3P7NA

Crystal structure of light activated transcription factor el222 from erythrobacter litoralis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
191
Chain Sequence
PAQWVLDLIEASPIASVVSDPRLADNPLIAINQAFTDLTGYSEEECVGRNCRFLAGSGTEPWLTDKIRQGVREHKPVLVEILNYKKDGTPFRNAVLVAPIYDDDDELLYFLGSQVEVGMARRERAAEMLKTLSPRQLEVTTLVASGLRNKEVAARLGLSEKTVKMHRGLVMEKLNLKTSADLVRIAVEAGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Sensor histidine kinase
publication title Structural basis of photosensitivity in a bacterial light-oxygen-voltage/helix-turn-helix (LOV-HTH) DNA-binding protein.
pubmed doi rcsb
source organism Erythrobacter litoralis
total genus 62
structure length 191
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00196 GerE Bacterial regulatory proteins, luxR family
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3p7nA02
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p7nA01
1LSWA 1TNSA 3JAMK 2K4JA 1QZZA 1FBUA 4LD5A 2ZBKA 3EETA 3EDPA 2H6CA 1BI2A 5F6FA 1SFUA 2PR5A 4KIFA 4M71A 3G73A 5JVTA 5E1WA 1KQ9A 2M8EA 5E20A 4BHBA 2M1BA 1Z9CA 5LHGA 2HKOA 3KE2A 3T0YA 3ULQB 1IZ1A 3ICYA 1T2KA 1J5YA 1T39A 5HDCA 5D6EA 5BQTA 2DAOA 3I5UA 2W85A 2J80A 2Z9OA 2O03A 2QBYB 1U3EM 4LGWA 2ESNA 4BQAA 1XGSA 4IPAA 1XMKA 2F2EA 3LUQA 5CLSA 3M1EA 3EQLF 1W5SA 1K78B 3FZVA 4HV6A 1OT6A 5DUIA 4ASNA 1FSHA 3JSPA 5HDGA 3H82B 1FLIA 1P92A 1IXSB 4BBUA 2A3SA 2LKPA 3M8EA 1J7KA 2GZWA 4KT5C 5J3WA 4IRHA 2K4BA 3ZN1A 4WXDA 2H09A 4L9EA 1YO5C 3K1PA 5BPDA 2R78A 3IS2A 5H6QA 5HS8A 1JHFA 3KP6A 1UHWA 2JSCA 3RIRA 1RNLA 3ABUA 5FFXA 2JHEA 4M6YA 1T0FA 1MD0A 3L00A 4NQWA 2PI0A 5J7EA 3I58A 2YX4A 1N9OA 2CGPA 1HSTA 2EJRA 1KQ8A 5L3FA 1JE8A 3PHYA 1WI9A 4UV8A 4EETB 4XBFA 1EV7A 3L9FA 5EEHA 1LEBA 1KQ0A 1LDKB 1GXPA 4KNYA 1Z1DA 2YR2A 5K1YA 2L1MA 1B1BA 1LJ9A 1XD7A 3SZTA 1KOUA 2OQRA 4CICA 2VV7A 4A0XA 1GVJA 2VBZA 4KA4A 3R6SA 1O3SA 1FBSA 1NHAA 2V79A 2V0UA 1U5TA 3ZN0A 3FC7A 2RNJA 1HBXG 2HWVA 2FOKA 4RB2C 4I3JA 5FB2A 4H6JA 1OJGA 1QZYA 3A0VA 1REPC 4ENJA 2VODA 1MDMA 2L54A 1FYMA 2GQQA 3IRRA 2K7SA 3E6MA 2C6YA 3FXQA 2V0WA 4HX7A 3ZMSA 4A12A 2IT0A 3LICA 1SFXA 2F5CA 4WX9A 5BOXA 2NNYA 1XN7A 2J5PA 2HV1A 5HDKA 5FLXK 2JRTA 4FX4A 4A0YA 3B02A 1O3QA 2EA4A 4G8XA 5HLGA 1ZHFA 3C2WA 1IN8A 4GS9A 2CSOA 5CVRA 3T5XA 2QENA 3REOA 2WTEA 3SHFA 3ZMDA 1S66L 1GHCA 2BE5F 4EM2A 1R1VA 3F6OA 2FMYA 4DQ2A 2O3FA 5ICEA 1ZRCA 4HV5A 1O57A 2D1VA 2OA4A 3O6BB 5E8IA 2VXZA 4LK0F 3FMQA 2GIVA 4HP4A 4M9XA 4YFXF 1G3YA 3NHQA 5E8GA 4I2OA 2M1CA 4ETSA 1B4AA 5HDNA 3CUQC 1B6AA 4HH3A 5E1ZB 2XV4S 3W6KB 1IW7F 3F1OA 4ENKA 3GXOA 3WU0A 3TDZC 4LPZA 2A24B 2LNBA 1GXQA 1MJAA 2HYFA 5CJ9A 1OMIA 2LF8A 3LAPA 4HDUA 3ELKA 1H9TA 1I5ZA 1G6NA 2EA9A 1Z05A 3JSOA 1ZLJA 3ROUA 1FX7A 4A5NA 2D02A 5D8LB 2M30A 1YW7A 2V6CA 2EFPA 1OTAA 2MBFA 2XGXA 1BC8C 1IUYA 3EYYA 1HXDA 1S8NA 4LG0A 5ILSA 1ZH5A 1ZRDA 1BBYA 3ECOA 4ZYEA 2HFHA 5LGUA 4OIRF 2W24A 4P5OA 3IHUA 4HJ6A 4YG2F 1RUNA 5JI6A 3GW2A 4RGUA 2QM3A 2Y0MA 2BASA 4OIPF 5IT9Z 4M4XA 4A5MA 5DJTA 3ZMTA 2MH2A 3E5QA 2HDCA 2ETHA 2JTVA 1YW9A 1G3SA 1EH7A 4MN5A 4BH9A 4NHJA 3MFXA 1XB4A 2STTA 2FNPA 1HW1A 3NJAA 1FWZA 3N4MA 4UV9A 2A61A 4WF0A 4O6JA 2IA2A 1QNTA 2W25A 2PYPA 1EH6A 2P7CB 4B8XA 4MQ9F 4I3AA 4HH2A 1Z6TA 3HOTA 2HGCA 3I59A 5L3GA 3IKVA 4RAZA 5HD5A 4H0EA 2EFQA 3P7NA 3COAC 1V9ZA 1DPUA 2DQRA 4O3MA 3O3KA 1ZRFA 1WA9A 1BIAA 4WXCA 3F22A 1DUXC 4NXEA 1UHMA 4XLPF 2RQPA 4HX8A 2WWYA 1MZBA 3HUGA 3CUQA 2G7UA 2V1XA 1XSDA 3TDUC 2CMNA 1LQ1A 1DP8A 1S6LA 2O61A 1TTYA 2R3SA 2DI3A 2HQNA 3I54A 6PAXA 3NQOA 5LEJA 4WXHA 2QQBA 3CLOA 5BMZA 4TV7A 1OJ5A 3ZQ7A 3LI8A 4L9FA 3ZPLA 3F8BA 1DP9A 1OYIA 2DK5A 2FU4A 2O6GE 1F9IA 4UVCA 2FNAA 1LSXA 1WRJA 4JGOA 3QU3A 2ZNYA 4MN6A 4JGQA 2QWWA 2A5YB 4I38A 3F8NA 4HAMA 1R58A 1Z91A 1QBJA 5JFRA 3Q9VA 3F3XA 5DV5A 3H3ZA 5CVUA 1FC3A 5HVQC 2E7XA 3LA3A 2A6HF 4Y13A 4XLNF 1T1AA 4GO1A 1ON1A 1R36A 1FPQA 3HYIA 2O8XA 2D45A 4M9ZA 4PGHA 5F5YA 2WC2A 2HTJA 4KQDA 3LIEA 2PG4A 1CGPA 3K9TA 4I02A 4AIJA 3QAHA 2L4RA 2XIGA 2F5EA 3LIAA 3F1OB 2Z33A 3F72A 1B59A 4R8HA 4P55A 4LB6B 4BBVA 3F1NB 4MNUA 3HSEA 3GFJA 1R5GA 2KRFA 4GCVA 2ISYA 3WODF 1HW2A 5LHHA 3GZ5A 3LYXA 3MWMA 1TW2A 3LFKA 2HS5A 1R7JA 3V8LA 2Z3YA 3U1DA 1QQIA 3T50A 5K5QA 2FSWA 3BJOA 3HOSA 1MGTA 3BZ6A 2QUFA 5ICGA 4XSZF 2IVMA 2XAFA 2PR6A 5CYVA 2ELHA 2IW5A 2PD8A 4EJWA 4RB1A 4GGGA 2V1AA 1XGNA 3KP5A 3WTVC 1W7PB 2KDKA 5LRRA 1F9NA 4ZZDA 4CO8A 1T18A 1SD6A 1K7AA 4UVBA 1XDUA 3WTSC 4HF2A 2Y75A 2JPCA 4G6DA 3DP7A 4IF4A 1PP8F 2MH9A 2P7VB 2XHKA 5TJJA 5HLHA 2ZOHA 3F8MA 1F5TA 1IXCA 4ZYHA 2K27A 5CVJA 1ZGAA 2JZYA 3FM3A 3ECHA 3WTYC 4KMUX 3TO6A 4HP9A 4MGRA 3I59B 3KZZA 1XJ4A 3V4GA 1R5HA 4I3IA 3U9GA 3HHGA 1BYWA 3K2ZA 1FOKA 3TOAA 3ULFA 2FA5A 1HSJA 2K86A 2YPRA 4CYDA 3RTRA 3E3VA 3D0SA 3LA7A 1HQCA 4WCGA 3CUQB 4U7BA 2CW0F 2V9AA 3LSTA 1SAXA 3DPLC 1GSXA 3E6BA 2QHKA 4RB0A 4LMYA 1X3UA 3HSFA 3D5LA 3NRVA 1XCBA 4WWCA 3M7GA 2ZKZA 1FNNA 4HLYA 1SMTA 3HTUA 5J8CA 2DFIA 4ZZLA 1U5TC 2KKOA 3EUHA 1S1ZA 1G28A 4XT2B 4CHUA 1S3JA 1XCVA 3DPTA 2AS5F 3V7CA 5DUKA 3GDIA 3SXYA 1UB9A 3QPHA 4I5SA 1UWNX 3C3WA 3ZQ5A 3H92A 5F64A 1KU3A 1P0ZA 2R7DA 4LLLA 3BJ6A 1TQIA 1O7LA 3TQNA 2IJLA 4HX4A 1MJ9A 3KZYA 5L3BA 2QQAA 1OTIA 3V7RA 1ONVA 1IN5A 2EK5A 1TW3A 5DKKA 1ZG1A 3LQQA 5FFZA 1B9MA 2Z99A 4U0VA 3EEHA 2XRNA 3PYPA 2O0YA 5F68A 2YKFA 4Q48A 1KU2A 1FYKA 4E70A 2P4WA 1P2FA 3NOTC 3R4KA 3LIFA 4P9UA 1A04A 3W6JB 4YIIA 1WSUA 5A8BA 3WU1B 2CWEA 1ZREA 4L9GA 3BPVA 2KIMA 2V9VA 4KUMA 3HRUA 1J59A 2ZMEA 2A68F 4HOBA 4GHIA 5KIZA 3UB9A 2ACJA 2HTSA 3Q9SA 4ESJA 1IRGA 1Z7UA 1R00A 4I7HA 5A2QZ 3RKYA 1U8RA 2QJ5A 2F5FA 4CGZA 1OTDA 2VN2A 2QWSA 2ZCWA 2PLYA 1U78A 2DBBA 3RI4A 4XSXF 2P8TA 4HQMA 2G9WA 4OOIA 5DCMA 3SW1A 1BIBA 3JAMZ 1Z6RA 2E7WA 5D5VB 3F6VA 2R7FA 4JQFA 4EXOA 2GXBA 2PJPA 2PN6A 2X0LA 3WTXC 1TNTA 4O5VA 2IA0A 1D3YA 3ZMVA 5D8KB 1BI3A 3KP4A 1E17A 3R61A 1YLFA 1XSXA 3UB8A 4MEYF 1YG2A 2CQKA 4F3LB 5IS1A 5CVIA 1PP7U 4UVAA 1R1TA 2XUBA 1JNUA 1O3RA 3KFWX 1GSWA 3CUOA 3VOEA 2FBHA 3LIDA 2OBPA 3P9IA 3K0LA 2OWHA 4HZFA 5F6AA 1W5TA 2XKPA 3I0TA 3QOPA 4LJZF 2ZO4A 4LLNA 3FMSA 1IN4A 4KN4X 1QPMA 2LDUA 2L0WA 3KEOA 5AIPA 3ZMZA 4Q47A 2PEXA 1TLHB 5E17F 1Q1HA 2NRAC 2ISZA 1SMYF 1XJ2A 4LK1F 3SQNA 1OTBA 3ZP5A 3P9KA 1T1CA 4WK8F 3MAJA 2L3DA 3MR0A 1YS6A 1XJ6A 2VLGA 5I5LA 3GFLA 4MHGA 4L9VA 1TS6A 1P6RA 1K79A 2L4AA 3F8FA 3VOLA 2BV6A 1R23A 3AAFA 3MJQA 5LBQA 2DK8A 2XROA 2VONA 1OYWA 1ZARA 1F1ZA 3G6OA 3BJAA 2VC1A 1USSA 3BY9A 2CO5A 2L02A 4RS8A 4LRYC 5LEKA 5DCFA 4MTEA 2PFBA 3FM5A 3CWFA 3KP3A 2W0NA 1OR7A 4KFCA 1OPCA 5ILUA 4IHSA 4KDPA 4ON0A 3K1MA 3IS2B 3J81K 3RDIA 1PUEE 4EJTA 3FWEA 3GZ6A 2OOLA 3LA2A 4N0BA 2WKQA 4RGRA 3VEPA 1BI0A 5EFWA 1S7OA 3TKYA 2DQLA 3T8TA 1ZYRF 3B73A 2IRFG 4A6EA 4HHDA 2PQ8A 4BNCA 3HSRA 1HW5A 3E5UA 2DW4A 5D6FA 1ZAOA 1BC7C 1TS7A 1XGOA 1I6XA 3MZHA 4RGXA 4HA8A 2H6BA 4PGGA 1H9GA 4GXOA 1IAWA 5LRSA 2H28A 5KVRA 3A0SA 1KU7A 5FGMA 1DPRA 4G7HF 3UE6A 3ERED 1S4RA 4I39A 4L0YB 3IWFA 2MLKA 3MFKA 2ZJ2A 3N97A 1B9NA 3IKTA 1RI7A 2VBXA 2PMUA 1BOAA 4PCQA 2EV0A 1SD7A 4EM0B 1LL8A 4ESFA 1BM9A 3RKXA 1I27A 4R70A 3MQOA 2EFNA 3J7AO 5DD8A 1ULYA 1FZPB 2V1DA 4R6LA 5DCMB 2INWA 3L7WA 1U5TB 3L2CA 2L01A 1P4AA 5FLXZ 5DDGA 4GW9A 4H6JB 2HYGD 1W4MA 4K2EA 4HI4A 3M9AA 2COMA 3SFZA 5BPIA 5ED4A 3E6CC 1MDMB 3IRQA 2XKOA 4KMFA 3EYIA 3UMDA 2QVOA 1QO0D 2YX7A 1LT0A 4HOIA 3WGGA 2B02A 2ZBBA 4KUOA 1XMAA 3DKWA 2E1CA 3GO5A 4NXFA 2LF7A 3R0JA 1KGSA 1K6OA 2P5VA 2HEOA 4DJ2A 1N9NA 3F8CA 3BWLA 2EWNA 5G4YA 2UXXA 1L3LA 2VV6A 4GS9B 4YFNF 4GYIA 4RB3C 3RPQA 1N9LA 1FYLA 3H7WA 2ZNZA 4LB5A 3K69A 4P96A 3BDDA 3DF8A 1FP2A 2KIUA 5F1RA 2FEZA 4IJAA 2DTRA 4QWQA 2CG4A 2IPQX 4KUKA 2OD5A 4JK1X 3GECA 3H82A 2FBIA 3DXJF 4ZYDA 4L18B 4HF1A 2QJ7A 5KK1A 4UXNA 4JBAA 1TS8A 4PKYA 3C1DA 3LWFA 5HSQA 2GA1A 2VOOA 4WF2A 1T98A 4KICA 2A07F 3B33A 5AIQA 5HDSA 1G3TA 1T1BA 3GX4X 1LNWA 3KLOA 4G7OF 4DJ3A 4G6QA 1U2WA 4IRGA 3OOPA 2BYVE 4YFKF 3T8RA 2DPUA 2JPBA 3O2PE 3V8JA 4LG0B 4ENMA 1W7PD 1SD5A 1O7FA 3BWGA 5J8FA 1VTNC 1MKMA 2RC4A 4S05A 1HKTA 4CXFA 3C7JA 1HKQA 2GJ3A 4HIAA 2CFXA 2A69F 3WTZA 1YTYA 3V8KA 1BI1A 3TO9A 4OMZA 4G9YA 1TS0A 2ZFWA 2FXAA 2WV0A 1YIOA 4HQAA 4BYYA 4M6XA 4AVPA 3E4QA 2P5KA 2HQRA 2VEAA 3L09A 2UZKA 2KIFA 5CVVA 5HD3A 1UCRA 3BOQA 2D01A 2MLGA 3TO7A 2P5LC 1IRFA 4AIHA 2YKHA 4CDGA 4WL9A 1ODVA 1R1UA 1YFHA 2M5WA 3UB7A 2RKHA 2EV5A 4MEXF 3RKWA 4L5JA 4Y17A 1ZG3A 3IC7A 5TRDA 1RIOH 4ENNA 3H9WA 1KU9A 4HW0A 4U7DA 5D5UB 4CZZA 2MA3A 1R22A 3NOPC 1XJ3A 2Q2EA 2UWMA 4LLOB 4HYEA 2JT1A 2HZTA 2P6TA 2XASA 3A0RA 4EJOA 4FHTA 2IP2A 2OQGA 4K08A 3MEXA 5J6XA 5EEGA 3GFMA 5ERIA 1JHHA 3CAXA 4MQVA 1USTA 4LRXC 5DKLA 3RYPA 1JXSA 2ADUA 2EFWA 3GUDA 4M74A 5L3EA 1Y0UA 3H7WB 2BBYA 2F5DA 2KX6A 1QGPA 5HS9A 1OKRA 4HY8A 2L4MA 1IN7A 3FXUA 1KYWA 5FO5A 3J80K 4QLCU 2A24A 1H0MA 5TBMA 4U88A 4BHCA 4KYWA 4I01A 3ISPA 2ZXJA 1PDNC 4I09A 1DP7P 3LIBA 2XAHA 3FF5A 2WKPA 4F7ZA 2FQ3A 3WG9A 5ICCA 1YYVA 1IN6A 3H3UA 1VB6A 1S4SA 1V9YA 5HZHA 1WWXA 1P4WA 4NXGA 2XAGA 1ZG5A 1S29A 2G7HA 5LGTA 5E1XA 4KN7X 4BXUA 3OV8A 3FX3A 4OINF 4OU0A 1CF7A 4EQ1A 1P97A 1DDNA 3F1PA 4PDKA 3FHZA 4U0YA 4HQEA 1IF1A 4EEUA 2TDXA 3E97A 4Q4ZF 4GYGA 4EVIA 1XDSA 2CYYA 2PMHA 3NOUC 2VBYA 5HOOA 2P7JA 3RH8B 5HWWA 3WTTC 5HLIA 4G7ZF 2YSRA 4EJVA 3BPXA 1D06A 4L9TA 3G3ZA 4WLAA 1SD4A 5IT9K 4HJ3A 3MXQA 1O3TA 5H6RA 3WTWC 2HOEA 2KJBA 3E5XA 4A2UA 1KA8A 3TOBA 1S7AA 4P9FA 1P4XA 2Q0OA 3FMRA 3QU6A 5D4SA 2JN7A 4IXAA 3RTYA 2H27A 2Z6CA 4FX0A 3QP6A 4R1HA 3VFZA 2RVCA 2NS0A 4B09A 2DU9A 2RN7A 5HS7A 3LAJA 1OTEA 2BGCA 2MD5A 2ESHA 1XFQA 2Z5UA 4I0AA 4KIGA 3WE3A 2EFOA 3DEUA 2WKRA 1TBXA 5HWVA 4JGPA 1OT9A 1AOYA 5IT3A 3KCCA 2EV6A 2RV8A 1HKSA 2J5OA 2H94A 2VT2A 4EM1A 3PQKA 4M9SA 2E1NA 2I9VA 1LVAA 4YIFA 2UXNA 2OU2A 1GSVA 1FBQA 1I1SA 1WQ2A 3HJIA 1EW0A 3IWZA 3HRTA 3PFIA 1AWCA 2KJCA 4EGYA 2FE3A 3FXRA 2Y48A 4YWZA 1BN5A 3WGHA 5J4EA 2QZ8A 4GCZA 1OYYA 1T6SA 2PD7A 3J80Z 2HR3A 1YS7A 3SZPA 2AXLA 4LFUA 3V7SA 1J0RA 3GVAA 4AD9A 4DNCA 2A6EF 4RQ9A 1C0WA 1MJBA 5HWTA 3KEQA 5G4ZA 1ZGJA 2DO7A 3GFIA 2W84A 1F4KA 2VBWA 1D8JA 3LI9A 4ZH4F 4HNBA 4EESA 1NWZA 3U2RA 3DV8A 3ML6A 1ODDA 4M72A 2RGVA 3F1NA 2EA2A 5TBMB 1UFMA 1FP1D 2OZUA 1FY7A 3E6DA 4IVNA 1XFNA 5L3CA 2XAQA 3CO6C 1KYZA 3MZYA 3KX0X 2V1UA 4KIBA 2HKXA 1RZ4A 2VE8A 4FT8A 2D1HA 3MQQA 4XRFA 3CJNA 2K02A 3NEUA 1J9IA 4R3AA 2DT5A 4BBTA 5D5WB 4EJUA 4PKYG 2IA1A 1WKMA 4WN5A 2QLZA 3FG8A 1LDJA 3KETA 2FMLA 4EQQA 3I53A 2ZMEB 3KP7A 3HRSA 3CO7C 4GHIB 2D2WA 3EWKA 1U6GA 2GA2A 1CF7B 1W7PA 3F1PB 4EW7A 1I1GA 2BEOA 5ICFA 2YU3A 1X0OA 3OLOA 1G3WA 5AONA 2NNNA 1J75A 5LLQA 3ZMUA 3TGNA 2XAJA 3MCZA 1YQAA 2STWA 3R0AA 3GLXA 2DLLA 2M45A 4EERA 3C18A 3IL2A 4R38A 3HTSB 1Y28A 3JW4A 2X4HA 3HIFA 1LEAA 4RGSA 3HJKA 5D5XB 5E18F 5F69A 2NYXA 4UUVA 4WUJA 1V3FA 4Q5SF 5IU1A 3DFGA 3PQJA 1FSEA 5DYMA 3LQRA 3WGIA 4ESBA 2EB7A 4L9NA 3GEZA 1MZUA 1LB2A 3P9CA 3D72A 3E4PA 1T19A 4OIQF 1S67L 2P6SA 1D7EA 1J2XA 1DP6A 5JR3A 4OMYA 2M87A 5ILVA 4NXBA 3Q5FA 1YW8A 4ZYGA 2PYRA 3VB2A 3HHHA 3WE2A 3RYRA 1F98A 1G4DA 3I71A 4R79A 1IXRC 4L5IA 3VODA 1TQMA 2MC3A 1EH8A 4N9HA 5LHIA 5D4RA 4Z2YA 2QBYA 4HBLA 4HDVA 3S2WA 2VOPA 2GWRA 1T38A 2RDPA 3GWZA 1UGUA 3T1BA 2QKPA 5FD5A 2PHYA 5FD6A 2FBKA 5K5RA 4XT2A 3BY8A 4HLXA 2NAZA 4L9JA 5BS6A 2VE9A 4N9IA 3JTGA 3KLNA 3HRMA 2DPDA 1K78A 4E04A 5DEQA 4AWXB 1UWPX 2K7LA 3UB6A 3DQVC 3UMEA 3BROA 4M73A 5L3DA 2ZOIA 3GYHX 3BY6A 3I4PA 5HDDA 4OIOF 4EV0A 3F23A 4B9OA 3C8CA 1S1YA 5AVEA 5H20A 3J81Z 4RAYA 1E2XA 2OAZA 5DJUA 4U0WA 4JGRA 4UHTA 1XSVA 5AVFA 2V1BA 4G94A 2W57A 4Y15A 5K5OA 2PDRA 4MTDA 1TQPA 3E4OA 2VV8A 3KP2A 4A0ZA 3R60A 3F21A 1RUOA 2OWJA 4BHPA 3K1NA 3I64A 1LDDA 4NB5A 4EMSA 1ZLKA 4EGZA 3VE4A 3RJPA 1D5VA 3K3CA 4BAYA 2QYOA 4IHTA 4HF0A 3BP8A 3GF2A 3QPTA 4HJ4A 2OZ6A 4LRZE 2GXGA 4A6DA 2B0LA 5LGNA 1L0OC 4PZJA 3MQ0A 1JGSA 4LLGF 2VC0A 1XGMA 3ABTA 3VE3A 4AIKA 2LSOA 1STZA 4I98B 1ZN2A 3CDHA 2FF4A 1BJAA 4IRIA 3QP5A 2QQ9A 1DRMA 4D0PA 4EEPA 3M8FA 2XVCA 1V4RA 5DD4A 2Q8KA 4I0BA 1LSVA 4UNOA 1D8KA 1SFEA 2VT3A 3IBRA 1ON2A 2FRHA 3CTAA 3JTHA 5JHUA 4L0ZB 5A2QK 3RPUA 2Z6DA 4F3LA 2W27A 2PBIA 1FT9A 3K3DA 4S04A 3QRFF 3WTUC 2GAUA
chains in the Genus database with same CATH superfamily
2KIQA 1G6OA 1LSWA 3N6IA 3G1MA 3I4NJ 3UNWA 1TNSA 2XSJC 3JAMK 2K4JA 1MMNA 1QZZA 1FBUA 1UHSA 2ZBKA 4LD5A 2M4KA 3EETA 1Q2QA 4NC7A 4OLDA 3HOUJ 3EDPA 1X1AA 2H6CA 4B1RA 5AQBA 3CF2A 1BI2A 5F6FA 4OOYA 1SFUA 5J8XA 2AO9A 2PR5A 4KIFA 3PUBA 4M71A 1K4TA 3G73A 4KQQA 5JVTA 5E1WA 4DYQA 4A3LJ 4QSHA 1KQ9A 2M8EA 5E20A 1YLYA 1XX2A 4BHBA 4ME4A 3LR3A 2ZJ9A 1K6SA 3LR5A 2M1BA 2XRLA 1Z9CA 1T8IA 5LHGA 1VQ9I 1Y0NA 2CS3A 4RM3A 2HKOA 1FIKA 5CTMA 3KE2A 3T0YA 2PX9A 3ULQB 2OAP1 4B3XA 1IZ1A 3HVFA 4CLCB 5IHVA 2HF6A 3ICYA 1T2KA 3WS2A 1J5YA 1T39A 2Q9NA 5HDCA 2LP0A 5D6EA 1ETQA 2OCEA 5BQTA 4B43A 3ZQGA 2DAOA 2XLNA 3UR3C 1W0UA 4F94A 1OCRH 3I5UA 2W85A 2CC1A 5M5WJ 4C2MJ 2J80A 2Z9OA 2M7UA 1XMXA 2O03A 4BDZA 2QBYB 3ERMA 2K31A 1U3EM 3BLSA 4LGWA 2ESNA 2J7VA 1FR6A 2CMPA 3TBIA 4B44A 3VOYA 4BQAA 2VA0A 1XGSA 3ZHHA 5GP9A 4IPAA 1X1PA 3RZOJ 4E7ZA 3S3OA 2I72A 1XMKA 4X6AJ 2XB5A 2F2EA 3LUQA 5CLSA 1S72I 3O87A 3M1EA 2TCTA 3EQLF 2HJ9C 5AQ7A 2C5WB 2K9LA 3I7JA 1W5SA 5GHZA 3C2HA 3AG4H 3VP4A 2RAEA 4XK4A 1CK3A 1K78B 1K56D 4NBQA 1SVMA 3FZVA 3MVPA 4HV6A 2XA7S 2Y2GA 1OT6A 2Y2OA 1N75A 4RA2A 2M34A 5DUIA 3GTMJ 1JTGA 3N05A 4ASNA 1H88C 1VI0A 1FSHA 4CCMA 4HG2A 3CCMI 1QMFA 3JSPA 5HDGA 1JWVA 4R4RA 3H82B 3G4SI 2MD0A 4LIVA 2AQEA 3H3VK 1FLIA 3W2VA 2VL8A 4XOPA 1P92A 2LC2A 1IXSB 2E1MB 5KNLA 2EX6A 2A3SA 2P08A 2LKPA 3N7WA 2CQXA 5HODA 4UQIS 3M8EA 1J7KA 1Y56A 5A90A 4OAZA 2GZWA 4KT5C 2QKMB 4L5EA 4Y4RA 4IRHA 2K4BA 1TWAJ 2H8WA 4WXDA 3ZN1A 1JKRC 1PYYA 3IF6B 4A3DJ 4MMNA 2H09A 5GTHC 4L9EA 2L5QA 1YO5C 1Y6IA 3K1PA 3NWTA 5BPDA 4A3JJ 3D5RC 2R78A 3IS2A 5H6QA 4BL3A 4U3TA 3HZJA 2Y2ZA 5HS8A 3CDLA 1JHFA 1FMWA 1MBKA 2Y69H 3S22A 5EG0A 4N4OB 3KSIA 1LFPA 3KP6A 1IDYA 4IHQA 4RLFA 2MJ6A 1UHWA 3LSJA 1V5GA 4PM5A 5DTTA 1Y1WJ 2LB9A 2OLVA 2BY1A 2JSCA 3RIRA 1RNLA 3ABUA 1PI4A 5DM7F 4BQNA 5FFXA 1Y1VJ 5HNFA 3UKGA 2JHEA 5TGFA 2CW8A 1FMVA 1DJAA 4IBRA 2FOWA 4M6YA 3T4LA 1RKWA 3PAGA 4S2PA 4S2NA 1T0FA 2L2OA 1D1JA 1MD0A 2NS7A 4FCYA 3L00A 4NQWA 2PI0A 2O9CA 3PAEA 2JN6A 4R23A 5E43A 4I76A 2Y79A 4Z9QA 4XLFA 2XEPA 1XX5A 3V3RA 5J7EA 3I58A 3KYZA 4KZ8A 1PUFB 4Y3OA 2VKSA 3C7VA 1L0FA 1MMSA 2YX4A 1N9OA 2VB6A 3ZG7B 1A35A 2CGPA 2WK0A 1HSTA 3MXRA 3Q3SA 2EJRA 1KQ8A 4KZ4A 4BD1A 1NZOA 5L3FA 5L8MA 5M18A 3HLBA 1N78A 2AHQA 1JE8A 1OCCH 2OLUA 1WI9A 2VGJA 3PHYA 2V4JC 4UV8A 3RPUD 4DDSA 4EETB 3DWKA 4XBFA 1EV7A 4KZAA 2E5NA 3L9FA 3NIAA 5EEHA 1LEBA 1D1AA 1KQ0A 3LEQA 1LDKB 1GXPA 2DMTA 4KNYA 2WV1A 3ZNYA 3DAVA 1Z1DA 2YR2A 5K1YA 2L1MA 5C4JJ 1B1BA 2O9LA 1Z0XA 1LJ9A 1XD7A 5L07A 2PBYA 3HPHA 3SZTA 3V67A 2JA2A 1KOUA 2OQRA 5KMWA 2LYCA 3S32A 4CICA 5DTKA 2VV7A 5E3MA 4JPMA 2B63J 2OSUA 1GV5A 4RA7A 3UE3A 4A0XA 4DBRA 3TW8A 1GVJA 5E3OA 5TFQA 1VQPI 2VBZA 1CEGA 2HDRA 4PM8A 2XC7A 3SS5A 1X1CA 3R6SA 4KA4A 1FBSA 1O3SA 1QVUA 1NHAA 2V79A 2V0UA 2X6OA 3BC8A 1U5TA 3ZN0A 3FC7A 2RNJA 4OQGA 1HBXG 3I4MJ 3DU5A 2HWVA 2FOKA 4RB2C 4I3JA 4QWOA 1V55H 5CQGA 5FB2A 1WJAA 3ZQCA 4A3KJ 4NETA 1SEUA 4H6JA 1OJGA 1AKHA 2Z2MB 5C4XJ 5F1JA 1QZYA 3B6CA 4N9KA 4XKWA 3A0VA 4JKTA 1REPC 4ENJA 2Z16A 2VODA 1MDMA 1HZOA 2L54A 3FKWA 1A6IA 2R7ZJ 1A6QA 1FYMA 2EFUA 2GQQA 4NKPA 3IRRA 2K7SA 3E6MA 2C6YA 3FXQA 1WJDA 4HX7A 2V0WA 3ZMSA 4P0MA 4A12A 2IT0A 3ZGAB 3LICA 3S16J 2GM4A 3N8RA 5CX7A 1SFXA 1WCMJ 2DA2A 2H0TA 2F5CA 2NOJB 4WX9A 5BOXA 1CEFA 2NNYA 1XN7A 2J5PA 3QPLA 4OAYA 4KG5A 1I5QA 2R5ZA 1AHDP 2HV1A 5HDKA 5FLXK 1UELB 2ICWG 2JRTA 2WAEA 5EPHA 4B4CA 3HXLA 4FX4A 2I5UA 4KISA 2KPMA 1MBEA 2DRWA 4XRMA 3C7UA 4IVIA 1IDZA 3Q0UA 4A0YA 3B02A 1O3QA 2EA4A 3FISA 5CERA 5M3FJ 4QU3A 2L7MP 3WHBA 4AYBA 4G8XA 1WZ2A 2TRTA 2CV1A 5HLGA 1ZHFA 3C2WA 3OIQA 5FQIA 1W8YA 4C3IJ 1IN8A 1YLPA 4GS9A 4JP0A 1X1BA 1MSEC 4PK4A 4BLMA 1BSGA 2CSOA 5CVRA 3T5XA 2QENA 3IXBA 3W4OA 4Q0HA 3REOA 2WTEA 4M3BA 3SHFA 3ZMDA 2GLOA 3BW6A 3E98A 4OQIA 3UE0A 4Y0TA 3GTJJ 1VQMI 2VJWA 4QB8A 3JRIA 2XGEA 1S66L 2E2IJ 2KZGA 2LK2A 1GHCA 1MSFC 1VNDA 3A4CA 2BE5F 1JUMA 3BTIA 1PYVA 1ETVA 2LVSA 4EM2A 1R1VA 3F6OA 2FMYA 4WBGA 4DQ2A 2O3FA 5ICEA 1ZRCA 3CG5A 1K25A 1PWCA 3M2KA 2OCCH 1O57A 4HV5A 2D1VA 3MD2A 3UDFA 2DFEA 2E5ZA 1WH7A 2DOEA 2OA4A 3O6BB 2LKXA 5E8IA 2VXZA 4LK0F 4XN0A 3OYHA 1X2NA 1MMGA 1WGXA 2GIVA 3FMQA 4II3A 4M9XA 4HP4A 3JRDA 4YFXF 2VK3A 1G3YA 4XICA 3NHQA 5E8GA 5B66C 1QPIA 1NG7A 4I2OA 4X0GA 3FXLA 3FDYA 4EEFG 5B3SH 2M1CA 1DP3A 4ETSA 1B4AA 2ZLYA 4AM3A 1IYSA 3JR9A 5HDNA 3CUQC 1B6AA 4HH3A 5E1ZB 1OQYA 1K4EA 2R7OA 3VYSB 4OQ0A 2VQCA 1PRQA 4KENB 3HDDA 2XV4S 3P01A 3QP2A 3MSHA 3W6KB 2MYSA 2IS2A 1IW7F 2KOIA 3F1OA 4ENKA 3OBFA 3GXOA 3WU0A 3RKQA 1IJWC 3TDZC 3W4PA 2EIJH 4LPZA 2A24B 2XF6A 2EZHA 2LNBA 1GXQA 1MJAA 4B48A 3IUOA 1FCNA 2HYFA 5CJ9A 5EVEA 1OMIA 1ZTUA 2LF8A 2IBDA 1IKIA 2HDQA 3ASNH 3LAPA 2CW7A 2ZD8A 5IP7J 4HDUA 3ELKA 1H9TA 1U60A 1I5ZA 1G6NA 3AL0C 3AGFA 5EM0A 1MH4A 2EA9A 5JYOA 1Z05A 3JSOA 3JVUA 1ZLJA 3ZYTA 3ROUA 1FX7A 4A5NA 2D02A 4R3JA 5D8LB 2M30A 2JMWA 1YW7A 2V6CA 1S7EA 2EFPA 5FKKA 2JUGA 4C9YA 1OTAA 4ZJ2A 2MBFA 1X3ZB 2XGXA 1BC8C 4U0TA 3D3OA 3ZVTA 2DMQA 1IUYA 3EYYA 1HXDA 1S8NA 1RCJA 4LG0A 5ILSA 1SDEA 1U0JA 3IXHA 1ZH5A 3BM6A 1ZRDA 5GLDA 4ESPA 1I2SA 5CGSA 1BBYA 4J01A 3ECOA 1OCPA 3BR1A 4ZYEA 1ES3A 1FSWA 2HFHA 5EV0A 5FI2A 5LGUA 4S2OA 4OIRF 3IXDA 2W24A 4P5OA 3IHUA 2O99A 2RCXA 4HJ6A 3LFUA 2PMZN 3ZNTA 4YG2F 1RUNA 3L2QA 5JI6A 3GW2A 3LSIA 1Y8QB 2JC7A 3BR0A 4RGUA 2JSPA 2QM3A 2Y0MA 2V1ZA 3PM1A 2XA7M 2BASA 2PBDP 4MBFA 2DMUA 4OIPF 4BACA 3BQYA 5IT9Z 1IYPA 2R7UA 3D1NI 4M4XA 4A5MA 4CUGA 5DJTA 2CJJA 2GX5A 3ZMTA 3HL2A 2G0EA 3GTCA 4NQWB 4XLHA 3SEZA 3PBRA 2MH2A 3E5QA 3CPTA 2DMPA 5DTDA 2HDCA 2XPVA 2BXZA 2ETHA 2JTVA 1YW9A 2XGCA 3BFEA 2FUG2 4GN2A 1G3SA 1JT6A 3A1YA 1EH7A 4FQGA 3TW6A 4BH9A 4MN5A 5FQMA 4NHJA 3MFXA 2QCOA 1XB4A 2DOAA 1A5JA 2DDAA 4YINA 4NC6A 3SYTA 2STTA 2FNPA 4JOMA 3LSGA 1HW1A 3NJAA 1FWZA 1DGRM 2IGNA 3N4MA 4UV9A 2A61A 3OYMA 3GTGJ 4KZBA 4WF0A 2UV1A 1T56A 2HOAA 1KZHA 4BEHA 4O6JA 2NVUB 3IH8A 2M4GA 2HVRA 3Q7ZA 3GR2A 3BYDA 5FKMA 3BT9A 3PBNA 3TP0A 3T1XA 2ZC2A 2IA2A 2OUMA 2XSDC 1QNTA 3F0CA 2WY7Q 2W25A 3KIOA 2ZXWH 2PYPA 1EH6A 4NNJA 1LHYA 2P7CB 4KZ9A 1QHGA 3HLDA 1ZKGA 4B8XA 4MQ9F 3OR1C 4RX2A 4I3AA 1TP4A 4HH2A 1Z6TA 3G71I 2E60A 2XDMA 1N4OA 3HOTA 3CCVI 1BZAA 2P9VA 2HGCA 3I59A 5L3GA 2DDBA 3IKVA 1TDGA 4RAZA 1W8QA 2W1RA 5HD5A 2D5VA 4H0EA 2EFQA 3HEFA 3P7NA 2L0KA 3COAC 1NRJA 1DPUA 1V9ZA 4DN0A 2HDSA 4YEJA 3DPUA 1J9MA 2DQRA 4O3MA 3O3KA 4XLCA 1ZRFA 1WA9A 5EVIA 1BIAA 5L09A 2R0QC 3I55I 2NVYJ 4WXCA 3F22A 1DUXC 3CMEI 4NXEA 1UHMA 1MNEA 1MPLA 3MN2A 4XLPF 2RQPA 1FOFA 2R5YB 3A03A 1E3PA 4HX8A 2WWYA 1YPRA 1MZBA 3HUGA 5IYBJ 5GAEJ 3KEYA 3PBTA 3CUQA 4ZTFA 2G7UA 4PHTA 4QY5A 2V1XA 2LR8A 2WB1N 3BFGA 1XSDA 3D4FA 4XN3A 5F27A 2JCHA 3ZG8B 3K10A 3TDUC 2CMNA 2P04A 4QPRA 4BU2A 1LQ1A 3AG2H 3EEAA 2BW3A 1G59A 5FKOA 1ACFA 5HPIA 1DP8A 1S6LA 2O61A 2HDUA 1TTYA 2KRCA 3SS3A 2R3SA 2DI3A 2HQNA 3I54A 3JRGA 6PAXA 3NQOA 3NI9A 3O88A 2VXDA 3Q07A 4DE2A 5LEJA 2Y2MA 3KSGA 1JJ8C 4WXHA 1IYQA 4XNFA 2QQBA 1SANA 3CLOA 2W7NA 5BMZA 1GCEA 1P7IA 4TV7A 2VQGA 1OJ5A 3ZQ7A 3BRMA 3LI8A 1E3UD 3FXOA 1ESIA 1M6KA 1ESUA 3B6AA 1GHPA 4L9FA 5FROA 3ZPLA 4JXVA 3F8BA 1DP9A 1OYIA 4PAUA 3QPSA 1XC5A 2DK5A 3WHCA 1Z67A 3F9KA 2G2WA 4ZYAA 3HREA 2X01A 3CD6I 2FU4A 2O6GE 3BZCA 4UVCA 2FNAA 1F9IA 1LSXA 1WRJA 1PVEA 2LRDA 1JGGA 3B3XA 3D9YA 4JGOA 5D3OA 3QU3A 2ZNYA 4MN6A 4JGQA 2QWWA 5GAGJ 2A5YB 3ESWB 4NK3A 4I38A 4OOMA 2EX8A 3ZG0A 2HOTA 3F8NA 3EQVA 4HAMA 1H8ZA 1SKOA 2CV2A 3MZEA 5C5KA 1R58A 2M3AA 3QNBA 1Z91A 2QSHX 3OIOA 4DYCA 1QBJA 4GDNA 5JFRA 3Q9VA 2OAQ1 2W3GA 4HEA2 3F3XA 2HPIA 3G2YA 3WS4A 3NARA 3M8JA 1S9HA 5DV5A 3H3ZA 5CVUA 1FC3A 4II7A 5HVQC 3VP1A 4BQOA 1Y39A 1DQUA 1IRXA 2E7XA 3LA3A 4XKCA 2R7VA 3GMWA 2A6HF 2P74A 2AQFA 3H0GJ 4Y13A 3CZ6A 1VQ8I 4WM9A 1XA1A 4XLNF 2F5VA 3LSMA 1T1AA 4GO1A 3CCRI 3IT9A 1GT0C 1ON1A 1R36A 1FPQA 2BZTA 1VETA 3CP8A 3HYIA 3IX3A 2O8XA 4YOFA 1PNEA 4M3FA 2K85A 1PFLA 3MF0A 2D45A 1TWHJ 1CI8A 3E0YA 4M9ZA 4PGHA 3KYCB 4IQJA 2WC2A 2HTJA 4JX4A 2W1TB 4OLGA 5F5YA 1V54H 2ZB9A 3CUEA 3LIEA 4KQDA 3SS4A 5LFAA 2HXIA 2PG4A 1CGPA 4DDYA 3K9TA 4I02A 4AIJA 3IF5A 3PBQA 3QAHA 2H5SA 3L2RA 3CCEI 2XIGA 2L4RA 4XUZA 5FI7A 2F5EA 5FEGA 3LIAA 5FRNA 3F1OB 1PZPA 2Z33A 3F72A 1B59A 4R8HA 4P55A 4LB6B 4C2UA 1F43A 4XIDA 3LSPA 4CJNA 4CCOA 4BBVA 2IS4A 3FHNA 3F1NB 4MNUA 3HSEA 3GFJA 1R5GA 1NJ4A 2KRFA 4GCVA 1RKTA 1HDPA 4UHUA 1SFKA 2ISYA 3WODF 4CCKA 1HW2A 1VQLI 3HLFA 4Y5FA 1UG2A 5LHHA 1NRFA 3GZ5A 3C30A 3LYXA 3MWMA 2IAIA 1TW2A 2ZJRF 3LFKA 3GQZA 4IHXA 2HS5A 2DFFA 5J47A 1R7JA 3V8LA 3VFHA 2M8GX 2Z3YA 1L0EA 3U1DA 1EA3A 1N25A 1QQIA 3L1PA 3T50A 4AFIA 5K5QA 2X6WA 2ZFUA 1YAXA 1NYYA 4NG2A 3TL4X 2FSWA 3BJOA 3SDBA 4UEYA 3ZCZA 3K4NA 4BE2A 3HOSA 1MGTA 2J8YA 3BR3A 3ZQQA 3BZ6A 2QUFA 5ICGA 3HGYA 1L0GA 3C2GA 2ME6A 4XSZF 1JKQC 2DA1A 3H9GA 2IVMA 4N1HA 4WLAA 2XAFA 2ZM0A 2PR6A 5CYVA 2ELHA 1YE9A 2DA7A 2IW5A 3EUAA 2R7WA 1WPKA 4EJWA 2PD8A 4KG6A 4EUVA 2ZSIB 2E71A 4RB1A 2GZAA 4GGGA 2V1AA 2DTZA 5HL6A 4C6YA 3W3CA 1XGNA 4IUHA 3KP5A 4YRVA 3CPTB 2VGLS 3WTVC 3S1NJ 1W7PB 2KDKA 3FXMA 2JKGA 3OPLA 1EJ9A 2Y2JA 2R93J 1GA9A 5LRRA 4C75A 3UNGC 4D60A 2ID3A 1BULA 1F9NA 2EBIA 4CO8A 4ZZDA 1T18A 1EI5A 4D5FA 5EGOA 2ZQAA 5EVID 4DKIA 4FETA 4A3EJ 1SD6A 1K7AA 1TVFA 4UVBA 4WMCA 1XDUA 3WTSC 4HF2A 2PU2A 1MWUA 2Y75A 2Y0SN 5AQAA 1NK3P 4W1UA 2VJJA 1X19A 1JWZA 1MC0A 4II2A 2JPCA 3WRTA 1ZC2A 4G6DA 1MBGA 3DP7A 4IF4A 1PP8F 1FCOA 3DKXA 1IC8A 1KVMA 2JKRI 4Y0UA 2Y8HA 4MO7A 1CI9A 2QF7A 2MH9A 2P7VB 1WJ5A 2XHKA 5TJJA 5HLHA 2ZOHA 1GVDA 3F8MA 1F5TA 2R4GA 4BWIA 4DW6A 4RBOA 1IXCA 1BR4A 4ZYHA 2K27A 5CEDA 5CVJA 1ZGAA 4PJMA 2JZYA 1VQNI 3FM3A 2DOFA 2DCFA 3G34A 2XGDA 4KZ6A 4BGDA 4YELA 3K70D 3ECHA 4X56A 3WTYC 3TW7A 3MS6A 3A0BC 4KMUX 4IUKA 1K4FA 4QY6A 2HPMA 3TO6A 3C4OA 4HP9A 2Z2SB 4B88A 2P9VB 4MGRA 5FQQA 3I59B 3FWLA 3KZZA 1XJ4A 3V4GA 1R5HA 2HP5A 4I3IA 2IGKA 1YJNI 3U9GA 3HHGA 4BS9A 4C2TA 3K2ZA 5F08A 3TOAA 1FOKA 2VJ5A 2BHZA 2FA5A 1BYWA 3ULFA 1LPQA 1FTZA 1HSJA 2K86A 2XF5A 2YPRA 4BXXJ 1JUPA 1Y8RB 2CH0A 3E3VA 3RTRA 2LG4A 4CYDA 5CTNA 3W4QA 2Y2NA 4IO9F 5IP9J 3OIPA 3D0SA 3V50A 4DYRA 3S2DJ 5HL1A 4ZDPA 1XP4A 5DF7A 3LA7A 1HQCA 1KONA 1G5UA 3T4QA 3HUGB 4WCGA 2N8GA 5EJCA 5C44J 3CDIA 3CUQB 1X2MA 2CW0F 4U7BA 5GHXA 3DEWA 2V9AA 2DCEA 3LSTA 3PFYA 1XS9A 1SAXA 5FA7A 3DPLC 3T4OA 4QPQA 1GSXA 2HU9A 1ERDA 3E6BA 3U4LP 1LKXA 2QHKA 4RB0A 3IV5A 2KISA 1W5CC 1QU3A 1EROA 3FYZA 1S5LC 1UG0A 3S8PA 4LMYA 1G6AA 1ZTRA 2Y2LA 4GD8A 4JLFA 1BL0A 2DODA 3AL0B 3PO3J 1X3UA 2CU7A 3HSFA 3IHAA 1W1WE 3D5LA 3S1YA 1QRYA 3NRVA 3DBHB 1JKPC 3Q82A 1XCBA 4WWCA 3M7GA 2ZKZA 2EWWA 1FNNA 4B4XA 5GPCA 2RL3A 4HLYA 1SMTA 1KVLA 3HTUA 4UUSA 1WE4A 3BFFA 3BG6A 5J8CA 2DFIA 5FSRA 4ZZLA 4BMWA 2Y2HA 1U5TC 2KKOA 5EM1A 3EUHA 2OTJI 1S1ZA 5EE8A 4PJNA 1G28A 4XT2B 4WEJA 4CHUA 2QSFX 4UA9A 1ONHA 1S3JA 1TEMA 3GCMA 1XCVA 1R5ID 3DPTA 1B72A 2AS5F 3V7CA 4MNRA 5K5BA 5DUKA 4A5RA 3GDIA 3SXYA 4FCFA 1UB9A 1TWCJ 3QPHA 4PM6A 4I5SA 1XGJA 4ZDOA 2ZC4B 1SKOB 1UWNX 3HKZA 4ARZB 4EBLA 3C3WA 2ZMVA 5CHJA 3S1MJ 4XUXA 3ZQ5A 1WI3A 4AC0A 3PSIA 3A02A 3H92A 2BVMA 5F64A 2NVTJ 4AVZA 9ANTA 1KU3A 3WS0A 1P0ZA 2PRFA 3HG9A 4DE3A 2R7DA 1TT5B 4LLLA 3ISGA 3BJ6A 4L0LA 1TQIA 3G2BA 1O7LA 4OPQA 3TQNA 2IJLA 4HX4A 1MJ9A 1MMAA 1G8XA 3L7HA 2JK3A 1VETB 3QQAA 3KZYA 3QYFA 1VHMA 5J4YA 5L3BA 4XR6A 2JQ7A 2MG4A 2NVXJ 2WYXA 2QQAA 1OTIA 3BCAA 3QOEA 3V7RA 3DTMA 4NUBA 1K6YA 1ONVA 1YMSA 1IN5A 1TZLA 4D9JA 5H2FC 2F6CA 1SFOJ 2EK5A 3CC2I 2MGQA 1AA7A 3CQZJ 1TW3A 2I10A 5DKKA 1BTLA 4QIWN 1ZG1A 1ZQ3P 2Y30A 2FQ4A 3LQQA 5FFZA 1B9MA 2Z99A 4U0VA 3EEHA 3ZDJA 2EIMH 2XRNA 1VM1A 3PNYA 2O0YA 3PYPA 1ONGA 3AGDA 2EILH 4IX7A 5F68A 1SHVA 4A3FJ 4WYYA 2LD5A 2F4OB 3KX2A 1KU2A 4Q48A 4E70A 3S3MA 1FYKA 2YKFA 1O07A 2P4WA 3PBOA 1P2FA 3NOTC 3R4KA 3LIFA 2LBFA 4P9UA 1KGGA 2F48A 4P6ZM 1A04A 4Y0OA 3W6JB 2WGIA 4YIIA 1WSUA 5A8BA 3WU1B 2HQAA 5HLTA 1GV2A 1RR8C 2CWEA 1P9QC 1ZREA 4L9GA 4X68A 2HNHA 1MW7A 3BPVA 2BTFP 3LCEA 2KIMA 3EGXC 4WMCD 2V9VA 4KUMA 3HRUA 2GDNA 3PL8A 2K40A 2K9NA 2ZMEA 2A68F 4HOBA 1J59A 5FLVA 4GHIA 5KIZA 3UB9A 2ACJA 2BLSA 1AU7A 3JRFA 2HTSA 1GHIA 5F0FA 4Y52J 1WYBA 2H0YA 3CJRB 3Q9SA 3CJMA 1OLTA 2BXYA 4ESJA 1YMXA 3A2KA 1IRGA 4F91B 1Z7UA 3E0JB 3S14J 4BJTA 5K7HA 3RXWA 1R00A 4I7HA 4IZZA 5A2QZ 3RKYA 2EXBA 2QGUA 1U8RA 3MKYB 1YOVB 2QJ5A 2F5FA 5EEAA 5FAOA 3DTKA 1D0YA 1HCRA 4CGZA 3IBJA 1JT0A 1OTDA 3IH2A 2VN2A 4F93B 3KPHA 2QWSA 2ZCWA 1E4DA 4QHCA 3L2VA 4X6TA 3IQAA 4Q0IA 3GV9A 2PLYA 3Q0WA 4IKFA 1U78A 2DBBA 3RI4A 1ZHHB 1F2KA 3AGEA 4XSXF 2P8TA 2KLOA 4HQMA 4A3BJ 2HQ5A 2ZXHA 5CRFA 2G9WA 5CECA 1PJRA 4IEJA 4OOIA 5DCMA 3SW1A 4GRIA 4YNRA 1BIBA 2R7XA 1ITYA 2A6TA 4H8RA 1YX3A 3VP3A 4C3QA 3JAMZ 1Z6RA 3H5RA 1A36A 2XDVA 2E7WA 5D5VB 1XPXA 1TT0A 3F6VA 3DBLB 2A49A 3KSHA 2R7FA 4JQFA 4EXOA 3VDXA 1X1DA 1I39A 2GXBA 2PJPA 4DMZA 2PN6A 3M6BA 2X0LA 3WTXC 2EX2A 3PXPA 1TNTA 4YFMA 1MWRA 3ZQLA 4BQQA 4FTXA 5IOYA 4S2LA 1AWIA 4O5VA 3BQAA 2IA0A 1D3YA 2HVSA 1NYMA 3DTIA 5HAIA 3ZMVA 1POGA 5D8KB 5JYPA 4GDFA 1IGNA 1OMEA 2KMUA 3QP4A 1BI3A 4E3KA 3KP4A 4S2KA 1E17A 4ZJ1A 3R61A 1U9OA 1Q1VA 1XSXA 1YLFA 3UB8A 2MC4A 4MEYF 1YG2A 2CQKA 4F3LB 5IS1A 4FISA 5CVIA 3OPHA 2ZJPF 4UVAA 1PP7U 1R1TA 5FATA 2XUBA 1JNUA 4A3IJ 1O3RA 1QVTA 2V9KA 3KFWX 4BDYA 1GSWA 3EGDC 3LO7A 4E3IA 1FIPA 4ZTJA 5LD2C 3T4TA 3CUOA 4S2MA 3VOEA 3HOYJ 2ELKA 4O0PA 5BOHA 2VGLM 2FBHA 3LIDA 2OBPA 3P9IA 4E3JA 5F83A 3K0LA 1Z09A 4HZFA 2OWHA 1BOBA 3SEQA 3IXGA 5L2FA 5F6AA 2HGVA 4R4SA 1W5TA 3NECA 5BNGA 2VUMJ 4CZCA 4EATA 3G6EI 1RETA 2KHMA 3KZIC 2KP6A 2XKPA 3I0TA 5IYCJ 1R71A 4FTHA 3QOPA 4XOTA 2P0WA 2PMZA 4LJZF 1PW1A 1ZGWA 3MKFA 4DXCA 1M1EB 3ITAA 3HJEA 2ZO4A 3HOXJ 4LLNA 1L0DA 1XPBA 2CUFA 2KDOA 1IN4A 3FMSA 1ZG6A 4KN4X 1QPMA 2LDUA 3OYAA 1DJBA 2L0WA 3KEOA 5AIPA 3OL4A 1T95A 3ZMZA 5CEBA 4Q47A 2PEXA 1LI9A 1XKZA 2QPNA 1CF0A 1ES2A 5LBRA 1SVLA 1TLHB 5E17F 1Q1HA 1VZ0A 1T08B 4XORA 2NRAC 2JA6J 2ISZA 2JA8J 1SMYF 4Y33A 4BY7J 5DM6F 1XJ2A 3G4PA 4LK1F 4DIQA 4DZPA 3SQNA 1OTBA 3ZP5A 3P9KA 1T1CA 4WK8F 4KITB 2KFDA 3MAJA 1BR1A 4MDZA 1ZK8A 2L3DA 1OISA 4FE7A 2EIKH 3MR0A 1A31A 3IAS2 5HPFA 2QEXI 1D0XA 1YS6A 2R7RA 1XJ6A 2VLGA 5I5LA 4DRTA 4F3QA 1LLBA 5FQ9A 4MBKA 1ZELA 3GFLA 4MHGA 4RVAA 1ORKA 4L9VA 3ZRGA 3VFFA 1WJCA 4X1EA 2DXIA 1TS6A 2VX8A 1P6RA 1K79A 1E3UA 2WAFA 2WZZA 2L4AA 3F8FA 3VOLA 2BV6A 3JRBA 2BY3A 4PSWA 1R23A 4CH7A 5J4VA 2VKVA 3J7ZI 3AAFA 1YJ9I 3MJQA 5LBQA 2DK8A 4BUPA 2XROA 2VONA 5A91A 3LOCA 4G3WA 4WZ5C 1MBHA 5KCMA 1B72B 2ZQCA 1OYWA 4RYEA 1ZARA 5EVIC 5EZGA 4EWFA 1F1ZA 2Y9ZA 2CV0A 3G6OA 3BJAA 3GTQJ 3HL9A 3HLCA 2VC1A 2OV5A 1USSA 1WFXA 3BY9A 5CGWA 2CO5A 3IX4A 2L02A 4RS8A 4LRYC 2K5CA 3A0HC 4AUXA 5DCFA 5LEKA 4Z1WA 3IH4A 4XRSA 2XR0A 2X02A 3WRZA 1TWGJ 4MTEA 2PFBA 3OYGA 3FM5A 2PJRA 1MH3A 5K7FA 3CWFA 3HOVJ 4Q0JA 4BE1A 3DW0A 2VKHA 3KP3A 2JKFA 2W0NA 3IX8A 5G18A 4EBPA 3W2ZA 3DKYA 1OR7A 3K70C 2X9DA 4KFCA 1OPCA 5ILUA 2CUEA 2WKIA 5DFYA 5EF6A 4IHSA 2V1NA 4KDPA 3W2WA 3I3LA 1HLUP 3VPRA 1MBFA 2WB1A 4ON0A 3OS1A 3K1MA 5CQEA 2W1OA 4J00A 1XA7A 3IS2B 4GDBA 1YJWI 3MFDA 3J81K 3RDIA 4Z6YA 1PUEE 4EJTA 5EG0B 3DTEA 3FWEA 3GZ6A 2OOLA 2WGWA 3LA2A 4LIUA 4N0BA 2WKQA 4LENA 4RGRA 3CF5F 4ZRRA 2EZIA 3PNTA 4LV3A 3VEPA 1BI0A 3RQIA 5EFWA 1S7OA 3TKYA 4LV0A 2BOLA 2VPRA 3LR0A 1Z3XA 1K55C 2DQLA 1JI8A 3T8TA 3ZQHA 1H89C 3VP2A 4BBSJ 2H1KA 2LH9A 2DYRH 1ZYRF 1K54C 3B73A 4FUWA 3QHYA 2LBFB 2IRFG 4H4KC 5F1FA 4A6EA 3HGGA 4HESA 4HHDA 3T4SA 2PQ8A 4RLQA 4BNCA 3HSRA 4BJ6C 1HW5A 3OY9A 2EZLA 3E5UA 4UQIM 2DW4A 2BG1A 5D6FA 4LCMA 2KQRA 1ZAOA 1FSYA 4GNUA 2KDZA 1BC7C 4RAGA 1TS7A 1XGOA 1I6XA 1H8YA 3MZHA 4RGXA 4HA8A 2H6BA 4PGGA 4KZ3A 1H9GA 4GXOA 1X58A 1IAWA 1TF1A 3ZXSA 5LRSA 2H28A 2E8JA 2HPBA 5KVRA 2JKRM 3A0SA 1X4OA 3IH3A 4ETXA 3DU6A 2ECBA 1KU7A 1ETYA 3CUEC 5FGMA 3I9V2 3UDXA 3GRJA 1DPRA 3QP1A 4BENA 5IP6A 4G7HF 3C2BA 3UE6A 3ERED 3VYTB 1S4RA 3ABLH 4I39A 4L0YB 4M3KA 3J7YJ 1BLSA 1H3QA 5IT5A 2L9NA 3IWFA 3JPUA 2MLKA 3MFKA 2ZJ2A 3SDGA 3N97A 1B9NA 3IKTA 3K4CA 3TE8A 3DBAA 5GLAA 1RI7A 2VBXA 3OYFA 4BY1J 4JF4A 2PMUA 1BOAA 3B42A 2CUZA 4PCQA 4X55A 2EV0A 3T1RA 1SD7A 4EM0B 1LL8A 4KQOA 5HAPA 2E1OA 4ESFA 1BM9A 3RKXA 3NBLA 1ETXA 3LNQA 3OYCA 2ZL1A 3LR4A 1WYCA 4B93A 1I27A 4PSXA 4R70A 2BVLA 2E2HJ 2X71A 1SAUA 3MQOA 3Q81A 2EFNA 3J7AO 5DD8A 4BBUA 1ULYA 1FZPB 2IGOA 2V1DA 4R6LA 4E6WA 5DCMB 2MSYA 1LI0A 3AG3H 2XPUA 2INWA 3L7WA 2VLAA 1U5TB 3L2CA 2K9QA 2L01A 2ACGA 1P4AA 5FLXZ 5DDGA 2LFBA 5EYRA 2V20A 5FQJA 3MKWB 4GW9A 4WZ5A 4PJ0C 4XM3A 4AIDA 4H6JB 5F1GA 2K3PA 3X2QH 1AKHB 2FH5A 1E3HA 1W4MA 2HYGD 4B47A 4K2EA 4HI4A 4OONA 3M9AA 2COMA 2FFFB 2RREA 3A3JA 4CPKA 3SFZA 3WS5A 4X69A 1Z6FA 1FOXA 4E3OA 1PI5A 2JVHA 5BPIA 5ED4A 3E6CC 2JJ7A 1MDMB 3IRQA 5FI6A 2XKOA 2WKEA 3A3DA 4KMFA 1P9RA 3G31A 3AG1H 4WEKA 3BR2A 3HBLA 1JJ6C 3EYIA 3UMDA 3B47A 2QVOA 1QO0D 2YX7A 1LT0A 4HOIA 3JRHA 3WGGA 2B02A 3RFBA 2HVQA 4KT6A 2ZBBA 2JKTI 4KUOA 3U2AA 3ABMH 2EQRA 3LSHA 1YLZA 4ETZA 1LFBA 3H1CA 1YRNA 3KSFA 2DA6A 1XMAA 3HUMA 3EPZA 3HCYA 2EWVA 3DKWA 2HP6A 2E1CA 3S1QJ 3MMHA 3GO5A 1ZG4A 4NXFA 2LF7A 3ONQA 5EVLA 3U1KA 2IWBA 4RM2A 2WADA 3R0JA 3PTEA 1KGSA 1K6OA 2JA5J 3IWOA 4QD4A 2P5VA 2R5ZB 1R49A 2HEOA 4DJ2A 1N9NA 4F92B 3F8CA 3BWLA 3QWLA 3N4IA 3BTCA 3DBRB 4N9LA 2EWNA 1L2SA 4S2IA 4XL9A 3TJZC 5EZHA 2WKHA 1JKOC 1ZKJA 5G4YA 4OP8A 4JXSA 4E7LA 2UXXA 1L3LA 3K4MA 3CCJI 1SC7A 2VV6A 3M4OJ 2L7KA 2VJ4A 1NY0A 4KZ7A 2NOGA 2G2UA 2NS8A 5CGXA 1K55A 5M5YJ 4GS9B 4YFNF 3BQ8A 1TL8A 4ID4A 1LVKA 4GYIA 3RPQA 4RB3C 3FKVA 1N9LA 3JREA 1FYLA 1K54A 3H7WA 1RESA 2ZNZA 3ZOBA 4LB5A 5KSCA 3K6GA 3K69A 2GOXB 3BDDA 3G1LA 4P96A 3E2KA 3Q1FA 1D0ZA 3DF8A 5GTIC 1PWGA 1FP2A 2KIUA 3NC8A 3JVVA 1VQOI 3A3EA 5F1RA 4UA7A 2FEZA 4HNVA 3OPPA 1E3OC 1JTXA 2CFOA 2DTRA 1JTYA 4IJAA 3JRAA 4JXWA 3OOVA 4QWQA 2R7QA 1MWSA 3HLGA 2LREA 4JX5A 4G12A 1MBLA 1TD5A 2CG4A 2IPQX 1T33A 2L9SA 4KUKA 2OD5A 4JK1X 3GECA 3H82A 2FBIA 3DXJF 4ZYDA 4L18B 1MNDA 4HF1A 2R9XA 1IKGA 1TWFJ 3FBNB 2DT7B 5KK1A 2QJ7A 1EF4A 1HLVA 1D1CA 4UXNA 1K57C 1KDWA 2LMDA 4JBAA 2V8FA 3CLQA 3PSFA 3C1DA 3LWFA 5JHFA 2GA1A 1TS8A 4PKYA 5HSQA 3VP0A 2VOOA 4WF2A 1SVOA 4M3EA 4S2JA 4CQHA 1T98A 4FE4A 4KICA 4ZDLA 1LL5A 5IYDJ 2A07F 3B33A 5AIQA 5HDSA 1G3TA 1T1BA 4W97A 3OSFA 1NH3A 2AVXA 1V5EA 2XAUA 1LNWA 3KLOA 3GX4X 4NDLA 4G7OF 1ERMA 1SDNA 4DJ3A 1ES5A 2CQ7A 4JBFA 5J40A 5J3LA 4G6QA 3IAM2 1XGIA 3OCNA 4P87A 1U2WA 3ZQFA 4JYKA 4IRGA 4HSTA 4U87A 1U8BA 3OOPA 2BYVE 1I3AA 3CJTB 4YFKF 2GNXA 1VF9A 4E3NA 3T8RA 1W36D 1APLC 2X48A 2DPUA 2ZQ7A 4E4HA 2M0CA 2JPBA 1HOMA 3O2PE 2OJED 2WY8Q 1FQGA 4R0QA 4WELA 3V8JA 3G2ZA 4LG0B 4ENMA 2HP9A 1W7PD 3EUHC 3OSGA 1SD5A 1O7FA 1HA8A 3CITA 3SJMA 4E7HA 1OCTC 1CJFA 3PJRA 3BWGA 2DT6A 5J8FA 1VTNC 1W63M 3BZKA 2YS9A 4DJAA 5DF9A 1MKMA 5EOEA 3GTKJ 1PUFA 4CA0A 3S7QA 3O5YA 1UAAA 3AKZA 3AFHA 1J09A 2X1DA 2ZJQF 2RC4A 4S05A 1HKTA 4CXFA 1ZR4A 3C7JA 1HKQA 3CCSI 4DE1A 2JE5A 3L2UA 3S3NA 2M9HA 2C6WB 1IOUA 2GJ3A 4HIAA 5FDSA 4XQFA 2CFXA 4G3KA 3MMYB 2A69F 5CKTA 3WTZA 1YTYA 2IS6A 3V8KA 1BI1A 3TO9A 4DGWB 3A01A 4B3AA 2M2EA 3BTJA 4G9YA 4OMZA 5CPRB 5F0CA 1KE0A 2W3EA 1TS0A 3M6HA 2JUCA 2ZFWA 2K9SA 1S6RA 1FJLA 2FXAA 1SZVA 4IHYA 2J9PA 2WV0A 3M07A 1YIOA 4HQAA 2NUPC 4Y3IA 3UDIA 4BYYA 2JA7J 4M6XA 4AVPA 5JLWA 1LUJB 4S0HB 3LY4A 5JLXA 3E4QA 2P5KA 1C3BA 2HQRA 3W6VA 2VEAA 4FH2A 4MN7A 3L09A 2UZKA 4BEHB 2KIFA 2O5RA 5CVVA 3I56I 5HD3A 2HZDA 3OS0A 3HOWJ 3S7PA 1XG1A 4PJJA 4RDUA 3DWZA 3IWQA 1UCRA 4UUTA 4RX3A 5HARA 4HNTA 2VI6A 4X53A 3BOQA 2JVGA 2R9WA 2D01A 3RSNA 4V2GA 1LE8A 1I6HJ 2MLGA 3CMMA 3HOZJ 3P98A 4A3CJ 2A05A 2V7FA 3TO7A 1ALQA 2P5LC 4ZDXA 5A92A 1IRFA 2ID6A 4AIHA 1W63Q 2V6EA 2YKHA 2IWCA 4CDGA 3TSGA 2Q9MA 3E2LA 5A93A 4XMYA 3OOUA 2V9PA 4CSWA 4WL9A 2OF7A 3CESA 3S7OA 1NTCA 1ODVA 1R1UA 2HI3A 3WWXA 1YFHA 2M5WA 2QQ8A 4LV1A 5TR7A 3VOZA 3G1OA 3UB7A 2RKHA 3QYBA 4BE0A 2EV5A 2ZMEC 4UB6C 3V42A 2R7TA 4MEXF 2A2LA 3FPVA 3RKWA 2GXAA 4L5JA 2UWXA 3ZCOA 4Y17A 1ZG3A 2VKDA 3IC7A 3EUKL 3CC7I 2DFHA 3H5AA 5C3EJ 1K57A 5TRDA 1RIOH 2EX9A 3UY6A 5M3MJ 4CCNA 4ENNA 1KU9A 1TC3C 3H9WA 5EVIB 1WJEA 4LG3A 1YITI 4ABZA 2E35A 1YI2I 3OCLA 4O8GA 5K7ZA 4GKUA 2BW3B 2IEKA 4N4NB 3GTPJ 1WJBA 4HW0A 5M5XJ 5D5UB 4U7DA 1WJFA 2LTPA 4CZZA 2MA3A 2HXOA 5GADJ 3DCFA 3H5NA 1VFCA 1R22A 4QPOA 1FCMA 3NOPC 1FEXA 5FQKA 1XJ3A 4PUSA 3KYQA 3GBGA 2I8DA 2Q2EA 5FRMA 2UWMA 1KE3A 4LLOB 4HYEA 2ZQ9A 2V26A 4HSRA 2JT1A 4WZ4A 1YRNB 1K6RA 4AU7A 3FBIB 2HZTA 2P6TA 2XASA 2DMWA 3UE1A 4EBNA 2JBFA 2Y2PA 3A0RA 4E3MA 4EJOA 3NWSA 1Z7LA 2WZXA 1R4NB 2LOOA 4FHTA 5U47A 2LY9A 1M40A 2IP2A 2OQGA 1VQ5I 4K08A 3MEXA 4M3GA 3GZNB 5J6XA 3KYDB 5IPAA 5EEGA 3GFMA 5ERIA 1JHHA 3M2JA 3CAXA 4A93J 4MQVA 1USTA 3K2NA 1WHUA 4LRXC 4PFOA 5DKLA 3RYPA 1U9NA 4GD6A 5GLBA 3NAUA 2HJEA 3FKJA 3CZDA 3TMOA 4CLCA 4V19K 1JXSA 1Q2PA 1EKEA 2ADUA 3FXKA 2EFWA 1IO2A 3CCUI 3GUDA 3HUNA 4M74A 1PW8A 4O7DA 3DWLE 5L3EA 1Y0UA 3H7WB 2BBYA 3TRCA 3BLYA 5F04A 2F5DA 2WAQN 2KX6A 1QGPA 5HS9A 1OKRA 4OH0A 4HY8A 1OCZH 2L4MA 5E3LA 4KQRA 1IN7A 4J19A 1DU6A 2GOMA 3FXUA 1KYWA 3K2AA 4MIMA 5FO5A 1R9TJ 3J80K 4QLCU 1FIAA 2A24A 1P7JA 2LY1A 3O8HA 1H0MA 5HNHA 5TBMA 3HC7A 5JVGF 3P09A 1NZUA 4U88A 3BECA 4BHCA 4KYWA 4I01A 3GLLA 3ISPA 1CQTA 1DU0A 2ZXJA 5IOZA 1PDNC 3HB9A 4I09A 5CHUA 2DNSA 2O8KA 1DP7P 3LIBA 2XAHA 3FF5A 1YQSA 4ZTKA 3VYUB 2WKPA 3GVBA 4OPZA 4F7ZA 3H9QA 2OTLI 4PPRA 1RPWA 4EU0A 2FQ3A 3OYIA 4IOAF 3BEBA 4DOZA 3WG9A 2COBA 5ICCA 1YYVA 1IN6A 2ECCA 3H3UA 1VB6A 3Q0VA 1HDDC 1S4SA 1V9YA 4PMAA 4BD0A 2OPTA 1E25A 3VWBA 5HZHA 1I3QJ 1WWXA 1YSPA 1P4WA 3GMEA 4NXGA 2VQHA 2QYBA 2XAGA 5F0HA 1ZG5A 4O01A 1MY8A 2CQQA 1YX5A 3Q7VA 3WS1A 1S29A 3OYKA 2G7HA 5MC7A 5LGTA 5E1XA 2NVQJ 4OP5A 4P85A 4KN7X 4IHVA 3LL7A 3OV8A 4BXUA 3FX3A 2HOSA 4OINF 3S17J 2K9MA 4OU0A 2H10A 4M6VA 2J3TD 3C38A 4XRSG 1CF7A 4K0XA 4EQ1A 1P97A 1VEUA 5GL9A 2XPWA 3O3VA 2OV7A 2XH9A 1DDNA 1H8MA 3F1PA 4PDKA 3FHZA 4U0YA 1ETOA 4EV4A 4HQEA 1IF1A 4PM7A 4EEUA 2TDXA 3E97A 3ZFZA 4JX6A 4HPQA 2L7FP 4Q4ZF 3OYEA 4GYGA 3CCQI 3PO2J 4EVIA 1J3WA 2K2NA 1XDSA 2MFZA 2CYYA 3QYEA 2CQNA 3ZGKA 4D5CA 1GHMA 2NUTC 2XD1A 4P6BA 4RAFA 5AQ9A 3DLLF 2PMHA 1YLWA 3NOUC 2VBYA 2XD5A 2H8RA 5HOOA 1RRJA 4CCLA 4IOCF 2P7JA 3RH8B 5HWWA 3WTTC 1KGFA 5HLIA 4G7ZF 1Z21A 1JUSA 2YSRA 1AXBA 3OWTA 1I50J 3A01B 4EJVA 3ZR8X 3BPXA 4HNUA 1D06A 4L9TA 3G3ZA 1BJZA 2Y31A 1ETWA 1OR7C 1F5MA 2BHYA 1SD4A 2DYSH 4FASD 1NLYA 3LEZA 5IT9K 1BA5A 1VQQA 3T1SA 2J3WA 1IEMA 4HJ3A 1VQ4I 3W8KA 1Y54A 3MXQA 1X3WB 1O3TA 5H6RA 3WTWC 2O9AA 4XKBA 2HOEA 2A5WA 2KJBA 3E5XA 4A2UA 1BLHA 1RGZA 3VYRB 3EOIA 4D2OA 1KA8A 3BR6A 1B8IA 5FDHA 3TOBA 2E19A 5EGOB 1S7AA 4P9FA 1I2WA 3HKZN 1P4XA 2Q0OA 3FMRA 3QU6A 4ITVA 5TISC 4IXAA 5D4SA 2JN7A 3MZDA 5GLCA 3RTYA 3CCYA 2H27A 2Z6CA 4FX0A 3QP6A 4R1HA 3VFZA 4UA6A 4BJ5C 4XLEA 2RVCA 2JKTM 2NS0A 3BFDA 3SZGA 4B09A 1N9BA 3LY3A 2DU9A 2CUJA 2RN7A 5HS7A 3LMMA 4C3HJ 5HAQA 1EWZA 1HD8A 3R7WA 3H35A 4Y7NJ 3M1CA 3KYEA 1LE8B 4IJGA 3OL3A 3LAJA 1OTEA 5M19A 2R5YA 2XFTA 2BGCA 2MD5A 4FSFA 2E34A 2ESHA 2IS1A 2E8IA 2DA3A 1XFQA 3V39A 4MLLA 2Z5UA 3MKZA 1BLCA 4I0AA 1YHQI 4KIGA 3FPWA 1GUUA 4FH4A 2ME0A 2EFOA 3WE3A 3LFVA 2PT7A 3DEUA 3T12B 2IXSA 1P9WA 1KE4A 3CP2A 2GIZA 3CMAI 3OYDA 2WKRA 4Y2FA 1TBXA 5DTSA 4JGPA 3SH8A 5HWVA 3K7AJ 1AOYA 1OT9A 5AJGA 5IT3A 3MXSA 1FOYA 3SH9A 2F4MB 5EECA 2QA4I 3O8GA 1IRZA 3QODA 3KCCA 1W36C 2EV6A 2IWDA 1HTZA 2FJ1A 2RV8A 1HKSA 2J5OA 4C30A 4JXGA 2H94A 2VT2A 5B1BH 4CLCD 4E3LA 4EM1A 3PQKA 2K3FA 4M9SA 3VMAA 2E1NA 2I9VA 4IVKA 4K0WA 1QZEA 4ZBEA 1LVAA 4YIFA 2UXNA 2WUQA 2OU2A 3A3FA 3N8SA 3IHBA 3NDEA 4MCWA 1GSVA 3WG7H 1FBQA 1I1SA 5KSHA 2XF7A 1WQ2A 3HJIA 3EQUA 1EW0A 3V5MA 3IWZA 3HRTA 1X4PA 3BG7A 1FR1A 2Z1DA 3PFIA 2XSSA 1AWCA 1ENHA 2KJCA 2Q2EB 2FE3A 4EGYA 3FXRA 3OYBA 4A3MJ 4HBTA 2Y48A 4YWZA 1BN5A 1ZR2A 3WGHA 2W3HA 2QZ8A 5J4EA 4NEED 4E7IA 4GCZA 1OYYA 1T6SA 3T4JA 1CQAA 4BXFA 3HLWA 5KAIC 1W79A 2OC6A 4E7SA 5DS9A 3GTOJ 5FKNA 4UUSB 2FZ0A 2PD7A 3J80Z 2HR3A 4ZJZA 4ZC3A 3FIWA 1YS7A 3SZPA 2HDDA 1YLTA 4ZAMA 2AXLA 2H1LA 1MNMC 1YKDA 2BY2A 2VZWA 2Y2IA 3MBZA 3H36A 2LY2A 4LFUA 3T4KA 3V7SA 1J0RA 3S93A 3GVAA 4AD9A 4QJGA 3L9KA 4RMNA 4IEDA 3OYLA 3VV4A 4DNCA 1RC9A 3P5JA 2Y2KA 2A6EF 3J7AY 1IELA 1OPXA 4RQ9A 2Y9YA 3SFIA 5GAHJ 1C0WA 4MEZA 3K4KA 1MJBA 5HWTA 3V3SA 3KEQA 3ZG5A 4N92A 3BCBA 5G4ZA 2W1TA 1ZGJA 2BY0A 2DO7A 5CXWA 3GFIA 2M0MA 4LITA 2W84A 1F4KA 2DA4A 3OMYA 2VBWA 5EOOA 2ZM8A 1D8JA 1GA0A 3LI9A 1IV6A 3RXXA 5FASA 3E1SA 4ZH4F 1F36A 4A69C 4HNBA 5E79C 3G32A 4GB7A 2DJIA 1NWZA 2W3FA 4EESA 3U2RA 3DV8A 3ML6A 1ODDA 4M72A 1BT5A 2RGVA 1IFQA 2XF3A 3F1NA 2EA2A 2Y55A 3HLEA 1UFMA 1FP1D 5TBMB 1K38A 2OZUA 1FY7A 1GDTA 3BR5A 1JWPA 1BUEA 1BLPA 3UN7A 1G2HA 3E6DA 1PZOA 4IVNA 3JRCA 3LGOA 1XFNA 5L3CA 2VGKA 1KGEA 2VKEA 2XAQA 1D1BA 3CO6C 4FD8A 1KYZA 2XGNA 2WA0A 4NC8A 3MZYA 3KX0X 4HEFA 2V1UA 2X85A 4KIBA 2HKXA 1RZ4A 2VE8A 4FT8A 4OPYA 2D1HA 3QP8A 1SKFA 2YUSA 3K4LA 3MQQA 4XRFA 2DMNA 2ZQ8A 1K0KA 3H9JA 3CMZA 3CJNA 2K02A 3NEUA 1J9IA 4R3AA 3T1QB 2DT5A 5HX9A 5EDNA 2QKLB 1ERQA 1W5DA 3G30A 2VASA 2WBMA 3JCUC 4E7KA 1QA6A 4IHWA 4HBUA 4BBTA 2ZSHB 1H8AC 5D5WB 2KT0A 4MFEA 4D1QA 1FTTA 4EJUA 5CHMA 4PKYG 3S4XA 2IA1A 4CCJA 4IL6C 3Q7VB 2PU4A 1WKMA 4WN5A 2QLZA 3FG8A 1LDJA 1QMEA 2CRGA 4AYBN 3KETA 4KZ5A 2FMLA 4EQQA 1K4SA 3I53A 2ZMEB 3KP7A 3HRSA 3CO7C 2B5RA 2D2WA 4E6KG 3HUOA 4GHIB 3EWKA 1U6GA 4X25A 3U21A 1WH5A 3RJUA 3IH9A 2HZ5A 2GA2A 1CF7B 2P81A 2X1EA 3BQZA 1VEUB 2E1MC 1W7PA 3MZ8A 4JF6A 3F1PB 3O86A 4EW7A 1I1GA 1SCWA 1W7FA 2BEOA 5ICFA 1YM1A 2YU3A 2DA5A 1A0KA 1XXMA 2Y59A 1X0OA 3IF6C 3OLOA 5EUAA 1FOWA 1G3WA 5AONA 2NNNA 5FLMJ 1J75A 2XQZA 5GHYA 3GSGA 4E6XA 3HPGA 5LLQA 3ZMUA 4V2FA 3TGNA 3UPOA 2Q1ZB 2XAJA 3MCZA 2FX0A 3RCOA 2V2FF 4DXBA 1YQAA 1Z77A 3K4BA 2STWA 3R0AA 4F52A 4GFBA 4U0XA 4R3BA 3GLXA 2DLLA 2M45A 3VSKA 3PUFA 3FV7A 5L10A 2DJNA 4EERA 1WVRA 3ITBA 2ZXIA 3C18A 3IL2A 4R38A 3HTSB 1Y28A 3JW4A 2X4HA 3HIFA 1LEAA 4RGSA 4CLCE 1YIJI 5J1YA 2EINH 4LOCA 4CYCA 3HJKA 2M7VA 3SOIA 3CC4I 5D5XB 5E18F 2AXTC 5F69A 3OYNA 2NYXA 4UUVA 3BJNA 4WUJA 2IGMA 1V3FA 4MBHA 3TP3A 2M7AA 1B8IB 4E7JA 4GZBA 4Y7PA 4Q5SF 1R4MB 3LSRA 3DFGA 3PQJA 3OZHA 3PIOF 1PWDA 2Y91A 5IU1A 2DN0A 4GOGA 1FSEA 5DYMA 1NK2P 1K83J 3FKIJ 4PJLA 5E2FA 2ZC3B 5F82A 3LQRA 2O9BA 5E3NA 3WGIA 4ESBA 2EB7A 2HDWA 4L9NA 3GEZA 4UAAA 1HC8A 1VQ6I 1PIOA 3MKLA 1MZUA 3A3IA 1LB2A 3CHWP 2JWTA 3P9CA 4XONA 5KHDA 1KDSA 2PAVP 3D72A 1BR2A 4D7NA 3E4PA 4DF6A 1T19A 4OIQF 2O7OA 2J9OA 2XK1A 3R7WB 1S67L 2P6SA 3PBSA 1H5XA 1D7EA 1J2XA 1DP6A 5JR3A 1LFUP 4OMYA 2M87A 5J1RA 2UUZA 3NULA 5ILVA 4NXBA 2B7EA 3Q5FA 1D5YA 1YW8A 1O7EA 4P1WA 4ZYGA 2PYRA 1XTAA 4MLOA 1VQKI 3VB2A 4I6ZA 1K61A 2VJIA 4M3DA 3KO6A 3HHHA 5HW3A 3WE2A 3RYRA 5M1AA 1F98A 3S7NA 2L9VA 1G4DA 3TEDA 3I71A 1VQ7I 2Z2LB 3UB5P 4R79A 2X51A 1IXRC 2EH3A 4L5IA 4OVDA 2MW8A 3VODA 4BJPA 1UZCA 3FK7A 1TQMA 2MC3A 5J3WA 3IWIA 3DEEA 1MXOA 3S15J 1EH8A 4N9HA 5LHIA 3UO9A 3C4PA 3RQ4A 5I94A 3HM5A 2A3UA 2FFYA 5D4RA 4Z2YA 3CCLI 2QBYA 4EQIA 2J3TC 4HBLA 4IQ4A 4BL2A 4HDVA 2E36A 3S2WA 5B1AH 1DGWY 2X6YA 2F4IA 4OWRB 3WU2C 5E2GA 3D5SC 2L7ZA 2W82A 4UY8I 2GWRA 2VOPA 1GLNA 1T38A 1UJ8A 2RDPA 3GWZA 2B18A 3CI6A 1UGUA 4A3GJ 3BG5A 2RNGA 3T1BA 2QKPA 2W3DA 5FD5A 2PHYA 5FD6A 3FK6A 2FBKA 3HBRA 4UB8C 5K5RA 2UV0E 1UMQA 3BY8A 4XT2A 4HLXA 2B9SA 2NAZA 4L9JA 4LV2A 1NG6A 5BS6A 2VE9A 4N9IA 2WGVA 3OYJA 3KLNA 3JTGA 3HRMA 2EXAA 4PFPA 1N77A 2DPDA 3BLMA 1K78A 4FOFA 3NDGA 4E04A 3NCKA 3ASOH 1E0EA 2JRMA 5DEQA 4AWXB 5IY5H 1MBJA 1UWPX 2K7LA 4ARZA 3UB6A 3DQVC 3UMEA 2KLIA 4BKXA 2Y0SA 3BROA 4M73A 5L3DA 1JTDA 4QTRA 2ZM2A 2ZOIA 5HFOA 4KJZA 2E2JJ 2VQLA 3GYHX 3BY6A 3I4PA 2L9RA 4YIRX 4LCLA 4N1XA 5DF8A 4OIOF 4OOLA 4EV0A 5HDDA 4P6ZS 3F23A 4B9OA 3C8CA 1S1YA 4D7MA 1IV8A 5AVEA 4JF5A 5H20A 3J81Z 4DE0A 3FZCA 4X1LA 4RAYA 2RQQA 3IF6A 1E2XA 4MFDA 2OAZA 2R92J 5DJUA 4U0WA 2M7BA 3IP4B 1O4XA 1FILA 4BQMA 5KZHA 5FAPA 3ZG9B 3UPPA 2KZVA 3PNVA 4JGRA 4UHTA 1XSVA 2VPLA 4DBQA 2ZC6B 2ZMFA 5AVFA 4F55A 5FL3A 4GLQA 3QNCA 2W48A 5DFXA 3UPNA 3VSLA 4OKPA 2V1BA 4G94A 2W57A 3S2HJ 4Y15A 5TGTA 2PJRB 1RGYA 4BL0B 4GJ4A 4B4ZA 5K5OA 2B95A 2PDRA 4MTDA 4PM9A 1TQPA 3E4OA 4KG2A 2FD5A 3BTLA 5J1UA 2VV8A 1OJLA 3KP2A 2ZMAA 4A0ZA 3R60A 3F21A 1RUOA 1NXYA 2EZKA 1HF0A 2OWJA 4BHPA 3K1NA 3I64A 3OC2A 1K56A 4IBXA 1TDLA 1LDDA 4NB5A 2W00A 3GTLJ 4EMSA 1ZLKA 4EGZA 2ZC7A 3VE4A 2Y4AA 3DLAA 2LLKA 3SH7A 3RJPA 1D5VA 3H0DA 3S1RJ 2R7SA 4ZJ3A 2X1CA 3OR2C 1ES4A 2ELJA 2WGWB 1MKIA 3K3CA 4XXRA 4BAYA 1LL9A 2QYOA 3PIPF 2W4SA 1W0TA 1Z3YA 4IHTA 4HF0A 3BP8A 3GF2A 3QPTA 4HJ4A 2QZ6A 5KAFC 3OS2A 4CLCC 1YSQA 4R1GA 2QMIA 4HRIA 4Q8IA 3MZFA 2OZ6A 4LRZE 4OQHA 2GXGA 4XLAA 3MKEA 4A6DA 3G35A 2B0LA 5LGNA 1DY6A 3TG9A 3PR6A 2X6XA 3BFCA 1L0OC 5B5EC 1DJCA 3N8LA 4PZJA 2NXNB 3MQ0A 1JGSA 2ZQDA 4LLGF 2Y2QA 3L2WA 2VC0A 3JYIA 4K91A 4C3JJ 1XGMA 1MMDA 3OPRA 2KRHA 5E2EA 3ABTA 3VE3A 1BW6A 1MIJA 4AIKA 2KL4A 1STZA 2LSOA 4I98B 1ZN2A 3CDHA 1IYOA 2YU9J 3KYLA 4G6TB 2FF4A 1BJAA 4IRIA 1MWTA 2EFXA 2QSGX 3ZQIA 3QP5A 5GPAA 1ACIA 3BG3A 2QQ9A 1DRMA 4X1MA 4D0PA 3C5AA 1RP5A 1S0WA 3BG9A 4EEPA 3M8FA 2XVCA 2LKSA 1RR7A 5FAQA 1OFCX 1V4RA 4ANJA 3CJQB 3LSKA 1IG7A 2VIXA 4OPRA 5DD4A 1IUFA 2WAQA 2Q8KA 1YT4A 3E7LA 1Y4OA 4I99C 4DZJA 2LB5A 2XB0X 4I0BA 1OCOH 2GBYA 1LSVA 4UNOA 3RZDJ 1D8KA 5FEFA 1SFEA 3NY4A 2HYJA 2ZC5B 2VT3A 3K4JA 4EUZA 3IBRA 3CMYA 1G68A 1ON2A 2FRHA 2MABA 3CTAA 5FJ8J 3JTHA 4BBRJ 5JHUA 1HVBA 2XFSA 1R6RA 4L0ZB 3M3YJ 5A2QK 2ZL1B 3RPUA 1BW5A 2Z6DA 2V8CA 4G3VA 1QHHD 1JVJA 2EPFA 3TOIA 4F3LA 4CYCB 3FXJA 3W2AA 2W27A 2PBIA 5FKLA 1FT9A 3K3DA 4S04A 3QRFF 4S2NC 1NLZA 1T0FC 1V5FA 3WTUC 2GAUA 5E2HA 3ZVWA 5DVAA 4XKVA 1YLJA 1ETKA 3ABKH
chains in the Genus database with same CATH topology
1G6OA 1LSWA 1TNSA 3JAMK 2K4JA 1QZZA 1FBUA 4LD5A 2ZBKA 3EETA 3EDPA 2H6CA 1BI2A 5F6FA 1SFUA 2PR5A 4KIFA 4M71A 3G73A 5JVTA 5E1WA 1KQ9A 2M8EA 5E20A 4ME4A 4BHBA