3P7NA

Crystal structure of light activated transcription factor el222 from erythrobacter litoralis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
191
Chain Sequence
PAQWVLDLIEASPIASVVSDPRLADNPLIAINQAFTDLTGYSEEECVGRNCRFLAGSGTEPWLTDKIRQGVREHKPVLVEILNYKKDGTPFRNAVLVAPIYDDDDELLYFLGSQVEVGMARRERAAEMLKTLSPRQLEVTTLVASGLRNKEVAARLGLSEKTVKMHRGLVMEKLNLKTSADLVRIAVEAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of photosensitivity in a bacterial light-oxygen-voltage/helix-turn-helix (LOV-HTH) DNA-binding protein.
pubmed doi rcsb
source organism Erythrobacter litoralis
molecule tags Dna binding protein
molecule keywords Sensor histidine kinase
total genus 62
structure length 191
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p7nA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p7nA01
3BY6A 5E1ZB 1FY7A 1IXRC 2PD7A 5DCMB 3FM5A 3L00A 2KKOA 4HLYA 2HDCA 2IVMA 1SD5A 3EWKA 4FX4A 2DK8A 2FOKA 1B1BA 3KZYA 2CFXA 4WL9A 1TTYA 4XSZF 4I5SA 4EETB 4LJZF 3JAMZ 5JFRA 1GVJA 2HQNA 4HNBA 1IUYA 3FXQA 4LLLA 1CF7B 5J6XA 3CO6C 1R1VA 1K78B 4PGHA 4RB1A 1DUXC 4QWQA 2QYOA 2CMNA 2P5LC 2QWSA 2D1HA 4FX0A 1OTAA 2ZCWA 3FM3A 5JVTA 5F64A 2GZWA 4KIFA 1BJAA 1UFMA 2HQRA 4M6YA 4KMUX 1Z6RA 3GFJA 3DEUA 4YFNF 2VODA 3HJIA 4XT2B 4KA4A 1WKMA 1T19A 2XV4S 3CUQA 5L3DA 2H94A 4ON0A 5FD6A 5E8GA 1SFEA 3IWFA 4ZYGA 2ZKZA 3GLXA 2HR3A 4LRYC 3T0YA 1BI2A 4O5VA 3IC7A 3NOTC 1ZGJA 2JT1A 1F98A 5CVVA 5ILVA 1G4DA 2R3SA 3NQOA 4U7DA 3SXYA 2O3FA 1FYKA 2CW0F 4RGXA 4NB5A 4KYWA 2GXGA 2PMUA 5K5OA 1TS6A 3GFIA 1P4WA 3O2PE 1P92A 3SZTA 3QPHA 2A6HF 2MH9A 3B02A 3WGIA 1XSXA 1FWZA 1YG2A 5HDKA 4OIQF 1U2WA 5HS7A 2PMHA 1S4RA 2Z6DA 4KN4X 3I58A 1TS0A 3HRSA 4A2UA 3PQKA 2GA2A 4MGRA 3MCZA 5LGNA 4IXAA 3P9CA 4E70A 4RAYA 2Y0MA 4E04A 4RS8A 3HOTA 3J7AO 1I5ZA 1J75A 5DCFA 2CQKA 3O3KA 4FHTA 4Q48A 1U3EM 2MH2A 4WUJA 1FSHA 2O03A 1IW7F 4FT8A 1O3QA 4RQ9A 3DPLC 1O7LA 1IN8A 2FE3A 2IPQX 3K3DA 3IKVA 4HQEA 3FMSA 4M9SA 4M73A 3C3WA 1UCRA 2FQ3A 3ZN0A 3R60A 3LSTA 4KMFA 3NEUA 4G8XA 2X4HA 1LJ9A 4P9UA 3GX4X 1LL8A 5HDDA 4OOIA 2LF8A 2DI3A 2VOPA 1BIBA 2EV6A 4HP9A 1P4XA 4KUMA 1F9IA 5EFWA 2XASA 5HVQC 4KICA 3GZ6A 1F4KA 2EWNA 1EV7A 1G3SA 3RYPA 1MZUA 2RNJA 1ZAOA 2L3DA 2VT2A 3KX0X 4EEUA 2VE9A 2R7DA 3WODF 5F1RA 2A69F 2PLYA 2BYVE 5HLGA 3H3UA 3R0JA 4K2EA 5ICCA 1OR7A 2GA1A 4L9FA 2V1DA 4BH9A 1V3FA 1QNTA 1FZPB 4L5JA 3EUHA 3E97A 1PP7U 2C6YA 1XDSA 1Z6TA 4D0PA 2ISYA 4U0WA 3J81K 4HH2A 1ON2A 3PFIA 4P55A 2BASA 1UHMA 1RNLA 2EFQA 4A0YA 2D01A 4HX7A 3CUQC 5HWVA 3RPQA 4LRXC 2K86A 1SD6A 1VB6A 1R22A 1BC7C 4M74A 3CUQB 5IT9K 1KGSA 1W7PB 3E6MA 4ZYHA 3QU3A 2A24B 1YFHA 3U1DA 5H6QA 3BJ6A 4IVNA 3WE2A 3WTTC 1YO5C 3WTWC 5L3BA 1OT6A 4LLOB 4HHDA 4L0ZB 4WLAA 1TNSA 4I01A 2XVCA 3JAMK 1BBYA 3MFXA 2ZOIA 1U5TB 1X3UA 3IWZA 3N4MA 2DAOA 3LIEA 3I64A 3VOLA 5HOOA 1W4MA 2F5DA 3R0AA 5JR3A 3ISPA 2FBKA 1V4RA 3TGNA 5FLXK 4M72A 4YIIA 2QQAA 2YSRA 3BY9A 5F68A 4UHTA 2QHKA 4A5NA 4JGRA 3FC7A 1MJBA 5LGTA 3F1PB 1VTNC 4OINF 4O6JA 5BPDA 4EGZA 3PQJA 2NS0A 2ZOHA 2D1VA 3GECA 4UVBA 2ZMEB 4I38A 1LEBA 2P7VB 4TV7A 2ZBKA 4Y15A 5LRSA 1SFUA 1DRMA 1ZLJA 1SD4A 1USTA 3MXQA 3NOPC 2GIVA 4ZH4F 3C8CA 1ZRFA 1TQIA 5IU1A 3ECOA 1OT9A 1U5TA 3F6OA 1XJ3A 2J80A 3QRFF 3R6SA 2O6GE 4HDVA 1MJ9A 5BS6A 1NHAA 3DFGA 5K1YA 4L9NA 1FX7A 3MFKA 3I59A 1XGMA 1JHFA 3TKYA 2K4JA 1T98A 3BWLA 4OIRF 1XN7A 4KN7X 4A0ZA 3ZMSA 5HSQA 3G6OA 1RUNA 2HWVA 3F8BA 3LAJA 3VFZA 3KEQA 3I71A 2HFHA 2O8XA 2RQPA 3LA3A 1P97A 3L2CA 3F8MA 5E1XA 2PD8A 1HW1A 2XKOA 5LLQA 2JTVA 2L4AA 3TO9A 3WGGA 2QWWA 5ED4A 4YWZA 4ZYDA 1FSEA 1SD7A 4HW0A 4KIGA 5CLSA 2XAJA 2BE5F 3GXOA 1Z1DA 3JSOA 2FF4A 4GS9A 3LWFA 3J80K 2UWMA 3TDUC 1TW3A 5CVJA 5AIPA 2FNAA 3D5LA 3DQVC 2K4BA 3ICYA 4MN5A 1I1SA 2PYPA 3BROA 1ULYA 1P4AA 2H27A 3IBRA 2IT0A 2LF7A 1BN5A 2FMLA 1O3TA 2VBWA 1LDJA 4Q47A 3L09A 2XAQA 3V7CA 4K08A 3VOEA 3T5XA 3IHUA 2WWYA 1XJ2A 3NJAA 5HZHA 1XDUA 4P96A 2Q0OA 5K5RA 2KRFA 3Q9SA 2OU2A 3M8EA 2W24A 2DK5A 3LIAA 3SW1A 3COAC 3OOPA 1DPRA 2HEOA 1SAXA 2HTSA 5AONA 4UV9A 1QBJA 2BGCA 2P6TA 2E1CA 2AXLA 1JHHA 3V8KA 1ON1A 4L9JA 3B73A 1IAWA 1FBSA 2CO5A 5ERIA 4Y13A 4CICA 1J9IA 3CUOA 5JI6A 3W6KB 2W25A 1HXDA 5CVIA 1B9NA 4IJAA 5KVRA 2P7JA 2PEXA 3LI9A 2BEOA 2L4RA 4R79A 4F7ZA 4NQWA 3ML6A 3FX3A 2NYXA 2OQGA 2R78A 2LSOA 2XAGA 4IRHA 3FZVA 2EK5A 1LDKB 3D0SA 1HKQA 1W7PA 5CVUA 4AIKA 2CYYA 1H9GA 1S29A 3MQOA 4EERA 2BV6A 3D72A 2VBYA 2EV5A 3KLNA 1HW2A 4P9FA 5E17F 5HLHA 5HDNA 4PGGA 1FNNA 3GW2A 5D6FA 5DYMA 4WF2A 1OTDA 1FT9A 3FMRA 5BOXA 3UB8A 1G3TA 3DP7A 1TW2A 3E3VA 4I98B 1GSWA 1S3JA 4I7HA 1OYWA 1KOUA 3KP5A 2PHYA 4LD5A 3LIFA 5FFZA 2JZYA 4A6EA 3HRTA 4KUKA 3T50A 3GDIA 5A8BA 3K1MA 1IN6A 4U0YA 4EQ1A 3T1BA 2LDUA 3MZYA 2FRHA 2HTJA 2P4WA 3QU6A 1UGUA 4NHJA 3H3ZA 5LGUA 2WC2A 3MZHA 3JTHA 3HUGA 3NOUC 5HS9A 2MBFA 3EEHA 1OTBA 3ULFA 5FLXZ 2DBBA 2NRAC 3UE6A 1G28A 5J8CA 2DFIA 4LLNA 3DV8A 2V1BA 1FP1D 3I59B 3WTYC 2ZO4A 1ZG3A 4OMZA 1ZN2A 4GXOA 4QLCU 4XLPF 1KU7A 4RAZA 4RB2C 3I0TA 2LKPA 5CYVA 1BI0A 2KDKA 1XGNA 3A0SA 4MTEA 3OLOA 2VONA 4CHUA 2Z9OA 5J3WA 1YW9A 1U8RA 5FGMA 2JPBA 4LK0F 5L3GA 4MN6A 4EVIA 4L9EA 3F23A 1L3LA 3CJNA 1CF7A 2K7LA 2WKRA 2W27A 3HTUA 4N9IA 4R6LA 5BMZA 4ESBA 1YQAA 5HS8A 3I4PA 1KYWA 3E4QA 5DUIA 3A0VA 2Q2EA 1IF1A 3E4OA 4AIJA 4HJ3A 4HF2A 2VT3A 1BI1A 3UB7A 3WTVC 4LGWA 4PZJA 5HWTA 2PG4A 1WI9A 1XSDA 2EA9A 3G3ZA 1YS7A 3VE3A 5CVRA 3QPTA 1T18A 1S1ZA 2VLGA 1XMKA 1WSUA 4LRZE 1KU3A 4R1HA 3I5UA 4Y17A 4NXBA 1XJ4A 2V9VA 1OKRA 3BDDA 4YIFA 3HSEA 5KIZA 2H6BA 2V1UA 2ZJ2A 1J5YA 1U78A 1DDNA 2L54A 4I3JA 3V7SA 2QJ7A 4G7OF 3RH8B 4LMYA 5G4YA 1LNWA 3F21A 4M6XA 1P2FA 4HP4A 4S04A 2ELHA 3E5UA 2QLZA 5A2QZ 4U0VA 3LQRA 5AVFA 4AVPA 2EJRA 4RB3C 3EYIA 2EFNA 1JGSA 2IP2A 3LFKA 4M71A 1N9LA 2MLKA 2A68F 3W6JB 1O3RA 2JHEA 1KQ8A 3F22A 5IS1A 3GF2A 2MD5A 2IA1A 1W5TA 2W84A 2DLLA 1USSA 2EFWA 3DKWA 1OYIA 4EMSA 4DNCA 4LG0A 5FFXA 2DW4A 4G7HF 4OMYA 3V8LA 3QAHA 5HWWA 2HKOA 2KJBA 2V1XA 1IN5A 2Y48A 1BI3A 3GUDA 3M8FA 4H0EA 2VBXA 4HIAA 1J59A 3JSPA 2OA4A 4HX4A 4PKYA 4HBLA 1UHWA 1Y28A 1MDMA 3ABUA 6PAXA 2OQRA 3SFZA 3TOAA 5D5WB 2XRNA 3T8TA 4JGQA 2ISZA 1H9TA 2QBYA 3GFLA 5FB2A 1UWNX 5DJTA 4PDKA 1EH6A 1FLIA 2XHKA 1FYMA 1G3WA 4ZZLA 3Q9VA 4I0BA 4M9XA 2G9WA 3L9FA 4KDPA 3VEPA 5ICFA 4MEXF 2ZXJA 3PYPA 5H20A 2OD5A 4WN5A 2M1CA 4EEPA 3HHGA 5J8FA 1R00A 2WV0A 2DPDA 1I27A 1V9YA 2EA4A 2OBPA 5E8IA 2PDRA 1KA8A 4GYGA 1K6OA 4LB5A 4GHIB 1BOAA 1MGTA 5BQTA 1KU9A 1ZRCA 2DPUA 2VBZA 1FYLA 4YFXF 2YPRA 4JK1X 4HY8A 5EEHA 1YLFA 3J80Z 2HKXA 4RGRA 2UXNA 1XMAA 3IKTA 3HJKA 1RUOA 5K5QA 5AIQA 3GVAA 5JHUA 1WQ2A 1J0RA 3RTYA 3BP8A 1KYZA 4P5OA 1FOKA 2QZ8A 2CWEA 4I09A 5DDGA 2D45A 2ZNZA 4KQDA 3BY8A 3LA2A 4Z2YA 2DTRA 2HZTA 3U9GA 3K1NA 4NXFA 4LG0B 5IT3A 1S66L 5LBQA 2QENA 1X0OA 5ICEA 1D06A 3K2ZA 1FPQA 2M45A 2FU4A 3ZMVA 4MNUA 2O0YA 4WX9A 3E6DA 2QJ5A 5DEQA 4O3MA 1B9MA 4WCGA 1Q1HA 4NXEA 3WG9A 4RGSA 2XGXA 2A61A 2J5OA 3BPXA 5HDGA 2TDXA 3FF5A 4EJUA 4WF0A 2OOLA 2M30A 4M9ZA 2F5FA 3FHZA 2FSWA 4I3AA 3BZ6A 4B09A 1BIAA 2RN7A 2A3SA 4BHPA 1J7KA 5LRRA 1IRGA 3E6BA 4A12A 1MJAA 2WKPA 4GO1A 3WTXC 4GCVA 2Z5UA 3WTSC 3GO5A 2ESNA 4KFCA 1K7AA 1HQCA 1OPCA 3F6VA 4U88A 2ZMEA 4HYEA 3B33A 3C2WA 4JGPA 1GXPA 3DPTA 3TDZC 2G7UA 3ROUA 2VN2A 1P0ZA 3F3XA 3F8FA 2V1AA 4ETSA 1ZARA 5J7EA 5TBMB 4L0YB 3CWFA 1IN4A 4U7BA 2XAFA 2IA2A 2KIMA 3EYYA 3NRVA 2JN7A 1I6XA 5FO5A 1F1ZA 4EESA 2P7CB 3F8CA 4OIOF 4KUOA 1U5TC 2AS5F 3I53A 1E2XA 1I1GA 2V0WA 3ZMTA 2VE8A 3AAFA 4WXHA 1R23A 3MQ0A 4CDGA 1D7EA 1S8NA 1H0MA 2XKPA 4I3IA 3RIRA 4B9OA 2J5PA 1T6SA 1FP2A 5LEJA 2E7WA 3VODA 2RVCA 4BYYA 4L5IA 4AD9A 3M9AA 3BPVA 4UVCA 4AWXB 5LHIA 3UB9A 1DP6A 2RV8A 2D2WA 1K78A 3WU1B 4HX8A 3JW4A 5D4SA 2EB7A 1J2XA 2HYGD 1JE8A 3BJOA 2P5KA 3M1EA 3ZMZA 2JSCA 1XGSA 4IF4A 2YKHA 3ERED 3EDPA 1DPUA 4DQ2A 1QZZA 3LYXA 2I9VA 1XB4A 2XUBA 3KP6A 2A6EF 4R38A 3JTGA 1HBXG 4RGUA 2BBYA 1O57A 3KZZA 3R4KA 3HRUA 4XSXF 1WWXA 4G6DA 4R8HA 2CSOA 1LSXA 5L3CA 5H6RA 4BHBA 1ODDA 2QBYB 3VE4A 4ZYEA 2L1MA 4H6JB 3KETA 1QZYA 4A0XA 1TS8A 4KNYA 2P8TA 2HYFA 3RKWA 4HLXA 4XBFA 3LIDA 1ZG5A 1RIOH 3H92A 1Z91A 4YFKF 3S2WA 2VOOA 3CO7C 2YKFA 3WE3A 1C0WA 5LEKA 1E17A 4YG2F 2H6CA 2M1BA 2XIGA 4LLGF 1Y0UA 2P6SA 1T1BA 1GSVA 4HAMA 2LNBA 3MJQA 3EQLF 2IJLA 5D8LB 1KU2A 1D8KA 1R36A 1K79A 3SHFA 4CXFA 1N9OA 2GJ3A 1EH8A 3BWGA 3IRRA 2EFOA 4HF1A 3WGHA 1R1UA 4IRGA 2QKPA 4G94A 2VV7A 4PKYG 3EETA 1G6NA 2HGCA 1LSWA 1UWPX 2VV8A 3ELKA 2E1NA 2E7XA 3J81Z 4BAYA 2NNNA 2QQ9A 4HF0A 5TJJA 2DT5A 2L4MA 2KX6A 3REOA 2PN6A 4XLNF 1XCVA 3HSRA 3BOQA 3K0LA 1S7OA 2HOEA 2YU3A 1HKSA 3KP7A 1AWCA 4R3AA 1ONVA 3LIBA 4M4XA 4WXDA 1S6LA 1S7AA 3KE2A 2FNPA 3KP4A 2FBHA 3MEXA 3ZQ7A 5AVEA 3HRMA 5D5UB 2NNYA 1STZA 3TO6A 5DV5A 3A0RA 4UNOA 2DQRA 3H82B 2ACJA 4HZFA 5E18F 1R7JA 4HOIA 4CO8A 2Z3YA 2K02A 1FBQA 4MEYF 3FG8A 2X0LA 1MD0A 1YYVA 2ETHA 2EV0A 2QQBA 3MQQA 1DP9A 2W0NA 1TQMA 5DJUA 1AOYA 1FBUA 2ADUA 1L0OC 1HSTA 3FXUA 4HV6A 2VC1A 4ENKA 1XFNA 4HQMA 2COMA 5DD4A 4LPZA 5F6FA 1DP7P 4A6DA 3GWZA 2IRFG 3M7GA 5ILSA 3V4GA 1QPMA 3E4PA 3E5QA 3NHQA 5TBMA 3RKXA 3HHHA 1V9ZA 3SZPA 2O61A 4CZZA 1Z7UA 5DD8A 4EM0B 4HDUA 4WXCA 3F1NA 3RI4A 3DF8A 2INWA 1O7FA 3RJPA 5HD5A 2R7FA 5E20A 2Z6CA 2UZKA 1PP8F 3VB2A 2STTA 3IS2B 1LDDA 1ZLKA 1BC8C 4EM1A 2FXAA 4LK1F 4H6JA 3GEZA 3PHYA 5LHHA 3T8RA 4B8XA 2CGPA 1U6GA 3KP2A 3RKYA 5TRDA 5A2QK 3CAXA 1YW7A 2H09A 3MWMA 1LSVA 2UXXA 4G9YA 1ZG1A 4ENNA 1XCBA 2RC4A 3MAJA 4LFUA 1YTYA 1LVAA 1UB9A 4CGZA 1S1YA 1MZBA 2FBIA 2B02A 1T1CA 1MKMA 4CYDA 5DKKA 2K7SA 3P9KA 4BNCA 2Z33A 1T0FA 1TLHB 2A5YB 2EFPA 1ZH5A 4HI4A 4I2OA 4JQFA 1D5VA 2PFBA 3UMEA 3H9WA 3CLOA 4ENJA 1IXCA 5E1WA 2YR2A 4EJTA 4G7ZF 1YW8A 4BHCA 3K9TA 4GW9A 3IS2A 1ZREA 3UMDA 4UXNA 3U2RA 1D8JA 2A24A 4EXOA 1XFQA 1ODVA 5EEGA 3RYRA 4HA8A 3KFWX 3H7WB 4EW7A 2RDPA 4BBVA 1LEAA 4OIPF 2DQLA 2W57A 1SFXA 4N9HA 3DXJF 1BM9A 1TBXA 5F5YA 2L01A 2RKHA 5I5LA 1B4AA 1HW5A 2JRTA 3HIFA 3ZQ5A 2STWA 2PI0A 1HSJA 3OV8A 1YIOA 1WRJA 3C7JA 1S4SA 2VV6A 3F1OA 2A07F 4ENMA 2MLGA 2OWJA 2FEZA 2OAZA 3C1DA 2H28A 2L0WA 3N97A 2V6CA 5G4ZA 5D6EA 1CGPA 2PJPA 2OWHA 3F72A 3E5XA 1JNUA 1MDMB 2HV1A 2RGVA 3QP5A 2VXZA 1RZ4A 1GXQA 2PQ8A 4BXUA 4L9GA 1N9NA 5HLIA 2DU9A 2YX7A 1T2KA 4UV8A 4JGOA 2KJCA 3CTAA 1IN7A 4IHTA 2G7HA 4F3LA 2Z99A 2M5WA 3KP3A 5HDSA 1R1TA 1SMYF 3FMQA 3QP6A 3TO7A 1B59A 2QVOA 2QUFA 5ILUA 2IA0A 1EH7A 3SQNA 1P6RA 3H82A 4I02A 1G3YA 1TQPA 4N0BA 2EA2A 1D3YA 5ICGA 5J4EA 4AIHA 4LB6B 3P7NA 5HD3A 4WWCA 3HYIA 3F1PA 2V79A 2B0LA 4JBAA 4I39A 2Y75A 1REPC 4A5MA 4GS9B 3G73A 1RI7A 4EGYA 1SMTA 1ZRDA 2MC3A 3GFMA 1FC3A 5F6AA 3ZN1A 1F9NA 4ZZDA 3P9IA 2M8EA 1OTEA 2F5EA 3E6CC 2V9AA 1LB2A 2GWRA 2PR6A 1JXSA 4S05A 4F3LB 2PBIA 4MQ9F 1W7PD 5IT9Z 1OJ5A 1XGOA 1IRFA 2V0UA 3LUQA 2OZUA 5DCMA 2GAUA 4EJVA 5FD5A 1T1AA 3LICA 3ZP5A 1Z9CA 3TQNA 2OZ6A 4EJWA 3LQQA 4L9VA 3KLOA 5CJ9A 4XRFA 2M87A 3F1OB 4ESJA 4GCZA 1OMIA 5DKLA 5DUKA 4RB0A 3O6BB 2IW5A 2F2EA 3ZMDA 3L7WA 4PCQA 2WTEA 4Q5SF 2YX4A 4BBTA 4EJOA 3BJAA 1LT0A 2FA5A 2VC0A 1XSVA 5KK1A 1R58A 4L9TA 2QM3A 3Q5FA 4EV0A 3F1NB 1BYWA 4HJ4A 5D5VB 1DP8A 3FXRA 3KCCA 3V7RA 2K27A 3K69A 2P5VA 1KQ0A 1EW0A 1NWZA 3C18A 4HOBA 4XT2A 3UB6A 4L18B 1GSXA 1O3SA 2GQQA 3TOBA 4IHSA 1WA9A 3WTZA 3HOSA 3H7WA 1IXSB 5BPIA 1OTIA 4HH3A 1PUEE 1HKTA 5D8KB 3K3CA 1GHCA 1A04A 1OYYA 2D02A 2F5CA 3QOPA 2XROA 5F69A 2CG4A 3WU0A 2XAHA 1QO0D 1ZGAA 1XJ6A 4EQQA 4HJ6A 2JPCA 4KIBA 2ZFWA 1XD7A 3RPUA 2KIUA 1KQ9A 4ESFA 4BBUA 4NXGA 4ASNA 4HV5A 3WTUC 1TS7A 3I54A 1F5TA 1R5GA 1T38A 4HQAA 5HDCA 2FMYA 4DJ2A 4IRIA 3ZMUA 4I0AA 3GZ5A 4GHIA 2DO7A 2NAZA 3FWEA 3GYHX 3V8JA 3MR0A 3ABTA 1T39A 5LHGA 3ULQB 4UUVA 1YS6A 4BQAA 2W85A 1S67L 2ZBBA 4WK8F 2GXBA 1QGPA 3HTSB 2L02A 3ECHA 4UVAA 3IRQA 4EM2A 2HS5A 1PDNC 1R5HA 1LQ1A 1B6AA 1IZ1A 4MHGA 2PR5A 3HSFA 4OU0A 4DJ3A 5L3EA 3LA7A 5D4RA 3CDHA 3RDIA 4G6QA 1QQIA 1ZHFA 3K1PA 2ZNYA 3R61A 5L3FA 2Q8KA 1TNTA 2PYRA 1OJGA 5D5XB 2KIFA 3KEOA 3RTRA 4R70A 4IPAA 2WKQA 2ESHA 4GYIA 2VEAA 4MQVA 3ZPLA 1Z05A 3F8NA 3LI8A 1W5SA 2MA3A 3LAPA 4GGGA 4Q4ZF 3IL2A 4MTDA 4KT5C 1ZYRF
chains in the Genus database with same CATH superfamily
1VZ0A 3BY6A 3CUEA 5E1ZB 2X01A 3T1QB 1FY7A 2CQNA 1IXRC 2BHYA 5J47A 4XICA 2PD7A 5DCMB 3FXOA 3FM5A 4S2LA 3L00A 3M8JA 5C5KA 1XKZA 1AA7A 2XQZA 4NEED 2KKOA 5M5XJ 3N6IA 4M3FA 4HLYA 2HDCA 2IVMA 3LR3A 1SEUA 1SD5A 1VEUB 1I3AA 2Y91A 2KIQA 1WE4A 1D1JA 4E3OA 4ZTFA 1ZKJA 3HGYA 5CHUA 3EWKA 4FX4A 1W0TA 2DK8A 2FOKA 4BY1J 1B1BA 3KZYA 2CFXA 1BT5A 2Y0SA 3G1OA 4WL9A 1TTYA 5FA7A 4XSZF 4I5SA 4EETB 2H10A 4LJZF 3JAMZ 3T4JA 5JFRA 3GTKJ 1GVJA 2HQNA 2JE5A 2X9DA 3PNYA 1OMEA 4WEKA 4D60A 1T8IA 4HEFA 4HNBA 1X1PA 1F5MA 3EQUA 4BL2A 2I5UA 4RA2A 1D0ZA 3FXQA 4LLLA 1CF7B 4Y52J 2VQCA 1IUYA 4KG5A 2Y2ZA 4NC8A 5J6XA 3CO6C 1R1VA 1K78B 2VGKA 4PGHA 4RB1A 1DUXC 2KPMA 4QWQA 4C3JJ 2HXOA 2QYOA 2WA0A 2CMNA 2P5LC 1DJAA 2D1HA 5DS9A 1JKRC 4FX0A 2QWSA 5GAEJ 2ZC2A 3CCRI 5E2GA 1OTAA 5FDHA 2ZCWA 3FM3A 3IAM2 3OMYA 5JVTA 1VQ9I 1YMSA 3L2RA 3PBOA 4OPYA 5F64A 5M19A 2VI6A 2GZWA 4KIFA 1BJAA 3JRCA 1UFMA 1MIJA 1T08B 3AL0B 2HQRA 4M6YA 3BM6A 4KMUX 9ANTA 1PRQA 1Z6RA 3GFJA 3CDLA 3DEUA 4YFNF 3BQAA 4I99C 2VODA 3OYDA 2B18A 4WBGA 3EGDC 3HJIA 4XT2B 2Z1DA 1WHUA 4KA4A 1YSPA 3FV7A 1WKMA 1T19A 2XV4S 3CUQA 5L3DA 1NYMA 3GMWA 2H94A 4ON0A 5FD6A 3CMZA 3LSIA 4NUBA 5E8GA 4C2UA 1SFEA 2VGLS 5GLCA 4HSTA 2XGEA 3FPVA 3IWFA 4PM6A 4ZYGA 3K4CA 4EV4A 1QMEA 3A1YA 1MW7A 4IUHA 3OYKA 3OBFA 2ICWG 2ZKZA 4MFEA 3GLXA 4EWFA 5K5BA 4OOMA 2HR3A 4UAAA 4LRYC 1QMFA 2IXSA 3T0YA 3ZDJA 4ZTJA 5KSCA 1BI2A 3HLGA 3DU5A 1S5LC 3PXPA 3WU2C 3S4XA 5DF7A 1K56D 3VYTB 2M9HA 4O5VA 3KYLA 3IC7A 3NOTC 1HDDC 4QTRA 5EE8A 1ZGJA 2JT1A 5D3OA 1F98A 5CVVA 1U60A 5ILVA 2H1KA 1V55H 1G4DA 2R3SA 5DM7F 2J3TD 3NQOA 3PBSA 4U7DA 1Y1WJ 3VV4A 3SXYA 2O3FA 1FYKA 4OP8A 3BQYA 4Z9QA 2CW0F 4MTDA 4RGXA 2PX9A 4NB5A 2UUZA 3BLSA 4KYWA 2GXGA 2PMUA 2KDOA 2XF6A 5K5OA 4KJZA 1TS6A 3GFIA 1P4WA 4C9YA 2PAVP 1W63Q 1MBJA 1V54H 2JVHA 3O2PE 3TW7A 1P92A 3SZTA 3QPHA 3KSIA 4LIVA 1GT0C 1UJ8A 2A6HF 2MH9A 1MBGA 3B02A 3WGIA 5M1AA 5EVIC 1XSXA 1FWZA 1RESA 1YG2A 2H8RA 5HDKA 3HOUJ 3E7LA 4BGDA 1U2WA 4OIQF 2RREA 3U2AA 4IOAF 5GLBA 5HS7A 2XEPA 2ZSHB 1MWTA 1XA7A 2PMHA 1S4RA 2K40A 1W5DA 2QSFX 2Z6DA 4KN4X 1GHMA 3I58A 3JRHA 3HRSA 1TS0A 4A2UA 4KZ9A 1FOFA 3ZQGA 3PQKA 5B3SH 2GA2A 4MGRA 3MCZA 3CP8A 3MKYB 1MXOA 5HLTA 3D1NI 3BLYA 5IT5A 5LGNA 4IXAA 3P9CA 2E5ZA 2XF5A 4E70A 4A3FJ 2ACGA 1MBEA 4RAYA 2Y0MA 1TWAJ 4RS8A 4E04A 3MS6A 3ZQIA 3HOTA 3LMMA 3J7AO 1S72I 3VWBA 3S7PA 3UO9A 1I5ZA 3BG6A 5K7FA 1J75A 3OZHA 4A3LJ 2IBDA 3QYBA 5DCFA 3LNQA 2CQKA 3O3KA 4FHTA 4Q48A 1U3EM 2MH2A 4WUJA 1FSHA 5AQAA 5A90A 3K4NA 1E4DA 4OLGA 2O03A 2XPVA 4BS9A 1IW7F 1ES4A 3MKEA 4FT8A 1PNEA 3N8LA 3TRCA 3HPHA 5BNGA 1O3QA 4RQ9A 3DPLC 2UWXA 3CAXA 1O7LA 1IN8A 2FE3A 2IPQX 2R5YA 1YIJI 1SKOB 2VGJA 3K3DA 3QNBA 4YRVA 3IKVA 2KL4A 3LL7A 1TEMA 4O7DA 1HC8A 3DWKA 4HQEA 1K56A 3B6AA 3FMSA 4M9SA 2PRFA 2GXAA 4M73A 4RDUA 2W00A 1PI4A 2LKSA 3BC8A 3C3WA 2DN0A 1UCRA 3K4BA 4C3IJ 3J7YJ 1A0KA 1ETYA 4IEDA 2Y9YA 2MFZA 2FQ3A 3ZN0A 3LGOA 1I2SA 3R60A 2WV1A 3LSTA 3CMAI 2F6CA 3HZJA 2R7WA 4I6ZA 3NEUA 4G8XA 4KMFA 3ITAA 5FSRA 5EOEA 2X4HA 1W5CC 1LJ9A 4P9UA 2GM4A 1XS9A 3GX4X 2CMPA 4MMNA 3HREA 3ZNTA 2K3PA 5DTTA 3RQ4A 1LL8A 1TL8A 5HDDA 4OOIA 2E36A 2LF8A 1P7IA 2DI3A 4RAGA 4IQJA 3I7JA 1CQAA 4MBFA 2VOPA 1BIBA 2EV6A 4HP9A 1P4XA 3R7WB 4KUMA 4GLQA 4XLCA 3NWSA 2G2WA 1F9IA 4ABZA 5EFWA 2XASA 2ZQ9A 5HVQC 4KICA 1VQ5I 3GZ6A 1F4KA 3OS2A 2QMIA 1BLSA 2EWNA 1EV7A 2O7OA 3PR6A 1LFPA 2ZSIB 3ITBA 4NNJA 3V5MA 2HVQA 1G3SA 3RYPA 1MZUA 2RNJA 2IWCA 1X3ZB 2J7VA 3D5RC 1ZAOA 2L3DA 2JBFA 3S3MA 2VT2A 1S0WA 3KX0X 1KDSA 4EEUA 2VE9A 2R7DA 2ZM8A 3O87A 3WODF 3CESA 4A3KJ 4MDZA 1GVDA 5DF9A 2VQHA 5EUAA 1BA5A 5F1RA 3L2VA 2A69F 1N78A 3DEWA 2PLYA 3P09A 2X1EA 3SS3A 5L8MA 4XRSA 1JWVA 4CUGA 2BYVE 4CZCA 4E7LA 5HLGA 3H3UA 3CCYA 3R0JA 4K2EA 1QRYA 5ICCA 1OR7A 3SZGA 3ZG0A 3PL8A 3EGXC 2GA1A 4L9FA 2V1DA 4BH9A 2NUTC 3DU6A 1V3FA 1QNTA 1FZPB 4HRIA 2JJ7A 4CPKA 4DKIA 3PBRA 4L5JA 3EUHA 2AVXA 3LR5A 1MH4A 3E97A 1PP7U 4LCMA 2C6YA 1ETWA 2CUZA 1XDSA 1G8XA 1Z6TA 3BR3A 4ANJA 4Q0JA 4D0PA 2ISYA 2FFYA 4U0WA 3J81K 4HH2A 2DJNA 4E3MA 2W48A 1VQ8I 2ZFUA 3TP0A 1Y8RB 1ON2A 3ZFZA 3PFIA 4BJ5C 2VKVA 3BZKA 4P55A 4XLEA 4EBNA 3LOCA 4WEJA 1GV5A 4C3QA 3H3VK 4DDYA 3AGDA 4A3EJ 3H36A 3MVPA 3LFUA 1YLZA 1IYPA 2BASA 1UHMA 1RNLA 2EFQA 3OCLA 2VUMJ 4UUSA 4A0YA 2D01A 4ZDXA 1PIOA 4HX7A 3BRMA 2L2OA 3OYFA 3S15J 3RXXA 4KZ5A 3TJZC 5HAPA 5GHZA 3CUQC 5HWVA 2IGKA 1NTCA 4PFOA 3RPQA 2B95A 4LRXC 4BEHB 2K86A 3UE3A 1SD6A 1Z21A 1VB6A 1R22A 1BC7C 4M74A 3CUQB 4R0QA 3HCYA 5IT9K 3MF0A 1KGSA 1W7PB 3E6MA 4PFPA 4ZYHA 1T95A 1BOBA 5CKTA 1JKQC 5I94A 2MW8A 2KOIA 2DA2A 1FR1A 3JYIA 4BD1A 3QU3A 3ZGKA 2A24B 1YFHA 3GLLA 2JKGA 3UKGA 4X68A 4A93J 3D9YA 5HARA 5KAFC 3U1DA 1ONHA 4OQ0A 3MZFA 5H6QA 4XRSG 3BJ6A 2JC7A 4UA6A 5K7ZA 4IVNA 3BYDA 3OYIA 2I8DA 1VEUA 4KZ3A 3SEZA 4PAUA 3HOVJ 3LFVA 2LFBA 3WE2A 3WTTC 1YKDA 1XA1A 4OOYA 1YO5C 3I4NJ 3WTWC 2R93J 5L3BA 1PUFB 2M8GX 3CP2A 1OT6A 2R5ZA 2CV1A 1EWZA 4G3VA 4HHDA 4L0ZB 4LLOB 4WLAA 3KPHA 1OCPA 1TNSA 1BW5A 4YOFA 4II2A 1U0JA 1OCTC 2HDRA 4MLOA 3HGGA 4I01A 2XVCA 3A01B 1H88C 2JK3A 3FISA 2M34A 3JAMK 3M07A 3IF6A 1BBYA 2WAEA 3N4IA 3CF5F 4U0TA 3MFXA 5A91A 2DYRH 3FDYA 1U5TB 2ZOIA 4RMNA 2ZJQF 3CJQB 1X3UA 3IWZA 2R7XA 3KSFA 2AQFA 3N4MA 2DAOA 4Y7NJ 1U9OA 1BR4A 5FKNA 2LKXA 3I64A 3LIEA 3NULA 5EYRA 2ZMVA 3FBIB 1TWCJ 1F2KA 4HESA 3VOLA 5HOOA 1W4MA 2EZLA 2F5DA 3K4MA 1BW6A 3R0AA 4XRMA 1HCRA 3LY3A 4PMAA 5JR3A 3ISPA 5EF6A 2OAP1 2VJIA 4UUSB 3AL0C 1CK3A 3OR1C 4OAYA 2FBKA 1IC8A 1VFCA 5FLVA 1V4RA 4S2IA 2M4KA 3RJUA 2RAEA 1YI2I 1PVEA 3TGNA 5FLXK 4M72A 2OCCH 3T4QA 4YIIA 2X51A 2QQAA 2YSRA 3BY9A 5F68A 4UHTA 2QHKA 4A5NA 4R1GA 4DZJA 4JGRA 3FC7A 1MJBA 3T1SA 5LGTA 2JA7J 3E98A 3Q3SA 3IXDA 3F1PB 1VTNC 4OINF 4O6JA 4J19A 5BPDA 3G4SI 4EGZA 2CH0A 4XR6A 3LSRA 4A3IJ 3PQJA 2C5WB 3BW6A 5E2FA 2NS0A 2ZOHA 4GDBA 2D1VA 3GECA 2MYSA 3MXRA 4R3JA 4UVBA 3VFFA 3BFEA 2ZMEB 4I38A 1LEBA 1CEFA 2P7VB 4TV7A 2ZBKA 4Y15A 3IH2A 5LRSA 5IPAA 3RZDJ 1SFUA 4ME4A 4OP5A 1DRMA 5HL6A 1ZLJA 3PFYA 1SD4A 3PUFA 1USTA 2K3FA 4B44A 3MXQA 1VQNI 1WZ2A 3NOPC 2GIVA 4AFIA 2HP5A 4ZH4F 1K6YA 4FCFA 3C8CA 1FTZA 3G32A 1ZRFA 1MKIA 3N7WA 3TW8A 4EQ1A 1Y54A 3OPRA 3NI9A 2VIXA 2AXTC 1TD5A 2HPBA 3B3XA 1TQIA 3IAS2 5IU1A 1MWUA 1IFQA 4CLCE 3ECOA 4OQGA 4OWRB 3QYFA 1LI9A 1OT9A 4A3BJ 2DMUA 2ZM0A 3OL3A 4MBHA 3TOIA 1U5TA 3F6OA 1YPRA 2DCEA 3A03A 1XJ3A 1XPBA 4OONA 4S2KA 1V5FA 2J80A 3QRFF 4GKUA 4Y0OA 5E79C 4RYEA 5L10A 3HUGB 3R6SA 4E7IA 2O6GE 1X1CA 1MJ9A 4HDVA 5BS6A 2XLNA 3ABLH 4U87A 4B4XA 3CD6I 3TG9A 1JT0A 1IV8A 3RPUD 3HOXJ 2QSGX 3ASNH 1NHAA 3NARA 4MO7A 5F82A 1WCMJ 3DFGA 1ETQA 2KT0A 2DRWA 2ECCA 3H35A 5K1YA 2VQLA 3S1YA 4LOCA 3VP1A 4L9NA 3SDGA 1NXYA 1FX7A 3U4LP 1H8MA 5FKKA 4IL6C 3MFKA 3I59A 1XGMA 4ETXA 1JHFA 3TKYA 1HA8A 2K4JA 4OQIA 1T98A 1Z67A 3BWLA 3IF5A 2MSYA 4OIRF 2HDWA 2NOJB 1XN7A 4KN7X 2UV1A 4A0ZA 1H8ZA 3ZMSA 4CH7A 5HSQA 5E2EA 2X6OA 3G6OA 1RUNA 2HWVA 4B3XA 3F8BA 1T33A 2XGCA 3OOUA 2OAQ1 4WYYA 5FQJA 3LAJA 3TSGA 3K70C 1QZEA 3VFZA 2YUSA 2XPUA 3KEQA 1ES5A 2L7FP 3DLLF 1ITYA 2XA7S 2Y2QA 3NY4A 5FEFA 3I71A 4ZYAA 1E3UA 4PJJA 2XSSA 2EQRA 2HFHA 2TRTA 5DF8A 2X1DA 5J3LA 2O8XA 2RQPA 3FXLA 3LA3A 3L2CA 1P97A 3WRZA 3DBHB 3F8MA 1D0XA 5E1XA 4R70A 2PD8A 4CSWA 1H8YA 1HW1A 3WHBA 2XKOA 4NG2A 3CCJI 4BENA 5LLQA 2JTVA 2L4AA 3TO9A 2M4GA 3V42A 3WGGA 5GHYA 2QWWA 1K0KA 4JF4A 5ED4A 4YWZA 4ZYDA 3Q07A 1FSEA 3ZRGA 5CERA 1SD7A 4HW0A 4KIGA 4Y3IA 2WYXA 3ZG9B 1B8IA 5CLSA 2XAJA 2BE5F 3GXOA 3HOZJ 1Z09A 2EFXA 2X6XA 4DYQA 2B63J 4GB7A 1Z1DA 2Y8HA 4KZ4A 3JSOA 2FF4A 3KX2A 1EKEA 1HVBA 4E6WA 4GS9A 3LWFA 4DE3A 2A3UA 2DTZA 2CUFA 1YX5A 3J80K 2DNSA 4YEJA 2UWMA 2GIZA 4LV2A 3TDUC 3IWOA 2OJED 3FKVA 1TW3A 3MD2A 5CVJA 2WB1N 5AIPA 1YJ9I 2FNAA 3AG2H 3D5LA 2K4BA 1POGA 1X1DA 3DQVC 4HNTA 5IY5H 3ICYA 4MN5A 1I1SA 2PYPA 3BROA 4LV0A 1ULYA 1P4AA 2H27A 3IBRA 3J7ZI 2IT0A 2LF7A 1BN5A 2FMLA 2ZC4B 3MZEA 3MXSA 5L09A 1O3TA 2VBWA 1K6SA 2R9XA 4X55A 3ZQCA 1LDJA 4Q47A 2IGMA 3OYHA 3L09A 4E7HA 2XAQA 2HP9A 2V7FA 3AG1H 3FKIJ 3V7CA 3CPTB 4K08A 3VOEA 2Q9MA 3T5XA 3IHUA 2BY2A 2WWYA 1JJ6C 1VQ7I 5FL3A 1XJ2A 1LL9A 1WGXA 2ZL1A 2M0CA 2WKEA 2Y2OA 2ID6A 3NJAA 5HZHA 4Y2FA 1XDUA 1W0UA 4P96A 4HEA2 2Q0OA 5K5RA 3A0HC 2KRFA 3Q9SA 5FKOA 2OU2A 3BEBA 3M8EA 1D1CA 1K4SA 4X53A 4QB8A 2W24A 4II7A 5HODA 3OYGA 2L7MP 2DK5A 3G2BA 4BE1A 3COAC 2XDVA 1OCCH 1IYOA 3LIAA 3OOPA 3SW1A 1PWGA 3WS2A 2QCOA 1DPRA 3EPZA 3QOEA 1GDTA 2HEOA 1SAXA 2HTSA 5AONA 4HNVA 2EIMH 1QVUA 3HBLA 4UV9A 1QBJA 2BGCA 2P6TA 1ENHA 2E1CA 3L9KA 2AXLA 1JHHA 3V8KA 1ON1A 4XORA 4L9JA 5TISC 1IV6A 5C4XJ 3OC2A 3QP8A 3B73A 4NK3A 1LLBA 4ZRRA 2LTPA 1IAWA 2LH9A 1FBSA 2CO5A 5F1JA 5ERIA 4D1QA 3HG9A 5CXWA 4Y13A 1GUUA 4CICA 5GP9A 5CRFA 1J9IA 2LYCA 3BG5A 3CUOA 1NG7A 5JI6A 1I6HJ 3W6KB 2W1OA 2W25A 3OPLA 1EI5A 5CEBA 1HXDA 1Y8QB 4M3GA 3OYLA 1K57C 2K31A 5CVIA 2BHZA 2DFHA 3PNTA 1CEGA 4IVIA 1B9NA 1X19A 4IJAA 1MNEA 5KVRA 2P7JA 4JPMA 2PEXA 4ZTKA 3LI9A 2BEOA 2L4RA 4PJ0C 4R79A 4F7ZA 4NQWA 4IO9F 3E1SA 3ML6A 3FX3A 1WH5A 1B72B 3IWQA 1WJAA 3B42A 4Z1WA 2JMWA 3HDDA 2NYXA 5M5YJ 2OQGA 4NC6A 2R78A 1OR7C 2A2LA 2LSOA 2XAGA 4IRHA 3FZVA 2EK5A 1LDKB 3D0SA 1HKQA 1W7PA 4E6KG 5GTHC 5CVUA 4GZBA 2R7QA 1J3WA 3CUEC 4AIKA 2R92J 2A49A 3S7NA 2V9KA 4BL0B 3A0BC 1H9GA 2CYYA 1S29A 3MQOA 5FAQA 5GLAA 2BV6A 3W8KA 3D72A 4EERA 2OC6A 2VBYA 2WAFA 3E2LA 4D7MA 2LRDA 1DGRM 2CU7A 3BG3A 4AM3A 2EV5A 2BZTA 4PM7A 4S2PA 1K55A 1ERDA 2V4JC 3WHCA 3KLNA 2NVXJ 1YSQA 3LO7A 5A93A 2M7AA 3NWTA 2PMZA 4JP0A 3FK6A 1LPQA 1HW2A 1BULA 3DTKA 4P9FA 5E17F 3CJRB 5HLHA 3M6HA 5HDNA 4PGGA 2QSHX 2LY9A 3VYRB 1TC3C 1FNNA 3GW2A 4PJLA 1N77A 2ELKA 1LVKA 4WF2A 3FXJA 5D6FA 5DYMA 1OTDA 2V8CA 3VP3A 1FT9A 1NK2P 3L2QA 5FI7A 4CYCB 1N75A 3FMRA 5GAGJ 3IX8A 3PBTA 5BOXA 2ECBA 3UB8A 1G3TA 2WK0A 3DP7A 3DKXA 3W2VA 1TW2A 2ZJPF 3W2ZA 3FHNA 3E3VA 4I98B 3M3YJ 2CW8A 1QHHD 5EVIA 2M7VA 1Y0NA 3BCAA 4JX6A 4A3MJ 3OYAA 2HOTA 1GSWA 4Q0HA 4CLCB 3A4CA 1S3JA 5TGTA 4I7HA 4CCLA 2ZQ7A 3Q1FA 4GRIA 4XKCA 3QODA 4S0HB 1OYWA 1KOUA 3KP5A 2PHYA 4X1MA 4LD5A 4WZ4A 1Q2PA 3LIFA 5FFZA 1I2WA 1PJRA 2JZYA 2LB5A 2HDQA 2NS8A 5IP7J 4A6EA 3HRTA 4KUKA 1GLNA 2E2HJ 3P98A 3T50A 3GDIA 3KO6A 2MABA 3OIQA 4IHVA 5A8BA 3K1MA 1IN6A 4U0YA 2E8IA 4C2TA 4N4NB 4B48A 3IF6B 3L7HA 3T1BA 2CFOA 2LDUA 3KEYA 3MZYA 4RX2A 2N8GA 2FRHA 2HTJA 2P4WA 3QU6A 1FOYA 1UGUA 3ZR8X 2XC7A 4NHJA 3H3ZA 1HF0A 5IP9J 5LGUA 2WC2A 3HJEA 3HOYJ 3MZHA 4JKTA 3IF6C 3CDIA 3JTHA 1G2HA 3HUGA 1E3UD 2EX8A 2HGVA 2YU9J 5HS9A 2MBFA 3NOUC 5GHXA 3EEHA 2CV2A 2K9SA 1OTBA 2K9LA 5J1YA 4HBTA 4KENB 3H9QA 5CGSA 2L7KA 3OYBA 1TT0A 2DJIA 2Y79A 3ULFA 1FCOA 2MC4A 5FLXZ 1IOUA 2DBBA 2NRAC 3L2UA 2Z2LB 4PJMA 5J8CA 2XB5A 1G28A 3UE6A 2DFIA 4LLNA 5FJ8J 4ETZA 3DV8A 4DJAA 1CJFA 2JKTI 2KRHA 5FAPA 2ZMEC 3IXHA 5HNFA 1FP1D 2V1BA 3I59B 3KYEA 1LL5A 3WTYC 4JLFA 1MBKA 1XX2A 3S16J 2QEXI 4JXSA 4K0WA 2ZO4A 4BXFA 2HQ5A 2GLOA 1ZG3A 1HZOA 4OMZA 1ZN2A 4GXOA 4QLCU 4XLPF 4H4KC 2VKEA 1E0EA 2LY2A 1FIKA 4ZAMA 2K9QA 1KU7A 1WPKA 1X2MA 4RAZA 2EPFA 3JCUC 4RB2C 3I0TA 2LY1A 1T0FC 1MH3A 1M1EB 2LKPA 4UUTA 1BI0A 5CYVA 2KDKA 4WMCA 1FJLA 2WADA 4DW6A 4JX5A 1XGNA 2GDNA 1M40A 3A0SA 1K6RA 4GJ4A 4MTEA 3OLOA 2VONA 2VKDA 4M3KA 3OYNA 3GTMJ 4GOGA 3W4OA 4CHUA 4JF6A 5CGXA 4A3DJ 4NQWB 2Z9OA 5J3WA 1MMGA 1YW9A 1ZHHB 1U8RA 2Y55A 3DTMA 1TF1A 5FGMA 2R9WA 5FAOA 2JPBA 3WG7H 3N05A 2DMWA 3PUBA 3UNGC 4LK0F 5L3GA 4MN6A 4EVIA 1MC0A 3JRBA 4L9EA 4V2GA 3QQAA 3F23A 1FQGA 1L3LA 3CJNA 1CF7A 4N92A 2K7LA 1W79A 3FPWA 4XQFA 2WKRA 2VKHA 2KQRA 4AUXA 2W27A 3HTUA 3JPUA 4N9IA 4R6LA 1LKXA 5BMZA 3V3SA 4ESBA 4RBOA 4P6ZM 1FIPA 4FUWA 1YQAA 2CRGA 2Z2SB 3OIPA 4N4OB 5HS8A 5IOYA 5M18A 3I4PA 1KYWA 2V6EA 3DBLB 3E4QA 5DUIA 3A0VA 4V2FA 2Q2EA 1VNDA 1IF1A 3E4OA 5GADJ 2KP6A 3OYMA 2JKRI 4XN0A 1SFOJ 2Y2IA 3CG5A 5JHFA 4F93B 2DA1A 4AIJA 4HJ3A 2Y69H 4HF2A 1UZCA 2VT3A 3K4KA 1BI1A 1A35A 1IRZA 1SVLA 3WTVC 2DXIA 3UB7A 4LGWA 4PZJA 5HWTA 2PG4A 1WI9A 1XSDA 2EA9A 2ZM2A 3G3ZA 1IELA 3DCFA 1YS7A 3VE3A 3ZVTA 2DA3A 5CVRA 4KZBA 4FISA 2NVUB 1R71A 1K57A 2HOAA 4UQIM 5EVID 3IQAA 2CQXA 3QPTA 1T18A 1S1ZA 1P7JA 1J9MA 3O5YA 1JTYA 2VLGA 3NC8A 4D5FA 4LG3A 2V1ZA 2P0WA 1XMKA 3D5SC 1WSUA 1BL0A 1ONGA 4LRZE 1KU3A 2K5CA 3TEDA 4R1HA 3I5UA 2R0QC 4Y17A 2HP6A 4NXBA 3MMYB 1AKHA 2XGDA 1YLPA 1IRXA 1XJ4A 4NC7A 2XB0X 2V9VA 1OKRA 3BDDA 3CLQA 3TW6A 4YIFA 3HSEA 3GTJJ 4E7JA 3JR9A 5FI2A 1W36C 2H6BA 5KIZA 4AU7A 2P81A 1JGGA 2V1UA 2ZJ2A 2EXAA 3HLEA 1J5YA 1U78A 3AGEA 5E43A 1DDNA 2L54A 4I3JA 1YJNI 2LC2A 2LVSA 3V7SA 3CCQI 4XMYA 2QJ7A 3K70D 2ME0A 3SS5A 4G7OF 1QHGA 4A3CJ 3RH8B 2P74A 3T4KA 4LMYA 5G4YA 1LNWA 4D9JA 3ONQA 1HLVA 3F21A 3E0JB 4AYBN 4S2JA 2XD5A 3CF2A 4M6XA 2P9VA 1P2FA 4HP4A 4QHCA 4QD4A 4S04A 2ELHA 1ETXA 3E5UA 3GCMA 3I3LA 2QLZA 2QYBA 4FCYA 5A2QZ 2CJJA 4U0VA 4X1EA 3LQRA 1EA3A 5AVFA 1SFKA 2NVYJ 5DTSA 4PM8A 2LMDA 1E3OC 4PUSA 1MSEC 5HPIA 3O8GA 4AVPA 5A92A 2Y2LA 2EJRA 4RB3C 3MSHA 3EYIA 2EFNA 3ZG8B 1JGSA 5EM0A 4BQMA 2UV0E 1WVRA 2IP2A 1QVTA 3LFKA 4M71A 4QWOA 1N9LA 3DTEA 3FWLA 2K9NA 2MLKA 4XM3A 2A68F 3X2QH 3OPPA 2VPRA 3C4PA 3W6JB 1OCRH 1O3RA 1MNMC 1KQ8A 2JHEA 3IT9A 3F22A 5IS1A 3GF2A 2MD5A 1DQUA 2E60A 2IA1A 1W5TA 3BJNA 4KG2A 2W84A 2WKIA 3H9JA 2DLLA 1R4MB 1USSA 3WRTA 4XUXA 1WH7A 4LIUA 2EFWA 3DKWA 2ZD8A 1MY8A 1OYIA 5FQIA 3CZ6A 5M5WJ 1A36A 4EMSA 3K4JA 2Y2HA 3HLDA 4DNCA 1APLC 4LENA 2DYSH 4LG0A 4FH4A 4W1UA 4CLCA 5FFXA 2DW4A 4G7HF 3VPRA 3I55I 3V8LA 2L0KA 4OMYA 2E34A 1TWFJ 3QAHA 3U1KA 3S1MJ 5HWWA 4LV3A 4GFBA 2HKOA 2KJBA 2V20A 1X4OA 2V1XA 1IN5A 2Y48A 1BI3A 3CCVI 3GUDA 3M8FA 4DYRA 4MN7A 4H0EA 5LD2C 2ZQCA 1VQKI 2VBXA 4HIAA 5EJCA 1J59A 4Q0IA 4CCJA 3G1LA 3JSPA 3PNVA 2OA4A 5C44J 4DXCA 3QWLA 3HL2A 3GRJA 4HX4A 4ZJ3A 1IYSA 4PKYA 4HBLA 5J1RA 1L0FA 2QKLB 4XKVA 2OCEA 2O9CA 5DFYA 4II3A 4S2NA 1UHWA 4X1LA 4S2OA 1Y28A 1MDMA 3QP1A 3ABUA 2A5WA 3QNCA 4XL9A 3GQZA 2FJ1A 4E3KA 3EOIA 3K6GA 4E4HA 1VETA 3G30A 6PAXA 2OQRA 2VJWA 4WMCD 1IDZA 3FKWA 4DN0A 5FASA 4MFDA 3PIPF 2WB1A 2X71A 4P6ZS 1ETOA 2R5YB 3OSGA 1OISA 3SFZA 3TOAA 5D5WB 2XRNA 2O8KA 4X25A 3T8TA 2QGUA 5EGOA 1K54C 2DA6A 2XDMA 2XR0A 1OPXA 4JGQA 2ISZA 1H9TA 2QBYA 4CQHA 3GFLA 3OWTA 5FB2A 2PJRA 3S1RJ 1UWNX 5F0HA 1GV2A 2CUEA 1GHPA 1MPLA 2MD0A 2A6TA 1EH6A 4PDKA 2W1TA 3CPTA 1YOVB 5DJTA 2ZJRF 1FLIA 2XHKA 2DFFA 1G3WA 1FYMA 1R6RA 2JUGA 4ZZLA 4ZJ2A 1IDYA 3Q9VA 3SDBA 4I0BA 2AQEA 4M9XA 2ZL1B 2G9WA 3V67A 3L9FA 3TMOA 5J8XA 3PIOF 3CCLI 2LD5A 4KDPA 3V39A 4ZJZA 2VPLA 2R7OA 3VEPA 4KZAA 4C2MJ 1SKFA 1FCMA 4D7NA 5ICFA 5EEAA 3BCBA 3C7VA 4MEXF 1WJCA 5CQGA 2W82A 2ZXJA 3J7AY 1KGGA 3PYPA 3CMEI 4YNRA 3A02A 1LE8B 5H20A 3V3RA 2LK2A 1NY0A 2OD5A 1XG1A 3W2AA 2B5RA 4WN5A 2M1CA 4EEPA 3HHGA 1NZUA 1O7EA 5J8FA 1ZTRA 3ERMA 1E25A 3G1MA 1W1WE 5IYBJ 3G2YA 1R00A 5KMWA 2WV0A 2DPDA 1I27A 2HDSA 1V9YA 2EA4A 2OBPA 3W3CA 5E8IA 3IUOA 2PDRA 4R4RA 3WS4A 1KA8A 4GYGA 5CQEA 1K61A 1K6OA 1RPWA 3KYQA 5E3OA 4LB5A 4GHIB 3OY9A 3NDGA 1BOAA 1MGTA 5BQTA 4X6AJ 2ZQ8A 4FSFA 4OPQA 1KU9A 1MMNA 2QA4I 2NVTJ 3GV9A 3VOZA 1ZRCA 2DPUA 2VBZA 2F4MB 3UY6A 1FYLA 4YFXF 2YPRA 3GTOJ 4JK1X 4HY8A 2CQQA 3H9GA 5EEHA 1YLFA 3J80Z 5B1AH 5KAIC 2XH9A 2JWTA 4EATA 3C2GA 4L0LA 2HKXA 4RGRA 3S93A 1P9RA 2MGQA 2UXNA 1XMAA 4B4CA 1JVJA 3HM5A 1N9BA 1W8QA 3A3JA 1X3WB 2R7UA 3IKTA 3HJKA 1RUOA 5K5QA 4UA9A 5AIQA 3R7WA 1LHYA 3BLMA 3B6CA 3GVAA 5JHUA 1FCNA 1WQ2A 2X48A 1J0RA 2XRLA 3RTYA 3V50A 3BP8A 4C75A 2LG4A 3JREA 3L1PA 2J9OA 1KYZA 4P5OA 1Y6IA 4R3BA 1FOKA 2DOFA 2QKMB 2QZ8A 4FETA 2W1TB 2CWEA 4I09A 5DDGA 2D45A 3RSNA 2HJEA 4GD8A 2BY0A 4DZPA 2ZNZA 3BFDA 3IH9A 3BR1A 3M1CA 1YLJA 3VDXA 3LEQA 3NECA 4WZ5C 4Y3OA 5GL9A 2HZDA 3S17J 3PBQA 4KQDA 3BY8A 3LA2A 4Z2YA 4BACA 2FH5A 3FIWA 3QPLA 2DTRA 2HZTA 4AC0A 5L07A 3U9GA 3K1NA 4NXFA 2ZXIA 4CLCC 4LG0B 5IT3A 1X1BA 1S66L 5LBQA 2QENA 2RCXA 2LREA 2R4GA 3WWXA 1X0OA 5ICEA 2LR8A 1D06A 3LSMA 3K2ZA 1FPQA 1A31A 3FBNB 2NVQJ 2M45A 3M6BA 3VMAA 1D5YA 2FU4A 4IQ4A 3BG9A 3GBGA 3ZMVA 4MNUA 2O0YA 5DTDA 1PZPA 2W4SA 1HOMA 4WX9A 3E6DA 4XLFA 1BZAA 2QJ5A 1WFXA 5FI6A 5DEQA 4O3MA 1B9MA 2B9SA 1FEXA 1SDNA 2Y4AA 5HX9A 5BOHA 2CV0A 4WCGA 1Q1HA 3K2AA 4NXEA 2VJ4A 2CQ7A 3BR0A 1FMVA 2DODA 3S2DJ 3BR5A 3WG9A 5CGWA 4RGSA 2XGXA 5F1FA 2OUMA 2A61A 2J5OA 3BPXA 3IH3A 2TDXA 5HDGA 1G68A 2Y2JA 3FZCA 3MKFA 3FF5A 4EJUA 5TFQA 2E2IJ 2RL3A 3CITA 4WF0A 2OOLA 2XPWA 2M30A 4B4ZA 4M9ZA 1KE4A 5B66C 4BU2A 2Y59A 2F5FA 3FHZA 2RQQA 4K0XA 2FSWA 4I3AA 3BZ6A 4B09A 3M2JA 1BIAA 4OLDA 2RN7A 2R5ZB 2EBIA 1G6OA 3IWIA 5DTKA 1ZC2A 2A3SA 4BHPA 1J7KA 1VI0A 2KFDA 3E6BA 3I9V2 5LRRA 1IRGA 1ZG4A 1FR6A 1A6IA 1OLTA 4A12A 3T1RA 1MJAA 4HPQA 2WKPA 1KGFA 1PWDA 4GO1A 3JRGA 3WTXC 2BW3B 4OOLA 5CX7A 1K4FA 4FQGA 4GCVA 1ERMA 1KZHA 2Z5UA 3HLWA 4KG6A 1DP3A 3WTSC 3AG3H 3GO5A 2ESNA 3MMHA 2LBFB 1R9TJ 2DCFA 1UG2A 4KFCA 3OCNA 2R7TA 1L0GA 3UN7A 3UPNA 2I72A 1WJ5A 1CF0A 2P9VB 2PBDP 1K7AA 2COBA 1HQCA 1OPCA 3F6VA 4U88A 3C5AA 3KSGA 2W3DA 4X56A 3IHBA 1E3HA 2ZMEA 4HYEA 3B33A 3C2WA 3QP4A 4JGPA 1GXPA 3DPTA 3TDZC 2G7UA 4D5CA 2VXDA 3ROUA 3U21A 2L5QA 2VN2A 5IP6A 3F3XA 2DT7B 2EIJH 1P0ZA 2PBYA 1JUSA 3F8FA 5HAIA 2V1AA 2IEKA 4ETSA 3BTCA 2W3GA 3HLBA 1OCOH 1CI8A 1ZARA 1QPIA 2ZQAA 3EEAA 3Q7VB 5HAQA 5J7EA 2DMTA 5TBMB 4L0YB 4BWIA 4DE0A 3T12B 4BD0A 3LCEA 3CWFA 3I56I 2BTFP 1IN4A 3ZOBA 3LR0A 3I4MJ 4U7BA 4LV1A 4P6BA 3A3FA 2XAFA 4LITA 2IA2A 2KIMA 1WYBA 3EYYA 3NRVA 2JN7A 3CMYA 1I6XA 5FO5A 1F1ZA 4ZDLA 4CA0A 1ES2A 1RETA 4MCWA 3ZCZA 4EESA 2P7CB 3F8CA 2EZIA 4ID4A 1GA0A 4OIOF 4BBRJ 3S14J 2WGIA 4KUOA 1U5TC 2AS5F 2ZMAA 4YIRX 3I53A 1E2XA 5EVLA 1I1GA 2V0WA 3ZMTA 3DWLE 2EX6A 2VE8A 2EZHA 1N4OA 3AAFA 2BLSA 3MN2A 2X6YA 4WXHA 5EGOB 1RGZA 3VP2A 1R23A 2JA5J 3MQ0A 4CDGA 1D7EA 1S8NA 1H0MA 3HVFA 2XKPA 4I3IA 3DKYA 3RIRA 4B9OA 2J5PA 1IG7A 1T6SA 1FP2A 1YM1A 3RZOJ 4R23A 3HKZA 4ITVA 5LEJA 2E7WA 2L9RA 5FQMA 3VODA 2RVCA 2VLAA 4BYYA 4L5IA 4AD9A 3D3OA 3M9AA 4ZBEA 4Q8IA 3BPVA 3PO2J 4UVCA 1MBLA 2H0YA 4AWXB 5LHIA 3UB9A 1DP6A 2RV8A 3Q0WA 4B47A 4B43A 2D2WA 1X2NA 1K78A 3ESWB 3WU1B 3ZGAB 3UR3C 4HX8A 3ZG7B 3JW4A 3OYJA 1L0DA 3CZDA 4DBQA 1A6QA 5D4SA 2VJ5A 1W36D 2EB7A 1J2XA 2HYGD 1JE8A 3BJOA 1DU0A 2F4OB 2P5KA 1JWZA 3M1EA 2P04A 3ZMZA 2JSCA 1XGSA 4IF4A 5M3MJ 1SCWA 1FOXA 2HZ5A 2YKHA 5EPHA 3OYEA 2OV7A 2NXNB 3ERED 2Y0SN 3EDPA 1DPUA 4DQ2A 1QZZA 4EEFG 4DRTA 2GOXB 1VQPI 2I9VA 1XB4A 2XUBA 3LYXA 3BTIA 2EX2A 2LLKA 1LFBA 1OCZH 3ZNYA 2XSDC 3HC7A 1IYQA 3C2BA 2JRMA 2OTJI 2E1OA 2X6WA 3KP6A 1FMWA 2A6EF 1JI8A 3DEEA 5K7HA 4R38A 3JTGA 2M0MA 4HG2A 4X0GA 3C38A 3BQ8A 1Z3XA 2M7BA 3ZHHA 1HBXG 4B93A 4KQRA 4RGUA 2BBYA 5KHDA 1O57A 3KZZA 3AGFA 1ETKA 3R4KA 1K4EA 3HRUA 4XSXF 2WAQA 2F4IA 2JN6A 4BJPA 5CEDA 3CCSI 1WWXA 2DOEA 4G6DA 2CSOA 2Y31A 4R8HA 4FASD 4MIMA 1LSXA 2XA7M 5L3CA 5H6RA 4BHBA 4FD8A 4GN2A 3SJMA 1ODDA 5EDNA 3IV5A 1XX5A 2LP0A 4IOCF 3ABMH 2DOAA 2QBYB 4JYKA 3S22A 3VE4A 3A01A 5IOZA 3GTCA 2L9VA 1YQSA 3HUMA 4ZYEA 5LFAA 4K91A 3WS1A 2BW3A 3HBRA 3ZXSA 1PFLA 2L1MA 3Q82A 3SFIA 5TR7A 1WI3A 2ZQDA 3HL9A 4WZ5A 5CECA 4H6JB 3KETA 1QZYA 4A0XA 1IJWC 4IVKA 3UB5P 1TS8A 4E3NA 3OS0A 4KNYA 2P8TA 4Y7PA 2HYFA 3RKWA 4HLXA 4XBFA 1BTLA 1CI9A 3HUOA 3LIDA 1TDLA 2KHMA 1ZG5A 2BVMA 2R7VA 1NLZA 3JRIA 5E3LA 3CCEI 1RIOH 4EU0A 5J4YA 3MKZA 3H92A 1YJWI 3VOYA 4A3GJ 1Z91A 4OAZA 4YFKF 1PWCA 4NBQA 1NZOA 2HVRA 3S2WA 2VOOA 3A3DA 3OPHA 3BZCA 4A69C 3CO7C 2Q9NA 2X02A 5GAHJ 2YKFA 4H8RA 3MFDA 3WE3A 2DDBA 1C0WA 5LEKA 1E17A 2FUG2 1I5QA 1ESUA 3T1XA 3O8HA 4YG2F 2H6CA 2M1BA 2XIGA 3D4FA 4LLGF 2M2EA 1RR8C 1Y0UA 1WJDA 2P6SA 4XIDA 1T1BA 4MBKA 1GSVA 4Y4RA 5F0FA 3S3OA 4HAMA 1B8IB 2LNBA 3WS5A 3MJQA 3P5JA 4BLMA 3PBNA 3EQLF 2IJLA 5D8LB 2EXBA 2NOGA 1KU2A 1D8KA 4KISA 4FH2A 4M3BA 3ZQHA 1R36A 1K79A 5EM1A 2DA5A 3SHFA 4CXFA 2OTLI 1N9OA 2GJ3A 1EH8A 2Y2MA 4UB6C 3BWGA 1BLPA 1OJLA 3QHYA 3IRRA 4AVZA 1ZTUA 3PAGA 2EFOA 2XD1A 4HF1A 3WGHA 1AU7A 3EUHC 1R1UA 4IRGA 1ZG6A 2QKPA 4JXWA 5GLDA 1SC7A 1X1AA 1S7EA 4G94A 2ZC6B 2H8WA 1KE0A 2VV7A 4IBRA 4PKYG 4PM5A 2PU4A 2X1CA 3EETA 1G6NA 2ZC7A 2HGCA 3PJRA 3OL4A 3H1CA 3IP4B 1YRNB 1LSWA 1J09A 1UWPX 2VV8A 1F43A 2JKRM 3ELKA 2E1NA 5HPFA 2E7XA 3RFBA 2V1NA 3J81Z 4BAYA 2NNNA 4Y33A 1K38A 2QQ9A 4QPOA 2BXZA 3NDEA 4HF0A 5TJJA 5EVIB 2DT5A 2E5NA 2L4MA 2VB6A 2H0TA 2WGWB 2KX6A 3REOA 2PN6A 1YLYA 2QZ6A 3FXKA 4XLNF 4OVDA 2ME6A 2IWDA 1XCVA 1Y39A 3HSRA 3BOQA 4F55A 3K0LA 4BMWA 1S7OA 3GZNB 2HOEA 3N8SA 4GD6A 4E3JA 3JVVA 2YU3A 1HKSA 1PW1A 2OPTA 5AQ7A 3KP7A 1Z7LA 1AWCA 4R3AA 3VSKA 4DMZA 1ONVA 3M2KA 3LIBA 4M4XA 4WXDA 3OYCA 1S6LA 1S7AA 3KE2A 2FNPA 3KP4A 2FBHA 1XGJA 1RR7A 3P01A 2FD5A 3MEXA 3BTLA 3ZQ7A 2Y2GA 5AVEA 5LBRA 3HRMA 3G6EI 2DDAA 3H5NA 1BSGA 5D5UB 2NNYA 4FTHA 2EH3A 1STZA 3TO6A 2V2FF 3TE8A 5DV5A 4YFMA 1FSYA 3S7QA 4EQIA 4RLQA 3A0RA 4UNOA 3BECA 4P0MA 1LE8A 4IHXA 2AO9A 2DQRA 2Y2KA 3H82B 3G2ZA 1FSWA 2ACJA 4HZFA 3Q7ZA 5E18F 1LI0A 2Q1ZB 4YELA 2JKTM 5CTMA 1R7JA 3IH4A 2OF7A 4AIDA 4DE1A 4HOIA 4CO8A 2Z3YA 1JUMA 2K02A 1FBQA 2K85A 4MEYF 2X0LA 1MD0A 1QA6A 2CW7A 1KVMA 1YYVA 2JKFA 3FG8A 2ETHA 1NRJA 3PO3J 2EV0A 5IHVA 2QQBA 2GBYA 1H89C 3MQQA 1DP9A 1KDWA 1ETVA 2HI3A 3G31A 2HXIA 4F91B 1HLUP 5CTNA 3O3VA 2VX8A 4J00A 4OPRA 2W0NA 1TQMA 5DJUA 4DE2A 4Y0TA 1HDPA 1P9WA 3SH8A 3HOWJ 5J1UA 1AOYA 3BG7A 4RLFA 2VZWA 1FBUA 2LBFA 2XSJC 3ISGA 2ADUA 1DU6A 2XK1A 3AG4H 1L0OC 3CHWP 1HSTA 3FXUA 2DT6A 4HV6A 3CJMA 2VC1A 4ENKA 4C3HJ 1XFNA 5HW3A 4HQMA 5GTIC 3FYZA 2COMA 4PPRA 3DBRB 2W3EA 5DD4A 4LPZA 3RQIA 3ZQLA 4CLCD 5F6FA 3DBAA 1DP7P 4BQNA 1UG0A 2I10A 1RP5A 4WELA 3WS0A 4A6DA 5EG0B 1H3QA 1TDGA 5EV0A 2O9AA 3SOIA 5JYPA 1RC9A 3GWZA 2IRFG 2JVGA 3M7GA 3BR2A 3FXMA 1QPMA 5ILSA 3V4GA 4NETA 2ID3A 2IGOA 1JKPC 1YX3A 3E4PA 3E5QA 3OS1A 4QY6A 3AKZA 3NHQA 2A05A 5TBMA 1YE9A 2VK3A 4XOPA 3RKXA 1NH3A 1ZQ3P 3HHHA 2BVLA 3IH8A 2ZXHA 3VYUB 1OFCX 1V9ZA 3SZPA 2O61A 5HFOA 4CZZA 1Z7UA 3HXLA 4UY8I 2E19A 3S32A 2CC1A 3PAEA 4M6VA 5DD8A 5KSHA 4EM0B 4R4SA 4A5RA 4CJNA 1MWSA 4RA7A 4HDUA 4X69A 4WXCA 1VQOI 3LSJA 1JTDA 4KZ6A 4DIQA 3LEZA 3F1NA 4MLLA 3RI4A 3DF8A 2ZC3B 1UELB 2INWA 3JRFA 4DYCA 1YAXA 3NAUA 2DMPA 4GDNA 4XONA 2IS6A 4PSWA 1O7FA 3RJPA 4O8GA 5HD5A 2R7FA 2H5SA 5F1GA 5E20A 2Z6CA 2UZKA 1L2SA 3HKZN 4IZZA 1PP8F 2O9LA 5TGFA 3VB2A 4JOMA 3GVBA 1XC5A 2L9SA 3BFGA 5U47A 5E3MA 1JTGA 5FQKA 2STTA 3IS2B 3CQZJ 1LDDA 2QQ8A 5GPAA 1MBHA 3C4OA 1YRNA 1ZLKA 1IKGA 3IX4A 1YLWA 1BC8C 3T4SA 3BQZA 4EM1A 2FXAA 2B7EA 4LK1F 3KSHA 3GEZA 1Z6FA 4H6JA 4JXVA 1X4PA 1MMAA 4ZC3A 3PHYA 4QPRA 3UDXA 5LHHA 1NLYA 3S8PA 3DWZA 3T8RA 4B8XA 2CGPA 1U6GA 3GTPJ 2AHQA 5E3NA 3GTQJ 1RKTA 3K10A 3G35A 3KP2A 1RKWA 3RKYA 5A2QK 3OR2C 2DMNA 2KZVA 5TRDA 1O4XA 2HDDA 2W3HA 1R4NB 1YW7A 2H09A 3MWMA 4BDYA 4OPZA 1LSVA 1IGNA 1PYVA 2UXXA 1KONA 3FK7A 4CCNA 2Y2NA 4G9YA 1ZG1A 4ENNA 1SKOA 1XCBA 2RC4A 3MAJA 4LFUA 1YTYA 2O5RA 1Y4OA 1LVAA 1VM1A 4D2OA 1UB9A 3A3EA 4CGZA 1S1YA 1MZBA 1D1AA 3Q81A 2FBIA 2B02A 3Q0VA 5JYOA 1T1CA 4V19K 1AWIA 1MKMA 3HEFA 1L0EA 1I39A 4XLHA 2Y2PA 3BFFA 4CYDA 5DKKA 2KLOA 4XLAA 1TVFA 2WZZA 4E7SA 2K7SA 1SVOA 2XF3A 3P9KA 4BY7J 1R49A 3GMEA 4BNCA 1WJFA 2Z33A 2EX9A 1T0FA 1TLHB 2A5YB 2EFPA 2EIKH 5C3EJ 1T56A 1ZH5A 4HI4A 2CUJA 4I2OA 4JQFA 1JWPA 3A3IA 5FATA 1D5VA 4F52A 5IYCJ 2PFBA 3UMEA 3G4PA 5FROA 3H9WA 4IHQA 3UE0A 2XFTA 3CLOA 4XKBA 3OOVA 2JA2A 3AFHA 2XGNA 1NYYA 5FQ9A 1W7FA 4ENJA 3Q7VA 3MKLA 3CMMA 1VQ6I 1IXCA 3CJTB 1SZVA 2DA4A 5E1WA 1HD8A 3G34A 1G6AA 5JLXA 2YR2A 3RCOA 4G7ZF 4EJTA 1YW8A 3TL4X 1WJBA 1OQYA 4BHCA 3K9TA 1QU3A 1ACIA 4GW9A 4PHTA 3IS2A 4WM9A 2Y30A 1ZREA 3UMDA 4UXNA 2KISA 3U2RA 3W4QA 2YS9A 3O88A 5F83A 1IUFA 2IS4A 1D8JA 2A24A 5M3FJ 4JF5A 1I3QJ 1U9NA 2VA0A 4EXOA 4BE0A 1BUEA 1XFQA 2EWWA 4QY5A 1ODVA 5EEGA 3RYRA 1ACFA 3NIAA 4HA8A 3KFWX 1UMQA 2VQGA 4E7ZA 3H7WB 1DJBA 3DLAA 2DMQA 3SS4A 4EW7A 1HTZA 1V5EA 4JBFA 2RDPA 4C30A 4ZDOA 4BBVA 1LEAA 3KYCB 4OIPF 1TWHJ 4XUZA 2DQLA 1Q2QA 2W57A 1XTAA 3OSFA 4KQOA 2OV5A 2V8FA 5KNLA 1SFXA 4FTXA 4N9HA 3K4LA 2PJRB 1NRFA 3DXJF 4Y0UA 4FE4A 1BM9A 3JRAA 1TBXA 1DY6A 1RCJA 4BQOA 1RGYA 5F5YA 1U8BA 2L01A 2RKHA 3PSIA 3IBJA 5I5LA 4OQHA 1BLCA 1B4AA 2ZC5B 2OLVA 2WZXA 5DFXA 1HW5A 1R5ID 2JRTA 3HIFA 2WGWA 4I76A 3ZQ5A 2STWA 3W2WA 2JA8J 1JKOC 5FRMA 2PI0A 1K83J 1H5XA 1HSJA 1S6RA 2M3AA 4U3TA 4EBLA 1VF9A 2GZAA 4QIWN 3OV8A 2HF6A 1YIOA 4KQQA 2IS2A 5MC7A 1Z3YA 1WRJA 1Z77A 3C7JA 1S4SA 2VV6A 2ZLYA 3F1OA 1X58A 2A07F 4BXXJ 1AKHB 1D0YA 4ENMA 2KZGA 3GTLJ 2MLGA 1NG6A 5DVAA 2OWJA 2FEZA 2OAZA 3C1DA 2D5VA 3DW0A 2IS1A 2BY3A 2H1LA 1XP4A 2H28A 2L0WA 3OIOA 3N97A 2V6CA 5G4ZA 2WY8Q 5D6EA 1TT5B 1XXMA 2O9BA 4DBRA 4BE2A 1CGPA 2NUPC 2VGLM 2PJPA 1ERQA 4M3DA 1GA9A 3H0DA 2OWHA 3H5RA 4NKPA 4ESPA 3F72A 1BR1A 2Z16A 3LSGA 4XKWA 3E5XA 3TBIA 4AYBA 2HOSA 4CCKA 1JNUA 3E0YA 1EROA 4N1XA 4P85A 1MDMB 2HV1A 3KZIC 2K2NA 2RGVA 3QP5A 2VXZA 1RZ4A 2BG1A 1GXQA 4UEYA 3DPUA 1VQLI 4QSHA 2PQ8A 2WAQN 5B1BH 4BXUA 4L9GA 1N9NA 2K9MA 4LCLA 2WY7Q 5HLIA 1ESIA 2LOOA 2DU9A 2WBMA 2YX7A 4RM3A 1T2KA 1ALQA 4C6YA 5EG0A 3ZYTA 4P87A 4UV8A 3UDFA 1VHMA 4JGOA 2KJCA 1UHSA 1G59A 3CTAA 1BR2A 1ORKA 2IWBA 2R7ZJ 1IN7A 2EZKA 3LSHA 4IHTA 5EOOA 2G7HA 1KGEA 2TCTA 2HQAA 4F3LA 3BFCA 2PU2A 2Z99A 1WJEA 2M5WA 3O86A 3KP3A 2FFFB 5HDSA 1R1TA 1SMYF 3FMQA 2HDUA 3QP6A 3TO7A 4ARZB 1AXBA 1KVLA 2JUCA 1O07A 2WGVA 2IAIA 3EUAA 1B59A 2OLUA 4EUVA 2QVOA 3ZVWA 2QUFA 4DF6A 5ILUA 5E2HA 2IA0A 1SDEA 1EH7A 1YLTA 2FX0A 4B88A 1NJ4A 4QJGA 3SQNA 1P6RA 1Z0XA 2KRCA 1ZELA 3H82A 5AQBA 4I02A 1G3YA 1TQPA 1F36A 2NS7A 4FE7A 5KZHA 3HB9A 4BL3A 4N0BA 1NK3P 2EA2A 3CC2I 1YHQI 1D3YA 3DTIA 2RNGA 5F08A 1SVMA 5ICGA 1CQTA 4N1HA 3ABKH 4BEHA 1A5JA 5J4EA 2MJ6A 4AIHA 4LB6B 4PM9A 1DJCA 2R7RA 3BR6A 3P7NA 5AQ9A 5HD3A 3UPOA 4WWCA 3HYIA 3IXBA 2PT7A 3RKQA 2V79A 3E2KA 2B0LA 3F1PA 4XK4A 4JBAA 4KZ7A 2HYJA 4I39A 4XN3A 1S9HA 2Y75A 4N9LA 4UB8C 1REPC 3UDIA 4UA7A 1IO2A 1FIAA 1MSFC 4A5MA 3H0GJ 2W3FA 1G5UA 4KZ8A 2VASA 3C7UA 4YINA 1VETB 4GS9B 1BJZA 4OH0A 3G73A 4Y5FA 1RI7A 3SYTA 1SMTA 2PMZN 4EGYA 4U0XA 1ZRDA 1K54A 1PUFA 4B1RA 2QF7A 3W4PA 2MC3A 3KYZA 3S1QJ 3NBLA 3GFMA 3HUNA 5CPRB 1FC3A 5G18A 4ZJ1A 5F6AA 2EILH 3HLCA 3ZN1A 1F9NA 4ZZDA 2WUQA 3P9IA 5IYDJ 2M8EA 1OTEA 2F5EA 3E6CC 3H5AA 4BDZA 1LB2A 2V9AA 2GWRA 2PR6A 1JXSA 4S05A 4F3LB 4MEZA 2PBIA 1Y1VJ 4MQ9F 1W7PD 1FILA 5IT9Z 1OJ5A 4A3JJ 1XGOA 1IRFA 2V0UA 3LUQA 1SAUA 2OZUA 5DCMA 2GAUA 4XXRA 1TP4A 4E3LA 5FKMA 3LSKA 4RVAA 4G3KA 3ZG5A 3C2HA 4EJVA 2L9NA 1ZR4A 3B47A 2DFEA 4N9KA 5FD5A 1T1AA 1SANA 3LICA 3ZP5A 3SH7A 3L2WA 1IKIA 1Z9CA 4F94A 2J3TC 3TQNA 4KT6A 2OZ6A 4EJWA 1PYYA 1TZLA 3LQQA 3G71I 4L9VA 3KLOA 5CJ9A 4XRFA 2M87A 1ZGWA 5FDSA 3F1OB 3VYSB 1D1BA 4QPQA 4ESJA 3LR4A 1OMIA 1XMXA 3QP2A 4GCZA 4QU3A 5DUKA 4RB0A 5DKLA 2F5VA 3O6BB 4DOZA 5C4JJ 3S2HJ 2IW5A 4ZDPA 4EUZA 1H8AC 4E6XA 5EZHA 2F2EA 3ZMDA 3L7WA 4PCQA 2WTEA 1ES3A 4Q5SF 3FKJA 2ZJ9A 2J3WA 4CYCA 3BTJA 3VSLA 2YX4A 4GDFA 3KIOA 4JXGA 2CS3A 4EJOA 3BJAA 1LT0A 4X6TA 4BBTA 1VQMI 1N25A 2FA5A 2VC0A 4IX7A 1XSVA 5KK1A 2E1MB 4F92B 2FZ0A 1K55C 3UE1A 1R58A 3F0CA 4IKFA 4L9TA 2QM3A 3Q5FA 4J01A 4EV0A 3F1NB 5CHMA 2ZB9A 3F9KA 1BYWA 5GPCA 4HJ4A 4BUPA 5D5VB 1DP8A 5F27A 3FXRA 2DA7A 1K25A 1MNDA 1ZR2A 3KCCA 3V7RA 3ASOH 2K27A 2HU9A 4DGWB 2JQ7A 1XGIA 3K69A 2P5VA 1KQ0A 1EW0A 1NWZA 3C18A 4HOBA 1B72A 4BJ6C 4XT2A 5HNHA 3UB6A 4BJTA 4G3WA 4IEJA 2X85A 4L18B 1GSXA 4W97A 2HJ9C 4CCOA 4RAFA 3S7OA 4IJGA 1JUPA 1O3SA 1VQ4I 1UAAA 2W1RA 1TWGJ 2FQ4A 2GQQA 3TOBA 5H2FC 4IHSA 1WA9A 3IHAA 3T4OA 5DM6F 1JJ8C 1YITI 1RRJA 2G0EA 1W63M 2W7NA 3IX3A 3ZCOA 1PI5A 3KYDB 4UHUA 3WTZA 1KE3A 5EVEA 5J4VA 5EECA 5JVGF 3HOSA 3H7WA 4BKXA 1IXSB 4XNFA 4DXBA 5BPIA 4HNUA 2BY1A 1OTIA 4BQQA 3GSGA 4HH3A 1VQQA 1PUEE 1HKTA 3VP4A 5D8KB 3JVUA 3JRDA 3Q0UA 1SHVA 3K3CA 1GHCA 1ZKGA 1A04A 1OYYA 2D02A 2XFSA 4FOFA 2F5CA 3QOPA 2XROA 4O01A 5F69A 2V26A 2XAUA 2CG4A 3WU0A 4B3AA 1LFUP 2KMUA 2EINH 2XAHA 1P9QC 1PW8A 2Z2MB 2VKSA 2ZXWH 2E1MC 3S3NA 3GR2A 5L2FA 1FOWA 1QO0D 4IBXA 3K7AJ 2G2UA 1ZGAA 1XJ6A 4EQQA 2ELJA 3IXGA 4EBPA 3BT9A 2F48A 4M3EA 1LUJB 4HJ6A 3UNWA 2JPCA 4KIBA 4Z6YA 2ZFWA 4XOTA 4GNUA 4G6TB 1XD7A 3RPUA 2KIUA 5AJGA 4O0PA 4E7KA 3GTGJ 2GNXA 1KQ9A 3MKWB 2O99A 4ESFA 3DAVA 2EFUA 5FQQA 2JSPA 1ZK8A 1EJ9A 4BBUA 2VJJA 4NXGA 4ASNA 1DGWY 4HBUA 4HV5A 3WTUC 1V5GA 1IEMA 1TS7A 3SEQA 2KDZA 3I54A 2ZMFA 1F5TA 2JCHA 1R5GA 2E71A 2WKHA 2IGNA 4NDLA 4PSXA 1T38A 1GHIA 4HQAA 2GX5A 4UQIS 5HDCA 3RXWA 5CHJA 2HPIA 3HPGA 2FMYA 1M6KA 4IRIA 4DJ2A 3ZMUA 4CCMA 5JLWA 3T4TA 1E3PA 4I0AA 3C30A 3GZ5A 2Y9ZA 3MZDA 4GHIA 1Y56A 2DO7A 4S2NC 1PZOA 2NAZA 2FOWA 3FWEA 3PSFA 3CC7I 4DDSA 3GYHX 3CC4I 3V8JA 3ZQFA 3MR0A 5FLMJ 3ABTA 1T39A 5LHGA 5F04A 3ULQB 4UUVA 2C6WB 3PTEA 1YS6A 4BQAA 2HVSA 3A2KA 3QYEA 3CCUI 5FRNA 2W85A 4BBSJ 3ZQQA 3QPSA 1MMSA 1S67L 2P08A 2ZBBA 3UPPA 5HL1A 4L5EA 4WK8F 2GXBA 1QGPA 5F0CA 3HTSB 4RX3A 2R7SA 2L02A 1YMXA 4S2MA 2J8YA 3ECHA 4UVAA 5B5EC 1K4TA 4RM2A 3IRQA 2LB9A 4EM2A 3NCKA 2HS5A 3PM1A 1AHDP 1JT6A 1I50J 1PDNC 1R5HA 3K2NA 4JX4A 4F3QA 4IUKA 1LQ1A 1B6AA 1IZ1A 4MHGA 2E8JA 2PR5A 3HSFA 4OU0A 4DJ3A 3T4LA 5L3EA 3LA7A 5D4RA 5J40A 4PJNA 4E3IA 3CDHA 3RDIA 4G6QA 3HLFA 2HPMA 1QQIA 1ZHFA 3K1PA 5FEGA 4IHYA 2KLIA 3VP0A 1FTTA 4HSRA 1YT4A 2ZNYA 3R61A 5FKLA 5L3FA 1MWRA 3TP3A 5KCMA 4ARZA 2Q8KA 1TNTA 4IHWA 2PYRA 1OJGA 3MBZA 3EQVA 4PK4A 5D5XB 2GOMA 2KIFA 2MG4A 3KEOA 3RTRA 2EWVA 1MMDA 3M4OJ 4IPAA 2J9PA 3CI6A 2WKQA 2ESHA 3S1NJ 3N8RA 1Q1VA 1BLHA 2VL8A 1XPXA 4GYIA 1EF4A 4KITB 2VEAA 3CCMI 1C3BA 4G12A 4P1WA 2V9PA 1MBFA 4MQVA 3LSPA 3ZPLA 3SH9A 3LY4A 1WYCA 1W8YA 1Z05A 3EUKL 2Q2EB 2BOLA 2HNHA 3F8NA 2JA6J 2QPNA 3LI8A 1W5SA 4MNRA 4OKPA 3VFHA 2XF7A 1GCEA 2E2JJ 2MA3A 2L7ZA 5EZGA 2BXYA 2E35A 3LAPA 4GGGA 4Q4ZF 3IL2A 2M7UA 3W6VA 2OSUA 3MZ8A 1JTXA 4KT5C 1ZYRF
chains in the Genus database with same CATH topology
3BY6A 3CUEA 5E1ZB 1FY7A 1IXRC 2PD7A 5DCMB 3FM5A 3L00A 5C5KA 4NEED 2KKOA 4HLYA 2HDCA 2IVMA 3LR3A 1SD5A 3EWKA 4FX4A 2DK8A 2FOKA 1B1BA 3KZYA 2CFXA 4WL9A 1TTYA