5TGFA

Crystal structure of putative beta-lactamase from bacteroides dorei dsm 17855
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
333
structure length
333
Chain Sequence
TYDFTPLDSIISSWMDKGYYPGGAICVVKNDSVLFEKAYGSFTGDTKVYVASAGKWVAAAVIGAVVDRTDLSWDDPVEKWLPQFRGDAKGGILLRQLLSHTSGVRPYLPAPRVDNYNHLDSAVTEILSLDTVFTPGTRFEYGGLAMQIAGRMAEVAMGKEFEPLFQELIAAPLGMTHSHFAPVNTDGGHAPMLGGGLCTTLNDYIRFLKMIYHNGRSGNREILKPETVQTMQADQVRNAVVAPGEYVEKALGQHHTSIYGLGEWRELVDEATGEAYQISSPGWAGAYPWINKRDGVYGFFIAHVQGEANKKDGFSSFYGSPVLSETVTKIVNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a beta-lactamase from Bacteroides dorei DSM 17855
rcsb
source organism Bacteroides dorei dsm 17855
molecule tags Hydrolase
total genus 100
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5tgfA00
1KE3A 5AQ7A 2ZQ9A 2IWCA 1GHMA 4GNUA 5FQKA 4DE1A 2JC7A 1N9BA 3CJMA 4EQIA 3AGEA 1XP4A 2EFUA 2G2WA 5CTMA 5DVAA 5GHZA 1E3UD 5F83A 4D2OA 4EBLA 4WZ5C 1U60A 1FCNA 3VP2A 4OOMA 4PMAA 5CGSA 2PBYA 4KZ4A 3N6IA 3BFFA 3OC2A 1I2WA 1XA1A 4BD1A 1PI5A 2HP5A 1MWTA 5DF8A 3BEBA 4OQ0A 3GMWA 1FSWA 4Y0TA 4WZ5A 4R3JA 5CGXA 4OPQA 3PBQA 5HFOA 3PBTA 3QHYA 1E3UA 4KG6A 4ZJ1A 4IBXA 2Y2NA 4OLGA 2JCHA 4U0TA 3IXGA 4P0MA 1KE0A 3QNCA 5CECA 1K54C 1MWSA 4NETA 1ESUA 4WEJA 2ZD8A 3ZG8B 3NIAA 4ZJ2A 5AQ9A 2Y2PA 3ZNTA 4EBNA 3WS2A 1O07A 2FFFB 5F1FA 3OPRA 1K54A 2Q9MA 5GHYA 3BFDA 4N9LA 3Q1FA 5JYPA 5F1GA 3VMAA 5GLDA 4BLMA 4RVAA 3RXWA 5FAOA 3UPOA 1NZOA 5EVIB 3HBRA 4S2NA 5FI7A 3SH7A 3UDFA 3G2YA 4ZJ3A 1KVMA 3D4FA 4FCFA 4GZBA 4R4SA 1FCOA 5CHJA 4ZTKA 3SOIA 3ZDJA 3E2KA 3FKVA 3HUNA 3BM6A 3G31A 5EPHA 1K4FA 2Y55A 4DE2A 1IEMA 3ZG5A 1MPLA 3LEZA 4N92A 3EQUA 3GR2A 1XKZA 5FQQA 2P9VA 5GLAA 3V3RA 2RCXA 1NRFA 3MKEA 5HAQA 3WWXA 4GOGA 3B3XA 1O7EA 3IWOA 4N1HA 4BJPA 3DW0A 4S2IA 1HVBA 4IEDA 5HX9A 3UO9A 3O87A 4O7DA 3UY6A 1AXBA 1K6SA 3BYDA 4C3QA 1BLHA 2XD1A 4QB8A 1W8YA 1HTZA 3HVFA 3RJUA 3SS5A 2B5RA 2FFYA 3MFDA 4QJGA 3ZGAB 5JYOA 2Y59A 4OQIA 2WGWB 4KG2A 2WK0A 5KSHA 1H8ZA 2XF3A 1W5DA 1MXOA 2DCFA 3AGDA 3PBRA 4UHUA 3VFHA 4WELA 4LCMA 4KZ7A 2PU4A 1LL9A 1RGZA 4KZ9A 2X01A 3GRJA 5AQBA 5TGFA 4M3KA 2Y2JA 4KZBA 2ZC6B 2XH9A 1S0WA 3C5AA 1I2SA 3TOIA 3WS0A 3C4OA 4OKPA 2J9PA 1MWUA 4MBHA 5A93A 4U3TA 4DF6A 1K55C 4CJNA 2XQZA 1L0DA 4E3LA 1YQSA 2UWXA 2WGVA 5E43A 3G34A 1W7FA 5A91A 1K55A 3IWQA 2IWDA 1GHIA 4DXCA 2Y2GA 4JF5A 4R3BA 4JXSA 3V3SA 2Y2QA 4JKTA 5EUAA 3IT9A 1ES4A 2ZM2A 2HDRA 5FQJA 4E3MA 1K25A 1PWDA 4WMCD 1BLCA 3GV9A 2J8YA 5BOHA 3G4PA 3HREA 3BFGA 3BFEA 5M18A 1KGGA 4JBFA 4LCLA 5CEBA 4KZ5A 2EX9A 5FQ9A 3S22A 1SCWA 1L0EA 4JXVA 3ISGA 2ZC3B 4JF4A 1Y54A 4KQQA 2XLNA 2Y2LA 2R9XA 4JXGA 3UPNA 5CTNA 2WADA 2OLVA 5M1AA 4WMCA 4IVKA 5CGWA 4OPYA 1BTLA 1LI9A 2WGWA 3BRMA 3O3VA 3HLBA 2G2UA 3ZHHA 4LV1A 1VM1A 4Y7PA 4FSFA 2Y2MA 3BLSA 3FWLA 3W4QA 4B88A 3NCKA 4E3OA 2P9VB 2XFSA 3IHAA 2WGIA 3CG5A 3N8LA 4NK3A 4C6YA 4JXWA 4LENA 3NDGA 4R1GA 3O86A 2H10A 1MBLA 5FQMA 1MWRA 3W4PA 5DF7A 3V5MA 3G35A 3PAEA 1EROA 1K57C 3CMZA 2ZLYA 1W79A 5CRFA 1WYBA 1K38A 3MZDA 4K91A 4KZAA 1GHPA 1Z6FA 1HZOA 4Y0UA 1JWZA 1IYSA 4EWFA 1K57A 1QMFA 3I7JA 4F94A 3VSLA 3DWKA 4S2NC 4A5RA 1GCEA 3ZVWA 1BSGA 1PW1A 1IKIA 2EX8A 3GTCA 3ZVTA 2OSUA 1CK3A 2ZQDA 3N8RA 1YMSA 2WZXA 3PBOA 4KZ8A 4KQRA 2ZM8A 3WRTA 3HL9A 4OP8A 4PM8A 3WS1A 2Y2KA 4WYYA 2GDNA 3A3FA 4EUZA 2OLUA 4UA9A 4FH4A 3PTEA 4UA7A 3LO7A 5GHXA 4ID4A 2V20A 2ZC4B 4BL3A 1FR1A 4H8RA 1BZAA 1KDWA 4LV3A 3FZCA 2DNSA 3SS4A 3IXBA 4MBKA 1NYYA 1K56D 1OMEA 1BLPA 2Q9NA 3MZFA 5FAPA 1JWPA 4R23A 3G2ZA 2EFXA 1FSYA 1XXMA 2RL3A 4N9KA 4OOYA 3SS3A 4QD4A 3VSKA 1BUEA 4OQHA 4ZBEA 1BT5A 4RA7A 1KVLA 4PM6A 5TFQA 4BENA 2V2FF 2HPBA 3P09A 2XK1A 2V1ZA 5FAQA 1K56A 4U0XA 3VFFA 4GD6A 4B4ZA 5KSCA 1I5QA 1PW8A 1PI4A 2WKEA 4QY5A 1KGEA 3A3JA 3ZNYA 5E2EA 1KGFA 4PM9A 1WE4A 4GDNA 3VP3A 1GA9A 2ZJ9A 5EOOA 1L0FA 4X69A 3DWZA 4OONA 5CHUA 1LLBA 1PZOA 2HDSA 3BFCA 3V50A 4X6TA 4BL2A 1PIOA 3VOZA 1DJBA 1N4OA 3OZHA 1YLYA 5FATA 4S2MA 2XEPA 3IH9A 4BD0A 1G68A 2XGNA 3IH8A 2HDQA 1VQQA 2Y2HA 1G6AA 4WBGA 3GSGA 3O88A 3HLFA 1PWGA 3ZFZA 5HL1A 4P6BA 3UE1A 3ZG9B 4RYEA 5EVLA 3HLWA 5A90A 5M19A 4IVIA 1RP5A 4GKUA 3Q07A 1NZUA 1BLSA 4CPKA 1HD8A 4GD8A 5GLBA 4MLLA 3HLCA 3UNWA 1YLPA 3MKFA 1JVJA 1TDLA 3V39A 3PBSA 1LHYA 2QZ6A 3LY4A 4HBUA 3IF6C 2WYXA 3GQZA 4S2KA 2XD5A 1CEFA 3IHBA 4OOLA 4K0WA 1DJCA 1RCJA 2VGJA 2Y91A 3DTMA 1YMXA 3OCNA 3ZG7B 3IF6A 2X02A 3VP0A 3LY3A 1FQGA 1FR6A 3G30A 4E3JA 1Q2QA 3N7WA 3SH9A 2H0TA 2JE5A 5TR7A 1YLZA 4MEZA 4X56A 3BECA 1FOFA 1SHVA 3EQVA 4R4RA 5DTTA 1ERQA 4QU3A 5G18A 1YLWA 5CXWA 1QMEA 4R0QA 4GN2A 4QHCA 1DY6A 3A3EA 2WUQA 4HEFA 4OVDA 5FQIA 3WRZA 2JBFA 4JF6A 5HAIA 1PZPA 5U47A 4DDSA 4ZDXA 3A3DA 1YM1A 2ZQCA 4S2JA 1NY0A 4DRTA 2VGKA 4EV4A 3IXDA 3N4IA 1XX2A 1TVFA 3SH8A 3ZG0A 4QY6A 3JYIA 5E2HA 5HARA 4DXBA 5GL9A 5HW3A 3UDIA 1BULA 1DJAA 4RX2A 1ES2A 1ZG6A 4MNRA 3GVBA 2WKIA 1KE4A 4FD8A 1K6RA 1XA7A 5CEDA 5J8XA 2ZQ7A 2ZM0A 4YFMA 1SDEA 1ESIA 3OPLA 1JTGA 4YINA 2A49A 2BG1A 3OCLA 1IYOA 4UA6A 4Y0OA 3Q7VB 4X55A 3M2KA 4Q8IA 1M40A 3FYZA 5DTSA 5E2GA 4XUXA 3IXHA 4ZAMA 2DRWA 2ZMAA 5FDHA 3A3IA 4L0LA 1JTDA 1XPBA 3G32A 4IBRA 4DE3A 1IELA 2EX6A 3NY4A 4GB7A 3S1YA 5FI6A 4X53A 1SDNA 5GLCA 4RX3A 2H5SA 3WS5A 1ZG4A 4P87A 1RGYA 2QPNA 5A92A 1IKGA 1CI9A 2EXBA 3CZDA 2EXAA 4S2OA 3NDEA 5EECA 2A3UA 3NI9A 1K4EA 1M6KA 1W8QA 4DDYA 4PM5A 5FA7A 2Y2IA 3NBLA 4OPZA 1ONGA 3VP4A 1YLJA 2WAEA 4S2PA 2P74A 4E3KA 5FI2A 1PYYA 4PPRA 4JPMA 3UE0A 1L0GA 2WZZA 1PWCA 2HDUA 2J9OA 3FKWA 1XGJA 4E3NA 3PAGA 3NC8A 2WAFA 3IF5A 3S4XA 5KZHA 1E4DA 1FCMA 3ITBA 3IF6B 1NJ4A 1S6RA 5E2FA 4GDBA 4B4XA 1NXYA 3P98A 1C3BA 4E6XA 5L2FA 4KZ6A 3HLGA 5I94A 1MKIA 4FH2A 1ES5A 5D3OA 3ZCZA 2ZC7A 4EBPA 1YLTA 2XFTA 1ZC2A 2IWBA 4XXRA 5CHMA 3UN7A 1L2SA 3BLMA 3OPPA 1JWVA 2HP6A 3Q7VA 3MBZA 4UAAA 4HBTA 3RXXA 2QMIA 2WKHA 3IQAA 2XDMA 3Q7ZA 1TDGA 2EX2A 3TG9A 1LL5A 4BQMA 5EOEA 2X71A 3HLEA 4OQGA 1ZKJA 3TSGA 4P85A 3MZEA 3VOYA 1TEMA 3HLDA 3HUOA 3AGFA 3W8KA 1E25A 3WS4A 1YT4A 3UE3A 2ZQ8A 4DE0A 5FASA 1H8YA 2ZQAA 5EVID 5FSRA 2BLSA 2C6WB 5EVIC 4C75A 1WYCA 1IYQA 2I72A 4PM7A 1IYPA 2HP9A 3FV7A 5CERA 3MXSA 4K0XA 4HESA 1NYMA 2E8IA 3QNBA 4WM9A 4N1XA 1GA0A 5IHVA 5EVIA 4OPRA 2ZC5B 1H5XA 1EI5A 3LCEA 3IWIA 5HAPA 2Y4AA 4E6WA 1SKFA 2CC1A 1MY8A 1EWZA 4OLDA 3M2JA 1Q2PA 3C4PA 2J7VA 3Q81A 4OH0A 2XR0A 4KG5A 1ES3A 3E2LA 4DKIA 4Z9QA 4S2LA 3MXRA 1KDSA 3M6HA 3PBNA 4JLFA 4KENB 4MBFA 5F82A 3OPHA 5DTKA 1XGIA 5DF9A 3M6BA 1J9MA 2PU2A 4LV0A 3Q82A 4LV2A 2OV5A 3ITAA 1CEGA 2Z2LB 4KZ3A 4XUZA 1LI0A 5EE8A 4OP5A 3UDXA 3UPPA 4X68A 2H0YA 3HUMA 1CI8A 2C5WB 4WZ4A 2Z2MB 5KMWA 3W4OA 1ALQA 4KQOA 4E3IA 3C7VA 3N8SA 1ONHA 3C7UA 5AQAA 2R9WA 2Y2OA 4WEKA 3VP1A 1ERMA
chains in the Genus database with same CATH superfamily
1KE3A 5AQ7A 2IWCA 2M1CA 2W0NA 5HD5A 4DE1A 1XP4A 2G2WA 1SKOB 1E3UD 3VP2A 4OOMA 5CGSA 1F2KA 3N6IA 3OC2A 1XA1A 3T4JA 3BEBA 3GMWA 3JVUA 4WZ5A 5CGXA 4OPQA 5HL6A 3NOPC 4P0MA 1Y28A 5CECA 1MWSA 3D72A 2ZD8A 2PR5A 3NIAA 2Y2PA 3ZNTA 5F1FA 2FFFB 3OPRA 4HY8A 1K54A 4N9LA 2ZOHA 2GX5A 1VETA 5EVIB 1NRJA 3G2YA 3OOVA 4HP4A 4ZJ3A 4GZBA 1XFQA 2JKRM 1VHMA 1MKMA 3ZDJA 3E2KA 1SKOA 3HUNA 3BM6A 2WKPA 2KX6A 4GCZA 3CWFA 4R38A 3EQUA 2YKFA 4Y13A 1NRFA 5HAQA 4MDZA 4S2IA 1F9IA 3LI8A 3BYDA 1BLHA 4FTXA 4LLOB 4F3LB 2K2NA 3ZGAB 4KG2A 1H8ZA 2XF3A 1W5DA 1MXOA 2DCFA 3PBRA 4LCMA 2PR6A 2PU4A 4KZ9A 4P6ZS 4M3KA 5TGFA 1YSPA 3SW1A 2ZC6B 1W63M 2HJEA 3WS0A 3GDIA 4L9FA 2K7SA 1MWUA 1L0DA 1ODVA 4DXCA 1TD5A 5FQJA 4E3MA 3O5YA 2V8FA 4WMCD 3BFGA 5L8MA 1KGGA 3TJZC 5FQ9A 1N9OA 1SCWA 3S22A 4JXVA 2XLNA 3E98A 2WADA 4F3LA 1BTLA 1LI9A 2OWJA 2I9VA 4LV1A 3FWLA 3NCKA 2J3TD 3N8LA 4QPRA 4C6YA 4JXWA 3A0VA 2J3TC 4R1GA 2H10A 1MBLA 5FQMA 1S4RA 3G35A 4R70A 4H6JA 1W79A 2A2LA 1NLYA 3ZYTA 4HQAA 3DWKA 4A5RA 1DP6A 3TW8A 4DJ3A 1J3WA 1IKIA 3D3OA 2OSUA 4CLCD 3MFXA 4KZ8A 4KQRA 2ZM8A 3WRTA 4QWOA 2Y2KA 4PKYA 4CLCC 2OLUA 3S7QA 2Y8HA 3BWLA 1FR1A 3KSFA 3E4QA 4LV3A 3SS4A 3IXBA 1K56D 1JWPA 5EM1A 1WA9A 1XXMA 2EFXA 4YWZA 4Y3IA 4OQHA 1KVLA 2W27A 4EU0A 4BENA 5FAQA 4U0XA 4B4ZA 5KSCA 3MSHA 1PW8A 1D06A 3VP3A 2ZJ9A 3BFCA 3V50A 4NXFA 1PIOA 1DJBA 3OZHA 5HPFA 4S2MA 3LR4A 3IH8A 3S7OA 1TS0A 2HDQA 1VQQA 1G6AA 3UE1A 3ZG9B 4RYEA 4IVIA 3VE4A 1BLSA 4CPKA 1HD8A 5GLBA 4MLLA 4X25A 3MKFA 1JVJA 1P0ZA 2V1BA 2O9CA 4MN6A 3IF6C 1T1AA 3UB7A 2WYXA 1CEFA 3MXQA 4YNRA 1T1BA 4IHQA 3CUEA 4K0WA 3T12B 3OCNA 3ZG7B 3R4KA 3MQQA 3LY3A 3G30A 2VK3A 3H82B 3SH9A 3BECA 1FOFA 3EQVA 1YLWA 1CJFA 4GN2A 4QHCA 4OVDA 2B18A 1YKDA 2V1AA 5HAIA 5U47A 4DDSA 1YM1A 2ZQCA 1NY0A 2ZMVA 2XA7M 3E0YA 3SH8A 5HARA 4DXBA 5HDCA 1MZUA 2W3HA 3BQAA 3E4PA 1OT9A 3LR5A 2JKFA 2WKIA 3C38A 3MQ0A 4YFMA 1KOUA 2A49A 4UA6A 3Q7VB 3M2KA 5E2GA 3H7WA 2ZMAA 2AVXA 4IBRA 4DE3A 3CHWP 2VEAA 4X53A 5FI6A 2O9AA 1SDNA 5HWTA 3KX0X 3IBRA 5A92A 4S2OA 5EECA 2A3UA 2OOLA 4OPZA 2WAEA 2FZ0A 5FI2A 3C30A 1P97A 1XGJA 3PAGA 3S4XA 1FCMA 5E2FA 4B4XA 1NXYA 1ES5A 4MMNA 2ZC7A 4EBPA 1YLTA 3MR0A 2J80A 4PKYG 5CHMA 1L2SA 3Q7VA 4UAAA 3EOIA 4BQMA 3Q7ZA 1LL5A 1ZKJA 4P85A 5G4ZA 3WS4A 1D7EA 3RTYA 5FASA 1H8YA 2ZQAA 2C6WB 4NG2A 5DKLA 3EGXC 2I72A 2HP9A 3CUEC 1G5UA 2JKTM 3FV7A 4II7A 5CERA 4WM9A 5IHVA 3LCEA 4E6WA 1MY8A 1EWZA 1Q2PA 4OH0A 4PAUA 1A0KA 4FUWA 4ARZB 4MBFA 3OPHA 2PU2A 3T1RA 3Q82A 3UE6A 1CEGA 5EE8A 3UDXA 3UPPA 1F98A 2C5WB 4E3IA 3C7VA 5AQAA 4WEKA 3CLOA 1ERMA 4KUKA 5FL3A 1GHMA 4UQIM 1N9BA 4EQIA 2PYPA 3KYZA 5CTMA 5DVAA 1U60A 1FCNA 5TBMA 3BFFA 1I2WA 1S1YA 2GNXA 4BD1A 1PI5A 5DF8A 4OQ0A 1VB6A 1DRMA 3PBTA 4Q0IA 1E3UA 4WN5A 4HH2A 2W3EA 4IBXA 4OLGA 4U0TA 5F69A 1KE0A 3QNCA 5L09A 4ZJ2A 2LB5A 3NOUC 3WS2A 3Q1FA 4NXGA 3VMAA 3IX3A 5FAOA 5IU1A 1H8MA 3HBRA 4GLQA 4UQIS 3UDFA 4MN7A 1XJ4A 3D4FA 4ZTKA 1FCOA 2WKRA 4LRYC 3SOIA 4BMWA 1TS7A 2QKPA 3G31A 1K4FA 3ZG5A 3LEZA 2JN7A 5GLAA 2RCXA 4NXBA 3WWXA 1O7EA 3IWOA 4N1HA 3F1PA 1HVBA 5HX9A 3UY6A 3O87A 4O7DA 4QB8A 1HTZA 3SS5A 1NWZA 1LSWA 3PHYA 3T4TA 5IT5A 1PNEA 2WK0A 1LL9A 1RGZA 2X01A 5J3WA 2KLIA 3C5AA 3LYXA 1S0WA 1XJ3A 4OKPA 3C4OA 3BY9A 2HF6A 4MBHA 2HGVA 4DF6A 1K55C 2XQZA 5K5BA 3DBAA 3BJNA 2WGVA 2VGLS 3G34A 1W7FA 2IWDA 1GHIA 4JF5A 4R3BA 3V3SA 1ES4A 1VETB 2ZL1B 1K25A 1BLCA 3U2AA 3BFEA 2VKSA 5HD3A 4JBFA 1LL8A 3CI6A 4KZ5A 2EX9A 3PYPA 1IOUA 4JF4A 1F5MA 1GSWA 5CX7A 5DJTA 3UPNA 4AFIA 3VOLA 4WMCA 5CGWA 4OPYA 2KOIA 3ZHHA 4B9OA 1PFLA 4FSFA 2Y2MA 4B88A 5EVEA 2XFSA 3TE8A 2WGIA 3CG5A 3KYEA 3NOTC 4HI4A 2PHYA 3W2ZA 3O86A 5DF7A 3V5MA 1EROA 1K57C 3CMZA 2ZLYA 5CRFA 4LGWA 1WYBA 3PR6A 1K38A 4K91A 3HJIA 4KZAA 4Y0UA 5G4YA 1QMFA 3I7JA 3ZQ5A 1BSGA 1PW1A 3B47A 3GTCA 3P01A 5I5LA 3N8RA 2ZL1A 3DTKA 5FEGA 3PTEA 4UA7A 4CLCA 4BL3A 1AWIA 1KDWA 1H3QA 4ESPA 3LI9A 1OMEA 5FAPA 2HZ5A 1FSYA 3LR3A 2MJ6A 5TFQA 2V1ZA 2XK1A 1K56A 1I5QA 1PI4A 3HJKA 4QY5A 3A3JA 5E2EA 1GA9A 3DWZA 2HDSA 4X6TA 1YLYA 2VJWA 1T19A 2XEPA 5F6AA 4R3AA 1NLZA 4YOFA 3L7HA 4NEED 2Y2HA 4WBGA 1LSVA 3ZFZA 5M19A 3HLWA 2PD7A 1N9NA 1RP5A 1NZUA 4H6JB 2H28A 5EV0A 3PBSA 1LHYA 4Q0HA 2QZ6A 1SZVA 3IX8A 2XD5A 5C5KA 2D01A 3DTMA 2P7JA 3IF6A 2X02A 3VP0A 1FQGA 3L9KA 2H0TA 5TR7A 3ULFA 4MEZA 4X56A 3E4OA 4R4RA 4HNBA 3KSHA 3LICA 2VV6A 1QMEA 3A3EA 3ICYA 5FQIA 2JBFA 5KMWA 1PZPA 2INWA 4ZDXA 1XX2A 3ZG0A 3UDIA 3KO6A 1DJAA 5HPIA 3UB8A 1ZG6A 1K6RA 1SDEA 3OPLA 2PDRA 1PRQA 3LIFA 2W1RA 5DFXA 3P7NA 4XUXA 3LUQA 4GHIA 2DRWA 4ZAMA 3A3IA 3G32A 3NY4A 3S1YA 5GLCA 3LGOA 3S7NA 1Y4OA 1ZG4A 3LIBA 3WS5A 5A8BA 2EXBA 3CZDA 4EXOA 1K4EA 1M6KA 1W8QA 4L9GA 4PM5A 5FEFA 1YLJA 4S2PA 4PPRA 4Y5FA 4E3NA 3IF5A 5KZHA 1S6RA 4GDBA 4O8GA 3P98A 1C3BA 5L2FA 1ACFA 1MKIA 3ZCZA 1ZC2A 2IWBA 2B95A 3BLMA 1S67L 3OPPA 2HP6A 4GS9B 1EW0A 1K0KA 3RXXA 2OAP1 2WKHA 2XDMA 3TG9A 2X71A 4OQGA 3TSGA 3MZEA 3HUOA 1E25A 1XJ2A 5EVID 5LBRA 1OTDA 4DN0A 5EVIC 1WYCA 1IYPA 4K0XA 2E8IA 4RQ9A 2Z6CA 4N1XA 4WL9A 4D60A 1H5XA 3C8CA 3FPVA 3IWIA 1JNUA 5HAPA 2Y4AA 4HOIA 2CC1A 3M2JA 3UB9A 3C4PA 3H7WB 3UB6A 3Q81A 1HLUP 4HJ3A 4DKIA 4S2LA 3MXRA 1KDSA 3M6HA 5F82A 1XGIA 5DF9A 4GS9A 3ITAA 4KZ3A 3MF0A 1S1ZA 2H0YA 4WZ4A 2A24A 4KQOA 1ONHA 3C7UA 2Y2OA 2ZQ9A 4Y17A 4GNUA 5FQKA 1Z09A 3AGEA 3T50A 5GHZA 3R7WB 3UMEA 4PMAA 2PBYA 4KZ4A 4CLCE 1MWTA 4Y0TA 1OTIA 4R3JA 3PBQA 5HFOA 1OTEA 4KG6A 4ZJ1A 2JCHA 4NETA 1STZA 1ESUA 3EEHA 4WEJA 2XA7S 2DMWA 5GHYA 3FPWA 4KQDA 3BFDA 5GLDA 4RVAA 4WF0A 3UPOA 1NZOA 4JGQA 4S2NA 3SH7A 4R4SA 3FKVA 3R7WA 3K3DA 5EPHA 1YPRA 5FQQA 1XKZA 2W1TA 2P9VA 2FH5A 3V3RA 4ETXA 3MKEA 3LIDA 3DW0A 3UO9A 1AXBA 1XFNA 3K3CA 4XT2A 1W8YA 3RJUA 2B5RA 3MFDA 1FILA 4HJ4A 5TBMB 5JYOA 2Y59A 3DTEA 4JGRA 5MC7A 3AGDA 3VFHA 3IX4A 4NXEA 2OAQ1 2Y2JA 4KZBA 1I2SA 3CPTB 1FIKA 2QHKA 2XSSA 2PYRA 5A93A 4U3TA 2W3GA 1YQSA 1OTAA 3V67A 2UWXA 1VEUB 3F1OB 1K55A 4JXSA 2VZWA 2Y2QA 1CF0A 2ACGA 3IT9A 5EUAA 3GV9A 5BOHA 3G4PA 3HREA 5M18A 3MMHA 4LCLA 3ISGA 2ZC3B 5J7EA 2R9XA 4JXGA 5CTNA 1XJ6A 4IVKA 3O3VA 3PXPA 1VM1A 3BLSA 1N9LA 4IUKA 4HH3A 3IHAA 3QP1A 3F1NA 4NK3A 4LENA 2J3WA 2PAVP 3CPTA 1MWRA 3F1PB 3W4PA 2QJ5A 3LFVA 4MN5A 3MZDA 2QWSA 4G3VA 1JWZA 1IYSA 4I39A 1VEUA 1K57A 4Y15A 2O0YA 3F1OA 4S2NC 3RH8B 2V0UA 2ZQDA 1YMSA 2WZXA 4OP8A 3WS1A 3A3FA 1V9ZA 5EFWA 4FH4A 2CMNA 3B33A 4PHTA 5EM0A 4ID4A 1T18A 2ZC4B 2BASA 3FZCA 2DNSA 1BLPA 2Q9NA 4R23A 3G2ZA 4N9KA 4OOYA 3VSKA 4QD4A 2L4RA 4I38A 4B93A 4ZBEA 4RA7A 2HPBA 5HSQA 2WKEA 4I3JA 3ZNYA 1KGFA 4PM9A 1WE4A 4GDNA 5EOOA 4X69A 4OONA 5CHUA 2XROA 2L1MA 2W3FA 3VOZA 1W63Q 5FATA 4GW9A 3IH9A 4BD0A 4EQ1A 1S4SA 3O88A 3HLFA 4P6BA 3JPUA 5EVLA 4GKUA 4LRXC 3Q07A 4GD8A 3HLCA 1TDLA 3V39A 3GECA 3LY4A 4JGPA 3GQZA 3IHBA 2Y91A 3RFBA 1YMXA 4O01A 4E3JA 1Q2QA 2JE5A 3K2NA 3VE3A 1TS8A 4IJGA 5DTTA 1ERQA 4CLCB 5G18A 5CXWA 3FG8A 2B02A 4HEFA 3WRZA 3OLOA 2PBDP 1V9YA 2VGKA 4QY6A 4BBVA 3G6OA 5E2HA 2Y79A 1BULA 5J4EA 4RX2A 1ES2A 1KE4A 1XA7A 2QYBA 5J8XA 2R78A 2ZM0A 4E04A 1ESIA 1JTGA 3QP5A 4YINA 3OCLA 2PRFA 1DP8A 2JKGA 5KIZA 4Q8IA 1M40A 2VLGA 1JTDA 1XPBA 1IELA 4GB7A 2V9AA 2H5SA 1RGYA 2EA9A 3NHQA 2EXAA 3NDEA 1D1JA 2O9BA 3T1XA 4DDYA 3NECA 1OT6A 2O99A 4ZRRA 5FA7A 2P74A 4E3KA 1PYYA 1L3LA 1L0GA 2WZZA 1PWCA 2HDUA 4WLAA 2WAFA 3ITBA 3IF6B 1NJ4A 5F68A 3DTIA 4P6ZM 5DKKA 4E6XA 5I94A 5D3OA 4Y2FA 2D02A 2XFTA 4NKPA 2L0WA 1P9RA 3MBZA 3T4SA 2QMIA 2VV7A 1X0OA 3T1QB 3H9WA 5DJUA 2LB9A 5EOEA 3T1SA 4DJ2A 4HJ6A 1TEMA 3UE3A 5FDSA 4DE0A 3QP4A 5FSRA 2ZOIA 3T4OA 2YKHA 3KSIA 4HESA 2EWVA 1CQAA 5EVIA 2ZC5B 1BYWA 2V0WA 3D9YA 4GHIB 2OWHA 3A0SA 1ES3A 2PD8A 2BTFP 4KENB 4G3KA 4EEPA 3M6BA 3QP6A 4XUZA 2Z2LB 5HDDA 3HUMA 1CI8A 1T1CA 1ALQA 3N8SA 3VP1A 4H8RA 4BWIA 1UWPX 4L9EA 2JC7A 3CJMA 3EGDC 2EFUA 4EBLA 5F83A 4D2OA 4WZ5C 2HP5A 1FSWA 2ZMFA 5HWWA 2IA2A 3UMDA 3QHYA 3MQOA 4EESA 4LRZE 2Y2NA 3IXGA 2UV0E 1K54C 3B42A 3ZG8B 4O0PA 5AQ9A 3BY8A 4EBNA 4FOFA 1O07A 2Q9MA 2JKTI 4KUOA 5JYPA 5F1GA 4BLMA 3RXWA 2GJ3A 4LFUA 2M7UA 5FI7A 1KVMA 4FCFA 5CHJA 1H0MA 2XRNA 4EEUA 4UEYA 2Y55A 2NUPC 4DE2A 1GSXA 1IEMA 1MPLA 3T4KA 4R6LA 4N92A 3GR2A 4X1MA 2PT7A 2HJ9C 4GOGA 3B3XA 2A24B 4BJPA 5HDSA 4IEDA 3CITA 3SZTA 5DFYA 1K6SA 4C3QA 2XD1A 3HVFA 2FFYA 4QJGA 4OQIA 2WGWB 5KSHA 4UHUA 4WELA 5HWVA 4KZ7A 1LSXA 3GRJA 4EERA 1IFQA 3IS2B 5AQBA 2XH9A 3TOIA 2J9PA 4IUHA 3MS6A 2E8JA 1OPXA 4CJNA 4E3LA 4G3WA 5E43A 5A91A 3IWQA 2Y2GA 4JKTA 2ZM2A 2HDRA 3U4LP 5F5YA 3QP2A 1PWDA 1P9WA 2J8YA 5AJGA 5CEBA 1L0EA 3LEQA 1Y54A 4KQQA 2Y2LA 2OLVA 5M1AA 5L07A 4EW7A 1G6OA 2WGWA 3BRMA 3HLBA 2G2UA 4Y7PA 3W4QA 2W1TB 4E3OA 2P9VB 3IS2A 3NDGA 1OTBA 4MCWA 2W3DA 3PAEA 2V8CA 2GZAA 4XT2B 2Z6DA 1GHPA 1Z6FA 1HZOA 4EWFA 4F94A 3VSLA 1GCEA 3ZVWA 2EX8A 3BW6A 3ZVTA 3HCYA 1CK3A 3PBOA 3HL9A 4PM8A 4HHDA 4WYYA 2GDNA 4EUZA 1TS6A 4UA9A 3H82A 2Q0OA 3LO7A 3C2WA 5GHXA 2V20A 3MJQA 3EWKA 1BZAA 2ZBBA 4MBKA 4LPZA 1NYYA 1GSVA 3JVVA 3MZFA 2RL3A 3SS3A 1BUEA 1BT5A 4PM6A 2V2FF 3P09A 3VFFA 4GD6A 4BBTA 5TJJA 1KGEA 2P04A 1L0FA 1LLBA 1PZOA 4Z1WA 4BL2A 1N4OA 3FC7A 1G68A 2XGNA 3GSGA 3F1NB 3NJAA 1PWGA 5HL1A 5A90A 1YAXA 3UB5P 2VX8A 3UNWA 1YLPA 5AVFA 4JGOA 4HBUA 4K08A 3CAXA 4S2KA 4OOLA 1DJCA 1DP9A 1RCJA 2VGJA 4I3IA 1FR6A 3N7WA 2JKRI 1YLZA 1SHVA 1MC0A 4EETB 4QU3A 4R0QA 1DY6A 2WUQA 1ZTUA 3BQ8A 2P08A 4JF6A 3A3DA 4S2JA 4DRTA 4EV4A 3IXDA 3N4IA 2VV8A 1TVFA 4EUVA 3JYIA 3KYQA 5HW3A 5GL9A 4I5SA 4HP9A 1OJGA 4MNRA 3NULA 3QP8A 3GVBA 2KDKA 4FD8A 5CEDA 2ZQ7A 3EEAA 2M7VA 2BG1A 3IBJA 1IYOA 3T4LA 4Y0OA 3OBFA 4X55A 3FYZA 5DTSA 5L10A 4M4XA 3IXHA 3LR0A 3T4QA 5FDHA 4L0LA 3A0RA 2EX6A 4ARZA 4RX3A 4P87A 5HZHA 2QPNA 1IKGA 1CI9A 1OJ5A 2NUTC 3NI9A 1YSQA 1TF1A 4X1LA 2HV1A 4BBUA 4WUJA 2VA0A 2Y2IA 3NBLA 5IS1A 1ONGA 3VP4A 3UE0A 4JPMA 2J9OA 2EWWA 3FKWA 3NC8A 2G7UA 1E4DA 3VV4A 4ETZA 4KZ6A 3HLGA 4FH2A 1ZHHB 2WKQA 4XXRA 3UN7A 1JWVA 4HBTA 3IQAA 4I3AA 1TDGA 2EX2A 2VGLM 3HLEA 5AVEA 4GJ4A 2K31A 3S7PA 3VOYA 3HLDA 1UGUA 3AGFA 3W8KA 1YT4A 2ZQ8A 3TRCA 2BLSA 4C75A 1IYQA 4PM7A 4CQHA 4Q0JA 3MXSA 1NYMA 3QNBA 1GA0A 4OPRA 1EI5A 2QJ7A 1LT0A 1SKFA 4OLDA 1UWNX 2J7VA 2XR0A 3DAVA 4KG5A 3KSGA 3E2LA 4Z9QA 4JLFA 3PBNA 3LIAA 5DTKA 4LV2A 1J9MA 4LV0A 2OV5A 1G28A 3LIEA 1LI0A 4OP5A 4X68A 4HIAA 4DMZA 2Z2MB 3W4OA 4ME4A 1S66L 2R9WA 2JHEA
chains in the Genus database with same CATH topology
1KE3A 5AQ7A 2ZQ9A 2IWCA 1GHMA 4GNUA 5FQKA 4DE1A 2JC7A 1N9BA 3CJMA 4EQIA 3AGEA 1XP4A 2EFUA 2G2WA 5CTMA 5DVAA 5GHZA 1E3UD 5F83A 4D2OA 4EBLA 4WZ5C 1U60A 1FCNA 3VP2A 4OOMA 4PMAA 5CGSA 2PBYA 4KZ4A 3N6IA 3BFFA 3OC2A 1I2WA 1XA1A 4BD1A 1PI5A 2HP5A 1MWTA 5DF8A 3BEBA 4OQ0A 3GMWA 1FSWA 4Y0TA 4WZ5A 4R3JA 5CGXA 4OPQA 3PBQA 5HFOA 3PBTA 3QHYA 1E3UA 4KG6A 4ZJ1A 4IBXA 2Y2NA 4OLGA 2JCHA 4U0TA 3IXGA 4P0MA 1KE0A 3QNCA 5CECA 1K54C 1MWSA 4NETA 1ESUA 4WEJA 2ZD8A 3ZG8B 3NIAA 4ZJ2A 5AQ9A 2Y2PA 3ZNTA 4EBNA 3WS2A 1O07A 2FFFB 5F1FA 3OPRA 1K54A 2Q9MA 5GHYA 3BFDA 4N9LA 3Q1FA 5JYPA 5F1GA 3VMAA 5GLDA 4BLMA 4RVAA 3RXWA 5FAOA 3UPOA 1NZOA 5EVIB 3HBRA 4S2NA 5FI7A 3SH7A 3UDFA 3G2YA 4ZJ3A 1KVMA 3D4FA 4FCFA 4GZBA 4R4SA 1FCOA 5CHJA 4ZTKA 3SOIA 3ZDJA 3E2KA 3FKVA 3HUNA 3BM6A 3G31A 5EPHA 1K4FA 2Y55A 4DE2A 1IEMA 3ZG5A 1MPLA 3LEZA 4N92A 3EQUA 3GR2A 1XKZA 5FQQA 2P9VA 5GLAA 3V3RA 2RCXA 1NRFA 3MKEA 5HAQA 3WWXA 4GOGA 3B3XA 1O7EA 3IWOA 4N1HA 4BJPA 3DW0A 4S2IA 1HVBA 4IEDA 5HX9A 3UO9A 3O87A 4O7DA 3UY6A 1AXBA 1K6SA 3BYDA 4C3QA 1BLHA 2XD1A 4QB8A 1W8YA 1HTZA 3HVFA 3RJUA 3SS5A 2B5RA 2FFYA 3MFDA 4QJGA 3ZGAB 5JYOA 2Y59A 4OQIA 2WGWB 4KG2A 2WK0A 5KSHA 1H8ZA 2XF3A 1W5DA 1MXOA 2DCFA 3AGDA 3PBRA 4UHUA 3VFHA 4WELA 4LCMA 4KZ7A 2PU4A 1LL9A 1RGZA 4KZ9A 2X01A 3GRJA 5AQBA 5TGFA 4M3KA 2Y2JA 4KZBA 2ZC6B 2XH9A 1S0WA 3C5AA 1I2SA 3TOIA 3WS0A 3C4OA 4OKPA 2J9PA 1MWUA 4MBHA 5A93A 4U3TA 4DF6A 1K55C 4CJNA 2XQZA 1L0DA 4E3LA 1YQSA 2UWXA 2WGVA 5E43A 3G34A 1W7FA 5A91A 1K55A 3IWQA 2IWDA 1GHIA 4DXCA 2Y2GA 4JF5A 4R3BA 4JXSA 3V3SA 2Y2QA 4JKTA 5EUAA 3IT9A 1ES4A 2ZM2A 2HDRA 5FQJA 4E3MA 1K25A 1PWDA 4WMCD 1BLCA 3GV9A 2J8YA 5BOHA 3G4PA 3HREA 3BFGA 3BFEA 5M18A 1KGGA 4JBFA 4LCLA 5CEBA 4KZ5A 2EX9A 5FQ9A 3S22A 1SCWA 1L0EA 4JXVA 3ISGA 2ZC3B 4JF4A 1Y54A 4KQQA 2XLNA 2Y2LA 2R9XA 4JXGA 3UPNA 5CTNA 2WADA 2OLVA 5M1AA 4WMCA 4IVKA 5CGWA 4OPYA 1BTLA 1LI9A 2WGWA 3BRMA 3O3VA 3HLBA 2G2UA 3ZHHA 4LV1A 1VM1A 4Y7PA 4FSFA 2Y2MA 3BLSA 3FWLA 3W4QA 4B88A 3NCKA 4E3OA 2P9VB 2XFSA 3IHAA 2WGIA 3CG5A 3N8LA 4NK3A 4C6YA 4JXWA 4LENA 3NDGA 4R1GA 3O86A 2H10A 1MBLA 5FQMA 1MWRA 3W4PA 5DF7A 3V5MA 3G35A 3PAEA 1EROA 1K57C 3CMZA 2ZLYA 1W79A 5CRFA 1WYBA 1K38A 3MZDA 4K91A 4KZAA 1GHPA 1Z6FA 1HZOA 4Y0UA 1JWZA 1IYSA 4EWFA 1K57A 1QMFA 3I7JA 4F94A 3VSLA 3DWKA 4S2NC 4A5RA 1GCEA 3ZVWA 1BSGA 1PW1A 1IKIA 2EX8A 3GTCA 3ZVTA 2OSUA 1CK3A 2ZQDA 3N8RA 1YMSA 2WZXA 3PBOA 4KZ8A 4KQRA 2ZM8A 3WRTA 3HL9A 4OP8A 4PM8A 3WS1A 2Y2KA 4WYYA 2GDNA 3A3FA 4EUZA 2OLUA 4UA9A 4FH4A 3PTEA 4UA7A 3LO7A 5GHXA 4ID4A 2V20A 2ZC4B 4BL3A 1FR1A 4H8RA 1BZAA 1KDWA 4LV3A 3FZCA 2DNSA 3SS4A 3IXBA 4MBKA 1NYYA 1K56D 1OMEA 1BLPA 2Q9NA 3MZFA 5FAPA 1JWPA 4R23A 3G2ZA 2EFXA 1FSYA 1XXMA 2RL3A 4N9KA 4OOYA 3SS3A 4QD4A 3VSKA 1BUEA 4OQHA 4ZBEA 1BT5A 4RA7A 1KVLA 4PM6A 5TFQA 4BENA 2V2FF 2HPBA 3P09A 2XK1A 2V1ZA 5FAQA 1K56A 4U0XA 3VFFA 4GD6A 4B4ZA 5KSCA 1I5QA 1PW8A 1PI4A 2WKEA 4QY5A 1KGEA 3A3JA 3ZNYA 5E2EA 1KGFA 4PM9A 1WE4A 4GDNA 3VP3A 1GA9A 2ZJ9A 5EOOA 1L0FA 4X69A 3DWZA 4OONA 5CHUA 1LLBA 1PZOA 2HDSA 3BFCA 3V50A 4X6TA 4BL2A 1PIOA 3VOZA 1DJBA 1N4OA 3OZHA 1YLYA 5FATA 4S2MA 2XEPA 3IH9A 4BD0A 1G68A 2XGNA 3IH8A 2HDQA 1VQQA 2Y2HA 1G6AA 4WBGA 3GSGA 3O88A 3HLFA 1PWGA 3ZFZA 5HL1A 4P6BA 3UE1A 3ZG9B 4RYEA 5EVLA 3HLWA 5A90A 5M19A 4IVIA 1RP5A 4GKUA 3Q07A 1NZUA 1BLSA 4CPKA 1HD8A 4GD8A 5GLBA 4MLLA 3HLCA 3UNWA 1YLPA 3MKFA 1JVJA 1TDLA 3V39A 3PBSA 1LHYA 2QZ6A 3LY4A 4HBUA 3IF6C 2WYXA 3GQZA 4S2KA 2XD5A 1CEFA 3IHBA 4OOLA 4K0WA 1DJCA 1RCJA 2VGJA 2Y91A 3DTMA 1YMXA 3OCNA 3ZG7B 3IF6A 2X02A 3VP0A 3LY3A 1FQGA 1FR6A 3G30A 4E3JA 1Q2QA 3N7WA 3SH9A 2H0TA 2JE5A 5TR7A 1YLZA 4MEZA 4X56A 3BECA 1FOFA 1SHVA 3EQVA 4R4RA 5DTTA 1ERQA 4QU3A 5G18A 1YLWA 5CXWA 1QMEA 4R0QA 4GN2A 4QHCA 1DY6A 3A3EA 2WUQA 4HEFA 4OVDA 5FQIA 3WRZA 2JBFA 4JF6A 5HAIA 1PZPA 5U47A 4DDSA 4ZDXA 3A3DA 1YM1A 2ZQCA 4S2JA 1NY0A 4DRTA 2VGKA 4EV4A 3IXDA 3N4IA 1XX2A 1TVFA 3SH8A 3ZG0A 4QY6A 3JYIA 5E2HA 5HARA 4DXBA 5GL9A 5HW3A 3UDIA 1BULA 1DJAA 4RX2A 1ES2A 1ZG6A 4MNRA 3GVBA 2WKIA 1KE4A 4FD8A 1K6RA 1XA7A 5CEDA 5J8XA 2ZQ7A 2ZM0A 4YFMA 1SDEA 1ESIA 3OPLA 1JTGA 4YINA 2A49A 2BG1A 3OCLA 1IYOA 4UA6A 4Y0OA 3Q7VB 4X55A 3M2KA 4Q8IA 1M40A 3FYZA 5DTSA 5E2GA 4XUXA 3IXHA 4ZAMA 2DRWA 2ZMAA 5FDHA 3A3IA 4L0LA 1JTDA 1XPBA 3G32A 4IBRA 4DE3A 1IELA 2EX6A 3NY4A 4GB7A 3S1YA 5FI6A 4X53A 1SDNA 5GLCA 4RX3A 2H5SA 3WS5A 1ZG4A 4P87A 1RGYA 2QPNA 5A92A 1IKGA 1CI9A 2EXBA 3CZDA 2EXAA 4S2OA 3NDEA 5EECA 2A3UA 3NI9A 1K4EA 1M6KA 1W8QA 4DDYA 4PM5A 5FA7A 2Y2IA 3NBLA 4OPZA 1ONGA 3VP4A 1YLJA 2WAEA 4S2PA 2P74A 4E3KA 5FI2A 1PYYA 4PPRA 4JPMA 3UE0A 1L0GA 2WZZA 1PWCA 2HDUA 2J9OA 3FKWA 1XGJA 4E3NA 3PAGA 3NC8A 2WAFA 3IF5A 3S4XA 5KZHA 1E4DA 1FCMA 3ITBA 3IF6B 1NJ4A 1S6RA 5E2FA 4GDBA 4B4XA 1NXYA 3P98A 1C3BA 4E6XA 5L2FA 4KZ6A 3HLGA 5I94A 1MKIA 4FH2A 1ES5A 5D3OA 3ZCZA 2ZC7A 4EBPA 1YLTA 2XFTA 1ZC2A 2IWBA 4XXRA 5CHMA 3UN7A 1L2SA 3BLMA 3OPPA 1JWVA 2HP6A 3Q7VA 3MBZA 4UAAA 4HBTA 3RXXA 2QMIA 2WKHA 3IQAA 2XDMA 3Q7ZA 1TDGA 2EX2A 3TG9A 1LL5A 4BQMA 5EOEA 2X71A 3HLEA 4OQGA 1ZKJA 3TSGA 4P85A 3MZEA 3VOYA 1TEMA 3HLDA 3HUOA 3AGFA 3W8KA 1E25A 3WS4A 1YT4A 3UE3A 2ZQ8A 4DE0A 5FASA 1H8YA 2ZQAA 5EVID 5FSRA 2BLSA 2C6WB 5EVIC 4C75A 1WYCA 1IYQA 2I72A 4PM7A 1IYPA 2HP9A 3FV7A 5CERA 3MXSA 4K0XA 4HESA 1NYMA 2E8IA 3QNBA 4WM9A 4N1XA 1GA0A 5IHVA 5EVIA 4OPRA 2ZC5B 1H5XA 1EI5A 3LCEA 3IWIA 5HAPA 2Y4AA 4E6WA 1SKFA 2CC1A 1MY8A 1EWZA 4OLDA 3M2JA 1Q2PA 3C4PA 2J7VA 3Q81A 4OH0A 2XR0A 4KG5A 1ES3A 3E2LA 4DKIA 4Z9QA 4S2LA 3MXRA 1KDSA 3M6HA 3PBNA 4JLFA 4KENB 4MBFA 5F82A 3OPHA 5DTKA 1XGIA 5DF9A 3M6BA 1J9MA 2PU2A 4LV0A 3Q82A 4LV2A 2OV5A 3ITAA 1CEGA 2Z2LB 4KZ3A 4XUZA 1LI0A 5EE8A 4OP5A 3UDXA 3UPPA 4X68A 2H0YA 3HUMA 1CI8A 2C5WB 4WZ4A 2Z2MB 5KMWA 3W4OA 1ALQA 4KQOA 4E3IA 3C7VA 3N8SA 1ONHA 3C7UA 5AQAA 2R9WA 2Y2OA 4WEKA 3VP1A 1ERMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KE3 A;  5AQ7 A;  2ZQ9 A;  2IWC A;  1GHM A;  4GNU A;  5FQK A;  4DE1 A;  2JC7 A;  1N9B A;  3CJM A;  4EQI A;  3AGE A;  1XP4 A;  2EFU A;  2G2W A;  5CTM A;  5DVA A;  5GHZ A;  1E3U D;  5F83 A;  4D2O A;  4EBL A;  4WZ5 C;  1U60 A;  1FCN A;  3VP2 A;  4OOM A;  4PMA A;  5CGS A;  2PBY A;  4KZ4 A;  3N6I A;  3BFF A;  3OC2 A;  1I2W A;  1XA1 A;  4BD1 A;  1PI5 A;  2HP5 A;  1MWT A;  5DF8 A;  3BEB A;  4OQ0 A;  3GMW A;  1FSW A;  4Y0T A;  4WZ5 A;  4R3J A;  5CGX A;  4OPQ A;  3PBQ A;  5HFO A;  3PBT A;  3QHY A;  1E3U A;  4KG6 A;  4ZJ1 A;  4IBX A;  2Y2N A;  4OLG A;  2JCH A;  4U0T A;  3IXG A;  4P0M A;  1KE0 A;  3QNC A;  5CEC A;  1K54 C;  1MWS A;  4NET A;  1ESU A;  4WEJ A;  2ZD8 A;  3ZG8 B;  3NIA A;  4ZJ2 A;  5AQ9 A;  2Y2P A;  3ZNT A;  4EBN A;  3WS2 A;  1O07 A;  2FFF B;  5F1F A;  3OPR A;  1K54 A;  2Q9M A;  5GHY A;  3BFD A;  4N9L A;  3Q1F A;  5JYP A;  5F1G A;  3VMA A;  5GLD A;  4BLM A;  4RVA A;  3RXW A;  5FAO A;  3UPO A;  1NZO A;  5EVI B;  3HBR A;  4S2N A;  5FI7 A;  3SH7 A;  3UDF A;  3G2Y A;  4ZJ3 A;  1KVM A;  3D4F A;  4FCF A;  4GZB A;  4R4S A;  1FCO A;  5CHJ A;  4ZTK A;  3SOI A;  3ZDJ A;  3E2K A;  3FKV A;  3HUN A;  3BM6 A;  3G31 A;  5EPH A;  1K4F A;  2Y55 A;  4DE2 A;  1IEM A;  3ZG5 A;  1MPL A;  3LEZ A;  4N92 A;  3EQU A;  3GR2 A;  1XKZ A;  5FQQ A;  2P9V A;  5GLA A;  3V3R A;  2RCX A;  1NRF A;  3MKE A;  5HAQ A;  3WWX A;  4GOG A;  3B3X A;  1O7E A;  3IWO A;  4N1H A;  4BJP A;  3DW0 A;  4S2I A;  1HVB A;  4IED A;  5HX9 A;  3UO9 A;  3O87 A;  4O7D A;  3UY6 A;  1AXB A;  1K6S A;  3BYD A;  4C3Q A;  1BLH A;  2XD1 A;  4QB8 A;  1W8Y A;  1HTZ A;  3HVF A;  3RJU A;  3SS5 A;  2B5R A;  2FFY A;  3MFD A;  4QJG A;  3ZGA B;  5JYO A;  2Y59 A;  4OQI A;  2WGW B;  4KG2 A;  2WK0 A;  5KSH A;  1H8Z A;  2XF3 A;  1W5D A;  1MXO A;  2DCF A;  3AGD A;  3PBR A;  4UHU A;  3VFH A;  4WEL A;  4LCM A;  4KZ7 A;  2PU4 A;  1LL9 A;  1RGZ A;  4KZ9 A;  2X01 A;  3GRJ A;  5AQB A;  5TGF A;  4M3K A;  2Y2J A;  4KZB A;  2ZC6 B;  2XH9 A;  1S0W A;  3C5A A;  1I2S A;  3TOI A;  3WS0 A;  3C4O A;  4OKP A;  2J9P A;  1MWU A;  4MBH A;  5A93 A;  4U3T A;  4DF6 A;  1K55 C;  4CJN A;  2XQZ A;  1L0D A;  4E3L A;  1YQS A;  2UWX A;  2WGV A;  5E43 A;  3G34 A;  1W7F A;  5A91 A;  1K55 A;  3IWQ A;  2IWD A;  1GHI A;  4DXC A;  2Y2G A;  4JF5 A;  4R3B A;  4JXS A;  3V3S A;  2Y2Q A;  4JKT A;  5EUA A;  3IT9 A;  1ES4 A;  2ZM2 A;  2HDR A;  5FQJ A;  4E3M A;  1K25 A;  1PWD A;  4WMC D;  1BLC A;  3GV9 A;  2J8Y A;  5BOH A;  3G4P A;  3HRE A;  3BFG A;  3BFE A;  5M18 A;  1KGG A;  4JBF A;  4LCL A;  5CEB A;  4KZ5 A;  2EX9 A;  5FQ9 A;  3S22 A;  1SCW A;  1L0E A;  4JXV A;  3ISG A;  2ZC3 B;  4JF4 A;  1Y54 A;  4KQQ A;  2XLN A;  2Y2L A;  2R9X A;  4JXG A;  3UPN A;  5CTN A;  2WAD A;  2OLV A;  5M1A A;  4WMC A;  4IVK A;  5CGW A;  4OPY A;  1BTL A;  1LI9 A;  2WGW A;  3BRM A;  3O3V A;  3HLB A;  2G2U A;  3ZHH A;  4LV1 A;  1VM1 A;  4Y7P A;  4FSF A;  2Y2M A;  3BLS A;  3FWL A;  3W4Q A;  4B88 A;  3NCK A;  4E3O A;  2P9V B;  2XFS A;  3IHA A;  2WGI A;  3CG5 A;  3N8L A;  4NK3 A;  4C6Y A;  4JXW A;  4LEN A;  3NDG A;  4R1G A;  3O86 A;  2H10 A;  1MBL A;  5FQM A;  1MWR A;  3W4P A;  5DF7 A;  3V5M A;  3G35 A;  3PAE A;  1ERO A;  1K57 C;  3CMZ A;  2ZLY A;  1W79 A;  5CRF A;  1WYB A;  1K38 A;  3MZD A;  4K91 A;  4KZA A;  1GHP A;  1Z6F A;  1HZO A;  4Y0U A;  1JWZ A;  1IYS A;  4EWF A;  1K57 A;  1QMF A;  3I7J A;  4F94 A;  3VSL A;  3DWK A;  4S2N C;  4A5R A;  1GCE A;  3ZVW A;  1BSG A;  1PW1 A;  1IKI A;  2EX8 A;  3GTC A;  3ZVT A;  2OSU A;  1CK3 A;  2ZQD A;  3N8R A;  1YMS A;  2WZX A;  3PBO A;  4KZ8 A;  4KQR A;  2ZM8 A;  3WRT A;  3HL9 A;  4OP8 A;  4PM8 A;  3WS1 A;  2Y2K A;  4WYY A;  2GDN A;  3A3F A;  4EUZ A;  2OLU A;  4UA9 A;  4FH4 A;  3PTE A;  4UA7 A;  3LO7 A;  5GHX A;  4ID4 A;  2V20 A;  2ZC4 B;  4BL3 A;  1FR1 A;  4H8R A;  1BZA A;  1KDW A;  4LV3 A;  3FZC A;  2DNS A;  3SS4 A;  3IXB A;  4MBK A;  1NYY A;  1K56 D;  1OME A;  1BLP A;  2Q9N A;  3MZF A;  5FAP A;  1JWP A;  4R23 A;  3G2Z A;  2EFX A;  1FSY A;  1XXM A;  2RL3 A;  4N9K A;  4OOY A;  3SS3 A;  4QD4 A;  3VSK A;  1BUE A;  4OQH A;  4ZBE A;  1BT5 A;  4RA7 A;  1KVL A;  4PM6 A;  5TFQ A;  4BEN A;  2V2F F;  2HPB A;  3P09 A;  2XK1 A;  2V1Z A;  5FAQ A;  1K56 A;  4U0X A;  3VFF A;  4GD6 A;  4B4Z A;  5KSC A;  1I5Q A;  1PW8 A;  1PI4 A;  2WKE A;  4QY5 A;  1KGE A;  3A3J A;  3ZNY A;  5E2E A;  1KGF A;  4PM9 A;  1WE4 A;  4GDN A;  3VP3 A;  1GA9 A;  2ZJ9 A;  5EOO A;  1L0F A;  4X69 A;  3DWZ A;  4OON A;  5CHU A;  1LLB A;  1PZO A;  2HDS A;  3BFC A;  3V50 A;  4X6T A;  4BL2 A;  1PIO A;  3VOZ A;  1DJB A;  1N4O A;  3OZH A;  1YLY A;  5FAT A;  4S2M A;  2XEP A;  3IH9 A;  4BD0 A;  1G68 A;  2XGN A;  3IH8 A;  2HDQ A;  1VQQ A;  2Y2H A;  1G6A A;  4WBG A;  3GSG A;  3O88 A;  3HLF A;  1PWG A;  3ZFZ A;  5HL1 A;  4P6B A;  3UE1 A;  3ZG9 B;  4RYE A;  5EVL A;  3HLW A;  5A90 A;  5M19 A;  4IVI A;  1RP5 A;  4GKU A;  3Q07 A;  1NZU A;  1BLS A;  4CPK A;  1HD8 A;  4GD8 A;  5GLB A;  4MLL A;  3HLC A;  3UNW A;  1YLP A;  3MKF A;  1JVJ A;  1TDL A;  3V39 A;  3PBS A;  1LHY A;  2QZ6 A;  3LY4 A;  4HBU A;  3IF6 C;  2WYX A;  3GQZ A;  4S2K A;  2XD5 A;  1CEF A;  3IHB A;  4OOL A;  4K0W A;  1DJC A;  1RCJ A;  2VGJ A;  2Y91 A;  3DTM A;  1YMX A;  3OCN A;  3ZG7 B;  3IF6 A;  2X02 A;  3VP0 A;  3LY3 A;  1FQG A;  1FR6 A;  3G30 A;  4E3J A;  1Q2Q A;  3N7W A;  3SH9 A;  2H0T A;  2JE5 A;  5TR7 A;  1YLZ A;  4MEZ A;  4X56 A;  3BEC A;  1FOF A;  1SHV A;  3EQV A;  4R4R A;  5DTT A;  1ERQ A;  4QU3 A;  5G18 A;  1YLW A;  5CXW A;  1QME A;  4R0Q A;  4GN2 A;  4QHC A;  1DY6 A;  3A3E A;  2WUQ A;  4HEF A;  4OVD A;  5FQI A;  3WRZ A;  2JBF A;  4JF6 A;  5HAI A;  1PZP A;  5U47 A;  4DDS A;  4ZDX A;  3A3D A;  1YM1 A;  2ZQC A;  4S2J A;  1NY0 A;  4DRT A;  2VGK A;  4EV4 A;  3IXD A;  3N4I A;  1XX2 A;  1TVF A;  3SH8 A;  3ZG0 A;  4QY6 A;  3JYI A;  5E2H A;  5HAR A;  4DXB A;  5GL9 A;  5HW3 A;  3UDI A;  1BUL A;  1DJA A;  4RX2 A;  1ES2 A;  1ZG6 A;  4MNR A;  3GVB A;  2WKI A;  1KE4 A;  4FD8 A;  1K6R A;  1XA7 A;  5CED A;  5J8X A;  2ZQ7 A;  2ZM0 A;  4YFM A;  1SDE A;  1ESI A;  3OPL A;  1JTG A;  4YIN A;  2A49 A;  2BG1 A;  3OCL A;  1IYO A;  4UA6 A;  4Y0O A;  3Q7V B;  4X55 A;  3M2K A;  4Q8I A;  1M40 A;  3FYZ A;  5DTS A;  5E2G A;  4XUX A;  3IXH A;  4ZAM A;  2DRW A;  2ZMA A;  5FDH A;  3A3I A;  4L0L A;  1JTD A;  1XPB A;  3G32 A;  4IBR A;  4DE3 A;  1IEL A;  2EX6 A;  3NY4 A;  4GB7 A;  3S1Y A;  5FI6 A;  4X53 A;  1SDN A;  5GLC A;  4RX3 A;  2H5S A;  3WS5 A;  1ZG4 A;  4P87 A;  1RGY A;  2QPN A;  5A92 A;  1IKG A;  1CI9 A;  2EXB A;  3CZD A;  2EXA A;  4S2O A;  3NDE A;  5EEC A;  2A3U A;  3NI9 A;  1K4E A;  1M6K A;  1W8Q A;  4DDY A;  4PM5 A;  5FA7 A;  2Y2I A;  3NBL A;  4OPZ A;  1ONG A;  3VP4 A;  1YLJ A;  2WAE A;  4S2P A;  2P74 A;  4E3K A;  5FI2 A;  1PYY A;  4PPR A;  4JPM A;  3UE0 A;  1L0G A;  2WZZ A;  1PWC A;  2HDU A;  2J9O A;  3FKW A;  1XGJ A;  4E3N A;  3PAG A;  3NC8 A;  2WAF A;  3IF5 A;  3S4X A;  5KZH A;  1E4D A;  1FCM A;  3ITB A;  3IF6 B;  1NJ4 A;  1S6R A;  5E2F A;  4GDB A;  4B4X A;  1NXY A;  3P98 A;  1C3B A;  4E6X A;  5L2F A;  4KZ6 A;  3HLG A;  5I94 A;  1MKI A;  4FH2 A;  1ES5 A;  5D3O A;  3ZCZ A;  2ZC7 A;  4EBP A;  1YLT A;  2XFT A;  1ZC2 A;  2IWB A;  4XXR A;  5CHM A;  3UN7 A;  1L2S A;  3BLM A;  3OPP A;  1JWV A;  2HP6 A;  3Q7V A;  3MBZ A;  4UAA A;  4HBT A;  3RXX A;  2QMI A;  2WKH A;  3IQA A;  2XDM A;  3Q7Z A;  1TDG A;  2EX2 A;  3TG9 A;  1LL5 A;  4BQM A;  5EOE A;  2X71 A;  3HLE A;  4OQG A;  1ZKJ A;  3TSG A;  4P85 A;  3MZE A;  3VOY A;  1TEM A;  3HLD A;  3HUO A;  3AGF A;  3W8K A;  1E25 A;  3WS4 A;  1YT4 A;  3UE3 A;  2ZQ8 A;  4DE0 A;  5FAS A;  1H8Y A;  2ZQA A;  5EVI D;  5FSR A;  2BLS A;  2C6W B;  5EVI C;  4C75 A;  1WYC A;  1IYQ A;  2I72 A;  4PM7 A;  1IYP A;  2HP9 A;  3FV7 A;  5CER A;  3MXS A;  4K0X A;  4HES A;  1NYM A;  2E8I A;  3QNB A;  4WM9 A;  4N1X A;  1GA0 A;  5IHV A;  5EVI A;  4OPR A;  2ZC5 B;  1H5X A;  1EI5 A;  3LCE A;  3IWI A;  5HAP A;  2Y4A A;  4E6W A;  1SKF A;  2CC1 A;  1MY8 A;  1EWZ A;  4OLD A;  3M2J A;  1Q2P A;  3C4P A;  2J7V A;  3Q81 A;  4OH0 A;  2XR0 A;  4KG5 A;  1ES3 A;  3E2L A;  4DKI A;  4Z9Q A;  4S2L A;  3MXR A;  1KDS A;  3M6H A;  3PBN A;  4JLF A;  4KEN B;  4MBF A;  5F82 A;  3OPH A;  5DTK A;  1XGI A;  5DF9 A;  3M6B A;  1J9M A;  2PU2 A;  4LV0 A;  3Q82 A;  4LV2 A;  2OV5 A;  3ITA A;  1CEG A;  2Z2L B;  4KZ3 A;  4XUZ A;  1LI0 A;  5EE8 A;  4OP5 A;  3UDX A;  3UPP A;  4X68 A;  2H0Y A;  3HUM A;  1CI8 A;  2C5W B;  4WZ4 A;  2Z2M B;  5KMW A;  3W4O A;  1ALQ A;  4KQO A;  4E3I A;  3C7V A;  3N8S A;  1ONH A;  3C7U A;  5AQA A;  2R9W A;  2Y2O A;  4WEK A;  3VP1 A;  1ERM A; 
#chains in the Genus database with same CATH topology
 1KE3 A;  5AQ7 A;  2IWC A;  2M1C A;  2W0N A;  5HD5 A;  4DE1 A;  1XP4 A;  2G2W A;  1SKO B;  1E3U D;  3VP2 A;  4OOM A;  5CGS A;  1F2K A;  3N6I A;  3OC2 A;  1XA1 A;  3T4J A;  3BEB A;  3GMW A;  3JVU A;  4WZ5 A;  5CGX A;  4OPQ A;  5HL6 A;  3NOP C;  4P0M A;  1Y28 A;  5CEC A;  1MWS A;  3D72 A;  2ZD8 A;  2PR5 A;  3NIA A;  2Y2P A;  3ZNT A;  5F1F A;  2FFF B;  3OPR A;  4HY8 A;  1K54 A;  4N9L A;  2ZOH A;  2GX5 A;  1VET A;  5EVI B;  1NRJ A;  3G2Y A;  3OOV A;  4HP4 A;  4ZJ3 A;  4GZB A;  1XFQ A;  2JKR M;  1VHM A;  1MKM A;  3ZDJ A;  3E2K A;  1SKO A;  3HUN A;  3BM6 A;  2WKP A;  2KX6 A;  4GCZ A;  3CWF A;  4R38 A;  3EQU A;  2YKF A;  4Y13 A;  1NRF A;  5HAQ A;  4MDZ A;  4S2I A;  1F9I A;  3LI8 A;  3BYD A;  1BLH A;  4FTX A;  4LLO B;  4F3L B;  2K2N A;  3ZGA B;  4KG2 A;  1H8Z A;  2XF3 A;  1W5D A;  1MXO A;  2DCF A;  3PBR A;  4LCM A;  2PR6 A;  2PU4 A;  4KZ9 A;  4P6Z S;  4M3K A;  5TGF A;  1YSP A;  3SW1 A;  2ZC6 B;  1W63 M;  2HJE A;  3WS0 A;  3GDI A;  4L9F A;  2K7S A;  1MWU A;  1L0D A;  1ODV A;  4DXC A;  1TD5 A;  5FQJ A;  4E3M A;  3O5Y A;  2V8F A;  4WMC D;  3BFG A;  5L8M A;  1KGG A;  3TJZ C;  5FQ9 A;  1N9O A;  1SCW A;  3S22 A;  4JXV A;  2XLN A;  3E98 A;  2WAD A;  4F3L A;  1BTL A;  1LI9 A;  2OWJ A;  2I9V A;  4LV1 A;  3FWL A;  3NCK A;  2J3T D;  3N8L A;  4QPR A;  4C6Y A;  4JXW A;  3A0V A;  2J3T C;  4R1G A;  2H10 A;  1MBL A;  5FQM A;  1S4R A;  3G35 A;  4R70 A;  4H6J A;  1W79 A;  2A2L A;  1NLY A;  3ZYT A;  4HQA A;  3DWK A;  4A5R A;  1DP6 A;  3TW8 A;  4DJ3 A;  1J3W A;  1IKI A;  3D3O A;  2OSU A;  4CLC D;  3MFX A;  4KZ8 A;  4KQR A;  2ZM8 A;  3WRT A;  4QWO A;  2Y2K A;  4PKY A;  4CLC C;  2OLU A;  3S7Q A;  2Y8H A;  3BWL A;  1FR1 A;  3KSF A;  3E4Q A;  4LV3 A;  3SS4 A;  3IXB A;  1K56 D;  1JWP A;  5EM1 A;  1WA9 A;  1XXM A;  2EFX A;  4YWZ A;  4Y3I A;  4OQH A;  1KVL A;  2W27 A;  4EU0 A;  4BEN A;  5FAQ A;  4U0X A;  4B4Z A;  5KSC A;  3MSH A;  1PW8 A;  1D06 A;  3VP3 A;  2ZJ9 A;  3BFC A;  3V50 A;  4NXF A;  1PIO A;  1DJB A;  3OZH A;  5HPF A;  4S2M A;  3LR4 A;  3IH8 A;  3S7O A;  1TS0 A;  2HDQ A;  1VQQ A;  1G6A A;  3UE1 A;  3ZG9 B;  4RYE A;  4IVI A;  3VE4 A;  1BLS A;  4CPK A;  1HD8 A;  5GLB A;  4MLL A;  4X25 A;  3MKF A;  1JVJ A;  1P0Z A;  2V1B A;  2O9C A;  4MN6 A;  3IF6 C;  1T1A A;  3UB7 A;  2WYX A;  1CEF A;  3MXQ A;  4YNR A;  1T1B A;  4IHQ A;  3CUE A;  4K0W A;  3T12 B;  3OCN A;  3ZG7 B;  3R4K A;  3MQQ A;  3LY3 A;  3G30 A;  2VK3 A;  3H82 B;  3SH9 A;  3BEC A;  1FOF A;  3EQV A;  1YLW A;  1CJF A;  4GN2 A;  4QHC A;  4OVD A;  2B18 A;  1YKD A;  2V1A A;  5HAI A;  5U47 A;  4DDS A;  1YM1 A;  2ZQC A;  1NY0 A;  2ZMV A;  2XA7 M;  3E0Y A;  3SH8 A;  5HAR A;  4DXB A;  5HDC A;  1MZU A;  2W3H A;  3BQA A;  3E4P A;  1OT9 A;  3LR5 A;  2JKF A;  2WKI A;  3C38 A;  3MQ0 A;  4YFM A;  1KOU A;  2A49 A;  4UA6 A;  3Q7V B;  3M2K A;  5E2G A;  3H7W A;  2ZMA A;  2AVX A;  4IBR A;  4DE3 A;  3CHW P;  2VEA A;  4X53 A;  5FI6 A;  2O9A A;  1SDN A;  5HWT A;  3KX0 X;  3IBR A;  5A92 A;  4S2O A;  5EEC A;  2A3U A;  2OOL A;  4OPZ A;  2WAE A;  2FZ0 A;  5FI2 A;  3C30 A;  1P97 A;  1XGJ A;  3PAG A;  3S4X A;  1FCM A;  5E2F A;  4B4X A;  1NXY A;  1ES5 A;  4MMN A;  2ZC7 A;  4EBP A;  1YLT A;  3MR0 A;  2J80 A;  4PKY G;  5CHM A;  1L2S A;  3Q7V A;  4UAA A;  3EOI A;  4BQM A;  3Q7Z A;  1LL5 A;  1ZKJ A;  4P85 A;  5G4Z A;  3WS4 A;  1D7E A;  3RTY A;  5FAS A;  1H8Y A;  2ZQA A;  2C6W B;  4NG2 A;  5DKL A;  3EGX C;  2I72 A;  2HP9 A;  3CUE C;  1G5U A;  2JKT M;  3FV7 A;  4II7 A;  5CER A;  4WM9 A;  5IHV A;  3LCE A;  4E6W A;  1MY8 A;  1EWZ A;  1Q2P A;  4OH0 A;  4PAU A;  1A0K A;  4FUW A;  4ARZ B;  4MBF A;  3OPH A;  2PU2 A;  3T1R A;  3Q82 A;  3UE6 A;  1CEG A;  5EE8 A;  3UDX A;  3UPP A;  1F98 A;  2C5W B;  4E3I A;  3C7V A;  5AQA A;  4WEK A;  3CLO A;  1ERM A;  4KUK A;  5FL3 A;  1GHM A;  4UQI M;  1N9B A;  4EQI A;  2PYP A;  3KYZ A;  5CTM A;  5DVA A;  1U60 A;  1FCN A;  5TBM A;  3BFF A;  1I2W A;  1S1Y A;  2GNX A;  4BD1 A;  1PI5 A;  5DF8 A;  4OQ0 A;  1VB6 A;  1DRM A;  3PBT A;  4Q0I A;  1E3U A;  4WN5 A;  4HH2 A;  2W3E A;  4IBX A;  4OLG A;  4U0T A;  5F69 A;  1KE0 A;  3QNC A;  5L09 A;  4ZJ2 A;  2LB5 A;  3NOU C;  3WS2 A;  3Q1F A;  4NXG A;  3VMA A;  3IX3 A;  5FAO A;  5IU1 A;  1H8M A;  3HBR A;  4GLQ A;  4UQI S;  3UDF A;  4MN7 A;  1XJ4 A;  3D4F A;  4ZTK A;  1FCO A;  2WKR A;  4LRY C;  3SOI A;  4BMW A;  1TS7 A;  2QKP A;  3G31 A;  1K4F A;  3ZG5 A;  3LEZ A;  2JN7 A;  5GLA A;  2RCX A;  4NXB A;  3WWX A;  1O7E A;  3IWO A;  4N1H A;  3F1P A;  1HVB A;  5HX9 A;  3UY6 A;  3O87 A;  4O7D A;  4QB8 A;  1HTZ A;  3SS5 A;  1NWZ A;  1LSW A;  3PHY A;  3T4T A;  5IT5 A;  1PNE A;  2WK0 A;  1LL9 A;  1RGZ A;  2X01 A;  5J3W A;  2KLI A;  3C5A A;  3LYX A;  1S0W A;  1XJ3 A;  4OKP A;  3C4O A;  3BY9 A;  2HF6 A;  4MBH A;  2HGV A;  4DF6 A;  1K55 C;  2XQZ A;  5K5B A;  3DBA A;  3BJN A;  2WGV A;  2VGL S;  3G34 A;  1W7F A;  2IWD A;  1GHI A;  4JF5 A;  4R3B A;  3V3S A;  1ES4 A;  1VET B;  2ZL1 B;  1K25 A;  1BLC A;  3U2A A;  3BFE A;  2VKS A;  5HD3 A;  4JBF A;  1LL8 A;  3CI6 A;  4KZ5 A;  2EX9 A;  3PYP A;  1IOU A;  4JF4 A;  1F5M A;  1GSW A;  5CX7 A;  5DJT A;  3UPN A;  4AFI A;  3VOL A;  4WMC A;  5CGW A;  4OPY A;  2KOI A;  3ZHH A;  4B9O A;  1PFL A;  4FSF A;  2Y2M A;  4B88 A;  5EVE A;  2XFS A;  3TE8 A;  2WGI A;  3CG5 A;  3KYE A;  3NOT C;  4HI4 A;  2PHY A;  3W2Z A;  3O86 A;  5DF7 A;  3V5M A;  1ERO A;  1K57 C;  3CMZ A;  2ZLY A;  5CRF A;  4LGW A;  1WYB A;  3PR6 A;  1K38 A;  4K91 A;  3HJI A;  4KZA A;  4Y0U A;  5G4Y A;  1QMF A;  3I7J A;  3ZQ5 A;  1BSG A;  1PW1 A;  3B47 A;  3GTC A;  3P01 A;  5I5L A;  3N8R A;  2ZL1 A;  3DTK A;  5FEG A;  3PTE A;  4UA7 A;  4CLC A;  4BL3 A;  1AWI A;  1KDW A;  1H3Q A;  4ESP A;  3LI9 A;  1OME A;  5FAP A;  2HZ5 A;  1FSY A;  3LR3 A;  2MJ6 A;  5TFQ A;  2V1Z A;  2XK1 A;  1K56 A;  1I5Q A;  1PI4 A;  3HJK A;  4QY5 A;  3A3J A;  5E2E A;  1GA9 A;  3DWZ A;  2HDS A;  4X6T A;  1YLY A;  2VJW A;  1T19 A;  2XEP A;  5F6A A;  4R3A A;  1NLZ A;  4YOF A;  3L7H A;  4NEE D;  2Y2H A;  4WBG A;  1LSV A;  3ZFZ A;  5M19 A;  3HLW A;  2PD7 A;  1N9N A;  1RP5 A;  1NZU A;  4H6J B;  2H28 A;  5EV0 A;  3PBS A;  1LHY A;  4Q0H A;  2QZ6 A;  1SZV A;  3IX8 A;  2XD5 A;  5C5K A;  2D01 A;  3DTM A;  2P7J A;  3IF6 A;  2X02 A;  3VP0 A;  1FQG A;  3L9K A;  2H0T A;  5TR7 A;  3ULF A;  4MEZ A;  4X56 A;  3E4O A;  4R4R A;  4HNB A;  3KSH A;  3LIC A;  2VV6 A;  1QME A;  3A3E A;  3ICY A;  5FQI A;  2JBF A;  5KMW A;  1PZP A;  2INW A;  4ZDX A;  1XX2 A;  3ZG0 A;  3UDI A;  3KO6 A;  1DJA A;  5HPI A;  3UB8 A;  1ZG6 A;  1K6R A;  1SDE A;  3OPL A;  2PDR A;  1PRQ A;  3LIF A;  2W1R A;  5DFX A;  3P7N A;  4XUX A;  3LUQ A;  4GHI A;  2DRW A;  4ZAM A;  3A3I A;  3G32 A;  3NY4 A;  3S1Y A;  5GLC A;  3LGO A;  3S7N A;  1Y4O A;  1ZG4 A;  3LIB A;  3WS5 A;  5A8B A;  2EXB A;  3CZD A;  4EXO A;  1K4E A;  1M6K A;  1W8Q A;  4L9G A;  4PM5 A;  5FEF A;  1YLJ A;  4S2P A;  4PPR A;  4Y5F A;  4E3N A;  3IF5 A;  5KZH A;  1S6R A;  4GDB A;  4O8G A;  3P98 A;  1C3B A;  5L2F A;  1ACF A;  1MKI A;  3ZCZ A;  1ZC2 A;  2IWB A;  2B95 A;  3BLM A;  1S67 L;  3OPP A;  2HP6 A;  4GS9 B;  1EW0 A;  1K0K A;  3RXX A;  2OAP 1;  2WKH A;  2XDM A;  3TG9 A;  2X71 A;  4OQG A;  3TSG A;  3MZE A;  3HUO A;  1E25 A;  1XJ2 A;  5EVI D;  5LBR A;  1OTD A;  4DN0 A;  5EVI C;  1WYC A;  1IYP A;  4K0X A;  2E8I A;  4RQ9 A;  2Z6C A;  4N1X A;  4WL9 A;  4D60 A;  1H5X A;  3C8C A;  3FPV A;  3IWI A;  1JNU A;  5HAP A;  2Y4A A;  4HOI A;  2CC1 A;  3M2J A;  3UB9 A;  3C4P A;  3H7W B;  3UB6 A;  3Q81 A;  1HLU P;  4HJ3 A;  4DKI A;  4S2L A;  3MXR A;  1KDS A;  3M6H A;  5F82 A;  1XGI A;  5DF9 A;  4GS9 A;  3ITA A;  4KZ3 A;  3MF0 A;  1S1Z A;  2H0Y A;  4WZ4 A;  2A24 A;  4KQO A;  1ONH A;  3C7U A;  2Y2O A;  2ZQ9 A;  4Y17 A;  4GNU A;  5FQK A;  1Z09 A;  3AGE A;  3T50 A;  5GHZ A;  3R7W B;  3UME A;  4PMA A;  2PBY A;  4KZ4 A;  4CLC E;  1MWT A;  4Y0T A;  1OTI A;  4R3J A;  3PBQ A;  5HFO A;  1OTE A;  4KG6 A;  4ZJ1 A;  2JCH A;  4NET A;  1STZ A;  1ESU A;  3EEH A;  4WEJ A;  2XA7 S;  2DMW A;  5GHY A;  3FPW A;  4KQD A;  3BFD A;  5GLD A;  4RVA A;  4WF0 A;  3UPO A;  1NZO A;  4JGQ A;  4S2N A;  3SH7 A;  4R4S A;  3FKV A;  3R7W A;  3K3D A;  5EPH A;  1YPR A;  5FQQ A;  1XKZ A;  2W1T A;  2P9V A;  2FH5 A;  3V3R A;  4ETX A;  3MKE A;  3LID A;  3DW0 A;  3UO9 A;  1AXB A;  1XFN A;  3K3C A;  4XT2 A;  1W8Y A;  3RJU A;  2B5R A;  3MFD A;  1FIL A;  4HJ4 A;  5TBM B;  5JYO A;  2Y59 A;  3DTE A;  4JGR A;  5MC7 A;  3AGD A;  3VFH A;  3IX4 A;  4NXE A;  2OAQ 1;  2Y2J A;  4KZB A;  1I2S A;  3CPT B;  1FIK A;  2QHK A;  2XSS A;  2PYR A;  5A93 A;  4U3T A;  2W3G A;  1YQS A;  1OTA A;  3V67 A;  2UWX A;  1VEU B;  3F1O B;  1K55 A;  4JXS A;  2VZW A;  2Y2Q A;  1CF0 A;  2ACG A;  3IT9 A;  5EUA A;  3GV9 A;  5BOH A;  3G4P A;  3HRE A;  5M18 A;  3MMH A;  4LCL A;  3ISG A;  2ZC3 B;  5J7E A;  2R9X A;  4JXG A;  5CTN A;  1XJ6 A;  4IVK A;  3O3V A;  3PXP A;  1VM1 A;  3BLS A;  1N9L A;  4IUK A;  4HH3 A;  3IHA A;  3QP1 A;  3F1N A;  4NK3 A;  4LEN A;  2J3W A;  2PAV P;  3CPT A;  1MWR A;  3F1P B;  3W4P A;  2QJ5 A;  3LFV A;  4MN5 A;  3MZD A;  2QWS A;  4G3V A;  1JWZ A;  1IYS A;  4I39 A;  1VEU A;  1K57 A;  4Y15 A;  2O0Y A;  3F1O A;  4S2N C;  3RH8 B;  2V0U A;  2ZQD A;  1YMS A;  2WZX A;  4OP8 A;  3WS1 A;  3A3F A;  1V9Z A;  5EFW A;  4FH4 A;  2CMN A;  3B33 A;  4PHT A;  5EM0 A;  4ID4 A;  1T18 A;  2ZC4 B;  2BAS A;  3FZC A;  2DNS A;  1BLP A;  2Q9N A;  4R23 A;  3G2Z A;  4N9K A;  4OOY A;  3VSK A;  4QD4 A;  2L4R A;  4I38 A;  4B93 A;  4ZBE A;  4RA7 A;  2HPB A;  5HSQ A;  2WKE A;  4I3J A;  3ZNY A;  1KGF A;  4PM9 A;  1WE4 A;  4GDN A;  5EOO A;  4X69 A;  4OON A;  5CHU A;  2XRO A;  2L1M A;  2W3F A;  3VOZ A;  1W63 Q;  5FAT A;  4GW9 A;  3IH9 A;  4BD0 A;  4EQ1 A;  1S4S A;  3O88 A;  3HLF A;  4P6B A;  3JPU A;  5EVL A;  4GKU A;  4LRX C;  3Q07 A;  4GD8 A;  3HLC A;  1TDL A;  3V39 A;  3GEC A;  3LY4 A;  4JGP A;  3GQZ A;  3IHB A;  2Y91 A;  3RFB A;  1YMX A;  4O01 A;  4E3J A;  1Q2Q A;  2JE5 A;  3K2N A;  3VE3 A;  1TS8 A;  4IJG A;  5DTT A;  1ERQ A;  4CLC B;  5G18 A;  5CXW A;  3FG8 A;  2B02 A;  4HEF A;  3WRZ A;  3OLO A;  2PBD P;  1V9Y A;  2VGK A;  4QY6 A;  4BBV A;  3G6O A;  5E2H A;  2Y79 A;  1BUL A;  5J4E A;  4RX2 A;  1ES2 A;  1KE4 A;  1XA7 A;  2QYB A;  5J8X A;  2R78 A;  2ZM0 A;  4E04 A;  1ESI A;  1JTG A;  3QP5 A;  4YIN A;  3OCL A;  2PRF A;  1DP8 A;  2JKG A;  5KIZ A;  4Q8I A;  1M40 A;  2VLG A;  1JTD A;  1XPB A;  1IEL A;  4GB7 A;  2V9A A;  2H5S A;  1RGY A;  2EA9 A;  3NHQ A;  2EXA A;  3NDE A;  1D1J A;  2O9B A;  3T1X A;  4DDY A;  3NEC A;  1OT6 A;  2O99 A;  4ZRR A;  5FA7 A;  2P74 A;  4E3K A;  1PYY A;  1L3L A;  1L0G A;  2WZZ A;  1PWC A;  2HDU A;  4WLA A;  2WAF A;  3ITB A;  3IF6 B;  1NJ4 A;  5F68 A;  3DTI A;  4P6Z M;  5DKK A;  4E6X A;  5I94 A;  5D3O A;  4Y2F A;  2D02 A;  2XFT A;  4NKP A;  2L0W A;  1P9R A;  3MBZ A;  3T4S A;  2QMI A;  2VV7 A;  1X0O A;  3T1Q B;  3H9W A;  5DJU A;  2LB9 A;  5EOE A;  3T1S A;  4DJ2 A;  4HJ6 A;  1TEM A;  3UE3 A;  5FDS A;  4DE0 A;  3QP4 A;  5FSR A;  2ZOI A;  3T4O A;  2YKH A;  3KSI A;  4HES A;  2EWV A;  1CQA A;  5EVI A;  2ZC5 B;  1BYW A;  2V0W A;  3D9Y A;  4GHI B;  2OWH A;  3A0S A;  1ES3 A;  2PD8 A;  2BTF P;  4KEN B;  4G3K A;  4EEP A;  3M6B A;  3QP6 A;  4XUZ A;  2Z2L B;  5HDD A;  3HUM A;  1CI8 A;  1T1C A;  1ALQ A;  3N8S A;  3VP1 A;  4H8R A;  4BWI A;  1UWP X;  4L9E A;  2JC7 A;  3CJM A;  3EGD C;  2EFU A;  4EBL A;  5F83 A;  4D2O A;  4WZ5 C;  2HP5 A;  1FSW A;  2ZMF A;  5HWW A;  2IA2 A;  3UMD A;  3QHY A;  3MQO A;  4EES A;  4LRZ E;  2Y2N A;  3IXG A;  2UV0 E;  1K54 C;  3B42 A;  3ZG8 B;  4O0P A;  5AQ9 A;  3BY8 A;  4EBN A;  4FOF A;  1O07 A;  2Q9M A;  2JKT I;  4KUO A;  5JYP A;  5F1G A;  4BLM A;  3RXW A;  2GJ3 A;  4LFU A;  2M7U A;  5FI7 A;  1KVM A;  4FCF A;  5CHJ A;  1H0M A;  2XRN A;  4EEU A;  4UEY A;  2Y55 A;  2NUP C;  4DE2 A;  1GSX A;  1IEM A;  1MPL A;  3T4K A;  4R6L A;  4N92 A;  3GR2 A;  4X1M A;  2PT7 A;  2HJ9 C;  4GOG A;  3B3X A;  2A24 B;  4BJP A;  5HDS A;  4IED A;  3CIT A;  3SZT A;  5DFY A;  1K6S A;  4C3Q A;  2XD1 A;  3HVF A;  2FFY A;  4QJG A;  4OQI A;  2WGW B;  5KSH A;  4UHU A;  4WEL A;  5HWV A;  4KZ7 A;  1LSX A;  3GRJ A;  4EER A;  1IFQ A;  3IS2 B;  5AQB A;  2XH9 A;  3TOI A;  2J9P A;  4IUH A;  3MS6 A;  2E8J A;  1OPX A;  4CJN A;  4E3L A;  4G3W A;  5E43 A;  5A91 A;  3IWQ A;  2Y2G A;  4JKT A;  2ZM2 A;  2HDR A;  3U4L P;  5F5Y A;  3QP2 A;  1PWD A;  1P9W A;  2J8Y A;  5AJG A;  5CEB A;  1L0E A;  3LEQ A;  1Y54 A;  4KQQ A;  2Y2L A;  2OLV A;  5M1A A;  5L07 A;  4EW7 A;  1G6O A;  2WGW A;  3BRM A;  3HLB A;  2G2U A;  4Y7P A;  3W4Q A;  2W1T B;  4E3O A;  2P9V B;  3IS2 A;  3NDG A;  1OTB A;  4MCW A;  2W3D A;  3PAE A;  2V8C A;  2GZA A;  4XT2 B;  2Z6D A;  1GHP A;  1Z6F A;  1HZO A;  4EWF A;  4F94 A;  3VSL A;  1GCE A;  3ZVW A;  2EX8 A;  3BW6 A;  3ZVT A;  3HCY A;  1CK3 A;  3PBO A;  3HL9 A;  4PM8 A;  4HHD A;  4WYY A;  2GDN A;  4EUZ A;  1TS6 A;  4UA9 A;  3H82 A;  2Q0O A;  3LO7 A;  3C2W A;  5GHX A;  2V20 A;  3MJQ A;  3EWK A;  1BZA A;  2ZBB A;  4MBK A;  4LPZ A;  1NYY A;  1GSV A;  3JVV A;  3MZF A;  2RL3 A;  3SS3 A;  1BUE A;  1BT5 A;  4PM6 A;  2V2F F;  3P09 A;  3VFF A;  4GD6 A;  4BBT A;  5TJJ A;  1KGE A;  2P04 A;  1L0F A;  1LLB A;  1PZO A;  4Z1W A;  4BL2 A;  1N4O A;  3FC7 A;  1G68 A;  2XGN A;  3GSG A;  3F1N B;  3NJA A;  1PWG A;  5HL1 A;  5A90 A;  1YAX A;  3UB5 P;  2VX8 A;  3UNW A;  1YLP A;  5AVF A;  4JGO A;  4HBU A;  4K08 A;  3CAX A;  4S2K A;  4OOL A;  1DJC A;  1DP9 A;  1RCJ A;  2VGJ A;  4I3I A;  1FR6 A;  3N7W A;  2JKR I;  1YLZ A;  1SHV A;  1MC0 A;  4EET B;  4QU3 A;  4R0Q A;  1DY6 A;  2WUQ A;  1ZTU A;  3BQ8 A;  2P08 A;  4JF6 A;  3A3D A;  4S2J A;  4DRT A;  4EV4 A;  3IXD A;  3N4I A;  2VV8 A;  1TVF A;  4EUV A;  3JYI A;  3KYQ A;  5HW3 A;  5GL9 A;  4I5S A;  4HP9 A;  1OJG A;  4MNR A;  3NUL A;  3QP8 A;  3GVB A;  2KDK A;  4FD8 A;  5CED A;  2ZQ7 A;  3EEA A;  2M7V A;  2BG1 A;  3IBJ A;  1IYO A;  3T4L A;  4Y0O A;  3OBF A;  4X55 A;  3FYZ A;  5DTS A;  5L10 A;  4M4X A;  3IXH A;  3LR0 A;  3T4Q A;  5FDH A;  4L0L A;  3A0R A;  2EX6 A;  4ARZ A;  4RX3 A;  4P87 A;  5HZH A;  2QPN A;  1IKG A;  1CI9 A;  1OJ5 A;  2NUT C;  3NI9 A;  1YSQ A;  1TF1 A;  4X1L A;  2HV1 A;  4BBU A;  4WUJ A;  2VA0 A;  2Y2I A;  3NBL A;  5IS1 A;  1ONG A;  3VP4 A;  3UE0 A;  4JPM A;  2J9O A;  2EWW A;  3FKW A;  3NC8 A;  2G7U A;  1E4D A;  3VV4 A;  4ETZ A;  4KZ6 A;  3HLG A;  4FH2 A;  1ZHH B;  2WKQ A;  4XXR A;  3UN7 A;  1JWV A;  4HBT A;  3IQA A;  4I3A A;  1TDG A;  2EX2 A;  2VGL M;  3HLE A;  5AVE A;  4GJ4 A;  2K31 A;  3S7P A;  3VOY A;  3HLD A;  1UGU A;  3AGF A;  3W8K A;  1YT4 A;  2ZQ8 A;  3TRC A;  2BLS A;  4C75 A;  1IYQ A;  4PM7 A;  4CQH A;  4Q0J A;  3MXS A;  1NYM A;  3QNB A;  1GA0 A;  4OPR A;  1EI5 A;  2QJ7 A;  1LT0 A;  1SKF A;  4OLD A;  1UWN X;  2J7V A;  2XR0 A;  3DAV A;  4KG5 A;  3KSG A;  3E2L A;  4Z9Q A;  4JLF A;  3PBN A;  3LIA A;  5DTK A;  4LV2 A;  1J9M A;  4LV0 A;  2OV5 A;  1G28 A;  3LIE A;  1LI0 A;  4OP5 A;  4X68 A;  4HIA A;  4DMZ A;  2Z2M B;  3W4O A;  4ME4 A;  1S66 L;  2R9W A;  2JHE A; 
#chains in the Genus database with same CATH homology
 1KE3 A;  5AQ7 A;  2ZQ9 A;  2IWC A;  1GHM A;  4GNU A;  5FQK A;  4DE1 A;  2JC7 A;  1N9B A;  3CJM A;  4EQI A;  3AGE A;  1XP4 A;  2EFU A;  2G2W A;  5CTM A;  5DVA A;  5GHZ A;  1E3U D;  5F83 A;  4D2O A;  4EBL A;  4WZ5 C;  1U60 A;  1FCN A;  3VP2 A;  4OOM A;  4PMA A;  5CGS A;  2PBY A;  4KZ4 A;  3N6I A;  3BFF A;  3OC2 A;  1I2W A;  1XA1 A;  4BD1 A;  1PI5 A;  2HP5 A;  1MWT A;  5DF8 A;  3BEB A;  4OQ0 A;  3GMW A;  1FSW A;  4Y0T A;  4WZ5 A;  4R3J A;  5CGX A;  4OPQ A;  3PBQ A;  5HFO A;  3PBT A;  3QHY A;  1E3U A;  4KG6 A;  4ZJ1 A;  4IBX A;  2Y2N A;  4OLG A;  2JCH A;  4U0T A;  3IXG A;  4P0M A;  1KE0 A;  3QNC A;  5CEC A;  1K54 C;  1MWS A;  4NET A;  1ESU A;  4WEJ A;  2ZD8 A;  3ZG8 B;  3NIA A;  4ZJ2 A;  5AQ9 A;  2Y2P A;  3ZNT A;  4EBN A;  3WS2 A;  1O07 A;  2FFF B;  5F1F A;  3OPR A;  1K54 A;  2Q9M A;  5GHY A;  3BFD A;  4N9L A;  3Q1F A;  5JYP A;  5F1G A;  3VMA A;  5GLD A;  4BLM A;  4RVA A;  3RXW A;  5FAO A;  3UPO A;  1NZO A;  5EVI B;  3HBR A;  4S2N A;  5FI7 A;  3SH7 A;  3UDF A;  3G2Y A;  4ZJ3 A;  1KVM A;  3D4F A;  4FCF A;  4GZB A;  4R4S A;  1FCO A;  5CHJ A;  4ZTK A;  3SOI A;  3ZDJ A;  3E2K A;  3FKV A;  3HUN A;  3BM6 A;  3G31 A;  5EPH A;  1K4F A;  2Y55 A;  4DE2 A;  1IEM A;  3ZG5 A;  1MPL A;  3LEZ A;  4N92 A;  3EQU A;  3GR2 A;  1XKZ A;  5FQQ A;  2P9V A;  5GLA A;  3V3R A;  2RCX A;  1NRF A;  3MKE A;  5HAQ A;  3WWX A;  4GOG A;  3B3X A;  1O7E A;  3IWO A;  4N1H A;  4BJP A;  3DW0 A;  4S2I A;  1HVB A;  4IED A;  5HX9 A;  3UO9 A;  3O87 A;  4O7D A;  3UY6 A;  1AXB A;  1K6S A;  3BYD A;  4C3Q A;  1BLH A;  2XD1 A;  4QB8 A;  1W8Y A;  1HTZ A;  3HVF A;  3RJU A;  3SS5 A;  2B5R A;  2FFY A;  3MFD A;  4QJG A;  3ZGA B;  5JYO A;  2Y59 A;  4OQI A;  2WGW B;  4KG2 A;  2WK0 A;  5KSH A;  1H8Z A;  2XF3 A;  1W5D A;  1MXO A;  2DCF A;  3AGD A;  3PBR A;  4UHU A;  3VFH A;  4WEL A;  4LCM A;  4KZ7 A;  2PU4 A;  1LL9 A;  1RGZ A;  4KZ9 A;  2X01 A;  3GRJ A;  5AQB A;  5TGF A;  4M3K A;  2Y2J A;  4KZB A;  2ZC6 B;  2XH9 A;  1S0W A;  3C5A A;  1I2S A;  3TOI A;  3WS0 A;  3C4O A;  4OKP A;  2J9P A;  1MWU A;  4MBH A;  5A93 A;  4U3T A;  4DF6 A;  1K55 C;  4CJN A;  2XQZ A;  1L0D A;  4E3L A;  1YQS A;  2UWX A;  2WGV A;  5E43 A;  3G34 A;  1W7F A;  5A91 A;  1K55 A;  3IWQ A;  2IWD A;  1GHI A;  4DXC A;  2Y2G A;  4JF5 A;  4R3B A;  4JXS A;  3V3S A;  2Y2Q A;  4JKT A;  5EUA A;  3IT9 A;  1ES4 A;  2ZM2 A;  2HDR A;  5FQJ A;  4E3M A;  1K25 A;  1PWD A;  4WMC D;  1BLC A;  3GV9 A;  2J8Y A;  5BOH A;  3G4P A;  3HRE A;  3BFG A;  3BFE A;  5M18 A;  1KGG A;  4JBF A;  4LCL A;  5CEB A;  4KZ5 A;  2EX9 A;  5FQ9 A;  3S22 A;  1SCW A;  1L0E A;  4JXV A;  3ISG A;  2ZC3 B;  4JF4 A;  1Y54 A;  4KQQ A;  2XLN A;  2Y2L A;  2R9X A;  4JXG A;  3UPN A;  5CTN A;  2WAD A;  2OLV A;  5M1A A;  4WMC A;  4IVK A;  5CGW A;  4OPY A;  1BTL A;  1LI9 A;  2WGW A;  3BRM A;  3O3V A;  3HLB A;  2G2U A;  3ZHH A;  4LV1 A;  1VM1 A;  4Y7P A;  4FSF A;  2Y2M A;  3BLS A;  3FWL A;  3W4Q A;  4B88 A;  3NCK A;  4E3O A;  2P9V B;  2XFS A;  3IHA A;  2WGI A;  3CG5 A;  3N8L A;  4NK3 A;  4C6Y A;  4JXW A;  4LEN A;  3NDG A;  4R1G A;  3O86 A;  2H10 A;  1MBL A;  5FQM A;  1MWR A;  3W4P A;  5DF7 A;  3V5M A;  3G35 A;  3PAE A;  1ERO A;  1K57 C;  3CMZ A;  2ZLY A;  1W79 A;  5CRF A;  1WYB A;  1K38 A;  3MZD A;  4K91 A;  4KZA A;  1GHP A;  1Z6F A;  1HZO A;  4Y0U A;  1JWZ A;  1IYS A;  4EWF A;  1K57 A;  1QMF A;  3I7J A;  4F94 A;  3VSL A;  3DWK A;  4S2N C;  4A5R A;  1GCE A;  3ZVW A;  1BSG A;  1PW1 A;  1IKI A;  2EX8 A;  3GTC A;  3ZVT A;  2OSU A;  1CK3 A;  2ZQD A;  3N8R A;  1YMS A;  2WZX A;  3PBO A;  4KZ8 A;  4KQR A;  2ZM8 A;  3WRT A;  3HL9 A;  4OP8 A;  4PM8 A;  3WS1 A;  2Y2K A;  4WYY A;  2GDN A;  3A3F A;  4EUZ A;  2OLU A;  4UA9 A;  4FH4 A;  3PTE A;  4UA7 A;  3LO7 A;  5GHX A;  4ID4 A;  2V20 A;  2ZC4 B;  4BL3 A;  1FR1 A;  4H8R A;  1BZA A;  1KDW A;  4LV3 A;  3FZC A;  2DNS A;  3SS4 A;  3IXB A;  4MBK A;  1NYY A;  1K56 D;  1OME A;  1BLP A;  2Q9N A;  3MZF A;  5FAP A;  1JWP A;  4R23 A;  3G2Z A;  2EFX A;  1FSY A;  1XXM A;  2RL3 A;  4N9K A;  4OOY A;  3SS3 A;  4QD4 A;  3VSK A;  1BUE A;  4OQH A;  4ZBE A;  1BT5 A;  4RA7 A;  1KVL A;  4PM6 A;  5TFQ A;  4BEN A;  2V2F F;  2HPB A;  3P09 A;  2XK1 A;  2V1Z A;  5FAQ A;  1K56 A;  4U0X A;  3VFF A;  4GD6 A;  4B4Z A;  5KSC A;  1I5Q A;  1PW8 A;  1PI4 A;  2WKE A;  4QY5 A;  1KGE A;  3A3J A;  3ZNY A;  5E2E A;  1KGF A;  4PM9 A;  1WE4 A;  4GDN A;  3VP3 A;  1GA9 A;  2ZJ9 A;  5EOO A;  1L0F A;  4X69 A;  3DWZ A;  4OON A;  5CHU A;  1LLB A;  1PZO A;  2HDS A;  3BFC A;  3V50 A;  4X6T A;  4BL2 A;  1PIO A;  3VOZ A;  1DJB A;  1N4O A;  3OZH A;  1YLY A;  5FAT A;  4S2M A;  2XEP A;  3IH9 A;  4BD0 A;  1G68 A;  2XGN A;  3IH8 A;  2HDQ A;  1VQQ A;  2Y2H A;  1G6A A;  4WBG A;  3GSG A;  3O88 A;  3HLF A;  1PWG A;  3ZFZ A;  5HL1 A;  4P6B A;  3UE1 A;  3ZG9 B;  4RYE A;  5EVL A;  3HLW A;  5A90 A;  5M19 A;  4IVI A;  1RP5 A;  4GKU A;  3Q07 A;  1NZU A;  1BLS A;  4CPK A;  1HD8 A;  4GD8 A;  5GLB A;  4MLL A;  3HLC A;  3UNW A;  1YLP A;  3MKF A;  1JVJ A;  1TDL A;  3V39 A;  3PBS A;  1LHY A;  2QZ6 A;  3LY4 A;  4HBU A;  3IF6 C;  2WYX A;  3GQZ A;  4S2K A;  2XD5 A;  1CEF A;  3IHB A;  4OOL A;  4K0W A;  1DJC A;  1RCJ A;  2VGJ A;  2Y91 A;  3DTM A;  1YMX A;  3OCN A;  3ZG7 B;  3IF6 A;  2X02 A;  3VP0 A;  3LY3 A;  1FQG A;  1FR6 A;  3G30 A;  4E3J A;  1Q2Q A;  3N7W A;  3SH9 A;  2H0T A;  2JE5 A;  5TR7 A;  1YLZ A;  4MEZ A;  4X56 A;  3BEC A;  1FOF A;  1SHV A;  3EQV A;  4R4R A;  5DTT A;  1ERQ A;  4QU3 A;  5G18 A;  1YLW A;  5CXW A;  1QME A;  4R0Q A;  4GN2 A;  4QHC A;  1DY6 A;  3A3E A;  2WUQ A;  4HEF A;  4OVD A;  5FQI A;  3WRZ A;  2JBF A;  4JF6 A;  5HAI A;  1PZP A;  5U47 A;  4DDS A;  4ZDX A;  3A3D A;  1YM1 A;  2ZQC A;  4S2J A;  1NY0 A;  4DRT A;  2VGK A;  4EV4 A;  3IXD A;  3N4I A;  1XX2 A;  1TVF A;  3SH8 A;  3ZG0 A;  4QY6 A;  3JYI A;  5E2H A;  5HAR A;  4DXB A;  5GL9 A;  5HW3 A;  3UDI A;  1BUL A;  1DJA A;  4RX2 A;  1ES2 A;  1ZG6 A;  4MNR A;  3GVB A;  2WKI A;  1KE4 A;  4FD8 A;  1K6R A;  1XA7 A;  5CED A;  5J8X A;  2ZQ7 A;  2ZM0 A;  4YFM A;  1SDE A;  1ESI A;  3OPL A;  1JTG A;  4YIN A;  2A49 A;  2BG1 A;  3OCL A;  1IYO A;  4UA6 A;  4Y0O A;  3Q7V B;  4X55 A;  3M2K A;  4Q8I A;  1M40 A;  3FYZ A;  5DTS A;  5E2G A;  4XUX A;  3IXH A;  4ZAM A;  2DRW A;  2ZMA A;  5FDH A;  3A3I A;  4L0L A;  1JTD A;  1XPB A;  3G32 A;  4IBR A;  4DE3 A;  1IEL A;  2EX6 A;  3NY4 A;  4GB7 A;  3S1Y A;  5FI6 A;  4X53 A;  1SDN A;  5GLC A;  4RX3 A;  2H5S A;  3WS5 A;  1ZG4 A;  4P87 A;  1RGY A;  2QPN A;  5A92 A;  1IKG A;  1CI9 A;  2EXB A;  3CZD A;  2EXA A;  4S2O A;  3NDE A;  5EEC A;  2A3U A;  3NI9 A;  1K4E A;  1M6K A;  1W8Q A;  4DDY A;  4PM5 A;  5FA7 A;  2Y2I A;  3NBL A;  4OPZ A;  1ONG A;  3VP4 A;  1YLJ A;  2WAE A;  4S2P A;  2P74 A;  4E3K A;  5FI2 A;  1PYY A;  4PPR A;  4JPM A;  3UE0 A;  1L0G A;  2WZZ A;  1PWC A;  2HDU A;  2J9O A;  3FKW A;  1XGJ A;  4E3N A;  3PAG A;  3NC8 A;  2WAF A;  3IF5 A;  3S4X A;  5KZH A;  1E4D A;  1FCM A;  3ITB A;  3IF6 B;  1NJ4 A;  1S6R A;  5E2F A;  4GDB A;  4B4X A;  1NXY A;  3P98 A;  1C3B A;  4E6X A;  5L2F A;  4KZ6 A;  3HLG A;  5I94 A;  1MKI A;  4FH2 A;  1ES5 A;  5D3O A;  3ZCZ A;  2ZC7 A;  4EBP A;  1YLT A;  2XFT A;  1ZC2 A;  2IWB A;  4XXR A;  5CHM A;  3UN7 A;  1L2S A;  3BLM A;  3OPP A;  1JWV A;  2HP6 A;  3Q7V A;  3MBZ A;  4UAA A;  4HBT A;  3RXX A;  2QMI A;  2WKH A;  3IQA A;  2XDM A;  3Q7Z A;  1TDG A;  2EX2 A;  3TG9 A;  1LL5 A;  4BQM A;  5EOE A;  2X71 A;  3HLE A;  4OQG A;  1ZKJ A;  3TSG A;  4P85 A;  3MZE A;  3VOY A;  1TEM A;  3HLD A;  3HUO A;  3AGF A;  3W8K A;  1E25 A;  3WS4 A;  1YT4 A;  3UE3 A;  2ZQ8 A;  4DE0 A;  5FAS A;  1H8Y A;  2ZQA A;  5EVI D;  5FSR A;  2BLS A;  2C6W B;  5EVI C;  4C75 A;  1WYC A;  1IYQ A;  2I72 A;  4PM7 A;  1IYP A;  2HP9 A;  3FV7 A;  5CER A;  3MXS A;  4K0X A;  4HES A;  1NYM A;  2E8I A;  3QNB A;  4WM9 A;  4N1X A;  1GA0 A;  5IHV A;  5EVI A;  4OPR A;  2ZC5 B;  1H5X A;  1EI5 A;  3LCE A;  3IWI A;  5HAP A;  2Y4A A;  4E6W A;  1SKF A;  2CC1 A;  1MY8 A;  1EWZ A;  4OLD A;  3M2J A;  1Q2P A;  3C4P A;  2J7V A;  3Q81 A;  4OH0 A;  2XR0 A;  4KG5 A;  1ES3 A;  3E2L A;  4DKI A;  4Z9Q A;  4S2L A;  3MXR A;  1KDS A;  3M6H A;  3PBN A;  4JLF A;  4KEN B;  4MBF A;  5F82 A;  3OPH A;  5DTK A;  1XGI A;  5DF9 A;  3M6B A;  1J9M A;  2PU2 A;  4LV0 A;  3Q82 A;  4LV2 A;  2OV5 A;  3ITA A;  1CEG A;  2Z2L B;  4KZ3 A;  4XUZ A;  1LI0 A;  5EE8 A;  4OP5 A;  3UDX A;  3UPP A;  4X68 A;  2H0Y A;  3HUM A;  1CI8 A;  2C5W B;  4WZ4 A;  2Z2M B;  5KMW A;  3W4O A;  1ALQ A;  4KQO A;  4E3I A;  3C7V A;  3N8S A;  1ONH A;  3C7U A;  5AQA A;  2R9W A;  2Y2O A;  4WEK A;  3VP1 A;  1ERM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...