5TGFA

Crystal structure of putative beta-lactamase from bacteroides dorei dsm 17855
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
333
structure length
333
Chain Sequence
TYDFTPLDSIISSWMDKGYYPGGAICVVKNDSVLFEKAYGSFTGDTKVYVASAGKWVAAAVIGAVVDRTDLSWDDPVEKWLPQFRGDAKGGILLRQLLSHTSGVRPYLPAPRVDNYNHLDSAVTEILSLDTVFTPGTRFEYGGLAMQIAGRMAEVAMGKEFEPLFQELIAAPLGMTHSHFAPVNTDGGHAPMLGGGLCTTLNDYIRFLKMIYHNGRSGNREILKPETVQTMQADQVRNAVVAPGEYVEKALGQHHTSIYGLGEWRELVDEATGEAYQISSPGWAGAYPWINKRDGVYGFFIAHVQGEANKKDGFSSFYGSPVLSETVTKIVNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Uncharacterized protein
publication title Crystal structure of a beta-lactamase from Bacteroides dorei DSM 17855
rcsb
source organism Bacteroides dorei dsm 17855
total genus 100
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5tgfA00
5GHXA 1GHMA 2PU4A 5CERA 5CXWA 3IWQA 3BM6A 4RX3A 1YMXA 4BL3A 3G35A 1LI0A 4Y0OA 5FATA 5CHMA 4IVIA 4XXRA 4KQRA 5HAPA 1AXBA 1O7EA 3BRMA 5DTSA 3BLSA 3CMZA 5FQ9A 5A90A 2J8YA 2EX9A 2HDUA 2ZLYA 3VP1A 1O07A 3HUMA 4E3IA 1EROA 5GHYA 1W5DA 3ITBA 2FFYA 4R3JA 4JF4A 3BYDA 2WUQA 4S2IA 2GDNA 1PW1A 3SS5A 3IXBA 4X68A 4DE3A 3IHBA 1BLSA 2WGVA 4BD1A 2P9VA 1XP4A 4LV1A 3ZFZA 1Z6FA 3DTMA 3IF6C 4BENA 3HLGA 2Y91A 3SS4A 2RL3A 4QD4A 5FASA 1H5XA 4E6WA 4N9LA 4KZBA 4KQQA 1EI5A 2ZQ7A 4Y0TA 1W8YA 1NYMA 4L0LA 1LL9A 3P98A 1IYOA 4IEDA 4MBKA 5A92A 4LCMA 4P87A 5EVIC 3TSGA 3BEBA 4QY5A 1HD8A 3ZCZA 1E3UA 2EXBA 4KZ7A 5FAQA 3WS2A 2Y2HA 3IF6A 5TR7A 3O88A 4ZJ3A 4OQ0A 4OOMA 1RP5A 2XR0A 1CI8A 3W4PA 3N4IA 1VM1A 2UWXA 2Y4AA 5E2GA 3ZGAB 4PM9A 4XUZA 4UAAA 4KG6A 1SCWA 3GQZA 3WWXA 3VSLA 2OLUA 1XXMA 5GLAA 2Y2JA 1ALQA 1PWDA 1HTZA 3PBSA 4JXVA 4OQGA 2ZD8A 2CC1A 2WKEA 3MZFA 3PBOA 4PMAA 5DF7A 3FKVA 3UN7A 5FQKA 2IWCA 1GHIA 4FSFA 3M6BA 2XD5A 2WKIA 3V50A 3MKEA 3UE0A 1FSYA 4HBTA 4CPKA 5HAQA 2IWDA 4U3TA 3SS3A 3V39A 4GOGA 1CI9A 2HDRA 4FCFA 2J9PA 1CEFA 1HVBA 2V2FF 1MXOA 3C7VA 3CZDA 3Q7ZA 2WZXA 4E6XA 2QZ6A 4M3KA 4FH2A 5CHJA 3N8LA 3PTEA 4WEJA 4GZBA 4PM6A 2Y2QA 3EQVA 5DTTA 3G30A 4S2NC 4KENB 1SHVA 4OP5A 1PZPA 5CGXA 2BG1A 4JBFA 1N9BA 3IXGA 4LV3A 4OONA 5EVID 5GLDA 3UY6A 3QNCA 4BD0A 3WS1A 1SDEA 3D4FA 3RXXA 1ERQA 1K54A 1BTLA 1YT4A 3HLCA 4R3BA 3OPRA 5FSRA 4C6YA 5BOHA 3OZHA 1KE3A 4OKPA 3NI9A 2WADA 3Q07A 4Z9QA 4WZ5C 4S2JA 4JXSA 5JYOA 3PAGA 1YQSA 4QU3A 3HLWA 5DVAA 1MWRA 4ZAMA 4KG5A 3GR2A 3UDIA 5A93A 1XGIA 1YLYA 2Z2LB 4MLLA 4X69A 5HAIA 1VQQA 3UE3A 3A3EA 3MBZA 3PBQA 5GHZA 4N1XA 4X6TA 1C3BA 3IXDA 2WKHA 3A3FA 4UA9A 2ZQ8A 1N4OA 1MKIA 1LI9A 4PM7A 4QHCA 3SH9A 4CJNA 3BFCA 1MBLA 1XKZA 4B88A 1MWUA 1LLBA 4OQIA 1FCNA 4QY6A 2VGJA 1BULA 5E2FA 5FAPA 4ZDXA 2HP5A 3EQUA 3MFDA 3OCNA 1K56D 1L0FA 4GN2A 3UE1A 2Y59A 4ZTKA 2A49A 3Q81A 1ES5A 3OC2A 5HW3A 1FQGA 4OLDA 4E3NA 3VP3A 3OCLA 3IWOA 3OPLA 3UNWA 3W4OA 3HLEA 3DWKA 1KE4A 3CG5A 2HPBA 2QMIA 4OLGA 3ZNYA 3VP2A 4WMCD 1IELA 2C6WB 3BFDA 4IBRA 2Y55A 4EQIA 2ZM2A 5CECA 2E8IA 1ONHA 4BLMA 4S2PA 5FI2A 5G18A 2G2WA 5EOOA 1DJCA 5HL1A 4DXBA 1PI5A 2Y2GA 3SH7A 3VP0A 4KG2A 3Q7VB 2HP9A 1S6RA 4E3MA 4EUZA 4UHUA 4ZJ1A 5E2EA 1BT5A 3HBRA 3GSGA 3MXSA 4P6BA 3ZHHA 2ZC4B 1MWTA 4FD8A 2WAFA 4S2MA 3PAEA 3MZEA 4RVAA 3IWIA 1IKIA 3FKWA 1YLTA 1YLJA 3LO7A 3IH9A 1Q2QA 2XFSA 2EX8A 2Q9MA 4PM5A 5DTKA 4LV2A 4WEKA 3UDXA 2J7VA 1IYQA 3NC8A 4S2LA 3ZG9B 3O87A 3TOIA 5U47A 1RGZA 4WELA 4Y7PA 3NDEA 4XUXA 1BLPA 1JWVA 2H0YA 3G4PA 3QHYA 4HEFA 4ZJ2A 4F94A 4KZ4A 4WYYA 3VOZA 2VGKA 2XGNA 4FH4A 3A3IA 1L2SA 3Q82A 1EWZA 3CJMA 4OOLA 4RYEA 1KVLA 4KZ5A 3P09A 1DJBA 1PWGA 1K38A 3IT9A 4MBHA 4E3KA 2DNSA 2OV5A 4BQMA 3GVBA 1YMSA 3WRZA 5JYPA 1I2SA 3FYZA 2ZQCA 4D2OA 2P9VB 4O7DA 1ESIA 2XK1A 5FQJA 1KVMA 4JPMA 4JLFA 2Y2LA 1FCOA 1KDWA 1ES4A 3G2YA 5GLBA 5HFOA 3MXRA 3VMAA 3HL9A 1PZOA 4OVDA 4H8RA 4JXWA 2JCHA 3LEZA 4QB8A 4DE1A 4WZ4A 1BLCA 3FZCA 1GA0A 3NCKA 1OMEA 5F1FA 5CHUA 4X55A 2X02A 3C4OA 3ZNTA 4P0MA 2I72A 5F83A 1FOFA 5EVLA 4EBNA 5CGSA 3IF6B 1TVFA 1K54C 1M6KA 1BLHA 3C4PA 1BUEA 2JC7A 2ZQDA 2RCXA 2WGWA 4ZBEA 3S22A 3UPNA 3OPPA 4Y0UA 2IWBA 3WS0A 1S0WA 2Y2MA 5GL9A 2Q9NA 4MEZA 3AGDA 2OLVA 4JKTA 3DWZA 5EVIB 5A91A 1TDGA 5KSCA 3O3VA 2FFFB 3AGEA 4E3OA 2Y2KA 5HARA 4NK3A 5CRFA 2WYXA 1IYSA 4RA7A 5M18A 4R4SA 4YINA 5I94A 3E2KA 2XF3A 2DCFA 1K4FA 1PIOA 1K57A 4DRTA 1L0DA 3BECA 4RX2A 1KE0A 2Y2IA 2G2UA 3RXWA 2XLNA 1IYPA 2EX2A 1RGYA 2QPNA 3IQAA 4OH0A 5J8XA 4K91A 3VOYA 1KGFA 4LENA 3FWLA 5FI6A 5CEDA 1FR1A 1XA1A 3S4XA 3W8KA 1U60A 1XX2A 1K55C 5AQBA 3RJUA 4E3JA 2EX6A 1HZOA 4EBLA 2Y2PA 5CEBA 1JTGA 1H8YA 4GDNA 5L2FA 3G2ZA 2C5WB 2ZC5B 1BSGA 2ZM0A 5KSHA 4WMCA 5HX9A 2ZC7A 4X56A 3S1YA 1TEMA 4ID4A 3SH8A 4S2KA 3V5MA 1K6SA 4MNRA 5EOEA 4N9KA 3PBTA 3OPHA 2HDQA 3MKFA 1NXYA 1PYYA 3ZVWA 4UA7A 4DKIA 1NYYA 1MWSA 5E43A 1K55A 4IVKA 1JWZA 1M40A 1W7FA 3UPPA 4GB7A 3Q1FA 2J9OA 5D3OA 2XDMA 3DW0A 1K4EA 2P74A 4LV0A 3VP4A 3BFEA 3QNBA 1YM1A 3HLFA 5FDHA 5TFQA 1KGGA 1CK3A 5FQIA 5FA7A 1I2WA 3C5AA 1ZC2A 2V1ZA 4C3QA 4U0TA 5F1GA 4UA6A 1ZG4A 5FI7A 1JTDA 5IHVA 2Y2NA 4WBGA 5CTMA 3N8SA 4S2OA 4DE0A 3A3DA 1XA7A 2EXAA 2XQZA 3C7UA 3VFFA 3HVFA 1JWPA 4KZ6A 3WRTA 1WYBA 4A5RA 4DDYA 3GMWA 1WYCA 1J9MA 4JF5A 3B3XA 3E2LA 1RCJA 4LCLA 5FQMA 1ERMA 1ZG6A 1L0GA 1DY6A 2Y2OA 4B4XA 2X71A 2PBYA 1L0EA 3IHAA 2JE5A 3G31A 2X01A 4KZ8A 3MZDA 3PBRA 1LL5A 1FR6A 3M6HA 4GNUA 1NZOA 3UDFA 1Y54A 2XEPA 3HLBA 4OOYA 4C75A 1G6AA 3ZG7B 5KMWA 4EV4A 4R23A 4OP8A 4R1GA 3ZG8B 4DDSA 1IKGA 4DE2A 5KZHA 4YFMA 4BJPA 2DRWA 1MY8A 3NIAA 2R9XA 3G32A 1QMEA 5AQAA 3NDGA 1Q2PA 1NRFA 1KGEA 2ZMAA 2Z2MB 4P85A 5EECA 1PW8A 5TGFA 4GKUA 1W79A 3JYIA 1KDSA 1SKFA 4OPQA 3VFHA 3VSKA 4JXGA 2BLSA 1FSWA 2WK0A 1ES3A 1ZKJA 1E3UD 3A3JA 2H10A 4EBPA 1CEGA 4K0WA 3G34A 3FV7A 5EVIA 1K25A 2HP6A 4PPRA 2XH9A 2WZZA 1W8QA 2R9WA 3GTCA 4Q8IA 3LCEA 2WAEA 3WS5A 2ZJ9A 1K57C 2H0TA 2ZQ9A 4KZ3A 4R4RA 4GD6A 1ES2A 5F82A 3ZG0A 5M19A 3ZVTA 1QMFA 3WS4A 1SDNA 4PM8A 4KQOA 3IH8A 4DF6A 1MPLA 3HUNA 4NETA 2PU2A 3BFGA 1ESUA 1LHYA 1I5QA 1E4DA 1YLWA 5DF8A 3LY4A 3PBNA 4OPRA 4R0QA 2ZC6B 1DJAA 2HDSA 5CTNA 4N1HA 4GD8A 3V3SA 3BLMA 4JF6A 4EWFA 2JBFA 4MBFA 2B5RA 1FCMA 3AGFA 5EPHA 3IXHA 1JVJA 1GHPA 3GV9A 4HBUA 1TDLA 3ITAA 2XFTA 3NBLA 4OPZA 2H5SA 4X53A 1K6RA 2WGIA 1PWCA 2EFXA 3UPOA 1K56A 1NJ4A 1WE4A 2WGWB 3ISGA 4DXCA 3NY4A 3M2KA 3M2JA 5AQ9A 3HUOA 3HREA 5M1AA 4N92A 5E2HA 1YLPA 1G68A 3W4QA 4GDBA 5CGWA 1XGJA 3TG9A 4K0XA 1ONGA 4OPYA 5FAOA 3ZG5A 1E25A 1XPBA 1YLZA 3I7JA 2ZC3B 3N7WA 5AQ7A 3BFFA 4WM9A 4OQHA 1GCEA 2XD1A 2A3UA 3LY3A 4S2NA 5EE8A 4BL2A 3HLDA 3ZDJA 3N6IA 4IBXA 2OSUA 1BZAA 3GRJA 4KZAA 3IF5A 5EUAA 3Q7VA 4U0XA 3UO9A 4B4ZA 4QJGA 4KZ9A 4HESA 5FQQA 1PI4A 4WZ5A 4E3LA 5GLCA 2ZM8A 3N8RA 3V3RA 1GA9A 1NY0A 2EFUA 3O86A 2ZQAA 1NZUA 2V20A 5DF9A 3SOIA 1H8ZA 1IEMA
chains in the Genus database with same CATH superfamily
5GHXA 4GCZA 2JKFA 3HCYA 3BM6A 4RX3A 1EW0A 2J3TC 5DJTA 5FATA 4LGWA 1JNUA 4XXRA 1AXBA 3CMZA 4L9EA 4JGRA 1FIKA 3EOIA 1EROA 4R3JA 2WUQA 3IXBA 4X68A 3IHBA 3HJKA 1BLSA 3LICA 2P9VA 3DTMA 3IF6C 4R70A 4BENA 2RL3A 4QD4A 5FASA 4N9LA 4KQQA 4EW7A 4Y0TA 4L0LA 2JKTI 4P87A 3K3DA 2EXBA 1OT6A 2Y2HA 3RTYA 1VM1A 4PM9A 2J80A 1SCWA 2OLUA 1XFQA 2ZD8A 2CC1A 3MZFA 3FKVA 2IWCA 3QP5A 4U3TA 3V39A 2HDRA 3H7WA 1S67L 2J9PA 3D9YA 3LR5A 4ESPA 3JVUA 5HD3A 3Q7ZA 1LSVA 4M3KA 1H8MA 3N8LA 3T4JA 4MN7A 4PM6A 3EQVA 3A0SA 4LV3A 5EVID 3UY6A 5GLDA 3QNCA 3WS1A 1SDEA 3RXXA 1ERQA 3HLCA 5FSRA 5BOHA 3BJNA 3V67A 3OZHA 3NI9A 4S2JA 2MJ6A 3UB9A 3PAGA 4QU3A 2B18A 2VJWA 3HLWA 5DVAA 4ZAMA 1XGIA 5HAIA 3UE3A 3MBZA 5AVFA 3A3FA 1N4OA 1MKIA 1MBLA 4MDZA 5FAPA 1L3LA 1S4SA 3OCNA 3K3CA 4GN2A 1T1AA 3DTKA 2A24B 3P01A 1ES5A 3OC2A 2Q0OA 4O01A 3IWOA 3W4OA 3UNWA 2QMIA 3T1SA 1IELA 2C6WB 4EQIA 2VZWA 5HL1A 5EOOA 1DJCA 2LB9A 2VLGA 2Y2GA 3VP0A 4ZJ1A 5E2EA 3HBRA 4CLCC 4P6ZS 2JN7A 5L09A 3PAEA 3LR0A 3MZEA 4RVAA 1IKIA 3FKWA 3E98A 1YLJA 2PAVP 2HJ9C 2XFSA 3CI6A 5DTKA 4LPZA 2UV0E 4WEKA 4YWZA 4Q0JA 4S2LA 1G6OA 3O87A 3TOIA 1RGZA 4WELA 2ZBBA 4XUXA 4PHTA 4WYYA 1P9WA 2XGNA 3BWLA 3CJMA 4KQDA 4R38A 1KVLA 4KZ5A 4I3JA 3FC7A 4MBHA 5HWTA 5K5BA 3F1OA 2CMNA 2P9VB 4G3KA 4O7DA 2H28A 5FQJA 1LSXA 4JLFA 3G2YA 3VMAA 1PZOA 4OVDA 4JXWA 4DE1A 3NCKA 4HI4A 1OMEA 4MN6A 5CHUA 2X02A 3ZNTA 2I72A 1FOFA 5EVLA 5CGSA 1M6KA 1YPRA 4EEPA 3OPPA 1S0WA 2PBDP 2Q9NA 4KUOA 4BBVA 3DWZA 1OPXA 5KSCA 5EM0A 2FFFB 4NKPA 2W3FA 3R7WB 5CRFA 4YINA 3F1NA 1K57A 1VHMA 4DN0A 2G2UA 3RXWA 1N9LA 2INWA 3H7WB 3LR3A 5CEDA 3MF0A 3F1PB 1XA1A 1K55C 4EEUA 1HZOA 1X0OA 2Y2PA 4GDNA 3MJQA 2C5WB 3UB5P 3IBRA 2ZC7A 4X56A 1S1YA 4ID4A 3V5MA 2JKRI 1PYYA 3EWKA 2O0YA 3T1RA 2OWHA 4GB7A 1K4EA 2P74A 5FDHA 2XRNA 4NXBA 1I2WA 2ZOHA 1J3WA 1N9OA 4UA6A 2VGLS 5C5KA 4WBGA 5CTMA 1S66L 2P04A 3N8SA 4S2OA 1BYWA 2J3WA 2PR5A 5IT5A 4DDYA 1WYBA 5DFYA 3GMWA 1P9RA 3PR6A 5FQMA 4B4XA 2PBYA 1L0EA 3IHAA 2JE5A 2X01A 4KZ8A 1G28A 3UDFA 4AFIA 4C75A 1H0MA 4EV4A 2W1TB 5KZHA 2ZMVA 2ZOIA 2DRWA 1QMEA 1SKOA 1Q2PA 2ZMAA 5HD5A 5TGFA 4ME4A 1YAXA 3VFHA 2BLSA 2WK0A 5KIZA 4CQHA 2H10A 4EBPA 4MMNA 3G34A 2WZZA 4MN5A 4Q8IA 2WAEA 3WS5A 3W2ZA 5F82A 3F1OB 4GD6A 1MKMA 3ZVTA 1SDNA 4PM8A 4KQOA 3BFGA 3E4QA 4IUKA 1I5QA 3UB6A 1TF1A 2OAP1 1VETB 2B5RA 4HBUA 3ITAA 4X53A 1K56A 5FEFA 3ISGA 4K08A 3HUOA 1G68A 4GDBA 5G4YA 3ZQ5A 4K0XA 4OPYA 3I7JA 2ZC3B 5AQ7A 4HY8A 2XD1A 3LY3A 5EE8A 2OSUA 1BZAA 3F1NB 4NXFA 3K2NA 3Q7VA 4QJGA 4KZ9A 3KSFA 5GLCA 4E3LA 1NY0A 1NZUA 3BW6A 3LGOA 1IEMA 5CXWA 4BL3A 3CAXA 3MSHA 1LI0A 5CHMA 4L9GA 1D7EA 2VX8A 5DTSA 1TS8A 2HDUA 4E3IA 1GSWA 3MFXA 4S2IA 5IU1A 5F5YA 4DE3A 1XJ6A 4IUHA 4BD1A 3E0YA 1XP4A 1Z6FA 3HLGA 4LLOB 1H5XA 4LRZE 3NULA 3LIEA 1DP6A 4CLCA 3P98A 1V9ZA 5A92A 2HZ5A 4LCMA 3TSGA 3BEBA 1HD8A 1E3UA 5TR7A 3OBFA 4OOMA 1RP5A 2UWXA 2Y4AA 3ZGAB 4XUZA 4UAAA 1K0KA 4KG6A 3GQZA 2W3EA 2J3TD 1VEUB 2KLIA 1ALQA 1HTZA 3PBSA 5L8MA 3QP2A 1T1BA 3PBOA 4GS9A 5DF7A 5FQKA 3CITA 4FSFA 2WKIA 3V50A 2GX5A 3MKEA 4HBTA 3UE0A 5HAQA 4HH2A 2OWJA 1CI9A 4I3IA 3IX8A 1CEFA 1HVBA 4GW9A 1MXOA 2WZXA 4E6XA 4FH2A 5CHJA 5HPIA 5LBRA 5DTTA 3G30A 2O9AA 5CGXA 5I94A 4JBFA 3IXGA 4BD0A 3D4FA 1BTLA 4R3BA 3OPRA 2WADA 3SZTA 3C38A 2Y79A 1YQSA 1LT0A 2Z2LB 5FEGA 1LSWA 3PBQA 4EETB 4X6TA 1W63M 2FH5A 3IXDA 4UA9A 4QHCA 3SH9A 4B88A 2WKRA 1LLBA 4ZDXA 4RQ9A 1K56D 2DMWA 4BMWA 2A49A 1FQGA 1T19A 3OCLA 4OLGA 4WMCD 2WKPA 3DTEA 3KYZA 5CECA 4EUVA 4H6JA 5AJGA 4IHQA 2EWWA 1PI5A 3SH7A 4KG2A 3Q7VB 4YNRA 4EUZA 1BT5A 3MXSA 5TBMA 4EU0A 3ZHHA 1Y4OA 4S2MA 2WAFA 3LEQA 4HJ6A 1YLTA 2V0UA 4ETZA 2EX8A 2Q9MA 4PM5A 4UQIS 2ZMFA 3H82A 2J7VA 3NC8A 4HJ4A 3ZG9B 4Y7PA 2O99A 3R4KA 3B42A 1BLPA 2VGKA 4FH4A 1MZUA 1F9IA 1K38A 3IT9A 2OV5A 3GVBA 1YSPA 4D2OA 3BQAA 2Y2LA 1ES4A 2PYRA 3HL9A 3DBAA 4H8RA 1GSVA 3S7QA 4QB8A 1BLCA 5F1FA 4X55A 4EERA 5F83A 4Q0IA 3KYEA 3L9KA 3SW1A 1BLHA 3NJAA 2VV7A 2WGWA 3ICYA 2O9BA 2IWBA 3WS0A 2K7SA 5EVIB 5A91A 4JGOA 3U4LP 4E3OA 2Y2KA 3P7NA 4NXEA 3S7OA 2WYXA 1IYSA 5M18A 2QHKA 3E2KA 2PD7A 2DCFA 1K4FA 4MCWA 4DRTA 1L0DA 2WKQA 2XLNA 1IYPA 2EX2A 1RGYA 2QPNA 2V9AA 3IQAA 2EA9A 3VOYA 5FI6A 1FR1A 3S4XA 4M4XA 3W8KA 2V8FA 1XX2A 4EBLA 1JTGA 3G2ZA 5HX9A 3CLOA 1N9NA 3PBTA 1UWPX 2HDQA 4UA7A 4DKIA 1NYYA 1CJFA 1XJ2A 4IVKA 1W63Q 3UB8A 2J9OA 2XDMA 1DP8A 1GSXA 2Y8HA 5J7EA 3QNBA 3HLFA 2O9CA 5TFQA 3RFBA 1CK3A 1UGUA 5FA7A 3C5AA 4O0PA 4YOFA 5HZHA 1OJ5A 4C3QA 5FI7A 1JTDA 3A3DA 3LR4A 1XA7A 2XQZA 3HVFA 1JWPA 4A5RA 4II7A 4JF5A 4LCLA 1ZG6A 4HP9A 3MZDA 2BTFP 2YKFA 3M6HA 1NZOA 1ZTUA 2AVXA 3CPTA 5KMWA 4R23A 2LB5A 4OP8A 1IKGA 4DE2A 2XA7M 3IS2A 1SZVA 2R9XA 3G32A 1XJ3A 1IFQA 4P85A 3H82B 1W79A 3VSKA 2JKGA 5J4EA 2I9VA 1CEGA 4K0WA 3FV7A 2XH9A 3GTCA 3FG8A 4FUWA 4ARZA 2H0TA 1YSQA 2ZQ9A 1ES2A 5M19A 3WS4A 5F68A 1MPLA 2PU2A 1ESUA 1LHYA 3UB7A 3S7NA 1YLWA 2V1BA 1DJAA 2HDSA 5CTNA 3QP4A 4JF6A 4EWFA 2JBFA 4NXGA 1FCMA 3AGFA 4R3AA 3NBLA 1K6RA 1PWCA 3CHWP 1NJ4A 1WE4A 2WGWB 4I39A 2OOLA 1YLPA 1XGJA 3IX4A 3N7WA 3BFFA 2A3UA 3ZDJA 3N6IA 4HP4A 3GRJA 4KZAA 5EUAA 4G3WA 4B4ZA 4HOIA 5FQQA 1PI4A 4FOFA 3T1QB 2ZM8A 3O86A 4PKYA 2GJ3A 2V20A 4Y5FA 4NG2A 1H8ZA 1DP9A 3QP8A 2PU4A 3IWQA 5I5LA 3G35A 3FPVA 4Y0OA 2VK3A 1F2KA 5FQ9A 1F5MA 2J8YA 3CWFA 3VP1A 1O07A 3HUMA 3ITBA 4JF4A 4WN5A 3KYQA 2FZ0A 2D01A 1PW1A 3SS5A 4XT2A 4BWIA 4IJGA 3ZFZA 1ODVA 3BY9A 2Y91A 3SS4A 4KZBA 3LIAA 2ZQ7A 1W8YA 1NYMA 1LL9A 3E4PA 1IYOA 2JKTM 4X1LA 4PAUA 3NECA 5FAQA 3L7HA 2HF6A 3IF6A 3WS2A 3EEHA 4ZJ3A 2XR0A 3W4PA 3N4IA 4R6LA 4ZRRA 2W3HA 5F6AA 3NOTC 1Y28A 5GLAA 1XXMA 2Y2JA 4JXVA 4OQGA 5J3WA 1ACFA 1PRQA 3M6BA 5L10A 1FSYA 1V9YA 3IS2B 3SS3A 1G5UA 2W3DA 3TE8A 4GHIA 2V2FF 3CZDA 3ULFA 2QZ6A 4GZBA 2Y2QA 4OP5A 3DAVA 4ARZB 1KE3A 3Q07A 4JXSA 5JYOA 2BASA 5A93A 3UDIA 4F3LA 4MLLA 4X69A 1VQQA 3A3EA 5EVEA 2GZAA 2G7UA 2WKHA 2ZQ8A 4CJNA 1LI9A 3BFCA 3LI8A 4OQIA 4QY6A 2VGJA 1DRMA 2HP5A 3MFDA 3D72A 2OAQ1 1P97A 2Y59A 2Z6DA 3UE1A 3IBJA 5HW3A 3VP3A 3OPLA 3DWKA 1KE4A 3CG5A 3ZNYA 3BFDA 4HQAA 2E8IA 3T4LA 2G2WA 4DXBA 3PXPA 3MMHA 1STZA 4E3MA 3GSGA 4P6BA 2VA0A 2ZC4B 3TJZC 4FD8A 3IWIA 4DJ2A 3LO7A 3IH9A 1Q2QA 3C30A 3VE4A 5DKKA 3NOPC 1OTBA 1JWVA 2H0YA 4ZJ2A 4F94A 3D3OA 3A3IA 1L2SA 2QJ5A 4OOLA 4RYEA 2ACGA 3P09A 1TS6A 4E3KA 5JYPA 4BQMA 3WRZA 1I2SA 3FYZA 2ZQCA 3KX0X 1ESIA 1KVMA 4JPMA 3FPWA 1KDWA 5GLBA 5HFOA 2JCHA 3LEZA 5FDSA 4WZ4A 1GA0A 3C4OA 1SKOB 3IX3A 5IS1A 3IF6B 1TVFA 1K54C 2VEAA 4ZBEA 2V0WA 4Y0UA 2W0NA 5GL9A 4MEZA 3AGDA 2OLVA 4JKTA 4JGQA 3C8CA 3TW8A 2QJ7A 3AGEA 5HARA 3MS6A 3RH8B 5F69A 4NK3A 4RA7A 2XF3A 2E8JA 3BECA 4RX2A 2Y2IA 4OH0A 1MC0A 3MR0A 5J8XA 4K91A 1KGFA 2VGLM 3FWLA 4LENA 2L1MA 4LRYC 1XJ4A 3A0VA 1T1CA 2YKHA 1U60A 4E3JA 2A24A 1PNEA 2EX6A 5CEBA 1H8YA 1PFLA 5L2FA 2PRFA 5KSHA 2ZL1A 3S1YA 1TEMA 3SH8A 4S2KA 1FILA 1OT9A 1LL8A 4N9KA 2JKRM 3ZVWA 1NXYA 2P7JA 1K55A 1M40A 1W7FA 5D3OA 3DW0A 3BFEA 1IOUA 1YM1A 3E4OA 1ZC2A 4GJ4A 4BBUA 4PKYG 5F1GA 2Y2NA 1OTDA 3WRTA 1OTAA 2QYBA 5HL6A 1P0ZA 3E2LA 1RCJA 4Y15A 2X71A 5DFXA 3PBRA 1LL5A 1FR6A 4GNUA 1NRJA 1Y54A 2XEPA 2QWSA 1G6AA 4KUKA 3ZG7B 4R1GA 3ZG8B 4DDSA 4YFMA 1CQAA 4BJPA 3TRCA 1WA9A 1MY8A 1NWZA 1NRFA 2K2NA 5EECA 1PW8A 4GKUA 4UEYA 4CLCB 4CLCD 4OPQA 1ES3A 1NLYA 2NUPC 1E3UD 1K25A 1W8QA 2R9WA 3UE6A 3R7WA 2ZJ9A 2PT7A 4LFUA 4R4RA 2NUTC 1QMFA 4DF6A 3IH8A 5L07A 3HUNA 4NETA 3CUEC 3LY4A 4OPRA 4GS9B 3JVVA 2ZC6B 1VB6A 4LRXC 3F1PA 4WL9A 5EPHA 1JVJA 1GHPA 3GV9A 1TDLA 2XFTA 3QP1A 3UPOA 5HDCA 2L4RA 4DXCA 3NY4A 3MQQA 5AQ9A 3HREA 3OLOA 1F98A 4N92A 5E2HA 1KOUA 5FAOA 1ONGA 1E25A 4WM9A 4OQHA 5HSQA 4BL2A 4WLAA 3IF5A 3GECA 4Y3IA 3UO9A 3LIDA 3T12B 2VV8A 4HESA 3N8RA 2EFUA 2PYPA 2KDKA 3GDIA 5DF9A 5EV0A 2HJEA 1GHMA 5EM1A 3H9WA 1D1JA 2R78A 5CERA 1YMXA 2ZL1B 4IVIA 4KQRA 5HAPA 1O7EA 3BRMA 3BLSA 5AVEA 3HJIA 5A90A 2EX9A 2ZLYA 5GHYA 1W5DA 2FFYA 3UMDA 3BYDA 4Y17A 3UMEA 2GDNA 4H6JB 2W1TA 2WGVA 3A0RA 4LV1A 5A8BA 4E6WA 5TBMB 4B93A 1EI5A 3BY8A 2V8CA 4WF0A 4IEDA 4MBKA 2XSSA 1H3QA 3MQ0A 5EVIC 4QY5A 3ZCZA 4EQ1A 4KZ7A 1AWIA 2D02A 3O88A 4OQ0A 1CI8A 5E2GA 5HPFA 3WWXA 3VSLA 1PWDA 1S1ZA 3O5YA 2WKEA 3T4SA 4PMAA 3C2WA 3UN7A 1GHIA 2XD5A 1VETA 4CPKA 3VE3A 1NLZA 2IWDA 2PD8A 4GOGA 3MXQA 2HV1A 4FCFA 3C7VA 1XFNA 2A2LA 3PTEA 4WEJA 3U2AA 4S2NC 4KENB 1SHVA 1PZPA 2BG1A 1N9BA 1TD5A 4OONA 4FTXA 1K54A 1YT4A 4C6YA 3BQ8A 4OKPA 3LYXA 1UWNX 4Z9QA 4WZ5C 5CX7A 1MWRA 4KG5A 3GR2A 1YLYA 1D06A 5GHZA 4N1XA 1C3BA 4PM7A 4UQIM 1XKZA 1MWUA 1FCNA 1BULA 5E2FA 3EQUA 3OOVA 4I3AA 1L0FA 3EEAA 4ZTKA 1S4RA 3Q81A 4X25A 4OLDA 4E3NA 3HLEA 2HPBA 5HWWA 3VP2A 4IBRA 3T4QA 2Y55A 2ZM2A 1ONHA 4BLMA 4S2PA 5FI2A 5G18A 3T4OA 2HP9A 2B95A 1S6RA 2PR6A 2KX6A 4UHUA 5TJJA 5DJUA 1OTIA 1MWTA 3G6OA 1A0KA 2PHYA 4BBTA 3T1XA 4ETXA 3LFVA 4LV2A 3UDXA 5HWVA 1IYQA 5HDDA 1CF0A 5U47A 3NDEA 3G4PA 3QHYA 4I5SA 4HEFA 1VEUA 4KZ4A 3MQOA 3VOZA 3Q82A 1EWZA 3LIFA 1DJBA 1PWGA 2DNSA 1TS7A 4Y2FA 1YMSA 2HGVA 2QKPA 2P08A 2XK1A 3CPTB 1FCOA 2EWVA 3MXRA 2KOIA 3NHQA 3FZCA 4HHDA 5DKLA 3VV4A 4P0MA 4EBNA 3C4PA 1BUEA 2JC7A 1OTEA 2ZQDA 2RCXA 3JPUA 3UPNA 3S22A 2Y2MA 4HJ3A 4B9OA 1TDGA 3O3VA 3LI9A 4R4SA 1PIOA 1KE0A 4HH3A 4P6ZM 3CUEA 3B47A 5AQBA 3T4TA 3RJUA 2ZC5B 1BSGA 2ZM0A 4WMCA 2VKSA 5FL3A 3NOUC 2M1CA 1K6SA 4MNRA 5EOEA 3OPHA 3MKFA 2GNXA 1MWSA 5E43A 1JWZA 3LUQA 3UPPA 4EXOA 3T50A 3Q1FA 2K31A 1T18A 4LV0A 4I38A 3VP4A 1KGGA 5FQIA 2V1ZA 3ZYTA 4U0TA 3KO6A 1ZG4A 4DMZA 5IHVA 4DE0A 4DJ3A 5EFWA 2EXAA 3VOLA 3C7UA 3VFFA 3EGXC 4KZ6A 2PDRA 5HDSA 1WYCA 1J9MA 3B3XA 1L0GA 1ERMA 4QPRA 1DY6A 2Y2OA 3G31A 1HLUP 4X1MA 3PHYA 1ZHHB 4D60A 5MC7A 2XROA 4G3VA 4OOYA 3HLBA 4JGPA 4XT2B 4WUJA 4GLQA 3NIAA 2V1AA 1Z09A 3DTIA 5AQAA 2M7VA 3NDGA 1KGEA 2Z2MB 3LIBA 4HNBA 3JYIA 1KDSA 1SKFA 4EESA 4JXGA 1FSWA 1OJGA 1ZKJA 2VV6A 2IA2A 3A3JA 4Q0HA 5G4ZA 4HIAA 5EVIA 2HP6A 4PPRA 3LCEA 1K57C 4NEED 4KZ3A 3ZG0A 2W3GA 4E04A 3KSHA 1E4DA 5DF8A 3PBNA 4R0QA 4N1HA 4GD8A 3V3SA 3BLMA 2B02A 4MBFA 2W1RA 2XA7S 3IXHA 3PYPA 1YKDA 4OPZA 2H5SA 4GHIB 2WGIA 2JHEA 3KSIA 2M7UA 2EFXA 3QP6A 2L0WA 3M2KA 3M2JA 5M1AA 1TS0A 4Y13A 3W4QA 5CGWA 2Z6CA 3TG9A 3ZG5A 1XPBA 1YLZA 2W27A 1GCEA 4S2NA 3HLDA 4O8GA 4QWOA 3EGDC 4IBXA 4L9FA 4Z1WA 4U0XA 3S7PA 3B33A 3T4KA 4F3LB 4WZ5A 3V3RA 1GA9A 2ZQAA 3KSGA 3SOIA 4CLCE
chains in the Genus database with same CATH topology
5GHXA 1GHMA 2PU4A 5CERA 5CXWA 3IWQA 3BM6A 4RX3A 1YMXA 4BL3A 3G35A 1LI0A 4Y0OA 5FATA 5CHMA 4IVIA 4XXRA 4KQRA 5HAPA 1AXBA 1O7EA 3BRMA 5DTSA 3BLSA 3CMZA 5FQ9A 5A90A 2J8YA 2EX9A 2HDUA 2ZLYA 3VP1A 1O07A 3HUMA 4E3IA 1EROA 5GHYA 1W5DA 3ITBA 2FFYA 4R3JA 4JF4A 3BYDA 2WUQA 4S2IA 2GDNA 1PW1A 3SS5A 3IXBA 4X68A 4DE3A 3IHBA 1BLSA 2WGVA 4BD1A 2P9VA 1XP4A 4LV1A 3ZFZA 1Z6FA 3DTMA 3IF6C 4BENA 3HLGA 2Y91A 3SS4A 2RL3A 4QD4A 5FASA 1H5XA 4E6WA 4N9LA 4KZBA 4KQQA 1EI5A 2ZQ7A 4Y0TA 1W8YA 1NYMA 4L0LA 1LL9A 3P98A 1IYOA 4IEDA 4MBKA 5A92A 4LCMA 4P87A 5EVIC 3TSGA 3BEBA 4QY5A 1HD8A 3ZCZA 1E3UA 2EXBA 4KZ7A 5FAQA 3WS2A 2Y2HA 3IF6A 5TR7A 3O88A 4ZJ3A 4OQ0A 4OOMA 1RP5A 2XR0A 1CI8A 3W4PA 3N4IA 1VM1A 2UWXA 2Y4AA 5E2GA 3ZGAB 4PM9A 4XUZA 4UAAA 4KG6A 1SCWA 3GQZA 3WWXA 3VSLA 2OLUA 1XXMA 5GLAA 2Y2JA 1ALQA 1PWDA 1HTZA 3PBSA 4JXVA 4OQGA 2ZD8A 2CC1A 2WKEA 3MZFA 3PBOA 4PMAA 5DF7A 3FKVA 3UN7A 5FQKA 2IWCA 1GHIA 4FSFA 3M6BA 2XD5A 2WKIA 3V50A 3MKEA 3UE0A 1FSYA 4HBTA 4CPKA 5HAQA 2IWDA 4U3TA 3SS3A 3V39A 4GOGA 1CI9A 2HDRA 4FCFA 2J9PA 1CEFA 1HVBA 2V2FF 1MXOA 3C7VA 3CZDA 3Q7ZA 2WZXA 4E6XA 2QZ6A 4M3KA 4FH2A 5CHJA 3N8LA 3PTEA 4WEJA 4GZBA 4PM6A 2Y2QA 3EQVA 5DTTA 3G30A 4S2NC 4KENB 1SHVA 4OP5A 1PZPA 5CGXA 2BG1A 4JBFA 1N9BA 3IXGA 4LV3A 4OONA 5EVID 5GLDA 3UY6A 3QNCA 4BD0A 3WS1A 1SDEA 3D4FA 3RXXA 1ERQA 1K54A 1BTLA 1YT4A 3HLCA 4R3BA 3OPRA 5FSRA 4C6YA 5BOHA 3OZHA 1KE3A 4OKPA 3NI9A 2WADA 3Q07A 4Z9QA 4WZ5C 4S2JA 4JXSA 5JYOA 3PAGA 1YQSA 4QU3A 3HLWA 5DVAA 1MWRA 4ZAMA 4KG5A 3GR2A 3UDIA 5A93A 1XGIA 1YLYA 2Z2LB 4MLLA 4X69A 5HAIA 1VQQA 3UE3A 3A3EA 3MBZA 3PBQA 5GHZA 4N1XA 4X6TA 1C3BA 3IXDA 2WKHA 3A3FA 4UA9A 2ZQ8A 1N4OA 1MKIA 1LI9A 4PM7A 4QHCA 3SH9A 4CJNA 3BFCA 1MBLA 1XKZA 4B88A 1MWUA 1LLBA 4OQIA 1FCNA 4QY6A 2VGJA 1BULA 5E2FA 5FAPA 4ZDXA 2HP5A 3EQUA 3MFDA 3OCNA 1K56D 1L0FA 4GN2A 3UE1A 2Y59A 4ZTKA 2A49A 3Q81A 1ES5A 3OC2A 5HW3A 1FQGA 4OLDA 4E3NA 3VP3A 3OCLA 3IWOA 3OPLA 3UNWA 3W4OA 3HLEA 3DWKA 1KE4A 3CG5A 2HPBA 2QMIA 4OLGA 3ZNYA 3VP2A 4WMCD 1IELA 2C6WB 3BFDA 4IBRA 2Y55A 4EQIA 2ZM2A 5CECA 2E8IA 1ONHA 4BLMA 4S2PA 5FI2A 5G18A 2G2WA 5EOOA 1DJCA 5HL1A 4DXBA 1PI5A 2Y2GA 3SH7A 3VP0A 4KG2A 3Q7VB 2HP9A 1S6RA 4E3MA 4EUZA 4UHUA 4ZJ1A 5E2EA 1BT5A 3HBRA 3GSGA 3MXSA 4P6BA 3ZHHA 2ZC4B 1MWTA 4FD8A 2WAFA 4S2MA 3PAEA 3MZEA 4RVAA 3IWIA 1IKIA 3FKWA 1YLTA 1YLJA 3LO7A 3IH9A 1Q2QA 2XFSA 2EX8A 2Q9MA 4PM5A 5DTKA 4LV2A 4WEKA 3UDXA 2J7VA 1IYQA 3NC8A 4S2LA 3ZG9B 3O87A 3TOIA 5U47A 1RGZA 4WELA 4Y7PA 3NDEA 4XUXA 1BLPA 1JWVA 2H0YA 3G4PA 3QHYA 4HEFA 4ZJ2A 4F94A 4KZ4A 4WYYA 3VOZA 2VGKA 2XGNA 4FH4A 3A3IA 1L2SA 3Q82A 1EWZA 3CJMA 4OOLA 4RYEA 1KVLA 4KZ5A 3P09A 1DJBA 1PWGA 1K38A 3IT9A 4MBHA 4E3KA 2DNSA 2OV5A 4BQMA 3GVBA 1YMSA 3WRZA 5JYPA 1I2SA 3FYZA 2ZQCA 4D2OA 2P9VB 4O7DA 1ESIA 2XK1A 5FQJA 1KVMA 4JPMA 4JLFA 2Y2LA 1FCOA 1KDWA 1ES4A 3G2YA 5GLBA 5HFOA 3MXRA 3VMAA 3HL9A 1PZOA 4OVDA 4H8RA 4JXWA 2JCHA 3LEZA 4QB8A 4DE1A 4WZ4A 1BLCA 3FZCA 1GA0A 3NCKA 1OMEA 5F1FA 5CHUA 4X55A 2X02A 3C4OA 3ZNTA 4P0MA 2I72A 5F83A 1FOFA 5EVLA 4EBNA 5CGSA 3IF6B 1TVFA 1K54C 1M6KA 1BLHA 3C4PA 1BUEA 2JC7A 2ZQDA 2RCXA 2WGWA 4ZBEA 3S22A 3UPNA 3OPPA 4Y0UA 2IWBA 3WS0A 1S0WA 2Y2MA 5GL9A 2Q9NA 4MEZA 3AGDA 2OLVA 4JKTA 3DWZA 5EVIB 5A91A 1TDGA 5KSCA 3O3VA 2FFFB 3AGEA 4E3OA 2Y2KA 5HARA 4NK3A 5CRFA 2WYXA 1IYSA 4RA7A 5M18A 4R4SA 4YINA 5I94A 3E2KA 2XF3A 2DCFA 1K4FA 1PIOA 1K57A 4DRTA 1L0DA 3BECA 4RX2A 1KE0A 2Y2IA 2G2UA 3RXWA 2XLNA 1IYPA 2EX2A 1RGYA 2QPNA 3IQAA 4OH0A 5J8XA 4K91A 3VOYA 1KGFA 4LENA 3FWLA 5FI6A 5CEDA 1FR1A 1XA1A 3S4XA 3W8KA 1U60A 1XX2A 1K55C 5AQBA 3RJUA 4E3JA 2EX6A 1HZOA 4EBLA 2Y2PA 5CEBA 1JTGA 1H8YA 4GDNA 5L2FA 3G2ZA 2C5WB 2ZC5B 1BSGA 2ZM0A 5KSHA 4WMCA 5HX9A 2ZC7A 4X56A 3S1YA 1TEMA 4ID4A 3SH8A 4S2KA 3V5MA 1K6SA 4MNRA 5EOEA 4N9KA 3PBTA 3OPHA 2HDQA 3MKFA 1NXYA 1PYYA 3ZVWA 4UA7A 4DKIA 1NYYA 1MWSA 5E43A 1K55A 4IVKA 1JWZA 1M40A 1W7FA 3UPPA 4GB7A 3Q1FA 2J9OA 5D3OA 2XDMA 3DW0A 1K4EA 2P74A 4LV0A 3VP4A 3BFEA 3QNBA 1YM1A 3HLFA 5FDHA 5TFQA 1KGGA 1CK3A 5FQIA 5FA7A 1I2WA 3C5AA 1ZC2A 2V1ZA 4C3QA 4U0TA 5F1GA 4UA6A 1ZG4A 5FI7A 1JTDA 5IHVA 2Y2NA 4WBGA 5CTMA 3N8SA 4S2OA 4DE0A 3A3DA 1XA7A 2EXAA 2XQZA 3C7UA 3VFFA 3HVFA 1JWPA 4KZ6A 3WRTA 1WYBA 4A5RA 4DDYA 3GMWA 1WYCA 1J9MA 4JF5A 3B3XA 3E2LA 1RCJA 4LCLA 5FQMA 1ERMA 1ZG6A 1L0GA 1DY6A 2Y2OA 4B4XA 2X71A 2PBYA 1L0EA 3IHAA 2JE5A 3G31A 2X01A 4KZ8A 3MZDA 3PBRA 1LL5A 1FR6A 3M6HA 4GNUA 1NZOA 3UDFA 1Y54A 2XEPA 3HLBA 4OOYA 4C75A 1G6AA 3ZG7B 5KMWA 4EV4A 4R23A 4OP8A 4R1GA 3ZG8B 4DDSA 1IKGA 4DE2A 5KZHA 4YFMA 4BJPA 2DRWA 1MY8A 3NIAA 2R9XA 3G32A 1QMEA 5AQAA 3NDGA 1Q2PA 1NRFA 1KGEA 2ZMAA 2Z2MB 4P85A 5EECA 1PW8A 5TGFA 4GKUA 1W79A 3JYIA 1KDSA 1SKFA 4OPQA 3VFHA 3VSKA 4JXGA 2BLSA 1FSWA 2WK0A 1ES3A 1ZKJA 1E3UD 3A3JA 2H10A 4EBPA 1CEGA 4K0WA 3G34A 3FV7A 5EVIA 1K25A 2HP6A 4PPRA 2XH9A 2WZZA 1W8QA 2R9WA 3GTCA 4Q8IA 3LCEA 2WAEA 3WS5A 2ZJ9A 1K57C 2H0TA 2ZQ9A 4KZ3A 4R4RA 4GD6A 1ES2A 5F82A 3ZG0A 5M19A 3ZVTA 1QMFA 3WS4A 1SDNA 4PM8A 4KQOA 3IH8A 4DF6A 1MPLA 3HUNA 4NETA 2PU2A 3BFGA 1ESUA 1LHYA 1I5QA 1E4DA 1YLWA 5DF8A 3LY4A 3PBNA 4OPRA 4R0QA 2ZC6B 1DJAA 2HDSA 5CTNA 4N1HA 4GD8A 3V3SA 3BLMA 4JF6A 4EWFA 2JBFA 4MBFA 2B5RA 1FCMA 3AGFA 5EPHA 3IXHA 1JVJA 1GHPA 3GV9A 4HBUA 1TDLA 3ITAA 2XFTA 3NBLA 4OPZA 2H5SA 4X53A 1K6RA 2WGIA 1PWCA 2EFXA 3UPOA 1K56A 1NJ4A 1WE4A 2WGWB 3ISGA 4DXCA 3NY4A 3M2KA 3M2JA 5AQ9A 3HUOA 3HREA 5M1AA 4N92A 5E2HA 1YLPA 1G68A 3W4QA 4GDBA 5CGWA 1XGJA 3TG9A 4K0XA 1ONGA 4OPYA 5FAOA 3ZG5A 1E25A 1XPBA 1YLZA 3I7JA 2ZC3B 3N7WA 5AQ7A 3BFFA 4WM9A 4OQHA 1GCEA 2XD1A 2A3UA 3LY3A 4S2NA 5EE8A 4BL2A 3HLDA 3ZDJA 3N6IA 4IBXA 2OSUA 1BZAA 3GRJA 4KZAA 3IF5A 5EUAA 3Q7VA 4U0XA 3UO9A 4B4ZA 4QJGA 4KZ9A 4HESA 5FQQA 1PI4A 4WZ5A 4E3LA 5GLCA 2ZM8A 3N8RA 3V3RA 1GA9A 1NY0A 2EFUA 3O86A 2ZQAA 1NZUA 2V20A 5DF9A 3SOIA 1H8ZA 1IEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GHX A;  1GHM A;  2PU4 A;  5CER A;  5CXW A;  3IWQ A;  3BM6 A;  4RX3 A;  1YMX A;  4BL3 A;  3G35 A;  1LI0 A;  4Y0O A;  5FAT A;  5CHM A;  4IVI A;  4XXR A;  4KQR A;  5HAP A;  1AXB A;  1O7E A;  3BRM A;  5DTS A;  3BLS A;  3CMZ A;  5FQ9 A;  5A90 A;  2J8Y A;  2EX9 A;  2HDU A;  2ZLY A;  3VP1 A;  1O07 A;  3HUM A;  4E3I A;  1ERO A;  5GHY A;  1W5D A;  3ITB A;  2FFY A;  4R3J A;  4JF4 A;  3BYD A;  2WUQ A;  4S2I A;  2GDN A;  1PW1 A;  3SS5 A;  3IXB A;  4X68 A;  4DE3 A;  3IHB A;  1BLS A;  2WGV A;  4BD1 A;  2P9V A;  1XP4 A;  4LV1 A;  3ZFZ A;  1Z6F A;  3DTM A;  3IF6 C;  4BEN A;  3HLG A;  2Y91 A;  3SS4 A;  2RL3 A;  4QD4 A;  5FAS A;  1H5X A;  4E6W A;  4N9L A;  4KZB A;  4KQQ A;  1EI5 A;  2ZQ7 A;  4Y0T A;  1W8Y A;  1NYM A;  4L0L A;  1LL9 A;  3P98 A;  1IYO A;  4IED A;  4MBK A;  5A92 A;  4LCM A;  4P87 A;  5EVI C;  3TSG A;  3BEB A;  4QY5 A;  1HD8 A;  3ZCZ A;  1E3U A;  2EXB A;  4KZ7 A;  5FAQ A;  3WS2 A;  2Y2H A;  3IF6 A;  5TR7 A;  3O88 A;  4ZJ3 A;  4OQ0 A;  4OOM A;  1RP5 A;  2XR0 A;  1CI8 A;  3W4P A;  3N4I A;  1VM1 A;  2UWX A;  2Y4A A;  5E2G A;  3ZGA B;  4PM9 A;  4XUZ A;  4UAA A;  4KG6 A;  1SCW A;  3GQZ A;  3WWX A;  3VSL A;  2OLU A;  1XXM A;  5GLA A;  2Y2J A;  1ALQ A;  1PWD A;  1HTZ A;  3PBS A;  4JXV A;  4OQG A;  2ZD8 A;  2CC1 A;  2WKE A;  3MZF A;  3PBO A;  4PMA A;  5DF7 A;  3FKV A;  3UN7 A;  5FQK A;  2IWC A;  1GHI A;  4FSF A;  3M6B A;  2XD5 A;  2WKI A;  3V50 A;  3MKE A;  3UE0 A;  1FSY A;  4HBT A;  4CPK A;  5HAQ A;  2IWD A;  4U3T A;  3SS3 A;  3V39 A;  4GOG A;  1CI9 A;  2HDR A;  4FCF A;  2J9P A;  1CEF A;  1HVB A;  2V2F F;  1MXO A;  3C7V A;  3CZD A;  3Q7Z A;  2WZX A;  4E6X A;  2QZ6 A;  4M3K A;  4FH2 A;  5CHJ A;  3N8L A;  3PTE A;  4WEJ A;  4GZB A;  4PM6 A;  2Y2Q A;  3EQV A;  5DTT A;  3G30 A;  4S2N C;  4KEN B;  1SHV A;  4OP5 A;  1PZP A;  5CGX A;  2BG1 A;  4JBF A;  1N9B A;  3IXG A;  4LV3 A;  4OON A;  5EVI D;  5GLD A;  3UY6 A;  3QNC A;  4BD0 A;  3WS1 A;  1SDE A;  3D4F A;  3RXX A;  1ERQ A;  1K54 A;  1BTL A;  1YT4 A;  3HLC A;  4R3B A;  3OPR A;  5FSR A;  4C6Y A;  5BOH A;  3OZH A;  1KE3 A;  4OKP A;  3NI9 A;  2WAD A;  3Q07 A;  4Z9Q A;  4WZ5 C;  4S2J A;  4JXS A;  5JYO A;  3PAG A;  1YQS A;  4QU3 A;  3HLW A;  5DVA A;  1MWR A;  4ZAM A;  4KG5 A;  3GR2 A;  3UDI A;  5A93 A;  1XGI A;  1YLY A;  2Z2L B;  4MLL A;  4X69 A;  5HAI A;  1VQQ A;  3UE3 A;  3A3E A;  3MBZ A;  3PBQ A;  5GHZ A;  4N1X A;  4X6T A;  1C3B A;  3IXD A;  2WKH A;  3A3F A;  4UA9 A;  2ZQ8 A;  1N4O A;  1MKI A;  1LI9 A;  4PM7 A;  4QHC A;  3SH9 A;  4CJN A;  3BFC A;  1MBL A;  1XKZ A;  4B88 A;  1MWU A;  1LLB A;  4OQI A;  1FCN A;  4QY6 A;  2VGJ A;  1BUL A;  5E2F A;  5FAP A;  4ZDX A;  2HP5 A;  3EQU A;  3MFD A;  3OCN A;  1K56 D;  1L0F A;  4GN2 A;  3UE1 A;  2Y59 A;  4ZTK A;  2A49 A;  3Q81 A;  1ES5 A;  3OC2 A;  5HW3 A;  1FQG A;  4OLD A;  4E3N A;  3VP3 A;  3OCL A;  3IWO A;  3OPL A;  3UNW A;  3W4O A;  3HLE A;  3DWK A;  1KE4 A;  3CG5 A;  2HPB A;  2QMI A;  4OLG A;  3ZNY A;  3VP2 A;  4WMC D;  1IEL A;  2C6W B;  3BFD A;  4IBR A;  2Y55 A;  4EQI A;  2ZM2 A;  5CEC A;  2E8I A;  1ONH A;  4BLM A;  4S2P A;  5FI2 A;  5G18 A;  2G2W A;  5EOO A;  1DJC A;  5HL1 A;  4DXB A;  1PI5 A;  2Y2G A;  3SH7 A;  3VP0 A;  4KG2 A;  3Q7V B;  2HP9 A;  1S6R A;  4E3M A;  4EUZ A;  4UHU A;  4ZJ1 A;  5E2E A;  1BT5 A;  3HBR A;  3GSG A;  3MXS A;  4P6B A;  3ZHH A;  2ZC4 B;  1MWT A;  4FD8 A;  2WAF A;  4S2M A;  3PAE A;  3MZE A;  4RVA A;  3IWI A;  1IKI A;  3FKW A;  1YLT A;  1YLJ A;  3LO7 A;  3IH9 A;  1Q2Q A;  2XFS A;  2EX8 A;  2Q9M A;  4PM5 A;  5DTK A;  4LV2 A;  4WEK A;  3UDX A;  2J7V A;  1IYQ A;  3NC8 A;  4S2L A;  3ZG9 B;  3O87 A;  3TOI A;  5U47 A;  1RGZ A;  4WEL A;  4Y7P A;  3NDE A;  4XUX A;  1BLP A;  1JWV A;  2H0Y A;  3G4P A;  3QHY A;  4HEF A;  4ZJ2 A;  4F94 A;  4KZ4 A;  4WYY A;  3VOZ A;  2VGK A;  2XGN A;  4FH4 A;  3A3I A;  1L2S A;  3Q82 A;  1EWZ A;  3CJM A;  4OOL A;  4RYE A;  1KVL A;  4KZ5 A;  3P09 A;  1DJB A;  1PWG A;  1K38 A;  3IT9 A;  4MBH A;  4E3K A;  2DNS A;  2OV5 A;  4BQM A;  3GVB A;  1YMS A;  3WRZ A;  5JYP A;  1I2S A;  3FYZ A;  2ZQC A;  4D2O A;  2P9V B;  4O7D A;  1ESI A;  2XK1 A;  5FQJ A;  1KVM A;  4JPM A;  4JLF A;  2Y2L A;  1FCO A;  1KDW A;  1ES4 A;  3G2Y A;  5GLB A;  5HFO A;  3MXR A;  3VMA A;  3HL9 A;  1PZO A;  4OVD A;  4H8R A;  4JXW A;  2JCH A;  3LEZ A;  4QB8 A;  4DE1 A;  4WZ4 A;  1BLC A;  3FZC A;  1GA0 A;  3NCK A;  1OME A;  5F1F A;  5CHU A;  4X55 A;  2X02 A;  3C4O A;  3ZNT A;  4P0M A;  2I72 A;  5F83 A;  1FOF A;  5EVL A;  4EBN A;  5CGS A;  3IF6 B;  1TVF A;  1K54 C;  1M6K A;  1BLH A;  3C4P A;  1BUE A;  2JC7 A;  2ZQD A;  2RCX A;  2WGW A;  4ZBE A;  3S22 A;  3UPN A;  3OPP A;  4Y0U A;  2IWB A;  3WS0 A;  1S0W A;  2Y2M A;  5GL9 A;  2Q9N A;  4MEZ A;  3AGD A;  2OLV A;  4JKT A;  3DWZ A;  5EVI B;  5A91 A;  1TDG A;  5KSC A;  3O3V A;  2FFF B;  3AGE A;  4E3O A;  2Y2K A;  5HAR A;  4NK3 A;  5CRF A;  2WYX A;  1IYS A;  4RA7 A;  5M18 A;  4R4S A;  4YIN A;  5I94 A;  3E2K A;  2XF3 A;  2DCF A;  1K4F A;  1PIO A;  1K57 A;  4DRT A;  1L0D A;  3BEC A;  4RX2 A;  1KE0 A;  2Y2I A;  2G2U A;  3RXW A;  2XLN A;  1IYP A;  2EX2 A;  1RGY A;  2QPN A;  3IQA A;  4OH0 A;  5J8X A;  4K91 A;  3VOY A;  1KGF A;  4LEN A;  3FWL A;  5FI6 A;  5CED A;  1FR1 A;  1XA1 A;  3S4X A;  3W8K A;  1U60 A;  1XX2 A;  1K55 C;  5AQB A;  3RJU A;  4E3J A;  2EX6 A;  1HZO A;  4EBL A;  2Y2P A;  5CEB A;  1JTG A;  1H8Y A;  4GDN A;  5L2F A;  3G2Z A;  2C5W B;  2ZC5 B;  1BSG A;  2ZM0 A;  5KSH A;  4WMC A;  5HX9 A;  2ZC7 A;  4X56 A;  3S1Y A;  1TEM A;  4ID4 A;  3SH8 A;  4S2K A;  3V5M A;  1K6S A;  4MNR A;  5EOE A;  4N9K A;  3PBT A;  3OPH A;  2HDQ A;  3MKF A;  1NXY A;  1PYY A;  3ZVW A;  4UA7 A;  4DKI A;  1NYY A;  1MWS A;  5E43 A;  1K55 A;  4IVK A;  1JWZ A;  1M40 A;  1W7F A;  3UPP A;  4GB7 A;  3Q1F A;  2J9O A;  5D3O A;  2XDM A;  3DW0 A;  1K4E A;  2P74 A;  4LV0 A;  3VP4 A;  3BFE A;  3QNB A;  1YM1 A;  3HLF A;  5FDH A;  5TFQ A;  1KGG A;  1CK3 A;  5FQI A;  5FA7 A;  1I2W A;  3C5A A;  1ZC2 A;  2V1Z A;  4C3Q A;  4U0T A;  5F1G A;  4UA6 A;  1ZG4 A;  5FI7 A;  1JTD A;  5IHV A;  2Y2N A;  4WBG A;  5CTM A;  3N8S A;  4S2O A;  4DE0 A;  3A3D A;  1XA7 A;  2EXA A;  2XQZ A;  3C7U A;  3VFF A;  3HVF A;  1JWP A;  4KZ6 A;  3WRT A;  1WYB A;  4A5R A;  4DDY A;  3GMW A;  1WYC A;  1J9M A;  4JF5 A;  3B3X A;  3E2L A;  1RCJ A;  4LCL A;  5FQM A;  1ERM A;  1ZG6 A;  1L0G A;  1DY6 A;  2Y2O A;  4B4X A;  2X71 A;  2PBY A;  1L0E A;  3IHA A;  2JE5 A;  3G31 A;  2X01 A;  4KZ8 A;  3MZD A;  3PBR A;  1LL5 A;  1FR6 A;  3M6H A;  4GNU A;  1NZO A;  3UDF A;  1Y54 A;  2XEP A;  3HLB A;  4OOY A;  4C75 A;  1G6A A;  3ZG7 B;  5KMW A;  4EV4 A;  4R23 A;  4OP8 A;  4R1G A;  3ZG8 B;  4DDS A;  1IKG A;  4DE2 A;  5KZH A;  4YFM A;  4BJP A;  2DRW A;  1MY8 A;  3NIA A;  2R9X A;  3G32 A;  1QME A;  5AQA A;  3NDG A;  1Q2P A;  1NRF A;  1KGE A;  2ZMA A;  2Z2M B;  4P85 A;  5EEC A;  1PW8 A;  5TGF A;  4GKU A;  1W79 A;  3JYI A;  1KDS A;  1SKF A;  4OPQ A;  3VFH A;  3VSK A;  4JXG A;  2BLS A;  1FSW A;  2WK0 A;  1ES3 A;  1ZKJ A;  1E3U D;  3A3J A;  2H10 A;  4EBP A;  1CEG A;  4K0W A;  3G34 A;  3FV7 A;  5EVI A;  1K25 A;  2HP6 A;  4PPR A;  2XH9 A;  2WZZ A;  1W8Q A;  2R9W A;  3GTC A;  4Q8I A;  3LCE A;  2WAE A;  3WS5 A;  2ZJ9 A;  1K57 C;  2H0T A;  2ZQ9 A;  4KZ3 A;  4R4R A;  4GD6 A;  1ES2 A;  5F82 A;  3ZG0 A;  5M19 A;  3ZVT A;  1QMF A;  3WS4 A;  1SDN A;  4PM8 A;  4KQO A;  3IH8 A;  4DF6 A;  1MPL A;  3HUN A;  4NET A;  2PU2 A;  3BFG A;  1ESU A;  1LHY A;  1I5Q A;  1E4D A;  1YLW A;  5DF8 A;  3LY4 A;  3PBN A;  4OPR A;  4R0Q A;  2ZC6 B;  1DJA A;  2HDS A;  5CTN A;  4N1H A;  4GD8 A;  3V3S A;  3BLM A;  4JF6 A;  4EWF A;  2JBF A;  4MBF A;  2B5R A;  1FCM A;  3AGF A;  5EPH A;  3IXH A;  1JVJ A;  1GHP A;  3GV9 A;  4HBU A;  1TDL A;  3ITA A;  2XFT A;  3NBL A;  4OPZ A;  2H5S A;  4X53 A;  1K6R A;  2WGI A;  1PWC A;  2EFX A;  3UPO A;  1K56 A;  1NJ4 A;  1WE4 A;  2WGW B;  3ISG A;  4DXC A;  3NY4 A;  3M2K A;  3M2J A;  5AQ9 A;  3HUO A;  3HRE A;  5M1A A;  4N92 A;  5E2H A;  1YLP A;  1G68 A;  3W4Q A;  4GDB A;  5CGW A;  1XGJ A;  3TG9 A;  4K0X A;  1ONG A;  4OPY A;  5FAO A;  3ZG5 A;  1E25 A;  1XPB A;  1YLZ A;  3I7J A;  2ZC3 B;  3N7W A;  5AQ7 A;  3BFF A;  4WM9 A;  4OQH A;  1GCE A;  2XD1 A;  2A3U A;  3LY3 A;  4S2N A;  5EE8 A;  4BL2 A;  3HLD A;  3ZDJ A;  3N6I A;  4IBX A;  2OSU A;  1BZA A;  3GRJ A;  4KZA A;  3IF5 A;  5EUA A;  3Q7V A;  4U0X A;  3UO9 A;  4B4Z A;  4QJG A;  4KZ9 A;  4HES A;  5FQQ A;  1PI4 A;  4WZ5 A;  4E3L A;  5GLC A;  2ZM8 A;  3N8R A;  3V3R A;  1GA9 A;  1NY0 A;  2EFU A;  3O86 A;  2ZQA A;  1NZU A;  2V20 A;  5DF9 A;  3SOI A;  1H8Z A;  1IEM A; 
#chains in the Genus database with same CATH topology
 5GHX A;  4GCZ A;  2JKF A;  3HCY A;  3BM6 A;  4RX3 A;  1EW0 A;  2J3T C;  5DJT A;  5FAT A;  4LGW A;  1JNU A;  4XXR A;  1AXB A;  3CMZ A;  4L9E A;  4JGR A;  1FIK A;  3EOI A;  1ERO A;  4R3J A;  2WUQ A;  3IXB A;  4X68 A;  3IHB A;  3HJK A;  1BLS A;  3LIC A;  2P9V A;  3DTM A;  3IF6 C;  4R70 A;  4BEN A;  2RL3 A;  4QD4 A;  5FAS A;  4N9L A;  4KQQ A;  4EW7 A;  4Y0T A;  4L0L A;  2JKT I;  4P87 A;  3K3D A;  2EXB A;  1OT6 A;  2Y2H A;  3RTY A;  1VM1 A;  4PM9 A;  2J80 A;  1SCW A;  2OLU A;  1XFQ A;  2ZD8 A;  2CC1 A;  3MZF A;  3FKV A;  2IWC A;  3QP5 A;  4U3T A;  3V39 A;  2HDR A;  3H7W A;  1S67 L;  2J9P A;  3D9Y A;  3LR5 A;  4ESP A;  3JVU A;  5HD3 A;  3Q7Z A;  1LSV A;  4M3K A;  1H8M A;  3N8L A;  3T4J A;  4MN7 A;  4PM6 A;  3EQV A;  3A0S A;  4LV3 A;  5EVI D;  3UY6 A;  5GLD A;  3QNC A;  3WS1 A;  1SDE A;  3RXX A;  1ERQ A;  3HLC A;  5FSR A;  5BOH A;  3BJN A;  3V67 A;  3OZH A;  3NI9 A;  4S2J A;  2MJ6 A;  3UB9 A;  3PAG A;  4QU3 A;  2B18 A;  2VJW A;  3HLW A;  5DVA A;  4ZAM A;  1XGI A;  5HAI A;  3UE3 A;  3MBZ A;  5AVF A;  3A3F A;  1N4O A;  1MKI A;  1MBL A;  4MDZ A;  5FAP A;  1L3L A;  1S4S A;  3OCN A;  3K3C A;  4GN2 A;  1T1A A;  3DTK A;  2A24 B;  3P01 A;  1ES5 A;  3OC2 A;  2Q0O A;  4O01 A;  3IWO A;  3W4O A;  3UNW A;  2QMI A;  3T1S A;  1IEL A;  2C6W B;  4EQI A;  2VZW A;  5HL1 A;  5EOO A;  1DJC A;  2LB9 A;  2VLG A;  2Y2G A;  3VP0 A;  4ZJ1 A;  5E2E A;  3HBR A;  4CLC C;  4P6Z S;  2JN7 A;  5L09 A;  3PAE A;  3LR0 A;  3MZE A;  4RVA A;  1IKI A;  3FKW A;  3E98 A;  1YLJ A;  2PAV P;  2HJ9 C;  2XFS A;  3CI6 A;  5DTK A;  4LPZ A;  2UV0 E;  4WEK A;  4YWZ A;  4Q0J A;  4S2L A;  1G6O A;  3O87 A;  3TOI A;  1RGZ A;  4WEL A;  2ZBB A;  4XUX A;  4PHT A;  4WYY A;  1P9W A;  2XGN A;  3BWL A;  3CJM A;  4KQD A;  4R38 A;  1KVL A;  4KZ5 A;  4I3J A;  3FC7 A;  4MBH A;  5HWT A;  5K5B A;  3F1O A;  2CMN A;  2P9V B;  4G3K A;  4O7D A;  2H28 A;  5FQJ A;  1LSX A;  4JLF A;  3G2Y A;  3VMA A;  1PZO A;  4OVD A;  4JXW A;  4DE1 A;  3NCK A;  4HI4 A;  1OME A;  4MN6 A;  5CHU A;  2X02 A;  3ZNT A;  2I72 A;  1FOF A;  5EVL A;  5CGS A;  1M6K A;  1YPR A;  4EEP A;  3OPP A;  1S0W A;  2PBD P;  2Q9N A;  4KUO A;  4BBV A;  3DWZ A;  1OPX A;  5KSC A;  5EM0 A;  2FFF B;  4NKP A;  2W3F A;  3R7W B;  5CRF A;  4YIN A;  3F1N A;  1K57 A;  1VHM A;  4DN0 A;  2G2U A;  3RXW A;  1N9L A;  2INW A;  3H7W B;  3LR3 A;  5CED A;  3MF0 A;  3F1P B;  1XA1 A;  1K55 C;  4EEU A;  1HZO A;  1X0O A;  2Y2P A;  4GDN A;  3MJQ A;  2C5W B;  3UB5 P;  3IBR A;  2ZC7 A;  4X56 A;  1S1Y A;  4ID4 A;  3V5M A;  2JKR I;  1PYY A;  3EWK A;  2O0Y A;  3T1R A;  2OWH A;  4GB7 A;  1K4E A;  2P74 A;  5FDH A;  2XRN A;  4NXB A;  1I2W A;  2ZOH A;  1J3W A;  1N9O A;  4UA6 A;  2VGL S;  5C5K A;  4WBG A;  5CTM A;  1S66 L;  2P04 A;  3N8S A;  4S2O A;  1BYW A;  2J3W A;  2PR5 A;  5IT5 A;  4DDY A;  1WYB A;  5DFY A;  3GMW A;  1P9R A;  3PR6 A;  5FQM A;  4B4X A;  2PBY A;  1L0E A;  3IHA A;  2JE5 A;  2X01 A;  4KZ8 A;  1G28 A;  3UDF A;  4AFI A;  4C75 A;  1H0M A;  4EV4 A;  2W1T B;  5KZH A;  2ZMV A;  2ZOI A;  2DRW A;  1QME A;  1SKO A;  1Q2P A;  2ZMA A;  5HD5 A;  5TGF A;  4ME4 A;  1YAX A;  3VFH A;  2BLS A;  2WK0 A;  5KIZ A;  4CQH A;  2H10 A;  4EBP A;  4MMN A;  3G34 A;  2WZZ A;  4MN5 A;  4Q8I A;  2WAE A;  3WS5 A;  3W2Z A;  5F82 A;  3F1O B;  4GD6 A;  1MKM A;  3ZVT A;  1SDN A;  4PM8 A;  4KQO A;  3BFG A;  3E4Q A;  4IUK A;  1I5Q A;  3UB6 A;  1TF1 A;  2OAP 1;  1VET B;  2B5R A;  4HBU A;  3ITA A;  4X53 A;  1K56 A;  5FEF A;  3ISG A;  4K08 A;  3HUO A;  1G68 A;  4GDB A;  5G4Y A;  3ZQ5 A;  4K0X A;  4OPY A;  3I7J A;  2ZC3 B;  5AQ7 A;  4HY8 A;  2XD1 A;  3LY3 A;  5EE8 A;  2OSU A;  1BZA A;  3F1N B;  4NXF A;  3K2N A;  3Q7V A;  4QJG A;  4KZ9 A;  3KSF A;  5GLC A;  4E3L A;  1NY0 A;  1NZU A;  3BW6 A;  3LGO A;  1IEM A;  5CXW A;  4BL3 A;  3CAX A;  3MSH A;  1LI0 A;  5CHM A;  4L9G A;  1D7E A;  2VX8 A;  5DTS A;  1TS8 A;  2HDU A;  4E3I A;  1GSW A;  3MFX A;  4S2I A;  5IU1 A;  5F5Y A;  4DE3 A;  1XJ6 A;  4IUH A;  4BD1 A;  3E0Y A;  1XP4 A;  1Z6F A;  3HLG A;  4LLO B;  1H5X A;  4LRZ E;  3NUL A;  3LIE A;  1DP6 A;  4CLC A;  3P98 A;  1V9Z A;  5A92 A;  2HZ5 A;  4LCM A;  3TSG A;  3BEB A;  1HD8 A;  1E3U A;  5TR7 A;  3OBF A;  4OOM A;  1RP5 A;  2UWX A;  2Y4A A;  3ZGA B;  4XUZ A;  4UAA A;  1K0K A;  4KG6 A;  3GQZ A;  2W3E A;  2J3T D;  1VEU B;  2KLI A;  1ALQ A;  1HTZ A;  3PBS A;  5L8M A;  3QP2 A;  1T1B A;  3PBO A;  4GS9 A;  5DF7 A;  5FQK A;  3CIT A;  4FSF A;  2WKI A;  3V50 A;  2GX5 A;  3MKE A;  4HBT A;  3UE0 A;  5HAQ A;  4HH2 A;  2OWJ A;  1CI9 A;  4I3I A;  3IX8 A;  1CEF A;  1HVB A;  4GW9 A;  1MXO A;  2WZX A;  4E6X A;  4FH2 A;  5CHJ A;  5HPI A;  5LBR A;  5DTT A;  3G30 A;  2O9A A;  5CGX A;  5I94 A;  4JBF A;  3IXG A;  4BD0 A;  3D4F A;  1BTL A;  4R3B A;  3OPR A;  2WAD A;  3SZT A;  3C38 A;  2Y79 A;  1YQS A;  1LT0 A;  2Z2L B;  5FEG A;  1LSW A;  3PBQ A;  4EET B;  4X6T A;  1W63 M;  2FH5 A;  3IXD A;  4UA9 A;  4QHC A;  3SH9 A;  4B88 A;  2WKR A;  1LLB A;  4ZDX A;  4RQ9 A;  1K56 D;  2DMW A;  4BMW A;  2A49 A;  1FQG A;  1T19 A;  3OCL A;  4OLG A;  4WMC D;  2WKP A;  3DTE A;  3KYZ A;  5CEC A;  4EUV A;  4H6J A;  5AJG A;  4IHQ A;  2EWW A;  1PI5 A;  3SH7 A;  4KG2 A;  3Q7V B;  4YNR A;  4EUZ A;  1BT5 A;  3MXS A;  5TBM A;  4EU0 A;  3ZHH A;  1Y4O A;  4S2M A;  2WAF A;  3LEQ A;  4HJ6 A;  1YLT A;  2V0U A;  4ETZ A;  2EX8 A;  2Q9M A;  4PM5 A;  4UQI S;  2ZMF A;  3H82 A;  2J7V A;  3NC8 A;  4HJ4 A;  3ZG9 B;  4Y7P A;  2O99 A;  3R4K A;  3B42 A;  1BLP A;  2VGK A;  4FH4 A;  1MZU A;  1F9I A;  1K38 A;  3IT9 A;  2OV5 A;  3GVB A;  1YSP A;  4D2O A;  3BQA A;  2Y2L A;  1ES4 A;  2PYR A;  3HL9 A;  3DBA A;  4H8R A;  1GSV A;  3S7Q A;  4QB8 A;  1BLC A;  5F1F A;  4X55 A;  4EER A;  5F83 A;  4Q0I A;  3KYE A;  3L9K A;  3SW1 A;  1BLH A;  3NJA A;  2VV7 A;  2WGW A;  3ICY A;  2O9B A;  2IWB A;  3WS0 A;  2K7S A;  5EVI B;  5A91 A;  4JGO A;  3U4L P;  4E3O A;  2Y2K A;  3P7N A;  4NXE A;  3S7O A;  2WYX A;  1IYS A;  5M18 A;  2QHK A;  3E2K A;  2PD7 A;  2DCF A;  1K4F A;  4MCW A;  4DRT A;  1L0D A;  2WKQ A;  2XLN A;  1IYP A;  2EX2 A;  1RGY A;  2QPN A;  2V9A A;  3IQA A;  2EA9 A;  3VOY A;  5FI6 A;  1FR1 A;  3S4X A;  4M4X A;  3W8K A;  2V8F A;  1XX2 A;  4EBL A;  1JTG A;  3G2Z A;  5HX9 A;  3CLO A;  1N9N A;  3PBT A;  1UWP X;  2HDQ A;  4UA7 A;  4DKI A;  1NYY A;  1CJF A;  1XJ2 A;  4IVK A;  1W63 Q;  3UB8 A;  2J9O A;  2XDM A;  1DP8 A;  1GSX A;  2Y8H A;  5J7E A;  3QNB A;  3HLF A;  2O9C A;  5TFQ A;  3RFB A;  1CK3 A;  1UGU A;  5FA7 A;  3C5A A;  4O0P A;  4YOF A;  5HZH A;  1OJ5 A;  4C3Q A;  5FI7 A;  1JTD A;  3A3D A;  3LR4 A;  1XA7 A;  2XQZ A;  3HVF A;  1JWP A;  4A5R A;  4II7 A;  4JF5 A;  4LCL A;  1ZG6 A;  4HP9 A;  3MZD A;  2BTF P;  2YKF A;  3M6H A;  1NZO A;  1ZTU A;  2AVX A;  3CPT A;  5KMW A;  4R23 A;  2LB5 A;  4OP8 A;  1IKG A;  4DE2 A;  2XA7 M;  3IS2 A;  1SZV A;  2R9X A;  3G32 A;  1XJ3 A;  1IFQ A;  4P85 A;  3H82 B;  1W79 A;  3VSK A;  2JKG A;  5J4E A;  2I9V A;  1CEG A;  4K0W A;  3FV7 A;  2XH9 A;  3GTC A;  3FG8 A;  4FUW A;  4ARZ A;  2H0T A;  1YSQ A;  2ZQ9 A;  1ES2 A;  5M19 A;  3WS4 A;  5F68 A;  1MPL A;  2PU2 A;  1ESU A;  1LHY A;  3UB7 A;  3S7N A;  1YLW A;  2V1B A;  1DJA A;  2HDS A;  5CTN A;  3QP4 A;  4JF6 A;  4EWF A;  2JBF A;  4NXG A;  1FCM A;  3AGF A;  4R3A A;  3NBL A;  1K6R A;  1PWC A;  3CHW P;  1NJ4 A;  1WE4 A;  2WGW B;  4I39 A;  2OOL A;  1YLP A;  1XGJ A;  3IX4 A;  3N7W A;  3BFF A;  2A3U A;  3ZDJ A;  3N6I A;  4HP4 A;  3GRJ A;  4KZA A;  5EUA A;  4G3W A;  4B4Z A;  4HOI A;  5FQQ A;  1PI4 A;  4FOF A;  3T1Q B;  2ZM8 A;  3O86 A;  4PKY A;  2GJ3 A;  2V20 A;  4Y5F A;  4NG2 A;  1H8Z A;  1DP9 A;  3QP8 A;  2PU4 A;  3IWQ A;  5I5L A;  3G35 A;  3FPV A;  4Y0O A;  2VK3 A;  1F2K A;  5FQ9 A;  1F5M A;  2J8Y A;  3CWF A;  3VP1 A;  1O07 A;  3HUM A;  3ITB A;  4JF4 A;  4WN5 A;  3KYQ A;  2FZ0 A;  2D01 A;  1PW1 A;  3SS5 A;  4XT2 A;  4BWI A;  4IJG A;  3ZFZ A;  1ODV A;  3BY9 A;  2Y91 A;  3SS4 A;  4KZB A;  3LIA A;  2ZQ7 A;  1W8Y A;  1NYM A;  1LL9 A;  3E4P A;  1IYO A;  2JKT M;  4X1L A;  4PAU A;  3NEC A;  5FAQ A;  3L7H A;  2HF6 A;  3IF6 A;  3WS2 A;  3EEH A;  4ZJ3 A;  2XR0 A;  3W4P A;  3N4I A;  4R6L A;  4ZRR A;  2W3H A;  5F6A A;  3NOT C;  1Y28 A;  5GLA A;  1XXM A;  2Y2J A;  4JXV A;  4OQG A;  5J3W A;  1ACF A;  1PRQ A;  3M6B A;  5L10 A;  1FSY A;  1V9Y A;  3IS2 B;  3SS3 A;  1G5U A;  2W3D A;  3TE8 A;  4GHI A;  2V2F F;  3CZD A;  3ULF A;  2QZ6 A;  4GZB A;  2Y2Q A;  4OP5 A;  3DAV A;  4ARZ B;  1KE3 A;  3Q07 A;  4JXS A;  5JYO A;  2BAS A;  5A93 A;  3UDI A;  4F3L A;  4MLL A;  4X69 A;  1VQQ A;  3A3E A;  5EVE A;  2GZA A;  2G7U A;  2WKH A;  2ZQ8 A;  4CJN A;  1LI9 A;  3BFC A;  3LI8 A;  4OQI A;  4QY6 A;  2VGJ A;  1DRM A;  2HP5 A;  3MFD A;  3D72 A;  2OAQ 1;  1P97 A;  2Y59 A;  2Z6D A;  3UE1 A;  3IBJ A;  5HW3 A;  3VP3 A;  3OPL A;  3DWK A;  1KE4 A;  3CG5 A;  3ZNY A;  3BFD A;  4HQA A;  2E8I A;  3T4L A;  2G2W A;  4DXB A;  3PXP A;  3MMH A;  1STZ A;  4E3M A;  3GSG A;  4P6B A;  2VA0 A;  2ZC4 B;  3TJZ C;  4FD8 A;  3IWI A;  4DJ2 A;  3LO7 A;  3IH9 A;  1Q2Q A;  3C30 A;  3VE4 A;  5DKK A;  3NOP C;  1OTB A;  1JWV A;  2H0Y A;  4ZJ2 A;  4F94 A;  3D3O A;  3A3I A;  1L2S A;  2QJ5 A;  4OOL A;  4RYE A;  2ACG A;  3P09 A;  1TS6 A;  4E3K A;  5JYP A;  4BQM A;  3WRZ A;  1I2S A;  3FYZ A;  2ZQC A;  3KX0 X;  1ESI A;  1KVM A;  4JPM A;  3FPW A;  1KDW A;  5GLB A;  5HFO A;  2JCH A;  3LEZ A;  5FDS A;  4WZ4 A;  1GA0 A;  3C4O A;  1SKO B;  3IX3 A;  5IS1 A;  3IF6 B;  1TVF A;  1K54 C;  2VEA A;  4ZBE A;  2V0W A;  4Y0U A;  2W0N A;  5GL9 A;  4MEZ A;  3AGD A;  2OLV A;  4JKT A;  4JGQ A;  3C8C A;  3TW8 A;  2QJ7 A;  3AGE A;  5HAR A;  3MS6 A;  3RH8 B;  5F69 A;  4NK3 A;  4RA7 A;  2XF3 A;  2E8J A;  3BEC A;  4RX2 A;  2Y2I A;  4OH0 A;  1MC0 A;  3MR0 A;  5J8X A;  4K91 A;  1KGF A;  2VGL M;  3FWL A;  4LEN A;  2L1M A;  4LRY C;  1XJ4 A;  3A0V A;  1T1C A;  2YKH A;  1U60 A;  4E3J A;  2A24 A;  1PNE A;  2EX6 A;  5CEB A;  1H8Y A;  1PFL A;  5L2F A;  2PRF A;  5KSH A;  2ZL1 A;  3S1Y A;  1TEM A;  3SH8 A;  4S2K A;  1FIL A;  1OT9 A;  1LL8 A;  4N9K A;  2JKR M;  3ZVW A;  1NXY A;  2P7J A;  1K55 A;  1M40 A;  1W7F A;  5D3O A;  3DW0 A;  3BFE A;  1IOU A;  1YM1 A;  3E4O A;  1ZC2 A;  4GJ4 A;  4BBU A;  4PKY G;  5F1G A;  2Y2N A;  1OTD A;  3WRT A;  1OTA A;  2QYB A;  5HL6 A;  1P0Z A;  3E2L A;  1RCJ A;  4Y15 A;  2X71 A;  5DFX A;  3PBR A;  1LL5 A;  1FR6 A;  4GNU A;  1NRJ A;  1Y54 A;  2XEP A;  2QWS A;  1G6A A;  4KUK A;  3ZG7 B;  4R1G A;  3ZG8 B;  4DDS A;  4YFM A;  1CQA A;  4BJP A;  3TRC A;  1WA9 A;  1MY8 A;  1NWZ A;  1NRF A;  2K2N A;  5EEC A;  1PW8 A;  4GKU A;  4UEY A;  4CLC B;  4CLC D;  4OPQ A;  1ES3 A;  1NLY A;  2NUP C;  1E3U D;  1K25 A;  1W8Q A;  2R9W A;  3UE6 A;  3R7W A;  2ZJ9 A;  2PT7 A;  4LFU A;  4R4R A;  2NUT C;  1QMF A;  4DF6 A;  3IH8 A;  5L07 A;  3HUN A;  4NET A;  3CUE C;  3LY4 A;  4OPR A;  4GS9 B;  3JVV A;  2ZC6 B;  1VB6 A;  4LRX C;  3F1P A;  4WL9 A;  5EPH A;  1JVJ A;  1GHP A;  3GV9 A;  1TDL A;  2XFT A;  3QP1 A;  3UPO A;  5HDC A;  2L4R A;  4DXC A;  3NY4 A;  3MQQ A;  5AQ9 A;  3HRE A;  3OLO A;  1F98 A;  4N92 A;  5E2H A;  1KOU A;  5FAO A;  1ONG A;  1E25 A;  4WM9 A;  4OQH A;  5HSQ A;  4BL2 A;  4WLA A;  3IF5 A;  3GEC A;  4Y3I A;  3UO9 A;  3LID A;  3T12 B;  2VV8 A;  4HES A;  3N8R A;  2EFU A;  2PYP A;  2KDK A;  3GDI A;  5DF9 A;  5EV0 A;  2HJE A;  1GHM A;  5EM1 A;  3H9W A;  1D1J A;  2R78 A;  5CER A;  1YMX A;  2ZL1 B;  4IVI A;  4KQR A;  5HAP A;  1O7E A;  3BRM A;  3BLS A;  5AVE A;  3HJI A;  5A90 A;  2EX9 A;  2ZLY A;  5GHY A;  1W5D A;  2FFY A;  3UMD A;  3BYD A;  4Y17 A;  3UME A;  2GDN A;  4H6J B;  2W1T A;  2WGV A;  3A0R A;  4LV1 A;  5A8B A;  4E6W A;  5TBM B;  4B93 A;  1EI5 A;  3BY8 A;  2V8C A;  4WF0 A;  4IED A;  4MBK A;  2XSS A;  1H3Q A;  3MQ0 A;  5EVI C;  4QY5 A;  3ZCZ A;  4EQ1 A;  4KZ7 A;  1AWI A;  2D02 A;  3O88 A;  4OQ0 A;  1CI8 A;  5E2G A;  5HPF A;  3WWX A;  3VSL A;  1PWD A;  1S1Z A;  3O5Y A;  2WKE A;  3T4S A;  4PMA A;  3C2W A;  3UN7 A;  1GHI A;  2XD5 A;  1VET A;  4CPK A;  3VE3 A;  1NLZ A;  2IWD A;  2PD8 A;  4GOG A;  3MXQ A;  2HV1 A;  4FCF A;  3C7V A;  1XFN A;  2A2L A;  3PTE A;  4WEJ A;  3U2A A;  4S2N C;  4KEN B;  1SHV A;  1PZP A;  2BG1 A;  1N9B A;  1TD5 A;  4OON A;  4FTX A;  1K54 A;  1YT4 A;  4C6Y A;  3BQ8 A;  4OKP A;  3LYX A;  1UWN X;  4Z9Q A;  4WZ5 C;  5CX7 A;  1MWR A;  4KG5 A;  3GR2 A;  1YLY A;  1D06 A;  5GHZ A;  4N1X A;  1C3B A;  4PM7 A;  4UQI M;  1XKZ A;  1MWU A;  1FCN A;  1BUL A;  5E2F A;  3EQU A;  3OOV A;  4I3A A;  1L0F A;  3EEA A;  4ZTK A;  1S4R A;  3Q81 A;  4X25 A;  4OLD A;  4E3N A;  3HLE A;  2HPB A;  5HWW A;  3VP2 A;  4IBR A;  3T4Q A;  2Y55 A;  2ZM2 A;  1ONH A;  4BLM A;  4S2P A;  5FI2 A;  5G18 A;  3T4O A;  2HP9 A;  2B95 A;  1S6R A;  2PR6 A;  2KX6 A;  4UHU A;  5TJJ A;  5DJU A;  1OTI A;  1MWT A;  3G6O A;  1A0K A;  2PHY A;  4BBT A;  3T1X A;  4ETX A;  3LFV A;  4LV2 A;  3UDX A;  5HWV A;  1IYQ A;  5HDD A;  1CF0 A;  5U47 A;  3NDE A;  3G4P A;  3QHY A;  4I5S A;  4HEF A;  1VEU A;  4KZ4 A;  3MQO A;  3VOZ A;  3Q82 A;  1EWZ A;  3LIF A;  1DJB A;  1PWG A;  2DNS A;  1TS7 A;  4Y2F A;  1YMS A;  2HGV A;  2QKP A;  2P08 A;  2XK1 A;  3CPT B;  1FCO A;  2EWV A;  3MXR A;  2KOI A;  3NHQ A;  3FZC A;  4HHD A;  5DKL A;  3VV4 A;  4P0M A;  4EBN A;  3C4P A;  1BUE A;  2JC7 A;  1OTE A;  2ZQD A;  2RCX A;  3JPU A;  3UPN A;  3S22 A;  2Y2M A;  4HJ3 A;  4B9O A;  1TDG A;  3O3V A;  3LI9 A;  4R4S A;  1PIO A;  1KE0 A;  4HH3 A;  4P6Z M;  3CUE A;  3B47 A;  5AQB A;  3T4T A;  3RJU A;  2ZC5 B;  1BSG A;  2ZM0 A;  4WMC A;  2VKS A;  5FL3 A;  3NOU C;  2M1C A;  1K6S A;  4MNR A;  5EOE A;  3OPH A;  3MKF A;  2GNX A;  1MWS A;  5E43 A;  1JWZ A;  3LUQ A;  3UPP A;  4EXO A;  3T50 A;  3Q1F A;  2K31 A;  1T18 A;  4LV0 A;  4I38 A;  3VP4 A;  1KGG A;  5FQI A;  2V1Z A;  3ZYT A;  4U0T A;  3KO6 A;  1ZG4 A;  4DMZ A;  5IHV A;  4DE0 A;  4DJ3 A;  5EFW A;  2EXA A;  3VOL A;  3C7U A;  3VFF A;  3EGX C;  4KZ6 A;  2PDR A;  5HDS A;  1WYC A;  1J9M A;  3B3X A;  1L0G A;  1ERM A;  4QPR A;  1DY6 A;  2Y2O A;  3G31 A;  1HLU P;  4X1M A;  3PHY A;  1ZHH B;  4D60 A;  5MC7 A;  2XRO A;  4G3V A;  4OOY A;  3HLB A;  4JGP A;  4XT2 B;  4WUJ A;  4GLQ A;  3NIA A;  2V1A A;  1Z09 A;  3DTI A;  5AQA A;  2M7V A;  3NDG A;  1KGE A;  2Z2M B;  3LIB A;  4HNB A;  3JYI A;  1KDS A;  1SKF A;  4EES A;  4JXG A;  1FSW A;  1OJG A;  1ZKJ A;  2VV6 A;  2IA2 A;  3A3J A;  4Q0H A;  5G4Z A;  4HIA A;  5EVI A;  2HP6 A;  4PPR A;  3LCE A;  1K57 C;  4NEE D;  4KZ3 A;  3ZG0 A;  2W3G A;  4E04 A;  3KSH A;  1E4D A;  5DF8 A;  3PBN A;  4R0Q A;  4N1H A;  4GD8 A;  3V3S A;  3BLM A;  2B02 A;  4MBF A;  2W1R A;  2XA7 S;  3IXH A;  3PYP A;  1YKD A;  4OPZ A;  2H5S A;  4GHI B;  2WGI A;  2JHE A;  3KSI A;  2M7U A;  2EFX A;  3QP6 A;  2L0W A;  3M2K A;  3M2J A;  5M1A A;  1TS0 A;  4Y13 A;  3W4Q A;  5CGW A;  2Z6C A;  3TG9 A;  3ZG5 A;  1XPB A;  1YLZ A;  2W27 A;  1GCE A;  4S2N A;  3HLD A;  4O8G A;  4QWO A;  3EGD C;  4IBX A;  4L9F A;  4Z1W A;  4U0X A;  3S7P A;  3B33 A;  3T4K A;  4F3L B;  4WZ5 A;  3V3R A;  1GA9 A;  2ZQA A;  3KSG A;  3SOI A;  4CLC E; 
#chains in the Genus database with same CATH homology
 5GHX A;  1GHM A;  2PU4 A;  5CER A;  5CXW A;  3IWQ A;  3BM6 A;  4RX3 A;  1YMX A;  4BL3 A;  3G35 A;  1LI0 A;  4Y0O A;  5FAT A;  5CHM A;  4IVI A;  4XXR A;  4KQR A;  5HAP A;  1AXB A;  1O7E A;  3BRM A;  5DTS A;  3BLS A;  3CMZ A;  5FQ9 A;  5A90 A;  2J8Y A;  2EX9 A;  2HDU A;  2ZLY A;  3VP1 A;  1O07 A;  3HUM A;  4E3I A;  1ERO A;  5GHY A;  1W5D A;  3ITB A;  2FFY A;  4R3J A;  4JF4 A;  3BYD A;  2WUQ A;  4S2I A;  2GDN A;  1PW1 A;  3SS5 A;  3IXB A;  4X68 A;  4DE3 A;  3IHB A;  1BLS A;  2WGV A;  4BD1 A;  2P9V A;  1XP4 A;  4LV1 A;  3ZFZ A;  1Z6F A;  3DTM A;  3IF6 C;  4BEN A;  3HLG A;  2Y91 A;  3SS4 A;  2RL3 A;  4QD4 A;  5FAS A;  1H5X A;  4E6W A;  4N9L A;  4KZB A;  4KQQ A;  1EI5 A;  2ZQ7 A;  4Y0T A;  1W8Y A;  1NYM A;  4L0L A;  1LL9 A;  3P98 A;  1IYO A;  4IED A;  4MBK A;  5A92 A;  4LCM A;  4P87 A;  5EVI C;  3TSG A;  3BEB A;  4QY5 A;  1HD8 A;  3ZCZ A;  1E3U A;  2EXB A;  4KZ7 A;  5FAQ A;  3WS2 A;  2Y2H A;  3IF6 A;  5TR7 A;  3O88 A;  4ZJ3 A;  4OQ0 A;  4OOM A;  1RP5 A;  2XR0 A;  1CI8 A;  3W4P A;  3N4I A;  1VM1 A;  2UWX A;  2Y4A A;  5E2G A;  3ZGA B;  4PM9 A;  4XUZ A;  4UAA A;  4KG6 A;  1SCW A;  3GQZ A;  3WWX A;  3VSL A;  2OLU A;  1XXM A;  5GLA A;  2Y2J A;  1ALQ A;  1PWD A;  1HTZ A;  3PBS A;  4JXV A;  4OQG A;  2ZD8 A;  2CC1 A;  2WKE A;  3MZF A;  3PBO A;  4PMA A;  5DF7 A;  3FKV A;  3UN7 A;  5FQK A;  2IWC A;  1GHI A;  4FSF A;  3M6B A;  2XD5 A;  2WKI A;  3V50 A;  3MKE A;  3UE0 A;  1FSY A;  4HBT A;  4CPK A;  5HAQ A;  2IWD A;  4U3T A;  3SS3 A;  3V39 A;  4GOG A;  1CI9 A;  2HDR A;  4FCF A;  2J9P A;  1CEF A;  1HVB A;  2V2F F;  1MXO A;  3C7V A;  3CZD A;  3Q7Z A;  2WZX A;  4E6X A;  2QZ6 A;  4M3K A;  4FH2 A;  5CHJ A;  3N8L A;  3PTE A;  4WEJ A;  4GZB A;  4PM6 A;  2Y2Q A;  3EQV A;  5DTT A;  3G30 A;  4S2N C;  4KEN B;  1SHV A;  4OP5 A;  1PZP A;  5CGX A;  2BG1 A;  4JBF A;  1N9B A;  3IXG A;  4LV3 A;  4OON A;  5EVI D;  5GLD A;  3UY6 A;  3QNC A;  4BD0 A;  3WS1 A;  1SDE A;  3D4F A;  3RXX A;  1ERQ A;  1K54 A;  1BTL A;  1YT4 A;  3HLC A;  4R3B A;  3OPR A;  5FSR A;  4C6Y A;  5BOH A;  3OZH A;  1KE3 A;  4OKP A;  3NI9 A;  2WAD A;  3Q07 A;  4Z9Q A;  4WZ5 C;  4S2J A;  4JXS A;  5JYO A;  3PAG A;  1YQS A;  4QU3 A;  3HLW A;  5DVA A;  1MWR A;  4ZAM A;  4KG5 A;  3GR2 A;  3UDI A;  5A93 A;  1XGI A;  1YLY A;  2Z2L B;  4MLL A;  4X69 A;  5HAI A;  1VQQ A;  3UE3 A;  3A3E A;  3MBZ A;  3PBQ A;  5GHZ A;  4N1X A;  4X6T A;  1C3B A;  3IXD A;  2WKH A;  3A3F A;  4UA9 A;  2ZQ8 A;  1N4O A;  1MKI A;  1LI9 A;  4PM7 A;  4QHC A;  3SH9 A;  4CJN A;  3BFC A;  1MBL A;  1XKZ A;  4B88 A;  1MWU A;  1LLB A;  4OQI A;  1FCN A;  4QY6 A;  2VGJ A;  1BUL A;  5E2F A;  5FAP A;  4ZDX A;  2HP5 A;  3EQU A;  3MFD A;  3OCN A;  1K56 D;  1L0F A;  4GN2 A;  3UE1 A;  2Y59 A;  4ZTK A;  2A49 A;  3Q81 A;  1ES5 A;  3OC2 A;  5HW3 A;  1FQG A;  4OLD A;  4E3N A;  3VP3 A;  3OCL A;  3IWO A;  3OPL A;  3UNW A;  3W4O A;  3HLE A;  3DWK A;  1KE4 A;  3CG5 A;  2HPB A;  2QMI A;  4OLG A;  3ZNY A;  3VP2 A;  4WMC D;  1IEL A;  2C6W B;  3BFD A;  4IBR A;  2Y55 A;  4EQI A;  2ZM2 A;  5CEC A;  2E8I A;  1ONH A;  4BLM A;  4S2P A;  5FI2 A;  5G18 A;  2G2W A;  5EOO A;  1DJC A;  5HL1 A;  4DXB A;  1PI5 A;  2Y2G A;  3SH7 A;  3VP0 A;  4KG2 A;  3Q7V B;  2HP9 A;  1S6R A;  4E3M A;  4EUZ A;  4UHU A;  4ZJ1 A;  5E2E A;  1BT5 A;  3HBR A;  3GSG A;  3MXS A;  4P6B A;  3ZHH A;  2ZC4 B;  1MWT A;  4FD8 A;  2WAF A;  4S2M A;  3PAE A;  3MZE A;  4RVA A;  3IWI A;  1IKI A;  3FKW A;  1YLT A;  1YLJ A;  3LO7 A;  3IH9 A;  1Q2Q A;  2XFS A;  2EX8 A;  2Q9M A;  4PM5 A;  5DTK A;  4LV2 A;  4WEK A;  3UDX A;  2J7V A;  1IYQ A;  3NC8 A;  4S2L A;  3ZG9 B;  3O87 A;  3TOI A;  5U47 A;  1RGZ A;  4WEL A;  4Y7P A;  3NDE A;  4XUX A;  1BLP A;  1JWV A;  2H0Y A;  3G4P A;  3QHY A;  4HEF A;  4ZJ2 A;  4F94 A;  4KZ4 A;  4WYY A;  3VOZ A;  2VGK A;  2XGN A;  4FH4 A;  3A3I A;  1L2S A;  3Q82 A;  1EWZ A;  3CJM A;  4OOL A;  4RYE A;  1KVL A;  4KZ5 A;  3P09 A;  1DJB A;  1PWG A;  1K38 A;  3IT9 A;  4MBH A;  4E3K A;  2DNS A;  2OV5 A;  4BQM A;  3GVB A;  1YMS A;  3WRZ A;  5JYP A;  1I2S A;  3FYZ A;  2ZQC A;  4D2O A;  2P9V B;  4O7D A;  1ESI A;  2XK1 A;  5FQJ A;  1KVM A;  4JPM A;  4JLF A;  2Y2L A;  1FCO A;  1KDW A;  1ES4 A;  3G2Y A;  5GLB A;  5HFO A;  3MXR A;  3VMA A;  3HL9 A;  1PZO A;  4OVD A;  4H8R A;  4JXW A;  2JCH A;  3LEZ A;  4QB8 A;  4DE1 A;  4WZ4 A;  1BLC A;  3FZC A;  1GA0 A;  3NCK A;  1OME A;  5F1F A;  5CHU A;  4X55 A;  2X02 A;  3C4O A;  3ZNT A;  4P0M A;  2I72 A;  5F83 A;  1FOF A;  5EVL A;  4EBN A;  5CGS A;  3IF6 B;  1TVF A;  1K54 C;  1M6K A;  1BLH A;  3C4P A;  1BUE A;  2JC7 A;  2ZQD A;  2RCX A;  2WGW A;  4ZBE A;  3S22 A;  3UPN A;  3OPP A;  4Y0U A;  2IWB A;  3WS0 A;  1S0W A;  2Y2M A;  5GL9 A;  2Q9N A;  4MEZ A;  3AGD A;  2OLV A;  4JKT A;  3DWZ A;  5EVI B;  5A91 A;  1TDG A;  5KSC A;  3O3V A;  2FFF B;  3AGE A;  4E3O A;  2Y2K A;  5HAR A;  4NK3 A;  5CRF A;  2WYX A;  1IYS A;  4RA7 A;  5M18 A;  4R4S A;  4YIN A;  5I94 A;  3E2K A;  2XF3 A;  2DCF A;  1K4F A;  1PIO A;  1K57 A;  4DRT A;  1L0D A;  3BEC A;  4RX2 A;  1KE0 A;  2Y2I A;  2G2U A;  3RXW A;  2XLN A;  1IYP A;  2EX2 A;  1RGY A;  2QPN A;  3IQA A;  4OH0 A;  5J8X A;  4K91 A;  3VOY A;  1KGF A;  4LEN A;  3FWL A;  5FI6 A;  5CED A;  1FR1 A;  1XA1 A;  3S4X A;  3W8K A;  1U60 A;  1XX2 A;  1K55 C;  5AQB A;  3RJU A;  4E3J A;  2EX6 A;  1HZO A;  4EBL A;  2Y2P A;  5CEB A;  1JTG A;  1H8Y A;  4GDN A;  5L2F A;  3G2Z A;  2C5W B;  2ZC5 B;  1BSG A;  2ZM0 A;  5KSH A;  4WMC A;  5HX9 A;  2ZC7 A;  4X56 A;  3S1Y A;  1TEM A;  4ID4 A;  3SH8 A;  4S2K A;  3V5M A;  1K6S A;  4MNR A;  5EOE A;  4N9K A;  3PBT A;  3OPH A;  2HDQ A;  3MKF A;  1NXY A;  1PYY A;  3ZVW A;  4UA7 A;  4DKI A;  1NYY A;  1MWS A;  5E43 A;  1K55 A;  4IVK A;  1JWZ A;  1M40 A;  1W7F A;  3UPP A;  4GB7 A;  3Q1F A;  2J9O A;  5D3O A;  2XDM A;  3DW0 A;  1K4E A;  2P74 A;  4LV0 A;  3VP4 A;  3BFE A;  3QNB A;  1YM1 A;  3HLF A;  5FDH A;  5TFQ A;  1KGG A;  1CK3 A;  5FQI A;  5FA7 A;  1I2W A;  3C5A A;  1ZC2 A;  2V1Z A;  4C3Q A;  4U0T A;  5F1G A;  4UA6 A;  1ZG4 A;  5FI7 A;  1JTD A;  5IHV A;  2Y2N A;  4WBG A;  5CTM A;  3N8S A;  4S2O A;  4DE0 A;  3A3D A;  1XA7 A;  2EXA A;  2XQZ A;  3C7U A;  3VFF A;  3HVF A;  1JWP A;  4KZ6 A;  3WRT A;  1WYB A;  4A5R A;  4DDY A;  3GMW A;  1WYC A;  1J9M A;  4JF5 A;  3B3X A;  3E2L A;  1RCJ A;  4LCL A;  5FQM A;  1ERM A;  1ZG6 A;  1L0G A;  1DY6 A;  2Y2O A;  4B4X A;  2X71 A;  2PBY A;  1L0E A;  3IHA A;  2JE5 A;  3G31 A;  2X01 A;  4KZ8 A;  3MZD A;  3PBR A;  1LL5 A;  1FR6 A;  3M6H A;  4GNU A;  1NZO A;  3UDF A;  1Y54 A;  2XEP A;  3HLB A;  4OOY A;  4C75 A;  1G6A A;  3ZG7 B;  5KMW A;  4EV4 A;  4R23 A;  4OP8 A;  4R1G A;  3ZG8 B;  4DDS A;  1IKG A;  4DE2 A;  5KZH A;  4YFM A;  4BJP A;  2DRW A;  1MY8 A;  3NIA A;  2R9X A;  3G32 A;  1QME A;  5AQA A;  3NDG A;  1Q2P A;  1NRF A;  1KGE A;  2ZMA A;  2Z2M B;  4P85 A;  5EEC A;  1PW8 A;  5TGF A;  4GKU A;  1W79 A;  3JYI A;  1KDS A;  1SKF A;  4OPQ A;  3VFH A;  3VSK A;  4JXG A;  2BLS A;  1FSW A;  2WK0 A;  1ES3 A;  1ZKJ A;  1E3U D;  3A3J A;  2H10 A;  4EBP A;  1CEG A;  4K0W A;  3G34 A;  3FV7 A;  5EVI A;  1K25 A;  2HP6 A;  4PPR A;  2XH9 A;  2WZZ A;  1W8Q A;  2R9W A;  3GTC A;  4Q8I A;  3LCE A;  2WAE A;  3WS5 A;  2ZJ9 A;  1K57 C;  2H0T A;  2ZQ9 A;  4KZ3 A;  4R4R A;  4GD6 A;  1ES2 A;  5F82 A;  3ZG0 A;  5M19 A;  3ZVT A;  1QMF A;  3WS4 A;  1SDN A;  4PM8 A;  4KQO A;  3IH8 A;  4DF6 A;  1MPL A;  3HUN A;  4NET A;  2PU2 A;  3BFG A;  1ESU A;  1LHY A;  1I5Q A;  1E4D A;  1YLW A;  5DF8 A;  3LY4 A;  3PBN A;  4OPR A;  4R0Q A;  2ZC6 B;  1DJA A;  2HDS A;  5CTN A;  4N1H A;  4GD8 A;  3V3S A;  3BLM A;  4JF6 A;  4EWF A;  2JBF A;  4MBF A;  2B5R A;  1FCM A;  3AGF A;  5EPH A;  3IXH A;  1JVJ A;  1GHP A;  3GV9 A;  4HBU A;  1TDL A;  3ITA A;  2XFT A;  3NBL A;  4OPZ A;  2H5S A;  4X53 A;  1K6R A;  2WGI A;  1PWC A;  2EFX A;  3UPO A;  1K56 A;  1NJ4 A;  1WE4 A;  2WGW B;  3ISG A;  4DXC A;  3NY4 A;  3M2K A;  3M2J A;  5AQ9 A;  3HUO A;  3HRE A;  5M1A A;  4N92 A;  5E2H A;  1YLP A;  1G68 A;  3W4Q A;  4GDB A;  5CGW A;  1XGJ A;  3TG9 A;  4K0X A;  1ONG A;  4OPY A;  5FAO A;  3ZG5 A;  1E25 A;  1XPB A;  1YLZ A;  3I7J A;  2ZC3 B;  3N7W A;  5AQ7 A;  3BFF A;  4WM9 A;  4OQH A;  1GCE A;  2XD1 A;  2A3U A;  3LY3 A;  4S2N A;  5EE8 A;  4BL2 A;  3HLD A;  3ZDJ A;  3N6I A;  4IBX A;  2OSU A;  1BZA A;  3GRJ A;  4KZA A;  3IF5 A;  5EUA A;  3Q7V A;  4U0X A;  3UO9 A;  4B4Z A;  4QJG A;  4KZ9 A;  4HES A;  5FQQ A;  1PI4 A;  4WZ5 A;  4E3L A;  5GLC A;  2ZM8 A;  3N8R A;  3V3R A;  1GA9 A;  1NY0 A;  2EFU A;  3O86 A;  2ZQA A;  1NZU A;  2V20 A;  5DF9 A;  3SOI A;  1H8Z A;  1IEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...