2HDRA

Ampc beta-lactamase in complex with 4-amino-3-hydroxybenzoic acid
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Deconstructing fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 110
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2hdrA00
3FKVA 4OP8A 5EE8A 4OPYA 1E25A 1KE3A 4X56A 4C3QA 3W8KA 4B88A 1PWCA 1YM1A 1S6RA 1K57A 2Q9NA 4IBRA 3IH9A 4PM6A 4MBHA 4E6WA 4D2OA 5FAOA 3QNCA 1FCNA 5EECA 2Y2JA 4JXSA 1JTGA 3VFFA 1SKFA 1W79A 4OOLA 5HAIA 1PWGA 4FSFA 1GHPA 4KG5A 2IWBA 3UDXA 1ERMA 3UNWA 4QY6A 1IKIA 3DWZA 3NDEA 5A92A 4OQGA 2BG1A 4U3TA 1I5QA 1M6KA 4S2OA 3EQUA 3WWXA 2RL3A 3VSKA 3N8LA 4JF5A 5BOHA 4U0TA 3A3FA 2EFXA 5HL1A 2ZC7A 1DY6A 5AQ9A 4ZJ3A 5HAPA 4B4XA 1PZOA 5KSCA 3BFFA 4QJGA 1L2SA 3N7WA 5A93A 4RYEA 4NETA 1M40A 1ALQA 4BENA 4OP5A 3OCNA 4X69A 2WKEA 1G68A 3IF5A 2EFUA 5F1FA 5G18A 3AGEA 3E2KA 1N4OA 4P0MA 3Q7VB 4GB7A 4H8RA 4L0LA 2I72A 3HLGA 3FWLA 1XPBA 4S2MA 1K54C 5DTKA 5AQ7A 5GLBA 3UO9A 3N4IA 1KGEA 5FQJA 1MWSA 3WRZA 4LV0A 4OOYA 3M6HA 1I2SA 3NIAA 2J7VA 2H10A 1YLJA 4ZAMA 3WS5A 2EX9A 1KE4A 1L0FA 2WZZA 2ZM0A 5JYPA 4KQOA 1NRFA 4CPKA 3PBRA 3WRTA 3BFGA 3TSGA 3GTCA 2XD1A 1ES4A 2HDQA 3BRMA 3GMWA 4QY5A 2R9XA 3MFDA 5D3OA 3AGDA 3Q7VA 4X53A 4K0WA 4XUZA 4N92A 3G31A 3MKFA 5HARA 4KZBA 2XQZA 4PM8A 3Q07A 1Q2QA 2EXBA 2Y55A 5CEDA 3FZCA 5EVID 1K56D 5CHJA 4WEKA 5HX9A 4E3MA 1XGJA 2WGVA 4R3JA 5M1AA 1E3UA 4DE3A 3ZDJA 1YMSA 2Z2LB 1TVFA 3ZCZA 1PI5A 4GOGA 2HDRA 1JVJA 4XXRA 4KQQA 1FQGA 4EBLA 5FI6A 4HESA 4K91A 5F1GA 1HZOA 1BZAA 5FSRA 1S0WA 2ZM8A 5FQIA 3N6IA 2Q9MA 4GN2A 1H8YA 1EROA 3RXWA 4KZ9A 3VP4A 2ZQDA 1RP5A 3BECA 5DF7A 4Z9QA 5EOEA 1LI9A 2V2FF 1K38A 3ZNYA 1IKGA 3ZVWA 3ZG7B 4GD8A 2HP6A 2ZC5B 3C4OA 4E3KA 2OV5A 1PW8A 2C6WB 2UWXA 3UDIA 2P9VB 3VP1A 3ZVTA 4C6YA 4LENA 1K57C 2XFSA 4EV4A 5CECA 3GRJA 3IXBA 2WK0A 4N1HA 5EVIB 4PM9A 2Y2GA 3OCLA 2ZJ9A 3QNBA 3A3EA 3BFDA 1MPLA 4OLDA 1YLYA 4Y0UA 3S1YA 3NY4A 1LHYA 4FD8A 2P9VA 2Y91A 3FV7A 3IXDA 3PBOA 2WUQA 3RJUA 3OPPA 4Y0TA 3HLEA 4U0XA 1CK3A 3PBSA 3G30A 5IHVA 4E3LA 1U60A 4EBNA 4WYYA 1SDEA 1SDNA 3IQAA 4R0QA 4EBPA 5E2HA 2VGJA 1IYSA 1NYMA 4LV3A 4KZ3A 4WMCA 2XD5A 3CG5A 5FAPA 2Y4AA 5CGSA 4O7DA 1O7EA 2Y2MA 5FI7A 3V5MA 3ZFZA 5CXWA 3MKEA 5FQKA 1K6SA 4ZTKA 4RVAA 5DTSA 1GHIA 3MXSA 4S2PA 3B3XA 5HAQA 2EX2A 3VMAA 2E8IA 3UN7A 4F94A 3IWIA 1ESIA 3GVBA 2Y2NA 1AXBA 1K4FA 3MBZA 2IWCA 4JBFA 4BJPA 2BLSA 3PBNA 4YFMA 2X01A 3O88A 2PU4A 2QZ6A 1N9BA 2EXAA 5J8XA 3SH7A 3C7UA 4KZ7A 2ZMAA 4A5RA 3MZDA 2ZLYA 2JCHA 4BLMA 2J8YA 2VGKA 4GKUA 3Q81A 1C3BA 2DNSA 4YINA 1Z6FA 1KGGA 1IEMA 5CGWA 1DJBA 2WGIA 4QU3A 3ZHHA 4GDNA 4OQHA 1L0GA 1FR1A 5GHZA 5CRFA 2ZQ8A 4OQ0A 4OLGA 3VP0A 3SS3A 4DDYA 3HLFA 1QMFA 2JBFA 5A90A 1DJAA 3VOYA 2JC7A 4OOMA 4BL3A 1PWDA 1EWZA 4GNUA 3A3DA 3C7VA 2G2WA 5KZHA 4BL2A 1PI4A 2B5RA 5CHMA 3UY6A 3NC8A 3UE1A 4P87A 3SS5A 4E3IA 1KVLA 2H0TA 4JXWA 3N8RA 3V3RA 4UAAA 1NZUA 2WKHA 4QD4A 1I2WA 3CJMA 1GCEA 1L0EA 2A3UA 1QMEA 3LO7A 5FATA 4K0XA 4X68A 4OPQA 4LCMA 4MBKA 3E2LA 1IYPA 4Y7PA 2C5WB 1PIOA 4DDSA 1ZKJA 5EOOA 1ONGA 3BLMA 1FOFA 1ES5A 1WYBA 3UPOA 4GZBA 5M19A 3HVFA 1XXMA 3QHYA 3IT9A 4KG2A 1BUEA 1BLHA 2X71A 5GHXA 4B4ZA 3TOIA 3OPHA 4UA7A 5JYOA 3ITBA 2J9PA 2ZQ9A 3S22A 1YT4A 3G4PA 4BQMA 2XEPA 3Q82A 3UE0A 1RGYA 3V3SA 3IHBA 2V20A 3ZG8B 4IBXA 2ZM2A 3BYDA 3ZG0A 4BD1A 3JYIA 4JF4A 3P09A 3ZGAB 4DE0A 3W4OA 2ZQ7A 1WE4A 4GDBA 4KZ5A 4WEJA 5CTNA 3D4FA 4ZJ2A 1K6RA 4KQRA 3M2JA 4R3BA 1IYOA 3OZHA 1XA1A 1MXOA 3G35A 4E3OA 4NK3A 3RXXA 5GHYA 1BTLA 1NYYA 4P85A 1ESUA 2XGNA 4JF6A 3BFEA 4N9KA 2GDNA 5CHUA 3M2KA 4UHUA 5HFOA 1WYCA 2ZQAA 1YLPA 3G32A 1IYQA 3HUNA 1W8QA 2J9OA 2PU2A 4KENB 4PPRA 4WZ5A 3VSLA 1YQSA 4CJNA 2A49A 2WAEA 1CEFA 3G2YA 3Q1FA 4R23A 1GHMA 5TR7A 4Y0OA 3HLWA 4MEZA 4QB8A 3FKWA 3OC2A 2IWDA 3W4QA 3IF6B 4DRTA 4E6XA 3LY4A 2WAFA 4S2IA 3OPLA 2WKIA 3VOZA 4KZAA 1ZG6A 1BLPA 1ONHA 5EVIA 2Y59A 2HDSA 4RX3A 3WS0A 3ZG5A 2ZD8A 2WYXA 4MLLA 5TFQA 1W5DA 5GLCA 3Q7ZA 1GA0A 2DRWA 2ZQCA 1TEMA 1FR6A 5E2GA 3WS2A 3IXHA 1HVBA 1K4EA 5FI2A 4UA9A 2HP5A 1ES2A 3IH8A 1XKZA 3N8SA 3ZG9B 3O87A 4DXCA 2P74A 1KVMA 1G6AA 3IF6A 4IEDA 3WS1A 4IVKA 1KDWA 3HBRA 5GLDA 3MZEA 4JXGA 3CMZA 2RCXA 3M6BA 3G2ZA 5FA7A 5DF9A 1ERQA 1ES3A 3FYZA 1K55A 4XUXA 4X55A 5KSHA 5FQ9A 1BULA 2XH9A 2XK1A 4JLFA 1K25A 3IWOA 4JKTA 3DW0A 1PZPA 1W7FA 3SOIA 4S2NA 4RA7A 5E43A 2WGWB 1LL9A 2XDMA 3DTMA 3A3JA 4OH0A 1KE0A 3BFCA 3NDGA 4E3NA 1Q2PA 5FDHA 1KGFA 4OQIA 4EQIA 1FCMA 1E3UD 1SCWA 3PAGA 4HBUA 4JXVA 4MNRA 4DF6A 4N1XA 4S2KA 1J9MA 1L0DA 3S4XA 4R4SA 4WBGA 5DVAA 3PTEA 5FQQA 4OONA 2X02A 5EVLA 4BD0A 4LV2A 4FCFA 2Y2IA 4WM9A 2WGWA 5DF8A 5CEBA 5F82A 3C4PA 4OVDA 3EQVA 2WADA 3SS4A 3V50A 5GLAA 4KZ8A 5CTMA 1JTDA 1FSYA 3AGFA 5CERA 1XA7A 4LCLA 2V1ZA 4WELA 2QMIA 1BT5A 1GA9A 2EX6A 1FCOA 4OPZA 4S2JA 4E3JA 3IXGA 3PBTA 1YLZA 4EUZA 5FASA 1NXYA 1MWTA 3C5AA 1NY0A 4HBTA 3UPNA 2Y2HA 3DWKA 2OLVA 1BSGA 1XX2A 3O3VA 1TDGA 1BLSA 4GD6A 3MZFA 2HP9A 1LI0A 1LLBA 3NBLA 1NZOA 5U47A 2Y2KA 3A3IA 5M18A 5I94A 3ITAA 4KZ4A 1W8YA 2QPNA 3IHAA 1MY8A 5DTTA 5E2EA 1KDSA 3LCEA 3OPRA 4PM7A 1MBLA 2HDUA 4N9LA 3HUMA 3G34A 4Q8IA 1TDLA 2FFYA 3UDFA 2H5SA 4WZ5C 1YLWA 2ZC3B 1CI8A 1ZG4A 5EUAA 3SH9A 3BLSA 1XP4A 4R4RA 2Y2PA 2CC1A 4X6TA 4DXBA 5GL9A 1XGIA 3W4PA 3VP2A 5FQMA 2FFFB 2G2UA 5F83A 5FAQA 1K54A 4M3KA 1IELA 2XR0A 5AQAA 1Y54A 4KZ6A 4KG6A 4WMCD 2OLUA 5KMWA 4ZJ1A 3VP3A 1YMXA 5CGXA 5AQBA 4RX2A 4ID4A 5EVIC 3VFHA 4FH2A 4S2LA 1CI9A 1EI5A 3ISGA 3UPPA 1JWPA 2EX8A 1OMEA 2JE5A 2WZXA 2XFTA 1H5XA 2Z2MB 2R9WA 1CEGA 1H8ZA 3GR2A 1JWVA 3SH8A 4JPMA 3IWQA 2ZC4B 4FH4A 4QHCA 3IF6C 1MWUA 4P6BA 5E2FA 3P98A 3ZNTA 4DE1A 3PAEA 3UE3A 4DE2A 4PM5A 4OKPA 2Y2OA 2Y2QA 1PW1A 4IVIA 5EPHA 5HW3A 2H0YA 1MKIA 1K55C 1HTZA 3V39A 1O07A 5L2FA 1MWRA 3HREA 1ZC2A 4C75A 1VM1A 2OSUA 4HEFA 3NI9A 4EWFA 1VQQA 2PBYA 3BEBA 4MBFA 4DKIA 4S2NC 1K56A 2Y2LA 1SHVA 3HL9A 1DJCA 2HPBA 2DCFA 3HLCA 5TGFA 1LL5A 3NCKA 4PMAA 1E4DA 2XLNA 1NJ4A 3O86A 4UA6A 3HLBA 3CZDA 1RCJA 1RGZA 4WZ4A 5A91A 2ZC6B 3GV9A 1HD8A 4ZBEA 4LV1A 2XF3A 1JWZA 3LEZA 3GSGA 3MXRA 4OPRA 3LY3A 1PYYA 3TG9A 1YLTA 3WS4A 3GQZA 1BLCA 3HUOA 3I7JA 3PBQA 1FSWA 4ZDXA 4R1GA 3BM6A 3HLDA
chains in the Genus database with same CATH superfamily
2O9BA 5EE8A 4CLCC 4KQDA 4D2OA 2PYPA 5FAOA 3T4JA 1W63M 1JTGA 4B93A 1W79A 4OOLA 3D72A 1PWGA 2V8FA 2W3GA 2IWBA 3UDXA 1IKIA 3DWZA 3C38A 2B95A 4R70A 2BG1A 3RTYA 3WWXA 5F5YA 2ZL1B 5BOHA 5HAPA 4B4XA 1PZOA 3BFFA 3N7WA 4YNRA 1ALQA 4X69A 3OCNA 3IX4A 3Q7VB 2FZ0A 4L0LA 4S2MA 5DTKA 1K54C 3UO9A 3WRZA 1I2SA 2ZM0A 5JYPA 4KQOA 4Y3IA 3PBRA 3TSGA 3E0YA 5F1FA 2HDQA 3GMWA 1AWIA 3MFDA 4MN7A 3AGDA 1P97A 4XUZA 3G31A 3SZTA 1G5UA 1TF1A 4WEKA 5HX9A 2XSSA 3F1OB 1E3UA 3ZCZA 1FQGA 5FI6A 4HESA 1XJ2A 1BZAA 5FSRA 3PXPA 1S0WA 2ZM8A 5FQIA 2Q9MA 4Y15A 1EROA 3RXWA 1RP5A 5DF7A 5EOEA 1LI9A 2V2FF 5KIZA 5IT5A 4UQIS 3UB9A 1IKGA 4GD8A 2HP6A 3C4OA 3VP1A 4EV4A 2PR6A 3CPTB 2WK0A 1DRMA 3NOPC 3OCLA 3BFDA 4WN5A 1YLYA 1OTIA 3OLOA 2Y8HA 1LHYA 5J7EA 4Y0TA 3G30A 3KYQA 4HY8A 4WYYA 4EBPA 1IYSA 4LV3A 2VZWA 3CG5A 5CGSA 2Y2MA 5FI7A 5FQKA 2VJWA 4RVAA 3MXSA 4S2PA 5HAQA 1AXBA 3IX3A 4JBFA 2IWCA 1FILA 4BBUA 1MKMA 2BLSA 2X01A 3O88A 2QZ6A 2ZMAA 2JCHA 2VGKA 3ULFA 4QU3A 3ZHHA 4OQHA 1L0GA 1FR1A 2HF6A 3EOIA 5CRFA 4CLCE 2ZQ8A 3LR3A 2VGLM 3HLFA 2ZL1A 1QMFA 2JBFA 3VOYA 2JC7A 4OOMA 3A3DA 5FDSA 4ETXA 2WKRA 2OAQ1 3B42A 3SS5A 2H0TA 3KSGA 1K0KA 3V3RA 2WKHA 3LYXA 2PT7A 3LUQA 4MBKA 3E2LA 1IYPA 4Y7PA 1PIOA 4ETZA 1ZKJA 1ES5A 3UPOA 3HVFA 3QHYA 3IT9A 4KG2A 1BUEA 1BLHA 3TOIA 4YOFA 4BMWA 3ITBA 2J9PA 3LIFA 4ESPA 2OOLA 3F1OA 3UE0A 4IBXA 3ZG0A 4BD1A 3JYIA 4UEYA 4JF4A 3IS2A 3W4OA 1WE4A 4WEJA 1TS6A 1F5MA 3MR0A 1MXOA 1ACFA 1NYYA 4P85A 2HV1A 3BFEA 3M2KA 1W8QA 2J9OA 4WZ5A 3LEQA 4CJNA 3T1XA 2WAEA 1CEFA 4JGOA 4X1MA 3UMDA 4Y0OA 3HLWA 4MEZA 5HDCA 3FKWA 3OC2A 2IWDA 5EV0A 3IF6B 4DRTA 2E8JA 1ZG6A 2HDSA 4MLLA 5GLCA 4RQ9A 2DRWA 2ZQCA 3WS2A 3H9WA 4UA9A 2HP5A 2KLIA 5AVFA 3O87A 2P74A 1NLYA 2INWA 5GLDA 2A2LA 3CMZA 3LR0A 3M6BA 1OPXA 4PAUA 1ES3A 1K55A 4X55A 5KSHA 4Q0HA 1Y4OA 3C8CA 1W7FA 2W3DA 4RA7A 2WGWB 3DTMA 1KE0A 1BYWA 3BFCA 4H6JA 1KGFA 4OQIA 2GNXA 4JXVA 3EEHA 4DF6A 1L0DA 3FPVA 4R4SA 2ZBBA 2GZAA 4Q0JA 2Y2IA 4WM9A 5CEBA 1P9RA 5F82A 4WL9A 1FSYA 3KYZA 1XA7A 4GCZA 4F3LB 2EX6A 3GECA 4S2JA 3PBTA 1NXYA 3HCYA 4Y13A 2Y2HA 2OLVA 3O3VA 2PD8A 3F1NB 1NZOA 2Y2KA 4L9EA 5I94A 3H82B 4DJ3A 1N9OA 2HDUA 4N9LA 1TDLA 3S7OA 2L4RA 1YLWA 2ZC3B 1CI8A 1ZG4A 3TW8A 1XP4A 4X6TA 2CC1A 3LIDA 1XGIA 3QP4A 2G2UA 5F68A 4HP9A 3JVUA 5AQAA 1Y54A 4KZ6A 4WMCD 5CGXA 4RX2A 3JVVA 1OMEA 2EX8A 2JE5A 1CEGA 3IWQA 2ZC4B 4P6BA 3P98A 4DE2A 4OKPA 1DP8A 5EPHA 5HPFA 3V39A 3MSHA 4I5SA 1LL8A 2PBYA 3BEBA 4DKIA 4S2NC 1DJCA 2DCFA 1LL5A 4PMAA 1NJ4A 1SZVA 3HLBA 1FIKA 1V9YA 5F69A 2XF3A 1JWZA 3LEZA 3GSGA 3MXRA 3LY3A 3GQZA 1BLCA 1FSWA 4R1GA 4OP8A 1E25A 1KE3A 4C3QA 4B88A 1S4RA 3MMHA 3NHQA 3IH9A 4PM6A 4PKYA 4E6WA 2GX5A 4Y17A 5EECA 3D9YA 2NUTC 4JXSA 3VFFA 5HAIA 3NECA 2PRFA 5HWVA 3UNWA 1Z09A 5A92A 4U3TA 2ZOIA 5TBMA 2RL3A 3VSKA 5HL1A 2XA7S 4HH2A 1M40A 4BENA 4OP5A 2PDRA 3IF5A 5G18A 3AGEA 1N4OA 1S4SA 5FQJA 3NIAA 2H10A 3WS5A 2L1MA 3CUEC 2W1TA 5EVEA 4CPKA 4F3LA 3WRTA 3BFGA 3ICYA 4QY5A 2GJ3A 4X53A 3LIEA 4PM8A 1T1AA 2EXBA 1K56D 2EWWA 4DJ2A 4E3MA 2PD7A 1XJ6A 2WGVA 5M1AA 2Z2LB 3DTIA 4P6ZS 4XXRA 4KQQA 5L09A 3BECA 4NXGA 1D7EA 3ZNYA 3ZVWA 5DKLA 5K5BA 1K57C 3MQOA 4WF0A 2D02A 4PM9A 5IU1A 2W1RA 3A3EA 3T50A 2O9CA 1MPLA 3NY4A 4EXOA 2WUQA 3OPPA 2ZOHA 3HLEA 1CK3A 2FH5A 3VE4A 3PBSA 5IHVA 4E3LA 5A8BA 1U60A 1SDNA 1S1YA 4WMCA 3EGDC 1O7EA 1K6SA 3RH8B 1GHIA 5FEGA 3OOVA 4BBTA 2E8IA 1PRQA 2M1CA 4II7A 3MBZA 4WUJA 5MC7A 1IFQA 4YFMA 4Y2FA 1T1BA 2EXAA 1UGUA 5DFXA 3V67A 4KZ7A 4A5RA 2ZLYA 2J8YA 4GHIA 2DMWA 3Q81A 1C3BA 4R3AA 1IEMA 3KO6A 4CLCB 1DJBA 2JN7A 4JGPA 1VB6A 4LRYC 2I9VA 2QYBA 5L10A 4OLGA 3VP0A 3SS3A 4DDYA 3S7PA 2M7VA 2JKTM 1EWZA 4GNUA 3QP2A 3C7VA 2G2WA 5KZHA 1PI4A 2B5RA 5CHMA 3UY6A 4EERA 2QHKA 4E3IA 5J4EA 1OTDA 3IX8A 1T19A 4CQHA 2VX8A 1NZUA 3E4QA 4QD4A 1GCEA 3LO7A 5FATA 4O0PA 2PHYA 4LCMA 2MJ6A 2C5WB 3QP1A 1ONGA 3BLMA 5HL6A 5M19A 1XXMA 4ME4A 3IS2B 1F9IA 3L9KA 3V3SA 4MCWA 2YKHA 3QP5A 3M2JA 3G6OA 4NK3A 5GHYA 1BTLA 4JF6A 3VSLA 3HUNA 4KENB 1YQSA 1XJ3A 3LGOA 1UWNX 4R23A 4NKPA 1GHMA 4K08A 2VEAA 4XT2A 3K3DA 4E6XA 4S2IA 5HDDA 3R4KA 1BLPA 1ONHA 1YPRA 4RX3A 3ZG5A 3U4LP 1W5DA 2Z6CA 3IXHA 2ACGA 1OJGA 1XKZA 3QP8A 1KVMA 4HJ4A 3WS1A 4IVKA 3HBRA 3MZEA 3T1RA 4H6JB 2V1BA 5FA7A 1SKOB 5FQ9A 4Z1WA 1BULA 2XH9A 1K25A 4R6LA 3TRCA 4JKTA 5E43A 3A3JA 4KUKA 3NDGA 4I38A 5FDHA 1FCMA 1SCWA 3PAGA 4HBUA 4S2KA 1J9MA 4WBGA 4GLQA 3U2AA 5DF8A 4FCFA 4BD0A 4QPRA 3EQVA 2YKFA 4CLCA 4PHTA 1D1JA 4DMZA 3AGFA 5CERA 4MMNA 1CQAA 2QMIA 1BT5A 1FCOA 4OPZA 3IXGA 4EUZA 1YLZA 3C5AA 1MWTA 2R78A 1G6OA 2V9AA 1TDGA 4G3VA 3MZFA 1L3LA 2PYRA 4KZ4A 3IBJA 1MY8A 3LCEA 3NOTC 2XROA 4JGQA 4Q8IA 2FFYA 2JHEA 3K3CA 3SH9A 3BLSA 4O8GA 5GL9A 5FAQA 2UV0E 1K54A 1XFQA 1IELA 4ZJ1A 1YKDA 5AQBA 5EVIC 5LBRA 3VFHA 4FH2A 4FOFA 5EM1A 2VKSA 2XFTA 3GR2A 2Z2MB 4FH4A 4QHCA 3IF6C 3ZNTA 4IHQA 1WA9A 3BJNA 4PM5A 5HWTA 5HW3A 4BBVA 3NOUC 3HJKA 1O07A 5L2FA 2OAP1 1MWRA 2CMNA 2OSUA 2G7UA 3NI9A 4MN6A 4MBFA 2Y2LA 3HLCA 3B33A 3O86A 4HQAA 2HJ9C 2P04A 3CZDA 1RGZA 2W3HA 3GV9A 3T4QA 1HD8A 2V0UA 4OPRA 3WS4A 3PBQA 4E04A 2KX6A 3I7JA 3FKVA 4X56A 4IBRA 1G28A 4NXEA 3LIBA 1Y28A 5TBMB 3QNCA 1FCNA 4LRZE 4NEED 4FSFA 1LSWA 1SKOA 4HJ6A 3P01A 1ERMA 3A0RA 2W3FA 4OQGA 1PFLA 4JF5A 3A3FA 5HPIA 2W1TB 1L2SA 4QJGA 1NLZA 2JKRI 2WKEA 1G68A 2EFUA 2ZMFA 3E2KA 1T18A 4GB7A 3VV4A 4H8RA 2I72A 5GLBA 5AQ7A 3N4IA 5DJUA 3EGXC 2VGLS 2EX9A 1KE4A 1L0FA 4ARZA 1NRFA 4MDZA 3LR5A 5D3OA 2XD1A 3BRMA 4K0WA 1YSPA 2BTFP 3T4OA 4DN0A 4KZBA 3Q07A 5HSQA 3KSHA 5CHJA 1MC0A 1XGJA 3K2NA 4R3JA 4HHDA 2JKGA 2VLGA 1YMSA 2M7UA 4GOGA 5FL3A 1JVJA 3TJZC 1HZOA 2J3TD 3N6IA 3BQ8A 4GN2A 1H8YA 4KZ9A 2ZQDA 4EQ1A 4Z9QA 2J3TC 1VHMA 4O01A 4I3AA 3B47A 1W63Q 2ZC5B 2OV5A 1PW8A 2C6WB 2UWXA 3UDIA 2L0WA 4C6YA 3SW1A 1V9ZA 4N1HA 3PHYA 3FPWA 3UB5P 2J3WA 2QJ7A 2ZJ9A 3QNBA 3E98A 1X0OA 4OLDA 3S1YA 4I3IA 2P9VA 3RJUA 4U0XA 2OWHA 4EBNA 1VETB 1SDEA 4R0QA 1HLUP 2VGJA 1LT0A 1NYMA 4KZ3A 2XD5A 3CITA 2Y4AA 3DTEA 3V5MA 3ZQ5A 1OT6A 3F1PB 1TD5A 4GHIB 2EX2A 3VMAA 3UN7A 4F94A 3T1SA 4MN5A 1UWPX 2Y2NA 4BJPA 3LR4A 5J3WA 3C2WA 3SH7A 3C7UA 3MZDA 1LSVA 4BLMA 4GKUA 3QP6A 1Z6FA 1KGGA 5CGWA 2OWJA 4EU0A 2WGIA 5GHZA 4QWOA 2VA0A 4OQ0A 1VEUA 5A90A 2EWVA 5HZHA 5DJTA 4BL2A 3NC8A 4JXWA 3N8RA 1I2WA 5HD5A 3TE8A 4K0XA 3T4LA 2O0YA 2VV6A 5EOOA 1FOFA 4GZBA 3H7WB 4HI4A 2ZQ9A 1MZUA 4I39A 1YT4A 4UQIM 4BQMA 1TS0A 1RGYA 3ZG8B 1ZTUA 3BYDA 4NG2A 4G3KA 3P09A 4JGRA 2ZQ7A 3PR6A 4KZ5A 4XT2B 2LB9A 3D4FA 4R3BA 3MXQA 1XA1A 1NWZA 3G35A 4WLAA 3RXXA 3T4SA 2XGNA 4N9KA 2GDNA 2VV7A 1WYCA 5HFOA 1XJ4A 4PPRA 1IYQA 4IUKA 3DTKA 2PU2A 3DAVA 2A49A 3G2YA 3CWFA 4LRXC 2WKIA 2H28A 4HH3A 2Y59A 5TFQA 3Q7ZA 1GA0A 4FUWA 5E2GA 1CF0A 1HVBA 3KX0X 5FI2A 3E4OA 1ES2A 3N8SA 3ZG9B 1G6AA 1KDWA 4G3WA 3G2ZA 4PKYG 2P7JA 4XUXA 2EA9A 3VOLA 1VETA 3A0SA 2XK1A 4JLFA 3IWOA 3BW6A 1PZPA 3SOIA 4S2NA 3F1PA 2XDMA 4IJGA 1YAXA 4EQIA 4N1XA 3S4XA 5G4YA 1EW0A 1D06A 1OTAA 1XFNA 3O5YA 5FQQA 4OONA 5EVLA 4LV2A 2PAVP 3S7NA 2WADA 1P9WA 3V50A 5GLAA 5G4ZA 2B18A 4LCLA 2V1ZA 4WELA 2NUPC 2A24A 1NY0A 1ODVA 4KUOA 4Y5FA 1OJ5A 1BLSA 4GD6A 3NBLA 2Q0OA 4D60A 5U47A 3ITAA 5DTTA 5E2EA 3G34A 3MF0A 3LICA 2H5SA 4WZ5C 2AVXA 5EUAA 2Y2PA 4DXBA 3VP2A 2FFFB 5F83A 2ZMVA 5HDSA 4KG6A 3CUEA 3H7WA 1YMXA 5TJJA 5IS1A 1EI5A 3UPPA 1JWPA 2VK3A 2VV8A 1H8ZA 2W27A 3JPUA 1JWVA 4DE1A 5E2FA 3PAEA 4NXBA 5HD3A 2Y2OA 1KOUA 2Y2QA 1PW1A 4IVIA 3CLOA 1MKIA 1K55C 1HTZA 4C75A 1OTEA 4X25A 4EWFA 4YWZA 1VQQA 1GSVA 3MQQA 1K56A 5I5LA 1H8MA 3HL9A 2HPBA 2O9AA 3NCKA 2XLNA 4L9GA 3IBRA 3MFXA 2D01A 2V1AA 5A91A 2ZC6B 5C5KA 4ZBEA 2KDKA 2PR5A 3UB8A 1F2KA 1PYYA 4ZDXA 4OPYA 3W8KA 1PWCA 2JKFA 1YM1A 1S6RA 1K57A 2QKPA 2Q9NA 4MBHA 3CAXA 4LGWA 2Y2JA 4L9FA 2O99A 1SKFA 3KYEA 1GHPA 5EM0A 4KG5A 4QY6A 3ZYTA 3UB6A 3NDEA 4HIAA 1I5QA 1M6KA 4S2OA 3HJIA 3EQUA 2B02A 3DBAA 3N8LA 4U0TA 2EFXA 3RFBA 4ARZB 5DFYA 2ZC7A 1DY6A 5AQ9A 4ZJ3A 2J80A 5KSCA 5A93A 4FTXA 4RYEA 1JNUA 4NETA 5FEFA 1OT9A 5HWWA 4P0MA 4LPZA 3HLGA 3FWLA 1XPBA 1KGEA 1MWSA 4LV0A 4OOYA 3CI6A 3M6HA 2J7VA 1YLJA 4ZAMA 2QJ5A 2WZZA 4IUHA 4HNBA 1YSQA 1DP6A 2Z6DA 3GTCA 1ES4A 3FG8A 2R9XA 3Q7VA 4LLOB 4N92A 3EEAA 1S1ZA 3MKFA 3NULA 5HARA 2XQZA 1Q2QA 2Y55A 5CEDA 3FZCA 5EVID 2Y79A 2K31A 4DE3A 3ZDJA 1TVFA 1PI5A 2HDRA 4EW7A 4EBLA 4K91A 5F1GA 2V8CA 5CX7A 4HP4A 1P0ZA 3VP4A 1K38A 3ZG7B 4E3KA 5KMWA 3ZVTA 2P9VB 4LENA 5CECA 2XFSA 3GRJA 3IXBA 3C30A 2WKQA 3KSIA 5EVIB 1S67L 2WKPA 2Y2GA 2LB5A 4Y0UA 3T4TA 2P08A 1PNEA 4GJ4A 4FD8A 3FV7A 2Y91A 3IXDA 2IA2A 3CPTA 3PBOA 1NRJA 1ZHHB 3CHWP 3BY9A 3IQAA 5E2HA 5FAPA 4O7DA 3ZFZA 1H0MA 5CXWA 3MKEA 4ZTKA 5DTSA 3B3XA 4GW9A 1GSWA 3IWIA 1ESIA 3GVBA 1K4FA 4I3JA 3PBNA 5AVEA 2PU4A 1VEUB 1N9BA 5J8XA 2XA7M 4BWIA 4GS9B 2DNSA 4YINA 4GDNA 3VE3A 3LI9A 4AFIA 3FC7A 1DJAA 4BL3A 1TS8A 2HGVA 1PWDA 2W0NA 2HJEA 2K7SA 4R38A 3UE1A 4P87A 1KVLA 4UAAA 4M4XA 1F98A 3CJMA 1L0EA 2A3UA 1QMEA 4X68A 4OPQA 4DDSA 1IOUA 4P6ZM 1GSXA 3T4KA 3T1QB 1WYBA 3R7WB 2X71A 4X1LA 5GHXA 4B4ZA 3OPHA 1A0KA 4UA7A 5JYOA 3S22A 3G4PA 2XEPA 3Q82A 4B9OA 3IHBA 2V20A 3BY8A 2ZM2A 3L7HA 2K2NA 3ZGAB 5L8MA 4DE0A 1CJFA 4GDBA 4EEUA 5CTNA 3BQAA 1K6RA 3OBFA 4KQRA 4ZJ2A 3E4PA 1IYOA 3OZHA 4E3OA 1TS7A 1ESUA 5F6AA 3W2ZA 3NJAA 5CHUA 4UHUA 2ZQAA 1YLPA 3G32A 3KSFA 1LSXA 3Q1FA 2JKRM 5TR7A 4QB8A 3W4QA 3EWKA 4LFUA 3LY4A 2WAFA 3VOZA 3OPLA 4KZAA 2BASA 2W3EA 3WS0A 5EVIA 1T1CA 2ZD8A 2WYXA 1TEMA 1FR6A 1K4EA 3IH8A 4DXCA 3PYPA 3IF6A 4IEDA 4EETB 1H3QA 4JXGA 2RCXA 5DF9A 3MQ0A 1ERQA 4NXFA 1N9NA 3FYZA 3DW0A 2QWSA 3MJQA 1LL9A 4OH0A 4E3NA 1Q2PA 3LI8A 4HOIA 1E3UD 3D3OA 1OTBA 4MNRA 5DVAA 3P7NA 3PTEA 3MS6A 2A24B 2X02A 2WGWA 4GS9A 4ZRRA 3C4PA 4OVDA 3GDIA 5L07A 3SS4A 4KZ8A 5CTMA 1JTDA 3LIAA 3BWLA 3UE6A 1GA9A 4E3JA 5FASA 4HBTA 2XRNA 3UPNA 3DWKA 4EEPA 1BSGA 1XX2A 4Q0IA 2HP9A 1J3WA 1LI0A 1LLBA 3A3IA 5M18A 2PBDP 1W8YA 2QPNA 3IHAA 1KDSA 3OPRA 4PM7A 1MBLA 3S7QA 3HUMA 5AJGA 3UDFA 4EUVA 4R4RA 3F1NA 3UB7A 3W4PA 5FQMA 3T12B 4M3KA 2XR0A 3A0VA 3H82A 3R7WA 2OLUA 3VP3A 4ID4A 3LFVA 4S2LA 1CI9A 1N9LA 4EESA 1DP9A 3ISGA 1S66L 2WZXA 1H5XA 2R9WA 3SH8A 4JPMA 1MWUA 3UE3A 2JKTI 2KOIA 2H0YA 1STZA 5EFWA 3HREA 1ZC2A 1VM1A 4HEFA 1SHVA 5TGFA 1E4DA 2V0WA 4UA6A 4WZ4A 1RCJA 4LV1A 3UMEA 4HJ3A 3TG9A 4CLCD 1YLTA 5DKKA 3HUOA 2HZ5A 3BM6A 3HLDA
chains in the Genus database with same CATH topology
3FKVA 4OP8A 5EE8A 4OPYA 1E25A 1KE3A 4X56A 4C3QA 3W8KA 4B88A 1PWCA 1YM1A 1S6RA 1K57A 2Q9NA 4IBRA 3IH9A 4PM6A 4MBHA 4E6WA 4D2OA 5FAOA 3QNCA 1FCNA 5EECA 2Y2JA 4JXSA 1JTGA 3VFFA 1SKFA 1W79A 4OOLA 5HAIA 1PWGA 4FSFA 1GHPA 4KG5A 2IWBA 3UDXA 1ERMA 3UNWA 4QY6A 1IKIA 3DWZA 3NDEA 5A92A 4OQGA 2BG1A 4U3TA 1I5QA 1M6KA 4S2OA 3EQUA 3WWXA 2RL3A 3VSKA 3N8LA 4JF5A 5BOHA 4U0TA 3A3FA 2EFXA 5HL1A 2ZC7A 1DY6A 5AQ9A 4ZJ3A 5HAPA 4B4XA 1PZOA 5KSCA 3BFFA 4QJGA 1L2SA 3N7WA 5A93A 4RYEA 4NETA 1M40A 1ALQA 4BENA 4OP5A 3OCNA 4X69A 2WKEA 1G68A 3IF5A 2EFUA 5F1FA 5G18A 3AGEA 3E2KA 1N4OA 4P0MA 3Q7VB 4GB7A 4H8RA 4L0LA 2I72A 3HLGA 3FWLA 1XPBA 4S2MA 1K54C 5DTKA 5AQ7A 5GLBA 3UO9A 3N4IA 1KGEA 5FQJA 1MWSA 3WRZA 4LV0A 4OOYA 3M6HA 1I2SA 3NIAA 2J7VA 2H10A 1YLJA 4ZAMA 3WS5A 2EX9A 1KE4A 1L0FA 2WZZA 2ZM0A 5JYPA 4KQOA 1NRFA 4CPKA 3PBRA 3WRTA 3BFGA 3TSGA 3GTCA 2XD1A 1ES4A 2HDQA 3BRMA 3GMWA 4QY5A 2R9XA 3MFDA 5D3OA 3AGDA 3Q7VA 4X53A 4K0WA 4XUZA 4N92A 3G31A 3MKFA 5HARA 4KZBA 2XQZA 4PM8A 3Q07A 1Q2QA 2EXBA 2Y55A 5CEDA 3FZCA 5EVID 1K56D 5CHJA 4WEKA 5HX9A 4E3MA 1XGJA 2WGVA 4R3JA 5M1AA 1E3UA 4DE3A 3ZDJA 1YMSA 2Z2LB 1TVFA 3ZCZA 1PI5A 4GOGA 2HDRA 1JVJA 4XXRA 4KQQA 1FQGA 4EBLA 5FI6A 4HESA 4K91A 5F1GA 1HZOA 1BZAA 5FSRA 1S0WA 2ZM8A 5FQIA 3N6IA 2Q9MA 4GN2A 1H8YA 1EROA 3RXWA 4KZ9A 3VP4A 2ZQDA 1RP5A 3BECA 5DF7A 4Z9QA 5EOEA 1LI9A 2V2FF 1K38A 3ZNYA 1IKGA 3ZVWA 3ZG7B 4GD8A 2HP6A 2ZC5B 3C4OA 4E3KA 2OV5A 1PW8A 2C6WB 2UWXA 3UDIA 2P9VB 3VP1A 3ZVTA 4C6YA 4LENA 1K57C 2XFSA 4EV4A 5CECA 3GRJA 3IXBA 2WK0A 4N1HA 5EVIB 4PM9A 2Y2GA 3OCLA 2ZJ9A 3QNBA 3A3EA 3BFDA 1MPLA 4OLDA 1YLYA 4Y0UA 3S1YA 3NY4A 1LHYA 4FD8A 2P9VA 2Y91A 3FV7A 3IXDA 3PBOA 2WUQA 3RJUA 3OPPA 4Y0TA 3HLEA 4U0XA 1CK3A 3PBSA 3G30A 5IHVA 4E3LA 1U60A 4EBNA 4WYYA 1SDEA 1SDNA 3IQAA 4R0QA 4EBPA 5E2HA 2VGJA 1IYSA 1NYMA 4LV3A 4KZ3A 4WMCA 2XD5A 3CG5A 5FAPA 2Y4AA 5CGSA 4O7DA 1O7EA 2Y2MA 5FI7A 3V5MA 3ZFZA 5CXWA 3MKEA 5FQKA 1K6SA 4ZTKA 4RVAA 5DTSA 1GHIA 3MXSA 4S2PA 3B3XA 5HAQA 2EX2A 3VMAA 2E8IA 3UN7A 4F94A 3IWIA 1ESIA 3GVBA 2Y2NA 1AXBA 1K4FA 3MBZA 2IWCA 4JBFA 4BJPA 2BLSA 3PBNA 4YFMA 2X01A 3O88A 2PU4A 2QZ6A 1N9BA 2EXAA 5J8XA 3SH7A 3C7UA 4KZ7A 2ZMAA 4A5RA 3MZDA 2ZLYA 2JCHA 4BLMA 2J8YA 2VGKA 4GKUA 3Q81A 1C3BA 2DNSA 4YINA 1Z6FA 1KGGA 1IEMA 5CGWA 1DJBA 2WGIA 4QU3A 3ZHHA 4GDNA 4OQHA 1L0GA 1FR1A 5GHZA 5CRFA 2ZQ8A 4OQ0A 4OLGA 3VP0A 3SS3A 4DDYA 3HLFA 1QMFA 2JBFA 5A90A 1DJAA 3VOYA 2JC7A 4OOMA 4BL3A 1PWDA 1EWZA 4GNUA 3A3DA 3C7VA 2G2WA 5KZHA 4BL2A 1PI4A 2B5RA 5CHMA 3UY6A 3NC8A 3UE1A 4P87A 3SS5A 4E3IA 1KVLA 2H0TA 4JXWA 3N8RA 3V3RA 4UAAA 1NZUA 2WKHA 4QD4A 1I2WA 3CJMA 1GCEA 1L0EA 2A3UA 1QMEA 3LO7A 5FATA 4K0XA 4X68A 4OPQA 4LCMA 4MBKA 3E2LA 1IYPA 4Y7PA 2C5WB 1PIOA 4DDSA 1ZKJA 5EOOA 1ONGA 3BLMA 1FOFA 1ES5A 1WYBA 3UPOA 4GZBA 5M19A 3HVFA 1XXMA 3QHYA 3IT9A 4KG2A 1BUEA 1BLHA 2X71A 5GHXA 4B4ZA 3TOIA 3OPHA 4UA7A 5JYOA 3ITBA 2J9PA 2ZQ9A 3S22A 1YT4A 3G4PA 4BQMA 2XEPA 3Q82A 3UE0A 1RGYA 3V3SA 3IHBA 2V20A 3ZG8B 4IBXA 2ZM2A 3BYDA 3ZG0A 4BD1A 3JYIA 4JF4A 3P09A 3ZGAB 4DE0A 3W4OA 2ZQ7A 1WE4A 4GDBA 4KZ5A 4WEJA 5CTNA 3D4FA 4ZJ2A 1K6RA 4KQRA 3M2JA 4R3BA 1IYOA 3OZHA 1XA1A 1MXOA 3G35A 4E3OA 4NK3A 3RXXA 5GHYA 1BTLA 1NYYA 4P85A 1ESUA 2XGNA 4JF6A 3BFEA 4N9KA 2GDNA 5CHUA 3M2KA 4UHUA 5HFOA 1WYCA 2ZQAA 1YLPA 3G32A 1IYQA 3HUNA 1W8QA 2J9OA 2PU2A 4KENB 4PPRA 4WZ5A 3VSLA 1YQSA 4CJNA 2A49A 2WAEA 1CEFA 3G2YA 3Q1FA 4R23A 1GHMA 5TR7A 4Y0OA 3HLWA 4MEZA 4QB8A 3FKWA 3OC2A 2IWDA 3W4QA 3IF6B 4DRTA 4E6XA 3LY4A 2WAFA 4S2IA 3OPLA 2WKIA 3VOZA 4KZAA 1ZG6A 1BLPA 1ONHA 5EVIA 2Y59A 2HDSA 4RX3A 3WS0A 3ZG5A 2ZD8A 2WYXA 4MLLA 5TFQA 1W5DA 5GLCA 3Q7ZA 1GA0A 2DRWA 2ZQCA 1TEMA 1FR6A 5E2GA 3WS2A 3IXHA 1HVBA 1K4EA 5FI2A 4UA9A 2HP5A 1ES2A 3IH8A 1XKZA 3N8SA 3ZG9B 3O87A 4DXCA 2P74A 1KVMA 1G6AA 3IF6A 4IEDA 3WS1A 4IVKA 1KDWA 3HBRA 5GLDA 3MZEA 4JXGA 3CMZA 2RCXA 3M6BA 3G2ZA 5FA7A 5DF9A 1ERQA 1ES3A 3FYZA 1K55A 4XUXA 4X55A 5KSHA 5FQ9A 1BULA 2XH9A 2XK1A 4JLFA 1K25A 3IWOA 4JKTA 3DW0A 1PZPA 1W7FA 3SOIA 4S2NA 4RA7A 5E43A 2WGWB 1LL9A 2XDMA 3DTMA 3A3JA 4OH0A 1KE0A 3BFCA 3NDGA 4E3NA 1Q2PA 5FDHA 1KGFA 4OQIA 4EQIA 1FCMA 1E3UD 1SCWA 3PAGA 4HBUA 4JXVA 4MNRA 4DF6A 4N1XA 4S2KA 1J9MA 1L0DA 3S4XA 4R4SA 4WBGA 5DVAA 3PTEA 5FQQA 4OONA 2X02A 5EVLA 4BD0A 4LV2A 4FCFA 2Y2IA 4WM9A 2WGWA 5DF8A 5CEBA 5F82A 3C4PA 4OVDA 3EQVA 2WADA 3SS4A 3V50A 5GLAA 4KZ8A 5CTMA 1JTDA 1FSYA 3AGFA 5CERA 1XA7A 4LCLA 2V1ZA 4WELA 2QMIA 1BT5A 1GA9A 2EX6A 1FCOA 4OPZA 4S2JA 4E3JA 3IXGA 3PBTA 1YLZA 4EUZA 5FASA 1NXYA 1MWTA 3C5AA 1NY0A 4HBTA 3UPNA 2Y2HA 3DWKA 2OLVA 1BSGA 1XX2A 3O3VA 1TDGA 1BLSA 4GD6A 3MZFA 2HP9A 1LI0A 1LLBA 3NBLA 1NZOA 5U47A 2Y2KA 3A3IA 5M18A 5I94A 3ITAA 4KZ4A 1W8YA 2QPNA 3IHAA 1MY8A 5DTTA 5E2EA 1KDSA 3LCEA 3OPRA 4PM7A 1MBLA 2HDUA 4N9LA 3HUMA 3G34A 4Q8IA 1TDLA 2FFYA 3UDFA 2H5SA 4WZ5C 1YLWA 2ZC3B 1CI8A 1ZG4A 5EUAA 3SH9A 3BLSA 1XP4A 4R4RA 2Y2PA 2CC1A 4X6TA 4DXBA 5GL9A 1XGIA 3W4PA 3VP2A 5FQMA 2FFFB 2G2UA 5F83A 5FAQA 1K54A 4M3KA 1IELA 2XR0A 5AQAA 1Y54A 4KZ6A 4KG6A 4WMCD 2OLUA 5KMWA 4ZJ1A 3VP3A 1YMXA 5CGXA 5AQBA 4RX2A 4ID4A 5EVIC 3VFHA 4FH2A 4S2LA 1CI9A 1EI5A 3ISGA 3UPPA 1JWPA 2EX8A 1OMEA 2JE5A 2WZXA 2XFTA 1H5XA 2Z2MB 2R9WA 1CEGA 1H8ZA 3GR2A 1JWVA 3SH8A 4JPMA 3IWQA 2ZC4B 4FH4A 4QHCA 3IF6C 1MWUA 4P6BA 5E2FA 3P98A 3ZNTA 4DE1A 3PAEA 3UE3A 4DE2A 4PM5A 4OKPA 2Y2OA 2Y2QA 1PW1A 4IVIA 5EPHA 5HW3A 2H0YA 1MKIA 1K55C 1HTZA 3V39A 1O07A 5L2FA 1MWRA 3HREA 1ZC2A 4C75A 1VM1A 2OSUA 4HEFA 3NI9A 4EWFA 1VQQA 2PBYA 3BEBA 4MBFA 4DKIA 4S2NC 1K56A 2Y2LA 1SHVA 3HL9A 1DJCA 2HPBA 2DCFA 3HLCA 5TGFA 1LL5A 3NCKA 4PMAA 1E4DA 2XLNA 1NJ4A 3O86A 4UA6A 3HLBA 3CZDA 1RCJA 1RGZA 4WZ4A 5A91A 2ZC6B 3GV9A 1HD8A 4ZBEA 4LV1A 2XF3A 1JWZA 3LEZA 3GSGA 3MXRA 4OPRA 3LY3A 1PYYA 3TG9A 1YLTA 3WS4A 3GQZA 1BLCA 3HUOA 3I7JA 3PBQA 1FSWA 4ZDXA 4R1GA 3BM6A 3HLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKV A;  4OP8 A;  5EE8 A;  4OPY A;  1E25 A;  1KE3 A;  4X56 A;  4C3Q A;  3W8K A;  4B88 A;  1PWC A;  1YM1 A;  1S6R A;  1K57 A;  2Q9N A;  4IBR A;  3IH9 A;  4PM6 A;  4MBH A;  4E6W A;  4D2O A;  5FAO A;  3QNC A;  1FCN A;  5EEC A;  2Y2J A;  4JXS A;  1JTG A;  3VFF A;  1SKF A;  1W79 A;  4OOL A;  5HAI A;  1PWG A;  4FSF A;  1GHP A;  4KG5 A;  2IWB A;  3UDX A;  1ERM A;  3UNW A;  4QY6 A;  1IKI A;  3DWZ A;  3NDE A;  5A92 A;  4OQG A;  2BG1 A;  4U3T A;  1I5Q A;  1M6K A;  4S2O A;  3EQU A;  3WWX A;  2RL3 A;  3VSK A;  3N8L A;  4JF5 A;  5BOH A;  4U0T A;  3A3F A;  2EFX A;  5HL1 A;  2ZC7 A;  1DY6 A;  5AQ9 A;  4ZJ3 A;  5HAP A;  4B4X A;  1PZO A;  5KSC A;  3BFF A;  4QJG A;  1L2S A;  3N7W A;  5A93 A;  4RYE A;  4NET A;  1M40 A;  1ALQ A;  4BEN A;  4OP5 A;  3OCN A;  4X69 A;  2WKE A;  1G68 A;  3IF5 A;  2EFU A;  5F1F A;  5G18 A;  3AGE A;  3E2K A;  1N4O A;  4P0M A;  3Q7V B;  4GB7 A;  4H8R A;  4L0L A;  2I72 A;  3HLG A;  3FWL A;  1XPB A;  4S2M A;  1K54 C;  5DTK A;  5AQ7 A;  5GLB A;  3UO9 A;  3N4I A;  1KGE A;  5FQJ A;  1MWS A;  3WRZ A;  4LV0 A;  4OOY A;  3M6H A;  1I2S A;  3NIA A;  2J7V A;  2H10 A;  1YLJ A;  4ZAM A;  3WS5 A;  2EX9 A;  1KE4 A;  1L0F A;  2WZZ A;  2ZM0 A;  5JYP A;  4KQO A;  1NRF A;  4CPK A;  3PBR A;  3WRT A;  3BFG A;  3TSG A;  3GTC A;  2XD1 A;  1ES4 A;  2HDQ A;  3BRM A;  3GMW A;  4QY5 A;  2R9X A;  3MFD A;  5D3O A;  3AGD A;  3Q7V A;  4X53 A;  4K0W A;  4XUZ A;  4N92 A;  3G31 A;  3MKF A;  5HAR A;  4KZB A;  2XQZ A;  4PM8 A;  3Q07 A;  1Q2Q A;  2EXB A;  2Y55 A;  5CED A;  3FZC A;  5EVI D;  1K56 D;  5CHJ A;  4WEK A;  5HX9 A;  4E3M A;  1XGJ A;  2WGV A;  4R3J A;  5M1A A;  1E3U A;  4DE3 A;  3ZDJ A;  1YMS A;  2Z2L B;  1TVF A;  3ZCZ A;  1PI5 A;  4GOG A;  2HDR A;  1JVJ A;  4XXR A;  4KQQ A;  1FQG A;  4EBL A;  5FI6 A;  4HES A;  4K91 A;  5F1G A;  1HZO A;  1BZA A;  5FSR A;  1S0W A;  2ZM8 A;  5FQI A;  3N6I A;  2Q9M A;  4GN2 A;  1H8Y A;  1ERO A;  3RXW A;  4KZ9 A;  3VP4 A;  2ZQD A;  1RP5 A;  3BEC A;  5DF7 A;  4Z9Q A;  5EOE A;  1LI9 A;  2V2F F;  1K38 A;  3ZNY A;  1IKG A;  3ZVW A;  3ZG7 B;  4GD8 A;  2HP6 A;  2ZC5 B;  3C4O A;  4E3K A;  2OV5 A;  1PW8 A;  2C6W B;  2UWX A;  3UDI A;  2P9V B;  3VP1 A;  3ZVT A;  4C6Y A;  4LEN A;  1K57 C;  2XFS A;  4EV4 A;  5CEC A;  3GRJ A;  3IXB A;  2WK0 A;  4N1H A;  5EVI B;  4PM9 A;  2Y2G A;  3OCL A;  2ZJ9 A;  3QNB A;  3A3E A;  3BFD A;  1MPL A;  4OLD A;  1YLY A;  4Y0U A;  3S1Y A;  3NY4 A;  1LHY A;  4FD8 A;  2P9V A;  2Y91 A;  3FV7 A;  3IXD A;  3PBO A;  2WUQ A;  3RJU A;  3OPP A;  4Y0T A;  3HLE A;  4U0X A;  1CK3 A;  3PBS A;  3G30 A;  5IHV A;  4E3L A;  1U60 A;  4EBN A;  4WYY A;  1SDE A;  1SDN A;  3IQA A;  4R0Q A;  4EBP A;  5E2H A;  2VGJ A;  1IYS A;  1NYM A;  4LV3 A;  4KZ3 A;  4WMC A;  2XD5 A;  3CG5 A;  5FAP A;  2Y4A A;  5CGS A;  4O7D A;  1O7E A;  2Y2M A;  5FI7 A;  3V5M A;  3ZFZ A;  5CXW A;  3MKE A;  5FQK A;  1K6S A;  4ZTK A;  4RVA A;  5DTS A;  1GHI A;  3MXS A;  4S2P A;  3B3X A;  5HAQ A;  2EX2 A;  3VMA A;  2E8I A;  3UN7 A;  4F94 A;  3IWI A;  1ESI A;  3GVB A;  2Y2N A;  1AXB A;  1K4F A;  3MBZ A;  2IWC A;  4JBF A;  4BJP A;  2BLS A;  3PBN A;  4YFM A;  2X01 A;  3O88 A;  2PU4 A;  2QZ6 A;  1N9B A;  2EXA A;  5J8X A;  3SH7 A;  3C7U A;  4KZ7 A;  2ZMA A;  4A5R A;  3MZD A;  2ZLY A;  2JCH A;  4BLM A;  2J8Y A;  2VGK A;  4GKU A;  3Q81 A;  1C3B A;  2DNS A;  4YIN A;  1Z6F A;  1KGG A;  1IEM A;  5CGW A;  1DJB A;  2WGI A;  4QU3 A;  3ZHH A;  4GDN A;  4OQH A;  1L0G A;  1FR1 A;  5GHZ A;  5CRF A;  2ZQ8 A;  4OQ0 A;  4OLG A;  3VP0 A;  3SS3 A;  4DDY A;  3HLF A;  1QMF A;  2JBF A;  5A90 A;  1DJA A;  3VOY A;  2JC7 A;  4OOM A;  4BL3 A;  1PWD A;  1EWZ A;  4GNU A;  3A3D A;  3C7V A;  2G2W A;  5KZH A;  4BL2 A;  1PI4 A;  2B5R A;  5CHM A;  3UY6 A;  3NC8 A;  3UE1 A;  4P87 A;  3SS5 A;  4E3I A;  1KVL A;  2H0T A;  4JXW A;  3N8R A;  3V3R A;  4UAA A;  1NZU A;  2WKH A;  4QD4 A;  1I2W A;  3CJM A;  1GCE A;  1L0E A;  2A3U A;  1QME A;  3LO7 A;  5FAT A;  4K0X A;  4X68 A;  4OPQ A;  4LCM A;  4MBK A;  3E2L A;  1IYP A;  4Y7P A;  2C5W B;  1PIO A;  4DDS A;  1ZKJ A;  5EOO A;  1ONG A;  3BLM A;  1FOF A;  1ES5 A;  1WYB A;  3UPO A;  4GZB A;  5M19 A;  3HVF A;  1XXM A;  3QHY A;  3IT9 A;  4KG2 A;  1BUE A;  1BLH A;  2X71 A;  5GHX A;  4B4Z A;  3TOI A;  3OPH A;  4UA7 A;  5JYO A;  3ITB A;  2J9P A;  2ZQ9 A;  3S22 A;  1YT4 A;  3G4P A;  4BQM A;  2XEP A;  3Q82 A;  3UE0 A;  1RGY A;  3V3S A;  3IHB A;  2V20 A;  3ZG8 B;  4IBX A;  2ZM2 A;  3BYD A;  3ZG0 A;  4BD1 A;  3JYI A;  4JF4 A;  3P09 A;  3ZGA B;  4DE0 A;  3W4O A;  2ZQ7 A;  1WE4 A;  4GDB A;  4KZ5 A;  4WEJ A;  5CTN A;  3D4F A;  4ZJ2 A;  1K6R A;  4KQR A;  3M2J A;  4R3B A;  1IYO A;  3OZH A;  1XA1 A;  1MXO A;  3G35 A;  4E3O A;  4NK3 A;  3RXX A;  5GHY A;  1BTL A;  1NYY A;  4P85 A;  1ESU A;  2XGN A;  4JF6 A;  3BFE A;  4N9K A;  2GDN A;  5CHU A;  3M2K A;  4UHU A;  5HFO A;  1WYC A;  2ZQA A;  1YLP A;  3G32 A;  1IYQ A;  3HUN A;  1W8Q A;  2J9O A;  2PU2 A;  4KEN B;  4PPR A;  4WZ5 A;  3VSL A;  1YQS A;  4CJN A;  2A49 A;  2WAE A;  1CEF A;  3G2Y A;  3Q1F A;  4R23 A;  1GHM A;  5TR7 A;  4Y0O A;  3HLW A;  4MEZ A;  4QB8 A;  3FKW A;  3OC2 A;  2IWD A;  3W4Q A;  3IF6 B;  4DRT A;  4E6X A;  3LY4 A;  2WAF A;  4S2I A;  3OPL A;  2WKI A;  3VOZ A;  4KZA A;  1ZG6 A;  1BLP A;  1ONH A;  5EVI A;  2Y59 A;  2HDS A;  4RX3 A;  3WS0 A;  3ZG5 A;  2ZD8 A;  2WYX A;  4MLL A;  5TFQ A;  1W5D A;  5GLC A;  3Q7Z A;  1GA0 A;  2DRW A;  2ZQC A;  1TEM A;  1FR6 A;  5E2G A;  3WS2 A;  3IXH A;  1HVB A;  1K4E A;  5FI2 A;  4UA9 A;  2HP5 A;  1ES2 A;  3IH8 A;  1XKZ A;  3N8S A;  3ZG9 B;  3O87 A;  4DXC A;  2P74 A;  1KVM A;  1G6A A;  3IF6 A;  4IED A;  3WS1 A;  4IVK A;  1KDW A;  3HBR A;  5GLD A;  3MZE A;  4JXG A;  3CMZ A;  2RCX A;  3M6B A;  3G2Z A;  5FA7 A;  5DF9 A;  1ERQ A;  1ES3 A;  3FYZ A;  1K55 A;  4XUX A;  4X55 A;  5KSH A;  5FQ9 A;  1BUL A;  2XH9 A;  2XK1 A;  4JLF A;  1K25 A;  3IWO A;  4JKT A;  3DW0 A;  1PZP A;  1W7F A;  3SOI A;  4S2N A;  4RA7 A;  5E43 A;  2WGW B;  1LL9 A;  2XDM A;  3DTM A;  3A3J A;  4OH0 A;  1KE0 A;  3BFC A;  3NDG A;  4E3N A;  1Q2P A;  5FDH A;  1KGF A;  4OQI A;  4EQI A;  1FCM A;  1E3U D;  1SCW A;  3PAG A;  4HBU A;  4JXV A;  4MNR A;  4DF6 A;  4N1X A;  4S2K A;  1J9M A;  1L0D A;  3S4X A;  4R4S A;  4WBG A;  5DVA A;  3PTE A;  5FQQ A;  4OON A;  2X02 A;  5EVL A;  4BD0 A;  4LV2 A;  4FCF A;  2Y2I A;  4WM9 A;  2WGW A;  5DF8 A;  5CEB A;  5F82 A;  3C4P A;  4OVD A;  3EQV A;  2WAD A;  3SS4 A;  3V50 A;  5GLA A;  4KZ8 A;  5CTM A;  1JTD A;  1FSY A;  3AGF A;  5CER A;  1XA7 A;  4LCL A;  2V1Z A;  4WEL A;  2QMI A;  1BT5 A;  1GA9 A;  2EX6 A;  1FCO A;  4OPZ A;  4S2J A;  4E3J A;  3IXG A;  3PBT A;  1YLZ A;  4EUZ A;  5FAS A;  1NXY A;  1MWT A;  3C5A A;  1NY0 A;  4HBT A;  3UPN A;  2Y2H A;  3DWK A;  2OLV A;  1BSG A;  1XX2 A;  3O3V A;  1TDG A;  1BLS A;  4GD6 A;  3MZF A;  2HP9 A;  1LI0 A;  1LLB A;  3NBL A;  1NZO A;  5U47 A;  2Y2K A;  3A3I A;  5M18 A;  5I94 A;  3ITA A;  4KZ4 A;  1W8Y A;  2QPN A;  3IHA A;  1MY8 A;  5DTT A;  5E2E A;  1KDS A;  3LCE A;  3OPR A;  4PM7 A;  1MBL A;  2HDU A;  4N9L A;  3HUM A;  3G34 A;  4Q8I A;  1TDL A;  2FFY A;  3UDF A;  2H5S A;  4WZ5 C;  1YLW A;  2ZC3 B;  1CI8 A;  1ZG4 A;  5EUA A;  3SH9 A;  3BLS A;  1XP4 A;  4R4R A;  2Y2P A;  2CC1 A;  4X6T A;  4DXB A;  5GL9 A;  1XGI A;  3W4P A;  3VP2 A;  5FQM A;  2FFF B;  2G2U A;  5F83 A;  5FAQ A;  1K54 A;  4M3K A;  1IEL A;  2XR0 A;  5AQA A;  1Y54 A;  4KZ6 A;  4KG6 A;  4WMC D;  2OLU A;  5KMW A;  4ZJ1 A;  3VP3 A;  1YMX A;  5CGX A;  5AQB A;  4RX2 A;  4ID4 A;  5EVI C;  3VFH A;  4FH2 A;  4S2L A;  1CI9 A;  1EI5 A;  3ISG A;  3UPP A;  1JWP A;  2EX8 A;  1OME A;  2JE5 A;  2WZX A;  2XFT A;  1H5X A;  2Z2M B;  2R9W A;  1CEG A;  1H8Z A;  3GR2 A;  1JWV A;  3SH8 A;  4JPM A;  3IWQ A;  2ZC4 B;  4FH4 A;  4QHC A;  3IF6 C;  1MWU A;  4P6B A;  5E2F A;  3P98 A;  3ZNT A;  4DE1 A;  3PAE A;  3UE3 A;  4DE2 A;  4PM5 A;  4OKP A;  2Y2O A;  2Y2Q A;  1PW1 A;  4IVI A;  5EPH A;  5HW3 A;  2H0Y A;  1MKI A;  1K55 C;  1HTZ A;  3V39 A;  1O07 A;  5L2F A;  1MWR A;  3HRE A;  1ZC2 A;  4C75 A;  1VM1 A;  2OSU A;  4HEF A;  3NI9 A;  4EWF A;  1VQQ A;  2PBY A;  3BEB A;  4MBF A;  4DKI A;  4S2N C;  1K56 A;  2Y2L A;  1SHV A;  3HL9 A;  1DJC A;  2HPB A;  2DCF A;  3HLC A;  5TGF A;  1LL5 A;  3NCK A;  4PMA A;  1E4D A;  2XLN A;  1NJ4 A;  3O86 A;  4UA6 A;  3HLB A;  3CZD A;  1RCJ A;  1RGZ A;  4WZ4 A;  5A91 A;  2ZC6 B;  3GV9 A;  1HD8 A;  4ZBE A;  4LV1 A;  2XF3 A;  1JWZ A;  3LEZ A;  3GSG A;  3MXR A;  4OPR A;  3LY3 A;  1PYY A;  3TG9 A;  1YLT A;  3WS4 A;  3GQZ A;  1BLC A;  3HUO A;  3I7J A;  3PBQ A;  1FSW A;  4ZDX A;  4R1G A;  3BM6 A;  3HLD A; 
#chains in the Genus database with same CATH topology
 2O9B A;  5EE8 A;  4CLC C;  4KQD A;  4D2O A;  2PYP A;  5FAO A;  3T4J A;  1W63 M;  1JTG A;  4B93 A;  1W79 A;  4OOL A;  3D72 A;  1PWG A;  2V8F A;  2W3G A;  2IWB A;  3UDX A;  1IKI A;  3DWZ A;  3C38 A;  2B95 A;  4R70 A;  2BG1 A;  3RTY A;  3WWX A;  5F5Y A;  2ZL1 B;  5BOH A;  5HAP A;  4B4X A;  1PZO A;  3BFF A;  3N7W A;  4YNR A;  1ALQ A;  4X69 A;  3OCN A;  3IX4 A;  3Q7V B;  2FZ0 A;  4L0L A;  4S2M A;  5DTK A;  1K54 C;  3UO9 A;  3WRZ A;  1I2S A;  2ZM0 A;  5JYP A;  4KQO A;  4Y3I A;  3PBR A;  3TSG A;  3E0Y A;  5F1F A;  2HDQ A;  3GMW A;  1AWI A;  3MFD A;  4MN7 A;  3AGD A;  1P97 A;  4XUZ A;  3G31 A;  3SZT A;  1G5U A;  1TF1 A;  4WEK A;  5HX9 A;  2XSS A;  3F1O B;  1E3U A;  3ZCZ A;  1FQG A;  5FI6 A;  4HES A;  1XJ2 A;  1BZA A;  5FSR A;  3PXP A;  1S0W A;  2ZM8 A;  5FQI A;  2Q9M A;  4Y15 A;  1ERO A;  3RXW A;  1RP5 A;  5DF7 A;  5EOE A;  1LI9 A;  2V2F F;  5KIZ A;  5IT5 A;  4UQI S;  3UB9 A;  1IKG A;  4GD8 A;  2HP6 A;  3C4O A;  3VP1 A;  4EV4 A;  2PR6 A;  3CPT B;  2WK0 A;  1DRM A;  3NOP C;  3OCL A;  3BFD A;  4WN5 A;  1YLY A;  1OTI A;  3OLO A;  2Y8H A;  1LHY A;  5J7E A;  4Y0T A;  3G30 A;  3KYQ A;  4HY8 A;  4WYY A;  4EBP A;  1IYS A;  4LV3 A;  2VZW A;  3CG5 A;  5CGS A;  2Y2M A;  5FI7 A;  5FQK A;  2VJW A;  4RVA A;  3MXS A;  4S2P A;  5HAQ A;  1AXB A;  3IX3 A;  4JBF A;  2IWC A;  1FIL A;  4BBU A;  1MKM A;  2BLS A;  2X01 A;  3O88 A;  2QZ6 A;  2ZMA A;  2JCH A;  2VGK A;  3ULF A;  4QU3 A;  3ZHH A;  4OQH A;  1L0G A;  1FR1 A;  2HF6 A;  3EOI A;  5CRF A;  4CLC E;  2ZQ8 A;  3LR3 A;  2VGL M;  3HLF A;  2ZL1 A;  1QMF A;  2JBF A;  3VOY A;  2JC7 A;  4OOM A;  3A3D A;  5FDS A;  4ETX A;  2WKR A;  2OAQ 1;  3B42 A;  3SS5 A;  2H0T A;  3KSG A;  1K0K A;  3V3R A;  2WKH A;  3LYX A;  2PT7 A;  3LUQ A;  4MBK A;  3E2L A;  1IYP A;  4Y7P A;  1PIO A;  4ETZ A;  1ZKJ A;  1ES5 A;  3UPO A;  3HVF A;  3QHY A;  3IT9 A;  4KG2 A;  1BUE A;  1BLH A;  3TOI A;  4YOF A;  4BMW A;  3ITB A;  2J9P A;  3LIF A;  4ESP A;  2OOL A;  3F1O A;  3UE0 A;  4IBX A;  3ZG0 A;  4BD1 A;  3JYI A;  4UEY A;  4JF4 A;  3IS2 A;  3W4O A;  1WE4 A;  4WEJ A;  1TS6 A;  1F5M A;  3MR0 A;  1MXO A;  1ACF A;  1NYY A;  4P85 A;  2HV1 A;  3BFE A;  3M2K A;  1W8Q A;  2J9O A;  4WZ5 A;  3LEQ A;  4CJN A;  3T1X A;  2WAE A;  1CEF A;  4JGO A;  4X1M A;  3UMD A;  4Y0O A;  3HLW A;  4MEZ A;  5HDC A;  3FKW A;  3OC2 A;  2IWD A;  5EV0 A;  3IF6 B;  4DRT A;  2E8J A;  1ZG6 A;  2HDS A;  4MLL A;  5GLC A;  4RQ9 A;  2DRW A;  2ZQC A;  3WS2 A;  3H9W A;  4UA9 A;  2HP5 A;  2KLI A;  5AVF A;  3O87 A;  2P74 A;  1NLY A;  2INW A;  5GLD A;  2A2L A;  3CMZ A;  3LR0 A;  3M6B A;  1OPX A;  4PAU A;  1ES3 A;  1K55 A;  4X55 A;  5KSH A;  4Q0H A;  1Y4O A;  3C8C A;  1W7F A;  2W3D A;  4RA7 A;  2WGW B;  3DTM A;  1KE0 A;  1BYW A;  3BFC A;  4H6J A;  1KGF A;  4OQI A;  2GNX A;  4JXV A;  3EEH A;  4DF6 A;  1L0D A;  3FPV A;  4R4S A;  2ZBB A;  2GZA A;  4Q0J A;  2Y2I A;  4WM9 A;  5CEB A;  1P9R A;  5F82 A;  4WL9 A;  1FSY A;  3KYZ A;  1XA7 A;  4GCZ A;  4F3L B;  2EX6 A;  3GEC A;  4S2J A;  3PBT A;  1NXY A;  3HCY A;  4Y13 A;  2Y2H A;  2OLV A;  3O3V A;  2PD8 A;  3F1N B;  1NZO A;  2Y2K A;  4L9E A;  5I94 A;  3H82 B;  4DJ3 A;  1N9O A;  2HDU A;  4N9L A;  1TDL A;  3S7O A;  2L4R A;  1YLW A;  2ZC3 B;  1CI8 A;  1ZG4 A;  3TW8 A;  1XP4 A;  4X6T A;  2CC1 A;  3LID A;  1XGI A;  3QP4 A;  2G2U A;  5F68 A;  4HP9 A;  3JVU A;  5AQA A;  1Y54 A;  4KZ6 A;  4WMC D;  5CGX A;  4RX2 A;  3JVV A;  1OME A;  2EX8 A;  2JE5 A;  1CEG A;  3IWQ A;  2ZC4 B;  4P6B A;  3P98 A;  4DE2 A;  4OKP A;  1DP8 A;  5EPH A;  5HPF A;  3V39 A;  3MSH A;  4I5S A;  1LL8 A;  2PBY A;  3BEB A;  4DKI A;  4S2N C;  1DJC A;  2DCF A;  1LL5 A;  4PMA A;  1NJ4 A;  1SZV A;  3HLB A;  1FIK A;  1V9Y A;  5F69 A;  2XF3 A;  1JWZ A;  3LEZ A;  3GSG A;  3MXR A;  3LY3 A;  3GQZ A;  1BLC A;  1FSW A;  4R1G A;  4OP8 A;  1E25 A;  1KE3 A;  4C3Q A;  4B88 A;  1S4R A;  3MMH A;  3NHQ A;  3IH9 A;  4PM6 A;  4PKY A;  4E6W A;  2GX5 A;  4Y17 A;  5EEC A;  3D9Y A;  2NUT C;  4JXS A;  3VFF A;  5HAI A;  3NEC A;  2PRF A;  5HWV A;  3UNW A;  1Z09 A;  5A92 A;  4U3T A;  2ZOI A;  5TBM A;  2RL3 A;  3VSK A;  5HL1 A;  2XA7 S;  4HH2 A;  1M40 A;  4BEN A;  4OP5 A;  2PDR A;  3IF5 A;  5G18 A;  3AGE A;  1N4O A;  1S4S A;  5FQJ A;  3NIA A;  2H10 A;  3WS5 A;  2L1M A;  3CUE C;  2W1T A;  5EVE A;  4CPK A;  4F3L A;  3WRT A;  3BFG A;  3ICY A;  4QY5 A;  2GJ3 A;  4X53 A;  3LIE A;  4PM8 A;  1T1A A;  2EXB A;  1K56 D;  2EWW A;  4DJ2 A;  4E3M A;  2PD7 A;  1XJ6 A;  2WGV A;  5M1A A;  2Z2L B;  3DTI A;  4P6Z S;  4XXR A;  4KQQ A;  5L09 A;  3BEC A;  4NXG A;  1D7E A;  3ZNY A;  3ZVW A;  5DKL A;  5K5B A;  1K57 C;  3MQO A;  4WF0 A;  2D02 A;  4PM9 A;  5IU1 A;  2W1R A;  3A3E A;  3T50 A;  2O9C A;  1MPL A;  3NY4 A;  4EXO A;  2WUQ A;  3OPP A;  2ZOH A;  3HLE A;  1CK3 A;  2FH5 A;  3VE4 A;  3PBS A;  5IHV A;  4E3L A;  5A8B A;  1U60 A;  1SDN A;  1S1Y A;  4WMC A;  3EGD C;  1O7E A;  1K6S A;  3RH8 B;  1GHI A;  5FEG A;  3OOV A;  4BBT A;  2E8I A;  1PRQ A;  2M1C A;  4II7 A;  3MBZ A;  4WUJ A;  5MC7 A;  1IFQ A;  4YFM A;  4Y2F A;  1T1B A;  2EXA A;  1UGU A;  5DFX A;  3V67 A;  4KZ7 A;  4A5R A;  2ZLY A;  2J8Y A;  4GHI A;  2DMW A;  3Q81 A;  1C3B A;  4R3A A;  1IEM A;  3KO6 A;  4CLC B;  1DJB A;  2JN7 A;  4JGP A;  1VB6 A;  4LRY C;  2I9V A;  2QYB A;  5L10 A;  4OLG A;  3VP0 A;  3SS3 A;  4DDY A;  3S7P A;  2M7V A;  2JKT M;  1EWZ A;  4GNU A;  3QP2 A;  3C7V A;  2G2W A;  5KZH A;  1PI4 A;  2B5R A;  5CHM A;  3UY6 A;  4EER A;  2QHK A;  4E3I A;  5J4E A;  1OTD A;  3IX8 A;  1T19 A;  4CQH A;  2VX8 A;  1NZU A;  3E4Q A;  4QD4 A;  1GCE A;  3LO7 A;  5FAT A;  4O0P A;  2PHY A;  4LCM A;  2MJ6 A;  2C5W B;  3QP1 A;  1ONG A;  3BLM A;  5HL6 A;  5M19 A;  1XXM A;  4ME4 A;  3IS2 B;  1F9I A;  3L9K A;  3V3S A;  4MCW A;  2YKH A;  3QP5 A;  3M2J A;  3G6O A;  4NK3 A;  5GHY A;  1BTL A;  4JF6 A;  3VSL A;  3HUN A;  4KEN B;  1YQS A;  1XJ3 A;  3LGO A;  1UWN X;  4R23 A;  4NKP A;  1GHM A;  4K08 A;  2VEA A;  4XT2 A;  3K3D A;  4E6X A;  4S2I A;  5HDD A;  3R4K A;  1BLP A;  1ONH A;  1YPR A;  4RX3 A;  3ZG5 A;  3U4L P;  1W5D A;  2Z6C A;  3IXH A;  2ACG A;  1OJG A;  1XKZ A;  3QP8 A;  1KVM A;  4HJ4 A;  3WS1 A;  4IVK A;  3HBR A;  3MZE A;  3T1R A;  4H6J B;  2V1B A;  5FA7 A;  1SKO B;  5FQ9 A;  4Z1W A;  1BUL A;  2XH9 A;  1K25 A;  4R6L A;  3TRC A;  4JKT A;  5E43 A;  3A3J A;  4KUK A;  3NDG A;  4I38 A;  5FDH A;  1FCM A;  1SCW A;  3PAG A;  4HBU A;  4S2K A;  1J9M A;  4WBG A;  4GLQ A;  3U2A A;  5DF8 A;  4FCF A;  4BD0 A;  4QPR A;  3EQV A;  2YKF A;  4CLC A;  4PHT A;  1D1J A;  4DMZ A;  3AGF A;  5CER A;  4MMN A;  1CQA A;  2QMI A;  1BT5 A;  1FCO A;  4OPZ A;  3IXG A;  4EUZ A;  1YLZ A;  3C5A A;  1MWT A;  2R78 A;  1G6O A;  2V9A A;  1TDG A;  4G3V A;  3MZF A;  1L3L A;  2PYR A;  4KZ4 A;  3IBJ A;  1MY8 A;  3LCE A;  3NOT C;  2XRO A;  4JGQ A;  4Q8I A;  2FFY A;  2JHE A;  3K3C A;  3SH9 A;  3BLS A;  4O8G A;  5GL9 A;  5FAQ A;  2UV0 E;  1K54 A;  1XFQ A;  1IEL A;  4ZJ1 A;  1YKD A;  5AQB A;  5EVI C;  5LBR A;  3VFH A;  4FH2 A;  4FOF A;  5EM1 A;  2VKS A;  2XFT A;  3GR2 A;  2Z2M B;  4FH4 A;  4QHC A;  3IF6 C;  3ZNT A;  4IHQ A;  1WA9 A;  3BJN A;  4PM5 A;  5HWT A;  5HW3 A;  4BBV A;  3NOU C;  3HJK A;  1O07 A;  5L2F A;  2OAP 1;  1MWR A;  2CMN A;  2OSU A;  2G7U A;  3NI9 A;  4MN6 A;  4MBF A;  2Y2L A;  3HLC A;  3B33 A;  3O86 A;  4HQA A;  2HJ9 C;  2P04 A;  3CZD A;  1RGZ A;  2W3H A;  3GV9 A;  3T4Q A;  1HD8 A;  2V0U A;  4OPR A;  3WS4 A;  3PBQ A;  4E04 A;  2KX6 A;  3I7J A;  3FKV A;  4X56 A;  4IBR A;  1G28 A;  4NXE A;  3LIB A;  1Y28 A;  5TBM B;  3QNC A;  1FCN A;  4LRZ E;  4NEE D;  4FSF A;  1LSW A;  1SKO A;  4HJ6 A;  3P01 A;  1ERM A;  3A0R A;  2W3F A;  4OQG A;  1PFL A;  4JF5 A;  3A3F A;  5HPI A;  2W1T B;  1L2S A;  4QJG A;  1NLZ A;  2JKR I;  2WKE A;  1G68 A;  2EFU A;  2ZMF A;  3E2K A;  1T18 A;  4GB7 A;  3VV4 A;  4H8R A;  2I72 A;  5GLB A;  5AQ7 A;  3N4I A;  5DJU A;  3EGX C;  2VGL S;  2EX9 A;  1KE4 A;  1L0F A;  4ARZ A;  1NRF A;  4MDZ A;  3LR5 A;  5D3O A;  2XD1 A;  3BRM A;  4K0W A;  1YSP A;  2BTF P;  3T4O A;  4DN0 A;  4KZB A;  3Q07 A;  5HSQ A;  3KSH A;  5CHJ A;  1MC0 A;  1XGJ A;  3K2N A;  4R3J A;  4HHD A;  2JKG A;  2VLG A;  1YMS A;  2M7U A;  4GOG A;  5FL3 A;  1JVJ A;  3TJZ C;  1HZO A;  2J3T D;  3N6I A;  3BQ8 A;  4GN2 A;  1H8Y A;  4KZ9 A;  2ZQD A;  4EQ1 A;  4Z9Q A;  2J3T C;  1VHM A;  4O01 A;  4I3A A;  3B47 A;  1W63 Q;  2ZC5 B;  2OV5 A;  1PW8 A;  2C6W B;  2UWX A;  3UDI A;  2L0W A;  4C6Y A;  3SW1 A;  1V9Z A;  4N1H A;  3PHY A;  3FPW A;  3UB5 P;  2J3W A;  2QJ7 A;  2ZJ9 A;  3QNB A;  3E98 A;  1X0O A;  4OLD A;  3S1Y A;  4I3I A;  2P9V A;  3RJU A;  4U0X A;  2OWH A;  4EBN A;  1VET B;  1SDE A;  4R0Q A;  1HLU P;  2VGJ A;  1LT0 A;  1NYM A;  4KZ3 A;  2XD5 A;  3CIT A;  2Y4A A;  3DTE A;  3V5M A;  3ZQ5 A;  1OT6 A;  3F1P B;  1TD5 A;  4GHI B;  2EX2 A;  3VMA A;  3UN7 A;  4F94 A;  3T1S A;  4MN5 A;  1UWP X;  2Y2N A;  4BJP A;  3LR4 A;  5J3W A;  3C2W A;  3SH7 A;  3C7U A;  3MZD A;  1LSV A;  4BLM A;  4GKU A;  3QP6 A;  1Z6F A;  1KGG A;  5CGW A;  2OWJ A;  4EU0 A;  2WGI A;  5GHZ A;  4QWO A;  2VA0 A;  4OQ0 A;  1VEU A;  5A90 A;  2EWV A;  5HZH A;  5DJT A;  4BL2 A;  3NC8 A;  4JXW A;  3N8R A;  1I2W A;  5HD5 A;  3TE8 A;  4K0X A;  3T4L A;  2O0Y A;  2VV6 A;  5EOO A;  1FOF A;  4GZB A;  3H7W B;  4HI4 A;  2ZQ9 A;  1MZU A;  4I39 A;  1YT4 A;  4UQI M;  4BQM A;  1TS0 A;  1RGY A;  3ZG8 B;  1ZTU A;  3BYD A;  4NG2 A;  4G3K A;  3P09 A;  4JGR A;  2ZQ7 A;  3PR6 A;  4KZ5 A;  4XT2 B;  2LB9 A;  3D4F A;  4R3B A;  3MXQ A;  1XA1 A;  1NWZ A;  3G35 A;  4WLA A;  3RXX A;  3T4S A;  2XGN A;  4N9K A;  2GDN A;  2VV7 A;  1WYC A;  5HFO A;  1XJ4 A;  4PPR A;  1IYQ A;  4IUK A;  3DTK A;  2PU2 A;  3DAV A;  2A49 A;  3G2Y A;  3CWF A;  4LRX C;  2WKI A;  2H28 A;  4HH3 A;  2Y59 A;  5TFQ A;  3Q7Z A;  1GA0 A;  4FUW A;  5E2G A;  1CF0 A;  1HVB A;  3KX0 X;  5FI2 A;  3E4O A;  1ES2 A;  3N8S A;  3ZG9 B;  1G6A A;  1KDW A;  4G3W A;  3G2Z A;  4PKY G;  2P7J A;  4XUX A;  2EA9 A;  3VOL A;  1VET A;  3A0S A;  2XK1 A;  4JLF A;  3IWO A;  3BW6 A;  1PZP A;  3SOI A;  4S2N A;  3F1P A;  2XDM A;  4IJG A;  1YAX A;  4EQI A;  4N1X A;  3S4X A;  5G4Y A;  1EW0 A;  1D06 A;  1OTA A;  1XFN A;  3O5Y A;  5FQQ A;  4OON A;  5EVL A;  4LV2 A;  2PAV P;  3S7N A;  2WAD A;  1P9W A;  3V50 A;  5GLA A;  5G4Z A;  2B18 A;  4LCL A;  2V1Z A;  4WEL A;  2NUP C;  2A24 A;  1NY0 A;  1ODV A;  4KUO A;  4Y5F A;  1OJ5 A;  1BLS A;  4GD6 A;  3NBL A;  2Q0O A;  4D60 A;  5U47 A;  3ITA A;  5DTT A;  5E2E A;  3G34 A;  3MF0 A;  3LIC A;  2H5S A;  4WZ5 C;  2AVX A;  5EUA A;  2Y2P A;  4DXB A;  3VP2 A;  2FFF B;  5F83 A;  2ZMV A;  5HDS A;  4KG6 A;  3CUE A;  3H7W A;  1YMX A;  5TJJ A;  5IS1 A;  1EI5 A;  3UPP A;  1JWP A;  2VK3 A;  2VV8 A;  1H8Z A;  2W27 A;  3JPU A;  1JWV A;  4DE1 A;  5E2F A;  3PAE A;  4NXB A;  5HD3 A;  2Y2O A;  1KOU A;  2Y2Q A;  1PW1 A;  4IVI A;  3CLO A;  1MKI A;  1K55 C;  1HTZ A;  4C75 A;  1OTE A;  4X25 A;  4EWF A;  4YWZ A;  1VQQ A;  1GSV A;  3MQQ A;  1K56 A;  5I5L A;  1H8M A;  3HL9 A;  2HPB A;  2O9A A;  3NCK A;  2XLN A;  4L9G A;  3IBR A;  3MFX A;  2D01 A;  2V1A A;  5A91 A;  2ZC6 B;  5C5K A;  4ZBE A;  2KDK A;  2PR5 A;  3UB8 A;  1F2K A;  1PYY A;  4ZDX A;  4OPY A;  3W8K A;  1PWC A;  2JKF A;  1YM1 A;  1S6R A;  1K57 A;  2QKP A;  2Q9N A;  4MBH A;  3CAX A;  4LGW A;  2Y2J A;  4L9F A;  2O99 A;  1SKF A;  3KYE A;  1GHP A;  5EM0 A;  4KG5 A;  4QY6 A;  3ZYT A;  3UB6 A;  3NDE A;  4HIA A;  1I5Q A;  1M6K A;  4S2O A;  3HJI A;  3EQU A;  2B02 A;  3DBA A;  3N8L A;  4U0T A;  2EFX A;  3RFB A;  4ARZ B;  5DFY A;  2ZC7 A;  1DY6 A;  5AQ9 A;  4ZJ3 A;  2J80 A;  5KSC A;  5A93 A;  4FTX A;  4RYE A;  1JNU A;  4NET A;  5FEF A;  1OT9 A;  5HWW A;  4P0M A;  4LPZ A;  3HLG A;  3FWL A;  1XPB A;  1KGE A;  1MWS A;  4LV0 A;  4OOY A;  3CI6 A;  3M6H A;  2J7V A;  1YLJ A;  4ZAM A;  2QJ5 A;  2WZZ A;  4IUH A;  4HNB A;  1YSQ A;  1DP6 A;  2Z6D A;  3GTC A;  1ES4 A;  3FG8 A;  2R9X A;  3Q7V A;  4LLO B;  4N92 A;  3EEA A;  1S1Z A;  3MKF A;  3NUL A;  5HAR A;  2XQZ A;  1Q2Q A;  2Y55 A;  5CED A;  3FZC A;  5EVI D;  2Y79 A;  2K31 A;  4DE3 A;  3ZDJ A;  1TVF A;  1PI5 A;  2HDR A;  4EW7 A;  4EBL A;  4K91 A;  5F1G A;  2V8C A;  5CX7 A;  4HP4 A;  1P0Z A;  3VP4 A;  1K38 A;  3ZG7 B;  4E3K A;  5KMW A;  3ZVT A;  2P9V B;  4LEN A;  5CEC A;  2XFS A;  3GRJ A;  3IXB A;  3C30 A;  2WKQ A;  3KSI A;  5EVI B;  1S67 L;  2WKP A;  2Y2G A;  2LB5 A;  4Y0U A;  3T4T A;  2P08 A;  1PNE A;  4GJ4 A;  4FD8 A;  3FV7 A;  2Y91 A;  3IXD A;  2IA2 A;  3CPT A;  3PBO A;  1NRJ A;  1ZHH B;  3CHW P;  3BY9 A;  3IQA A;  5E2H A;  5FAP A;  4O7D A;  3ZFZ A;  1H0M A;  5CXW A;  3MKE A;  4ZTK A;  5DTS A;  3B3X A;  4GW9 A;  1GSW A;  3IWI A;  1ESI A;  3GVB A;  1K4F A;  4I3J A;  3PBN A;  5AVE A;  2PU4 A;  1VEU B;  1N9B A;  5J8X A;  2XA7 M;  4BWI A;  4GS9 B;  2DNS A;  4YIN A;  4GDN A;  3VE3 A;  3LI9 A;  4AFI A;  3FC7 A;  1DJA A;  4BL3 A;  1TS8 A;  2HGV A;  1PWD A;  2W0N A;  2HJE A;  2K7S A;  4R38 A;  3UE1 A;  4P87 A;  1KVL A;  4UAA A;  4M4X A;  1F98 A;  3CJM A;  1L0E A;  2A3U A;  1QME A;  4X68 A;  4OPQ A;  4DDS A;  1IOU A;  4P6Z M;  1GSX A;  3T4K A;  3T1Q B;  1WYB A;  3R7W B;  2X71 A;  4X1L A;  5GHX A;  4B4Z A;  3OPH A;  1A0K A;  4UA7 A;  5JYO A;  3S22 A;  3G4P A;  2XEP A;  3Q82 A;  4B9O A;  3IHB A;  2V20 A;  3BY8 A;  2ZM2 A;  3L7H A;  2K2N A;  3ZGA B;  5L8M A;  4DE0 A;  1CJF A;  4GDB A;  4EEU A;  5CTN A;  3BQA A;  1K6R A;  3OBF A;  4KQR A;  4ZJ2 A;  3E4P A;  1IYO A;  3OZH A;  4E3O A;  1TS7 A;  1ESU A;  5F6A A;  3W2Z A;  3NJA A;  5CHU A;  4UHU A;  2ZQA A;  1YLP A;  3G32 A;  3KSF A;  1LSX A;  3Q1F A;  2JKR M;  5TR7 A;  4QB8 A;  3W4Q A;  3EWK A;  4LFU A;  3LY4 A;  2WAF A;  3VOZ A;  3OPL A;  4KZA A;  2BAS A;  2W3E A;  3WS0 A;  5EVI A;  1T1C A;  2ZD8 A;  2WYX A;  1TEM A;  1FR6 A;  1K4E A;  3IH8 A;  4DXC A;  3PYP A;  3IF6 A;  4IED A;  4EET B;  1H3Q A;  4JXG A;  2RCX A;  5DF9 A;  3MQ0 A;  1ERQ A;  4NXF A;  1N9N A;  3FYZ A;  3DW0 A;  2QWS A;  3MJQ A;  1LL9 A;  4OH0 A;  4E3N A;  1Q2P A;  3LI8 A;  4HOI A;  1E3U D;  3D3O A;  1OTB A;  4MNR A;  5DVA A;  3P7N A;  3PTE A;  3MS6 A;  2A24 B;  2X02 A;  2WGW A;  4GS9 A;  4ZRR A;  3C4P A;  4OVD A;  3GDI A;  5L07 A;  3SS4 A;  4KZ8 A;  5CTM A;  1JTD A;  3LIA A;  3BWL A;  3UE6 A;  1GA9 A;  4E3J A;  5FAS A;  4HBT A;  2XRN A;  3UPN A;  3DWK A;  4EEP A;  1BSG A;  1XX2 A;  4Q0I A;  2HP9 A;  1J3W A;  1LI0 A;  1LLB A;  3A3I A;  5M18 A;  2PBD P;  1W8Y A;  2QPN A;  3IHA A;  1KDS A;  3OPR A;  4PM7 A;  1MBL A;  3S7Q A;  3HUM A;  5AJG A;  3UDF A;  4EUV A;  4R4R A;  3F1N A;  3UB7 A;  3W4P A;  5FQM A;  3T12 B;  4M3K A;  2XR0 A;  3A0V A;  3H82 A;  3R7W A;  2OLU A;  3VP3 A;  4ID4 A;  3LFV A;  4S2L A;  1CI9 A;  1N9L A;  4EES A;  1DP9 A;  3ISG A;  1S66 L;  2WZX A;  1H5X A;  2R9W A;  3SH8 A;  4JPM A;  1MWU A;  3UE3 A;  2JKT I;  2KOI A;  2H0Y A;  1STZ A;  5EFW A;  3HRE A;  1ZC2 A;  1VM1 A;  4HEF A;  1SHV A;  5TGF A;  1E4D A;  2V0W A;  4UA6 A;  4WZ4 A;  1RCJ A;  4LV1 A;  3UME A;  4HJ3 A;  3TG9 A;  4CLC D;  1YLT A;  5DKK A;  3HUO A;  2HZ5 A;  3BM6 A;  3HLD A; 
#chains in the Genus database with same CATH homology
 3FKV A;  4OP8 A;  5EE8 A;  4OPY A;  1E25 A;  1KE3 A;  4X56 A;  4C3Q A;  3W8K A;  4B88 A;  1PWC A;  1YM1 A;  1S6R A;  1K57 A;  2Q9N A;  4IBR A;  3IH9 A;  4PM6 A;  4MBH A;  4E6W A;  4D2O A;  5FAO A;  3QNC A;  1FCN A;  5EEC A;  2Y2J A;  4JXS A;  1JTG A;  3VFF A;  1SKF A;  1W79 A;  4OOL A;  5HAI A;  1PWG A;  4FSF A;  1GHP A;  4KG5 A;  2IWB A;  3UDX A;  1ERM A;  3UNW A;  4QY6 A;  1IKI A;  3DWZ A;  3NDE A;  5A92 A;  4OQG A;  2BG1 A;  4U3T A;  1I5Q A;  1M6K A;  4S2O A;  3EQU A;  3WWX A;  2RL3 A;  3VSK A;  3N8L A;  4JF5 A;  5BOH A;  4U0T A;  3A3F A;  2EFX A;  5HL1 A;  2ZC7 A;  1DY6 A;  5AQ9 A;  4ZJ3 A;  5HAP A;  4B4X A;  1PZO A;  5KSC A;  3BFF A;  4QJG A;  1L2S A;  3N7W A;  5A93 A;  4RYE A;  4NET A;  1M40 A;  1ALQ A;  4BEN A;  4OP5 A;  3OCN A;  4X69 A;  2WKE A;  1G68 A;  3IF5 A;  2EFU A;  5F1F A;  5G18 A;  3AGE A;  3E2K A;  1N4O A;  4P0M A;  3Q7V B;  4GB7 A;  4H8R A;  4L0L A;  2I72 A;  3HLG A;  3FWL A;  1XPB A;  4S2M A;  1K54 C;  5DTK A;  5AQ7 A;  5GLB A;  3UO9 A;  3N4I A;  1KGE A;  5FQJ A;  1MWS A;  3WRZ A;  4LV0 A;  4OOY A;  3M6H A;  1I2S A;  3NIA A;  2J7V A;  2H10 A;  1YLJ A;  4ZAM A;  3WS5 A;  2EX9 A;  1KE4 A;  1L0F A;  2WZZ A;  2ZM0 A;  5JYP A;  4KQO A;  1NRF A;  4CPK A;  3PBR A;  3WRT A;  3BFG A;  3TSG A;  3GTC A;  2XD1 A;  1ES4 A;  2HDQ A;  3BRM A;  3GMW A;  4QY5 A;  2R9X A;  3MFD A;  5D3O A;  3AGD A;  3Q7V A;  4X53 A;  4K0W A;  4XUZ A;  4N92 A;  3G31 A;  3MKF A;  5HAR A;  4KZB A;  2XQZ A;  4PM8 A;  3Q07 A;  1Q2Q A;  2EXB A;  2Y55 A;  5CED A;  3FZC A;  5EVI D;  1K56 D;  5CHJ A;  4WEK A;  5HX9 A;  4E3M A;  1XGJ A;  2WGV A;  4R3J A;  5M1A A;  1E3U A;  4DE3 A;  3ZDJ A;  1YMS A;  2Z2L B;  1TVF A;  3ZCZ A;  1PI5 A;  4GOG A;  2HDR A;  1JVJ A;  4XXR A;  4KQQ A;  1FQG A;  4EBL A;  5FI6 A;  4HES A;  4K91 A;  5F1G A;  1HZO A;  1BZA A;  5FSR A;  1S0W A;  2ZM8 A;  5FQI A;  3N6I A;  2Q9M A;  4GN2 A;  1H8Y A;  1ERO A;  3RXW A;  4KZ9 A;  3VP4 A;  2ZQD A;  1RP5 A;  3BEC A;  5DF7 A;  4Z9Q A;  5EOE A;  1LI9 A;  2V2F F;  1K38 A;  3ZNY A;  1IKG A;  3ZVW A;  3ZG7 B;  4GD8 A;  2HP6 A;  2ZC5 B;  3C4O A;  4E3K A;  2OV5 A;  1PW8 A;  2C6W B;  2UWX A;  3UDI A;  2P9V B;  3VP1 A;  3ZVT A;  4C6Y A;  4LEN A;  1K57 C;  2XFS A;  4EV4 A;  5CEC A;  3GRJ A;  3IXB A;  2WK0 A;  4N1H A;  5EVI B;  4PM9 A;  2Y2G A;  3OCL A;  2ZJ9 A;  3QNB A;  3A3E A;  3BFD A;  1MPL A;  4OLD A;  1YLY A;  4Y0U A;  3S1Y A;  3NY4 A;  1LHY A;  4FD8 A;  2P9V A;  2Y91 A;  3FV7 A;  3IXD A;  3PBO A;  2WUQ A;  3RJU A;  3OPP A;  4Y0T A;  3HLE A;  4U0X A;  1CK3 A;  3PBS A;  3G30 A;  5IHV A;  4E3L A;  1U60 A;  4EBN A;  4WYY A;  1SDE A;  1SDN A;  3IQA A;  4R0Q A;  4EBP A;  5E2H A;  2VGJ A;  1IYS A;  1NYM A;  4LV3 A;  4KZ3 A;  4WMC A;  2XD5 A;  3CG5 A;  5FAP A;  2Y4A A;  5CGS A;  4O7D A;  1O7E A;  2Y2M A;  5FI7 A;  3V5M A;  3ZFZ A;  5CXW A;  3MKE A;  5FQK A;  1K6S A;  4ZTK A;  4RVA A;  5DTS A;  1GHI A;  3MXS A;  4S2P A;  3B3X A;  5HAQ A;  2EX2 A;  3VMA A;  2E8I A;  3UN7 A;  4F94 A;  3IWI A;  1ESI A;  3GVB A;  2Y2N A;  1AXB A;  1K4F A;  3MBZ A;  2IWC A;  4JBF A;  4BJP A;  2BLS A;  3PBN A;  4YFM A;  2X01 A;  3O88 A;  2PU4 A;  2QZ6 A;  1N9B A;  2EXA A;  5J8X A;  3SH7 A;  3C7U A;  4KZ7 A;  2ZMA A;  4A5R A;  3MZD A;  2ZLY A;  2JCH A;  4BLM A;  2J8Y A;  2VGK A;  4GKU A;  3Q81 A;  1C3B A;  2DNS A;  4YIN A;  1Z6F A;  1KGG A;  1IEM A;  5CGW A;  1DJB A;  2WGI A;  4QU3 A;  3ZHH A;  4GDN A;  4OQH A;  1L0G A;  1FR1 A;  5GHZ A;  5CRF A;  2ZQ8 A;  4OQ0 A;  4OLG A;  3VP0 A;  3SS3 A;  4DDY A;  3HLF A;  1QMF A;  2JBF A;  5A90 A;  1DJA A;  3VOY A;  2JC7 A;  4OOM A;  4BL3 A;  1PWD A;  1EWZ A;  4GNU A;  3A3D A;  3C7V A;  2G2W A;  5KZH A;  4BL2 A;  1PI4 A;  2B5R A;  5CHM A;  3UY6 A;  3NC8 A;  3UE1 A;  4P87 A;  3SS5 A;  4E3I A;  1KVL A;  2H0T A;  4JXW A;  3N8R A;  3V3R A;  4UAA A;  1NZU A;  2WKH A;  4QD4 A;  1I2W A;  3CJM A;  1GCE A;  1L0E A;  2A3U A;  1QME A;  3LO7 A;  5FAT A;  4K0X A;  4X68 A;  4OPQ A;  4LCM A;  4MBK A;  3E2L A;  1IYP A;  4Y7P A;  2C5W B;  1PIO A;  4DDS A;  1ZKJ A;  5EOO A;  1ONG A;  3BLM A;  1FOF A;  1ES5 A;  1WYB A;  3UPO A;  4GZB A;  5M19 A;  3HVF A;  1XXM A;  3QHY A;  3IT9 A;  4KG2 A;  1BUE A;  1BLH A;  2X71 A;  5GHX A;  4B4Z A;  3TOI A;  3OPH A;  4UA7 A;  5JYO A;  3ITB A;  2J9P A;  2ZQ9 A;  3S22 A;  1YT4 A;  3G4P A;  4BQM A;  2XEP A;  3Q82 A;  3UE0 A;  1RGY A;  3V3S A;  3IHB A;  2V20 A;  3ZG8 B;  4IBX A;  2ZM2 A;  3BYD A;  3ZG0 A;  4BD1 A;  3JYI A;  4JF4 A;  3P09 A;  3ZGA B;  4DE0 A;  3W4O A;  2ZQ7 A;  1WE4 A;  4GDB A;  4KZ5 A;  4WEJ A;  5CTN A;  3D4F A;  4ZJ2 A;  1K6R A;  4KQR A;  3M2J A;  4R3B A;  1IYO A;  3OZH A;  1XA1 A;  1MXO A;  3G35 A;  4E3O A;  4NK3 A;  3RXX A;  5GHY A;  1BTL A;  1NYY A;  4P85 A;  1ESU A;  2XGN A;  4JF6 A;  3BFE A;  4N9K A;  2GDN A;  5CHU A;  3M2K A;  4UHU A;  5HFO A;  1WYC A;  2ZQA A;  1YLP A;  3G32 A;  1IYQ A;  3HUN A;  1W8Q A;  2J9O A;  2PU2 A;  4KEN B;  4PPR A;  4WZ5 A;  3VSL A;  1YQS A;  4CJN A;  2A49 A;  2WAE A;  1CEF A;  3G2Y A;  3Q1F A;  4R23 A;  1GHM A;  5TR7 A;  4Y0O A;  3HLW A;  4MEZ A;  4QB8 A;  3FKW A;  3OC2 A;  2IWD A;  3W4Q A;  3IF6 B;  4DRT A;  4E6X A;  3LY4 A;  2WAF A;  4S2I A;  3OPL A;  2WKI A;  3VOZ A;  4KZA A;  1ZG6 A;  1BLP A;  1ONH A;  5EVI A;  2Y59 A;  2HDS A;  4RX3 A;  3WS0 A;  3ZG5 A;  2ZD8 A;  2WYX A;  4MLL A;  5TFQ A;  1W5D A;  5GLC A;  3Q7Z A;  1GA0 A;  2DRW A;  2ZQC A;  1TEM A;  1FR6 A;  5E2G A;  3WS2 A;  3IXH A;  1HVB A;  1K4E A;  5FI2 A;  4UA9 A;  2HP5 A;  1ES2 A;  3IH8 A;  1XKZ A;  3N8S A;  3ZG9 B;  3O87 A;  4DXC A;  2P74 A;  1KVM A;  1G6A A;  3IF6 A;  4IED A;  3WS1 A;  4IVK A;  1KDW A;  3HBR A;  5GLD A;  3MZE A;  4JXG A;  3CMZ A;  2RCX A;  3M6B A;  3G2Z A;  5FA7 A;  5DF9 A;  1ERQ A;  1ES3 A;  3FYZ A;  1K55 A;  4XUX A;  4X55 A;  5KSH A;  5FQ9 A;  1BUL A;  2XH9 A;  2XK1 A;  4JLF A;  1K25 A;  3IWO A;  4JKT A;  3DW0 A;  1PZP A;  1W7F A;  3SOI A;  4S2N A;  4RA7 A;  5E43 A;  2WGW B;  1LL9 A;  2XDM A;  3DTM A;  3A3J A;  4OH0 A;  1KE0 A;  3BFC A;  3NDG A;  4E3N A;  1Q2P A;  5FDH A;  1KGF A;  4OQI A;  4EQI A;  1FCM A;  1E3U D;  1SCW A;  3PAG A;  4HBU A;  4JXV A;  4MNR A;  4DF6 A;  4N1X A;  4S2K A;  1J9M A;  1L0D A;  3S4X A;  4R4S A;  4WBG A;  5DVA A;  3PTE A;  5FQQ A;  4OON A;  2X02 A;  5EVL A;  4BD0 A;  4LV2 A;  4FCF A;  2Y2I A;  4WM9 A;  2WGW A;  5DF8 A;  5CEB A;  5F82 A;  3C4P A;  4OVD A;  3EQV A;  2WAD A;  3SS4 A;  3V50 A;  5GLA A;  4KZ8 A;  5CTM A;  1JTD A;  1FSY A;  3AGF A;  5CER A;  1XA7 A;  4LCL A;  2V1Z A;  4WEL A;  2QMI A;  1BT5 A;  1GA9 A;  2EX6 A;  1FCO A;  4OPZ A;  4S2J A;  4E3J A;  3IXG A;  3PBT A;  1YLZ A;  4EUZ A;  5FAS A;  1NXY A;  1MWT A;  3C5A A;  1NY0 A;  4HBT A;  3UPN A;  2Y2H A;  3DWK A;  2OLV A;  1BSG A;  1XX2 A;  3O3V A;  1TDG A;  1BLS A;  4GD6 A;  3MZF A;  2HP9 A;  1LI0 A;  1LLB A;  3NBL A;  1NZO A;  5U47 A;  2Y2K A;  3A3I A;  5M18 A;  5I94 A;  3ITA A;  4KZ4 A;  1W8Y A;  2QPN A;  3IHA A;  1MY8 A;  5DTT A;  5E2E A;  1KDS A;  3LCE A;  3OPR A;  4PM7 A;  1MBL A;  2HDU A;  4N9L A;  3HUM A;  3G34 A;  4Q8I A;  1TDL A;  2FFY A;  3UDF A;  2H5S A;  4WZ5 C;  1YLW A;  2ZC3 B;  1CI8 A;  1ZG4 A;  5EUA A;  3SH9 A;  3BLS A;  1XP4 A;  4R4R A;  2Y2P A;  2CC1 A;  4X6T A;  4DXB A;  5GL9 A;  1XGI A;  3W4P A;  3VP2 A;  5FQM A;  2FFF B;  2G2U A;  5F83 A;  5FAQ A;  1K54 A;  4M3K A;  1IEL A;  2XR0 A;  5AQA A;  1Y54 A;  4KZ6 A;  4KG6 A;  4WMC D;  2OLU A;  5KMW A;  4ZJ1 A;  3VP3 A;  1YMX A;  5CGX A;  5AQB A;  4RX2 A;  4ID4 A;  5EVI C;  3VFH A;  4FH2 A;  4S2L A;  1CI9 A;  1EI5 A;  3ISG A;  3UPP A;  1JWP A;  2EX8 A;  1OME A;  2JE5 A;  2WZX A;  2XFT A;  1H5X A;  2Z2M B;  2R9W A;  1CEG A;  1H8Z A;  3GR2 A;  1JWV A;  3SH8 A;  4JPM A;  3IWQ A;  2ZC4 B;  4FH4 A;  4QHC A;  3IF6 C;  1MWU A;  4P6B A;  5E2F A;  3P98 A;  3ZNT A;  4DE1 A;  3PAE A;  3UE3 A;  4DE2 A;  4PM5 A;  4OKP A;  2Y2O A;  2Y2Q A;  1PW1 A;  4IVI A;  5EPH A;  5HW3 A;  2H0Y A;  1MKI A;  1K55 C;  1HTZ A;  3V39 A;  1O07 A;  5L2F A;  1MWR A;  3HRE A;  1ZC2 A;  4C75 A;  1VM1 A;  2OSU A;  4HEF A;  3NI9 A;  4EWF A;  1VQQ A;  2PBY A;  3BEB A;  4MBF A;  4DKI A;  4S2N C;  1K56 A;  2Y2L A;  1SHV A;  3HL9 A;  1DJC A;  2HPB A;  2DCF A;  3HLC A;  5TGF A;  1LL5 A;  3NCK A;  4PMA A;  1E4D A;  2XLN A;  1NJ4 A;  3O86 A;  4UA6 A;  3HLB A;  3CZD A;  1RCJ A;  1RGZ A;  4WZ4 A;  5A91 A;  2ZC6 B;  3GV9 A;  1HD8 A;  4ZBE A;  4LV1 A;  2XF3 A;  1JWZ A;  3LEZ A;  3GSG A;  3MXR A;  4OPR A;  3LY3 A;  1PYY A;  3TG9 A;  1YLT A;  3WS4 A;  3GQZ A;  1BLC A;  3HUO A;  3I7J A;  3PBQ A;  1FSW A;  4ZDX A;  4R1G A;  3BM6 A;  3HLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...