2HDRA

Ampc beta-lactamase in complex with 4-amino-3-hydroxybenzoic acid
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Deconstructing fragment-based inhibitor discovery
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Hydrolase
total genus 110
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2hdrA00
1MPLA 4Q8IA 1TDGA 2WKIA 5E2GA 1XPBA 1NZOA 5TGFA 4BLMA 4WYYA 5EECA 4ZDXA 3MBZA 3Q82A 3ZNYA 1CEGA 2XH9A 3IXGA 1PZPA 1YLTA 1LI0A 3NC8A 5U47A 1ZKJA 4IEDA 4FD8A 1KE4A 3O87A 2OSUA 3N7WA 3M2KA 4IBXA 4OPYA 4OPZA 5FAQA 2EX2A 2QMIA 1MBLA 3HL9A 4PM5A 3GV9A 5AQAA 3FKWA 1GHPA 1EROA 1ZG4A 4UA9A 3UN7A 3HLFA 2Y91A 1KVMA 4X69A 5FSRA 1XA7A 5CERA 3UE1A 4D2OA 1PI5A 1FR1A 1S6RA 1K55C 4GD8A 3IF6A 1NY0A 2JE5A 1Q2QA 3GMWA 2Y2LA 4PM6A 4UAAA 4EBPA 3SH9A 3ZFZA 4Y0TA 3ZVWA 3IWOA 3VP3A 4QB8A 3W4PA 5I94A 3IHAA 4KZ3A 3FZCA 1FSWA 2EFUA 5FQJA 4U0XA 3ISGA 5E43A 1YQSA 1K4FA 1W8QA 3A3DA 1PYYA 3I7JA 2EXBA 3PTEA 4K91A 2R9XA 4DRTA 3M6HA 3HLEA 1KE0A 5DTKA 1QMEA 4FH2A 3IXDA 3UPPA 3RXXA 3GQZA 4P6BA 1XP4A 1MXOA 3UY6A 3TG9A 3GTCA 1KGGA 1BLSA 3ZVTA 1ZG6A 4OQ0A 1IYOA 4KZ6A 3W4OA 3EQUA 3BFDA 3HLDA 4C6YA 4CJNA 1JWZA 3C7UA 3C5AA 4WZ5C 3V3SA 1ESUA 3FKVA 4RVAA 2HP5A 5CGSA 1YMXA 5CHMA 2GDNA 5HX9A 1I5QA 1IELA 5FAPA 4Z9QA 1VM1A 3G2YA 5FQKA 2BLSA 4MBKA 4JBFA 4GOGA 2QZ6A 4HESA 1NYMA 5GHYA 2OLVA 4E6XA 4BD1A 3SS4A 1H5XA 4HEFA 1G68A 2ZM8A 4JXVA 4KZ7A 3V3RA 2XD5A 4PPRA 4R4RA 2Z2MB 3EQVA 3S1YA 1C3BA 3Q7VB 3ZG0A 3PBSA 4ZJ2A 4R3BA 3OPHA 5F1FA 4E3LA 4DF6A 2ZQAA 3A3FA 5EVIB 4F94A 1Z6FA 3QHYA 2HDRA 2HDSA 2QPNA 4ZBEA 3VMAA 1GA0A 1NZUA 1W7FA 2XDMA 2WZXA 3Q7VA 1SKFA 4Y0OA 3UNWA 3G31A 1XA1A 5CEBA 2X01A 3A3EA 4OPRA 4E3NA 3VP1A 3VSKA 4R1GA 5M18A 3P98A 1NRFA 5CTMA 4DXCA 3OCLA 3SS5A 1XXMA 3MXSA 5KZHA 4OQIA 2ZQ7A 4JXSA 5EOOA 2HPBA 5CTNA 1JTGA 5GLCA 1FQGA 4WM9A 1K57C 3Q7ZA 5CGWA 1N9BA 4QJGA 5GLBA 2J9PA 4RA7A 4XUZA 3WRTA 1FCNA 4S2LA 1BLHA 1FCMA 5KMWA 5HAQA 3ZHHA 4LCLA 1XGJA 5M1AA 2Y59A 3ZG9B 1GA9A 3O3VA 2CC1A 4WBGA 4E3KA 4JKTA 2EX8A 4XXRA 2ZC4B 1I2SA 4OPQA 1ES4A 5HAIA 1IEMA 3IQAA 3TSGA 3BYDA 4QD4A 3WWXA 3WS2A 4S2KA 4BL2A 1NYYA 4E6WA 2Z2LB 3Q81A 4GDBA 5FQ9A 4DE1A 1WYCA 4BD0A 3ITBA 3GSGA 4E3OA 2R9WA 4KZ5A 3HLCA 4WEJA 3ZDJA 3PBQA 4KZBA 1CI9A 1RGYA 3CG5A 1CEFA 2P74A 3LO7A 2Y4AA 4OH0A 1IYQA 3IWQA 2WKEA 4DXBA 4N1HA 5A91A 5KSHA 3HLBA 3WS0A 2XFSA 4OOLA 2ZMAA 5EUAA 4RYEA 4Y0UA 3IF6B 4EUZA 5AQBA 2OLUA 2XGNA 2XQZA 4UA6A 3MXRA 3HUOA 1LLBA 3BM6A 1FOFA 4EQIA 3NIAA 2C6WB 3LY3A 5FATA 4GD6A 5GL9A 5F82A 3RXWA 3UE3A 3M2JA 4U0TA 1SHVA 1U60A 4MNRA 3MZDA 3WS4A 2XR0A 1OMEA 5AQ9A 4OP8A 4CPKA 2ZM2A 3OPLA 4YINA 4R23A 4RX3A 4XUXA 4ZJ1A 2HP9A 2XLNA 5FQMA 4HBUA 5EVLA 1AXBA 2XF3A 1TEMA 1VQQA 2WK0A 1M40A 4JPMA 1PWCA 2J7VA 1FCOA 5A93A 4S2IA 2A3UA 2IWCA 5DVAA 1PI4A 4B4ZA 1CK3A 3FV7A 5FQQA 3O88A 4DDYA 1BLCA 3WS1A 1XKZA 1EI5A 4N9KA 5KSCA 1JWVA 2Y2HA 4GN2A 1N4OA 1HD8A 1GHIA 2WGWA 4WEKA 3MKFA 4BL3A 1L2SA 4IVIA 5GLDA 1TVFA 3BFEA 4JF5A 2WUQA 2Y2KA 3WS5A 4S2OA 1XGIA 2DNSA 4FH4A 4LENA 3OZHA 3MFDA 1TDLA 5E2EA 3NI9A 3E2KA 3VSLA 4BJPA 2ZC6B 3N8SA 1L0FA 2Y2QA 5HAPA 1PZOA 3Q1FA 3TOIA 3CZDA 1YMSA 3HLGA 4KZ4A 1L0DA 4S2MA 5FI2A 1MWUA 3G34A 4S2JA 2X02A 4WELA 2DCFA 2EX6A 4GZBA 5DTSA 1BTLA 1KDSA 1KGEA 4HBTA 4ID4A 4X53A 3G32A 1GCEA 3CJMA 1LL9A 3UE0A 4GNUA 1DY6A 1K54C 1K56D 1S0WA 4O7DA 4DDSA 1NJ4A 2RL3A 3VP2A 1HVBA 3V39A 1KVLA 4WZ4A 5EOEA 2ZC5B 2E8IA 4RX2A 1H8ZA 4FSFA 1IYSA 2ZM0A 4P85A 4JXWA 2Q9MA 2ZQ9A 4LV1A 1GHMA 1ES5A 2WGIA 2ZD8A 1IKIA 5FASA 1MWSA 2JBFA 1E25A 1K57A 2H0TA 3HBRA 5CEDA 1ONGA 3FWLA 1H8YA 1ZC2A 3N8LA 5CECA 2VGKA 5CHUA 2ZC3B 1PW8A 4OKPA 2JC7A 3DWKA 4S2NC 5CGXA 5FA7A 2H10A 4B4XA 1RCJA 4UHUA 5FI7A 3IH8A 1ESIA 5G18A 2XD1A 5J8XA 4E3MA 5HL1A 2WZZA 3BRMA 3ZCZA 3NDGA 2I72A 2G2WA 3ZGAB 3VP4A 1ES2A 4K0XA 4QHCA 4QY5A 1IKGA 4PMAA 3IWIA 5EVIC 4A5RA 1K6RA 4KG6A 5DF7A 3S4XA 2WKHA 2Y2IA 3V5MA 3VOYA 3DW0A 4KQQA 4DE2A 2EXAA 3C4OA 2C5WB 3G4PA 1W8YA 1KE3A 2RCXA 4R0QA 3LY4A 4C75A 4Y7PA 1LI9A 5AQ7A 4OQGA 4EBNA 2WGVA 4QY6A 1YLPA 4JF6A 5JYOA 1ALQA 4JXGA 1ERQA 2Q9NA 5TR7A 1K56A 4YFMA 1W5DA 3UPOA 1JVJA 1DJCA 2P9VB 3FYZA 5GHXA 5FQIA 5A92A 1RP5A 2WAFA 1MKIA 1MWRA 1O7EA 2WAEA 3D4FA 5E2FA 4EBLA 4KENB 3PBTA 3MZEA 3UO9A 1K55A 3DWZA 3IF5A 4E3JA 4LCMA 4LV0A 4WMCD 4KQOA 1J9MA 2V1ZA 5EPHA 2P9VA 5GLAA 1WE4A 4NETA 3A3IA 4LV2A 1Y54A 3N4IA 3DTMA 2ZQCA 2BG1A 4KQRA 3VOZA 3BFGA 2HDQA 1SDNA 2Y2NA 2V20A 1I2WA 1K4EA 3OC2A 3N6IA 1O07A 4BQMA 1RGZA 4X56A 4B88A 4X68A 2EFXA 4M3KA 1MY8A 3ITAA 4KG5A 2WGWB 4KZ8A 1JWPA 4E3IA 4JF4A 2H0YA 2V2FF 1E3UD 5FI6A 3VP0A 3UPNA 4PM9A 3OCNA 5F83A 1BZAA 1KDWA 4PM8A 3W8KA 3AGEA 3IH9A 4EWFA 5GHZA 3PBOA 1YLZA 1LHYA 1KGFA 3WRZA 5EE8A 4MBHA 2IWBA 4ZAMA 4WZ5A 3ZG5A 3BLSA 1G6AA 1BUEA 1BSGA 2B5RA 1HTZA 1BT5A 3IF6C 4GDNA 1XX2A 2J8YA 2PU2A 4IVKA 3HUNA 3QNCA 1LL5A 1HZOA 2HDUA 3LCEA 2UWXA 3OPRA 5DTTA 5EVID 1DJAA 4ZTKA 3SOIA 4OONA 1YM1A 4P0MA 2X71A 3MKEA 3NY4A 3PAGA 4GKUA 1YLWA 2XK1A 5HARA 3HLWA 2PU4A 2EX9A 5CHJA 1NXYA 3NBLA 4LV3A 3GR2A 1YLJA 2H5SA 2FFYA 1WYBA 5FDHA 5IHVA 1SDEA 4OLDA 3UDIA 3SH8A 1QMFA 2ZC7A 3IXBA 1FSYA 4WMCA 4MEZA 1K54A 3C4PA 4OVDA 3ZNTA 3PBNA 3QNBA 2HP6A 2J9OA 2WADA 3G2ZA 3GRJA 4X6TA 5M19A 3NCKA 1BULA 4N92A 4OOMA 4S2PA 3RJUA 4QU3A 2WYXA 1ERMA 2Y2MA 4P87A 1BLPA 4K0WA 3HREA 5HFOA 3VFHA 4KZAA 5A90A 4OQHA 4DKIA 3NDEA 1MWTA 2ZLYA 5DF8A 1PIOA 1K38A 4N9LA 3HVFA 1K25A 4X55A 3M6BA 1E3UA 5CRFA 4U3TA 4KZ9A 5E2HA 4ZJ3A 1ONHA 3LEZA 3W4QA 1DJBA 3N8RA 1Q2PA 3VFFA 4BENA 3UDXA 4R4SA 4NK3A 4OLGA 4S2NA 1JTDA 3AGFA 1YLYA 3S22A 4KG2A 3O86A 3A3JA 2Y2OA 4GB7A 1K6SA 5CXWA 2Y2JA 4MBFA 1SCWA 2Y55A 1E4DA 1EWZA 2DRWA 5L2FA 2Y2PA 4N1XA 5DF9A 1PWDA 5TFQA 5EVIA 3B3XA 4IBRA 4PM7A 2ZJ9A 3IT9A 4JLFA 2ZQDA 3BFCA 2G2UA 3GVBA 1FR6A 1M6KA 3BEBA 3G35A 1L0EA 3SS3A 4H8RA 2PBYA 1PWGA 3Q07A 4EV4A 4MLLA 3ZG7B 3OPPA 3AGDA 3PAEA 2ZQ8A 3C7VA 3ZG8B 2IWDA 3MZFA 1PW1A 4DE3A 1IYPA 5BOHA 2XEPA 4R3JA 3HUMA 3V50A 5F1GA 2VGJA 3BLMA 3UDFA 4C3QA 4FCFA 3PBRA 1CI8A 3JYIA 2Y2GA 4DE0A 3G30A 3P09A 3CMZA 4OOYA 3SH7A 1YT4A 3BFFA 2JCHA 4OP5A 1ES3A 5HW3A 2XFTA 2OV5A 2A49A 4L0LA 3IHBA 1W79A 3BECA 5FAOA 4UA7A 1L0GA 2FFFB 5JYPA 3IXHA 3E2LA 5D3OA
chains in the Genus database with same CATH superfamily
4Q8IA 1XPBA 1GSXA 4ZDXA 1H8MA 2PT7A 1PZPA 3T1SA 1X0OA 2INWA 3O87A 1MBLA 3GV9A 1EROA 5F69A 1KVMA 5FSRA 1XA7A 1PI5A 1K55C 3GMWA 4PM6A 4UAAA 2EWVA 4Y0TA 3OBFA 4LRXC 4QB8A 3IHAA 1FSWA 4K91A 2R9XA 1LT0A 4FH2A 3RXXA 5KIZA 4QWOA 3MR0A 3UY6A 2QKPA 1KGGA 1BLSA 1F2KA 1IYOA 2CMNA 3HLDA 4C6YA 4KUOA 3C7UA 5CHMA 2GDNA 1I5QA 1V9YA 3G2YA 4MBKA 4JBFA 4GOGA 2QZ6A 4HESA 1UWPX 2ZM8A 3CWFA 4PPRA 4R4RA 2Z2MB 3NOTC 1XJ4A 3Q7VB 3T4OA 2ZQAA 3A3FA 5EVIB 2KOIA 1GA0A 2L4RA 2XDMA 2HGVA 1SKFA 5IU1A 1OTIA 1LSWA 5CEBA 3KYEA 2X01A 3A3EA 4LRZE 4LFUA 3VP1A 4R1GA 3P98A 1VEUB 5EOOA 5CTNA 1JTGA 2VJWA 4WM9A 1K57C 1N9BA 5GLBA 5TJJA 2JKRM 1FCNA 2LB5A 2W3EA 1OTEA 5HAQA 2Y59A 3ZG9B 1GA9A 3TW8A 4E3KA 1ES4A 1IEMA 4HHDA 3L9KA 3ZDJA 1RGYA 4OH0A 5A91A 5KSHA 2XFSA 4OOLA 5EUAA 4Y0UA 2XGNA 4UA6A 1LLBA 2C6WB 3S7NA 3F1PA 3M2JA 1U60A 2JKTM 4HIAA 4OP8A 4WL9A 2B18A 5EVLA 1M40A 2WK0A 1PWCA 2IWCA 1NRJA 2MJ6A 3O88A 3WS1A 5KSCA 4G3WA 2K2NA 3MQOA 3MKFA 4ARZA 4BL3A 1NLZA 4PAUA 1SKOB 2WUQA 4BWIA 1XGIA 2VK3A 4P6ZS 3PR6A 3NOUC 3BQAA 3Q1FA 4Y13A 4WELA 4GZBA 4HBTA 3GECA 2GJ3A 4HH2A 4L9GA 1GCEA 3CJMA 4Y2FA 1OT6A 1S0WA 2E8IA 3KO6A 2ZM0A 4JXWA 4LV1A 1GHMA 3QP8A 4Z1WA 1ONGA 1YKDA 1PW8A 4F3LA 4S2NC 1UGUA 5G18A 1ESIA 4B9OA 1XJ2A 4FOFA 1A0KA 4G3VA 2G2WA 3LUQA 4PMAA 4A5RA 5DF7A 3S4XA 5IS1A 2WKHA 3DW0A 3LR3A 1LI9A 1ACFA 5AQ7A 4EBNA 3EGXC 4P6ZM 1FILA 4CQHA 1ALQA 1S1ZA 3NECA 1W5DA 1JVJA 3FYZA 5FQIA 3QP4A 5FEGA 1J3WA 2WAEA 5EFWA 5E2FA 5FEFA 3UO9A 2OOLA 1K55A 3IF5A 4JGRA 1Y4OA 4WMCD 4RQ9A 2V1ZA 2P9VA 1Y54A 3DTMA 2JKFA 3VOZA 2Y2NA 2PD8A 4X56A 4B88A 1EW0A 4KZ8A 4JF4A 2V2FF 1E3UD 2XRNA 3UPNA 4GJ4A 5F83A 3AGEA 4EWFA 2O99A 2PR6A 2P08A 3WRZA 4MBHA 2IWBA 3ZG5A 5HWVA 3A0RA 3BLSA 1G6AA 4WN5A 1BUEA 1F5MA 3NJAA 1HTZA 1BT5A 2B5RA 2PU2A 1HZOA 2UWXA 3DTEA 3T4SA 1G5UA 5F5YA 2PU4A 5G4YA 1NXYA 3T1QB 4WF0A 3ULFA 4WMCA 4MEZA 1K54A 3PBNA 4X6TA 3NCKA 4OOMA 4S2PA 5HFOA 1BLPA 4DKIA 2ZLYA 1YPRA 3M6BA 1E3UA 5E2HA 1ONHA 1DJBA 1Q2PA 4BENA 4NK3A 1JTDA 1D1JA 4EEPA 3O86A 3A3JA 3MF0A 5CXWA 3BY9A 1FIKA 1E4DA 2DRWA 5TFQA 4IBRA 4PM7A 2ZJ9A 3IT9A 3GDIA 2G2UA 3GVBA 5L09A 1TS6A 2PBYA 3ZG7B 2M7VA 4EEUA 1CI8A 4DE0A 3P09A 2KX6A 4ETZA 4JGPA 1IFQA 2OV5A 2A49A 3IHBA 2KDKA 2VV7A 2ZOHA 5JYPA 3IXHA 5D3OA 1TDGA 4WLAA 2D01A 4WYYA 2V0UA 2V0WA 4CLCE 3IXGA 1KE4A 2OSUA 3N7WA 3M2KA 4IBXA 5FAQA 1DP6A 2EX2A 3H82B 3FKWA 3JVUA 4UA9A 3HLFA 1DP9A 3KSGA 3UE1A 4D2OA 1S6RA 4R3AA 3IF6A 4X25A 1Y28A 2JE5A 1Q2QA 4EBPA 3OLOA 3W4PA 3SZTA 4KZ3A 2EFUA 3I7JA 2EXBA 4GCZA 2H28A 2OWHA 3GQZA 3TG9A 2QWSA 3GTCA 3ZVTA 2PYRA 3BFDA 1JWZA 1MC0A 4WZ5C 2HP5A 5CGSA 5HX9A 1IELA 4Z9QA 5F68A 1OPXA 5TBMA 2XROA 3V3RA 4KZ7A 2XD5A 4JGOA 3EQVA 1L3LA 3ZG0A 4R3BA 4EETB 4F94A 2J80A 1Z6FA 3VMAA 1W7FA 5DJTA 4I39A 3MFXA 3VSKA 2B02A 3LI9A 5HD3A 3MXSA 5KZHA 2ZQ7A 5CGWA 3Q7ZA 4QJGA 4RA7A 3WRTA 4S2LA 1FCMA 4DN0A 2JKGA 5KMWA 4LCLA 1XGJA 1P9WA 2UV0E 2CC1A 4JKTA 4Y5FA 3WWXA 1D06A 1P0ZA 3S7PA 3WS2A 1NYYA 4E6WA 5FQ9A 4MMNA 4E3OA 3GSGA 4KZ5A 1JNUA 4LGWA 3PBQA 4KZBA 5J4EA 3BW6A 1S1YA 4PKYG 3BWLA 5HSQA 3DAVA 1IYQA 3IWQA 4EU0A 3FPVA 5EV0A 2ZMAA 3PXPA 2M1CA 4HNBA 3MXRA 1FOFA 3NIAA 4GD6A 4ESPA 4U0TA 3C2WA 1TS8A 3MZDA 2XR0A 2QHKA 1OMEA 5AQ9A 5HPFA 2O9AA 2ZM2A 2QJ5A 4XUXA 2VV8A 2HP9A 2XLNA 4H6JA 2Y8HA 4X1MA 3IS2A 2XF3A 4HI4A 3UMDA 4ARZB 3A0SA 1FCOA 4S2IA 5DVAA 4B4ZA 1CK3A 1XKZA 2R78A 2Y2HA 5I5LA 1N4OA 3UE6A 4II7A 1L2SA 4IVIA 5GLDA 4IUHA 3DTIA 3BFEA 4JF5A 3QP1A 4E04A 4MCWA 4S2OA 2DNSA 3OZHA 1TDLA 2PAVP 4BJPA 5HAPA 4Y17A 2W1TB 3UB7A 1PZOA 3T12B 3CZDA 4KQDA 5FI2A 1MWUA 3G34A 2X02A 3LEQA 1KDSA 1KGEA 4X53A 4GHIA 3B33A 2VLGA 4K08A 1LL9A 3UE0A 3NULA 2NUTC 5FL3A 1DY6A 1K54C 4O7DA 2RL3A 2WKPA 1TS0A 2Z6CA 4WZ4A 5EOEA 1OTAA 4RX2A 1H8ZA 4MN5A 4F3LB 2Q9MA 1IKIA 3CPTA 1MWSA 3ZYTA 5HPIA 3FWLA 1ZC2A 4NXBA 2JC7A 5CGXA 4HP9A 3NOPC 5FI7A 1SZVA 1Z09A 2V8FA 4E3MA 2YKFA 3BRMA 2YKHA 2WKRA 2I72A 3VP4A 1ES2A 4K0XA 4QHCA 3IWIA 4KG6A 3KSHA 3VOYA 2OAQ1 4DE2A 2RCXA 4R0QA 3U4LP 5IT5A 2ZL1B 1ERQA 2Q9NA 2P9VB 5GHXA 2XSSA 2VEAA 1MWRA 3D4FA 1OJGA 4R6LA 3CI6A 4KENB 5G4ZA 3D72A 4LV0A 5GLAA 3A3IA 3T4QA 2ZOIA 4XT2B 2HZ5A 2ZQCA 4YOFA 3OC2A 1K4EA 3N6IA 3K2NA 3EOIA 4M3KA 1MY8A 4KG5A 2WGWB 1ZTUA 2W1RA 1BZAA 1OT9A 2K31A 4EQ1A 3PBOA 5FDSA 1YLZA 1KGFA 4WZ5A 1BSGA 3IF6C 3HUNA 3E98A 1LL5A 3E0YA 3QNCA 3IX4A 3LCEA 5DTTA 5EVID 1DJAA 3SOIA 4OONA 3MKEA 3PAGA 4EERA 2XK1A 5CHJA 2VKSA 3SW1A 4LV3A 3GR2A 4DJ3A 1WYBA 3SH8A 2ZC7A 3IXBA 3C4PA 2HP6A 2WADA 1ZHHB 3RJUA 4N92A 3UB5P 2WYXA 3C8CA 4K0WA 3VFHA 4KZAA 3BQ8A 4OQHA 2PYPA 1MWTA 5DF8A 3UB6A 4EUVA 3HVFA 4NXEA 5L10A 1K25A 4U3TA 3N8RA 4CLCC 4HJ3A 4GB7A 2Y55A 1EWZA 5L2FA 5AVEA 3RH8B 4I5SA 4N1XA 1PWDA 3F1NA 5EVIA 3B42A 3B3XA 4JLFA 1M6KA 3G35A 1CF0A 4EV4A 3H9WA 4I3IA 4WUJA 2XEPA 1MZUA 3F1OB 5F1GA 2VGJA 3BLMA 3UDFA 3PBRA 3G30A 4OOYA 5HDSA 4OP5A 2JCHA 3BFFA 2IA2A 5HW3A 4HQAA 3UB8A 2HF6A 1D7EA 5E2GA 5TGFA 4BLMA 3HCYA 5EECA 3EEAA 3Q82A 1CEGA 2XH9A 1YLTA 3NC8A 1ZKJA 3CHWP 3P7NA 4IEDA 4FD8A 4PHTA 3S7QA 3HL9A 3L7HA 1GHPA 2Y91A 5CERA 3FPWA 3OOVA 1NY0A 2Y2LA 3D3OA 1T1BA 3IWOA 4Q0HA 5I94A 2XA7S 3FZCA 4U0XA 3ISGA 5E43A 1K4FA 4DRTA 1KE0A 2V1AA 1QMEA 3LI8A 3UPPA 4P6BA 4MN6A 1XP4A 4NXGA 1ZG6A 4OQ0A 3EQUA 4CJNA 3C5AA 1ESUA 3FKVA 2PBDP 1YMXA 5FAPA 1VM1A 1F9IA 2W27A 5FQKA 2BLSA 4LPZA 2O9BA 2OLVA 4E6XA 4BD1A 3JPUA 2JKRI 3SS4A 2ZMFA 1G68A 4L9FA 3S1YA 1C3BA 3OPHA 4Y3IA 2HJEA 3LR5A 4DF6A 4B93A 3QHYA 4LLOB 4YNRA 2HDRA 1IOUA 1OTBA 1UWNX 4GS9A 4O8GA 5J7EA 4EW7A 2B95A 2QYBA 3UNWA 1XA1A 4OPRA 4E3NA 5DFYA 1NRFA 4I3JA 2OAP1 4OQIA 4JXSA 2XA7M 1FQGA 2J9PA 2JKTI 4GW9A 4XUZA 1BLHA 3RTYA 2ZMVA 3CUEA 3ZHHA 4MN7A 2M7UA 1CJFA 3LYXA 5M1AA 4WBGA 2EX8A 2ZC4B 4OPQA 3IQAA 1N9LA 3BYDA 4ETXA 4S2KA 4BL2A 1WYCA 4BD0A 3ITBA 4YWZA 3CG5A 1CEFA 2LB9A 2P74A 3LO7A 2Y4AA 4DXBA 2WKEA 4N1HA 3KYZA 3WS0A 4EUZA 2OLUA 2XQZA 2FZ0A 3BM6A 2Y79A 3RXWA 3UE3A 4CLCD 3WS4A 2QJ7A 4DJ2A 2W3DA 3EWKA 3OPLA 4GLQA 4ZJ1A 3DTKA 3MS6A 4HBUA 1AXBA 1TEMA 1VQQA 4JPMA 1T1CA 1H3QA 3FV7A 3T1RA 3T4LA 5FQQA 1P9RA 1EI5A 1TS7A 2KLIA 1GHIA 2K7SA 3KX0X 3UMEA 4I3AA 3MFDA 3NI9A 3E2KA 3FG8A 2JHEA 3QP5A 4GHIB 5A8BA 3N8SA 1XFNA 1L0FA 1XJ6A 2J3TC 3EGDC 4S2MA 1L0DA 4KUKA 5F6AA 1GSVA 2EX6A 4CLCA 5DTSA 4ID4A 3CPTB 4DDSA 1HVBA 3IBJA 2ZC5B 3VE3A 4IUKA 2ZQ9A 1NLYA 2ZD8A 5FASA 1S4SA 1XFQA 2JBFA 1E25A 3T4KA 2H0TA 2EA9A 5CEDA 3HJIA 4BBUA 3N8LA 5CECA 5CHUA 2ZC3B 3DWKA 3PHYA 2H10A 4B4XA 1RCJA 3IH8A 5HZHA 2XD1A 5J8XA 5HL1A 3ZGAB 5EVIC 1IKGA 1K6RA 1OTDA 3V5MA 4KQQA 1W8YA 4NG2A 3E4QA 3H7WA 4OQGA 1HLUP 3MXQA 1YLPA 3F1PB 4JF6A 5JYOA 4NEED 4ME4A 5TR7A 2NUPC 2W3FA 3UPOA 1DJCA 2PD7A 1RP5A 1O7EA 5L8MA 4EBLA 3PBTA 3BY8A 3DWZA 3CAXA 4HH3A 4E3JA 4LCMA 3LIEA 4KQOA 5HDDA 5EPHA 1T1AA 4PKYA 1TD5A 4NETA 4IJGA 5K5BA 2BG1A 4KQRA 3BFGA 2HDQA 1I2WA 1O07A 4BBTA 4BQMA 1RGZA 2P7JA 2EFXA 4FUWA 4E3IA 1JWPA 5FI6A 2VA0A 4X1LA 4PM9A 1LSXA 1KDWA 3IH9A 5GHZA 3S7OA 1W63M 3H82A 5EE8A 5HWWA 3LFVA 1AWIA 1PNEA 4GDNA 1XX2A 3LIBA 2HDUA 4ZTKA 4P0MA 2X71A 3NY4A 4MDZA 3HLWA 5HARA 2PDRA 2E8JA 1LL8A 3NBLA 2H5SA 1VETA 5HWTA 3KYQA 3DBAA 4OVDA 3QNBA 2J9OA 4QU3A 3K3CA 1S67L 2O9CA 4P87A 5A90A 3HREA 4NKPA 3BJNA 1VB6A 4L9EA 1K38A 4UQIS 2VZWA 4X55A 1W63Q 4ZJ3A 3LEZA 2A24A 3F1NB 3AGFA 4KG2A 3T1XA 1H0MA 4MBFA 1SCWA 4QPRA 5DF9A 3BFCA 3SS3A 5EM0A 1L0EA 1V9ZA 4H8RA 1OJ5A 3Q07A 3AGDA 3ZG8B 2ZQ8A 3C7VA 3MZFA 1N9NA 1PRQA 3HUMA 3V50A 4C3QA 1T19A 3JYIA 5AVFA 3SH7A 3E4OA 3W2ZA 1YT4A 2J3TD 3VE4A 3U2AA 2XFTA 3CUEC 1W79A 3IX8A 3E2LA 5HD5A 3ZNTA 1MPLA 4HP4A 2WKIA 3LGOA 1NZOA 4JGQA 3R7WA 3MMHA 5LBRA 3MBZA 3ZNYA 1LI0A 5U47A 4R38A 3TJZC 4UQIM 4OPZA 1G28A 4OPYA 5L07A 3T4JA 4EXOA 3O5YA 2QMIA 4PM5A 5AQAA 3UN7A 1ZG4A 4X69A 4LRYC 1FR1A 4GD8A 3KSFA 5J3WA 3SH9A 3ZFZA 2O0YA 3ZVWA 3VP3A 4D60A 2P04A 4Y15A 1XJ3A 5FQJA 1YQSA 3A3DA 1W8QA 3PTEA 1PYYA 1G6OA 3M6HA 3HLEA 3PYPA 5DTKA 4AFIA 2BTFP 3ICYA 3IXDA 1MXOA 4KZ6A 3W4OA 3TRCA 3V3SA 4RVAA 4O01A 4M4XA 3K3DA 4O0PA 1NYMA 5GHYA 1H5XA 4HEFA 4JXVA 4GS9B 3PBSA 4ZJ2A 5F1FA 4E3LA 3MJQA 2JN7A 2W1TA 1YAXA 2HDSA 4ZBEA 2QPNA 3FC7A 3V67A 1STZA 1NZUA 5C5KA 2WZXA 2V9AA 3Q7VA 4Y0OA 3G31A 5AJGA 5EVEA 3KSIA 5M18A 1F98A 5CTMA 3B47A 3OCLA 3SS5A 4DXCA 1XXMA 5DFXA 2W0NA 2HPBA 5GLCA 4HY8A 4IHQA 3CITA 1VEUA 3LICA 1CQAA 4HOIA 3RFBA 3O3VA 4XXRA 1I2SA 5HAIA 3TSGA 3JVVA 4QD4A 3QP2A 2Z2LB 3Q81A 4GDBA 4DE1A 2R9WA 3HLCA 4WEJA 3VV4A 1CI9A 2J3WA 3HLBA 4RYEA 3IF6B 2VV6A 5AQBA 1PFLA 3ZQ5A 3HUOA 3T50A 4EQIA 2ZL1A 3LY3A 5FATA 5GL9A 5F82A 1SHVA 4MNRA 3T4TA 2I9VA 3MQQA 1KOUA 4CPKA 2HV1A 4YINA 4R23A 2ACGA 4RX3A 5FQMA 1VHMA 3C38A 2J7VA 5A93A 4XT2A 2A3UA 1PI4A 1S4RA 4DDYA 1BLCA 4I38A 5DJUA 4N9KA 1JWVA 4GN2A 1HD8A 4WEKA 1S66L 2WGWA 2WKQA 1P97A 1TVFA 5TBMB 2Y2KA 2G7UA 2PR5A 3WS5A 4FH4A 4LENA 4CLCB 5E2EA 2Z6DA 2EWWA 3VSLA 5CX7A 4Q0JA 1SKOA 2ZC6B 2Y2QA 1N9OA 2HJ9C 2ZBBA 4KZ4A 1YMSA 3HLGA 3TOIA 4S2JA 2DCFA 1BTLA 2V8CA 1WA9A 3G32A 2PHYA 4GNUA 4DMZA 1K56D 1NJ4A 3VP2A 3V39A 1KVLA 4HJ6A 3IBRA 4FSFA 1IYSA 3QP6A 3LR4A 4P85A 3TE8A 1ES5A 2WGIA 2VX8A 3D9YA 1ODVA 1DP8A 1K57A 3G6OA 3HBRA 1H8YA 2VGKA 1LSVA 2W3HA 4OKPA 5FA7A 3EEHA 4UHUA 3R4KA 2WZZA 3ZCZA 4FTXA 3H7WB 3NDGA 2Q0OA 1YSPA 4QY5A 2L1MA 2Y2IA 2EXAA 3C4OA 2C5WB 3G4PA 1KE3A 4C75A 2VGLS 3LY4A 4Y7PA 4BMWA 1BYWA 2WGVA 3MQ0A 4QY6A 3UB9A 1GSWA 4JXGA 1K56A 3HJKA 4YFMA 3C30A 2PRFA 5A92A 2FH5A 3F1OA 2WAFA 1MKIA 2A2LA 3MZEA 4BBVA 4H6JB 3IS2B 1J9MA 5EM1A 1WE4A 4LV2A 3N4IA 3LR0A 1SDNA 2V20A 4X68A 3VOLA 3E4PA 3ITAA 2H0YA 3VP0A 3OCNA 5MC7A 4R70A 4PM8A 3W8KA 2GX5A 1LHYA 4ZAMA 4EESA 4IVKA 2J8YA 3P01A 3OPRA 1TF1A 1VETB 1YM1A 3A0VA 4GKUA 1YLWA 1MKMA 2VGLM 2EX9A 1T18A 3NHQA 1YLJA 2FFYA 5FDHA 3CLOA 1NWZA 5HL6A 1SDEA 4OLDA 5IHVA 3UDIA 1QMFA 1FSYA 5M19A 3G2ZA 3GRJA 1BULA 1ERMA 3MSHA 2Y2MA 2W3GA 3NDEA 2A24B 1PIOA 2BASA 4N9LA 5CRFA 4KZ9A 3W4QA 3VFFA 3UDXA 4R4SA 4OLGA 1DRMA 4S2NA 2L0WA 1YLYA 3S22A 2Y2OA 1K6SA 4Q0IA 2Y2JA 2Y2PA 4ZRRA 2ZQDA 2DMWA 1FR6A 3BEBA 2OWJA 2GZAA 1PWGA 4MLLA 4NXFA 3OPPA 4G3KA 5HDCA 3PAEA 4DE3A 2IWDA 1PW1A 1IYPA 5BOHA 4HJ4A 3LIAA 4R3JA 1YSQA 4FCFA 3LIFA 2Y2GA 5DKKA 4UEYA 3CMZA 2AVXA 3R7WB 1ES3A 2V1BA 3IX3A 4L0LA 1K0KA 3BECA 5FAOA 4UA7A 5DKLA 3LIDA 2GNXA 1L0GA 2D02A 2FFFB
chains in the Genus database with same CATH topology
1MPLA 4Q8IA 1TDGA 2WKIA 5E2GA 1XPBA 1NZOA 5TGFA 4BLMA 4WYYA 5EECA 4ZDXA 3MBZA 3Q82A 3ZNYA 1CEGA 2XH9A 3IXGA 1PZPA 1YLTA 1LI0A 3NC8A 5U47A 1ZKJA 4IEDA 4FD8A 1KE4A 3O87A 2OSUA 3N7WA 3M2KA 4IBXA 4OPYA 4OPZA 5FAQA 2EX2A 2QMIA 1MBLA 3HL9A 4PM5A 3GV9A 5AQAA 3FKWA 1GHPA 1EROA 1ZG4A 4UA9A 3UN7A 3HLFA 2Y91A 1KVMA 4X69A 5FSRA 1XA7A 5CERA 3UE1A 4D2OA 1PI5A 1FR1A 1S6RA 1K55C 4GD8A 3IF6A 1NY0A 2JE5A 1Q2QA 3GMWA 2Y2LA 4PM6A 4UAAA 4EBPA 3SH9A 3ZFZA 4Y0TA 3ZVWA 3IWOA 3VP3A 4QB8A 3W4PA 5I94A 3IHAA 4KZ3A 3FZCA 1FSWA 2EFUA 5FQJA 4U0XA 3ISGA 5E43A 1YQSA 1K4FA 1W8QA 3A3DA 1PYYA 3I7JA 2EXBA 3PTEA 4K91A 2R9XA 4DRTA 3M6HA 3HLEA 1KE0A 5DTKA 1QMEA 4FH2A 3IXDA 3UPPA 3RXXA 3GQZA 4P6BA 1XP4A 1MXOA 3UY6A 3TG9A 3GTCA 1KGGA 1BLSA 3ZVTA 1ZG6A 4OQ0A 1IYOA 4KZ6A 3W4OA 3EQUA 3BFDA 3HLDA 4C6YA 4CJNA 1JWZA 3C7UA 3C5AA 4WZ5C 3V3SA 1ESUA 3FKVA 4RVAA 2HP5A 5CGSA 1YMXA 5CHMA 2GDNA 5HX9A 1I5QA 1IELA 5FAPA 4Z9QA 1VM1A 3G2YA 5FQKA 2BLSA 4MBKA 4JBFA 4GOGA 2QZ6A 4HESA 1NYMA 5GHYA 2OLVA 4E6XA 4BD1A 3SS4A 1H5XA 4HEFA 1G68A 2ZM8A 4JXVA 4KZ7A 3V3RA 2XD5A 4PPRA 4R4RA 2Z2MB 3EQVA 3S1YA 1C3BA 3Q7VB 3ZG0A 3PBSA 4ZJ2A 4R3BA 3OPHA 5F1FA 4E3LA 4DF6A 2ZQAA 3A3FA 5EVIB 4F94A 1Z6FA 3QHYA 2HDRA 2HDSA 2QPNA 4ZBEA 3VMAA 1GA0A 1NZUA 1W7FA 2XDMA 2WZXA 3Q7VA 1SKFA 4Y0OA 3UNWA 3G31A 1XA1A 5CEBA 2X01A 3A3EA 4OPRA 4E3NA 3VP1A 3VSKA 4R1GA 5M18A 3P98A 1NRFA 5CTMA 4DXCA 3OCLA 3SS5A 1XXMA 3MXSA 5KZHA 4OQIA 2ZQ7A 4JXSA 5EOOA 2HPBA 5CTNA 1JTGA 5GLCA 1FQGA 4WM9A 1K57C 3Q7ZA 5CGWA 1N9BA 4QJGA 5GLBA 2J9PA 4RA7A 4XUZA 3WRTA 1FCNA 4S2LA 1BLHA 1FCMA 5KMWA 5HAQA 3ZHHA 4LCLA 1XGJA 5M1AA 2Y59A 3ZG9B 1GA9A 3O3VA 2CC1A 4WBGA 4E3KA 4JKTA 2EX8A 4XXRA 2ZC4B 1I2SA 4OPQA 1ES4A 5HAIA 1IEMA 3IQAA 3TSGA 3BYDA 4QD4A 3WWXA 3WS2A 4S2KA 4BL2A 1NYYA 4E6WA 2Z2LB 3Q81A 4GDBA 5FQ9A 4DE1A 1WYCA 4BD0A 3ITBA 3GSGA 4E3OA 2R9WA 4KZ5A 3HLCA 4WEJA 3ZDJA 3PBQA 4KZBA 1CI9A 1RGYA 3CG5A 1CEFA 2P74A 3LO7A 2Y4AA 4OH0A 1IYQA 3IWQA 2WKEA 4DXBA 4N1HA 5A91A 5KSHA 3HLBA 3WS0A 2XFSA 4OOLA 2ZMAA 5EUAA 4RYEA 4Y0UA 3IF6B 4EUZA 5AQBA 2OLUA 2XGNA 2XQZA 4UA6A 3MXRA 3HUOA 1LLBA 3BM6A 1FOFA 4EQIA 3NIAA 2C6WB 3LY3A 5FATA 4GD6A 5GL9A 5F82A 3RXWA 3UE3A 3M2JA 4U0TA 1SHVA 1U60A 4MNRA 3MZDA 3WS4A 2XR0A 1OMEA 5AQ9A 4OP8A 4CPKA 2ZM2A 3OPLA 4YINA 4R23A 4RX3A 4XUXA 4ZJ1A 2HP9A 2XLNA 5FQMA 4HBUA 5EVLA 1AXBA 2XF3A 1TEMA 1VQQA 2WK0A 1M40A 4JPMA 1PWCA 2J7VA 1FCOA 5A93A 4S2IA 2A3UA 2IWCA 5DVAA 1PI4A 4B4ZA 1CK3A 3FV7A 5FQQA 3O88A 4DDYA 1BLCA 3WS1A 1XKZA 1EI5A 4N9KA 5KSCA 1JWVA 2Y2HA 4GN2A 1N4OA 1HD8A 1GHIA 2WGWA 4WEKA 3MKFA 4BL3A 1L2SA 4IVIA 5GLDA 1TVFA 3BFEA 4JF5A 2WUQA 2Y2KA 3WS5A 4S2OA 1XGIA 2DNSA 4FH4A 4LENA 3OZHA 3MFDA 1TDLA 5E2EA 3NI9A 3E2KA 3VSLA 4BJPA 2ZC6B 3N8SA 1L0FA 2Y2QA 5HAPA 1PZOA 3Q1FA 3TOIA 3CZDA 1YMSA 3HLGA 4KZ4A 1L0DA 4S2MA 5FI2A 1MWUA 3G34A 4S2JA 2X02A 4WELA 2DCFA 2EX6A 4GZBA 5DTSA 1BTLA 1KDSA 1KGEA 4HBTA 4ID4A 4X53A 3G32A 1GCEA 3CJMA 1LL9A 3UE0A 4GNUA 1DY6A 1K54C 1K56D 1S0WA 4O7DA 4DDSA 1NJ4A 2RL3A 3VP2A 1HVBA 3V39A 1KVLA 4WZ4A 5EOEA 2ZC5B 2E8IA 4RX2A 1H8ZA 4FSFA 1IYSA 2ZM0A 4P85A 4JXWA 2Q9MA 2ZQ9A 4LV1A 1GHMA 1ES5A 2WGIA 2ZD8A 1IKIA 5FASA 1MWSA 2JBFA 1E25A 1K57A 2H0TA 3HBRA 5CEDA 1ONGA 3FWLA 1H8YA 1ZC2A 3N8LA 5CECA 2VGKA 5CHUA 2ZC3B 1PW8A 4OKPA 2JC7A 3DWKA 4S2NC 5CGXA 5FA7A 2H10A 4B4XA 1RCJA 4UHUA 5FI7A 3IH8A 1ESIA 5G18A 2XD1A 5J8XA 4E3MA 5HL1A 2WZZA 3BRMA 3ZCZA 3NDGA 2I72A 2G2WA 3ZGAB 3VP4A 1ES2A 4K0XA 4QHCA 4QY5A 1IKGA 4PMAA 3IWIA 5EVIC 4A5RA 1K6RA 4KG6A 5DF7A 3S4XA 2WKHA 2Y2IA 3V5MA 3VOYA 3DW0A 4KQQA 4DE2A 2EXAA 3C4OA 2C5WB 3G4PA 1W8YA 1KE3A 2RCXA 4R0QA 3LY4A 4C75A 4Y7PA 1LI9A 5AQ7A 4OQGA 4EBNA 2WGVA 4QY6A 1YLPA 4JF6A 5JYOA 1ALQA 4JXGA 1ERQA 2Q9NA 5TR7A 1K56A 4YFMA 1W5DA 3UPOA 1JVJA 1DJCA 2P9VB 3FYZA 5GHXA 5FQIA 5A92A 1RP5A 2WAFA 1MKIA 1MWRA 1O7EA 2WAEA 3D4FA 5E2FA 4EBLA 4KENB 3PBTA 3MZEA 3UO9A 1K55A 3DWZA 3IF5A 4E3JA 4LCMA 4LV0A 4WMCD 4KQOA 1J9MA 2V1ZA 5EPHA 2P9VA 5GLAA 1WE4A 4NETA 3A3IA 4LV2A 1Y54A 3N4IA 3DTMA 2ZQCA 2BG1A 4KQRA 3VOZA 3BFGA 2HDQA 1SDNA 2Y2NA 2V20A 1I2WA 1K4EA 3OC2A 3N6IA 1O07A 4BQMA 1RGZA 4X56A 4B88A 4X68A 2EFXA 4M3KA 1MY8A 3ITAA 4KG5A 2WGWB 4KZ8A 1JWPA 4E3IA 4JF4A 2H0YA 2V2FF 1E3UD 5FI6A 3VP0A 3UPNA 4PM9A 3OCNA 5F83A 1BZAA 1KDWA 4PM8A 3W8KA 3AGEA 3IH9A 4EWFA 5GHZA 3PBOA 1YLZA 1LHYA 1KGFA 3WRZA 5EE8A 4MBHA 2IWBA 4ZAMA 4WZ5A 3ZG5A 3BLSA 1G6AA 1BUEA 1BSGA 2B5RA 1HTZA 1BT5A 3IF6C 4GDNA 1XX2A 2J8YA 2PU2A 4IVKA 3HUNA 3QNCA 1LL5A 1HZOA 2HDUA 3LCEA 2UWXA 3OPRA 5DTTA 5EVID 1DJAA 4ZTKA 3SOIA 4OONA 1YM1A 4P0MA 2X71A 3MKEA 3NY4A 3PAGA 4GKUA 1YLWA 2XK1A 5HARA 3HLWA 2PU4A 2EX9A 5CHJA 1NXYA 3NBLA 4LV3A 3GR2A 1YLJA 2H5SA 2FFYA 1WYBA 5FDHA 5IHVA 1SDEA 4OLDA 3UDIA 3SH8A 1QMFA 2ZC7A 3IXBA 1FSYA 4WMCA 4MEZA 1K54A 3C4PA 4OVDA 3ZNTA 3PBNA 3QNBA 2HP6A 2J9OA 2WADA 3G2ZA 3GRJA 4X6TA 5M19A 3NCKA 1BULA 4N92A 4OOMA 4S2PA 3RJUA 4QU3A 2WYXA 1ERMA 2Y2MA 4P87A 1BLPA 4K0WA 3HREA 5HFOA 3VFHA 4KZAA 5A90A 4OQHA 4DKIA 3NDEA 1MWTA 2ZLYA 5DF8A 1PIOA 1K38A 4N9LA 3HVFA 1K25A 4X55A 3M6BA 1E3UA 5CRFA 4U3TA 4KZ9A 5E2HA 4ZJ3A 1ONHA 3LEZA 3W4QA 1DJBA 3N8RA 1Q2PA 3VFFA 4BENA 3UDXA 4R4SA 4NK3A 4OLGA 4S2NA 1JTDA 3AGFA 1YLYA 3S22A 4KG2A 3O86A 3A3JA 2Y2OA 4GB7A 1K6SA 5CXWA 2Y2JA 4MBFA 1SCWA 2Y55A 1E4DA 1EWZA 2DRWA 5L2FA 2Y2PA 4N1XA 5DF9A 1PWDA 5TFQA 5EVIA 3B3XA 4IBRA 4PM7A 2ZJ9A 3IT9A 4JLFA 2ZQDA 3BFCA 2G2UA 3GVBA 1FR6A 1M6KA 3BEBA 3G35A 1L0EA 3SS3A 4H8RA 2PBYA 1PWGA 3Q07A 4EV4A 4MLLA 3ZG7B 3OPPA 3AGDA 3PAEA 2ZQ8A 3C7VA 3ZG8B 2IWDA 3MZFA 1PW1A 4DE3A 1IYPA 5BOHA 2XEPA 4R3JA 3HUMA 3V50A 5F1GA 2VGJA 3BLMA 3UDFA 4C3QA 4FCFA 3PBRA 1CI8A 3JYIA 2Y2GA 4DE0A 3G30A 3P09A 3CMZA 4OOYA 3SH7A 1YT4A 3BFFA 2JCHA 4OP5A 1ES3A 5HW3A 2XFTA 2OV5A 2A49A 4L0LA 3IHBA 1W79A 3BECA 5FAOA 4UA7A 1L0GA 2FFFB 5JYPA 3IXHA 3E2LA 5D3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPL A;  4Q8I A;  1TDG A;  2WKI A;  5E2G A;  1XPB A;  1NZO A;  5TGF A;  4BLM A;  4WYY A;  5EEC A;  4ZDX A;  3MBZ A;  3Q82 A;  3ZNY A;  1CEG A;  2XH9 A;  3IXG A;  1PZP A;  1YLT A;  1LI0 A;  3NC8 A;  5U47 A;  1ZKJ A;  4IED A;  4FD8 A;  1KE4 A;  3O87 A;  2OSU A;  3N7W A;  3M2K A;  4IBX A;  4OPY A;  4OPZ A;  5FAQ A;  2EX2 A;  2QMI A;  1MBL A;  3HL9 A;  4PM5 A;  3GV9 A;  5AQA A;  3FKW A;  1GHP A;  1ERO A;  1ZG4 A;  4UA9 A;  3UN7 A;  3HLF A;  2Y91 A;  1KVM A;  4X69 A;  5FSR A;  1XA7 A;  5CER A;  3UE1 A;  4D2O A;  1PI5 A;  1FR1 A;  1S6R A;  1K55 C;  4GD8 A;  3IF6 A;  1NY0 A;  2JE5 A;  1Q2Q A;  3GMW A;  2Y2L A;  4PM6 A;  4UAA A;  4EBP A;  3SH9 A;  3ZFZ A;  4Y0T A;  3ZVW A;  3IWO A;  3VP3 A;  4QB8 A;  3W4P A;  5I94 A;  3IHA A;  4KZ3 A;  3FZC A;  1FSW A;  2EFU A;  5FQJ A;  4U0X A;  3ISG A;  5E43 A;  1YQS A;  1K4F A;  1W8Q A;  3A3D A;  1PYY A;  3I7J A;  2EXB A;  3PTE A;  4K91 A;  2R9X A;  4DRT A;  3M6H A;  3HLE A;  1KE0 A;  5DTK A;  1QME A;  4FH2 A;  3IXD A;  3UPP A;  3RXX A;  3GQZ A;  4P6B A;  1XP4 A;  1MXO A;  3UY6 A;  3TG9 A;  3GTC A;  1KGG A;  1BLS A;  3ZVT A;  1ZG6 A;  4OQ0 A;  1IYO A;  4KZ6 A;  3W4O A;  3EQU A;  3BFD A;  3HLD A;  4C6Y A;  4CJN A;  1JWZ A;  3C7U A;  3C5A A;  4WZ5 C;  3V3S A;  1ESU A;  3FKV A;  4RVA A;  2HP5 A;  5CGS A;  1YMX A;  5CHM A;  2GDN A;  5HX9 A;  1I5Q A;  1IEL A;  5FAP A;  4Z9Q A;  1VM1 A;  3G2Y A;  5FQK A;  2BLS A;  4MBK A;  4JBF A;  4GOG A;  2QZ6 A;  4HES A;  1NYM A;  5GHY A;  2OLV A;  4E6X A;  4BD1 A;  3SS4 A;  1H5X A;  4HEF A;  1G68 A;  2ZM8 A;  4JXV A;  4KZ7 A;  3V3R A;  2XD5 A;  4PPR A;  4R4R A;  2Z2M B;  3EQV A;  3S1Y A;  1C3B A;  3Q7V B;  3ZG0 A;  3PBS A;  4ZJ2 A;  4R3B A;  3OPH A;  5F1F A;  4E3L A;  4DF6 A;  2ZQA A;  3A3F A;  5EVI B;  4F94 A;  1Z6F A;  3QHY A;  2HDR A;  2HDS A;  2QPN A;  4ZBE A;  3VMA A;  1GA0 A;  1NZU A;  1W7F A;  2XDM A;  2WZX A;  3Q7V A;  1SKF A;  4Y0O A;  3UNW A;  3G31 A;  1XA1 A;  5CEB A;  2X01 A;  3A3E A;  4OPR A;  4E3N A;  3VP1 A;  3VSK A;  4R1G A;  5M18 A;  3P98 A;  1NRF A;  5CTM A;  4DXC A;  3OCL A;  3SS5 A;  1XXM A;  3MXS A;  5KZH A;  4OQI A;  2ZQ7 A;  4JXS A;  5EOO A;  2HPB A;  5CTN A;  1JTG A;  5GLC A;  1FQG A;  4WM9 A;  1K57 C;  3Q7Z A;  5CGW A;  1N9B A;  4QJG A;  5GLB A;  2J9P A;  4RA7 A;  4XUZ A;  3WRT A;  1FCN A;  4S2L A;  1BLH A;  1FCM A;  5KMW A;  5HAQ A;  3ZHH A;  4LCL A;  1XGJ A;  5M1A A;  2Y59 A;  3ZG9 B;  1GA9 A;  3O3V A;  2CC1 A;  4WBG A;  4E3K A;  4JKT A;  2EX8 A;  4XXR A;  2ZC4 B;  1I2S A;  4OPQ A;  1ES4 A;  5HAI A;  1IEM A;  3IQA A;  3TSG A;  3BYD A;  4QD4 A;  3WWX A;  3WS2 A;  4S2K A;  4BL2 A;  1NYY A;  4E6W A;  2Z2L B;  3Q81 A;  4GDB A;  5FQ9 A;  4DE1 A;  1WYC A;  4BD0 A;  3ITB A;  3GSG A;  4E3O A;  2R9W A;  4KZ5 A;  3HLC A;  4WEJ A;  3ZDJ A;  3PBQ A;  4KZB A;  1CI9 A;  1RGY A;  3CG5 A;  1CEF A;  2P74 A;  3LO7 A;  2Y4A A;  4OH0 A;  1IYQ A;  3IWQ A;  2WKE A;  4DXB A;  4N1H A;  5A91 A;  5KSH A;  3HLB A;  3WS0 A;  2XFS A;  4OOL A;  2ZMA A;  5EUA A;  4RYE A;  4Y0U A;  3IF6 B;  4EUZ A;  5AQB A;  2OLU A;  2XGN A;  2XQZ A;  4UA6 A;  3MXR A;  3HUO A;  1LLB A;  3BM6 A;  1FOF A;  4EQI A;  3NIA A;  2C6W B;  3LY3 A;  5FAT A;  4GD6 A;  5GL9 A;  5F82 A;  3RXW A;  3UE3 A;  3M2J A;  4U0T A;  1SHV A;  1U60 A;  4MNR A;  3MZD A;  3WS4 A;  2XR0 A;  1OME A;  5AQ9 A;  4OP8 A;  4CPK A;  2ZM2 A;  3OPL A;  4YIN A;  4R23 A;  4RX3 A;  4XUX A;  4ZJ1 A;  2HP9 A;  2XLN A;  5FQM A;  4HBU A;  5EVL A;  1AXB A;  2XF3 A;  1TEM A;  1VQQ A;  2WK0 A;  1M40 A;  4JPM A;  1PWC A;  2J7V A;  1FCO A;  5A93 A;  4S2I A;  2A3U A;  2IWC A;  5DVA A;  1PI4 A;  4B4Z A;  1CK3 A;  3FV7 A;  5FQQ A;  3O88 A;  4DDY A;  1BLC A;  3WS1 A;  1XKZ A;  1EI5 A;  4N9K A;  5KSC A;  1JWV A;  2Y2H A;  4GN2 A;  1N4O A;  1HD8 A;  1GHI A;  2WGW A;  4WEK A;  3MKF A;  4BL3 A;  1L2S A;  4IVI A;  5GLD A;  1TVF A;  3BFE A;  4JF5 A;  2WUQ A;  2Y2K A;  3WS5 A;  4S2O A;  1XGI A;  2DNS A;  4FH4 A;  4LEN A;  3OZH A;  3MFD A;  1TDL A;  5E2E A;  3NI9 A;  3E2K A;  3VSL A;  4BJP A;  2ZC6 B;  3N8S A;  1L0F A;  2Y2Q A;  5HAP A;  1PZO A;  3Q1F A;  3TOI A;  3CZD A;  1YMS A;  3HLG A;  4KZ4 A;  1L0D A;  4S2M A;  5FI2 A;  1MWU A;  3G34 A;  4S2J A;  2X02 A;  4WEL A;  2DCF A;  2EX6 A;  4GZB A;  5DTS A;  1BTL A;  1KDS A;  1KGE A;  4HBT A;  4ID4 A;  4X53 A;  3G32 A;  1GCE A;  3CJM A;  1LL9 A;  3UE0 A;  4GNU A;  1DY6 A;  1K54 C;  1K56 D;  1S0W A;  4O7D A;  4DDS A;  1NJ4 A;  2RL3 A;  3VP2 A;  1HVB A;  3V39 A;  1KVL A;  4WZ4 A;  5EOE A;  2ZC5 B;  2E8I A;  4RX2 A;  1H8Z A;  4FSF A;  1IYS A;  2ZM0 A;  4P85 A;  4JXW A;  2Q9M A;  2ZQ9 A;  4LV1 A;  1GHM A;  1ES5 A;  2WGI A;  2ZD8 A;  1IKI A;  5FAS A;  1MWS A;  2JBF A;  1E25 A;  1K57 A;  2H0T A;  3HBR A;  5CED A;  1ONG A;  3FWL A;  1H8Y A;  1ZC2 A;  3N8L A;  5CEC A;  2VGK A;  5CHU A;  2ZC3 B;  1PW8 A;  4OKP A;  2JC7 A;  3DWK A;  4S2N C;  5CGX A;  5FA7 A;  2H10 A;  4B4X A;  1RCJ A;  4UHU A;  5FI7 A;  3IH8 A;  1ESI A;  5G18 A;  2XD1 A;  5J8X A;  4E3M A;  5HL1 A;  2WZZ A;  3BRM A;  3ZCZ A;  3NDG A;  2I72 A;  2G2W A;  3ZGA B;  3VP4 A;  1ES2 A;  4K0X A;  4QHC A;  4QY5 A;  1IKG A;  4PMA A;  3IWI A;  5EVI C;  4A5R A;  1K6R A;  4KG6 A;  5DF7 A;  3S4X A;  2WKH A;  2Y2I A;  3V5M A;  3VOY A;  3DW0 A;  4KQQ A;  4DE2 A;  2EXA A;  3C4O A;  2C5W B;  3G4P A;  1W8Y A;  1KE3 A;  2RCX A;  4R0Q A;  3LY4 A;  4C75 A;  4Y7P A;  1LI9 A;  5AQ7 A;  4OQG A;  4EBN A;  2WGV A;  4QY6 A;  1YLP A;  4JF6 A;  5JYO A;  1ALQ A;  4JXG A;  1ERQ A;  2Q9N A;  5TR7 A;  1K56 A;  4YFM A;  1W5D A;  3UPO A;  1JVJ A;  1DJC A;  2P9V B;  3FYZ A;  5GHX A;  5FQI A;  5A92 A;  1RP5 A;  2WAF A;  1MKI A;  1MWR A;  1O7E A;  2WAE A;  3D4F A;  5E2F A;  4EBL A;  4KEN B;  3PBT A;  3MZE A;  3UO9 A;  1K55 A;  3DWZ A;  3IF5 A;  4E3J A;  4LCM A;  4LV0 A;  4WMC D;  4KQO A;  1J9M A;  2V1Z A;  5EPH A;  2P9V A;  5GLA A;  1WE4 A;  4NET A;  3A3I A;  4LV2 A;  1Y54 A;  3N4I A;  3DTM A;  2ZQC A;  2BG1 A;  4KQR A;  3VOZ A;  3BFG A;  2HDQ A;  1SDN A;  2Y2N A;  2V20 A;  1I2W A;  1K4E A;  3OC2 A;  3N6I A;  1O07 A;  4BQM A;  1RGZ A;  4X56 A;  4B88 A;  4X68 A;  2EFX A;  4M3K A;  1MY8 A;  3ITA A;  4KG5 A;  2WGW B;  4KZ8 A;  1JWP A;  4E3I A;  4JF4 A;  2H0Y A;  2V2F F;  1E3U D;  5FI6 A;  3VP0 A;  3UPN A;  4PM9 A;  3OCN A;  5F83 A;  1BZA A;  1KDW A;  4PM8 A;  3W8K A;  3AGE A;  3IH9 A;  4EWF A;  5GHZ A;  3PBO A;  1YLZ A;  1LHY A;  1KGF A;  3WRZ A;  5EE8 A;  4MBH A;  2IWB A;  4ZAM A;  4WZ5 A;  3ZG5 A;  3BLS A;  1G6A A;  1BUE A;  1BSG A;  2B5R A;  1HTZ A;  1BT5 A;  3IF6 C;  4GDN A;  1XX2 A;  2J8Y A;  2PU2 A;  4IVK A;  3HUN A;  3QNC A;  1LL5 A;  1HZO A;  2HDU A;  3LCE A;  2UWX A;  3OPR A;  5DTT A;  5EVI D;  1DJA A;  4ZTK A;  3SOI A;  4OON A;  1YM1 A;  4P0M A;  2X71 A;  3MKE A;  3NY4 A;  3PAG A;  4GKU A;  1YLW A;  2XK1 A;  5HAR A;  3HLW A;  2PU4 A;  2EX9 A;  5CHJ A;  1NXY A;  3NBL A;  4LV3 A;  3GR2 A;  1YLJ A;  2H5S A;  2FFY A;  1WYB A;  5FDH A;  5IHV A;  1SDE A;  4OLD A;  3UDI A;  3SH8 A;  1QMF A;  2ZC7 A;  3IXB A;  1FSY A;  4WMC A;  4MEZ A;  1K54 A;  3C4P A;  4OVD A;  3ZNT A;  3PBN A;  3QNB A;  2HP6 A;  2J9O A;  2WAD A;  3G2Z A;  3GRJ A;  4X6T A;  5M19 A;  3NCK A;  1BUL A;  4N92 A;  4OOM A;  4S2P A;  3RJU A;  4QU3 A;  2WYX A;  1ERM A;  2Y2M A;  4P87 A;  1BLP A;  4K0W A;  3HRE A;  5HFO A;  3VFH A;  4KZA A;  5A90 A;  4OQH A;  4DKI A;  3NDE A;  1MWT A;  2ZLY A;  5DF8 A;  1PIO A;  1K38 A;  4N9L A;  3HVF A;  1K25 A;  4X55 A;  3M6B A;  1E3U A;  5CRF A;  4U3T A;  4KZ9 A;  5E2H A;  4ZJ3 A;  1ONH A;  3LEZ A;  3W4Q A;  1DJB A;  3N8R A;  1Q2P A;  3VFF A;  4BEN A;  3UDX A;  4R4S A;  4NK3 A;  4OLG A;  4S2N A;  1JTD A;  3AGF A;  1YLY A;  3S22 A;  4KG2 A;  3O86 A;  3A3J A;  2Y2O A;  4GB7 A;  1K6S A;  5CXW A;  2Y2J A;  4MBF A;  1SCW A;  2Y55 A;  1E4D A;  1EWZ A;  2DRW A;  5L2F A;  2Y2P A;  4N1X A;  5DF9 A;  1PWD A;  5TFQ A;  5EVI A;  3B3X A;  4IBR A;  4PM7 A;  2ZJ9 A;  3IT9 A;  4JLF A;  2ZQD A;  3BFC A;  2G2U A;  3GVB A;  1FR6 A;  1M6K A;  3BEB A;  3G35 A;  1L0E A;  3SS3 A;  4H8R A;  2PBY A;  1PWG A;  3Q07 A;  4EV4 A;  4MLL A;  3ZG7 B;  3OPP A;  3AGD A;  3PAE A;  2ZQ8 A;  3C7V A;  3ZG8 B;  2IWD A;  3MZF A;  1PW1 A;  4DE3 A;  1IYP A;  5BOH A;  2XEP A;  4R3J A;  3HUM A;  3V50 A;  5F1G A;  2VGJ A;  3BLM A;  3UDF A;  4C3Q A;  4FCF A;  3PBR A;  1CI8 A;  3JYI A;  2Y2G A;  4DE0 A;  3G30 A;  3P09 A;  3CMZ A;  4OOY A;  3SH7 A;  1YT4 A;  3BFF A;  2JCH A;  4OP5 A;  1ES3 A;  5HW3 A;  2XFT A;  2OV5 A;  2A49 A;  4L0L A;  3IHB A;  1W79 A;  3BEC A;  5FAO A;  4UA7 A;  1L0G A;  2FFF B;  5JYP A;  3IXH A;  3E2L A;  5D3O A; 
#chains in the Genus database with same CATH topology
 4Q8I A;  1XPB A;  1GSX A;  4ZDX A;  1H8M A;  2PT7 A;  1PZP A;  3T1S A;  1X0O A;  2INW A;  3O87 A;  1MBL A;  3GV9 A;  1ERO A;  5F69 A;  1KVM A;  5FSR A;  1XA7 A;  1PI5 A;  1K55 C;  3GMW A;  4PM6 A;  4UAA A;  2EWV A;  4Y0T A;  3OBF A;  4LRX C;  4QB8 A;  3IHA A;  1FSW A;  4K91 A;  2R9X A;  1LT0 A;  4FH2 A;  3RXX A;  5KIZ A;  4QWO A;  3MR0 A;  3UY6 A;  2QKP A;  1KGG A;  1BLS A;  1F2K A;  1IYO A;  2CMN A;  3HLD A;  4C6Y A;  4KUO A;  3C7U A;  5CHM A;  2GDN A;  1I5Q A;  1V9Y A;  3G2Y A;  4MBK A;  4JBF A;  4GOG A;  2QZ6 A;  4HES A;  1UWP X;  2ZM8 A;  3CWF A;  4PPR A;  4R4R A;  2Z2M B;  3NOT C;  1XJ4 A;  3Q7V B;  3T4O A;  2ZQA A;  3A3F A;  5EVI B;  2KOI A;  1GA0 A;  2L4R A;  2XDM A;  2HGV A;  1SKF A;  5IU1 A;  1OTI A;  1LSW A;  5CEB A;  3KYE A;  2X01 A;  3A3E A;  4LRZ E;  4LFU A;  3VP1 A;  4R1G A;  3P98 A;  1VEU B;  5EOO A;  5CTN A;  1JTG A;  2VJW A;  4WM9 A;  1K57 C;  1N9B A;  5GLB A;  5TJJ A;  2JKR M;  1FCN A;  2LB5 A;  2W3E A;  1OTE A;  5HAQ A;  2Y59 A;  3ZG9 B;  1GA9 A;  3TW8 A;  4E3K A;  1ES4 A;  1IEM A;  4HHD A;  3L9K A;  3ZDJ A;  1RGY A;  4OH0 A;  5A91 A;  5KSH A;  2XFS A;  4OOL A;  5EUA A;  4Y0U A;  2XGN A;  4UA6 A;  1LLB A;  2C6W B;  3S7N A;  3F1P A;  3M2J A;  1U60 A;  2JKT M;  4HIA A;  4OP8 A;  4WL9 A;  2B18 A;  5EVL A;  1M40 A;  2WK0 A;  1PWC A;  2IWC A;  1NRJ A;  2MJ6 A;  3O88 A;  3WS1 A;  5KSC A;  4G3W A;  2K2N A;  3MQO A;  3MKF A;  4ARZ A;  4BL3 A;  1NLZ A;  4PAU A;  1SKO B;  2WUQ A;  4BWI A;  1XGI A;  2VK3 A;  4P6Z S;  3PR6 A;  3NOU C;  3BQA A;  3Q1F A;  4Y13 A;  4WEL A;  4GZB A;  4HBT A;  3GEC A;  2GJ3 A;  4HH2 A;  4L9G A;  1GCE A;  3CJM A;  4Y2F A;  1OT6 A;  1S0W A;  2E8I A;  3KO6 A;  2ZM0 A;  4JXW A;  4LV1 A;  1GHM A;  3QP8 A;  4Z1W A;  1ONG A;  1YKD A;  1PW8 A;  4F3L A;  4S2N C;  1UGU A;  5G18 A;  1ESI A;  4B9O A;  1XJ2 A;  4FOF A;  1A0K A;  4G3V A;  2G2W A;  3LUQ A;  4PMA A;  4A5R A;  5DF7 A;  3S4X A;  5IS1 A;  2WKH A;  3DW0 A;  3LR3 A;  1LI9 A;  1ACF A;  5AQ7 A;  4EBN A;  3EGX C;  4P6Z M;  1FIL A;  4CQH A;  1ALQ A;  1S1Z A;  3NEC A;  1W5D A;  1JVJ A;  3FYZ A;  5FQI A;  3QP4 A;  5FEG A;  1J3W A;  2WAE A;  5EFW A;  5E2F A;  5FEF A;  3UO9 A;  2OOL A;  1K55 A;  3IF5 A;  4JGR A;  1Y4O A;  4WMC D;  4RQ9 A;  2V1Z A;  2P9V A;  1Y54 A;  3DTM A;  2JKF A;  3VOZ A;  2Y2N A;  2PD8 A;  4X56 A;  4B88 A;  1EW0 A;  4KZ8 A;  4JF4 A;  2V2F F;  1E3U D;  2XRN A;  3UPN A;  4GJ4 A;  5F83 A;  3AGE A;  4EWF A;  2O99 A;  2PR6 A;  2P08 A;  3WRZ A;  4MBH A;  2IWB A;  3ZG5 A;  5HWV A;  3A0R A;  3BLS A;  1G6A A;  4WN5 A;  1BUE A;  1F5M A;  3NJA A;  1HTZ A;  1BT5 A;  2B5R A;  2PU2 A;  1HZO A;  2UWX A;  3DTE A;  3T4S A;  1G5U A;  5F5Y A;  2PU4 A;  5G4Y A;  1NXY A;  3T1Q B;  4WF0 A;  3ULF A;  4WMC A;  4MEZ A;  1K54 A;  3PBN A;  4X6T A;  3NCK A;  4OOM A;  4S2P A;  5HFO A;  1BLP A;  4DKI A;  2ZLY A;  1YPR A;  3M6B A;  1E3U A;  5E2H A;  1ONH A;  1DJB A;  1Q2P A;  4BEN A;  4NK3 A;  1JTD A;  1D1J A;  4EEP A;  3O86 A;  3A3J A;  3MF0 A;  5CXW A;  3BY9 A;  1FIK A;  1E4D A;  2DRW A;  5TFQ A;  4IBR A;  4PM7 A;  2ZJ9 A;  3IT9 A;  3GDI A;  2G2U A;  3GVB A;  5L09 A;  1TS6 A;  2PBY A;  3ZG7 B;  2M7V A;  4EEU A;  1CI8 A;  4DE0 A;  3P09 A;  2KX6 A;  4ETZ A;  4JGP A;  1IFQ A;  2OV5 A;  2A49 A;  3IHB A;  2KDK A;  2VV7 A;  2ZOH A;  5JYP A;  3IXH A;  5D3O A;  1TDG A;  4WLA A;  2D01 A;  4WYY A;  2V0U A;  2V0W A;  4CLC E;  3IXG A;  1KE4 A;  2OSU A;  3N7W A;  3M2K A;  4IBX A;  5FAQ A;  1DP6 A;  2EX2 A;  3H82 B;  3FKW A;  3JVU A;  4UA9 A;  3HLF A;  1DP9 A;  3KSG A;  3UE1 A;  4D2O A;  1S6R A;  4R3A A;  3IF6 A;  4X25 A;  1Y28 A;  2JE5 A;  1Q2Q A;  4EBP A;  3OLO A;  3W4P A;  3SZT A;  4KZ3 A;  2EFU A;  3I7J A;  2EXB A;  4GCZ A;  2H28 A;  2OWH A;  3GQZ A;  3TG9 A;  2QWS A;  3GTC A;  3ZVT A;  2PYR A;  3BFD A;  1JWZ A;  1MC0 A;  4WZ5 C;  2HP5 A;  5CGS A;  5HX9 A;  1IEL A;  4Z9Q A;  5F68 A;  1OPX A;  5TBM A;  2XRO A;  3V3R A;  4KZ7 A;  2XD5 A;  4JGO A;  3EQV A;  1L3L A;  3ZG0 A;  4R3B A;  4EET B;  4F94 A;  2J80 A;  1Z6F A;  3VMA A;  1W7F A;  5DJT A;  4I39 A;  3MFX A;  3VSK A;  2B02 A;  3LI9 A;  5HD3 A;  3MXS A;  5KZH A;  2ZQ7 A;  5CGW A;  3Q7Z A;  4QJG A;  4RA7 A;  3WRT A;  4S2L A;  1FCM A;  4DN0 A;  2JKG A;  5KMW A;  4LCL A;  1XGJ A;  1P9W A;  2UV0 E;  2CC1 A;  4JKT A;  4Y5F A;  3WWX A;  1D06 A;  1P0Z A;  3S7P A;  3WS2 A;  1NYY A;  4E6W A;  5FQ9 A;  4MMN A;  4E3O A;  3GSG A;  4KZ5 A;  1JNU A;  4LGW A;  3PBQ A;  4KZB A;  5J4E A;  3BW6 A;  1S1Y A;  4PKY G;  3BWL A;  5HSQ A;  3DAV A;  1IYQ A;  3IWQ A;  4EU0 A;  3FPV A;  5EV0 A;  2ZMA A;  3PXP A;  2M1C A;  4HNB A;  3MXR A;  1FOF A;  3NIA A;  4GD6 A;  4ESP A;  4U0T A;  3C2W A;  1TS8 A;  3MZD A;  2XR0 A;  2QHK A;  1OME A;  5AQ9 A;  5HPF A;  2O9A A;  2ZM2 A;  2QJ5 A;  4XUX A;  2VV8 A;  2HP9 A;  2XLN A;  4H6J A;  2Y8H A;  4X1M A;  3IS2 A;  2XF3 A;  4HI4 A;  3UMD A;  4ARZ B;  3A0S A;  1FCO A;  4S2I A;  5DVA A;  4B4Z A;  1CK3 A;  1XKZ A;  2R78 A;  2Y2H A;  5I5L A;  1N4O A;  3UE6 A;  4II7 A;  1L2S A;  4IVI A;  5GLD A;  4IUH A;  3DTI A;  3BFE A;  4JF5 A;  3QP1 A;  4E04 A;  4MCW A;  4S2O A;  2DNS A;  3OZH A;  1TDL A;  2PAV P;  4BJP A;  5HAP A;  4Y17 A;  2W1T B;  3UB7 A;  1PZO A;  3T12 B;  3CZD A;  4KQD A;  5FI2 A;  1MWU A;  3G34 A;  2X02 A;  3LEQ A;  1KDS A;  1KGE A;  4X53 A;  4GHI A;  3B33 A;  2VLG A;  4K08 A;  1LL9 A;  3UE0 A;  3NUL A;  2NUT C;  5FL3 A;  1DY6 A;  1K54 C;  4O7D A;  2RL3 A;  2WKP A;  1TS0 A;  2Z6C A;  4WZ4 A;  5EOE A;  1OTA A;  4RX2 A;  1H8Z A;  4MN5 A;  4F3L B;  2Q9M A;  1IKI A;  3CPT A;  1MWS A;  3ZYT A;  5HPI A;  3FWL A;  1ZC2 A;  4NXB A;  2JC7 A;  5CGX A;  4HP9 A;  3NOP C;  5FI7 A;  1SZV A;  1Z09 A;  2V8F A;  4E3M A;  2YKF A;  3BRM A;  2YKH A;  2WKR A;  2I72 A;  3VP4 A;  1ES2 A;  4K0X A;  4QHC A;  3IWI A;  4KG6 A;  3KSH A;  3VOY A;  2OAQ 1;  4DE2 A;  2RCX A;  4R0Q A;  3U4L P;  5IT5 A;  2ZL1 B;  1ERQ A;  2Q9N A;  2P9V B;  5GHX A;  2XSS A;  2VEA A;  1MWR A;  3D4F A;  1OJG A;  4R6L A;  3CI6 A;  4KEN B;  5G4Z A;  3D72 A;  4LV0 A;  5GLA A;  3A3I A;  3T4Q A;  2ZOI A;  4XT2 B;  2HZ5 A;  2ZQC A;  4YOF A;  3OC2 A;  1K4E A;  3N6I A;  3K2N A;  3EOI A;  4M3K A;  1MY8 A;  4KG5 A;  2WGW B;  1ZTU A;  2W1R A;  1BZA A;  1OT9 A;  2K31 A;  4EQ1 A;  3PBO A;  5FDS A;  1YLZ A;  1KGF A;  4WZ5 A;  1BSG A;  3IF6 C;  3HUN A;  3E98 A;  1LL5 A;  3E0Y A;  3QNC A;  3IX4 A;  3LCE A;  5DTT A;  5EVI D;  1DJA A;  3SOI A;  4OON A;  3MKE A;  3PAG A;  4EER A;  2XK1 A;  5CHJ A;  2VKS A;  3SW1 A;  4LV3 A;  3GR2 A;  4DJ3 A;  1WYB A;  3SH8 A;  2ZC7 A;  3IXB A;  3C4P A;  2HP6 A;  2WAD A;  1ZHH B;  3RJU A;  4N92 A;  3UB5 P;  2WYX A;  3C8C A;  4K0W A;  3VFH A;  4KZA A;  3BQ8 A;  4OQH A;  2PYP A;  1MWT A;  5DF8 A;  3UB6 A;  4EUV A;  3HVF A;  4NXE A;  5L10 A;  1K25 A;  4U3T A;  3N8R A;  4CLC C;  4HJ3 A;  4GB7 A;  2Y55 A;  1EWZ A;  5L2F A;  5AVE A;  3RH8 B;  4I5S A;  4N1X A;  1PWD A;  3F1N A;  5EVI A;  3B42 A;  3B3X A;  4JLF A;  1M6K A;  3G35 A;  1CF0 A;  4EV4 A;  3H9W A;  4I3I A;  4WUJ A;  2XEP A;  1MZU A;  3F1O B;  5F1G A;  2VGJ A;  3BLM A;  3UDF A;  3PBR A;  3G30 A;  4OOY A;  5HDS A;  4OP5 A;  2JCH A;  3BFF A;  2IA2 A;  5HW3 A;  4HQA A;  3UB8 A;  2HF6 A;  1D7E A;  5E2G A;  5TGF A;  4BLM A;  3HCY A;  5EEC A;  3EEA A;  3Q82 A;  1CEG A;  2XH9 A;  1YLT A;  3NC8 A;  1ZKJ A;  3CHW P;  3P7N A;  4IED A;  4FD8 A;  4PHT A;  3S7Q A;  3HL9 A;  3L7H A;  1GHP A;  2Y91 A;  5CER A;  3FPW A;  3OOV A;  1NY0 A;  2Y2L A;  3D3O A;  1T1B A;  3IWO A;  4Q0H A;  5I94 A;  2XA7 S;  3FZC A;  4U0X A;  3ISG A;  5E43 A;  1K4F A;  4DRT A;  1KE0 A;  2V1A A;  1QME A;  3LI8 A;  3UPP A;  4P6B A;  4MN6 A;  1XP4 A;  4NXG A;  1ZG6 A;  4OQ0 A;  3EQU A;  4CJN A;  3C5A A;  1ESU A;  3FKV A;  2PBD P;  1YMX A;  5FAP A;  1VM1 A;  1F9I A;  2W27 A;  5FQK A;  2BLS A;  4LPZ A;  2O9B A;  2OLV A;  4E6X A;  4BD1 A;  3JPU A;  2JKR I;  3SS4 A;  2ZMF A;  1G68 A;  4L9F A;  3S1Y A;  1C3B A;  3OPH A;  4Y3I A;  2HJE A;  3LR5 A;  4DF6 A;  4B93 A;  3QHY A;  4LLO B;  4YNR A;  2HDR A;  1IOU A;  1OTB A;  1UWN X;  4GS9 A;  4O8G A;  5J7E A;  4EW7 A;  2B95 A;  2QYB A;  3UNW A;  1XA1 A;  4OPR A;  4E3N A;  5DFY A;  1NRF A;  4I3J A;  2OAP 1;  4OQI A;  4JXS A;  2XA7 M;  1FQG A;  2J9P A;  2JKT I;  4GW9 A;  4XUZ A;  1BLH A;  3RTY A;  2ZMV A;  3CUE A;  3ZHH A;  4MN7 A;  2M7U A;  1CJF A;  3LYX A;  5M1A A;  4WBG A;  2EX8 A;  2ZC4 B;  4OPQ A;  3IQA A;  1N9L A;  3BYD A;  4ETX A;  4S2K A;  4BL2 A;  1WYC A;  4BD0 A;  3ITB A;  4YWZ A;  3CG5 A;  1CEF A;  2LB9 A;  2P74 A;  3LO7 A;  2Y4A A;  4DXB A;  2WKE A;  4N1H A;  3KYZ A;  3WS0 A;  4EUZ A;  2OLU A;  2XQZ A;  2FZ0 A;  3BM6 A;  2Y79 A;  3RXW A;  3UE3 A;  4CLC D;  3WS4 A;  2QJ7 A;  4DJ2 A;  2W3D A;  3EWK A;  3OPL A;  4GLQ A;  4ZJ1 A;  3DTK A;  3MS6 A;  4HBU A;  1AXB A;  1TEM A;  1VQQ A;  4JPM A;  1T1C A;  1H3Q A;  3FV7 A;  3T1R A;  3T4L A;  5FQQ A;  1P9R A;  1EI5 A;  1TS7 A;  2KLI A;  1GHI A;  2K7S A;  3KX0 X;  3UME A;  4I3A A;  3MFD A;  3NI9 A;  3E2K A;  3FG8 A;  2JHE A;  3QP5 A;  4GHI B;  5A8B A;  3N8S A;  1XFN A;  1L0F A;  1XJ6 A;  2J3T C;  3EGD C;  4S2M A;  1L0D A;  4KUK A;  5F6A A;  1GSV A;  2EX6 A;  4CLC A;  5DTS A;  4ID4 A;  3CPT B;  4DDS A;  1HVB A;  3IBJ A;  2ZC5 B;  3VE3 A;  4IUK A;  2ZQ9 A;  1NLY A;  2ZD8 A;  5FAS A;  1S4S A;  1XFQ A;  2JBF A;  1E25 A;  3T4K A;  2H0T A;  2EA9 A;  5CED A;  3HJI A;  4BBU A;  3N8L A;  5CEC A;  5CHU A;  2ZC3 B;  3DWK A;  3PHY A;  2H10 A;  4B4X A;  1RCJ A;  3IH8 A;  5HZH A;  2XD1 A;  5J8X A;  5HL1 A;  3ZGA B;  5EVI C;  1IKG A;  1K6R A;  1OTD A;  3V5M A;  4KQQ A;  1W8Y A;  4NG2 A;  3E4Q A;  3H7W A;  4OQG A;  1HLU P;  3MXQ A;  1YLP A;  3F1P B;  4JF6 A;  5JYO A;  4NEE D;  4ME4 A;  5TR7 A;  2NUP C;  2W3F A;  3UPO A;  1DJC A;  2PD7 A;  1RP5 A;  1O7E A;  5L8M A;  4EBL A;  3PBT A;  3BY8 A;  3DWZ A;  3CAX A;  4HH3 A;  4E3J A;  4LCM A;  3LIE A;  4KQO A;  5HDD A;  5EPH A;  1T1A A;  4PKY A;  1TD5 A;  4NET A;  4IJG A;  5K5B A;  2BG1 A;  4KQR A;  3BFG A;  2HDQ A;  1I2W A;  1O07 A;  4BBT A;  4BQM A;  1RGZ A;  2P7J A;  2EFX A;  4FUW A;  4E3I A;  1JWP A;  5FI6 A;  2VA0 A;  4X1L A;  4PM9 A;  1LSX A;  1KDW A;  3IH9 A;  5GHZ A;  3S7O A;  1W63 M;  3H82 A;  5EE8 A;  5HWW A;  3LFV A;  1AWI A;  1PNE A;  4GDN A;  1XX2 A;  3LIB A;  2HDU A;  4ZTK A;  4P0M A;  2X71 A;  3NY4 A;  4MDZ A;  3HLW A;  5HAR A;  2PDR A;  2E8J A;  1LL8 A;  3NBL A;  2H5S A;  1VET A;  5HWT A;  3KYQ A;  3DBA A;  4OVD A;  3QNB A;  2J9O A;  4QU3 A;  3K3C A;  1S67 L;  2O9C A;  4P87 A;  5A90 A;  3HRE A;  4NKP A;  3BJN A;  1VB6 A;  4L9E A;  1K38 A;  4UQI S;  2VZW A;  4X55 A;  1W63 Q;  4ZJ3 A;  3LEZ A;  2A24 A;  3F1N B;  3AGF A;  4KG2 A;  3T1X A;  1H0M A;  4MBF A;  1SCW A;  4QPR A;  5DF9 A;  3BFC A;  3SS3 A;  5EM0 A;  1L0E A;  1V9Z A;  4H8R A;  1OJ5 A;  3Q07 A;  3AGD A;  3ZG8 B;  2ZQ8 A;  3C7V A;  3MZF A;  1N9N A;  1PRQ A;  3HUM A;  3V50 A;  4C3Q A;  1T19 A;  3JYI A;  5AVF A;  3SH7 A;  3E4O A;  3W2Z A;  1YT4 A;  2J3T D;  3VE4 A;  3U2A A;  2XFT A;  3CUE C;  1W79 A;  3IX8 A;  3E2L A;  5HD5 A;  3ZNT A;  1MPL A;  4HP4 A;  2WKI A;  3LGO A;  1NZO A;  4JGQ A;  3R7W A;  3MMH A;  5LBR A;  3MBZ A;  3ZNY A;  1LI0 A;  5U47 A;  4R38 A;  3TJZ C;  4UQI M;  4OPZ A;  1G28 A;  4OPY A;  5L07 A;  3T4J A;  4EXO A;  3O5Y A;  2QMI A;  4PM5 A;  5AQA A;  3UN7 A;  1ZG4 A;  4X69 A;  4LRY C;  1FR1 A;  4GD8 A;  3KSF A;  5J3W A;  3SH9 A;  3ZFZ A;  2O0Y A;  3ZVW A;  3VP3 A;  4D60 A;  2P04 A;  4Y15 A;  1XJ3 A;  5FQJ A;  1YQS A;  3A3D A;  1W8Q A;  3PTE A;  1PYY A;  1G6O A;  3M6H A;  3HLE A;  3PYP A;  5DTK A;  4AFI A;  2BTF P;  3ICY A;  3IXD A;  1MXO A;  4KZ6 A;  3W4O A;  3TRC A;  3V3S A;  4RVA A;  4O01 A;  4M4X A;  3K3D A;  4O0P A;  1NYM A;  5GHY A;  1H5X A;  4HEF A;  4JXV A;  4GS9 B;  3PBS A;  4ZJ2 A;  5F1F A;  4E3L A;  3MJQ A;  2JN7 A;  2W1T A;  1YAX A;  2HDS A;  4ZBE A;  2QPN A;  3FC7 A;  3V67 A;  1STZ A;  1NZU A;  5C5K A;  2WZX A;  2V9A A;  3Q7V A;  4Y0O A;  3G31 A;  5AJG A;  5EVE A;  3KSI A;  5M18 A;  1F98 A;  5CTM A;  3B47 A;  3OCL A;  3SS5 A;  4DXC A;  1XXM A;  5DFX A;  2W0N A;  2HPB A;  5GLC A;  4HY8 A;  4IHQ A;  3CIT A;  1VEU A;  3LIC A;  1CQA A;  4HOI A;  3RFB A;  3O3V A;  4XXR A;  1I2S A;  5HAI A;  3TSG A;  3JVV A;  4QD4 A;  3QP2 A;  2Z2L B;  3Q81 A;  4GDB A;  4DE1 A;  2R9W A;  3HLC A;  4WEJ A;  3VV4 A;  1CI9 A;  2J3W A;  3HLB A;  4RYE A;  3IF6 B;  2VV6 A;  5AQB A;  1PFL A;  3ZQ5 A;  3HUO A;  3T50 A;  4EQI A;  2ZL1 A;  3LY3 A;  5FAT A;  5GL9 A;  5F82 A;  1SHV A;  4MNR A;  3T4T A;  2I9V A;  3MQQ A;  1KOU A;  4CPK A;  2HV1 A;  4YIN A;  4R23 A;  2ACG A;  4RX3 A;  5FQM A;  1VHM A;  3C38 A;  2J7V A;  5A93 A;  4XT2 A;  2A3U A;  1PI4 A;  1S4R A;  4DDY A;  1BLC A;  4I38 A;  5DJU A;  4N9K A;  1JWV A;  4GN2 A;  1HD8 A;  4WEK A;  1S66 L;  2WGW A;  2WKQ A;  1P97 A;  1TVF A;  5TBM B;  2Y2K A;  2G7U A;  2PR5 A;  3WS5 A;  4FH4 A;  4LEN A;  4CLC B;  5E2E A;  2Z6D A;  2EWW A;  3VSL A;  5CX7 A;  4Q0J A;  1SKO A;  2ZC6 B;  2Y2Q A;  1N9O A;  2HJ9 C;  2ZBB A;  4KZ4 A;  1YMS A;  3HLG A;  3TOI A;  4S2J A;  2DCF A;  1BTL A;  2V8C A;  1WA9 A;  3G32 A;  2PHY A;  4GNU A;  4DMZ A;  1K56 D;  1NJ4 A;  3VP2 A;  3V39 A;  1KVL A;  4HJ6 A;  3IBR A;  4FSF A;  1IYS A;  3QP6 A;  3LR4 A;  4P85 A;  3TE8 A;  1ES5 A;  2WGI A;  2VX8 A;  3D9Y A;  1ODV A;  1DP8 A;  1K57 A;  3G6O A;  3HBR A;  1H8Y A;  2VGK A;  1LSV A;  2W3H A;  4OKP A;  5FA7 A;  3EEH A;  4UHU A;  3R4K A;  2WZZ A;  3ZCZ A;  4FTX A;  3H7W B;  3NDG A;  2Q0O A;  1YSP A;  4QY5 A;  2L1M A;  2Y2I A;  2EXA A;  3C4O A;  2C5W B;  3G4P A;  1KE3 A;  4C75 A;  2VGL S;  3LY4 A;  4Y7P A;  4BMW A;  1BYW A;  2WGV A;  3MQ0 A;  4QY6 A;  3UB9 A;  1GSW A;  4JXG A;  1K56 A;  3HJK A;  4YFM A;  3C30 A;  2PRF A;  5A92 A;  2FH5 A;  3F1O A;  2WAF A;  1MKI A;  2A2L A;  3MZE A;  4BBV A;  4H6J B;  3IS2 B;  1J9M A;  5EM1 A;  1WE4 A;  4LV2 A;  3N4I A;  3LR0 A;  1SDN A;  2V20 A;  4X68 A;  3VOL A;  3E4P A;  3ITA A;  2H0Y A;  3VP0 A;  3OCN A;  5MC7 A;  4R70 A;  4PM8 A;  3W8K A;  2GX5 A;  1LHY A;  4ZAM A;  4EES A;  4IVK A;  2J8Y A;  3P01 A;  3OPR A;  1TF1 A;  1VET B;  1YM1 A;  3A0V A;  4GKU A;  1YLW A;  1MKM A;  2VGL M;  2EX9 A;  1T18 A;  3NHQ A;  1YLJ A;  2FFY A;  5FDH A;  3CLO A;  1NWZ A;  5HL6 A;  1SDE A;  4OLD A;  5IHV A;  3UDI A;  1QMF A;  1FSY A;  5M19 A;  3G2Z A;  3GRJ A;  1BUL A;  1ERM A;  3MSH A;  2Y2M A;  2W3G A;  3NDE A;  2A24 B;  1PIO A;  2BAS A;  4N9L A;  5CRF A;  4KZ9 A;  3W4Q A;  3VFF A;  3UDX A;  4R4S A;  4OLG A;  1DRM A;  4S2N A;  2L0W A;  1YLY A;  3S22 A;  2Y2O A;  1K6S A;  4Q0I A;  2Y2J A;  2Y2P A;  4ZRR A;  2ZQD A;  2DMW A;  1FR6 A;  3BEB A;  2OWJ A;  2GZA A;  1PWG A;  4MLL A;  4NXF A;  3OPP A;  4G3K A;  5HDC A;  3PAE A;  4DE3 A;  2IWD A;  1PW1 A;  1IYP A;  5BOH A;  4HJ4 A;  3LIA A;  4R3J A;  1YSQ A;  4FCF A;  3LIF A;  2Y2G A;  5DKK A;  4UEY A;  3CMZ A;  2AVX A;  3R7W B;  1ES3 A;  2V1B A;  3IX3 A;  4L0L A;  1K0K A;  3BEC A;  5FAO A;  4UA7 A;  5DKL A;  3LID A;  2GNX A;  1L0G A;  2D02 A;  2FFF B; 
#chains in the Genus database with same CATH homology
 1MPL A;  4Q8I A;  1TDG A;  2WKI A;  5E2G A;  1XPB A;  1NZO A;  5TGF A;  4BLM A;  4WYY A;  5EEC A;  4ZDX A;  3MBZ A;  3Q82 A;  3ZNY A;  1CEG A;  2XH9 A;  3IXG A;  1PZP A;  1YLT A;  1LI0 A;  3NC8 A;  5U47 A;  1ZKJ A;  4IED A;  4FD8 A;  1KE4 A;  3O87 A;  2OSU A;  3N7W A;  3M2K A;  4IBX A;  4OPY A;  4OPZ A;  5FAQ A;  2EX2 A;  2QMI A;  1MBL A;  3HL9 A;  4PM5 A;  3GV9 A;  5AQA A;  3FKW A;  1GHP A;  1ERO A;  1ZG4 A;  4UA9 A;  3UN7 A;  3HLF A;  2Y91 A;  1KVM A;  4X69 A;  5FSR A;  1XA7 A;  5CER A;  3UE1 A;  4D2O A;  1PI5 A;  1FR1 A;  1S6R A;  1K55 C;  4GD8 A;  3IF6 A;  1NY0 A;  2JE5 A;  1Q2Q A;  3GMW A;  2Y2L A;  4PM6 A;  4UAA A;  4EBP A;  3SH9 A;  3ZFZ A;  4Y0T A;  3ZVW A;  3IWO A;  3VP3 A;  4QB8 A;  3W4P A;  5I94 A;  3IHA A;  4KZ3 A;  3FZC A;  1FSW A;  2EFU A;  5FQJ A;  4U0X A;  3ISG A;  5E43 A;  1YQS A;  1K4F A;  1W8Q A;  3A3D A;  1PYY A;  3I7J A;  2EXB A;  3PTE A;  4K91 A;  2R9X A;  4DRT A;  3M6H A;  3HLE A;  1KE0 A;  5DTK A;  1QME A;  4FH2 A;  3IXD A;  3UPP A;  3RXX A;  3GQZ A;  4P6B A;  1XP4 A;  1MXO A;  3UY6 A;  3TG9 A;  3GTC A;  1KGG A;  1BLS A;  3ZVT A;  1ZG6 A;  4OQ0 A;  1IYO A;  4KZ6 A;  3W4O A;  3EQU A;  3BFD A;  3HLD A;  4C6Y A;  4CJN A;  1JWZ A;  3C7U A;  3C5A A;  4WZ5 C;  3V3S A;  1ESU A;  3FKV A;  4RVA A;  2HP5 A;  5CGS A;  1YMX A;  5CHM A;  2GDN A;  5HX9 A;  1I5Q A;  1IEL A;  5FAP A;  4Z9Q A;  1VM1 A;  3G2Y A;  5FQK A;  2BLS A;  4MBK A;  4JBF A;  4GOG A;  2QZ6 A;  4HES A;  1NYM A;  5GHY A;  2OLV A;  4E6X A;  4BD1 A;  3SS4 A;  1H5X A;  4HEF A;  1G68 A;  2ZM8 A;  4JXV A;  4KZ7 A;  3V3R A;  2XD5 A;  4PPR A;  4R4R A;  2Z2M B;  3EQV A;  3S1Y A;  1C3B A;  3Q7V B;  3ZG0 A;  3PBS A;  4ZJ2 A;  4R3B A;  3OPH A;  5F1F A;  4E3L A;  4DF6 A;  2ZQA A;  3A3F A;  5EVI B;  4F94 A;  1Z6F A;  3QHY A;  2HDR A;  2HDS A;  2QPN A;  4ZBE A;  3VMA A;  1GA0 A;  1NZU A;  1W7F A;  2XDM A;  2WZX A;  3Q7V A;  1SKF A;  4Y0O A;  3UNW A;  3G31 A;  1XA1 A;  5CEB A;  2X01 A;  3A3E A;  4OPR A;  4E3N A;  3VP1 A;  3VSK A;  4R1G A;  5M18 A;  3P98 A;  1NRF A;  5CTM A;  4DXC A;  3OCL A;  3SS5 A;  1XXM A;  3MXS A;  5KZH A;  4OQI A;  2ZQ7 A;  4JXS A;  5EOO A;  2HPB A;  5CTN A;  1JTG A;  5GLC A;  1FQG A;  4WM9 A;  1K57 C;  3Q7Z A;  5CGW A;  1N9B A;  4QJG A;  5GLB A;  2J9P A;  4RA7 A;  4XUZ A;  3WRT A;  1FCN A;  4S2L A;  1BLH A;  1FCM A;  5KMW A;  5HAQ A;  3ZHH A;  4LCL A;  1XGJ A;  5M1A A;  2Y59 A;  3ZG9 B;  1GA9 A;  3O3V A;  2CC1 A;  4WBG A;  4E3K A;  4JKT A;  2EX8 A;  4XXR A;  2ZC4 B;  1I2S A;  4OPQ A;  1ES4 A;  5HAI A;  1IEM A;  3IQA A;  3TSG A;  3BYD A;  4QD4 A;  3WWX A;  3WS2 A;  4S2K A;  4BL2 A;  1NYY A;  4E6W A;  2Z2L B;  3Q81 A;  4GDB A;  5FQ9 A;  4DE1 A;  1WYC A;  4BD0 A;  3ITB A;  3GSG A;  4E3O A;  2R9W A;  4KZ5 A;  3HLC A;  4WEJ A;  3ZDJ A;  3PBQ A;  4KZB A;  1CI9 A;  1RGY A;  3CG5 A;  1CEF A;  2P74 A;  3LO7 A;  2Y4A A;  4OH0 A;  1IYQ A;  3IWQ A;  2WKE A;  4DXB A;  4N1H A;  5A91 A;  5KSH A;  3HLB A;  3WS0 A;  2XFS A;  4OOL A;  2ZMA A;  5EUA A;  4RYE A;  4Y0U A;  3IF6 B;  4EUZ A;  5AQB A;  2OLU A;  2XGN A;  2XQZ A;  4UA6 A;  3MXR A;  3HUO A;  1LLB A;  3BM6 A;  1FOF A;  4EQI A;  3NIA A;  2C6W B;  3LY3 A;  5FAT A;  4GD6 A;  5GL9 A;  5F82 A;  3RXW A;  3UE3 A;  3M2J A;  4U0T A;  1SHV A;  1U60 A;  4MNR A;  3MZD A;  3WS4 A;  2XR0 A;  1OME A;  5AQ9 A;  4OP8 A;  4CPK A;  2ZM2 A;  3OPL A;  4YIN A;  4R23 A;  4RX3 A;  4XUX A;  4ZJ1 A;  2HP9 A;  2XLN A;  5FQM A;  4HBU A;  5EVL A;  1AXB A;  2XF3 A;  1TEM A;  1VQQ A;  2WK0 A;  1M40 A;  4JPM A;  1PWC A;  2J7V A;  1FCO A;  5A93 A;  4S2I A;  2A3U A;  2IWC A;  5DVA A;  1PI4 A;  4B4Z A;  1CK3 A;  3FV7 A;  5FQQ A;  3O88 A;  4DDY A;  1BLC A;  3WS1 A;  1XKZ A;  1EI5 A;  4N9K A;  5KSC A;  1JWV A;  2Y2H A;  4GN2 A;  1N4O A;  1HD8 A;  1GHI A;  2WGW A;  4WEK A;  3MKF A;  4BL3 A;  1L2S A;  4IVI A;  5GLD A;  1TVF A;  3BFE A;  4JF5 A;  2WUQ A;  2Y2K A;  3WS5 A;  4S2O A;  1XGI A;  2DNS A;  4FH4 A;  4LEN A;  3OZH A;  3MFD A;  1TDL A;  5E2E A;  3NI9 A;  3E2K A;  3VSL A;  4BJP A;  2ZC6 B;  3N8S A;  1L0F A;  2Y2Q A;  5HAP A;  1PZO A;  3Q1F A;  3TOI A;  3CZD A;  1YMS A;  3HLG A;  4KZ4 A;  1L0D A;  4S2M A;  5FI2 A;  1MWU A;  3G34 A;  4S2J A;  2X02 A;  4WEL A;  2DCF A;  2EX6 A;  4GZB A;  5DTS A;  1BTL A;  1KDS A;  1KGE A;  4HBT A;  4ID4 A;  4X53 A;  3G32 A;  1GCE A;  3CJM A;  1LL9 A;  3UE0 A;  4GNU A;  1DY6 A;  1K54 C;  1K56 D;  1S0W A;  4O7D A;  4DDS A;  1NJ4 A;  2RL3 A;  3VP2 A;  1HVB A;  3V39 A;  1KVL A;  4WZ4 A;  5EOE A;  2ZC5 B;  2E8I A;  4RX2 A;  1H8Z A;  4FSF A;  1IYS A;  2ZM0 A;  4P85 A;  4JXW A;  2Q9M A;  2ZQ9 A;  4LV1 A;  1GHM A;  1ES5 A;  2WGI A;  2ZD8 A;  1IKI A;  5FAS A;  1MWS A;  2JBF A;  1E25 A;  1K57 A;  2H0T A;  3HBR A;  5CED A;  1ONG A;  3FWL A;  1H8Y A;  1ZC2 A;  3N8L A;  5CEC A;  2VGK A;  5CHU A;  2ZC3 B;  1PW8 A;  4OKP A;  2JC7 A;  3DWK A;  4S2N C;  5CGX A;  5FA7 A;  2H10 A;  4B4X A;  1RCJ A;  4UHU A;  5FI7 A;  3IH8 A;  1ESI A;  5G18 A;  2XD1 A;  5J8X A;  4E3M A;  5HL1 A;  2WZZ A;  3BRM A;  3ZCZ A;  3NDG A;  2I72 A;  2G2W A;  3ZGA B;  3VP4 A;  1ES2 A;  4K0X A;  4QHC A;  4QY5 A;  1IKG A;  4PMA A;  3IWI A;  5EVI C;  4A5R A;  1K6R A;  4KG6 A;  5DF7 A;  3S4X A;  2WKH A;  2Y2I A;  3V5M A;  3VOY A;  3DW0 A;  4KQQ A;  4DE2 A;  2EXA A;  3C4O A;  2C5W B;  3G4P A;  1W8Y A;  1KE3 A;  2RCX A;  4R0Q A;  3LY4 A;  4C75 A;  4Y7P A;  1LI9 A;  5AQ7 A;  4OQG A;  4EBN A;  2WGV A;  4QY6 A;  1YLP A;  4JF6 A;  5JYO A;  1ALQ A;  4JXG A;  1ERQ A;  2Q9N A;  5TR7 A;  1K56 A;  4YFM A;  1W5D A;  3UPO A;  1JVJ A;  1DJC A;  2P9V B;  3FYZ A;  5GHX A;  5FQI A;  5A92 A;  1RP5 A;  2WAF A;  1MKI A;  1MWR A;  1O7E A;  2WAE A;  3D4F A;  5E2F A;  4EBL A;  4KEN B;  3PBT A;  3MZE A;  3UO9 A;  1K55 A;  3DWZ A;  3IF5 A;  4E3J A;  4LCM A;  4LV0 A;  4WMC D;  4KQO A;  1J9M A;  2V1Z A;  5EPH A;  2P9V A;  5GLA A;  1WE4 A;  4NET A;  3A3I A;  4LV2 A;  1Y54 A;  3N4I A;  3DTM A;  2ZQC A;  2BG1 A;  4KQR A;  3VOZ A;  3BFG A;  2HDQ A;  1SDN A;  2Y2N A;  2V20 A;  1I2W A;  1K4E A;  3OC2 A;  3N6I A;  1O07 A;  4BQM A;  1RGZ A;  4X56 A;  4B88 A;  4X68 A;  2EFX A;  4M3K A;  1MY8 A;  3ITA A;  4KG5 A;  2WGW B;  4KZ8 A;  1JWP A;  4E3I A;  4JF4 A;  2H0Y A;  2V2F F;  1E3U D;  5FI6 A;  3VP0 A;  3UPN A;  4PM9 A;  3OCN A;  5F83 A;  1BZA A;  1KDW A;  4PM8 A;  3W8K A;  3AGE A;  3IH9 A;  4EWF A;  5GHZ A;  3PBO A;  1YLZ A;  1LHY A;  1KGF A;  3WRZ A;  5EE8 A;  4MBH A;  2IWB A;  4ZAM A;  4WZ5 A;  3ZG5 A;  3BLS A;  1G6A A;  1BUE A;  1BSG A;  2B5R A;  1HTZ A;  1BT5 A;  3IF6 C;  4GDN A;  1XX2 A;  2J8Y A;  2PU2 A;  4IVK A;  3HUN A;  3QNC A;  1LL5 A;  1HZO A;  2HDU A;  3LCE A;  2UWX A;  3OPR A;  5DTT A;  5EVI D;  1DJA A;  4ZTK A;  3SOI A;  4OON A;  1YM1 A;  4P0M A;  2X71 A;  3MKE A;  3NY4 A;  3PAG A;  4GKU A;  1YLW A;  2XK1 A;  5HAR A;  3HLW A;  2PU4 A;  2EX9 A;  5CHJ A;  1NXY A;  3NBL A;  4LV3 A;  3GR2 A;  1YLJ A;  2H5S A;  2FFY A;  1WYB A;  5FDH A;  5IHV A;  1SDE A;  4OLD A;  3UDI A;  3SH8 A;  1QMF A;  2ZC7 A;  3IXB A;  1FSY A;  4WMC A;  4MEZ A;  1K54 A;  3C4P A;  4OVD A;  3ZNT A;  3PBN A;  3QNB A;  2HP6 A;  2J9O A;  2WAD A;  3G2Z A;  3GRJ A;  4X6T A;  5M19 A;  3NCK A;  1BUL A;  4N92 A;  4OOM A;  4S2P A;  3RJU A;  4QU3 A;  2WYX A;  1ERM A;  2Y2M A;  4P87 A;  1BLP A;  4K0W A;  3HRE A;  5HFO A;  3VFH A;  4KZA A;  5A90 A;  4OQH A;  4DKI A;  3NDE A;  1MWT A;  2ZLY A;  5DF8 A;  1PIO A;  1K38 A;  4N9L A;  3HVF A;  1K25 A;  4X55 A;  3M6B A;  1E3U A;  5CRF A;  4U3T A;  4KZ9 A;  5E2H A;  4ZJ3 A;  1ONH A;  3LEZ A;  3W4Q A;  1DJB A;  3N8R A;  1Q2P A;  3VFF A;  4BEN A;  3UDX A;  4R4S A;  4NK3 A;  4OLG A;  4S2N A;  1JTD A;  3AGF A;  1YLY A;  3S22 A;  4KG2 A;  3O86 A;  3A3J A;  2Y2O A;  4GB7 A;  1K6S A;  5CXW A;  2Y2J A;  4MBF A;  1SCW A;  2Y55 A;  1E4D A;  1EWZ A;  2DRW A;  5L2F A;  2Y2P A;  4N1X A;  5DF9 A;  1PWD A;  5TFQ A;  5EVI A;  3B3X A;  4IBR A;  4PM7 A;  2ZJ9 A;  3IT9 A;  4JLF A;  2ZQD A;  3BFC A;  2G2U A;  3GVB A;  1FR6 A;  1M6K A;  3BEB A;  3G35 A;  1L0E A;  3SS3 A;  4H8R A;  2PBY A;  1PWG A;  3Q07 A;  4EV4 A;  4MLL A;  3ZG7 B;  3OPP A;  3AGD A;  3PAE A;  2ZQ8 A;  3C7V A;  3ZG8 B;  2IWD A;  3MZF A;  1PW1 A;  4DE3 A;  1IYP A;  5BOH A;  2XEP A;  4R3J A;  3HUM A;  3V50 A;  5F1G A;  2VGJ A;  3BLM A;  3UDF A;  4C3Q A;  4FCF A;  3PBR A;  1CI8 A;  3JYI A;  2Y2G A;  4DE0 A;  3G30 A;  3P09 A;  3CMZ A;  4OOY A;  3SH7 A;  1YT4 A;  3BFF A;  2JCH A;  4OP5 A;  1ES3 A;  5HW3 A;  2XFT A;  2OV5 A;  2A49 A;  4L0L A;  3IHB A;  1W79 A;  3BEC A;  5FAO A;  4UA7 A;  1L0G A;  2FFF B;  5JYP A;  3IXH A;  3E2L A;  5D3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...