2HDRA

Ampc beta-lactamase in complex with 4-amino-3-hydroxybenzoic acid
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Deconstructing fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli k12
total genus 110
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2hdrA00
1DY6A 5DF9A 2OLUA 3MFDA 4E6WA 1MWSA 2OLVA 4X55A 5M18A 2XEPA 3G2YA 5F1FA 2XD1A 1JWZA 3M2KA 3TOIA 1YMSA 4KZ6A 4LCLA 3Q7ZA 5CHMA 5FQJA 3IF6A 3P98A 2FFYA 4N9KA 3UDXA 3C5AA 2DRWA 3MZEA 4E3OA 3PAGA 1MWUA 3LCEA 4XXRA 2UWXA 1ZG6A 4OQHA 4KG2A 4OP8A 1PW8A 4LV1A 3BYDA 2WUQA 5A90A 1GCEA 3OC2A 1N9BA 2P9VA 1GHMA 4PPRA 4KZ7A 1MBLA 4MBHA 5HAPA 3G32A 3AGFA 3WWXA 4WMCA 5HAQA 3VP1A 3UPPA 1JTDA 4OOLA 3VP4A 2Y2PA 4U0XA 1MPLA 3BFCA 5DTTA 2PU4A 1ES2A 3BFEA 5E2FA 5FA7A 3BRMA 5FSRA 4BD1A 2XLNA 1KE0A 1I5QA 1IEMA 3ZFZA 1E3UD 3GVBA 3JYIA 4MLLA 5E2GA 4GDNA 2XGNA 4XUXA 5A91A 2EX6A 3FZCA 5FATA 5AQ7A 2JCHA 4GD6A 3DTMA 2VGKA 1H8YA 2Y2MA 3W4QA 3DW0A 2VGJA 5CTNA 4ZJ3A 2X01A 1KGFA 2ZC6B 2ZM0A 2GDNA 2Y2LA 1ZKJA 1BZAA 1CEGA 4QHCA 2WKEA 5AQBA 4S2LA 1CK3A 1AXBA 3GRJA 4KZ8A 2J8YA 5HFOA 4X53A 1YMXA 5EUAA 1HVBA 1KDSA 2WADA 4L0LA 4WYYA 2EFUA 1PWCA 2XR0A 1E25A 2IWBA 3HUOA 1Z6FA 4NETA 1VM1A 4A5RA 2BLSA 2ZC7A 3MZFA 4S2NA 4JXGA 4EQIA 3HBRA 4ZJ2A 3A3DA 1LHYA 1BLHA 3WS0A 3GMWA 3OZHA 1RGZA 2Y91A 2XFTA 2HPBA 1JWPA 5F82A 5CXWA 1JTGA 2ZQCA 4BLMA 1BSGA 3FYZA 3NIAA 1LI9A 3N7WA 1FR1A 1K25A 3VSLA 4E3IA 2ZM8A 1GHIA 4GNUA 5A92A 4FD8A 2X71A 5I94A 1K57A 3UO9A 3TG9A 4ZJ1A 2RL3A 2HDRA 2XDMA 4S2IA 1IKGA 3M6BA 4JF6A 1Y54A 5HAIA 1GHPA 1WE4A 4BD0A 3CG5A 3V5MA 3BLSA 4KZ3A 4JXSA 4RX3A 4OQGA 3G31A 3Q7VA 1EROA 4U0TA 1S6RA 4K0WA 3G4PA 1NYMA 1YLYA 4UHUA 4EUZA 4EV4A 1YQSA 1KE4A 3G2ZA 4IEDA 2OSUA 4DKIA 2Z2LB 4PM6A 2EX9A 1SDNA 3NBLA 4DE0A 4E3MA 3SH7A 3BFFA 4DE3A 3V3RA 4IBXA 5KSHA 1WYBA 1PWGA 5JYPA 5FQIA 4DE2A 3HUMA 4OPQA 5F83A 1PZPA 1PWDA 1L0EA 3WRZA 3B3XA 1W79A 5CEDA 1M40A 1YLJA 2DNSA 4S2KA 2WGWB 4X56A 5E43A 1XGIA 4QB8A 4Z9QA 2ZQAA 3UPNA 1LI0A 4E6XA 2ZQ9A 4S2JA 2Y2GA 3A3IA 4MEZA 3S1YA 3WS1A 4DXBA 3AGDA 3WRTA 2WKIA 4PM7A 4EBLA 2Y2QA 3UDFA 1NRFA 4ZDXA 1E4DA 1EI5A 2J9PA 1E3UA 3IWOA 4RYEA 3C7UA 2XH9A 1YLTA 1K54C 3LEZA 3NI9A 3FKVA 3C4PA 1YLPA 5D3OA 4PM5A 1XP4A 1ALQA 5E2EA 4PMAA 3LY3A 2QPNA 1M6KA 1MY8A 3ZG7B 5FQMA 1ESIA 4OQ0A 4BQMA 4N1HA 4MBFA 1K55A 2EXBA 3CMZA 3O88A 4DDYA 4R0QA 4BL3A 2DCFA 4E3LA 1W8QA 1IYQA 4X68A 3GR2A 3UY6A 1YM1A 3MXSA 4P6BA 4P85A 1GA0A 5CRFA 1K6SA 4OOYA 3IF6B 1HTZA 1L0FA 1ZG4A 2WAEA 4KZ4A 3C7VA 2ZC3B 1QMEA 2HP5A 3ZVTA 1H8ZA 2XF3A 2A3UA 3ZG5A 1Q2QA 2XD5A 4H8RA 3HLGA 4GD8A 4OP5A 1CI9A 1G6AA 4GN2A 4C6YA 2WZXA 3BLMA 4IVIA 2Y2OA 4MNRA 4DF6A 5HW3A 4R4SA 4KZBA 5EVID 2P9VB 3NDEA 1IYSA 1YLWA 3HLFA 4OVDA 1MWTA 3DWKA 1L0GA 1O07A 1SHVA 1RGYA 2HDSA 3NC8A 5GLAA 3N8RA 5CHUA 4LV2A 3ZDJA 4WEJA 1XX2A 3OCNA 1TDGA 4HESA 3QNCA 4DXCA 2WGVA 1OMEA 1IYPA 1NJ4A 4JBFA 2R9WA 2R9XA 4S2MA 1PZOA 4WBGA 4R3BA 4E3NA 5M19A 1BLSA 1DJBA 2Z2MB 4N1XA 3PBSA 4JF5A 2B5RA 1PI5A 2Q9MA 2WK0A 2ZD8A 4S2PA 5DF7A 5FAOA 1KGEA 2ZQ8A 4ZAMA 3WS5A 5FQQA 1IELA 4FCFA 4HEFA 1LLBA 1XKZA 3OCLA 3HLEA 1J9MA 4JKTA 2G2UA 3IWIA 3BM6A 3SS5A 3IH9A 5FI7A 4E3JA 2EXAA 2WZZA 5DF8A 5CGXA 1XXMA 3IXDA 4MBKA 4WZ5C 4UA9A 3HVFA 3IT9A 1NZOA 2XK1A 3UNWA 3VSKA 3RXXA 3GQZA 2E8IA 1DJAA 3TSGA 3Q81A 4P87A 1YT4A 3N8LA 4LENA 3PBTA 3RXWA 1DJCA 5IHVA 1NYYA 4WMCD 5EVIC 5FI6A 3ITBA 4B4ZA 2V20A 3IXGA 3Q82A 4DRTA 1JWVA 2PBYA 3W8KA 1PI4A 2HP6A 4CJNA 1ERMA 4IVKA 3WS4A 3UPOA 4RX2A 4YINA 2HDUA 3CJMA 1MWRA 4LCMA 3CZDA 3P09A 1BUEA 5F1GA 4LV0A 1MXOA 2Y59A 4FSFA 5L2FA 1U60A 3SS4A 5EOEA 3QHYA 1PYYA 4X69A 5GHZA 3D4FA 1SKFA 1XA1A 1CI8A 3HLWA 1ES3A 1FR6A 4S2OA 1N4OA 3Q7VB 4FH2A 5AQ9A 1BT5A 2BG1A 4QD4A 1KVLA 4QU3A 3VFHA 3V3SA 4C3QA 2I72A 5M1AA 5FAQA 2Y2JA 2JBFA 4GDBA 5EOOA 4GZBA 3HREA 2Y4AA 3DWZA 3LO7A 4UA7A 5FAPA 5FQKA 1SCWA 3IF5A 4BJPA 4R1GA 4EBPA 2ZC4B 4B88A 5EVIA 5KSCA 3ZG0A 1QMFA 5HL1A 1K6RA 1FQGA 2A49A 2IWDA 1I2WA 5GLDA 3NCKA 3ZNTA 4ID4A 1GA9A 2EX2A 3IXHA 2H5SA 3O86A 3QNBA 4OOMA 5HARA 5HX9A 4OLGA 1YLZA 4Y0UA 5CGSA 1K56D 2ZC5B 4WEKA 3SS3A 3MXRA 4N92A 3V39A 3ZG8B 5FASA 5KMWA 1PIOA 2H10A 3ZNYA 4GOGA 3UE3A 1ONGA 5CEBA 5FI2A 4JXWA 1PW1A 3AGEA 1I2SA 2C5WB 1EWZA 3Q1FA 3ZHHA 4QJGA 1XA7A 1HD8A 3PTEA 5DTKA 1NZUA 2ZQ7A 4P0MA 3ZCZA 4WM9A 3LY4A 1LL5A 2QMIA 1NXYA 3IHAA 4FH4A 4JPMA 3W4OA 4KZ9A 4U3TA 1MKIA 2FFFB 1SDEA 1TEMA 3HLCA 3PAEA 3BFGA 3O3VA 3OPHA 4HBUA 4OH0A 3Q07A 1K54A 4KZAA 5TR7A 3V50A 2V2FF 2H0YA 4QY6A 1O7EA 1FSWA 3NY4A 3UDIA 1BTLA 3IHBA 1XPBA 4C75A 4EWFA 4B4XA 1VQQA 1KVMA 1L0DA 4JXVA 2X02A 1BLPA 2HDQA 4OPZA 5GLCA 3E2LA 3RJUA 3SOIA 3OPPA 1FCMA 2ZLYA 3W4PA 4S2NC 3M2JA 3N8SA 1G68A 3PBNA 1HZOA 3FWLA 4EBNA 3A3JA 5TFQA 2OV5A 4E3KA 2PU2A 1L2SA 3S4XA 5G18A 3OPRA 5BOHA 1W7FA 1XGJA 2JE5A 3BEBA 4OKPA 4QY5A 2WYXA 3VP2A 4BENA 2WKHA 3EQVA 4Y0OA 4RA7A 5EECA 4PM8A 4KG6A 3HLDA 1K4EA 4R4RA 3VMAA 1KGGA 3ISGA 4LV3A 4KQQA 3IXBA 4KQOA 2RCXA 3O87A 1K57C 1TDLA 3NDGA 4HBTA 4JLFA 3VOZA 3A3EA 4NK3A 2Q9NA 3UN7A 3N4IA 4D2OA 2ZMAA 1ZC2A 4OQIA 4WZ4A 3HUNA 3M6HA 3PBOA 3HLBA 2WAFA 2Y2NA 5CECA 2JC7A 1ESUA 1RP5A 4OPRA 5GLBA 4R3JA 4ZTKA 4IBRA 5EVLA 3IWQA 1FSYA 5CTMA 1FOFA 2V1ZA 2Y55A 3MKEA 3PBQA 3SH8A 3MBZA 1ES4A 1ES5A 3G35A 5CGWA 5DTSA 5EPHA 3WS2A 2ZJ9A 4Y7PA 4O7DA 1KE3A 2ZM2A 5GL9A 2Y2IA 5J8XA 4ZBEA 3VP3A 1TVFA 2C6WB 1K56A 3G34A 4OPYA 3SH9A 4F94A 2HP9A 2XFSA 4KG5A 1Q2PA 3BFDA 3FV7A 1CEFA 3BECA 3I7JA 1FCNA 1BLCA 2Y2HA 1BULA 2Y2KA 4GKUA 4X6TA 5GHYA 2EX8A 2J9OA 3GV9A 1LL9A 1W8YA 2ZQDA 5A93A 3MZDA 3VP0A 3VFFA 3E2KA 3GTCA 4XUZA 2G2WA 5AQAA 4YFMA 5FQ9A 4Q8IA 1K4FA 2CC1A 4RVAA 4WZ5A 4M3KA 5GHXA 4DE1A 4BL2A 4PM9A 3EQUA 1ERQA 1K38A 2H0TA 3ZVWA 2J7VA 1JVJA 3MKFA 4K0XA 1WYCA 3N6IA 2WGWA 3IF6C 5EE8A 3ITAA 2XQZA 1IKIA 1KDWA 4WELA 5E2HA 5U47A 2EFXA 4JF4A 4R23A 5JYOA 1K55C 2WGIA 4CPKA 3C4OA 4DDSA 4OONA 1H5XA 3OPLA 1RCJA 3IH8A 4KZ5A 4GB7A 5DVAA 3ZGAB 1C3BA 1S0WA 3FKWA 3UE1A 2P74A 4KQRA 4OLDA 2QZ6A 5FDHA 3HL9A 1W5DA 5EVIB 1ONHA 4KENB 4UAAA 3ZG9B 3IQAA 1NY0A 1FCOA 4UA6A 5TGFA 5CERA 4K91A 4Y0TA 3S22A 5KZHA 1IYOA 2IWCA 5CHJA 3PBRA 3VOYA 3UE0A 3G30A 3GSGA 4N9LA 3A3FA
chains in the Genus database with same CATH superfamily
5DF9A 4II7A 3G2YA 4NXBA 4KZ6A 4GHIB 3UDXA 2DRWA 1ODVA 3MZEA 3PAGA 4M4XA 3K3CA 4OQHA 4HIAA 4OP8A 1P9RA 1PW8A 3UB8A 1GCEA 3OC2A 5HAPA 3KYZA 3AGFA 1J3WA 4FUWA 2ZMFA 4BBUA 3BQ8A 3VP4A 2OOLA 5E2FA 5FA7A 3SW1A 2XLNA 1KE0A 1DRMA 1OTIA 3ZQ5A 2EX6A 4YOFA 2OWHA 2JCHA 3DTMA 5HWTA 3K3DA 2Y2MA 3W4QA 4HOIA 3EGXC 2GDNA 1ZKJA 3T4JA 3H7WA 5AQBA 1TS6A 1AXBA 2JKFA 5HFOA 2LB5A 4X53A 1YMXA 1HVBA 1KDSA 2WADA 4WYYA 2EFUA 5TJJA 1E25A 1VM1A 2PR6A 4JXGA 4ZJ2A 3A3DA 3OZHA 2XFTA 5F82A 5CXWA 2L4RA 1L3LA 3FYZA 1FR1A 1K25A 4GNUA 3RTYA 3TG9A 1OT6A 4DJ2A 4S2IA 3M6BA 4JF6A 1AWIA 1N9LA 1WE4A 4BD0A 4KZ3A 4RX3A 2PD7A 4JGPA 1S6RA 1NYMA 3QP2A 3FPWA 1KE4A 2OSUA 2Z2LB 2P08A 1SDNA 3V3RA 5KSHA 5JYPA 2WKRA 5F83A 1PWDA 3UPNA 3BJNA 4Z9QA 2ZQAA 4S2JA 4MEZA 3S1YA 4F3LB 2HJEA 3NECA 4L9FA 2W0NA 1KOUA 3IWOA 2XH9A 2YKHA 1TS7A 2HGVA 5D3OA 1S4RA 2K31A 1OJ5A 4WL9A 1TS8A 3LY3A 1M6KA 1MY8A 5FQMA 2EXBA 3O88A 4R0QA 2XA7M 3H82B 1XJ2A 1YM1A 4P85A 1GA0A 1XJ4A 5CRFA 2WAEA 1ZG4A 2KX6A 3C7VA 4Q0HA 3C2WA 3ZG5A 4GD8A 2AVXA 4IVIA 3PXPA 5HW3A 1NLZA 2JHEA 3DWKA 2GX5A 4DXCA 3R7WA 2GNXA 4XT2B 1OMEA 1IYPA 1NJ4A 3IX3A 1BLSA 2VZWA 4JF5A 2B5RA 2Q9MA 2ZD8A 4S2PA 2OAQ1 2M7UA 4ZAMA 4NG2A 3NOUC 3F1NB 4HEFA 1LLBA 3OCLA 3HLEA 1J9MA 2G2UA 2V1AA 4DN0A 2FH5A 2MJ6A 5DF8A 4UA9A 2XK1A 3VSKA 3RXXA 3GQZA 1DJAA 3UB9A 1YT4A 3KYEA 1NYYA 5AVEA 3IXGA 1JWVA 3W8KA 1VEUA 2HP6A 2O0YA 4CJNA 4IVKA 4YINA 2HDUA 2QJ5A 3LR3A 2ZMVA 3TJZC 1VETA 3E4QA 5F5YA 3HLWA 1ES3A 4S2OA 3Q7VB 5L8MA 4LRYC 2BG1A 2VGLM 2I72A 4GDBA 4H6JB 3U4LP 3V67A 3IF5A 3CI6A 4EBPA 1HLUP 5TBMB 4B88A 5KSCA 1QMFA 3PHYA 2A49A 3NCKA 1GA9A 2EX2A 3MQQA 3O86A 3P01A 5HX9A 4NXGA 5CGSA 3LIBA 3MXRA 3V39A 3ZG8B 5KMWA 2H10A 3ZNYA 4HJ6A 3ZHHA 1XA7A 5DTKA 4P0MA 4P6ZS 4WM9A 3P7NA 1MKIA 2FFFB 3HLCA 4HBUA 3OPHA 4OH0A 3LIDA 2B18A 3V50A 2VLGA 2W3GA 2VEAA 4C75A 3IHBA 1XPBA 4EWFA 1VQQA 1KVMA 5GLCA 3S7OA 1T19A 3RJUA 3OPPA 3FC7A 3SZTA 2QHKA 2OV5A 3B47A 4E3KA 1L2SA 3OPRA 3VV4A 4BENA 2WKHA 5FEFA 4Y0OA 3CWFA 3HLDA 4KG6A 1K4EA 3VMAA 3IS2A 4PKYG 1KGGA 5L07A 3ISGA 4HJ3A 1LSWA 4B93A 3A3EA 4LRXC 3N4IA 3DBAA 2ZMAA 1ZC2A 3M6HA 2JC7A 4OPRA 3IWQA 1YSQA 2O9CA 2V1ZA 3MKEA 3MBZA 2ZBBA 2FZ0A 5IT5A 1LSVA 4NEED 4O7DA 4WF0A 4ETXA 1KE3A 5GL9A 5J8XA 5DFXA 4F94A 4OPYA 4KG5A 2JN7A 4X6TA 5GHYA 2NUTC 2HV1A 4WN5A 1W8YA 2ZQDA 5A93A 4XUZA 2G2WA 1K4FA 4WZ5A 2PAVP 3OOVA 3EQUA 3ZVWA 1JVJA 3MKFA 2WGWA 3BQAA 5E2HA 1KDWA 4ETZA 4JF4A 4Z1WA 5JYOA 2R78A 3C4OA 4LPZA 4OONA 3OPLA 1S0WA 2QZ6A 5FDHA 5EVIB 5HD5A 1ONHA 4UAAA 5TGFA 3S22A 5KZHA 3PBRA 3GSGA 4N9LA 4MDZA 1SKOB 5DJTA 3N8LA 2WKQA 1DY6A 5G4ZA 3MFDA 4HY8A 1MWSA 2P04A 4X55A 3M2KA 3MFXA 1YMSA 2VKSA 5FQJA 3IF6A 3P98A 2FFYA 3C5AA 5FEGA 4E3OA 2Y79A 2A24A 1ZG6A 4JGQA 1TS0A 2P9VA 1GHMA 4PPRA 4KZ7A 4MBHA 1OJGA 4CLCB 5HAQA 3UPPA 1JTDA 4OOLA 3BFCA 4UEYA 2PU4A 3BFEA 5FSRA 2BASA 1IEMA 3ZFZA 4MLLA 3JYIA 2W3HA 4XUXA 3E4OA 2JKRM 3FZCA 1MZUA 1UWPX 2HJ9C 2JKGA 4GD6A 2JKTM 1H8YA 3DW0A 2VGJA 1XJ3A 4ZJ3A 2X01A 5FL3A 2Y2LA 1BZAA 4DJ3A 4YWZA 1CK3A 3GRJA 3JPUA 4L0LA 4GS9A 3HUOA 1Z6FA 4NETA 3ZYTA 2ZC7A 4S2NA 4EQIA 3WS0A 1BLHA 4Y17A 1P9WA 2V8CA 1K0KA 1JTGA 2ZQCA 5HDCA 1BSGA 3NIAA 5A92A 1GHIA 4FD8A 2W1TB 1IFQA 3UO9A 2VV7A 2RL3A 1IKGA 2Z6CA 3CG5A 3BLSA 4EETB 3G31A 1EROA 4K0WA 1YLYA 2V9AA 4DKIA 4MCWA 4E3MA 4JGOA 1S4SA 3HUMA 4EUVA 4OPQA 1PZPA 3WRZA 1L0EA 1W79A 1M40A 1YLJA 5E43A 1G28A 2Y2GA 3WS1A 4DXBA 3LEQA 3WRTA 2WKIA 4EBLA 2Y2QA 3UDFA 2J3TD 4HI4A 3HJIA 1E4DA 1K54C 3LEZA 3NI9A 2D02A 3FKVA 2BTFP 4PM5A 5E2EA 3VE4A 3DTEA 1ESIA 4BQMA 1K55A 1W8QA 1XFNA 3GR2A 3MXSA 4OOYA 2O9AA 4WLAA 3CUEA 5LBRA 1H8ZA 2XF3A 1FILA 1Q2QA 4H8RA 3T1QB 2QWSA 1UWNX 4GN2A 4C6YA 4MNRA 4DF6A 5EVID 3HLFA 1RGYA 1UGUA 4WEJA 1XX2A 1CF0A 3OCNA 3QNCA 2J3TC 2R9WA 5AJGA 2R9XA 4S2MA 3S7QA 4ESPA 4E3NA 4WBGA 5M19A 3T12B 2Z2MB 3PR6A 3T4SA 4MN7A 2P7JA 1PI5A 3LI8A 2ZQ8A 3NHQA 1N9OA 5FQQA 1LL8A 1XKZA 3BM6A 4BWIA 3HCYA 3MF0A 4E3JA 2WZZA 1XXMA 4CLCD 3HVFA 1NZOA 3PYPA 3UNWA 3PBTA 1DJCA 1CQAA 1IOUA 5EVIC 4I3AA 2V20A 4DRTA 2PBYA 3T1RA 4LCMA 1MWRA 5F1GA 1U60A 4X1MA 5EOEA 4CQHA 1XA1A 1CI8A 3MXQA 5L09A 3NJAA 3ULFA 2DMWA 4QPRA 3F1PA 1KVLA 4QU3A 3JVUA 4D60A 1F5MA 5FQKA 3CPTB 4R1GA 3LR4A 4X1LA 4CLCC 4OOMA 3OBFA 5HARA 4OLGA 2PYPA 1N9NA 4Y0UA 1K56D 2ZC5B 4WEKA 2G7UA 4N92A 4P6ZM 5CEBA 4GOGA 4GHIA 5FI2A 1PW1A 3D3OA 4Y13A 2C5WB 3T4OA 3LGOA 1HD8A 2ZQ7A 3KX0X 3IHAA 4KZ9A 4U3TA 3QP6A 1SDEA 3BFGA 3O3VA 3Q07A 2UV0E 2PRFA 1O7EA 4IJGA 3UDIA 2IA2A 4B4XA 4JXVA 2HDQA 1FCMA 2ZLYA 3N8SA 3PBNA 4EBNA 5TFQA 2VK3A 5BOHA 1W7FA 3T50A 4KUOA 3EQVA 5I5LA 5EECA 4PM8A 3IBRA 3IXBA 2RCXA 3NDGA 3LR5A 2Q9NA 4D2OA 3LIEA 3BY8A 3T4TA 3S7PA 3HLBA 2WAFA 1RP5A 3CHWP 2E8JA 2V0UA 3TE8A 4LGWA 3PBQA 1Y4OA 5CGWA 2K2NA 3SH9A 1CEFA 1Z09A 4EEUA 1BLCA 2Y2HA 4GKUA 4YNRA 3VFFA 4ARZB 3QP1A 4UQIS 5FQ9A 2CC1A 3EEHA 4BL2A 1ERQA 2Z6DA 1K38A 4I38A 2W1RA 1STZA 2ZOHA 4K0XA 3ICYA 1WYCA 3N6IA 3ITAA 1TF1A 1IKIA 3L7HA 2EFXA 4F3LA 2WGIA 4CPKA 1F2KA 1H5XA 1YKDA 4GB7A 3UE1A 2P74A 4KQRA 4BMWA 1W5DA 3IQAA 1MC0A 1IYOA 3MS6A 2HF6A 2IWCA 3VOYA 3G30A 3A3FA 2OLUA 2KOIA 4E6WA 2OLVA 3B42A 2ACGA 3H82A 3TOIA 4LCLA 3KO6A 3Q7ZA 5CHMA 4N9KA 2JKRI 3UE6A 3IX8A 2YKFA 3LCEA 4XXRA 1TD5A 2JKTI 4HQAA 3BYDA 3MQOA 5A90A 1N9BA 1OTAA 3G32A 4WMCA 2CMNA 5J3WA 4XT2A 4U0XA 1MPLA 5DTTA 1BYWA 3BRMA 4ME4A 3MR0A 4I3IA 1E3UD 1H3QA 5IS1A 5E2GA 4GDNA 2XGNA 5A91A 2L0WA 2INWA 1NWZA 5FATA 3RFBA 2VGKA 5CTNA 1LSXA 2ZM0A 4QHCA 3F1NA 3W2ZA 4KZ8A 2J8YA 5EVEA 3UB7A 1H8MA 3D9YA 4LFUA 1Y28A 2IWBA 2BLSA 5HL6A 4MN5A 3MZFA 4Y5FA 2EWVA 3HBRA 2PDRA 3LFVA 1JWPA 2PD8A 3CAXA 3N7WA 2ZM8A 2X71A 5F69A 1K57A 4R6LA 2B95A 3UB6A 4ZJ1A 2HDRA 2XDMA 3BY9A 1Y54A 5HAIA 1GHPA 3V5MA 1XFQA 3Q7VA 4U0TA 4EUZA 4EV4A 4CLCE 3B33A 3G2ZA 4IEDA 4PM6A 3NBLA 3SH7A 2ZL1B 4IBXA 5TBMA 2WKPA 3B3XA 5CX7A 4E6XA 4QB8A 4R3AA 1LI0A 2ZQ9A 3AGDA 2W3DA 4ZDXA 2J9PA 3C7UA 3U2AA 1YLPA 4HHDA 1XP4A 3F1OB 3LIAA 4Q0JA 3ZG7B 2KLIA 4N1HA 4MBFA 4DDYA 3CMZA 4BL3A 4E3LA 1GSXA 2LB9A 3EGDC 5DKKA 3UY6A 4P6BA 1K6SA 2PYRA 1HTZA 1QMEA 2HP5A 3QP5A 2A3UA 2XD5A 5G4YA 5HPFA 1G6AA 2WZXA 4KZBA 4OVDA 1IYSA 1YLWA 1MWTA 1L0GA 1ZHHB 5GLAA 3N8RA 4GCZA 5CHUA 1F98A 4GW9A 3TRCA 4LLOB 4R3BA 5DKLA 5MC7A 4HP9A 1DJBA 3T1XA 4N1XA 3PBSA 2WK0A 5FAOA 1KGEA 3FPVA 3WS5A 3H7WB 1IELA 4I39A 4JKTA 1PFLA 1FIKA 3A0VA 2EXAA 3T4KA 3IXDA 4WZ5C 3K2NA 3JVVA 3Q81A 1S66L 2HZ5A 4LENA 3RXWA 3MSHA 3VE3A 2XRNA 3ITBA 2XROA 3Q82A 2Q0OA 4HH2A 2PR5A 4FTXA 1PI4A 2B02A 1ERMA 3WS4A 4PHTA 3UPOA 3CZDA 3P09A 1BUEA 4LV0A 1MXOA 5L2FA 3SS4A 2K7SA 1W63M 1GSVA 3NOTC 1FR6A 4FH2A 1EW0A 3KSHA 1T1AA 3LUQA 3VFHA 4C3QA 1T18A 5FAQA 2Y2JA 2XSSA 5EOOA 4GZBA 3HREA 2Y4AA 1LT0A 2PHYA 2ZC4B 5EVIA 1K6RA 1FQGA 1OTEA 4ID4A 2QJ7A 5HDSA 3QNBA 1YLZA 4NXEA 4K08A 1GSWA 3EWKA 2QYBA 1ONGA 3KSIA 4JXWA 3AGEA 1I2SA 3Q1FA 2QKPA 3LY4A 1LL5A 3W4OA 2GZAA 3PAEA 4EQ1A 4KZAA 4CLCA 1VB6A 2H0YA 4QY6A 3NY4A 1V9ZA 3T1SA 1L0DA 4OPZA 3E2LA 4S2NC 3M2JA 1G68A 1OPXA 1HZOA 3A3JA 3MMHA 2PU2A 3S4XA 1XGJA 2JE5A 3BEBA 4OKPA 4QY5A 3E0YA 3R7WB 1D1JA 3L9KA 1F9IA 4IUKA 4LRZE 4R4RA 2EA9A 4LV3A 4KQQA 4KQOA 3O87A 1TDLA 3VOZA 2M7VA 4DMZA 3LIFA 2Y2NA 5CECA 1ESUA 4HP4A 1T1BA 4R3JA 4ZTKA 1FOFA 3G35A 4ZRRA 5EPHA 2W1TA 2ZJ9A 1VHMA 1TVFA 2C6WB 1K56A 2HP9A 4UQIM 3BECA 4R70A 1BULA 2Y2KA 2J9OA 1P0ZA 3MZDA 3VP0A 3E2KA 4MMNA 1VEUB 5AQAA 4Q8IA 1NLYA 4RVAA 5GHXA 4EU0A 2J7VA 1S67L 1VETB 5EM1A 5EE8A 4EW7A 1JNUA 2XQZA 5U47A 1V9YA 4R23A 1P97A 1D06A 1K55C 4WUJA 3IH8A 5DVAA 5HPIA 2H28A 3ZGAB 3KYQA 5HWWA 3CUEC 4OLDA 4KENB 1FCOA 5L10A 5CERA 4K91A 4Y0TA 5CHJA 5AVFA 4E04A 5C5KA 4O0PA 4EESA 4RQ9A 5A8BA 5M18A 2XEPA 5F1FA 2XD1A 1JWZA 2W3EA 1MWUA 4NXFA 2UWXA 2A2LA 5DFYA 5HWVA 4KG2A 1ACFA 1X0OA 5KIZA 4LV1A 4QWOA 2WUQA 1OTBA 1T1CA 1MBLA 3WWXA 1A0KA 3A0SA 4NKPA 2VJWA 3VP1A 2Y2PA 4PKYA 4Y2FA 1ES2A 4BD1A 5F6AA 4L9EA 1I5QA 3GVBA 2GJ3A 5AQ7A 3T4QA 1KGFA 2ZC6B 3T4LA 3LI9A 1CEGA 2V1BA 2WKEA 4Y3IA 4S2LA 4O8GA 2VV8A 3IS2B 5EUAA 4BBTA 1PWCA 2XR0A 4KUKA 5F68A 4A5RA 3H9WA 3IX4A 1S1ZA 3EOIA 1LHYA 3GMWA 2VV6A 5DJUA 1RGZA 2Y91A 3MQ0A 2HPBA 4BBVA 4BLMA 1DP9A 1LI9A 3VSLA 4E3IA 1MKMA 4L9GA 1S1YA 5I94A 3GECA 4KQDA 4JXSA 4OQGA 3HJKA 4UHUA 3G4PA 3C8CA 3UMDA 1YQSA 4AFIA 1H0MA 4HH3A 2EX9A 1PNEA 4DE0A 5HZHA 3BFFA 2OWJA 4DE3A 3NOPC 1WYBA 1PWGA 3CPTA 5FQIA 4DE2A 3BWLA 5CEDA 2DNSA 4S2KA 2WGWB 4X56A 1XGIA 3A3IA 4PM7A 1NRFA 1EI5A 4JGRA 1E3UA 4RYEA 3UB5P 4G3WA 1YLTA 3D72A 3C4PA 2V0WA 1ALQA 4PMAA 2QPNA 3E4PA 4PAUA 4G3KA 4OQ0A 2DCFA 4X68A 1IYQA 4Q0IA 3G6OA 3A0RA 2J80A 3IF6B 1L0FA 4KZ4A 2ZC3B 1DP6A 3ZVTA 2XA7S 2A24B 4OP5A 4R38A 3HLGA 1CI9A 3BLMA 1ZTUA 2Y2OA 5EM0A 3O5YA 4IUHA 4R4SA 2OAP1 2Y8HA 2P9VB 3NDEA 5K5BA 1O07A 1SHVA 3NC8A 2HDSA 3ZDJA 4LV2A 1SZVA 3VOLA 1TDGA 4HESA 2WGVA 4JBFA 1PZOA 4FOFA 4B9OA 2M1CA 3DAVA 5DF7A 4FCFA 3IWIA 3E98A 3CLOA 3SS5A 3IH9A 4GS9B 5FI7A 3KSGA 3DTIA 5CGXA 4MBKA 3UMEA 3IT9A 2VX8A 4HNBA 2E8IA 3TSGA 3IBJA 4P87A 5HSQA 5FDSA 4HJ4A 1DP8A 5IHVA 4WMCD 3BW6A 4EEPA 5FI6A 4B4ZA 2VA0A 4ARZA 2PBDP 2KDKA 4RX2A 3TW8A 3CJMA 2Y59A 4FSFA 3QHYA 3LYXA 1PYYA 4X69A 5GHZA 3D4FA 1SKFA 4H6JA 2PT7A 1N4OA 5AQ9A 1BT5A 4QD4A 3V3SA 5M1AA 5HD3A 2JBFA 3LO7A 3DWZA 4UA7A 5FAPA 1OTDA 2D01A 3LR0A 1SCWA 4BJPA 3CITA 2VGLS 3ZG0A 4Y15A 5HL1A 2IWDA 5GLDA 1I2WA 3ZNTA 3IXHA 2H5SA 3OLOA 3SS3A 5FASA 1PIOA 3UE3A 2O99A 2W27A 1EWZA 5HDDA 2O9BA 4QJGA 3PTEA 1NZUA 3ZCZA 5EFWA 5EV0A 2QMIA 1NXYA 1OT9A 4FH4A 4JPMA 1TEMA 4GLQA 2L1MA 1K54A 2J3WA 5TR7A 4I3JA 2V2FF 2ZOIA 1FSWA 1BTLA 1XJ6A 3QP4A 2X02A 1BLPA 5J7EA 3SOIA 3GDIA 3W4PA 1G6OA 3FWLA 5G18A 3KSFA 2WYXA 3VP2A 4RA7A 1G5UA 4X25A 4O01A 1K57C 4HBTA 4JLFA 4G3VA 5J4EA 4NK3A 3UN7A 4OQIA 4WZ4A 3HUNA 2W3FA 3PBOA 5GLBA 3MJQA 4IBRA 5EVLA 1FSYA 5CTMA 2Y55A 3SH8A 1ES4A 1ES5A 3QP8A 3RH8B 5DTSA 3WS2A 3S7NA 4Y7PA 3LICA 3C38A 2ZM2A 2Y2IA 4ZBEA 2V8FA 3VP3A 3G34A 4MN6A 2XFSA 1Q2PA 3BFDA 3C30A 3FV7A 3I7JA 1FCNA 3R4KA 2EX8A 4GJ4A 3GV9A 1NRJA 1LL9A 2EWWA 3GTCA 4YFMA 1PRQA 4M3KA 2ZL1A 4DE1A 4PM9A 1W63Q 2H0TA 4IHQA 1WA9A 3FG8A 4EERA 4EXOA 3IF6C 1YAXA 4I5SA 4WELA 3DTKA 1YPRA 2I9VA 1D7EA 3F1PB 3EEAA 1CJFA 4DDSA 4KZ5A 1RCJA 3NULA 1SKOA 5IU1A 1C3BA 3FKWA 1YSPA 3HL9A 3ZG9B 2NUPC 1NY0A 4UA6A 3F1OA 3UE0A
chains in the Genus database with same CATH topology
1DY6A 5DF9A 2OLUA 3MFDA 4E6WA 1MWSA 2OLVA 4X55A 5M18A 2XEPA 3G2YA 5F1FA 2XD1A 1JWZA 3M2KA 3TOIA 1YMSA 4KZ6A 4LCLA 3Q7ZA 5CHMA 5FQJA 3IF6A 3P98A 2FFYA 4N9KA 3UDXA 3C5AA 2DRWA 3MZEA 4E3OA 3PAGA 1MWUA 3LCEA 4XXRA 2UWXA 1ZG6A 4OQHA 4KG2A 4OP8A 1PW8A 4LV1A 3BYDA 2WUQA 5A90A 1GCEA 3OC2A 1N9BA 2P9VA 1GHMA 4PPRA 4KZ7A 1MBLA 4MBHA 5HAPA 3G32A 3AGFA 3WWXA 4WMCA 5HAQA 3VP1A 3UPPA 1JTDA 4OOLA 3VP4A 2Y2PA 4U0XA 1MPLA 3BFCA 5DTTA 2PU4A 1ES2A 3BFEA 5E2FA 5FA7A 3BRMA 5FSRA 4BD1A 2XLNA 1KE0A 1I5QA 1IEMA 3ZFZA 1E3UD 3GVBA 3JYIA 4MLLA 5E2GA 4GDNA 2XGNA 4XUXA 5A91A 2EX6A 3FZCA 5FATA 5AQ7A 2JCHA 4GD6A 3DTMA 2VGKA 1H8YA 2Y2MA 3W4QA 3DW0A 2VGJA 5CTNA 4ZJ3A 2X01A 1KGFA 2ZC6B 2ZM0A 2GDNA 2Y2LA 1ZKJA 1BZAA 1CEGA 4QHCA 2WKEA 5AQBA 4S2LA 1CK3A 1AXBA 3GRJA 4KZ8A 2J8YA 5HFOA 4X53A 1YMXA 5EUAA 1HVBA 1KDSA 2WADA 4L0LA 4WYYA 2EFUA 1PWCA 2XR0A 1E25A 2IWBA 3HUOA 1Z6FA 4NETA 1VM1A 4A5RA 2BLSA 2ZC7A 3MZFA 4S2NA 4JXGA 4EQIA 3HBRA 4ZJ2A 3A3DA 1LHYA 1BLHA 3WS0A 3GMWA 3OZHA 1RGZA 2Y91A 2XFTA 2HPBA 1JWPA 5F82A 5CXWA 1JTGA 2ZQCA 4BLMA 1BSGA 3FYZA 3NIAA 1LI9A 3N7WA 1FR1A 1K25A 3VSLA 4E3IA 2ZM8A 1GHIA 4GNUA 5A92A 4FD8A 2X71A 5I94A 1K57A 3UO9A 3TG9A 4ZJ1A 2RL3A 2HDRA 2XDMA 4S2IA 1IKGA 3M6BA 4JF6A 1Y54A 5HAIA 1GHPA 1WE4A 4BD0A 3CG5A 3V5MA 3BLSA 4KZ3A 4JXSA 4RX3A 4OQGA 3G31A 3Q7VA 1EROA 4U0TA 1S6RA 4K0WA 3G4PA 1NYMA 1YLYA 4UHUA 4EUZA 4EV4A 1YQSA 1KE4A 3G2ZA 4IEDA 2OSUA 4DKIA 2Z2LB 4PM6A 2EX9A 1SDNA 3NBLA 4DE0A 4E3MA 3SH7A 3BFFA 4DE3A 3V3RA 4IBXA 5KSHA 1WYBA 1PWGA 5JYPA 5FQIA 4DE2A 3HUMA 4OPQA 5F83A 1PZPA 1PWDA 1L0EA 3WRZA 3B3XA 1W79A 5CEDA 1M40A 1YLJA 2DNSA 4S2KA 2WGWB 4X56A 5E43A 1XGIA 4QB8A 4Z9QA 2ZQAA 3UPNA 1LI0A 4E6XA 2ZQ9A 4S2JA 2Y2GA 3A3IA 4MEZA 3S1YA 3WS1A 4DXBA 3AGDA 3WRTA 2WKIA 4PM7A 4EBLA 2Y2QA 3UDFA 1NRFA 4ZDXA 1E4DA 1EI5A 2J9PA 1E3UA 3IWOA 4RYEA 3C7UA 2XH9A 1YLTA 1K54C 3LEZA 3NI9A 3FKVA 3C4PA 1YLPA 5D3OA 4PM5A 1XP4A 1ALQA 5E2EA 4PMAA 3LY3A 2QPNA 1M6KA 1MY8A 3ZG7B 5FQMA 1ESIA 4OQ0A 4BQMA 4N1HA 4MBFA 1K55A 2EXBA 3CMZA 3O88A 4DDYA 4R0QA 4BL3A 2DCFA 4E3LA 1W8QA 1IYQA 4X68A 3GR2A 3UY6A 1YM1A 3MXSA 4P6BA 4P85A 1GA0A 5CRFA 1K6SA 4OOYA 3IF6B 1HTZA 1L0FA 1ZG4A 2WAEA 4KZ4A 3C7VA 2ZC3B 1QMEA 2HP5A 3ZVTA 1H8ZA 2XF3A 2A3UA 3ZG5A 1Q2QA 2XD5A 4H8RA 3HLGA 4GD8A 4OP5A 1CI9A 1G6AA 4GN2A 4C6YA 2WZXA 3BLMA 4IVIA 2Y2OA 4MNRA 4DF6A 5HW3A 4R4SA 4KZBA 5EVID 2P9VB 3NDEA 1IYSA 1YLWA 3HLFA 4OVDA 1MWTA 3DWKA 1L0GA 1O07A 1SHVA 1RGYA 2HDSA 3NC8A 5GLAA 3N8RA 5CHUA 4LV2A 3ZDJA 4WEJA 1XX2A 3OCNA 1TDGA 4HESA 3QNCA 4DXCA 2WGVA 1OMEA 1IYPA 1NJ4A 4JBFA 2R9WA 2R9XA 4S2MA 1PZOA 4WBGA 4R3BA 4E3NA 5M19A 1BLSA 1DJBA 2Z2MB 4N1XA 3PBSA 4JF5A 2B5RA 1PI5A 2Q9MA 2WK0A 2ZD8A 4S2PA 5DF7A 5FAOA 1KGEA 2ZQ8A 4ZAMA 3WS5A 5FQQA 1IELA 4FCFA 4HEFA 1LLBA 1XKZA 3OCLA 3HLEA 1J9MA 4JKTA 2G2UA 3IWIA 3BM6A 3SS5A 3IH9A 5FI7A 4E3JA 2EXAA 2WZZA 5DF8A 5CGXA 1XXMA 3IXDA 4MBKA 4WZ5C 4UA9A 3HVFA 3IT9A 1NZOA 2XK1A 3UNWA 3VSKA 3RXXA 3GQZA 2E8IA 1DJAA 3TSGA 3Q81A 4P87A 1YT4A 3N8LA 4LENA 3PBTA 3RXWA 1DJCA 5IHVA 1NYYA 4WMCD 5EVIC 5FI6A 3ITBA 4B4ZA 2V20A 3IXGA 3Q82A 4DRTA 1JWVA 2PBYA 3W8KA 1PI4A 2HP6A 4CJNA 1ERMA 4IVKA 3WS4A 3UPOA 4RX2A 4YINA 2HDUA 3CJMA 1MWRA 4LCMA 3CZDA 3P09A 1BUEA 5F1GA 4LV0A 1MXOA 2Y59A 4FSFA 5L2FA 1U60A 3SS4A 5EOEA 3QHYA 1PYYA 4X69A 5GHZA 3D4FA 1SKFA 1XA1A 1CI8A 3HLWA 1ES3A 1FR6A 4S2OA 1N4OA 3Q7VB 4FH2A 5AQ9A 1BT5A 2BG1A 4QD4A 1KVLA 4QU3A 3VFHA 3V3SA 4C3QA 2I72A 5M1AA 5FAQA 2Y2JA 2JBFA 4GDBA 5EOOA 4GZBA 3HREA 2Y4AA 3DWZA 3LO7A 4UA7A 5FAPA 5FQKA 1SCWA 3IF5A 4BJPA 4R1GA 4EBPA 2ZC4B 4B88A 5EVIA 5KSCA 3ZG0A 1QMFA 5HL1A 1K6RA 1FQGA 2A49A 2IWDA 1I2WA 5GLDA 3NCKA 3ZNTA 4ID4A 1GA9A 2EX2A 3IXHA 2H5SA 3O86A 3QNBA 4OOMA 5HARA 5HX9A 4OLGA 1YLZA 4Y0UA 5CGSA 1K56D 2ZC5B 4WEKA 3SS3A 3MXRA 4N92A 3V39A 3ZG8B 5FASA 5KMWA 1PIOA 2H10A 3ZNYA 4GOGA 3UE3A 1ONGA 5CEBA 5FI2A 4JXWA 1PW1A 3AGEA 1I2SA 2C5WB 1EWZA 3Q1FA 3ZHHA 4QJGA 1XA7A 1HD8A 3PTEA 5DTKA 1NZUA 2ZQ7A 4P0MA 3ZCZA 4WM9A 3LY4A 1LL5A 2QMIA 1NXYA 3IHAA 4FH4A 4JPMA 3W4OA 4KZ9A 4U3TA 1MKIA 2FFFB 1SDEA 1TEMA 3HLCA 3PAEA 3BFGA 3O3VA 3OPHA 4HBUA 4OH0A 3Q07A 1K54A 4KZAA 5TR7A 3V50A 2V2FF 2H0YA 4QY6A 1O7EA 1FSWA 3NY4A 3UDIA 1BTLA 3IHBA 1XPBA 4C75A 4EWFA 4B4XA 1VQQA 1KVMA 1L0DA 4JXVA 2X02A 1BLPA 2HDQA 4OPZA 5GLCA 3E2LA 3RJUA 3SOIA 3OPPA 1FCMA 2ZLYA 3W4PA 4S2NC 3M2JA 3N8SA 1G68A 3PBNA 1HZOA 3FWLA 4EBNA 3A3JA 5TFQA 2OV5A 4E3KA 2PU2A 1L2SA 3S4XA 5G18A 3OPRA 5BOHA 1W7FA 1XGJA 2JE5A 3BEBA 4OKPA 4QY5A 2WYXA 3VP2A 4BENA 2WKHA 3EQVA 4Y0OA 4RA7A 5EECA 4PM8A 4KG6A 3HLDA 1K4EA 4R4RA 3VMAA 1KGGA 3ISGA 4LV3A 4KQQA 3IXBA 4KQOA 2RCXA 3O87A 1K57C 1TDLA 3NDGA 4HBTA 4JLFA 3VOZA 3A3EA 4NK3A 2Q9NA 3UN7A 3N4IA 4D2OA 2ZMAA 1ZC2A 4OQIA 4WZ4A 3HUNA 3M6HA 3PBOA 3HLBA 2WAFA 2Y2NA 5CECA 2JC7A 1ESUA 1RP5A 4OPRA 5GLBA 4R3JA 4ZTKA 4IBRA 5EVLA 3IWQA 1FSYA 5CTMA 1FOFA 2V1ZA 2Y55A 3MKEA 3PBQA 3SH8A 3MBZA 1ES4A 1ES5A 3G35A 5CGWA 5DTSA 5EPHA 3WS2A 2ZJ9A 4Y7PA 4O7DA 1KE3A 2ZM2A 5GL9A 2Y2IA 5J8XA 4ZBEA 3VP3A 1TVFA 2C6WB 1K56A 3G34A 4OPYA 3SH9A 4F94A 2HP9A 2XFSA 4KG5A 1Q2PA 3BFDA 3FV7A 1CEFA 3BECA 3I7JA 1FCNA 1BLCA 2Y2HA 1BULA 2Y2KA 4GKUA 4X6TA 5GHYA 2EX8A 2J9OA 3GV9A 1LL9A 1W8YA 2ZQDA 5A93A 3MZDA 3VP0A 3VFFA 3E2KA 3GTCA 4XUZA 2G2WA 5AQAA 4YFMA 5FQ9A 4Q8IA 1K4FA 2CC1A 4RVAA 4WZ5A 4M3KA 5GHXA 4DE1A 4BL2A 4PM9A 3EQUA 1ERQA 1K38A 2H0TA 3ZVWA 2J7VA 1JVJA 3MKFA 4K0XA 1WYCA 3N6IA 2WGWA 3IF6C 5EE8A 3ITAA 2XQZA 1IKIA 1KDWA 4WELA 5E2HA 5U47A 2EFXA 4JF4A 4R23A 5JYOA 1K55C 2WGIA 4CPKA 3C4OA 4DDSA 4OONA 1H5XA 3OPLA 1RCJA 3IH8A 4KZ5A 4GB7A 5DVAA 3ZGAB 1C3BA 1S0WA 3FKWA 3UE1A 2P74A 4KQRA 4OLDA 2QZ6A 5FDHA 3HL9A 1W5DA 5EVIB 1ONHA 4KENB 4UAAA 3ZG9B 3IQAA 1NY0A 1FCOA 4UA6A 5TGFA 5CERA 4K91A 4Y0TA 3S22A 5KZHA 1IYOA 2IWCA 5CHJA 3PBRA 3VOYA 3UE0A 3G30A 3GSGA 4N9LA 3A3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DY6 A;  5DF9 A;  2OLU A;  3MFD A;  4E6W A;  1MWS A;  2OLV A;  4X55 A;  5M18 A;  2XEP A;  3G2Y A;  5F1F A;  2XD1 A;  1JWZ A;  3M2K A;  3TOI A;  1YMS A;  4KZ6 A;  4LCL A;  3Q7Z A;  5CHM A;  5FQJ A;  3IF6 A;  3P98 A;  2FFY A;  4N9K A;  3UDX A;  3C5A A;  2DRW A;  3MZE A;  4E3O A;  3PAG A;  1MWU A;  3LCE A;  4XXR A;  2UWX A;  1ZG6 A;  4OQH A;  4KG2 A;  4OP8 A;  1PW8 A;  4LV1 A;  3BYD A;  2WUQ A;  5A90 A;  1GCE A;  3OC2 A;  1N9B A;  2P9V A;  1GHM A;  4PPR A;  4KZ7 A;  1MBL A;  4MBH A;  5HAP A;  3G32 A;  3AGF A;  3WWX A;  4WMC A;  5HAQ A;  3VP1 A;  3UPP A;  1JTD A;  4OOL A;  3VP4 A;  2Y2P A;  4U0X A;  1MPL A;  3BFC A;  5DTT A;  2PU4 A;  1ES2 A;  3BFE A;  5E2F A;  5FA7 A;  3BRM A;  5FSR A;  4BD1 A;  2XLN A;  1KE0 A;  1I5Q A;  1IEM A;  3ZFZ A;  1E3U D;  3GVB A;  3JYI A;  4MLL A;  5E2G A;  4GDN A;  2XGN A;  4XUX A;  5A91 A;  2EX6 A;  3FZC A;  5FAT A;  5AQ7 A;  2JCH A;  4GD6 A;  3DTM A;  2VGK A;  1H8Y A;  2Y2M A;  3W4Q A;  3DW0 A;  2VGJ A;  5CTN A;  4ZJ3 A;  2X01 A;  1KGF A;  2ZC6 B;  2ZM0 A;  2GDN A;  2Y2L A;  1ZKJ A;  1BZA A;  1CEG A;  4QHC A;  2WKE A;  5AQB A;  4S2L A;  1CK3 A;  1AXB A;  3GRJ A;  4KZ8 A;  2J8Y A;  5HFO A;  4X53 A;  1YMX A;  5EUA A;  1HVB A;  1KDS A;  2WAD A;  4L0L A;  4WYY A;  2EFU A;  1PWC A;  2XR0 A;  1E25 A;  2IWB A;  3HUO A;  1Z6F A;  4NET A;  1VM1 A;  4A5R A;  2BLS A;  2ZC7 A;  3MZF A;  4S2N A;  4JXG A;  4EQI A;  3HBR A;  4ZJ2 A;  3A3D A;  1LHY A;  1BLH A;  3WS0 A;  3GMW A;  3OZH A;  1RGZ A;  2Y91 A;  2XFT A;  2HPB A;  1JWP A;  5F82 A;  5CXW A;  1JTG A;  2ZQC A;  4BLM A;  1BSG A;  3FYZ A;  3NIA A;  1LI9 A;  3N7W A;  1FR1 A;  1K25 A;  3VSL A;  4E3I A;  2ZM8 A;  1GHI A;  4GNU A;  5A92 A;  4FD8 A;  2X71 A;  5I94 A;  1K57 A;  3UO9 A;  3TG9 A;  4ZJ1 A;  2RL3 A;  2HDR A;  2XDM A;  4S2I A;  1IKG A;  3M6B A;  4JF6 A;  1Y54 A;  5HAI A;  1GHP A;  1WE4 A;  4BD0 A;  3CG5 A;  3V5M A;  3BLS A;  4KZ3 A;  4JXS A;  4RX3 A;  4OQG A;  3G31 A;  3Q7V A;  1ERO A;  4U0T A;  1S6R A;  4K0W A;  3G4P A;  1NYM A;  1YLY A;  4UHU A;  4EUZ A;  4EV4 A;  1YQS A;  1KE4 A;  3G2Z A;  4IED A;  2OSU A;  4DKI A;  2Z2L B;  4PM6 A;  2EX9 A;  1SDN A;  3NBL A;  4DE0 A;  4E3M A;  3SH7 A;  3BFF A;  4DE3 A;  3V3R A;  4IBX A;  5KSH A;  1WYB A;  1PWG A;  5JYP A;  5FQI A;  4DE2 A;  3HUM A;  4OPQ A;  5F83 A;  1PZP A;  1PWD A;  1L0E A;  3WRZ A;  3B3X A;  1W79 A;  5CED A;  1M40 A;  1YLJ A;  2DNS A;  4S2K A;  2WGW B;  4X56 A;  5E43 A;  1XGI A;  4QB8 A;  4Z9Q A;  2ZQA A;  3UPN A;  1LI0 A;  4E6X A;  2ZQ9 A;  4S2J A;  2Y2G A;  3A3I A;  4MEZ A;  3S1Y A;  3WS1 A;  4DXB A;  3AGD A;  3WRT A;  2WKI A;  4PM7 A;  4EBL A;  2Y2Q A;  3UDF A;  1NRF A;  4ZDX A;  1E4D A;  1EI5 A;  2J9P A;  1E3U A;  3IWO A;  4RYE A;  3C7U A;  2XH9 A;  1YLT A;  1K54 C;  3LEZ A;  3NI9 A;  3FKV A;  3C4P A;  1YLP A;  5D3O A;  4PM5 A;  1XP4 A;  1ALQ A;  5E2E A;  4PMA A;  3LY3 A;  2QPN A;  1M6K A;  1MY8 A;  3ZG7 B;  5FQM A;  1ESI A;  4OQ0 A;  4BQM A;  4N1H A;  4MBF A;  1K55 A;  2EXB A;  3CMZ A;  3O88 A;  4DDY A;  4R0Q A;  4BL3 A;  2DCF A;  4E3L A;  1W8Q A;  1IYQ A;  4X68 A;  3GR2 A;  3UY6 A;  1YM1 A;  3MXS A;  4P6B A;  4P85 A;  1GA0 A;  5CRF A;  1K6S A;  4OOY A;  3IF6 B;  1HTZ A;  1L0F A;  1ZG4 A;  2WAE A;  4KZ4 A;  3C7V A;  2ZC3 B;  1QME A;  2HP5 A;  3ZVT A;  1H8Z A;  2XF3 A;  2A3U A;  3ZG5 A;  1Q2Q A;  2XD5 A;  4H8R A;  3HLG A;  4GD8 A;  4OP5 A;  1CI9 A;  1G6A A;  4GN2 A;  4C6Y A;  2WZX A;  3BLM A;  4IVI A;  2Y2O A;  4MNR A;  4DF6 A;  5HW3 A;  4R4S A;  4KZB A;  5EVI D;  2P9V B;  3NDE A;  1IYS A;  1YLW A;  3HLF A;  4OVD A;  1MWT A;  3DWK A;  1L0G A;  1O07 A;  1SHV A;  1RGY A;  2HDS A;  3NC8 A;  5GLA A;  3N8R A;  5CHU A;  4LV2 A;  3ZDJ A;  4WEJ A;  1XX2 A;  3OCN A;  1TDG A;  4HES A;  3QNC A;  4DXC A;  2WGV A;  1OME A;  1IYP A;  1NJ4 A;  4JBF A;  2R9W A;  2R9X A;  4S2M A;  1PZO A;  4WBG A;  4R3B A;  4E3N A;  5M19 A;  1BLS A;  1DJB A;  2Z2M B;  4N1X A;  3PBS A;  4JF5 A;  2B5R A;  1PI5 A;  2Q9M A;  2WK0 A;  2ZD8 A;  4S2P A;  5DF7 A;  5FAO A;  1KGE A;  2ZQ8 A;  4ZAM A;  3WS5 A;  5FQQ A;  1IEL A;  4FCF A;  4HEF A;  1LLB A;  1XKZ A;  3OCL A;  3HLE A;  1J9M A;  4JKT A;  2G2U A;  3IWI A;  3BM6 A;  3SS5 A;  3IH9 A;  5FI7 A;  4E3J A;  2EXA A;  2WZZ A;  5DF8 A;  5CGX A;  1XXM A;  3IXD A;  4MBK A;  4WZ5 C;  4UA9 A;  3HVF A;  3IT9 A;  1NZO A;  2XK1 A;  3UNW A;  3VSK A;  3RXX A;  3GQZ A;  2E8I A;  1DJA A;  3TSG A;  3Q81 A;  4P87 A;  1YT4 A;  3N8L A;  4LEN A;  3PBT A;  3RXW A;  1DJC A;  5IHV A;  1NYY A;  4WMC D;  5EVI C;  5FI6 A;  3ITB A;  4B4Z A;  2V20 A;  3IXG A;  3Q82 A;  4DRT A;  1JWV A;  2PBY A;  3W8K A;  1PI4 A;  2HP6 A;  4CJN A;  1ERM A;  4IVK A;  3WS4 A;  3UPO A;  4RX2 A;  4YIN A;  2HDU A;  3CJM A;  1MWR A;  4LCM A;  3CZD A;  3P09 A;  1BUE A;  5F1G A;  4LV0 A;  1MXO A;  2Y59 A;  4FSF A;  5L2F A;  1U60 A;  3SS4 A;  5EOE A;  3QHY A;  1PYY A;  4X69 A;  5GHZ A;  3D4F A;  1SKF A;  1XA1 A;  1CI8 A;  3HLW A;  1ES3 A;  1FR6 A;  4S2O A;  1N4O A;  3Q7V B;  4FH2 A;  5AQ9 A;  1BT5 A;  2BG1 A;  4QD4 A;  1KVL A;  4QU3 A;  3VFH A;  3V3S A;  4C3Q A;  2I72 A;  5M1A A;  5FAQ A;  2Y2J A;  2JBF A;  4GDB A;  5EOO A;  4GZB A;  3HRE A;  2Y4A A;  3DWZ A;  3LO7 A;  4UA7 A;  5FAP A;  5FQK A;  1SCW A;  3IF5 A;  4BJP A;  4R1G A;  4EBP A;  2ZC4 B;  4B88 A;  5EVI A;  5KSC A;  3ZG0 A;  1QMF A;  5HL1 A;  1K6R A;  1FQG A;  2A49 A;  2IWD A;  1I2W A;  5GLD A;  3NCK A;  3ZNT A;  4ID4 A;  1GA9 A;  2EX2 A;  3IXH A;  2H5S A;  3O86 A;  3QNB A;  4OOM A;  5HAR A;  5HX9 A;  4OLG A;  1YLZ A;  4Y0U A;  5CGS A;  1K56 D;  2ZC5 B;  4WEK A;  3SS3 A;  3MXR A;  4N92 A;  3V39 A;  3ZG8 B;  5FAS A;  5KMW A;  1PIO A;  2H10 A;  3ZNY A;  4GOG A;  3UE3 A;  1ONG A;  5CEB A;  5FI2 A;  4JXW A;  1PW1 A;  3AGE A;  1I2S A;  2C5W B;  1EWZ A;  3Q1F A;  3ZHH A;  4QJG A;  1XA7 A;  1HD8 A;  3PTE A;  5DTK A;  1NZU A;  2ZQ7 A;  4P0M A;  3ZCZ A;  4WM9 A;  3LY4 A;  1LL5 A;  2QMI A;  1NXY A;  3IHA A;  4FH4 A;  4JPM A;  3W4O A;  4KZ9 A;  4U3T A;  1MKI A;  2FFF B;  1SDE A;  1TEM A;  3HLC A;  3PAE A;  3BFG A;  3O3V A;  3OPH A;  4HBU A;  4OH0 A;  3Q07 A;  1K54 A;  4KZA A;  5TR7 A;  3V50 A;  2V2F F;  2H0Y A;  4QY6 A;  1O7E A;  1FSW A;  3NY4 A;  3UDI A;  1BTL A;  3IHB A;  1XPB A;  4C75 A;  4EWF A;  4B4X A;  1VQQ A;  1KVM A;  1L0D A;  4JXV A;  2X02 A;  1BLP A;  2HDQ A;  4OPZ A;  5GLC A;  3E2L A;  3RJU A;  3SOI A;  3OPP A;  1FCM A;  2ZLY A;  3W4P A;  4S2N C;  3M2J A;  3N8S A;  1G68 A;  3PBN A;  1HZO A;  3FWL A;  4EBN A;  3A3J A;  5TFQ A;  2OV5 A;  4E3K A;  2PU2 A;  1L2S A;  3S4X A;  5G18 A;  3OPR A;  5BOH A;  1W7F A;  1XGJ A;  2JE5 A;  3BEB A;  4OKP A;  4QY5 A;  2WYX A;  3VP2 A;  4BEN A;  2WKH A;  3EQV A;  4Y0O A;  4RA7 A;  5EEC A;  4PM8 A;  4KG6 A;  3HLD A;  1K4E A;  4R4R A;  3VMA A;  1KGG A;  3ISG A;  4LV3 A;  4KQQ A;  3IXB A;  4KQO A;  2RCX A;  3O87 A;  1K57 C;  1TDL A;  3NDG A;  4HBT A;  4JLF A;  3VOZ A;  3A3E A;  4NK3 A;  2Q9N A;  3UN7 A;  3N4I A;  4D2O A;  2ZMA A;  1ZC2 A;  4OQI A;  4WZ4 A;  3HUN A;  3M6H A;  3PBO A;  3HLB A;  2WAF A;  2Y2N A;  5CEC A;  2JC7 A;  1ESU A;  1RP5 A;  4OPR A;  5GLB A;  4R3J A;  4ZTK A;  4IBR A;  5EVL A;  3IWQ A;  1FSY A;  5CTM A;  1FOF A;  2V1Z A;  2Y55 A;  3MKE A;  3PBQ A;  3SH8 A;  3MBZ A;  1ES4 A;  1ES5 A;  3G35 A;  5CGW A;  5DTS A;  5EPH A;  3WS2 A;  2ZJ9 A;  4Y7P A;  4O7D A;  1KE3 A;  2ZM2 A;  5GL9 A;  2Y2I A;  5J8X A;  4ZBE A;  3VP3 A;  1TVF A;  2C6W B;  1K56 A;  3G34 A;  4OPY A;  3SH9 A;  4F94 A;  2HP9 A;  2XFS A;  4KG5 A;  1Q2P A;  3BFD A;  3FV7 A;  1CEF A;  3BEC A;  3I7J A;  1FCN A;  1BLC A;  2Y2H A;  1BUL A;  2Y2K A;  4GKU A;  4X6T A;  5GHY A;  2EX8 A;  2J9O A;  3GV9 A;  1LL9 A;  1W8Y A;  2ZQD A;  5A93 A;  3MZD A;  3VP0 A;  3VFF A;  3E2K A;  3GTC A;  4XUZ A;  2G2W A;  5AQA A;  4YFM A;  5FQ9 A;  4Q8I A;  1K4F A;  2CC1 A;  4RVA A;  4WZ5 A;  4M3K A;  5GHX A;  4DE1 A;  4BL2 A;  4PM9 A;  3EQU A;  1ERQ A;  1K38 A;  2H0T A;  3ZVW A;  2J7V A;  1JVJ A;  3MKF A;  4K0X A;  1WYC A;  3N6I A;  2WGW A;  3IF6 C;  5EE8 A;  3ITA A;  2XQZ A;  1IKI A;  1KDW A;  4WEL A;  5E2H A;  5U47 A;  2EFX A;  4JF4 A;  4R23 A;  5JYO A;  1K55 C;  2WGI A;  4CPK A;  3C4O A;  4DDS A;  4OON A;  1H5X A;  3OPL A;  1RCJ A;  3IH8 A;  4KZ5 A;  4GB7 A;  5DVA A;  3ZGA B;  1C3B A;  1S0W A;  3FKW A;  3UE1 A;  2P74 A;  4KQR A;  4OLD A;  2QZ6 A;  5FDH A;  3HL9 A;  1W5D A;  5EVI B;  1ONH A;  4KEN B;  4UAA A;  3ZG9 B;  3IQA A;  1NY0 A;  1FCO A;  4UA6 A;  5TGF A;  5CER A;  4K91 A;  4Y0T A;  3S22 A;  5KZH A;  1IYO A;  2IWC A;  5CHJ A;  3PBR A;  3VOY A;  3UE0 A;  3G30 A;  3GSG A;  4N9L A;  3A3F A; 
#chains in the Genus database with same CATH topology
 5DF9 A;  4II7 A;  3G2Y A;  4NXB A;  4KZ6 A;  4GHI B;  3UDX A;  2DRW A;  1ODV A;  3MZE A;  3PAG A;  4M4X A;  3K3C A;  4OQH A;  4HIA A;  4OP8 A;  1P9R A;  1PW8 A;  3UB8 A;  1GCE A;  3OC2 A;  5HAP A;  3KYZ A;  3AGF A;  1J3W A;  4FUW A;  2ZMF A;  4BBU A;  3BQ8 A;  3VP4 A;  2OOL A;  5E2F A;  5FA7 A;  3SW1 A;  2XLN A;  1KE0 A;  1DRM A;  1OTI A;  3ZQ5 A;  2EX6 A;  4YOF A;  2OWH A;  2JCH A;  3DTM A;  5HWT A;  3K3D A;  2Y2M A;  3W4Q A;  4HOI A;  3EGX C;  2GDN A;  1ZKJ A;  3T4J A;  3H7W A;  5AQB A;  1TS6 A;  1AXB A;  2JKF A;  5HFO A;  2LB5 A;  4X53 A;  1YMX A;  1HVB A;  1KDS A;  2WAD A;  4WYY A;  2EFU A;  5TJJ A;  1E25 A;  1VM1 A;  2PR6 A;  4JXG A;  4ZJ2 A;  3A3D A;  3OZH A;  2XFT A;  5F82 A;  5CXW A;  2L4R A;  1L3L A;  3FYZ A;  1FR1 A;  1K25 A;  4GNU A;  3RTY A;  3TG9 A;  1OT6 A;  4DJ2 A;  4S2I A;  3M6B A;  4JF6 A;  1AWI A;  1N9L A;  1WE4 A;  4BD0 A;  4KZ3 A;  4RX3 A;  2PD7 A;  4JGP A;  1S6R A;  1NYM A;  3QP2 A;  3FPW A;  1KE4 A;  2OSU A;  2Z2L B;  2P08 A;  1SDN A;  3V3R A;  5KSH A;  5JYP A;  2WKR A;  5F83 A;  1PWD A;  3UPN A;  3BJN A;  4Z9Q A;  2ZQA A;  4S2J A;  4MEZ A;  3S1Y A;  4F3L B;  2HJE A;  3NEC A;  4L9F A;  2W0N A;  1KOU A;  3IWO A;  2XH9 A;  2YKH A;  1TS7 A;  2HGV A;  5D3O A;  1S4R A;  2K31 A;  1OJ5 A;  4WL9 A;  1TS8 A;  3LY3 A;  1M6K A;  1MY8 A;  5FQM A;  2EXB A;  3O88 A;  4R0Q A;  2XA7 M;  3H82 B;  1XJ2 A;  1YM1 A;  4P85 A;  1GA0 A;  1XJ4 A;  5CRF A;  2WAE A;  1ZG4 A;  2KX6 A;  3C7V A;  4Q0H A;  3C2W A;  3ZG5 A;  4GD8 A;  2AVX A;  4IVI A;  3PXP A;  5HW3 A;  1NLZ A;  2JHE A;  3DWK A;  2GX5 A;  4DXC A;  3R7W A;  2GNX A;  4XT2 B;  1OME A;  1IYP A;  1NJ4 A;  3IX3 A;  1BLS A;  2VZW A;  4JF5 A;  2B5R A;  2Q9M A;  2ZD8 A;  4S2P A;  2OAQ 1;  2M7U A;  4ZAM A;  4NG2 A;  3NOU C;  3F1N B;  4HEF A;  1LLB A;  3OCL A;  3HLE A;  1J9M A;  2G2U A;  2V1A A;  4DN0 A;  2FH5 A;  2MJ6 A;  5DF8 A;  4UA9 A;  2XK1 A;  3VSK A;  3RXX A;  3GQZ A;  1DJA A;  3UB9 A;  1YT4 A;  3KYE A;  1NYY A;  5AVE A;  3IXG A;  1JWV A;  3W8K A;  1VEU A;  2HP6 A;  2O0Y A;  4CJN A;  4IVK A;  4YIN A;  2HDU A;  2QJ5 A;  3LR3 A;  2ZMV A;  3TJZ C;  1VET A;  3E4Q A;  5F5Y A;  3HLW A;  1ES3 A;  4S2O A;  3Q7V B;  5L8M A;  4LRY C;  2BG1 A;  2VGL M;  2I72 A;  4GDB A;  4H6J B;  3U4L P;  3V67 A;  3IF5 A;  3CI6 A;  4EBP A;  1HLU P;  5TBM B;  4B88 A;  5KSC A;  1QMF A;  3PHY A;  2A49 A;  3NCK A;  1GA9 A;  2EX2 A;  3MQQ A;  3O86 A;  3P01 A;  5HX9 A;  4NXG A;  5CGS A;  3LIB A;  3MXR A;  3V39 A;  3ZG8 B;  5KMW A;  2H10 A;  3ZNY A;  4HJ6 A;  3ZHH A;  1XA7 A;  5DTK A;  4P0M A;  4P6Z S;  4WM9 A;  3P7N A;  1MKI A;  2FFF B;  3HLC A;  4HBU A;  3OPH A;  4OH0 A;  3LID A;  2B18 A;  3V50 A;  2VLG A;  2W3G A;  2VEA A;  4C75 A;  3IHB A;  1XPB A;  4EWF A;  1VQQ A;  1KVM A;  5GLC A;  3S7O A;  1T19 A;  3RJU A;  3OPP A;  3FC7 A;  3SZT A;  2QHK A;  2OV5 A;  3B47 A;  4E3K A;  1L2S A;  3OPR A;  3VV4 A;  4BEN A;  2WKH A;  5FEF A;  4Y0O A;  3CWF A;  3HLD A;  4KG6 A;  1K4E A;  3VMA A;  3IS2 A;  4PKY G;  1KGG A;  5L07 A;  3ISG A;  4HJ3 A;  1LSW A;  4B93 A;  3A3E A;  4LRX C;  3N4I A;  3DBA A;  2ZMA A;  1ZC2 A;  3M6H A;  2JC7 A;  4OPR A;  3IWQ A;  1YSQ A;  2O9C A;  2V1Z A;  3MKE A;  3MBZ A;  2ZBB A;  2FZ0 A;  5IT5 A;  1LSV A;  4NEE D;  4O7D A;  4WF0 A;  4ETX A;  1KE3 A;  5GL9 A;  5J8X A;  5DFX A;  4F94 A;  4OPY A;  4KG5 A;  2JN7 A;  4X6T A;  5GHY A;  2NUT C;  2HV1 A;  4WN5 A;  1W8Y A;  2ZQD A;  5A93 A;  4XUZ A;  2G2W A;  1K4F A;  4WZ5 A;  2PAV P;  3OOV A;  3EQU A;  3ZVW A;  1JVJ A;  3MKF A;  2WGW A;  3BQA A;  5E2H A;  1KDW A;  4ETZ A;  4JF4 A;  4Z1W A;  5JYO A;  2R78 A;  3C4O A;  4LPZ A;  4OON A;  3OPL A;  1S0W A;  2QZ6 A;  5FDH A;  5EVI B;  5HD5 A;  1ONH A;  4UAA A;  5TGF A;  3S22 A;  5KZH A;  3PBR A;  3GSG A;  4N9L A;  4MDZ A;  1SKO B;  5DJT A;  3N8L A;  2WKQ A;  1DY6 A;  5G4Z A;  3MFD A;  4HY8 A;  1MWS A;  2P04 A;  4X55 A;  3M2K A;  3MFX A;  1YMS A;  2VKS A;  5FQJ A;  3IF6 A;  3P98 A;  2FFY A;  3C5A A;  5FEG A;  4E3O A;  2Y79 A;  2A24 A;  1ZG6 A;  4JGQ A;  1TS0 A;  2P9V A;  1GHM A;  4PPR A;  4KZ7 A;  4MBH A;  1OJG A;  4CLC B;  5HAQ A;  3UPP A;  1JTD A;  4OOL A;  3BFC A;  4UEY A;  2PU4 A;  3BFE A;  5FSR A;  2BAS A;  1IEM A;  3ZFZ A;  4MLL A;  3JYI A;  2W3H A;  4XUX A;  3E4O A;  2JKR M;  3FZC A;  1MZU A;  1UWP X;  2HJ9 C;  2JKG A;  4GD6 A;  2JKT M;  1H8Y A;  3DW0 A;  2VGJ A;  1XJ3 A;  4ZJ3 A;  2X01 A;  5FL3 A;  2Y2L A;  1BZA A;  4DJ3 A;  4YWZ A;  1CK3 A;  3GRJ A;  3JPU A;  4L0L A;  4GS9 A;  3HUO A;  1Z6F A;  4NET A;  3ZYT A;  2ZC7 A;  4S2N A;  4EQI A;  3WS0 A;  1BLH A;  4Y17 A;  1P9W A;  2V8C A;  1K0K A;  1JTG A;  2ZQC A;  5HDC A;  1BSG A;  3NIA A;  5A92 A;  1GHI A;  4FD8 A;  2W1T B;  1IFQ A;  3UO9 A;  2VV7 A;  2RL3 A;  1IKG A;  2Z6C A;  3CG5 A;  3BLS A;  4EET B;  3G31 A;  1ERO A;  4K0W A;  1YLY A;  2V9A A;  4DKI A;  4MCW A;  4E3M A;  4JGO A;  1S4S A;  3HUM A;  4EUV A;  4OPQ A;  1PZP A;  3WRZ A;  1L0E A;  1W79 A;  1M40 A;  1YLJ A;  5E43 A;  1G28 A;  2Y2G A;  3WS1 A;  4DXB A;  3LEQ A;  3WRT A;  2WKI A;  4EBL A;  2Y2Q A;  3UDF A;  2J3T D;  4HI4 A;  3HJI A;  1E4D A;  1K54 C;  3LEZ A;  3NI9 A;  2D02 A;  3FKV A;  2BTF P;  4PM5 A;  5E2E A;  3VE4 A;  3DTE A;  1ESI A;  4BQM A;  1K55 A;  1W8Q A;  1XFN A;  3GR2 A;  3MXS A;  4OOY A;  2O9A A;  4WLA A;  3CUE A;  5LBR A;  1H8Z A;  2XF3 A;  1FIL A;  1Q2Q A;  4H8R A;  3T1Q B;  2QWS A;  1UWN X;  4GN2 A;  4C6Y A;  4MNR A;  4DF6 A;  5EVI D;  3HLF A;  1RGY A;  1UGU A;  4WEJ A;  1XX2 A;  1CF0 A;  3OCN A;  3QNC A;  2J3T C;  2R9W A;  5AJG A;  2R9X A;  4S2M A;  3S7Q A;  4ESP A;  4E3N A;  4WBG A;  5M19 A;  3T12 B;  2Z2M B;  3PR6 A;  3T4S A;  4MN7 A;  2P7J A;  1PI5 A;  3LI8 A;  2ZQ8 A;  3NHQ A;  1N9O A;  5FQQ A;  1LL8 A;  1XKZ A;  3BM6 A;  4BWI A;  3HCY A;  3MF0 A;  4E3J A;  2WZZ A;  1XXM A;  4CLC D;  3HVF A;  1NZO A;  3PYP A;  3UNW A;  3PBT A;  1DJC A;  1CQA A;  1IOU A;  5EVI C;  4I3A A;  2V20 A;  4DRT A;  2PBY A;  3T1R A;  4LCM A;  1MWR A;  5F1G A;  1U60 A;  4X1M A;  5EOE A;  4CQH A;  1XA1 A;  1CI8 A;  3MXQ A;  5L09 A;  3NJA A;  3ULF A;  2DMW A;  4QPR A;  3F1P A;  1KVL A;  4QU3 A;  3JVU A;  4D60 A;  1F5M A;  5FQK A;  3CPT B;  4R1G A;  3LR4 A;  4X1L A;  4CLC C;  4OOM A;  3OBF A;  5HAR A;  4OLG A;  2PYP A;  1N9N A;  4Y0U A;  1K56 D;  2ZC5 B;  4WEK A;  2G7U A;  4N92 A;  4P6Z M;  5CEB A;  4GOG A;  4GHI A;  5FI2 A;  1PW1 A;  3D3O A;  4Y13 A;  2C5W B;  3T4O A;  3LGO A;  1HD8 A;  2ZQ7 A;  3KX0 X;  3IHA A;  4KZ9 A;  4U3T A;  3QP6 A;  1SDE A;  3BFG A;  3O3V A;  3Q07 A;  2UV0 E;  2PRF A;  1O7E A;  4IJG A;  3UDI A;  2IA2 A;  4B4X A;  4JXV A;  2HDQ A;  1FCM A;  2ZLY A;  3N8S A;  3PBN A;  4EBN A;  5TFQ A;  2VK3 A;  5BOH A;  1W7F A;  3T50 A;  4KUO A;  3EQV A;  5I5L A;  5EEC A;  4PM8 A;  3IBR A;  3IXB A;  2RCX A;  3NDG A;  3LR5 A;  2Q9N A;  4D2O A;  3LIE A;  3BY8 A;  3T4T A;  3S7P A;  3HLB A;  2WAF A;  1RP5 A;  3CHW P;  2E8J A;  2V0U A;  3TE8 A;  4LGW A;  3PBQ A;  1Y4O A;  5CGW A;  2K2N A;  3SH9 A;  1CEF A;  1Z09 A;  4EEU A;  1BLC A;  2Y2H A;  4GKU A;  4YNR A;  3VFF A;  4ARZ B;  3QP1 A;  4UQI S;  5FQ9 A;  2CC1 A;  3EEH A;  4BL2 A;  1ERQ A;  2Z6D A;  1K38 A;  4I38 A;  2W1R A;  1STZ A;  2ZOH A;  4K0X A;  3ICY A;  1WYC A;  3N6I A;  3ITA A;  1TF1 A;  1IKI A;  3L7H A;  2EFX A;  4F3L A;  2WGI A;  4CPK A;  1F2K A;  1H5X A;  1YKD A;  4GB7 A;  3UE1 A;  2P74 A;  4KQR A;  4BMW A;  1W5D A;  3IQA A;  1MC0 A;  1IYO A;  3MS6 A;  2HF6 A;  2IWC A;  3VOY A;  3G30 A;  3A3F A;  2OLU A;  2KOI A;  4E6W A;  2OLV A;  3B42 A;  2ACG A;  3H82 A;  3TOI A;  4LCL A;  3KO6 A;  3Q7Z A;  5CHM A;  4N9K A;  2JKR I;  3UE6 A;  3IX8 A;  2YKF A;  3LCE A;  4XXR A;  1TD5 A;  2JKT I;  4HQA A;  3BYD A;  3MQO A;  5A90 A;  1N9B A;  1OTA A;  3G32 A;  4WMC A;  2CMN A;  5J3W A;  4XT2 A;  4U0X A;  1MPL A;  5DTT A;  1BYW A;  3BRM A;  4ME4 A;  3MR0 A;  4I3I A;  1E3U D;  1H3Q A;  5IS1 A;  5E2G A;  4GDN A;  2XGN A;  5A91 A;  2L0W A;  2INW A;  1NWZ A;  5FAT A;  3RFB A;  2VGK A;  5CTN A;  1LSX A;  2ZM0 A;  4QHC A;  3F1N A;  3W2Z A;  4KZ8 A;  2J8Y A;  5EVE A;  3UB7 A;  1H8M A;  3D9Y A;  4LFU A;  1Y28 A;  2IWB A;  2BLS A;  5HL6 A;  4MN5 A;  3MZF A;  4Y5F A;  2EWV A;  3HBR A;  2PDR A;  3LFV A;  1JWP A;  2PD8 A;  3CAX A;  3N7W A;  2ZM8 A;  2X71 A;  5F69 A;  1K57 A;  4R6L A;  2B95 A;  3UB6 A;  4ZJ1 A;  2HDR A;  2XDM A;  3BY9 A;  1Y54 A;  5HAI A;  1GHP A;  3V5M A;  1XFQ A;  3Q7V A;  4U0T A;  4EUZ A;  4EV4 A;  4CLC E;  3B33 A;  3G2Z A;  4IED A;  4PM6 A;  3NBL A;  3SH7 A;  2ZL1 B;  4IBX A;  5TBM A;  2WKP A;  3B3X A;  5CX7 A;  4E6X A;  4QB8 A;  4R3A A;  1LI0 A;  2ZQ9 A;  3AGD A;  2W3D A;  4ZDX A;  2J9P A;  3C7U A;  3U2A A;  1YLP A;  4HHD A;  1XP4 A;  3F1O B;  3LIA A;  4Q0J A;  3ZG7 B;  2KLI A;  4N1H A;  4MBF A;  4DDY A;  3CMZ A;  4BL3 A;  4E3L A;  1GSX A;  2LB9 A;  3EGD C;  5DKK A;  3UY6 A;  4P6B A;  1K6S A;  2PYR A;  1HTZ A;  1QME A;  2HP5 A;  3QP5 A;  2A3U A;  2XD5 A;  5G4Y A;  5HPF A;  1G6A A;  2WZX A;  4KZB A;  4OVD A;  1IYS A;  1YLW A;  1MWT A;  1L0G A;  1ZHH B;  5GLA A;  3N8R A;  4GCZ A;  5CHU A;  1F98 A;  4GW9 A;  3TRC A;  4LLO B;  4R3B A;  5DKL A;  5MC7 A;  4HP9 A;  1DJB A;  3T1X A;  4N1X A;  3PBS A;  2WK0 A;  5FAO A;  1KGE A;  3FPV A;  3WS5 A;  3H7W B;  1IEL A;  4I39 A;  4JKT A;  1PFL A;  1FIK A;  3A0V A;  2EXA A;  3T4K A;  3IXD A;  4WZ5 C;  3K2N A;  3JVV A;  3Q81 A;  1S66 L;  2HZ5 A;  4LEN A;  3RXW A;  3MSH A;  3VE3 A;  2XRN A;  3ITB A;  2XRO A;  3Q82 A;  2Q0O A;  4HH2 A;  2PR5 A;  4FTX A;  1PI4 A;  2B02 A;  1ERM A;  3WS4 A;  4PHT A;  3UPO A;  3CZD A;  3P09 A;  1BUE A;  4LV0 A;  1MXO A;  5L2F A;  3SS4 A;  2K7S A;  1W63 M;  1GSV A;  3NOT C;  1FR6 A;  4FH2 A;  1EW0 A;  3KSH A;  1T1A A;  3LUQ A;  3VFH A;  4C3Q A;  1T18 A;  5FAQ A;  2Y2J A;  2XSS A;  5EOO A;  4GZB A;  3HRE A;  2Y4A A;  1LT0 A;  2PHY A;  2ZC4 B;  5EVI A;  1K6R A;  1FQG A;  1OTE A;  4ID4 A;  2QJ7 A;  5HDS A;  3QNB A;  1YLZ A;  4NXE A;  4K08 A;  1GSW A;  3EWK A;  2QYB A;  1ONG A;  3KSI A;  4JXW A;  3AGE A;  1I2S A;  3Q1F A;  2QKP A;  3LY4 A;  1LL5 A;  3W4O A;  2GZA A;  3PAE A;  4EQ1 A;  4KZA A;  4CLC A;  1VB6 A;  2H0Y A;  4QY6 A;  3NY4 A;  1V9Z A;  3T1S A;  1L0D A;  4OPZ A;  3E2L A;  4S2N C;  3M2J A;  1G68 A;  1OPX A;  1HZO A;  3A3J A;  3MMH A;  2PU2 A;  3S4X A;  1XGJ A;  2JE5 A;  3BEB A;  4OKP A;  4QY5 A;  3E0Y A;  3R7W B;  1D1J A;  3L9K A;  1F9I A;  4IUK A;  4LRZ E;  4R4R A;  2EA9 A;  4LV3 A;  4KQQ A;  4KQO A;  3O87 A;  1TDL A;  3VOZ A;  2M7V A;  4DMZ A;  3LIF A;  2Y2N A;  5CEC A;  1ESU A;  4HP4 A;  1T1B A;  4R3J A;  4ZTK A;  1FOF A;  3G35 A;  4ZRR A;  5EPH A;  2W1T A;  2ZJ9 A;  1VHM A;  1TVF A;  2C6W B;  1K56 A;  2HP9 A;  4UQI M;  3BEC A;  4R70 A;  1BUL A;  2Y2K A;  2J9O A;  1P0Z A;  3MZD A;  3VP0 A;  3E2K A;  4MMN A;  1VEU B;  5AQA A;  4Q8I A;  1NLY A;  4RVA A;  5GHX A;  4EU0 A;  2J7V A;  1S67 L;  1VET B;  5EM1 A;  5EE8 A;  4EW7 A;  1JNU A;  2XQZ A;  5U47 A;  1V9Y A;  4R23 A;  1P97 A;  1D06 A;  1K55 C;  4WUJ A;  3IH8 A;  5DVA A;  5HPI A;  2H28 A;  3ZGA B;  3KYQ A;  5HWW A;  3CUE C;  4OLD A;  4KEN B;  1FCO A;  5L10 A;  5CER A;  4K91 A;  4Y0T A;  5CHJ A;  5AVF A;  4E04 A;  5C5K A;  4O0P A;  4EES A;  4RQ9 A;  5A8B A;  5M18 A;  2XEP A;  5F1F A;  2XD1 A;  1JWZ A;  2W3E A;  1MWU A;  4NXF A;  2UWX A;  2A2L A;  5DFY A;  5HWV A;  4KG2 A;  1ACF A;  1X0O A;  5KIZ A;  4LV1 A;  4QWO A;  2WUQ A;  1OTB A;  1T1C A;  1MBL A;  3WWX A;  1A0K A;  3A0S A;  4NKP A;  2VJW A;  3VP1 A;  2Y2P A;  4PKY A;  4Y2F A;  1ES2 A;  4BD1 A;  5F6A A;  4L9E A;  1I5Q A;  3GVB A;  2GJ3 A;  5AQ7 A;  3T4Q A;  1KGF A;  2ZC6 B;  3T4L A;  3LI9 A;  1CEG A;  2V1B A;  2WKE A;  4Y3I A;  4S2L A;  4O8G A;  2VV8 A;  3IS2 B;  5EUA A;  4BBT A;  1PWC A;  2XR0 A;  4KUK A;  5F68 A;  4A5R A;  3H9W A;  3IX4 A;  1S1Z A;  3EOI A;  1LHY A;  3GMW A;  2VV6 A;  5DJU A;  1RGZ A;  2Y91 A;  3MQ0 A;  2HPB A;  4BBV A;  4BLM A;  1DP9 A;  1LI9 A;  3VSL A;  4E3I A;  1MKM A;  4L9G A;  1S1Y A;  5I94 A;  3GEC A;  4KQD A;  4JXS A;  4OQG A;  3HJK A;  4UHU A;  3G4P A;  3C8C A;  3UMD A;  1YQS A;  4AFI A;  1H0M A;  4HH3 A;  2EX9 A;  1PNE A;  4DE0 A;  5HZH A;  3BFF A;  2OWJ A;  4DE3 A;  3NOP C;  1WYB A;  1PWG A;  3CPT A;  5FQI A;  4DE2 A;  3BWL A;  5CED A;  2DNS A;  4S2K A;  2WGW B;  4X56 A;  1XGI A;  3A3I A;  4PM7 A;  1NRF A;  1EI5 A;  4JGR A;  1E3U A;  4RYE A;  3UB5 P;  4G3W A;  1YLT A;  3D72 A;  3C4P A;  2V0W A;  1ALQ A;  4PMA A;  2QPN A;  3E4P A;  4PAU A;  4G3K A;  4OQ0 A;  2DCF A;  4X68 A;  1IYQ A;  4Q0I A;  3G6O A;  3A0R A;  2J80 A;  3IF6 B;  1L0F A;  4KZ4 A;  2ZC3 B;  1DP6 A;  3ZVT A;  2XA7 S;  2A24 B;  4OP5 A;  4R38 A;  3HLG A;  1CI9 A;  3BLM A;  1ZTU A;  2Y2O A;  5EM0 A;  3O5Y A;  4IUH A;  4R4S A;  2OAP 1;  2Y8H A;  2P9V B;  3NDE A;  5K5B A;  1O07 A;  1SHV A;  3NC8 A;  2HDS A;  3ZDJ A;  4LV2 A;  1SZV A;  3VOL A;  1TDG A;  4HES A;  2WGV A;  4JBF A;  1PZO A;  4FOF A;  4B9O A;  2M1C A;  3DAV A;  5DF7 A;  4FCF A;  3IWI A;  3E98 A;  3CLO A;  3SS5 A;  3IH9 A;  4GS9 B;  5FI7 A;  3KSG A;  3DTI A;  5CGX A;  4MBK A;  3UME A;  3IT9 A;  2VX8 A;  4HNB A;  2E8I A;  3TSG A;  3IBJ A;  4P87 A;  5HSQ A;  5FDS A;  4HJ4 A;  1DP8 A;  5IHV A;  4WMC D;  3BW6 A;  4EEP A;  5FI6 A;  4B4Z A;  2VA0 A;  4ARZ A;  2PBD P;  2KDK A;  4RX2 A;  3TW8 A;  3CJM A;  2Y59 A;  4FSF A;  3QHY A;  3LYX A;  1PYY A;  4X69 A;  5GHZ A;  3D4F A;  1SKF A;  4H6J A;  2PT7 A;  1N4O A;  5AQ9 A;  1BT5 A;  4QD4 A;  3V3S A;  5M1A A;  5HD3 A;  2JBF A;  3LO7 A;  3DWZ A;  4UA7 A;  5FAP A;  1OTD A;  2D01 A;  3LR0 A;  1SCW A;  4BJP A;  3CIT A;  2VGL S;  3ZG0 A;  4Y15 A;  5HL1 A;  2IWD A;  5GLD A;  1I2W A;  3ZNT A;  3IXH A;  2H5S A;  3OLO A;  3SS3 A;  5FAS A;  1PIO A;  3UE3 A;  2O99 A;  2W27 A;  1EWZ A;  5HDD A;  2O9B A;  4QJG A;  3PTE A;  1NZU A;  3ZCZ A;  5EFW A;  5EV0 A;  2QMI A;  1NXY A;  1OT9 A;  4FH4 A;  4JPM A;  1TEM A;  4GLQ A;  2L1M A;  1K54 A;  2J3W A;  5TR7 A;  4I3J A;  2V2F F;  2ZOI A;  1FSW A;  1BTL A;  1XJ6 A;  3QP4 A;  2X02 A;  1BLP A;  5J7E A;  3SOI A;  3GDI A;  3W4P A;  1G6O A;  3FWL A;  5G18 A;  3KSF A;  2WYX A;  3VP2 A;  4RA7 A;  1G5U A;  4X25 A;  4O01 A;  1K57 C;  4HBT A;  4JLF A;  4G3V A;  5J4E A;  4NK3 A;  3UN7 A;  4OQI A;  4WZ4 A;  3HUN A;  2W3F A;  3PBO A;  5GLB A;  3MJQ A;  4IBR A;  5EVL A;  1FSY A;  5CTM A;  2Y55 A;  3SH8 A;  1ES4 A;  1ES5 A;  3QP8 A;  3RH8 B;  5DTS A;  3WS2 A;  3S7N A;  4Y7P A;  3LIC A;  3C38 A;  2ZM2 A;  2Y2I A;  4ZBE A;  2V8F A;  3VP3 A;  3G34 A;  4MN6 A;  2XFS A;  1Q2P A;  3BFD A;  3C30 A;  3FV7 A;  3I7J A;  1FCN A;  3R4K A;  2EX8 A;  4GJ4 A;  3GV9 A;  1NRJ A;  1LL9 A;  2EWW A;  3GTC A;  4YFM A;  1PRQ A;  4M3K A;  2ZL1 A;  4DE1 A;  4PM9 A;  1W63 Q;  2H0T A;  4IHQ A;  1WA9 A;  3FG8 A;  4EER A;  4EXO A;  3IF6 C;  1YAX A;  4I5S A;  4WEL A;  3DTK A;  1YPR A;  2I9V A;  1D7E A;  3F1P B;  3EEA A;  1CJF A;  4DDS A;  4KZ5 A;  1RCJ A;  3NUL A;  1SKO A;  5IU1 A;  1C3B A;  3FKW A;  1YSP A;  3HL9 A;  3ZG9 B;  2NUP C;  1NY0 A;  4UA6 A;  3F1O A;  3UE0 A; 
#chains in the Genus database with same CATH homology
 1DY6 A;  5DF9 A;  2OLU A;  3MFD A;  4E6W A;  1MWS A;  2OLV A;  4X55 A;  5M18 A;  2XEP A;  3G2Y A;  5F1F A;  2XD1 A;  1JWZ A;  3M2K A;  3TOI A;  1YMS A;  4KZ6 A;  4LCL A;  3Q7Z A;  5CHM A;  5FQJ A;  3IF6 A;  3P98 A;  2FFY A;  4N9K A;  3UDX A;  3C5A A;  2DRW A;  3MZE A;  4E3O A;  3PAG A;  1MWU A;  3LCE A;  4XXR A;  2UWX A;  1ZG6 A;  4OQH A;  4KG2 A;  4OP8 A;  1PW8 A;  4LV1 A;  3BYD A;  2WUQ A;  5A90 A;  1GCE A;  3OC2 A;  1N9B A;  2P9V A;  1GHM A;  4PPR A;  4KZ7 A;  1MBL A;  4MBH A;  5HAP A;  3G32 A;  3AGF A;  3WWX A;  4WMC A;  5HAQ A;  3VP1 A;  3UPP A;  1JTD A;  4OOL A;  3VP4 A;  2Y2P A;  4U0X A;  1MPL A;  3BFC A;  5DTT A;  2PU4 A;  1ES2 A;  3BFE A;  5E2F A;  5FA7 A;  3BRM A;  5FSR A;  4BD1 A;  2XLN A;  1KE0 A;  1I5Q A;  1IEM A;  3ZFZ A;  1E3U D;  3GVB A;  3JYI A;  4MLL A;  5E2G A;  4GDN A;  2XGN A;  4XUX A;  5A91 A;  2EX6 A;  3FZC A;  5FAT A;  5AQ7 A;  2JCH A;  4GD6 A;  3DTM A;  2VGK A;  1H8Y A;  2Y2M A;  3W4Q A;  3DW0 A;  2VGJ A;  5CTN A;  4ZJ3 A;  2X01 A;  1KGF A;  2ZC6 B;  2ZM0 A;  2GDN A;  2Y2L A;  1ZKJ A;  1BZA A;  1CEG A;  4QHC A;  2WKE A;  5AQB A;  4S2L A;  1CK3 A;  1AXB A;  3GRJ A;  4KZ8 A;  2J8Y A;  5HFO A;  4X53 A;  1YMX A;  5EUA A;  1HVB A;  1KDS A;  2WAD A;  4L0L A;  4WYY A;  2EFU A;  1PWC A;  2XR0 A;  1E25 A;  2IWB A;  3HUO A;  1Z6F A;  4NET A;  1VM1 A;  4A5R A;  2BLS A;  2ZC7 A;  3MZF A;  4S2N A;  4JXG A;  4EQI A;  3HBR A;  4ZJ2 A;  3A3D A;  1LHY A;  1BLH A;  3WS0 A;  3GMW A;  3OZH A;  1RGZ A;  2Y91 A;  2XFT A;  2HPB A;  1JWP A;  5F82 A;  5CXW A;  1JTG A;  2ZQC A;  4BLM A;  1BSG A;  3FYZ A;  3NIA A;  1LI9 A;  3N7W A;  1FR1 A;  1K25 A;  3VSL A;  4E3I A;  2ZM8 A;  1GHI A;  4GNU A;  5A92 A;  4FD8 A;  2X71 A;  5I94 A;  1K57 A;  3UO9 A;  3TG9 A;  4ZJ1 A;  2RL3 A;  2HDR A;  2XDM A;  4S2I A;  1IKG A;  3M6B A;  4JF6 A;  1Y54 A;  5HAI A;  1GHP A;  1WE4 A;  4BD0 A;  3CG5 A;  3V5M A;  3BLS A;  4KZ3 A;  4JXS A;  4RX3 A;  4OQG A;  3G31 A;  3Q7V A;  1ERO A;  4U0T A;  1S6R A;  4K0W A;  3G4P A;  1NYM A;  1YLY A;  4UHU A;  4EUZ A;  4EV4 A;  1YQS A;  1KE4 A;  3G2Z A;  4IED A;  2OSU A;  4DKI A;  2Z2L B;  4PM6 A;  2EX9 A;  1SDN A;  3NBL A;  4DE0 A;  4E3M A;  3SH7 A;  3BFF A;  4DE3 A;  3V3R A;  4IBX A;  5KSH A;  1WYB A;  1PWG A;  5JYP A;  5FQI A;  4DE2 A;  3HUM A;  4OPQ A;  5F83 A;  1PZP A;  1PWD A;  1L0E A;  3WRZ A;  3B3X A;  1W79 A;  5CED A;  1M40 A;  1YLJ A;  2DNS A;  4S2K A;  2WGW B;  4X56 A;  5E43 A;  1XGI A;  4QB8 A;  4Z9Q A;  2ZQA A;  3UPN A;  1LI0 A;  4E6X A;  2ZQ9 A;  4S2J A;  2Y2G A;  3A3I A;  4MEZ A;  3S1Y A;  3WS1 A;  4DXB A;  3AGD A;  3WRT A;  2WKI A;  4PM7 A;  4EBL A;  2Y2Q A;  3UDF A;  1NRF A;  4ZDX A;  1E4D A;  1EI5 A;  2J9P A;  1E3U A;  3IWO A;  4RYE A;  3C7U A;  2XH9 A;  1YLT A;  1K54 C;  3LEZ A;  3NI9 A;  3FKV A;  3C4P A;  1YLP A;  5D3O A;  4PM5 A;  1XP4 A;  1ALQ A;  5E2E A;  4PMA A;  3LY3 A;  2QPN A;  1M6K A;  1MY8 A;  3ZG7 B;  5FQM A;  1ESI A;  4OQ0 A;  4BQM A;  4N1H A;  4MBF A;  1K55 A;  2EXB A;  3CMZ A;  3O88 A;  4DDY A;  4R0Q A;  4BL3 A;  2DCF A;  4E3L A;  1W8Q A;  1IYQ A;  4X68 A;  3GR2 A;  3UY6 A;  1YM1 A;  3MXS A;  4P6B A;  4P85 A;  1GA0 A;  5CRF A;  1K6S A;  4OOY A;  3IF6 B;  1HTZ A;  1L0F A;  1ZG4 A;  2WAE A;  4KZ4 A;  3C7V A;  2ZC3 B;  1QME A;  2HP5 A;  3ZVT A;  1H8Z A;  2XF3 A;  2A3U A;  3ZG5 A;  1Q2Q A;  2XD5 A;  4H8R A;  3HLG A;  4GD8 A;  4OP5 A;  1CI9 A;  1G6A A;  4GN2 A;  4C6Y A;  2WZX A;  3BLM A;  4IVI A;  2Y2O A;  4MNR A;  4DF6 A;  5HW3 A;  4R4S A;  4KZB A;  5EVI D;  2P9V B;  3NDE A;  1IYS A;  1YLW A;  3HLF A;  4OVD A;  1MWT A;  3DWK A;  1L0G A;  1O07 A;  1SHV A;  1RGY A;  2HDS A;  3NC8 A;  5GLA A;  3N8R A;  5CHU A;  4LV2 A;  3ZDJ A;  4WEJ A;  1XX2 A;  3OCN A;  1TDG A;  4HES A;  3QNC A;  4DXC A;  2WGV A;  1OME A;  1IYP A;  1NJ4 A;  4JBF A;  2R9W A;  2R9X A;  4S2M A;  1PZO A;  4WBG A;  4R3B A;  4E3N A;  5M19 A;  1BLS A;  1DJB A;  2Z2M B;  4N1X A;  3PBS A;  4JF5 A;  2B5R A;  1PI5 A;  2Q9M A;  2WK0 A;  2ZD8 A;  4S2P A;  5DF7 A;  5FAO A;  1KGE A;  2ZQ8 A;  4ZAM A;  3WS5 A;  5FQQ A;  1IEL A;  4FCF A;  4HEF A;  1LLB A;  1XKZ A;  3OCL A;  3HLE A;  1J9M A;  4JKT A;  2G2U A;  3IWI A;  3BM6 A;  3SS5 A;  3IH9 A;  5FI7 A;  4E3J A;  2EXA A;  2WZZ A;  5DF8 A;  5CGX A;  1XXM A;  3IXD A;  4MBK A;  4WZ5 C;  4UA9 A;  3HVF A;  3IT9 A;  1NZO A;  2XK1 A;  3UNW A;  3VSK A;  3RXX A;  3GQZ A;  2E8I A;  1DJA A;  3TSG A;  3Q81 A;  4P87 A;  1YT4 A;  3N8L A;  4LEN A;  3PBT A;  3RXW A;  1DJC A;  5IHV A;  1NYY A;  4WMC D;  5EVI C;  5FI6 A;  3ITB A;  4B4Z A;  2V20 A;  3IXG A;  3Q82 A;  4DRT A;  1JWV A;  2PBY A;  3W8K A;  1PI4 A;  2HP6 A;  4CJN A;  1ERM A;  4IVK A;  3WS4 A;  3UPO A;  4RX2 A;  4YIN A;  2HDU A;  3CJM A;  1MWR A;  4LCM A;  3CZD A;  3P09 A;  1BUE A;  5F1G A;  4LV0 A;  1MXO A;  2Y59 A;  4FSF A;  5L2F A;  1U60 A;  3SS4 A;  5EOE A;  3QHY A;  1PYY A;  4X69 A;  5GHZ A;  3D4F A;  1SKF A;  1XA1 A;  1CI8 A;  3HLW A;  1ES3 A;  1FR6 A;  4S2O A;  1N4O A;  3Q7V B;  4FH2 A;  5AQ9 A;  1BT5 A;  2BG1 A;  4QD4 A;  1KVL A;  4QU3 A;  3VFH A;  3V3S A;  4C3Q A;  2I72 A;  5M1A A;  5FAQ A;  2Y2J A;  2JBF A;  4GDB A;  5EOO A;  4GZB A;  3HRE A;  2Y4A A;  3DWZ A;  3LO7 A;  4UA7 A;  5FAP A;  5FQK A;  1SCW A;  3IF5 A;  4BJP A;  4R1G A;  4EBP A;  2ZC4 B;  4B88 A;  5EVI A;  5KSC A;  3ZG0 A;  1QMF A;  5HL1 A;  1K6R A;  1FQG A;  2A49 A;  2IWD A;  1I2W A;  5GLD A;  3NCK A;  3ZNT A;  4ID4 A;  1GA9 A;  2EX2 A;  3IXH A;  2H5S A;  3O86 A;  3QNB A;  4OOM A;  5HAR A;  5HX9 A;  4OLG A;  1YLZ A;  4Y0U A;  5CGS A;  1K56 D;  2ZC5 B;  4WEK A;  3SS3 A;  3MXR A;  4N92 A;  3V39 A;  3ZG8 B;  5FAS A;  5KMW A;  1PIO A;  2H10 A;  3ZNY A;  4GOG A;  3UE3 A;  1ONG A;  5CEB A;  5FI2 A;  4JXW A;  1PW1 A;  3AGE A;  1I2S A;  2C5W B;  1EWZ A;  3Q1F A;  3ZHH A;  4QJG A;  1XA7 A;  1HD8 A;  3PTE A;  5DTK A;  1NZU A;  2ZQ7 A;  4P0M A;  3ZCZ A;  4WM9 A;  3LY4 A;  1LL5 A;  2QMI A;  1NXY A;  3IHA A;  4FH4 A;  4JPM A;  3W4O A;  4KZ9 A;  4U3T A;  1MKI A;  2FFF B;  1SDE A;  1TEM A;  3HLC A;  3PAE A;  3BFG A;  3O3V A;  3OPH A;  4HBU A;  4OH0 A;  3Q07 A;  1K54 A;  4KZA A;  5TR7 A;  3V50 A;  2V2F F;  2H0Y A;  4QY6 A;  1O7E A;  1FSW A;  3NY4 A;  3UDI A;  1BTL A;  3IHB A;  1XPB A;  4C75 A;  4EWF A;  4B4X A;  1VQQ A;  1KVM A;  1L0D A;  4JXV A;  2X02 A;  1BLP A;  2HDQ A;  4OPZ A;  5GLC A;  3E2L A;  3RJU A;  3SOI A;  3OPP A;  1FCM A;  2ZLY A;  3W4P A;  4S2N C;  3M2J A;  3N8S A;  1G68 A;  3PBN A;  1HZO A;  3FWL A;  4EBN A;  3A3J A;  5TFQ A;  2OV5 A;  4E3K A;  2PU2 A;  1L2S A;  3S4X A;  5G18 A;  3OPR A;  5BOH A;  1W7F A;  1XGJ A;  2JE5 A;  3BEB A;  4OKP A;  4QY5 A;  2WYX A;  3VP2 A;  4BEN A;  2WKH A;  3EQV A;  4Y0O A;  4RA7 A;  5EEC A;  4PM8 A;  4KG6 A;  3HLD A;  1K4E A;  4R4R A;  3VMA A;  1KGG A;  3ISG A;  4LV3 A;  4KQQ A;  3IXB A;  4KQO A;  2RCX A;  3O87 A;  1K57 C;  1TDL A;  3NDG A;  4HBT A;  4JLF A;  3VOZ A;  3A3E A;  4NK3 A;  2Q9N A;  3UN7 A;  3N4I A;  4D2O A;  2ZMA A;  1ZC2 A;  4OQI A;  4WZ4 A;  3HUN A;  3M6H A;  3PBO A;  3HLB A;  2WAF A;  2Y2N A;  5CEC A;  2JC7 A;  1ESU A;  1RP5 A;  4OPR A;  5GLB A;  4R3J A;  4ZTK A;  4IBR A;  5EVL A;  3IWQ A;  1FSY A;  5CTM A;  1FOF A;  2V1Z A;  2Y55 A;  3MKE A;  3PBQ A;  3SH8 A;  3MBZ A;  1ES4 A;  1ES5 A;  3G35 A;  5CGW A;  5DTS A;  5EPH A;  3WS2 A;  2ZJ9 A;  4Y7P A;  4O7D A;  1KE3 A;  2ZM2 A;  5GL9 A;  2Y2I A;  5J8X A;  4ZBE A;  3VP3 A;  1TVF A;  2C6W B;  1K56 A;  3G34 A;  4OPY A;  3SH9 A;  4F94 A;  2HP9 A;  2XFS A;  4KG5 A;  1Q2P A;  3BFD A;  3FV7 A;  1CEF A;  3BEC A;  3I7J A;  1FCN A;  1BLC A;  2Y2H A;  1BUL A;  2Y2K A;  4GKU A;  4X6T A;  5GHY A;  2EX8 A;  2J9O A;  3GV9 A;  1LL9 A;  1W8Y A;  2ZQD A;  5A93 A;  3MZD A;  3VP0 A;  3VFF A;  3E2K A;  3GTC A;  4XUZ A;  2G2W A;  5AQA A;  4YFM A;  5FQ9 A;  4Q8I A;  1K4F A;  2CC1 A;  4RVA A;  4WZ5 A;  4M3K A;  5GHX A;  4DE1 A;  4BL2 A;  4PM9 A;  3EQU A;  1ERQ A;  1K38 A;  2H0T A;  3ZVW A;  2J7V A;  1JVJ A;  3MKF A;  4K0X A;  1WYC A;  3N6I A;  2WGW A;  3IF6 C;  5EE8 A;  3ITA A;  2XQZ A;  1IKI A;  1KDW A;  4WEL A;  5E2H A;  5U47 A;  2EFX A;  4JF4 A;  4R23 A;  5JYO A;  1K55 C;  2WGI A;  4CPK A;  3C4O A;  4DDS A;  4OON A;  1H5X A;  3OPL A;  1RCJ A;  3IH8 A;  4KZ5 A;  4GB7 A;  5DVA A;  3ZGA B;  1C3B A;  1S0W A;  3FKW A;  3UE1 A;  2P74 A;  4KQR A;  4OLD A;  2QZ6 A;  5FDH A;  3HL9 A;  1W5D A;  5EVI B;  1ONH A;  4KEN B;  4UAA A;  3ZG9 B;  3IQA A;  1NY0 A;  1FCO A;  4UA6 A;  5TGF A;  5CER A;  4K91 A;  4Y0T A;  3S22 A;  5KZH A;  1IYO A;  2IWC A;  5CHJ A;  3PBR A;  3VOY A;  3UE0 A;  3G30 A;  3GSG A;  4N9L A;  3A3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...