FA 2A3SA 2HTJA 3SZTA 1N9LA 4Q48A 3MR0A 2ESHA 2XAQA 4YG2F 1R1VA 4RB3C 3NHQA 2PYPA 2M87A 4JQFA 2CG4A 1S67L 3RYPA 3MFXA 2RKHA 5HDGA 1F9IA 3IWZA 3KP5A 1IN5A 2VBWA 3E3VA 5AIQA 4L9JA 3WGIA 2I9VA 2QQ9A 1FSEA 3W6KB 2QQBA 2A68F 2ZFWA 1LJ9A 1B59A 1FOKA 1TTYA 2H09A 2FBHA 1FWZA 1ZHFA 4DNCA 4ZH4F 2V6CA 4LRZE 3MFKA 4LG0A 5G4ZA 1LDKB 4O6JA 1REPC 3K9TA 4UXNA 3SFZA 1T6SA 4B09A 1MZUA 3LFKA 1B4AA 1G3SA 2EB7A 5LHGA 3WTTC 3HOTA 5J3WA 3VEPA 5A2QZ 4ASNA 1B9MA 1KU2A 1K78A 1R58A 3CUQB 1Z9CA 5J6XA 4EJWA 2XIGA 3NRVA 1U3EM 1MGTA 3BROA 1SMYF 3JSPA 1ODDA 5D4SA 1HKTA 4U0YA 2NAZA 4KUMA 3U1DA 5HS7A 1TS6A 2A6EF 3WTYC 4RGUA 2KRFA 5E20A 3U2RA 2HOEA 1CF7B 3RH8B 3C7JA 2R3SA 3HRTA 2H28A 3LAJA 3Q5FA 1RIOH 3T50A 3PYPA 1KU9A 1P92A 1HW5A 3E6BA 1MZBA 3ZQ7A 4KFCA 3HTSB 1OYYA 5ILSA 2O03A 3QPTA 2JPBA 1FY7A 4HV6A 4BBTA 3KEOA 2FMYA 4FX4A 3F8BA 4JGQA 4Y17A 3ECOA 1W7PA 1BC8C 3QP6A 1P4AA 4M6YA 4EXOA 3GECA 3BPVA 4L18B 5HZHA 1MJBA 4IVNA 1XJ2A 3FMSA 1HXDA 3GLXA 2M8EA 2JRTA 3G3ZA 1FPQA 4M74A 3IBRA 3HTUA 2PEXA 3VE4A 4I7HA 1WA9A 2ZOHA 2DAOA 2PMHA 4XLPF 4GCZA 4WCGA 1FYKA 4WN5A 1S66L 3RPUA 1QZZA 3F1NA 3V7CA 3GZ5A 4GHIB 1Z6TA 3R6SA 1OTDA 2WKRA 4EGYA 1FP2A 4GYGA 1LEAA 5H20A 4YFNF 4CZZA 1VTNC 4OMZA 1ZG5A 2PFBA 3REOA 5DEQA 1OTIA 2P5KA 2EJRA 2HKOA 4ENNA 1J2XA 2AS5F 2KJBA 5JI6A 4IRIA 1UHWA 2A61A 1G3TA 4ENJA 4I2OA 5FFXA 2X4HA 2HR3A 3FC7A 2KIUA 4HP4A 3E97A 2ISYA 1T0FA 2JHEA 4LD5A 4KICA 2EA4A 3ZN0A 4HQEA 4M9ZA 1F4KA 2Q0OA 4U0VA 1MKMA 2A69F 2XROA 1SD7A 4I0AA 4F3LB 2L1MA 1TBXA 1XFQA 1O57A 2PQ8A 3EYIA 4EEPA 5J4EA 4R79A 3GEZA 4YIFA 4QLCU 4O3MA 2WV0A 3MZYA 3G6OA 4P5OA 1ZAOA 2EFOA 3GYHX 2VOPA 3FMRA 3B73A 4KUOA 2YSRA 3QU6A 3LICA 4I3IA 3HIFA 3V7SA 1K79A 4IPAA 1XMAA 2NNNA 4G7HF 2L54A 2RV8A 3BJOA 1S6LA 1OR7A 3I0TA 1FNNA 1LB2A 3F8MA 3D0SA 3FMQA 3H82A 2VE9A 2KKOA 3HHGA 5LBQA 4ZYDA 3I59A 3KETA 4YFKF 4RAZA 4A0XA 5ERIA 3JTGA 3I58A 4L9GA 2IA1A 4N0BA 5AVFA 1YFHA 1U78A 4I3AA 4EJOA 2FNAA 2MD5A 3V4GA 4XT2B 1J5YA 3FG8A 3KLOA 5E1XA 2HYFA 1V9ZA 1V9YA 3MAJA 1S8NA 2LNBA 2P4WA 5HD5A 5HLIA 1T1BA 2VV8A 5F68A 3ZMVA 4A2UA 5E8IA 3MEXA 1Z05A 1Z7UA 1HW1A 1AOYA 2OBPA 1UHMA 2EFNA 3KX0X 3CTAA 5CVIA 2DBBA 1XSVA 2PHYA 1KQ8A 4HF2A 4RAYA 3F3XA 4E04A 2H94A 2L4AA 3GDIA 1SFXA 2CWEA 2ZO4A 3M7GA 4WXDA 1FYMA 4HHDA 3WTSC 3L2CA 1XJ4A 3IKVA 4KT5C 4XSXF 2L4RA 5JFRA 3KZZA 2G7UA 4YIIA 1XMKA 5F69A 5HWVA 3IS2B 1XGOA 3DXJF 2DPUA 5HS8A 2FA5A 3IRQA 5DD8A 5L3CA 2PG4A 5K5RA 4EV0A 2A6HF 2RGVA 3V8KA 2YX7A 3L00A 1OKRA 1DDNA 5KIZA 4OINF 3C2WA 5E1ZB 4Q4ZF 2OOLA 1YG2A 3VOEA 2KX6A 1MD0A 5HLHA 1I1GA 5CVRA 3JSOA 1YLFA 5F64A 4MEYF 5EEGA 3EETA 3H7WA 3FX3A 3H3ZA 1L3LA 2EFQA 1JHHA
chains in the Genus database with same CATH superfamily
1D0YA 4J00A 2V1UA 1MH4A 1Z3YA 1HDPA 5KHDA 5L3GA 1RP5A 1IUFA 2F4OB 2DA6A 2GWRA 2J5OA 2OF7A 4KN4X 5EZHA 2CQKA 1O07A 3QHYA 4KZ6A 4EEUA 4NG2A 3LSPA 4G3KA 3CZ6A 2Z33A 4RS8A 4GKUA 2XFSA 1W36C 2EQRA 5ICFA 3ELKA 3HB9A 4MHGA 2LDUA 2HTSA 1S4RA 1LI0A 4NXEA 2W3EA 3GQZA 4PGHA 2QHKA 1Z7LA 4D7NA 3OSFA 2ZSIB 2OWJA 2XC7A 1T08B 1AXBA 5EM1A 1E17A 3RXXA 1F36A 4RAFA 1KZHA 4RVAA 4E3OA 2XD5A 5ILVA 4H8RA 4BXUA 1YMXA 2L02A 1KGFA 1TWGJ 1HW2A 4DGWB 1DP8A 3JRHA 4DJ3A 1OMEA 5CPRB 3HC7A 3E4PA 4MBKA 3BTCA 3KEYA 1SAUA 4HAMA 5FL3A 3HLWA 2KRHA 1RRJA 4ZYAA 1FILA 3I4NJ 1EF4A 2HPBA 3I5UA 4QIWN 3ZHHA 3B33A 4GS9A 1YS6A 1JKQC 5KSHA 4OLGA 4PPRA 1G3YA 4JXWA 1H8ZA 4PDKA 4U3TA 2E71A 2ZXJA 2NYXA 2J3WA 3K4LA 2PU4A 2G7HA 4NK3A 4IVIA 4IX7A 4XXRA 4HF0A 2JVHA 1OPXA 3CCLI 2JVGA 4FQGA 4S0HB 3GFLA 1ZARA 2CUJA 3IWQA 4I76A 3ZQGA 1LE8B 1ERQA 2M4KA 3LOCA 4Z2YA 1GXPA 5FEGA 2EZIA 2XB0X 5GADJ 1KU3A 1X4OA 1VQOI 4QPQA 1SANA 1YLPA 2VA0A 2XF7A 3ZDJA 2NS8A 4HY8A 3RQIA 1ZRCA 1KYZA 4UNOA 3GBGA 5EVIB 3TO6A 2NVYJ 4CZCA 1OT9A 3OS2A 3Q81A 4EETB 2EPFA 5LBRA 4PM5A 4U87A 4ME4A 2H6BA 4O01A 1WH5A 4BJTA 3EGDC 1BIAA 1G6OA 1WKMA 3COAC 2HV1A 5FKOA 2W57A 2Z99A 4RGXA 3CDLA 3CUQA 5E8GA 5HDKA 2BTFP 5FEFA 1TW3A 1GDTA 3IXBA 3LL7A 3M2KA 1STZA 4XKCA 1X1CA 1WWXA 2KIFA 2R7VA 1B72A 4N1HA 2CH0A 2FMLA 1B8IA 3SOIA 4EATA 3FHZA 5FDSA 4NC6A 1Q1HA 3CUEA 2PBDP 4NQWA 3ITAA 4DMZA 1XCBA 2X6XA 3V8JA 1YRNA 4M9XA 3BJNA 3H0GJ 2J3TD 1TZLA 5CRFA 3LSTA 1SKFA 5DM6F 4WZ5A 1RKWA 2LMDA 5LD2C 4BL3A 5CKTA 3OPPA 5BOHA 3P09A 5DTKA 5GPCA 1HD8A 1Y0NA 3ZGAB 3UB8A 2E1MC 5FI2A 3AAFA 4IZZA 2PR6A 1HSJA 2CUZA 2VBXA 3VSLA 4BDZA 1D1CA 4Q0HA 3GMEA 2KL4A 2FUG2 2ZQ8A 3ULFA 1HSTA 4A5MA 4HA8A 4HNVA 2K31A 1YQSA 3EQVA 3DTKA 3MMYB 2Y59A 1I27A 3CMZA 3SS5A 2NS0A 2VI6A 1S9HA 2GBYA 3NWTA 4M3GA 1CF7A 2O61A 5JYPA 4HH2A 1F1ZA 2HVSA 3HLFA 3K6GA 1KGEA 2RDPA 1NWZA 1YW8A 2VL8A 2EX9A 3UY6A 1M1EB 4J19A 2TCTA 1HQCA 1OLTA 1A35A 2M7VA 2PI0A 2X02A 5DCMB 4IJAA 3RKYA 3S2HJ 4CCMA 3IHAA 4HJ4A 1S7EA 4KZBA 2LREA 2Q9MA 3OIPA 2EV5A 5IYCJ 2RL3A 2FFYA 2QZ6A 2WUQA 2M7UA 2Y8HA 1PYYA 4RQ9A 3FBIB 2JWTA 2E2HJ 4WXCA 5JVTA 1S7OA 1VQ6I 2Z6CA 3DTMA 3U4LP 1FEXA 3IXDA 2LKSA 3CUOA 1BN5A 1W8YA 5CVUA 3IV5A 1E4DA 2GX5A 1BA5A 4HP9A 2CO5A 1TVFA 2M1BA 4IHSA 4HBTA 2QENA 3OOPA 3UMDA 3SS4A 3UNWA 4HX7A 5IP9J 3A01B 2A24B 3ZG9B 4PSWA 2DMUA 3O6BB 2KT0A 3HUOA 2M30A 5TRDA 2PJRA 4M3BA 1EH7A 2MH2A 2E8JA 4UV8A 2H8RA 2XB5A 2W3FA 4Q8IA 3DPTA 2RQPA 3MXQA 1KONA 5C5KA 2L7ZA 2Y48A 5B66C 3JAMK 2ZMVA 3G31A 4Y3OA 2ZJQF 3V3RA 2NVTJ 2F4IA 1Y4OA 2VV6A 2VKDA 3HRUA 1UWPX 4Z9QA 4YRVA 1NRFA 3O3VA 4A3EJ 4BGDA 4CLCB 1DP6A 3OPLA 4E3MA 2HWVA 3OLOA 4PKYA 4B4XA 2GA2A 1YLZA 2BW3B 1IO2A 2MD0A 4LB6B 4G6QA 2KFDA 5A2QK 4HZFA 3CF5F 1QMFA 1Y56A 3A02A 2XASA 2XPVA 1DPUA 1HF0A 4WMCA 4P6ZS 3BJAA 2XKOA 2ZSHB 4L5EA 4BACA 3KYEA 3BOQA 2O9CA 4S05A 4GHIA 4WF2A 1BJAA 3QWLA 4PJMA 5D8KB 4ETXA 3LI8A 3LNQA 4C2UA 1S1YA 2F6CA 3HXLA 1X4PA 5EE8A 3PTEA 3FKIJ 3PAGA 3WU1B 5FQQA 3WRTA 1PW1A 2D45A 3PBSA 2W1RA 3BY9A 4Z1WA 5EJCA 3MKEA 2JA5J 1K4EA 3TO7A 3ERED 4EMSA 2JN7A 4OONA 2E60A 1LVKA 3TOIA 5CVJA 5F0FA 5F5YA 2XEPA 3BP8A 2OSUA 3DLLF 5E2FA 2HF6A 2DO7A 3H5RA 4XOTA 1G28A 4FOFA 3HKZN 3FWLA 4WELA 3BG9A 4IQJA 3M8JA 1QA6A 2EA2A 1PWCA 3N97A 4JF5A 4OPRA 1P7IA 1V54H 1FC3A 1JHFA 2K7SA 1DP9A 4MDZA 2ADUA 1I39A 3B6AA 4XOPA 2XA7S 2DT7B 1T95A 4LCMA 1IRFA 3C2BA 5IT5A 3CLOA 4R8HA 4Q0JA 2NVXJ 2ZJ2A 1K38A 4EUVA 1NTCA 4LLNA 4V2GA 2XAJA 1YW9A 3N4MA 2QJ7A 3NCKA 2ZBKA 5A90A 4WF0A 2L0WA 1ZG1A 2WA0A 4ZJ3A 1R23A 4E7SA 2EIKH 3DWKA 2DA5A 4UUVA 3R7WB 5EGOA 2M45A 1YIJI 3C1DA 1UB9A 2OJED 4KZ9A 2Y0MA 2X51A 1LSWA 3UB9A 4E3KA 2W3GA 3NOTC 1FSHA 4Y5FA 1VQ9I 1BT5A 3CJMA 4UEYA 4IXAA 5F82A 2VPLA 1NYYA 3K69A 5BQTA 1IYQA 4JX6A 4F3LA 4E4HA 3QP8A 3CAXA 2AXTC 2FRHA 3W8KA 2RCXA 3RKWA 4KNYA 4S2KA 3M6BA 3G1OA 1FBQA 3OV8A 5M5YJ 1BOBA 4A93J 1CI9A 2CUEA 5CEDA 3V50A 1ZN2A 1FR1A 5A91A 2G9WA 4LGWA 3FM3A 2CQXA 4M9SA 3ABMH 3JAMZ 4GDBA 4A6DA 4LPZA 5FLMJ 2V1XA 2L7FP 1UG2A 2VBZA 1YX3A 4KMUX 3B42A 2PMUA 4HW0A 4BQNA 1VF9A 2UUZA 3W2VA 2Y2OA 1S72I 5DUIA 4JLFA 3IT9A 1IC8A 1IV6A 4EJTA 3BG3A 3FBNB 2BYVE 4OAZA 2STTA 3RJUA 3RSNA 5FLXZ 4KA4A 5B3SH 5HL6A 3F6OA 3QP4A 3PIPF 4Y3IA 3M4OJ 3GX4X 2FE3A 5BPIA 5FQMA 2WY7Q 5KVRA 3OYHA 1YLYA 4RA2A 5IYDJ 4DN0A 2ZLYA 4GW9A 1VHMA 2EX6A 1IN8A 3GUDA 3WHBA 5HL1A 1WI9A 1IXSB 3LYXA 2ESNA 3DU6A 4EERA 1GSXA 4OIRF 1AHDP 2DOEA 1IRZA 1YSPA 3LIBA 4FE7A 3HJEA 4S2MA 3Q7VA 4HNTA 2Q8KA 1K6SA 1TQPA 3VP1A 1K54C 2WTEA 3D5SC 3OYIA 1O4XA 1BLSA 1DY6A 3RKXA 3IX3A 2DMPA 3TEDA 4R3AA 3HOUJ 3FIWA 3AL0B 4B8XA 2WY8Q 1OR7C 3NI9A 4K2EA 5HPFA 1EV7A 3J81Z 5EVIC 5FRMA 1XSXA 1AKHA 1U2WA 4ABZA 1BC7C 1ZTRA 3VMAA 1KVMA 3K4MA 3MSHA 4UVAA 1D06A 4HESA 3H5NA 2FQ4A 4XT2A 5FAOA 2VV7A 4CH7A 3JRDA 5FQJA 3V42A 3TP0A 4MTEA 1GLNA 1YPRA 2QGUA 5AONA 2VEAA 1RI7A 2W1TA 4BBRJ 5IOZA 4X53A 4CICA 2CSOA 1NXYA 2K27A 4MLLA 2DLLA 3K1PA 3TW7A 4M3KA 4MCWA 3UB5P 3BTJA 2HKXA 2R7WA 1E3PA 1PVEA 4HBLA 3L1PA 4HNBA 1H9GA 4BD1A 5CECA 4PM9A 1NK3P 3WE3A 3JTHA 1FYLA 3RTYA 2J8YA 4ARZA 4E3IA 2O7OA 3LSGA 3E5UA 2QYOA 3SXYA 2GLOA 1G2HA 1U60A 5M19A 3O8GA 4WWCA 3IH8A 5ILUA 4Z6YA 4DF6A 2WAFA 4S2IA 2FEZA 3BR2A 5IS1A 1BL0A 4P85A 3S32A 3LR3A 4EBNA 4JF6A 1JVJA 4M72A 4UA9A 1A0KA 5FD6A 5GAGJ 1FJLA 2DCFA 3IQAA 2VKEA 3VODA 2E7WA 4E7KA 1JKOC 2CV1A 2X1CA 3ZPLA 5LEJA 1ODVA 3TSGA 2BY0A 2AXLA 1ERMA 2DNSA 2OZUA 1VQPI 2V9VA 2LYCA 1LL9A 2VASA 2QWWA 4BENA 2E34A 1ZTUA 2DMWA 2L4MA 2V1BA 3ECHA 4HX8A 1BLCA 5I5LA 2GXGA 4C3IJ 3GTQJ 1PJRA 3RI4A 1VQ8I 1ETOA 2Q2EB 5FKNA 4GNUA 1S7AA 1QHHD 2W00A 4F3QA 3L2UA 1MBLA 1KQ9A 1T33A 3GTPJ 3R4KA 1XA1A 4HSTA 4F7ZA 3IS2A 1TT5B 1Z67A 2V2FF 4IO9F 1HKQA 2Y0SN 4WK8F 1ZREA 2COBA 2L9VA 3MD2A 2IWCA 2K2NA 1ZK8A 3ULQB 3H92A 4MO7A 1LDDA 3H3UA 4X6AJ 1FTTA 2NUPC 1OCTC 5HWWA 2OU2A 1TWHJ 2D2WA 3HBRA 2DMQA 5H6QA 5HODA 3NEUA 3GCMA 4ON0A 3UDIA 5B5EC 1YMSA 1J59A 4XBFA 3FV7A 1YW7A 2P5VA 5G4YA 1WPKA 2FJ1A 3HRSA 3KPHA 4P96A 1VQ5I 3SJMA 4LB5A 1H8YA 2VE8A 1K55C 3EOIA 4P0MA 2OV5A 5KAIC 3I64A 2W4SA 3SH7A 4C30A 1XGNA 3E6DA 4P87A 3BC8A 2DTZA 4F92B 3EGXC 5TBMB 1ZG6A 3G34A 3DEUA 1P0ZA 3JREA 2CU7A 2LKPA 2X6YA 4YINA 3CCEI 4AU7A 4QY6A 4XRFA 4KIBA 2V1NA 4FETA 4BMWA 1FT9A 1WRJA 3PFYA 3KSIA 3QPLA 3B47A 1EW0A 5JLXA 1X58A 2UXNA 5E1WA 1USTA 2LF8A 4XORA 3TOAA 4KISA 4CLCC 1KOUA 1S1ZA 2VODA 2ETHA 2R7OA 3OYAA 3IWOA 3TRCA 2R7RA 2EH3A 4L5IA 2AHQA 3KP6A 3KYZA 5GTIC 3ZN1A 4LIUA 2M0MA 2BVMA 3ZXSA 1LSXA 2M1CA 3BZ6A 3ZRGA 5L3FA 2PDRA 1IXRC 2CMPA 4DQ2A 2OAP1 2XH9A 3D72A 3ROUA 2Y4AA 4ZTKA 3M8EA 1U5TB 3LR5A 3C2GA 2MBFA 1ALQA 2DFEA 3FXQA 5CQGA 3DTIA 2A49A 3EEHA 1X19A 3IH2A 4KITB 4XIDA 2L7KA 2XPWA 1QQIA 4GN2A 2G2UA 2VX8A 1IG7A 3RDIA 4IUHA 3LAPA 2PRFA 1T98A 3E2KA 5GLAA 2A5YB 5KSCA 4MN7A 2WAQA 4JX4A 1I2SA 3U21A 1KDSA 1ZGJA 2HYJA 1XKZA 1ZGAA 3CITA 2GQQA 1TQIA 4NB5A 2QEXI 1GA9A 3PXPA 4KYWA 1PDNC 1P97A 2JCHA 3BJ6A 3IH9A 2Y30A 3OCNA 3NOUC 5D5XB 3G73A 2EV0A 1T2KA 5M3FJ 2K4BA 1LPQA 1ZG3A 1GVJA 3FWEA 2P8TA 3HUGB 3OYGA 2V0WA 3C4PA 3NY4A 1OJ5A 2V7FA 5HAPA 1NG6A 3DBAA 1C3BA 2K9NA 3H9JA 2EWWA 2K40A 2H6CA 1X1PA 2XAHA 3CMMA 1PP7U 3SEQA 1FOFA 2QMIA 4UAAA 3V67A 4DXCA 2ELHA 2PU2A 2YS9A 2DA2A 2DTRA 2R7XA 1MDMB 3VOLA 2ZL1B 3LQRA 3HPGA 1K4FA 4AFIA 4G7OF 2E7XA 5F6AA 5FO5A 1SVLA 2CW8A 3LO7A 3M6HA 1NHAA 2Y2QA 4U0XA 3BQYA 1D5VA 1P2FA 4A3CJ 4AYBA 2B0LA 1VZ0A 3WTZA 2IS2A 3OYCA 1K54A 3LR0A 3S16J 3TJZC 4RM2A 2LTPA 2BY2A 4CDGA 1K6OA 1DQUA 4XSZF 1DRMA 4DYCA 3BTIA 2Z2SB 3HDDA 1BLPA 1OTEA 3M07A 3CDIA 4FHTA 3AGFA 4OVDA 3UE6A 1W8QA 2IS4A 3A0SA 4Y4RA 5EVIA 2MABA 3EYYA 4EBPA 3WE2A 1YQAA 5LGTA 4CJNA 1XN7A 2CW7A 1HC8A 5F6FA 2CV2A 9ANTA 4KQDA 3IXGA 3C4OA 3QP5A 1SFEA 4QSHA 1Z91A 4OIPF 3S3NA 4AM3A 3K7AJ 5G18A 3VYRB 4XRSA 2IRFG 3DV8A 1PRQA 1VEUB 4M3DA 3NQOA 4QU3A 2OZ6A 2DOFA 2BHZA 2XVCA 2ZMEB 2W85A 3BWGA 1ON2A 4GO1A 5F04A 4EJVA 1LFPA 3DP7A 3UKGA 1Z09A 2R9XA 3LIFA 3T1QB 1P9RA 2DYSH 2HJ9C 1SHVA 2VJWA 4MLOA 5DCFA 3UDXA 3QYBA 2CMNA 3CWFA 5DF7A 2MH9A 2RNGA 3BECA 4BU2A 3JRCA 1VQMI 3DWZA 3QPHA 1V5GA 3HSFA 2LBFB 3OPRA 3Q07A 3VSKA 3N8RA 4R0QA 3RTRA 3PL8A 2FD5A 3DAVA 3GTMJ 3I4PA 4XKVA 1C0WA 1X0OA 2J5PA 2P0WA 3GXOA 1TS7A 3EWKA 2R92J 4I38A 3CUQC 2P7CB 2BVLA 4XLEA 1LL5A 4C3QA 3PUFA 1DP7P 1OFCX 4D60A 4AD9A 1G8XA 2KRCA 1YJWI 2IWBA 4ZYEA 1I3QJ 1MJAA 4PGGA 1S29A 1O7FA 4BXXJ 1U9OA 1SDEA 1XP4A 3CCSI 2V1ZA 3LUQA 2E36A 5DV5A 1K6RA 4NXBA 1BI0A 4EWFA 4LK1F 3HREA 5DKKA 1GHCA 3C8CA 4I09A 2EFWA 2JUCA 2EIMH 2BEOA 1D0ZA 1Y8RB 2VN2A 2K7LA 2ID6A 3LSKA 5LRSA 5CX7A 1JGSA 1ETQA 1MMAA 4GZBA 3DCFA 4DE2A 3NAUA 5D8LB 1D7EA 5DCMA 1ONHA 3ITBA 2JT1A 4G9YA 1JT6A 2GA1A 2R7TA 5EOEA 5J1YA 2LKXA 3IF5A 4GLQA 5EV0A 1SFKA 3I3LA 4OIOF 3ASOH 1W7FA 1R7JA 3S1QJ 1MKIA 3DEWA 4CCOA 1OYIA 1LUJB 3ZMSA 2O9AA 4IHWA 2L2OA 4HOBA 4RYEA 4IHXA 2KHMA 1RGZA 1ULYA 4ZDOA 1MWTA 3A01A 1OTAA 2A24A 4UVBA 1ITYA 2ZC4B 1QPMA 4HV5A 3FZCA 1WYBA 4GRIA 3E5XA 4E7IA 3OYFA 1R22A 3S2WA 2MYSA 4U7BA 2ZD8A 4BS9A 1V5EA 2VGLM 5K5BA 3VYUB 2JZYA 2LY9A 3HYIA 2PX9A 5D3OA 2Z2LB 3N8LA 1TDGA 2LP0A 4DE0A 3J80K 4CLCA 1VQNI 1WGXA 4HEFA 2K86A 1ZC2A 2EV6A 4HEA2 3N8SA 1ON1A 2KIMA 3W4OA 3RXWA 4TV7A 2VOOA 2IPQX 1NYMA 4XUZA 4KT6A 2BW3A 3K10A 1WCMJ 2CQQA 4XONA 2WV1A 3SYTA 4BL0B 1RR8C 1J75A 2PBIA 3TOBA 5FRNA 4FCYA 3GF2A 3KYLA 3T1XA 2C6WB 1P7JA 2VQLA 1FBSA 3I71A 3R0JA 3ZQIA 3F1OB 3BZKA 3PR6A 2VIXA 3UB7A 2JA2A 2Y9YA 3A3DA 2PMZN 4L9TA 3DKXA 2J7VA 4Y15A 3CJTB 4B3XA 2OCEA 3HBLA 1BZAA 1MWRA 5C4XJ 1TS0A 3KFWX 3U1KA 1GUUA 1IYOA 5HD5A 2K9QA 2VQCA 5TGTA 4P1WA 1X1DA 4HF1A 3J7AY 5HWTA 3BTLA 5FGMA 1AWIA 3FHNA 4FE4A 3ZMUA 1ZLJA 4JGRA 4OIQF 3IX8A 3CP2A 5J8FA 2BY1A 1LL8A 2WWYA 4JX5A 2P9VB 4AWXB 3KYQA 2OCCH 4X25A 2FF4A 1R36A 3KCCA 1IKIA 3JYIA 1W5DA 1OCZH 4I01A 2XSDC 4Y0OA 2X6OA 4M73A 1FSYA 2FNPA 1R71A 2OTLI 1OMIA 2MW8A 3H36A 4G7ZF 2J9OA 3ZG7B 4C2TA 2YX4A 3DQVC 1XDSA 1ES2A 4P6BA 1XG1A 3DU5A 4F52A 1LLBA 3ZQHA 3VOYA 3V7RA 1MBFA 2LF7A 4A5NA 4G7HF 4EEFG 1XC5A 3BYDA 3MKFA 3DW0A 3CZDA 3IL2A 3S7PA 4A12A 4F91B 3O88A 2QWSA 2ZNZA 2OLVA 1OYWA 3WRZA 3R7WA 3MJQA 1KYWA 3LA7A 4MTDA 3VB2A 1B1BA 3WGHA 4JP0A 5CYVA 2JKTI 2QF7A 1KQ0A 1Z6RA 4S2OA 1F98A 1PNEA 2R78A 4MGRA 2J9PA 2V1AA 1U8BA 4RLFA 1PZOA 2FXAA 1XPBA 1PFLA 3LIAA 2KJCA 1XCVA 3TW6A 5DJTA 3IKTA 1UGUA 3FPVA 3F23A 5CGXA 1NG7A 1K56D 1R5HA 1RETA 4I5SA 1SD4A 5L10A 4E7JA 5IT9Z 3T0YA 1BYWA 1R5ID 1HCRA 5F08A 3K4KA 4CGZA 4CCJA 5FQ9A 4CHUA 1CQTA 2ZC7A 3C18A 5FDHA 2WB1N 5L3EA 5LGNA 4P55A 3D5LA 2XDMA 1I3AA 2L3DA 2MGQA 4PK4A 2XAGA 3F6VA 1U6GA 1X2NA 3P98A 4H0EA 3KYCB 1JT0A 3WG9A 1YLJA 3J80Z 2C5WB 4KZ8A 2IGOA 3CF2A 1XXMA 2M34A 4LLLA 4B3AA 4EGZA 2E1CA 2XGEA 1J7KA 2HYGD 3CESA 2L01A 1L0OC 3IH4A 4HOIA 1H5XA 1FTZA 4PMAA 2Y9ZA 2F4MB 1CGPA 3I4MJ 4FTXA 4JK1X 1TW2A 3KO6A 5GAEJ 4G94A 3CCRI 2K9MA 5CGWA 3E6CC 3JRIA 3PQJA 3IWFA 4MEZA 3ZQFA 2VC1A 2CQ7A 3EQLF 1TNTA 4A0ZA 4NHJA 1A04A 1MIJA 2HXOA 2EWVA 4LITA 2L5QA 4CCLA 1RGYA 2VGLS 1RKTA 4M4XA 1BSGA 1CJFA 5FAPA 1YM1A 3K0LA 3RKQA 5FASA 4AVZA 2EFUA 4IL6C 1OPCA 1K83J 3FXMA 4RB1A 2D1HA 2HPMA 1IN7A 1P4WA 3DF8A 5DM7F 3JR9A 2TRTA 2VT2A 1SZVA 1YLTA 3CG5A 1R4NB 3CCVI 4A6EA 4FD8A 4HQMA 1UELB 2VJ4A 2UWMA 3PBTA 5C3EJ 2J80A 3LFUA 4II2A 4YIRX 1PW8A 3UB6A 1MNMC 3RFBA 3PM1A 1TF1A 5DTTA 5J3LA 3T4JA 3KZYA 3AG2H 2OLUA 4ANJA 5EVLA 2QM3A 3HSRA 3IRRA 3BDDA 2LVSA 4AUXA 3D3OA 4XLFA 5K7ZA 1DJCA 1TL8A 2M9HA 5D4RA 4GDFA 3HKZA 4FT8A 2ZOIA 3PHYA 1IYPA 2QQAA 3A3IA 5CLSA 4PHTA 4QY5A 3NOPC 3V5MA 3MKYB 3OSGA 2OQGA 3N4IA 2R5ZB 2Y31A 1TS8A 3BFEA 1LT0A 3S1RJ 2D01A 4KENB 1WQ2A 1APLC 2WZZA 3M9AA 4HH3A 1D0XA 1Y39A 1TT0A 2DN0A 2Y2HA 4E7HA 4XKBA 4BAYA 4ZTJA 2KPMA 1QMEA 2P81A 1MBKA 1MBJA 1V4RA 2OAZA 3QOPA 4GXOA 4I02A 3MN2A 3IWIA 4LIVA 5A8BA 1OCRH 5BS6A 2HEOA 3H35A 3S7NA 1UWNX 3V3SA 3A0HC 4U0TA 2V4JC 2OPTA 1W5SA 4ETSA 2X71A 2DW4A 4UHUA 4C2MJ 3RIRA 2HP5A 5E18F 3G1MA 4ZBEA 1FBUA 3V8LA 1SAXA 1K7AA 1W63M 5HW3A 2X1EA 4U7DA 4I0BA 3WHCA 1SFOJ 1JWZA 4LV3A 2ZC5B 3WS5A 2E2JJ 3F8FA 2QA4I 1MMGA 5EFWA 3SFIA 3E98A 3ZGKA 2Q2EA 3A0BC 1O3QA 2HGCA 5CTNA 4DBRA 3WGGA 5C44J 2DT6A 5IPAA 1IN6A 2XGDA 5LGUA 2IT0A 3TMOA 1SKOB 4R23A 3A3EA 3N7WA 4ESPA 5EOOA 3CQZJ 6PAXA 2GNXA 1XGMA 5K7FA 1USSA 3VYTB 5M5XJ 2WGIA 4UVCA 4A3KJ 1QBJA 1I1SA 3PQKA 3Q1FA 5K7HA 4KG2A 3H0DA 2WGWB 2OA4A 2LSOA 4B9OA 1GXQA 3CMYA 3IUOA 3C3WA 3CCJI 3BR0A 2W84A 5FLXK 1IUYA 2KLIA 5FB2A 1T1CA 3T1BA 2OTJI 1IV8A 1KVLA 1HDDC 1BBYA 4ZZDA 1AU7A 2B02A 1I5QA 4L9FA 4LLOB 2ZJ9A 3HGGA 3CDHA 2ICWG 2ZM2A 2KMUA 1NZOA 1J0RA 2XF3A 4BHPA 1TWFJ 2E1NA 1Y54A 2COMA 2QJ5A 4EU0A 1QO0D 3MXRA 3FK7A 2AVXA 1PI4A 1YS7A 3DKWA 3P9IA 1JTYA 4FISA 2EA9A 1QZYA 3NWSA 1T19A 3G4SI 5LEKA 3T5XA 2RREA 5DDGA 5DD4A 4KMFA 3PSFA 4RDUA 1MC0A 2XR0A 3A0VA 2UWXA 2PBYA 4QD4A 1WFXA 3H9QA 1MBGA 4UUTA 1BIBA 5AIPA 3J81K 2XQZA 5H2FC 2I8DA 4R3JA 3WTWC 3KIOA 3VP3A 2EZLA 4JBAA 5K1YA 2HQAA 3GFMA 1FLIA 4WX9A 4UY8I 1RR7A 2DQLA 3F1PB 5AVEA 2HVQA 1SEUA 4M71A 2LOOA 2JJ7A 4MFEA 2EX2A 3LEQA 2FSWA 2DMNA 1PUFB 2KLOA 1RNLA 1T38A 4B4CA 1BLHA 2JKGA 1HLVA 2Y55A 4PZJA 4OOYA 4NUBA 2QKLB 1FP1D 4P9FA 3J7ZI 4I6ZA 3RZOJ 3HLGA 2Z6DA 1A31A 4BNCA 1M40A 3NBLA 2QUFA 4PKYG 4PJLA 2BBYA 3OC2A 1JTXA 2IXSA 3HUMA 4HJ3A 3OYLA 5LLQA 1JJ8C 1VQLI 1YYVA 4N9IA 4MMNA 3OCLA 4G8XA 4ESFA 4Y0UA 4DDYA 4UA6A 4LRXC 3ZR8X 1W79A 3CO7C 1K4TA 5ICCA 4IOAF 3WS2A 1ENHA 3MMHA 1F43A 2ZQ7A 3WU0A 3HOYJ 1J9IA 3EUKL 1LFUP 3MQQA 4AIHA 5JR3A 4E6KG 3ABKH 2X1DA 1W63Q 3FZVA 3DLAA 3ZG8B 3HUGA 1OJGA 3DKYA 1RC9A 2A6TA 1RZ4A 2FBKA 2V1DA 4N92A 5ED4A 3JRAA 2INWA 4NEED 3KP4A 1MDMA 3FKWA 2ZL1A 5DVAA 2V20A 1FMWA 3H9GA 3BZCA 4GFBA 1EA3A 4GJ4A 5L07A 3UR3C 3Q9VA 2DPDA 4BQAA 4WYYA 3IHUA 5FFZA 5TGFA 3K4NA 3LSIA 3E4OA 1E2XA 3A2KA 5EVEA 4R6LA 4R4SA 4EQIA 3VP2A 2ECBA 4GS9B 4L0LA 1BI1A 3ASNH 3RJPA 3BCBA 2DDAA 2DRWA 2WKEA 3IF6B 2IW5A 3SQNA 3NC8A 2HOTA 2JA6J 4BUPA 2DMTA 5J8CA 3J7YJ 2GOXB 2BXYA 1TC3C 1Q2PA 3G35A 4OOIA 2BASA 1BM9A 5TJJA 4Y52J 4B1RA 3EQUA 3W6JB 3R0AA 1IRXA 3MKLA 1DGRM 2QVOA 2BXZA 3QRFF 5HOOA 5E2HA 1QGPA 5BOXA 3MZDA 4MIMA 1IDYA 2DFHA 2ELJA 2IS6A 1VEUA 2FZ0A 2Z5UA 4F93B 4LMYA 3MF0A 4ZJZA 1DP3A 2ZMEA 5EYRA 2PAVP 2P7VB 4WBGA 4X1MA 2VB6A 2E2IJ 3TQNA 1PWDA 3DTEA 4EQQA 5DFYA 1DU0A 4ZYHA 4B48A 1IW7F 4XUXA 2NVQJ 2VGKA 2W25A 4KZ7A 4QJGA 1G5UA 2PT7A 2QZ8A 1KGGA 4OP8A 4LJZF 2J3TC 2LBFA 3BCAA 2YKFA 2Y2PA 4ZRRA 2PYRA 2LH9A 5ICGA 1VI0A 3BR5A 3ABLH 3ISPA 5E3LA 1WJFA 2CQNA 2WAEA 3ISGA 2DQRA 3CPTB 2Y2MA 3UPPA 4BBVA 2X48A 2I5UA 1AWCA 5DF8A 1Z77A 5L3BA 2P6TA 2GAUA 2M7BA 3EUAA 1VB6A 3C38A 2V26A 1U8RA 2ISZA 5GHYA 4KN7X 2ME6A 3JRBA 1YRNB 4MBFA 3S3OA 1MW7A 1XD7A 3BQAA 1HTZA 2WKPA 4L9EA 2X0LA 4L9NA 3TDUC 1YOVB 2PD8A 2M5WA 1FZPB 5FAQA 5FSRA 4EUZA 1JNUA 2MJ6A 1G68A 1N9BA 3U9GA 2R7ZJ 5LHHA 1KE0A 4H6JB 4BJ6C 3F21A 4E3LA 4BYYA 4S04A 3HJKA 1GV2A 4CCKA 1T8IA 2VLGA 1ES4A 5HAQA 1ZR2A 2PR5A 4UB6C 3KX2A 4ENKA 2F5FA 2EK5A 2K85A 5E2GA 2K9SA 2C6YA 4WXHA 4KIFA 5TISC 4BHBA 1WJBA 3K3DA 2IJLA 3ZQCA 1OTBA 3OS0A 2R7UA 5J7EA 5HSQA 3L2RA 3C2HA 4II3A 5KK1A 1YAXA 5LHIA 5E3NA 5HDNA 3QNBA 2O8XA 3GMWA 1LQ1A 1QNTA 1X2MA 3IAS2 3BT9A 4BY7J 4DRTA 5KNLA 1K0KA 4XLNF 2E5NA 2WZXA 2RC4A 3A0RA 1TLHB 3PBOA 3SH8A 3KE2A 3B6CA 3K1NA 4XN0A 2A3UA 2QBYB 1ONGA 1N78A 1LDJA 1WVRA 1A6IA 1R4MB 2XF5A 1H88C 4FTHA 3RPQA 3CLQA 3Q9SA 4YOFA 1O3TA 2HDUA 4LK0F 2W27A 4QWQA 4X55A 2YU3A 4ESBA 3PNYA 3FK6A 5H6RA 4RBOA 4HDVA 2XFTA 4WLAA 5F83A 1XB4A 3MVPA 1TNSA 2R0QC 3J7AO 5CQEA 1FCMA 3ZQQA 1S4SA 2B5RA 4JGPA 4R3BA 2K3PA 2IWDA 3MZ8A 3QPSA 3CD6I 5D6FA 4E70A 2XGNA 3GTJJ 3CO6C 3F1OA 4DIQA 5F1GA 4AC0A 4HYEA 2Z9OA 2ME0A 2BE5F 2GJ3A 1OISA 2FOKA 3EPZA 2ZQAA 1SMTA 3FXRA 4II7A 2HOSA 5CGSA 2R4GA 4JXSA 4LG3A 4JGOA 3R60A 5KMWA 3ZOBA 4A3GJ 3K1MA 4X68A 2NUTC 3T8TA 5HDSA 2HDQA 3K3CA 1EWZA 4R4RA 2DDBA 1IF1A 4I98B 4IF4A 2XLNA 4OPZA 2ZCWA 2EILH 5MC7A 1W4MA 2A5WA 3ABTA 3SHFA 1JE8A 3HGYA 3EUHC 5GPAA 2AQFA 4HNUA 4OPQA 1R9TJ 4S2JA 5AQAA 2R7QA 4EM0B 1NZUA 1G3WA 2P9VA 4RM3A 3SZPA 1N25A 1H0MA 3TP3A 4BHCA 3Q7ZA 1YKDA 4AIDA 3FXLA 5GHXA 3OR1C 2DT5A 4DOZA 4BBSJ 3D5RC 4XK4A 4OLDA 3HOZJ 2K9LA 2BOLA 2CRGA 2JK3A 4A0YA 3VPRA 4BH9A 3C7VA 1K56A 5J8XA 2DFIA 1XJ6A 1XGSA 1ZRFA 2DK5A 5HVQC 5J1RA 3P7NA 2FBIA 4RB0A 1WJDA 3AGEA 4C3JJ 1LVAA 2XGXA 4WMCD 1JI8A 1D8JA 5HDCA 1IJWC 2DU9A 3FM5A 3K4JA 1YO5C 2KDKA 2O9BA 3W2WA 4HSRA 4E3JA 2V8CA 3OYBA 4A3FJ 4BE2A 2WKQA 1DPRA 2XAUA 1ETWA 4BQQA 2QKMB 2FQ3A 3LWFA 3I9V2 4DW6A 1SC7A 4M6XA 1I2WA 2STWA 1WYCA 2ZXWH 1QZEA 4MN6A 4C9YA 5JHFA 2H27A 1PWGA 4KG6A 1F5TA 1OQYA 1TQMA 4U0WA 3HLDA 3LQQA 1PZPA 4XN3A 3DFGA 4L9VA 4OQGA 2HU9A 4N9KA 5DJUA 2ZM8A 3MBZA 2QLZA 2O6GE 3K2ZA 4O5VA 2ZJRF 2DK8A 2IA2A 4Q47A 3TL4X 4D9JA 1HVBA 5A92A 1X3ZB 5DUKA 3UPOA 5EECA 1P6RA 3HOWJ 4YEJA 3WTXC 3FF5A 1LE8A 4BJ5C 1VQKI 4CO8A 1QVUA 4BQMA 2HQ5A 1GV5A 2F2EA 4PUSA 4A3JJ 1PUEE 1FX7A 4LG0B 2RN7A 2B18A 1ESUA 3AGDA 2CC1A 3ZMDA 3BQ8A 3Q0WA 4G3WA 5L8MA 5F1JA 5IU1A 3E0YA 1ETVA 1I5ZA 4PJ0C 1JGGA 3P5JA 2EINH 3T8RA 3LIEA 1ES5A 5GLCA 1IAWA 2P08A 3UDFA 3E4QA 2HQRA 2OQRA 5GP9A 4UUSB 4DZJA 1H89C 2O99A 1ZLKA 3HLBA 3UO9A 5CHUA 3F8CA 1CF0A 4JXGA 3Q0UA 3GVAA 4CSWA 4IEJA 1O3SA 2CYYA 2LB5A 1ZYRF 5EEHA 2UZKA 4GYIA 2VONA 1BR2A 2DI3A 2IP2A 3GFIA 4HJ6A 3ZG5A 5FD5A 2PMZA 2XRNA 2E1MB 3WODF 3BW6A 3ABUA 3F9KA 1O7LA 3DEEA 1K78B 1R1UA 1OT6A 3OIOA 4JPMA 3H5AA 3NDEA 2BV6A 1XMXA 1J09A 3L7HA 1IXCA 4DJAA 3ZP5A 3R61A 2JA7J 3OL4A 1KU7A 1MBHA 2D5VA 4WL9A 1KGSA 2M4GA 2QKPA 3PJRA 4OAYA 2DJIA 3G30A 2EIJH 2CW0F 2IAIA 2ZB9A 1NH3A 3ZMTA 1MWSA 1UG0A 3QNCA 3IBJA 3K70D 3GWZA 3LSRA 3W4PA 3MXSA 1BI2A 2P5LC 3CCMI 3L9FA 1B6AA 3QYFA 1KE3A 3I54A 2ZC2A 1ES3A 2EBIA 1ZRDA 1UFMA 4WZ4A 3FYZA 4G12A 4ENMA 2R5ZA 2GIVA 1H8AC 2PD7A 2MC3A 2VXZA 3IH3A 5FQKA 2BGCA 4E7ZA 3AL0C 2ZXIA 3PNVA 4DE1A 1MMSA 4BBUA 2P7JA 3MQOA 4NXGA 4XRSG 3FXKA 3GO5A 2VBYA 3F8NA 2WYXA 4L0YB 4HQAA 2A07F 3E5QA 5EPHA 4F94A 2EX8A 2UXXA 2IS1A 2MLGA 4ZJ2A 3U2AA 5HD3A 1I6XA 5F1RA 5BNGA 2O9LA 2NNYA 4AVPA 1IELA 2P04A 3ZCOA 4IKFA 3BG6A 1XJ3A 1CK3A 4R70A 1V3FA 1E3OC 4RX2A 5J1UA 5CJ9A 5EEAA 5BMZA 1M6KA 2Y2NA 4RGRA 1T18A 5LRRA 4XM3A 2IA0A 2ACJA 3HUNA 2EFPA 3CCUI 3HSEA 2D1VA 1S6RA 1MXOA 3BFFA 4EW7A 2CS3A 1F9NA 1YTYA 2MLKA 5IT9K 2JRMA 2JTVA 1ZH5A 2A2LA 2ZNYA 1T1AA 4NETA 2F5CA 2WB1A 3QOEA 2CGPA 1B9NA 1EH6A 1LEBA 3OZHA 1P4XA 3K4BA 4IUKA 5ICEA 2L7MP 3JRGA 4FCFA 1W7PB 3CI6A 4HPQA 3C5AA 4A3IJ 3FKJA 2B63J 3S7QA 1JTDA 3MWMA 5HNHA 1SKOA 3N6IA 1LNWA 4I3JA 4ZJ1A 1FCNA 2KIQA 1CEGA 3PBRA 1YIOA 4PM6A 5FKLA 1HLUP 3PO2J 3EUHA 3QP2A 2WGWA 3B3XA 4D0PA 3T4SA 3S2DJ 3VDXA 5IT3A 3AG3H 3LR4A 2LRDA 4DBQA 2XHKA 3DBHB 2JPCA 1UMQA 3T4QA 4ZAMA 3BY6A 5K5OA 2K4JA 2E35A 3VFFA 4DDSA 4OQ0A 3VWBA 1UHSA 1Z1DA 1T39A 4RA7A 3BR3A 1TEMA 1W7PD 4NXFA 5IY5H 4MNUA 1SFUA 3B02A 1R5GA 3BRMA 2VT3A 4HX4A 4JOMA 2R7DA 1YE9A 2ZFUA 3P9KA 5GLBA 4XR6A 3UE0A 3ZQLA 4BEHB 1MJ9A 2Z16A 5D5WB 3OYDA 1BULA 4LFUA 2QSHX 3H9WA 2F5DA 2VKVA 3F1NB 4RB2C 2FOWA 3LY3A 5IP6A 2VQGA 3W2ZA 4H4KC 3GTOJ 5K5QA 1JXSA 4B93A 2Y2GA 2O5RA 2XV4S 2EZHA 3NJAA 2FH5A 3VE3A 4D2OA 1X3UA 4B43A 2HDRA 5M1AA 3WTVC 1A36A 3MZEA 1DJBA 1EI5A 5M18A 2CV0A 3F1PA 2Y75A 3P9CA 2PJPA 1AA7A 4Y13A 2IVMA 3K2NA 5AQ9A 1W5TA 1ACIA 1PP8F 5KZHA 3V39A 2DCEA 3L7WA 1RUOA 2V0UA 4JXVA 1IN4A 3LI9A 4M6VA 1PUFA 4KDPA 3CJQB 3OYEA 2YUSA 1VQQA 4YFXF 3LA3A 4HDUA 3TO9A 2Y69H 3RPUD 3GFJA 4HLXA 1O3RA 2OD5A 3FPWA 1R00A 2VPRA 3ERMA 3IC7A 1WZ2A 2XAFA 3GSGA 1XDUA 1Y0UA 4MQ9F 1N9NA 5DTDA 2P6SA 3D9YA 3M1EA 4BL2A 1TWAJ 1V5FA 4Q5SF 5DYMA 1LSVA 4KG5A 5D6EA 2OUMA 2YPRA 4A69C 1XPXA 2ZBBA 1QU3A 4HLYA 3T12B 3W6VA 2OC6A 3MS6A 3FXUA 3E6MA 1G6NA 2DOAA 1U5TC 1ONVA 3TKYA 1DUXC 3GRJA 1TWCJ 1ZGWA 1XA7A 2XUBA 1XS9A 2I10A 3A03A 3VFZA 3W2AA 1XSDA 2VKHA 1ZR4A 4FX0A 2W7NA 3ZVTA 5CHMA 4K0XA 3G2BA 5EZGA 4BXFA 4EQ1A 3OYMA 1W0TA 2MA3A 4P9UA 2B7EA 3AKZA 2V9AA 1DJAA 4YNRA 2ZKZA 4GCVA 1X1BA 4HG2A 2H0YA 2E1OA 3Q82A 3BFCA 2FU4A 3CJNA 3BY8A 3LIDA 4IJGA 3WS0A 1ERDA 2RNJA 2ECCA 3KEQA 4GGGA 1IRGA 5E43A 3ZNYA 3KLNA 2W24A 4UB8C 4CA0A 3IHBA 4GB7A 3ICYA 3IXHA 5DS9A 1N9OA 3UMEA 4FSFA 4HIAA 3T1RA 3IF6A 4X1LA 1Y1WJ 3G2YA 1XGIA 1XGJA 2CFXA 2YU9J 3I55I 3I56I 4HI4A 4UA7A 4XRMA 5AJGA 3BLYA 1UCRA 2OWHA 5DKLA 1QHGA 1SD6A 3QU3A 3S8PA 4N9HA 5HNFA 1MBEA 4XKWA 3BWLA 3OS1A 5IHVA 3S7OA 3MCZA 2HP9A 2JSCA 4Y7NJ 1BW5A 1P9WA 1G4DA 3CCYA 2FX0A 3MFDA 2Q9NA 1GSWA 5J47A 3G2ZA 4S2NA 4P6ZM 2K02A 4AIKA 1RUNA 4CYCB 2PLYA 5F0CA 2X9DA 1WJCA 3K2AA 2HFHA 4R1HA 1WJAA 2W0NA 2AO9A 3H82B 1ZQ3P 2DA3A 1JWPA 4G3VA 4IBXA 1XFNA 2JKRM 1ZG4A 1NLYA 4LRYC 4PM7A 3I59B 4ID4A 3TDZC 2Z1DA 1WI3A 3JW4A 1L0FA 1JWVA 1ZKJA 4U88A 4OMYA 2BHYA 5B1BH 4QPRA 1BOAA 3CPTA 4N9LA 4KIGA 3UPNA 1ZELA 1H8MA 3VP0A 2YR2A 4ZZLA 2V79A 3TE8A 2NOGA 1OJLA 2TDXA 4IRGA 4D7MA 5HLGA 1GHPA 1WH7A 4LCLA 1S3JA 2HZTA 3S15J 2ZMEC 1Y28A 4LLGF 1I50J 3K70C 4R38A 3C7UA 4WEJA 3LMMA 1L0DA 3HCYA 5EVID 4FH2A 3T4TA 3NIAA 3ZQ5A 1JTGA 1S5LC 1SD5A 2XKPA 1KA8A 2XA7M 2NRAC 2VKSA 4N1XA 4ZYGA 2V8FA 3KP3A 3RQ4A 3ZCZA 4PCQA 2KQRA 5DFXA 4BWIA 2HNHA 4H6JA 3BPXA 3BG7A 4RGSA 3HJIA 4XLHA 3PFIA 4IHYA 3H3VK 4LV0A 2EWNA 5EG0B 1TDLA 4UHTA 1K4SA 4EESA 2LD5A 2OV7A 1R1TA 2VC0A 5M3MJ 4X0GA 2H8WA 4ZDXA 3WU2C 1SVOA 5JHUA 3LFVA 4RX3A 4MQVA 5CHJA 1MSFC 4B88A 4Q0IA 3HOSA 2WC2A 2R7SA 2GZWA 5I94A 2F5EA 2LC2A 4BJPA 4G6DA 3GW2A 1H9TA 4MEXF 3GTKJ 1HOMA 2NOJB 2GXBA 1GA0A 1SCWA 3AFHA 2MSYA 3DPLC 4OWRB 5E17F 5E2EA 4EM2A 1D1JA 2KISA 1LKXA 2H1KA 1FSWA 2JC7A 3M1CA 4O0PA 4N4OB 2N8GA 3F72A 3MQ0A 4JKTA 3AG4H 2QBYA 4X56A 3KP7A 4KZ3A 1N75A 2R7FA 3ML6A 5D5VB 4MN5A 1HBXG 4WUJA 4E3NA 1YHQI 2WKIA 3JCUC 1D5YA 1N4OA 3I7JA 3F22A 3MZFA 1BI3A 1W5CC 3QAHA 5J40A 4EJUA 3GZ6A 4OKPA 3VP4A 1WSUA 3O2PE 1K61A 3PIOF 1EH8A 2I72A 4ESJA 3ZMZA 1H3QA 2WBMA 3L09A 1JUSA 3HHHA 3HLCA 4K08A 1L0EA 3OYKA 1OCCH 2CFOA 2F48A 3CHWP 5F1FA 1UZCA 1YT4A 2O0YA 2GXAA 2XD1A 1OCPA 3SW1A 3CC4I 4EBLA 3O3KA 3GR2A 3BG5A 5BPDA 4E6XA 3I53A 3LEZA 4A3DJ 3PBNA 3RYRA 5L3DA 2RAEA 2VJJA 5U47A 3MZHA 4IHTA 1UJ8A 5TBMA 3HRMA 1D3YA 1CI8A 5CVVA 1E3UD 2HQNA 3W4QA 4EM1A 2K3FA 2HS5A 4QHCA 4DJ2A 3OY9A 4I39A 4BKXA 4EVIA 4UV9A 1RCJA 1VETB 2Z3YA 4GDNA 3WTUC 2B95A 2YKHA 3LY4A 1EROA 4AIJA 3EDPA 3MKZA 5HDDA 5HS9A 4QWOA 4L0ZB 2RVCA 2UV1A 3LA2A 4Y7PA 4IRHA 4CXFA 1JUMA 2LG4A 4CYDA 2HDCA 1GSVA 2ELKA 4L5JA 1G6AA 1VNDA 2PN6A 3S17J 4OOMA 1IZ1A 3TGNA 2DXIA 1X3WB 3VYSB 5B1AH 5E3OA 1LI9A 3X2QH 1DU6A 2BG1A 4O7DA 4OQIA 4OU0A 4V2FA 1HKSA 1D8KA 4KUKA 3M8FA 3KP2A 2VJ5A 2ID3A 1U5TA 5D5UB 1PI5A 2D02A 3H7WB 4KQQA 2O3FA 1WJ5A 3G71I 4CLCD 3S4XA 1W1WE 2M3AA 4OH0A 2W3DA 2R5YB 2H1LA 2EXBA 2A3SA 5FKKA 2FFFB 2HTJA 3ZFZA 3SZTA 1N9LA 2V6EA 4Q48A 2Y2IA 2E19A 1ETKA 2HJEA 3MR0A 3UE1A 2ESHA 2X85A 2XAQA 5J4YA 2JE5A 4NC8A 3D4FA 1MMDA 4YG2F 4D5FA 1R1VA 4XL9A 4A3BJ 5EM0A 3F0CA 1VM1A 1GHIA 4RB3C 3A1YA 3UNGC 3NHQA 2HZDA 2PYPA 2M87A 4D1QA 3VV4A 4JQFA 4BDYA 2CG4A 1S67L 5JYOA 3RYPA 3MFXA 3QP1A 3HL9A 1ETYA 3IP4B 2XK1A 3OWTA 5GL9A 3MKWB 5FATA 2RKHA 3KSGA 1K57C 4HBUA 4MNRA 5HDGA 1F9IA 5E79C 2ZQCA 4IHQA 3IWZA 1EKEA 3KP5A 2W48A 1IN5A 1ESIA 2KDOA 3O87A 2VBWA 3E3VA 5AIQA 4L9JA 3WGIA 4PFOA 4KQRA 3G1LA 2I9VA 2QQ9A 3KSHA 1DGWY 1FSEA 3W6KB 4MBHA 4ZTFA 3SDBA 3P01A 5TFQA 2QQBA 2A68F 2ZFWA 1LJ9A 2RQQA 1LFBA 1B59A 3BLSA 3A3FA 1FOKA 1TTYA 3PO3J 1FQGA 2H09A 2FBHA 1FWZA 1ZHFA 4DNCA 2GDNA 2HZ5A 2E5ZA 3UE3A 3JVUA 3E0JB 4ZH4F 1Z3XA 2V6CA 1R49A 1VQ4I 4KQOA 3ZYTA 4LRZE 1VQ7I 3MFKA 4LG0A 2QSFX 5G4ZA 2Y0SA 4X69A 1LDKB 1JUPA 4FUWA 1R6RA 1Y1VJ 3CJRB 3VOZA 3LSHA 5JVGF 2MFZA 3PBQA 1T0FC 2CJJA 4OQHA 4O6JA 2GIZA 1REPC 3S1NJ 2JKFA 3JVVA 3K9TA 4UXNA 3SFZA 4C6YA 4UUSA 5FI6A 1T6SA 3GLLA 4B09A 5F27A 1KE4A 1MZUA 2JKRI 5HPIA 3LFKA 1B4AA 3HL2A 1G3SA 2EB7A 2MC4A 2V9KA 5LHGA 3WTTC 3HM5A 3HOTA 5J3WA 3ONQA 3VEPA 2X6WA 2LB9A 1MY8A 2ZMFA 3HOXJ 2W3HA 5A2QZ 3S1MJ 1ACFA 4ASNA 1B9MA 1YJ9I 1JKRC 1KU2A 1OCOH 1K78A 1IDZA 5DTSA 1R58A 3TBIA 3CUQB 4J01A 5J6XA 1Z9CA 5HAIA 4EJWA 1BW6A 1G59A 4BE1A 2XIGA 1PYVA 3NRVA 1U3EM 1B72B 1MGTA 3BROA 5KCMA 4HRIA 1XX2A 1SMYF 1T56A 3JSPA 4ZDPA 4DKIA 1B8IB 2LK2A 3T1SA 1V55H 1ODDA 1NLZA 4GD8A 5D4SA 1HKTA 4FASD 4NQWB 3S1YA 4U0YA 2EFXA 2JMWA 2DYRH 2LY2A 1JJ6C 2NAZA 3G32A 4KUMA 1LHYA 4GOGA 3BLMA 2ZM0A 3U1DA 2XSJC 1MMNA 1Z0XA 1POGA 2XDVA 5HS7A 4X6TA 1ZKGA 3BR6A 1TS6A 2IGNA 2A6EF 1UAAA 1U0JA 2XGCA 3O86A 3IAM2 3WTYC 4RGUA 2KRFA 5E20A 3U2RA 1WHUA 2HOEA 4XLCA 4JBFA 4M3EA 3SEZA 1CF7B 3RH8B 3C7JA 2R3SA 2MG4A 3HRTA 2H28A 2WK0A 1Z21A 3LAJA 2ZMAA 2A05A 3Q5FA 3RCOA 1RIOH 2LFBA 3PYPA 3T50A 4ETZA 1KU9A 1P92A 1HW5A 3E6BA 1MZBA 3ZQ7A 4KFCA 2JN6A 3HTSB 1OYYA 5ILSA 2Y91A 3OL3A 2O03A 4G6TB 3QPTA 1MNDA 1Q1VA 3PAEA 4B4ZA 2JPBA 1FY7A 4C3HJ 2HDWA 2IGKA 4HV6A 5M5WJ 5FA7A 4BBTA 2XRLA 3KEOA 2Y79A 3OR2C 4IQ4A 2FMYA 1QRYA 1S0WA 4FX4A 2H10A 4PM8A 1ZHHB 3RZDJ 1E3HA 5FJ8J 3D1NI 2QYBA 3F8BA 3QYEA 2BLSA 4Y17A 1NRJA 4JGQA 4OOLA 3ECOA 2G2WA 2H5SA 1W7PA 5FROA 3PUBA 1BC8C 3QP6A 1P4AA 4M6YA 1YSQA 3GECA 4DYRA 4EXOA 3BPVA 2HDDA 3SH9A 3T4LA 4KJZA 4L18B 2VK3A 5HZHA 4IEDA 1MJBA 4W1UA 4LENA 2IGMA 4IVNA 1XJ2A 1YX5A 3FMSA 2PJRB 1HXDA 2Y2LA 2JSPA 3GLXA 2Y2JA 2OAQ1 2M8EA 2VJIA 2JRTA 3G3ZA 3K4CA 5GHZA 1GT0C 2AQEA 2DA7A 1FIAA 1MSEC 1FPQA 4M74A 3IBRA 3N05A 4E6WA 2R93J 2BY3A 3HTUA 2PEXA 1GHMA 3VE4A 3GTCA 2KZGA 4I7HA 2M7AA 1WA9A 2UV0E 2ZOHA 1XX5A 2DAOA 3W3CA 2L0KA 5HX9A 2PMHA 4XLPF 1O7EA 2V9PA 4GCZA 4WCGA 1FYKA 2VQHA 1Q2QA 4ZDLA 3JRFA 4WN5A 3CC2I 1S66L 4BEHA 3HVFA 4EV4A 4IBRA 3RPUA 3G4PA 1QZZA 4R1GA 2HOAA 3V7CA 3GZ5A 3F1NA 1Z6TA 3R6SA 4GHIB 3ZVWA 4DZPA 1OTDA 2WKRA 4EGYA 1FP2A 3M2JA 4S2LA 3OMYA 4GYGA 4WM9A 2IBDA 5A93A 5HFOA 2KZVA 1LEAA 1D1BA 5H20A 4YFNF 2KP6A 4YELA 1I6HJ 4BY1J 3ZG0A 4B44A 1IEMA 2M0CA 4CZZA 1VTNC 1IKGA 1NK2P 1A5JA 1K57A 4XQFA 5HLTA 4OMZA 1ZG5A 1JKPC 5L2FA 2PFBA 4ZC3A 5DEQA 3REOA 3HLEA 4W97A 2GOMA 1P9QC 1QPIA 1FIPA 4UQIM 1OTIA 1J9MA 2P5KA 2EJRA 4PAUA 4QB8A 2HKOA 4ENNA 2G0EA 4XMYA 3Q0VA 1J2XA 2AS5F 2KJBA 4Y2FA 5L09A 5IYBJ 4CUGA 5JI6A 2VLAA 4IRIA 2HXIA 4LOCA 4CLCE 3NULA 1UHWA 2A61A 1G3TA 4ENJA 4NBQA 1W36D 5FFXA 4I2OA 2BZTA 4V19K 2X4HA 2B9SA 1PIOA 5LFAA 2HR3A 3FC7A 1J3WA 2KIUA 4HP4A 3E97A 4CQHA 4PJNA 1YI2I 4ITVA 4Y0TA 2ISYA 3S93A 1T0FA 2JHEA 2CUFA 4O8GA 4C75A 4LD5A 3L9KA 4A3LJ 2ZC3B 4KICA 2EA4A 4NC7A 5EGOB 3ZN0A 4X1EA 5F0HA 3CMEI 1E25A 5CEBA 4XLAA 4M3FA 4HQEA 4M9ZA 2JUGA 1F4KA 1MPLA 2Q0OA 4U0VA 3CP8A 2IEKA 3SDGA 1MKMA 2A69F 2XROA 4IHVA 2JQ7A 5AQ7A 1SD7A 4I0AA 2HP6A 4F3LB 2L1MA 1TD5A 4JYKA 1N77A 1TBXA 1BJZA 1FOYA 3A4CA 5GAHJ 1XFQA 1YLWA 1O57A 2PQ8A 3EYIA 4XNFA 2GM4A 3BFGA 3O5YA 2QPNA 4EEPA 5J4EA 2DODA 2HI3A 4R79A 3GEZA 1GCEA 2Z2MB 2NXNB 2ZC6B 3EEAA 3S22A 1CEFA 3WS4A 4YIFA 3SS3A 1FOWA 4QLCU 4O3MA 1FR6A 2JKTM 5CXWA 2WV0A 3MZYA 3C30A 4PFPA 1KDWA 3FXJA 4P5OA 3G6OA 1CQAA 2LY1A 3GV9A 5FQIA 3L2QA 1ORKA 2WADA 3CMAI 1ZAOA 2EFOA 3WG7H 1GVDA 3FMRA 3B73A 4QPOA 3GYHX 3KYDB 2VOPA 4N4NB 4RAGA 2YSRA 4KUOA 3QU6A 3LICA 4I3IA 4BD0A 3HIFA 1MH3A 3V7SA 1K79A 4IPAA 3CC7I 2GZAA 3NDGA 4I99C 1XMAA 3VFHA 2NNNA 2L54A 2RV8A 3FISA 5J4VA 3BJOA 1S6LA 2M8GX 3BR1A 1OR7A 3DBLB 3I0TA 3L2VA 1XTAA 3BM6A 2ZQDA 1FNNA 4YWZA 4CYCA 1LB2A 3F8MA 2Y2ZA 3D0SA 3KZIC 2QSGX 4WEKA 3FMQA 4IOCF 1K25A 3H82A 4K0WA 1RPWA 5AQBA 2VE9A 1BR1A 3S14J 3IF6C 5CERA 3FXOA 2KKOA 3HHGA 5LBQA 1MNEA 2NS7A 1YJNI 2HDSA 4ZYDA 2L9SA 3I59A 4YFKF 4RAZA 3KETA 2K5CA 4E7LA 2E8IA 4OPYA 1D1AA 3Q7VB 4A0XA 3NECA 2VGJA 5ERIA 3JTGA 1RESA 4NKPA 5FI7A 2HGVA 3I58A 5EF6A 4KZ5A 1NJ4A 1FMVA 3LSJA 3QODA 4L9GA 2IA1A 5FLVA 3FKVA 1NY0A 4DXBA 2XSSA 1HA8A 5FKMA 4N0BA 2ACGA 4S2NC 2W82A 1YFHA 1Z6FA 1WJEA 5AVFA 1U78A 4A3MJ 1ETXA 4I3AA 4EJOA 5KAFC 3WS1A 1AKHB 3T4KA 2FNAA 2MD5A 2ZXHA 4XICA 3L2WA 3V4GA 1IFQA 4XT2B 1J5YA 2WGVA 3E2LA 2H0TA 3KLOA 2KDZA 3FG8A 5E1XA 3LCEA 1IOUA 2XPUA 1EJ9A 2HYFA 2F5VA 2Y2KA 4S2PA 1F2KA 3QQAA 2VUMJ 3BQZA 1V9ZA 1V9YA 2W1TB 3S3MA 3OYNA 3HZJA 3MAJA 4GD6A 2HVRA 5C4JJ 1S8NA 2LNBA 3G6EI 3TW8A 2ZJPF 2P4WA 4RLQA 4PSXA 4K91A 4OP5A 5HLIA 1T1BA 3CUEC 5EG0A 2KOIA 2VV8A 4B47A 1W0UA 4UQIS 2Q1ZB 3ZMVA 5F68A 4A2UA 5E8IA 3TG9A 3MEXA 1Z05A 3H1CA 1Z7UA 1HW1A 1AOYA 2OBPA 2WAQN 2VXDA 4ARZB 4DE3A 1UHMA 2XF6A 4WZ5C 3SZGA 5JLWA 1TP4A 4IVKA 2EFNA 4F55A 3KX0X 3CTAA 5CVIA 2DBBA 1XSVA 2PHYA 1MWUA 3OOVA 1YITI 1KQ8A 2WKHA 5EUAA 4HF2A 1F5MA 1L0GA 4RAYA 3F3XA 3OPHA 2NVUB 3CCQI 2H94A 2M2EA 3ZNTA 4E04A 2L4AA 3FDYA 3GDIA 4JF4A 4CCNA 2JA8J 4YFMA 3IX4A 1SFXA 2CWEA 4KZ4A 1FCOA 3KSFA 2ZO4A 2LR8A 3HG9A 3M7GA 4RMNA 4WXDA 3DPUA 3OYJA 1FYMA 4QTRA 1E3UA 2EXAA 4HHDA 1Y6IA 3WTSC 4BLMA 3AG1H 5IP7J 3JPUA 1K6YA 4NDLA 3UN7A 3LGOA 3L2CA 3M3YJ 1XJ4A 4FH4A 3IKVA 5DF9A 4D5CA 4KT5C 3OOUA 4XSXF 1K55A 3HOVJ 2L4RA 5JFRA 3PNTA 2VZWA 5CTMA 3KZZA 2DJNA 3Q3SA 4BQOA 5HARA 2O8KA 2G7UA 4YIIA 1Y8QB 4AYBN 2X01A 1XMKA 3GTGJ 5F69A 5TR7A 5HWVA 3IS2B 1XGOA 1A6QA 3GTLJ 3DXJF 2DPUA 5HS8A 2FA5A 3E1SA 2DA4A 3BEBA 3OBFA 1QVTA 1L2SA 3IRQA 5DD8A 2JBFA 1BTLA 3O8HA 2PG4A 5L3CA 1FOXA 5K5RA 2ZQ9A 4CPKA 4PJJA 4EV0A 2W1OA 3LSMA 3GVBA 4MFDA 1E0EA 2P74A 2A6HF 2RGVA 3V8KA 1SDNA 2QQ8A 3HPHA 3ESWB 2YX7A 4LV1A 4LV2A 3BFDA 3L00A 3T4OA 2DFFA 1VETA 3GZNB 4Y33A 1OKRA 4DYQA 1DDNA 2LLKA 5KIZA 3E7LA 3NARA 4OINF 5IOYA 4A5RA 1HZOA 3C2WA 5E1ZB 4Q4ZF 2EZKA 4BE0A 1WE4A 3WWXA 4KZAA 2OOLA 1YG2A 3VOEA 1SVMA 2QCOA 1IGNA 1BUEA 1MD0A 1IYSA 5HLHA 2KX6A 2R9WA 1I1GA 5CVRA 2HPIA 3JSOA 1FIKA 1YLFA 3OIQA 1X1AA 5F64A 4MEYF 3DBRB 5EEGA 3PSIA 5E3MA 3EETA 2L9RA 2DA1A 3FX3A 1VFCA 3H7WA 1U9NA 3DWLE 3H3ZA 1BR4A 2R5YA 3HEFA 1L3LA 5GLDA 3A3JA 2EFQA 5GTHC 5EDNA 4NNJA 1JHHA 2L9NA
chains in the Genus database with same CATH topology
2V1UA 5L3GA 2GWRA 2J5OA 4KN4X 2CQKA 4EEUA 4G3KA 2Z33A 4RS8A 5ICFA 3ELKA 4MHGA 2LDUA 2HTSA 1S4RA 4NXEA 2W3EA 4PGHA 2QHKA 2OWJA 1E17A 5ILVA 4BXUA 2L02A 1HW2A </