5TGFA

Crystal structure of putative beta-lactamase from bacteroides dorei dsm 17855
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
333
structure length
333
Chain Sequence
b'TYDFTPLDSIISSWMDKGYYPGGAICVVKNDSVLFEKAYGSFTGDTKVYVASAGKWVAAAVIGAVVDRTDLSWDDPVEKWLPQFRGDAKGGILLRQLLSHTSGVRPYLPAPRVDNYNHLDSAVTEILSLDTVFTPGTRFEYGGLAMQIAGRMAEVAMGKEFEPLFQELIAAPLGMTHSHFAPVNTDGGHAPMLGGGLCTTLNDYIRFLKMIYHNGRSGNREILKPETVQTMQADQVRNAVVAPGEYVEKALGQHHTSIYGLGEWRELVDEATGEAYQISSPGWAGAYPWINKRDGVYGFFIAHVQGEANKKDGFSSFYGSPVLSETVTKIVNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a beta-lactamase from Bacteroides dorei DSM 17855
rcsb
source organism Bacteroides dorei dsm 17855
molecule tags Hydrolase
total genus 100
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5tgfA00
4LV0A 3GQZA 3G4PA 4NETA 1I5QA 3HREA 3UO9A 1SKFA 2H0YA 2P9VB 3N6IA 4GOGA 3OPHA 3ZVTA 4E3JA 2HP6A 2A3UA 4ID4A 3Q81A 3N8RA 4EBLA 2WADA 2Y2OA 3OC2A 3PBSA 4P6BA 2WUQA 1G6AA 3HUMA 5EOEA 2Z2LB 4DKIA 1M40A 1K55C 1K56A 1FCOA 5FATA 3VP0A 4QJGA 3ZGAB 5GLBA 3C4OA 1PW8A 2OV5A 5DF9A 1CEFA 2IWCA 2XQZA 1XA1A 3HLCA 5FDHA 1RGZA 1L0EA 3BLMA 3IF6A 4KZ9A 1ALQA 1CK3A 4QHCA 1K57C 3OPLA 4N1XA 4WZ5A 3HUOA 5M1AA 3V5MA 2CC1A 3BEBA 3UE1A 4OP5A 5EVIA 1MY8A 5E2HA 1NXYA 2WAFA 4WMCD 2WYXA 4XXRA 1BULA 3VP2A 5HW3A 4QB8A 2Z2MB 3B3XA 4WM9A 1FSWA 4KG6A 4UA6A 4X53A 4GDBA 3N4IA 4DDYA 3A3EA 3DW0A 4DRTA 1NYYA 2I72A 4IBXA 4U0TA 2Q9NA 3W4OA 3WS0A 3BM6A 2ZQ8A 5F1GA 2ZQ7A 3C7VA 4FH4A 4UA7A 5GHXA 4MLLA 4LCLA 2Y2LA 3HL9A 5A90A 2WKEA 5CXWA 2Y2PA 2Y91A 4LV2A 2ZJ9A 3QNBA 1K6RA 3ZCZA 2QZ6A 1TDGA 3EQUA 3IXDA 1K4FA 4OPYA 5HARA 3WRTA 4E3NA 2HP9A 4PM6A 3FYZA 5CTNA 3E2LA 4R3JA 1BLSA 1J9MA 2X02A 5A92A 4P87A 1E25A 3AGEA 3IHAA 4X55A 1SHVA 1HZOA 4E3LA 3HLWA 3UE3A 4PM5A 4QY5A 3V39A 1KDSA 1IYQA 3PAEA 1XGJA 2ZQDA 1L0FA 5DF8A 3VMAA 4K0XA 3WS2A 3PBOA 1ESIA 4KENB 1E3UD 3G34A 3IXBA 1ES5A 2V1ZA 5AQ7A 2G2UA 1W8YA 2ZC3B 3Q7ZA 4M3KA 4OKPA 4R4RA 3QHYA 3BYDA 3GVBA 1PYYA 5G18A 4DE1A 4DXCA 5A93A 4E3OA 1XA7A 3WS4A 3NCKA 3CMZA 3ZVWA 1MWSA 1GHPA 1BUEA 3Q7VA 4PM7A 2DNSA 3CG5A 5D3OA 3ZFZA 2WAEA 3A3FA 4OOYA 2QPNA 4R0QA 5FQMA 4S2NC 4OQIA 5GLDA 3VOZA 3S4XA 1K56D 4LV1A 3BRMA 2EFXA 3EQVA 1LL9A 5FQQA 2XEPA 2XDMA 3Q1FA 3IH9A 1ONGA 2OLVA 2G2WA 3GRJA 2RL3A 3VP1A 5GHYA 2ZQ9A 3AGFA 3NBLA 2FFYA 4FH2A 4KQRA 2QMIA 4OQGA 5EVLA 4OLGA 4R23A 4JF6A 4PPRA 5F83A 4CPKA 5FAOA 1K6SA 2XF3A 2R9WA 1E3UA 1LLBA 1EROA 4GZBA 4Y0OA 2XFTA 1WYCA 1U60A 2ZQAA 3FKVA 1CI8A 5HAIA 3HLGA 4KZ6A 4S2IA 4MBFA 1JTDA 5CEDA 5M18A 3D4FA 4E3MA 4U0XA 3BFGA 1XX2A 4GDNA 5BOHA 5EVID 3HLBA 3E2KA 1K55A 3VFHA 4DE3A 4S2MA 2WGWA 2XR0A 1ZC2A 4R1GA 5FSRA 3W4PA 3WS5A 4S2OA 1HTZA 3HLDA 5FQIA 2OSUA 4X69A 5I94A 3BFCA 1MXOA 4HESA 1H5XA 5AQAA 5DTSA 1NY0A 1ES3A 1M6KA 1L0DA 4MBKA 1XXMA 3NDGA 1DJCA 4P0MA 4B4XA 4JF4A 1K57A 2P9VA 4GNUA 1IYSA 4R3BA 3OCLA 2ZLYA 4ZJ2A 1IELA 3IXGA 1YLZA 2EX6A 3QNCA 4C75A 1MWUA 1BZAA 4C3QA 1ESUA 3MKEA 3N8LA 4KZ8A 3IT9A 4EWFA 4KG2A 4RYEA 1ERQA 3I7JA 4KQQA 5CHJA 3MZFA 5GLCA 2JE5A 2WKIA 1S6RA 2ZD8A 4OONA 4X56A 4S2LA 5A91A 5DTKA 4E3KA 3HLFA 4IBRA 4JPMA 4ZAMA 2OLUA 4FD8A 5EECA 4OPQA 3WRZA 2Y2HA 1GA0A 4C6YA 4Y0TA 4K91A 3ZHHA 3NDEA 4K0WA 4YFMA 1K54A 4ZBEA 3SH7A 3IH8A 3C5AA 1I2SA 1W5DA 2Y2GA 2Y55A 1IKGA 2XLNA 3M2JA 3PBRA 4WBGA 5HL1A 1DJBA 1H8ZA 2J8YA 1YLPA 5FQKA 5GLAA 2WZZA 5AQ9A 2ZM2A 3IF6C 3VSKA 3OPRA 4MNRA 3Q07A 1KVLA 3IXHA 5HAQA 1SDNA 4BD0A 4OVDA 4LCMA 1YM1A 4FSFA 4F94A 2Q9MA 2ZM8A 1L0GA 1PWDA 3FWLA 4KZ3A 4NK3A 3VSLA 1QMEA 1AXBA 3HVFA 5AQBA 1TDLA 3ZG5A 5EUAA 4BENA 4DF6A 2HDRA 3TOIA 1VQQA 1ES4A 4UAAA 1QMFA 5JYOA 3LY3A 2ZMAA 3O86A 1LHYA 3UDXA 5FAPA 3VFFA 4S2JA 4D2OA 3FV7A 1PZPA 3G30A 1ZG4A 3N7WA 5E2GA 4OPZA 4JKTA 3ZG7B 5FASA 3UPOA 3GMWA 5U47A 4LV3A 3DTMA 1NJ4A 4MEZA 3UNWA 1LI0A 5CGSA 4RX3A 3DWZA 1H8YA 3IWOA 1VM1A 3AGDA 3P09A 3ISGA 3BFEA 2Y2NA 3SS5A 1HD8A 4DXBA 5KMWA 4DE2A 2Y4AA 4L0LA 2B5RA 1XP4A 3MKFA 4XUZA 2R9XA 1FQGA 5CHMA 4OOLA 5E43A 1PI5A 1C3BA 1ZG6A 1FOFA 5KZHA 2XH9A 1LL5A 1PZOA 4KZ4A 5KSCA 2J9PA 5FA7A 3DWKA 3IWIA 4OOMA 5DVAA 4QD4A 2X71A 3HBRA 1KGGA 3WS1A 2Y2IA 2IWDA 2P74A 3GSGA 3UDIA 1W7FA 2J9OA 5FI6A 1K4EA 1YLYA 1GA9A 3BFFA 1EWZA 3PTEA 1RCJA 5M19A 1S0WA 2C5WB 2H0TA 4N9KA 1NZUA 4B4ZA 3C7UA 4JLFA 1KE0A 4JF5A 4IVIA 3PBQA 4HBUA 1O7EA 1Y54A 2HPBA 2EX9A 2ZC6B 2EXAA 1JWPA 3SOIA 3JYIA 1TVFA 3LO7A 3SH8A 3HLEA 4A5RA 1MKIA 4WEKA 4PM8A 3BLSA 1E4DA 2JBFA 1W8QA 2WKHA 3LEZA 4OPRA 3G35A 3RXXA 3HUNA 4UA9A 4B88A 3TSGA 2WZXA 2ZM0A 3G2ZA 4Q8IA 5TFQA 3OCNA 4ZJ1A 3NC8A 2Y2JA 3M6HA 4JXWA 1ZKJA 4JBFA 2BG1A 2ZQCA 1XPBA 3A3IA 5HAPA 5DTTA 3PAGA 4FCFA 5J8XA 3ZNYA 1EI5A 3BFDA 2WGIA 1YLTA 4YINA 3V3RA 1I2WA 1MPLA 4HEFA 4DE0A 4CJNA 4WEJA 3ITAA 4S2KA 1JWZA 4Y0UA 1MWRA 4KZAA 5CGXA 1N4OA 1W79A 3N8SA 3O88A 3CZDA 3IF5A 3VOYA 4QY6A 1MBLA 3O87A 4GD8A 5KSHA 2EFUA 5L2FA 3S1YA 2JC7A 5CEBA 5F82A 4EV4A 1IYOA 4IEDA 5CTMA 2GDNA 1IYPA 2Y59A 3TG9A 3V50A 1PI4A 1BLPA 3IF6B 4N92A 4R4SA 5CGWA 4Y7PA 4EBPA 3VP4A 1XKZA 2PBYA 5FI2A 1KGFA 4JXVA 5CERA 1KVMA 4WYYA 2E8IA 4WZ4A 3P98A 2BLSA 5E2EA 3BECA 3MBZA 2XFSA 1K25A 3NIAA 5EVIB 1SDEA 4MBHA 3PBTA 4UHUA 3G2YA 3C4PA 3V3SA 4E6XA 1YLWA 4BLMA 4JXSA 4ZJ3A 3O3VA 2HP5A 3UE0A 2J7VA 1YMSA 3ZG0A 1GCEA 2EX8A 2XD1A 4Z9QA 4KG5A 4GB7A 4DDSA 1MWTA 4OP8A 3OZHA 4BD1A 2H5SA 3MZEA 4OH0A 5E2FA 4RA7A 1IKIA 5FI7A 3IWQA 1YLJA 4KZBA 1BT5A 5TR7A 2EXBA 4GKUA 1CI9A 1ONHA 2ZC7A 1KGEA 4QU3A 4U3TA 3UPNA 4WZ5C 1GHMA 2EX2A 4KQOA 4ZDXA 5FAQA 1Z6FA 4PMAA 3NI9A 4OQHA 5EVIC 1BLHA 1WYBA 1K38A 5TGFA 5EPHA 3S22A 1FR6A 3RJUA 1NZOA 1RP5A 2PU4A 3GTCA 3IHBA 1BLCA 4S2PA 1CEGA 4GD6A 3MXRA 3UDFA 3W4QA 1ERMA 1N9BA 5IHVA 3ZDJA 1OMEA 2IWBA 4OQ0A 2VGJA 4EBNA 1K54C 4HBTA 2XGNA 4IVKA 3ZG9B 5EOOA 3IQAA 1RGYA 4WELA 1FCNA 3MFDA 5CECA 1KDWA 5HFOA 3ZG8B 3SS4A 1PIOA 4EQIA 2FFFB 2WGVA 1KE4A 2Y2MA 3NY4A 3PBNA 3M2KA 1PW1A 3MZDA 3ZNTA 3FKWA 3LCEA 2A49A 4X68A 1BTLA 3SS3A 3UN7A 2ZC5B 4H8RA 4S2NA 3LY4A 4N9LA 2DCFA 2HDSA 1O07A 4BJPA 1YT4A 2VGKA 1PWCA 4WMCA 2UWXA 1TEMA 1DJAA 1HVBA 5HX9A 2V20A 5CRFA 3Q7VB 2X01A 5EE8A 1JTGA 5DF7A 4E6WA 5JYPA 5FQ9A 4KZ7A 5GL9A 3SH9A 4BQMA 3A3JA 3WWXA 1JVJA 2Y2KA 3FZCA 1FR1A 3M6BA 5GHZA 2C6WB 1SCWA 4E3IA 4O7DA 4PM9A 4LENA 2XK1A 2RCXA 3ITBA 1KE3A 4BL2A 3MXSA 2Y2QA 1G68A 3G31A 1YQSA 2JCHA 1L2SA 3GR2A 3UY6A 4BL3A 3Q82A 4X6TA 3CJMA 3A3DA 2WK0A 4EUZA 1FCMA 2DRWA 1IEMA 4RX2A 1DY6A 4OLDA 5CHUA 1GHIA 1PWGA 1Q2QA 1NRFA 4ZTKA 3VP3A 1BSGA 2XD5A 5FQJA 1NYMA 1LI9A 3G32A 2HDQA 4XUXA 3UPPA 4P85A 5F1FA 2WGWB 2V2FF 2H10A 3GV9A 1WE4A 3W8KA 2PU2A 4N1HA 1FSYA 1YMXA 3RXWA 4RVAA 1ES2A 2ZC4B 1JWVA 2HDUA 4GN2A 4KZ5A 4JXGA 1XGIA 3OPPA 1Q2PA
chains in the Genus database with same CATH superfamily
2JKRM 3GQZA 3UB6A 3N6IA 3F1NB 2J3TC 3N8RA 3NULA 2WADA 2Y2OA 3OC2A 3PBSA 5EOEA 3T1XA 3CWFA 1K55C 1K56A 1FCOA 3CI6A 1V9ZA 3KSIA 4I3IA 3E4OA 5EM0A 3IX4A 3VOLA 1TS6A 2K2NA 4HQAA 1K57C 3OPLA 3KX0X 4HH3A 2CC1A 3BEBA 1MY8A 3VP2A 4MN5A 4WMCD 3B33A 1BULA 1LSVA 2Z2MB 4KG6A 1ODVA 4UA6A 4X53A 4GDBA 3N4IA 2HGVA 4DRTA 3W4OA 3BM6A 4NXBA 3C30A 1KOUA 4PKYG 4MLLA 4JGRA 4LCLA 3H9WA 5HSQA 1OTDA 4LV2A 3QNBA 1K6RA 2QZ6A 3FYZA 2Z6CA 1J9MA 4G3VA 3AGEA 3IHAA 3LI9A 4X55A 4LGWA 4E3LA 3V39A 1KDSA 5HPIA 2PBDP 3H7WA 5AQ7A 1W8YA 4M3KA 3E4PA 3BYDA 1F5MA 5G18A 2PD8A 3ZVWA 3H82B 3T1RA 3Q7VA 3CG5A 5D3OA 3A3FA 4I38A 2VV7A 4G3KA 5FQQA 4WL9A 2P08A 1G5UA 2G2WA 3NBLA 2FFYA 3MXQA 4KQRA 4JF6A 4PPRA 4CPKA 5L10A 1WYCA 1U60A 2EWVA 2ZQAA 2OWHA 1A0KA 4S2IA 5CEDA 1JTDA 4E3MA 4U0XA 1K55A 4DE3A 4S2MA 1ZC2A 3S7NA 3W4PA 1LL8A 4GJ4A 4X69A 1MXOA 2W3DA 3E0YA 5DTSA 1NY0A 1M6KA 1XXMA 3NDGA 1GSVA 4JF4A 1K57A 4Q0JA 1IYSA 3OCLA 3IXGA 2EX6A 3QNCA 4NXEA 4C3QA 4KZ8A 1ERQA 3I7JA 4EETB 3F1OB 2WKIA 4S2LA 3HLFA 4MMNA 4FD8A 4K91A 3NDEA 3UMDA 3C5AA 2Y55A 4WBGA 4M4XA 1W63M 4F3LB 3VSKA 5HAQA 3Q07A 4BD0A 4LCMA 2HV1A 4LRYC 5DKKA 3FWLA 4NK3A 1FIKA 3VSLA 5C5KA 3ZG5A 1T1BA 5EUAA 3ULFA 2HDRA 3TOIA 4UAAA 3LY3A 2O99A 3FV7A 1PZPA 1YKDA 4OPZA 1TS7A 4JKTA 3PXPA 3DTMA 3A0RA 4MEZA 4JGQA 1LI0A 5CGSA 4RX3A 3MJQA 1VM1A 4I39A 3BFEA 3SS5A 5KMWA 2Q0OA 4L0LA 4XUZA 3MKFA 3V67A 2R9XA 2JKGA 1OJ5A 2W27A 5FA7A 3DWKA 2X71A 1KGGA 1S1YA 3H82A 1EWZA 1T18A 4B4ZA 1NZUA 3C7UA 2QKPA 4JLFA 1KE0A 3UB5P 2W0NA 3T4JA 1Y54A 3SOIA 3HLEA 1E4DA 1W8QA 2WKHA 4OPRA 5TFQA 3OCNA 3M6HA 4JBFA 2BG1A 2WKPA 5J8XA 3L9KA 4GLQA 4HEFA 1JWZA 5CGXA 3O88A 4QY6A 3O87A 2K7SA 3D9YA 4EV4A 3LIBA 5CTMA 2Y59A 3V50A 3R4KA 1OJGA 4N92A 4B93A 3RH8B 4HY8A 4JXVA 2B18A 2INWA 2VKSA 1K25A 1CQAA 1SDEA 4K08A 3MR0A 4BLMA 2HP5A 1YMSA 3ZG0A 1F98A 2H5SA 3F1OA 5FI7A 1YLJA 5F5YA 1CI9A 1D06A 3T1SA 4II7A 4U3TA 4PAUA 4KQOA 4ZDXA 4OQHA 1WYBA 2OOLA 3RJUA 1NZOA 1RP5A 3T50A 3K3DA 4ESPA 2P7JA 1ERMA 4F3LA 3JVUA 1F2KA 2VGJA 2XGNA 3ZG9B 5EOOA 1FCNA 3MFDA 1KDWA 3SS4A 1PIOA 4EQIA 2FFFB 3NY4A 4IUHA 3PBNA 1ZHHB 4Z1WA 3MZDA 2O9CA 2ZC5B 1MKMA 3LY4A 4BJPA 3ZQ5A 1PWCA 2UWXA 1DJAA 2PDRA 2V20A 1JTGA 5JYPA 4KZ7A 3SH9A 5HZHA 5J7EA 2ZL1B 4UQIS 5FDSA 3S7QA 3HJKA 5HWVA 4O7DA 2XK1A 1OTIA 2NUTC 1KE3A 3MXSA 1TF1A 5FEGA 3G31A 3LR4A 1L2SA 3GR2A 3UY6A 4BL3A 1SKOA 2JKTM 1VETB 2WK0A 4EUZA 1FCMA 1NRJA 1DY6A 3PYPA 1Q2QA 2V0UA 4HI4A 3G32A 4P85A 1FSYA 3MF0A 3RXWA 1S4SA 1JNUA 2ZOHA 2HDUA 2QJ5A 3OPPA 4JXWA 1Q2PA 5GHYA 2QJ7A 3UO9A 1SKFA 3A0SA 4CLCD 4RQ9A 4E3JA 4ID4A 3Q81A 2Z2LB 4GHIB 1M40A 5FATA 1CF0A 3ZGAB 3T4KA 5GLBA 1PW8A 3FPWA 4BMWA 2JKTI 2IWCA 1XA1A 1ALQA 4L9FA 3EWKA 5IT5A 3HUOA 4OP5A 5E2HA 2WAFA 4EESA 2KX6A 3HJIA 4WM9A 4YNRA 1S67L 3UE6A 3D72A 4U0TA 4GW9A 4Y2FA 5F1GA 5GHXA 5EV0A 2Y2LA 5A90A 4UQIM 2Y91A 4LLOB 1TDGA 3IXDA 2HP9A 1BLSA 2X02A 4HJ6A 3K3CA 1XJ2A 1SHVA 1HZOA 4YOFA 3UE3A 5DF8A 3VMAA 4H6JB 2PT7A 1ESIA 1UWPX 2V1ZA 2ZC3B 2M7VA 3GVBA 4DXCA 1PYYA 4E3OA 3WS4A 3NCKA 3CMZA 4DJ3A 1GHPA 1BUEA 3UB9A 5HDCA 1XJ3A 4IUKA 2DNSA 4GS9B 4WLAA 5FQMA 2QPNA 2M1CA 4EEUA 5GLDA 2ZL1A 1S66L 3EQVA 4QWOA 3NOPC 4G3WA 1ONGA 2OLVA 5HPFA 2JHEA 3D3OA 3VP1A 4OLGA 1BYWA 2E8JA 5FAOA 1S4RA 5KIZA 1E3UA 1VETA 4Y0OA 3LIEA 3FKVA 4KZ6A 2B95A 3D4FA 1XX2A 5BOHA 3HLBA 2WKRA 3T12B 2OSUA 1PNEA 3BFCA 5AQAA 3EOIA 4P0MA 4B4XA 4B9OA 2ZMVA 1MWUA 1BZAA 1ESUA 4GHIA 3IT9A 3BW6A 4EWFA 4KG2A 1OTAA 3MZFA 2JE5A 4OONA 2UV0E 3O5YA 3L7HA 4IBRA 4JPMA 3C8CA 2Y2HA 4K0WA 3IH8A 1I2SA 2JKRI 1F9IA 2Y2GA 3NHQA 2XLNA 2J8YA 3UB8A 5GLAA 3RFBA 5AQ9A 2IA2A 2ZM2A 3IF6C 1KVLA 3IXHA 1SDNA 2W3EA 4OVDA 5IU1A 4FSFA 3DTIA 4KZ3A 5AQBA 1TDLA 3IBJA 2V9AA 5JYOA 3O86A 4DJ2A 1ZG4A 3N7WA 2D02A 3ZG7B 1TS8A 3GMWA 4LV3A 4O8GA 1NJ4A 3UNWA 3CITA 4Y13A 3IWOA 2PAVP 3AGDA 2VA0A 2OAQ1 1NWZA 3G6OA 3VV4A 1HD8A 4DXBA 1IFQA 2PR5A 1XP4A 4H6JA 1FQGA 5CHMA 4EEPA 5E43A 1C3BA 2B02A 2XH9A 1LL5A 1YSQA 3LFVA 3IWIA 5DVAA 3JPUA 3HBRA 2Y2IA 3GSGA 3UDIA 1W7FA 2J9OA 3MS6A 3SZTA 3R7WB 1K4EA 4GS9A 2VV8A 1RCJA 2C5WB 2H0TA 1N9OA 4HBUA 4NEED 2EX9A 3SH8A 4A5RA 1MKIA 4WEKA 3RXXA 4B88A 3HUNA 2V1AA 2Y2JA 4EUVA 1ZKJA 4WUJA 5DTTA 3PAGA 3ZNYA 4HP4A 3BFDA 3IS2B 1I2WA 4S2KA 5FEFA 1MWRA 2VGLS 1W79A 3IF5A 4GD8A 4FTXA 1IYOA 4IEDA 3LIDA 3LYXA 2H28A 1BLPA 5CGWA 4Y17A 4Y7PA 2PBYA 5CERA 1KGFA 1KVMA 2GX5A 2E8IA 4WZ4A 4HJ4A 3NIAA 1YSPA 5EVIB 4UHUA 1NLZA 2HF6A 3C4PA 3G2YA 4E6XA 2J7VA 1GCEA 2EX8A 4KG5A 4BD1A 2EA9A 4OP8A 3OBFA 5E2FA 1OT6A 1IKIA 2EXBA 4I3JA 3P01A 5DFYA 1P0ZA 1KGEA 2VZWA 3UPNA 4WZ5C 2EX2A 3LR0A 5EVIC 5TGFA 4ME4A 1FR6A 3S22A 2PU4A 5EFWA 3MXRA 3LR3A 2IWBA 4OQ0A 1K54C 3B42A 4IVKA 4Q0IA 4WELA 1J3WA 2W1RA 3ZG8B 4E04A 1T1AA 2NUPC 1PW1A 3LCEA 2A49A 1W63Q 1BTLA 4H8RA 4N9LA 2HDSA 1YT4A 2VGKA 4WMCA 1HVBA 5HX9A 5EE8A 2W3FA 5F6AA 2PR6A 2PYRA 1SKOB 1JVJA 2C6WB 2QWSA 4FUWA 2LB9A 3T4OA 4LENA 2RCXA 3ITBA 4BL2A 5HD3A 2Y2QA 1G68A 2JCHA 2M7UA 3CJMA 5LBRA 2XA7S 4OLDA 1PWGA 3VP3A 1NRFA 3R7WA 2WGWB 3W8KA 5HWWA 1YMXA 1N9LA 1OT9A 1JWVA 4GN2A 1XGIA 5HDSA 4LV0A 3G4PA 3HREA 3KYZA 2P9VB 3ZVTA 3OPHA 5L07A 2HP6A 2A3UA 4EBLA 2J80A 2A2LA 2WUQA 1G6AA 3CPTB 3HUMA 3IS2A 4BBTA 3EGXC 4QJGA 3KYQA 3C4OA 1LSWA 4I3AA 2OV5A 5DF9A 4BBVA 1LSXA 1DP6A 5TBMB 2XQZA 3TW8A 4KZ9A 3OLOA 4N1XA 4WZ5A 3T1QB 3UE1A 5EVIA 5A8BA 2WYXA 5HW3A 2ZMFA 1OTEA 1FSWA 4NXFA 4GCZA 4DDYA 1T19A 3IX8A 1NYYA 2QYBA 1DP9A 1DRMA 2I72A 1MC0A 2Q9NA 1XFQA 1GSXA 4FH4A 4O0PA 1D7EA 4UA7A 2FZ0A 3HL9A 2WKEA 3IX3A 5CXWA 1LT0A 3CUEC 2Y2PA 2ZJ9A 3EQUA 4E3NA 3E2LA 4R3JA 5A92A 3HLWA 4PM5A 3GDIA 1UWNX 1XGJA 2ZQDA 1L0FA 1DP8A 4BBUA 3DBAA 2XA7M 4KENB 1E3UD 3G34A 1ES5A 2PD7A 2G2UA 3LICA 4X1LA 4OKPA 4R4RA 1H8MA 3QHYA 4DE1A 4JGOA 3EGDC 3BY8A 1MWSA 4CQHA 5HL6A 3OOVA 3ZFZA 2WAEA 4OOYA 4R0QA 4S2NC 1K56D 4LV1A 4MN6A 2EFXA 1LL9A 2PHYA 2O9BA 2O9AA 4FH2A 2QMIA 5EVLA 2G7UA 1TS0A 2R9WA 1LLBA 1EROA 4ETZA 4R70A 4LFUA 1CI8A 2VEAA 5HAIA 3HLGA 4MBFA 5AVFA 5L09A 4Q0HA 2WGWA 3WS5A 1HTZA 2JKFA 3HLDA 5FQIA 4IHQA 2HJ9C 5I94A 1L0DA 3DTEA 4R38A 2P9VA 4R3BA 2ZLYA 4LRXC 5AJGA 1IELA 1YLZA 4C75A 1VB6A 4DMZA 3MKEA 3CPTA 4RYEA 4HH2A 5CHJA 1Z09A 3T4QA 1IOUA 1S6RA 1Y4OA 5A91A 4E3KA 4ZAMA 2OLUA 5TBMA 3T4LA 1G28A 4OPQA 3WRZA 1GA0A 4Y0TA 4CLCB 4YFMA 1W5DA 1IKGA 1DJBA 1H8ZA 2WZZA 1EW0A 1YM1A 4EU0A 1OTBA 3BWLA 2Q9MA 4EERA 2ZM8A 1L0GA 1QMEA 1AXBA 4EXOA 4DF6A 3A0VA 4LPZA 1ES4A 3RTYA 4L9EA 1QMFA 4CLCC 4XT2A 1UGUA 4D2OA 1LHYA 3G30A 5E2GA 5FASA 2OWJA 3UPOA 4HJ3A 5U47A 1H8YA 1VEUB 3EEHA 2J3TD 1K0KA 3CHWP 4DE2A 2B5RA 3ICYA 4OOLA 1ZG6A 5KZHA 1PZOA 5KSCA 2J9PA 4QD4A 3WS1A 5FI6A 1P9WA 1YLYA 1GA9A 3BFFA 3EEAA 2D01A 3PTEA 5M19A 5IS1A 4IVIA 3PBQA 1O7EA 2HPBA 1CJFA 3IBRA 1JWPA 3JYIA 3LO7A 4PM8A 3BLSA 2A24B 4Q8IA 3TSGA 2WZXA 1L3LA 4ZJ1A 2L4RA 2ZQCA 3A3IA 4EW7A 5HAPA 2W3GA 1H3QA 1YLTA 2WGIA 2Y79A 4YINA 3U2AA 5EVEA 2DMWA 4CJNA 4WEJA 3ITAA 4Y0UA 5FL3A 3N8SA 3NOTC 5KSHA 1MBLA 2W3HA 4WN5A 5CEBA 2FH5A 3LUQA 2GDNA 1IYPA 3TG9A 1PI4A 3IF6B 4R4SA 5DJUA 4EBPA 3VP4A 5FI2A 4HHDA 4WYYA 4X25A 2BLSA 5E2EA 1N9NA 2ACGA 3MQOA 4MBHA 3PBTA 3V3SA 1YLWA 4ZJ3A 3O3VA 3UE0A 4R6LA 3E98A 4GB7A 3OZHA 3MZEA 4OH0A 4HP9A 4KZBA 2ZOIA 1BT5A 5L8MA 1ONHA 5F69A 2ZC7A 2VX8A 4QU3A 1VHMA 1GHMA 5DKLA 1Z6FA 4CLCA 1K38A 5G4YA 5EPHA 3ZYTA 4GD6A 2W1TB 3UDFA 3LEQA 1X0OA 3ZDJA 1OMEA 4KQDA 4HBTA 4IJGA 3IQAA 1RGYA 5CECA 5HFOA 5G4ZA 1KE4A 2Y2MA 3M2KA 2ZBBA 3FPVA 3FKWA 4X68A 3SS3A 3UN7A 2DCFA 1O07A 5DFXA 1TEMA 5CRFA 2X01A 3QP2A 4E6WA 5FQ9A 3S7OA 5GL9A 1VEUA 3LGOA 3WWXA 2Y2KA 1AWIA 1FR1A 3KSGA 5GHZA 4E3IA 3E4QA 2VV6A 4ZRRA 3BQAA 3A3DA 2DRWA 4RX2A 4ARZB 4ZTKA 1BSGA 2XD5A 1LI9A 2V1BA 4XUXA 3UPPA 2H10A 1WE4A 3F1PB 3DAVA 4RVAA 1ES2A 2GNXA 4QHCA 4KZ5A 4JXGA 5EVID 4BWIA 2A24A 4NETA 1I5QA 3CLOA 2H0YA 4GOGA 2K31A 2VJWA 3LIAA 4P6BA 4DKIA 2L0WA 1YAXA 3PHYA 3VP0A 4HNBA 3QP8A 2VK3A 1CEFA 3LI8A 3F1NA 2PRFA 3HLCA 5FDHA 1RGZA 1L0EA 3BLMA 3IF6A 1CK3A 3LIFA 4O01A 5M1AA 3UMEA 3V5MA 3MQ0A 1P9RA 1NXYA 1G6OA 4XXRA 4QB8A 3B3XA 4ETXA 2R78A 2XSSA 3QP1A 3A3EA 3DW0A 5HDDA 4IBXA 3WS0A 2ZQ8A 2ZQ7A 3C7VA 1PFLA 4I5SA 2VLGA 3NECA 5HWTA 3ZCZA 3KYEA 4MCWA 4OPYA 1K4FA 5HARA 3WRTA 5DJTA 4PM6A 2W1TA 5CTNA 4P87A 1E25A 3S7PA 1Y28A 4QY5A 1IYQA 1GSWA 3PAEA 3FG8A 4NXGA 4K0XA 3WS2A 4Y3IA 3DTKA 3PBOA 3IXBA 3BQ8A 4CLCE 3Q7ZA 3VE3A 5A93A 2L1MA 1XA7A 3TJZC 5J3WA 2OAP1 4PM7A 2V8FA 2VGLM 1NLYA 4OQIA 3VOZA 3S4XA 3BRMA 3CAXA 2XEPA 2XDMA 3Q1FA 3IH9A 4HIAA 3GRJA 4L9GA 2RL3A 1XJ6A 2ZQ9A 3AGFA 3JVVA 4OQGA 4R23A 5F83A 4PKYA 1K6SA 2XF3A 4GZBA 2XFTA 4ARZA 1ACFA 2KLIA 5M18A 3BFGA 3MMHA 4GDNA 3VFHA 3E2KA 3HCYA 3T4TA 2XR0A 4R1GA 2EWWA 5FSRA 4NG2A 4S2OA 1FILA 3F1PA 3C38A 4HESA 1H5XA 2YKHA 1OPXA 1ES3A 2HJEA 4MBKA 1DJCA 4GNUA 4ZJ2A 1PRQA 2PYPA 3N8LA 4KQQA 5GLCA 2ZD8A 5TJJA 4X56A 5DTKA 3T4SA 5EECA 4C6YA 1STZA 3QP4A 3ZHHA 4ZBEA 1K54A 3SH7A 5J4EA 3PBRA 4P6ZS 3M2JA 2I9VA 2LB5A 5HL1A 1YLPA 5FQKA 1YPRA 2KDKA 3GECA 4XT2B 1ZTUA 3TE8A 3OPRA 4MNRA 4EQ1A 4F94A 1XFNA 1PWDA 3HVFA 4R3AA 4YWZA 4BENA 1VQQA 2ZMAA 3UDXA 3VFFA 5FAPA 4S2JA 2J3WA 4UEYA 4JGPA 3BY9A 3DWZA 5EM1A 1SZVA 2WKQA 3P09A 3ISGA 3K2NA 2Y2NA 2Y4AA 2HZ5A 4X1MA 3QP6A 4Y5FA 1PI5A 1FOFA 2GZAA 4KZ4A 5CX7A 4OOMA 2QHKA 2KOIA 2IWDA 2XROA 2P74A 2AVXA 1XJ4A 4AFIA 1S0WA 4N9KA 3BJNA 5AVEA 4JF5A 2BTFP 4Y15A 3KSFA 3VE4A 2ZC6B 2EXAA 4LRZE 2P04A 1TVFA 5K5BA 3LEZA 2JBFA 3TRCA 2Y8HA 3G35A 4UA9A 2ZM0A 3G2ZA 3NC8A 4DN0A 1MZUA 1XPBA 4FCFA 3FC7A 1EI5A 3V3RA 1MPLA 2V8CA 4DE0A 4KZAA 1N4OA 4FOFA 3CZDA 3VOYA 1V9YA 2EFUA 5L2FA 3S1YA 2JC7A 3UB7A 5F82A 4P6ZM 4MDZA 1XKZA 2V0WA 2XRNA 3P98A 2JN7A 3BECA 3MBZA 2XFSA 1H0MA 3MQQA 1P97A 4JXSA 2XD1A 4Z9QA 4DDSA 1MWTA 3SW1A 4RA7A 3CUEA 3IWQA 3NOUC 5TR7A 4GKUA 4NKPA 1T1CA 5FAQA 4PMAA 3NI9A 4PHTA 1BLHA 3GTCA 3NJAA 1WA9A 3B47A 3IHBA 1BLCA 2O0YA 4S2PA 1CEGA 3W4QA 5HD5A 1N9BA 5IHVA 4EBNA 3P7NA 4D60A 2YKFA 1HLUP 3KSHA 3U4LP 3H7WB 2WGVA 5F68A 3KO6A 4MN7A 3ZNTA 5MC7A 2BASA 4S2NA 3MFXA 1D1JA 4KUKA 3Q7VB 5DF7A 4WF0A 4BQMA 3A3JA 3FZCA 3M6BA 2CMNA 5I5LA 1SCWA 4PM9A 2GJ3A 3MSHA 4QPRA 1YQSA 1TD5A 3C2WA 3Q82A 4X6TA 4HOIA 2MJ6A 1S1ZA 1IEMA 5CHUA 1GHIA 5FQJA 3QP5A 3PR6A 1NYMA 2HDQA 3LR5A 5F1FA 2V2FF 3GV9A 2PU2A 4N1HA 2Z6DA 4KUOA 3W2ZA 2ZC4B
chains in the Genus database with same CATH topology
4LV0A 3GQZA 3G4PA 4NETA 1I5QA 3HREA 3UO9A 1SKFA 2H0YA 2P9VB 3N6IA 4GOGA 3OPHA 3ZVTA 4E3JA 2HP6A 2A3UA 4ID4A 3Q81A 3N8RA 4EBLA 2WADA 2Y2OA 3OC2A 3PBSA 4P6BA 2WUQA 1G6AA 3HUMA 5EOEA 2Z2LB 4DKIA 1M40A 1K55C 1K56A 1FCOA 5FATA 3VP0A 4QJGA 3ZGAB 5GLBA 3C4OA 1PW8A 2OV5A 5DF9A 1CEFA 2IWCA 2XQZA 1XA1A 3HLCA 5FDHA 1RGZA 1L0EA 3BLMA 3IF6A 4KZ9A 1ALQA 1CK3A 4QHCA 1K57C 3OPLA 4N1XA 4WZ5A 3HUOA 5M1AA 3V5MA 2CC1A 3BEBA 3UE1A 4OP5A 5EVIA 1MY8A 5E2HA 1NXYA 2WAFA 4WMCD 2WYXA 4XXRA 1BULA 3VP2A 5HW3A 4QB8A 2Z2MB 3B3XA 4WM9A 1FSWA 4KG6A 4UA6A 4X53A 4GDBA 3N4IA 4DDYA 3A3EA 3DW0A 4DRTA 1NYYA 2I72A 4IBXA 4U0TA 2Q9NA 3W4OA 3WS0A 3BM6A 2ZQ8A 5F1GA 2ZQ7A 3C7VA 4FH4A 4UA7A 5GHXA 4MLLA 4LCLA 2Y2LA 3HL9A 5A90A 2WKEA 5CXWA 2Y2PA 2Y91A 4LV2A 2ZJ9A 3QNBA 1K6RA 3ZCZA 2QZ6A 1TDGA 3EQUA 3IXDA 1K4FA 4OPYA 5HARA 3WRTA 4E3NA 2HP9A 4PM6A 3FYZA 5CTNA 3E2LA 4R3JA 1BLSA 1J9MA 2X02A 5A92A 4P87A 1E25A 3AGEA 3IHAA 4X55A 1SHVA 1HZOA 4E3LA 3HLWA 3UE3A 4PM5A 4QY5A 3V39A 1KDSA 1IYQA 3PAEA 1XGJA 2ZQDA 1L0FA 5DF8A 3VMAA 4K0XA 3WS2A 3PBOA 1ESIA 4KENB 1E3UD 3G34A 3IXBA 1ES5A 2V1ZA 5AQ7A 2G2UA 1W8YA 2ZC3B 3Q7ZA 4M3KA 4OKPA 4R4RA 3QHYA 3BYDA 3GVBA 1PYYA 5G18A 4DE1A 4DXCA 5A93A 4E3OA 1XA7A 3WS4A 3NCKA 3CMZA 3ZVWA 1MWSA 1GHPA 1BUEA 3Q7VA 4PM7A 2DNSA 3CG5A 5D3OA 3ZFZA 2WAEA 3A3FA 4OOYA 2QPNA 4R0QA 5FQMA 4S2NC 4OQIA 5GLDA 3VOZA 3S4XA 1K56D 4LV1A 3BRMA 2EFXA 3EQVA 1LL9A 5FQQA 2XEPA 2XDMA 3Q1FA 3IH9A 1ONGA 2OLVA 2G2WA 3GRJA 2RL3A 3VP1A 5GHYA 2ZQ9A 3AGFA 3NBLA 2FFYA 4FH2A 4KQRA 2QMIA 4OQGA 5EVLA 4OLGA 4R23A 4JF6A 4PPRA 5F83A 4CPKA 5FAOA 1K6SA 2XF3A 2R9WA 1E3UA 1LLBA 1EROA 4GZBA 4Y0OA 2XFTA 1WYCA 1U60A 2ZQAA 3FKVA 1CI8A 5HAIA 3HLGA 4KZ6A 4S2IA 4MBFA 1JTDA 5CEDA 5M18A 3D4FA 4E3MA 4U0XA 3BFGA 1XX2A 4GDNA 5BOHA 5EVID 3HLBA 3E2KA 1K55A 3VFHA 4DE3A 4S2MA 2WGWA 2XR0A 1ZC2A 4R1GA 5FSRA 3W4PA 3WS5A 4S2OA 1HTZA 3HLDA 5FQIA 2OSUA 4X69A 5I94A 3BFCA 1MXOA 4HESA 1H5XA 5AQAA 5DTSA 1NY0A 1ES3A 1M6KA 1L0DA 4MBKA 1XXMA 3NDGA 1DJCA 4P0MA 4B4XA 4JF4A 1K57A 2P9VA 4GNUA 1IYSA 4R3BA 3OCLA 2ZLYA 4ZJ2A 1IELA 3IXGA 1YLZA 2EX6A 3QNCA 4C75A 1MWUA 1BZAA 4C3QA 1ESUA 3MKEA 3N8LA 4KZ8A 3IT9A 4EWFA 4KG2A 4RYEA 1ERQA 3I7JA 4KQQA 5CHJA 3MZFA 5GLCA 2JE5A 2WKIA 1S6RA 2ZD8A 4OONA 4X56A 4S2LA 5A91A 5DTKA 4E3KA 3HLFA 4IBRA 4JPMA 4ZAMA 2OLUA 4FD8A 5EECA 4OPQA 3WRZA 2Y2HA 1GA0A 4C6YA 4Y0TA 4K91A 3ZHHA 3NDEA 4K0WA 4YFMA 1K54A 4ZBEA 3SH7A 3IH8A 3C5AA 1I2SA 1W5DA 2Y2GA 2Y55A 1IKGA 2XLNA 3M2JA 3PBRA 4WBGA 5HL1A 1DJBA 1H8ZA 2J8YA 1YLPA 5FQKA 5GLAA 2WZZA 5AQ9A 2ZM2A 3IF6C 3VSKA 3OPRA 4MNRA 3Q07A 1KVLA 3IXHA 5HAQA 1SDNA 4BD0A 4OVDA 4LCMA 1YM1A 4FSFA 4F94A 2Q9MA 2ZM8A 1L0GA 1PWDA 3FWLA 4KZ3A 4NK3A 3VSLA 1QMEA 1AXBA 3HVFA 5AQBA 1TDLA 3ZG5A 5EUAA 4BENA 4DF6A 2HDRA 3TOIA 1VQQA 1ES4A 4UAAA 1QMFA 5JYOA 3LY3A 2ZMAA 3O86A 1LHYA 3UDXA 5FAPA 3VFFA 4S2JA 4D2OA 3FV7A 1PZPA 3G30A 1ZG4A 3N7WA 5E2GA 4OPZA 4JKTA 3ZG7B 5FASA 3UPOA 3GMWA 5U47A 4LV3A 3DTMA 1NJ4A 4MEZA 3UNWA 1LI0A 5CGSA 4RX3A 3DWZA 1H8YA 3IWOA 1VM1A 3AGDA 3P09A 3ISGA 3BFEA 2Y2NA 3SS5A 1HD8A 4DXBA 5KMWA 4DE2A 2Y4AA 4L0LA 2B5RA 1XP4A 3MKFA 4XUZA 2R9XA 1FQGA 5CHMA 4OOLA 5E43A 1PI5A 1C3BA 1ZG6A 1FOFA 5KZHA 2XH9A 1LL5A 1PZOA 4KZ4A 5KSCA 2J9PA 5FA7A 3DWKA 3IWIA 4OOMA 5DVAA 4QD4A 2X71A 3HBRA 1KGGA 3WS1A 2Y2IA 2IWDA 2P74A 3GSGA 3UDIA 1W7FA 2J9OA 5FI6A 1K4EA 1YLYA 1GA9A 3BFFA 1EWZA 3PTEA 1RCJA 5M19A 1S0WA 2C5WB 2H0TA 4N9KA 1NZUA 4B4ZA 3C7UA 4JLFA 1KE0A 4JF5A 4IVIA 3PBQA 4HBUA 1O7EA 1Y54A 2HPBA 2EX9A 2ZC6B 2EXAA 1JWPA 3SOIA 3JYIA 1TVFA 3LO7A 3SH8A 3HLEA 4A5RA 1MKIA 4WEKA 4PM8A 3BLSA 1E4DA 2JBFA 1W8QA 2WKHA 3LEZA 4OPRA 3G35A 3RXXA 3HUNA 4UA9A 4B88A 3TSGA 2WZXA 2ZM0A 3G2ZA 4Q8IA 5TFQA 3OCNA 4ZJ1A 3NC8A 2Y2JA 3M6HA 4JXWA 1ZKJA 4JBFA 2BG1A 2ZQCA 1XPBA 3A3IA 5HAPA 5DTTA 3PAGA 4FCFA 5J8XA 3ZNYA 1EI5A 3BFDA 2WGIA 1YLTA 4YINA 3V3RA 1I2WA 1MPLA 4HEFA 4DE0A 4CJNA 4WEJA 3ITAA 4S2KA 1JWZA 4Y0UA 1MWRA 4KZAA 5CGXA 1N4OA 1W79A 3N8SA 3O88A 3CZDA 3IF5A 3VOYA 4QY6A 1MBLA 3O87A 4GD8A 5KSHA 2EFUA 5L2FA 3S1YA 2JC7A 5CEBA 5F82A 4EV4A 1IYOA 4IEDA 5CTMA 2GDNA 1IYPA 2Y59A 3TG9A 3V50A 1PI4A 1BLPA 3IF6B 4N92A 4R4SA 5CGWA 4Y7PA 4EBPA 3VP4A 1XKZA 2PBYA 5FI2A 1KGFA 4JXVA 5CERA 1KVMA 4WYYA 2E8IA 4WZ4A 3P98A 2BLSA 5E2EA 3BECA 3MBZA 2XFSA 1K25A 3NIAA 5EVIB 1SDEA 4MBHA 3PBTA 4UHUA 3G2YA 3C4PA 3V3SA 4E6XA 1YLWA 4BLMA 4JXSA 4ZJ3A 3O3VA 2HP5A 3UE0A 2J7VA 1YMSA 3ZG0A 1GCEA 2EX8A 2XD1A 4Z9QA 4KG5A 4GB7A 4DDSA 1MWTA 4OP8A 3OZHA 4BD1A 2H5SA 3MZEA 4OH0A 5E2FA 4RA7A 1IKIA 5FI7A 3IWQA 1YLJA 4KZBA 1BT5A 5TR7A 2EXBA 4GKUA 1CI9A 1ONHA 2ZC7A 1KGEA 4QU3A 4U3TA 3UPNA 4WZ5C 1GHMA 2EX2A 4KQOA 4ZDXA 5FAQA 1Z6FA 4PMAA 3NI9A 4OQHA 5EVIC 1BLHA 1WYBA 1K38A 5TGFA 5EPHA 3S22A 1FR6A 3RJUA 1NZOA 1RP5A 2PU4A 3GTCA 3IHBA 1BLCA 4S2PA 1CEGA 4GD6A 3MXRA 3UDFA 3W4QA 1ERMA 1N9BA 5IHVA 3ZDJA 1OMEA 2IWBA 4OQ0A 2VGJA 4EBNA 1K54C 4HBTA 2XGNA 4IVKA 3ZG9B 5EOOA 3IQAA 1RGYA 4WELA 1FCNA 3MFDA 5CECA 1KDWA 5HFOA 3ZG8B 3SS4A 1PIOA 4EQIA 2FFFB 2WGVA 1KE4A 2Y2MA 3NY4A 3PBNA 3M2KA 1PW1A 3MZDA 3ZNTA 3FKWA 3LCEA 2A49A 4X68A 1BTLA 3SS3A 3UN7A 2ZC5B 4H8RA 4S2NA 3LY4A 4N9LA 2DCFA 2HDSA 1O07A 4BJPA 1YT4A 2VGKA 1PWCA 4WMCA 2UWXA 1TEMA 1DJAA 1HVBA 5HX9A 2V20A 5CRFA 3Q7VB 2X01A 5EE8A 1JTGA 5DF7A 4E6WA 5JYPA 5FQ9A 4KZ7A 5GL9A 3SH9A 4BQMA 3A3JA 3WWXA 1JVJA 2Y2KA 3FZCA 1FR1A 3M6BA 5GHZA 2C6WB 1SCWA 4E3IA 4O7DA 4PM9A 4LENA 2XK1A 2RCXA 3ITBA 1KE3A 4BL2A 3MXSA 2Y2QA 1G68A 3G31A 1YQSA 2JCHA 1L2SA 3GR2A 3UY6A 4BL3A 3Q82A 4X6TA 3CJMA 3A3DA 2WK0A 4EUZA 1FCMA 2DRWA 1IEMA 4RX2A 1DY6A 4OLDA 5CHUA 1GHIA 1PWGA 1Q2QA 1NRFA 4ZTKA 3VP3A 1BSGA 2XD5A 5FQJA 1NYMA 1LI9A 3G32A 2HDQA 4XUXA 3UPPA 4P85A 5F1FA 2WGWB 2V2FF 2H10A 3GV9A 1WE4A 3W8KA 2PU2A 4N1HA 1FSYA 1YMXA 3RXWA 4RVAA 1ES2A 2ZC4B 1JWVA 2HDUA 4GN2A 4KZ5A 4JXGA 1XGIA 3OPPA 1Q2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LV0 A;  3GQZ A;  3G4P A;  4NET A;  1I5Q A;  3HRE A;  3UO9 A;  1SKF A;  2H0Y A;  2P9V B;  3N6I A;  4GOG A;  3OPH A;  3ZVT A;  4E3J A;  2HP6 A;  2A3U A;  4ID4 A;  3Q81 A;  3N8R A;  4EBL A;  2WAD A;  2Y2O A;  3OC2 A;  3PBS A;  4P6B A;  2WUQ A;  1G6A A;  3HUM A;  5EOE A;  2Z2L B;  4DKI A;  1M40 A;  1K55 C;  1K56 A;  1FCO A;  5FAT A;  3VP0 A;  4QJG A;  3ZGA B;  5GLB A;  3C4O A;  1PW8 A;  2OV5 A;  5DF9 A;  1CEF A;  2IWC A;  2XQZ A;  1XA1 A;  3HLC A;  5FDH A;  1RGZ A;  1L0E A;  3BLM A;  3IF6 A;  4KZ9 A;  1ALQ A;  1CK3 A;  4QHC A;  1K57 C;  3OPL A;  4N1X A;  4WZ5 A;  3HUO A;  5M1A A;  3V5M A;  2CC1 A;  3BEB A;  3UE1 A;  4OP5 A;  5EVI A;  1MY8 A;  5E2H A;  1NXY A;  2WAF A;  4WMC D;  2WYX A;  4XXR A;  1BUL A;  3VP2 A;  5HW3 A;  4QB8 A;  2Z2M B;  3B3X A;  4WM9 A;  1FSW A;  4KG6 A;  4UA6 A;  4X53 A;  4GDB A;  3N4I A;  4DDY A;  3A3E A;  3DW0 A;  4DRT A;  1NYY A;  2I72 A;  4IBX A;  4U0T A;  2Q9N A;  3W4O A;  3WS0 A;  3BM6 A;  2ZQ8 A;  5F1G A;  2ZQ7 A;  3C7V A;  4FH4 A;  4UA7 A;  5GHX A;  4MLL A;  4LCL A;  2Y2L A;  3HL9 A;  5A90 A;  2WKE A;  5CXW A;  2Y2P A;  2Y91 A;  4LV2 A;  2ZJ9 A;  3QNB A;  1K6R A;  3ZCZ A;  2QZ6 A;  1TDG A;  3EQU A;  3IXD A;  1K4F A;  4OPY A;  5HAR A;  3WRT A;  4E3N A;  2HP9 A;  4PM6 A;  3FYZ A;  5CTN A;  3E2L A;  4R3J A;  1BLS A;  1J9M A;  2X02 A;  5A92 A;  4P87 A;  1E25 A;  3AGE A;  3IHA A;  4X55 A;  1SHV A;  1HZO A;  4E3L A;  3HLW A;  3UE3 A;  4PM5 A;  4QY5 A;  3V39 A;  1KDS A;  1IYQ A;  3PAE A;  1XGJ A;  2ZQD A;  1L0F A;  5DF8 A;  3VMA A;  4K0X A;  3WS2 A;  3PBO A;  1ESI A;  4KEN B;  1E3U D;  3G34 A;  3IXB A;  1ES5 A;  2V1Z A;  5AQ7 A;  2G2U A;  1W8Y A;  2ZC3 B;  3Q7Z A;  4M3K A;  4OKP A;  4R4R A;  3QHY A;  3BYD A;  3GVB A;  1PYY A;  5G18 A;  4DE1 A;  4DXC A;  5A93 A;  4E3O A;  1XA7 A;  3WS4 A;  3NCK A;  3CMZ A;  3ZVW A;  1MWS A;  1GHP A;  1BUE A;  3Q7V A;  4PM7 A;  2DNS A;  3CG5 A;  5D3O A;  3ZFZ A;  2WAE A;  3A3F A;  4OOY A;  2QPN A;  4R0Q A;  5FQM A;  4S2N C;  4OQI A;  5GLD A;  3VOZ A;  3S4X A;  1K56 D;  4LV1 A;  3BRM A;  2EFX A;  3EQV A;  1LL9 A;  5FQQ A;  2XEP A;  2XDM A;  3Q1F A;  3IH9 A;  1ONG A;  2OLV A;  2G2W A;  3GRJ A;  2RL3 A;  3VP1 A;  5GHY A;  2ZQ9 A;  3AGF A;  3NBL A;  2FFY A;  4FH2 A;  4KQR A;  2QMI A;  4OQG A;  5EVL A;  4OLG A;  4R23 A;  4JF6 A;  4PPR A;  5F83 A;  4CPK A;  5FAO A;  1K6S A;  2XF3 A;  2R9W A;  1E3U A;  1LLB A;  1ERO A;  4GZB A;  4Y0O A;  2XFT A;  1WYC A;  1U60 A;  2ZQA A;  3FKV A;  1CI8 A;  5HAI A;  3HLG A;  4KZ6 A;  4S2I A;  4MBF A;  1JTD A;  5CED A;  5M18 A;  3D4F A;  4E3M A;  4U0X A;  3BFG A;  1XX2 A;  4GDN A;  5BOH A;  5EVI D;  3HLB A;  3E2K A;  1K55 A;  3VFH A;  4DE3 A;  4S2M A;  2WGW A;  2XR0 A;  1ZC2 A;  4R1G A;  5FSR A;  3W4P A;  3WS5 A;  4S2O A;  1HTZ A;  3HLD A;  5FQI A;  2OSU A;  4X69 A;  5I94 A;  3BFC A;  1MXO A;  4HES A;  1H5X A;  5AQA A;  5DTS A;  1NY0 A;  1ES3 A;  1M6K A;  1L0D A;  4MBK A;  1XXM A;  3NDG A;  1DJC A;  4P0M A;  4B4X A;  4JF4 A;  1K57 A;  2P9V A;  4GNU A;  1IYS A;  4R3B A;  3OCL A;  2ZLY A;  4ZJ2 A;  1IEL A;  3IXG A;  1YLZ A;  2EX6 A;  3QNC A;  4C75 A;  1MWU A;  1BZA A;  4C3Q A;  1ESU A;  3MKE A;  3N8L A;  4KZ8 A;  3IT9 A;  4EWF A;  4KG2 A;  4RYE A;  1ERQ A;  3I7J A;  4KQQ A;  5CHJ A;  3MZF A;  5GLC A;  2JE5 A;  2WKI A;  1S6R A;  2ZD8 A;  4OON A;  4X56 A;  4S2L A;  5A91 A;  5DTK A;  4E3K A;  3HLF A;  4IBR A;  4JPM A;  4ZAM A;  2OLU A;  4FD8 A;  5EEC A;  4OPQ A;  3WRZ A;  2Y2H A;  1GA0 A;  4C6Y A;  4Y0T A;  4K91 A;  3ZHH A;  3NDE A;  4K0W A;  4YFM A;  1K54 A;  4ZBE A;  3SH7 A;  3IH8 A;  3C5A A;  1I2S A;  1W5D A;  2Y2G A;  2Y55 A;  1IKG A;  2XLN A;  3M2J A;  3PBR A;  4WBG A;  5HL1 A;  1DJB A;  1H8Z A;  2J8Y A;  1YLP A;  5FQK A;  5GLA A;  2WZZ A;  5AQ9 A;  2ZM2 A;  3IF6 C;  3VSK A;  3OPR A;  4MNR A;  3Q07 A;  1KVL A;  3IXH A;  5HAQ A;  1SDN A;  4BD0 A;  4OVD A;  4LCM A;  1YM1 A;  4FSF A;  4F94 A;  2Q9M A;  2ZM8 A;  1L0G A;  1PWD A;  3FWL A;  4KZ3 A;  4NK3 A;  3VSL A;  1QME A;  1AXB A;  3HVF A;  5AQB A;  1TDL A;  3ZG5 A;  5EUA A;  4BEN A;  4DF6 A;  2HDR A;  3TOI A;  1VQQ A;  1ES4 A;  4UAA A;  1QMF A;  5JYO A;  3LY3 A;  2ZMA A;  3O86 A;  1LHY A;  3UDX A;  5FAP A;  3VFF A;  4S2J A;  4D2O A;  3FV7 A;  1PZP A;  3G30 A;  1ZG4 A;  3N7W A;  5E2G A;  4OPZ A;  4JKT A;  3ZG7 B;  5FAS A;  3UPO A;  3GMW A;  5U47 A;  4LV3 A;  3DTM A;  1NJ4 A;  4MEZ A;  3UNW A;  1LI0 A;  5CGS A;  4RX3 A;  3DWZ A;  1H8Y A;  3IWO A;  1VM1 A;  3AGD A;  3P09 A;  3ISG A;  3BFE A;  2Y2N A;  3SS5 A;  1HD8 A;  4DXB A;  5KMW A;  4DE2 A;  2Y4A A;  4L0L A;  2B5R A;  1XP4 A;  3MKF A;  4XUZ A;  2R9X A;  1FQG A;  5CHM A;  4OOL A;  5E43 A;  1PI5 A;  1C3B A;  1ZG6 A;  1FOF A;  5KZH A;  2XH9 A;  1LL5 A;  1PZO A;  4KZ4 A;  5KSC A;  2J9P A;  5FA7 A;  3DWK A;  3IWI A;  4OOM A;  5DVA A;  4QD4 A;  2X71 A;  3HBR A;  1KGG A;  3WS1 A;  2Y2I A;  2IWD A;  2P74 A;  3GSG A;  3UDI A;  1W7F A;  2J9O A;  5FI6 A;  1K4E A;  1YLY A;  1GA9 A;  3BFF A;  1EWZ A;  3PTE A;  1RCJ A;  5M19 A;  1S0W A;  2C5W B;  2H0T A;  4N9K A;  1NZU A;  4B4Z A;  3C7U A;  4JLF A;  1KE0 A;  4JF5 A;  4IVI A;  3PBQ A;  4HBU A;  1O7E A;  1Y54 A;  2HPB A;  2EX9 A;  2ZC6 B;  2EXA A;  1JWP A;  3SOI A;  3JYI A;  1TVF A;  3LO7 A;  3SH8 A;  3HLE A;  4A5R A;  1MKI A;  4WEK A;  4PM8 A;  3BLS A;  1E4D A;  2JBF A;  1W8Q A;  2WKH A;  3LEZ A;  4OPR A;  3G35 A;  3RXX A;  3HUN A;  4UA9 A;  4B88 A;  3TSG A;  2WZX A;  2ZM0 A;  3G2Z A;  4Q8I A;  5TFQ A;  3OCN A;  4ZJ1 A;  3NC8 A;  2Y2J A;  3M6H A;  4JXW A;  1ZKJ A;  4JBF A;  2BG1 A;  2ZQC A;  1XPB A;  3A3I A;  5HAP A;  5DTT A;  3PAG A;  4FCF A;  5J8X A;  3ZNY A;  1EI5 A;  3BFD A;  2WGI A;  1YLT A;  4YIN A;  3V3R A;  1I2W A;  1MPL A;  4HEF A;  4DE0 A;  4CJN A;  4WEJ A;  3ITA A;  4S2K A;  1JWZ A;  4Y0U A;  1MWR A;  4KZA A;  5CGX A;  1N4O A;  1W79 A;  3N8S A;  3O88 A;  3CZD A;  3IF5 A;  3VOY A;  4QY6 A;  1MBL A;  3O87 A;  4GD8 A;  5KSH A;  2EFU A;  5L2F A;  3S1Y A;  2JC7 A;  5CEB A;  5F82 A;  4EV4 A;  1IYO A;  4IED A;  5CTM A;  2GDN A;  1IYP A;  2Y59 A;  3TG9 A;  3V50 A;  1PI4 A;  1BLP A;  3IF6 B;  4N92 A;  4R4S A;  5CGW A;  4Y7P A;  4EBP A;  3VP4 A;  1XKZ A;  2PBY A;  5FI2 A;  1KGF A;  4JXV A;  5CER A;  1KVM A;  4WYY A;  2E8I A;  4WZ4 A;  3P98 A;  2BLS A;  5E2E A;  3BEC A;  3MBZ A;  2XFS A;  1K25 A;  3NIA A;  5EVI B;  1SDE A;  4MBH A;  3PBT A;  4UHU A;  3G2Y A;  3C4P A;  3V3S A;  4E6X A;  1YLW A;  4BLM A;  4JXS A;  4ZJ3 A;  3O3V A;  2HP5 A;  3UE0 A;  2J7V A;  1YMS A;  3ZG0 A;  1GCE A;  2EX8 A;  2XD1 A;  4Z9Q A;  4KG5 A;  4GB7 A;  4DDS A;  1MWT A;  4OP8 A;  3OZH A;  4BD1 A;  2H5S A;  3MZE A;  4OH0 A;  5E2F A;  4RA7 A;  1IKI A;  5FI7 A;  3IWQ A;  1YLJ A;  4KZB A;  1BT5 A;  5TR7 A;  2EXB A;  4GKU A;  1CI9 A;  1ONH A;  2ZC7 A;  1KGE A;  4QU3 A;  4U3T A;  3UPN A;  4WZ5 C;  1GHM A;  2EX2 A;  4KQO A;  4ZDX A;  5FAQ A;  1Z6F A;  4PMA A;  3NI9 A;  4OQH A;  5EVI C;  1BLH A;  1WYB A;  1K38 A;  5TGF A;  5EPH A;  3S22 A;  1FR6 A;  3RJU A;  1NZO A;  1RP5 A;  2PU4 A;  3GTC A;  3IHB A;  1BLC A;  4S2P A;  1CEG A;  4GD6 A;  3MXR A;  3UDF A;  3W4Q A;  1ERM A;  1N9B A;  5IHV A;  3ZDJ A;  1OME A;  2IWB A;  4OQ0 A;  2VGJ A;  4EBN A;  1K54 C;  4HBT A;  2XGN A;  4IVK A;  3ZG9 B;  5EOO A;  3IQA A;  1RGY A;  4WEL A;  1FCN A;  3MFD A;  5CEC A;  1KDW A;  5HFO A;  3ZG8 B;  3SS4 A;  1PIO A;  4EQI A;  2FFF B;  2WGV A;  1KE4 A;  2Y2M A;  3NY4 A;  3PBN A;  3M2K A;  1PW1 A;  3MZD A;  3ZNT A;  3FKW A;  3LCE A;  2A49 A;  4X68 A;  1BTL A;  3SS3 A;  3UN7 A;  2ZC5 B;  4H8R A;  4S2N A;  3LY4 A;  4N9L A;  2DCF A;  2HDS A;  1O07 A;  4BJP A;  1YT4 A;  2VGK A;  1PWC A;  4WMC A;  2UWX A;  1TEM A;  1DJA A;  1HVB A;  5HX9 A;  2V20 A;  5CRF A;  3Q7V B;  2X01 A;  5EE8 A;  1JTG A;  5DF7 A;  4E6W A;  5JYP A;  5FQ9 A;  4KZ7 A;  5GL9 A;  3SH9 A;  4BQM A;  3A3J A;  3WWX A;  1JVJ A;  2Y2K A;  3FZC A;  1FR1 A;  3M6B A;  5GHZ A;  2C6W B;  1SCW A;  4E3I A;  4O7D A;  4PM9 A;  4LEN A;  2XK1 A;  2RCX A;  3ITB A;  1KE3 A;  4BL2 A;  3MXS A;  2Y2Q A;  1G68 A;  3G31 A;  1YQS A;  2JCH A;  1L2S A;  3GR2 A;  3UY6 A;  4BL3 A;  3Q82 A;  4X6T A;  3CJM A;  3A3D A;  2WK0 A;  4EUZ A;  1FCM A;  2DRW A;  1IEM A;  4RX2 A;  1DY6 A;  4OLD A;  5CHU A;  1GHI A;  1PWG A;  1Q2Q A;  1NRF A;  4ZTK A;  3VP3 A;  1BSG A;  2XD5 A;  5FQJ A;  1NYM A;  1LI9 A;  3G32 A;  2HDQ A;  4XUX A;  3UPP A;  4P85 A;  5F1F A;  2WGW B;  2V2F F;  2H10 A;  3GV9 A;  1WE4 A;  3W8K A;  2PU2 A;  4N1H A;  1FSY A;  1YMX A;  3RXW A;  4RVA A;  1ES2 A;  2ZC4 B;  1JWV A;  2HDU A;  4GN2 A;  4KZ5 A;  4JXG A;  1XGI A;  3OPP A;  1Q2P A; 
#chains in the Genus database with same CATH topology
 2JKR M;  3GQZ A;  3UB6 A;  3N6I A;  3F1N B;  2J3T C;  3N8R A;  3NUL A;  2WAD A;  2Y2O A;  3OC2 A;  3PBS A;  5EOE A;  3T1X A;  3CWF A;  1K55 C;  1K56 A;  1FCO A;  3CI6 A;  1V9Z A;  3KSI A;  4I3I A;  3E4O A;  5EM0 A;  3IX4 A;  3VOL A;  1TS6 A;  2K2N A;  4HQA A;  1K57 C;  3OPL A;  3KX0 X;  4HH3 A;  2CC1 A;  3BEB A;  1MY8 A;  3VP2 A;  4MN5 A;  4WMC D;  3B33 A;  1BUL A;  1LSV A;  2Z2M B;  4KG6 A;  1ODV A;  4UA6 A;  4X53 A;  4GDB A;  3N4I A;  2HGV A;  4DRT A;  3W4O A;  3BM6 A;  4NXB A;  3C30 A;  1KOU A;  4PKY G;  4MLL A;  4JGR A;  4LCL A;  3H9W A;  5HSQ A;  1OTD A;  4LV2 A;  3QNB A;  1K6R A;  2QZ6 A;  3FYZ A;  2Z6C A;  1J9M A;  4G3V A;  3AGE A;  3IHA A;  3LI9 A;  4X55 A;  4LGW A;  4E3L A;  3V39 A;  1KDS A;  5HPI A;  2PBD P;  3H7W A;  5AQ7 A;  1W8Y A;  4M3K A;  3E4P A;  3BYD A;  1F5M A;  5G18 A;  2PD8 A;  3ZVW A;  3H82 B;  3T1R A;  3Q7V A;  3CG5 A;  5D3O A;  3A3F A;  4I38 A;  2VV7 A;  4G3K A;  5FQQ A;  4WL9 A;  2P08 A;  1G5U A;  2G2W A;  3NBL A;  2FFY A;  3MXQ A;  4KQR A;  4JF6 A;  4PPR A;  4CPK A;  5L10 A;  1WYC A;  1U60 A;  2EWV A;  2ZQA A;  2OWH A;  1A0K A;  4S2I A;  5CED A;  1JTD A;  4E3M A;  4U0X A;  1K55 A;  4DE3 A;  4S2M A;  1ZC2 A;  3S7N A;  3W4P A;  1LL8 A;  4GJ4 A;  4X69 A;  1MXO A;  2W3D A;  3E0Y A;  5DTS A;  1NY0 A;  1M6K A;  1XXM A;  3NDG A;  1GSV A;  4JF4 A;  1K57 A;  4Q0J A;  1IYS A;  3OCL A;  3IXG A;  2EX6 A;  3QNC A;  4NXE A;  4C3Q A;  4KZ8 A;  1ERQ A;  3I7J A;  4EET B;  3F1O B;  2WKI A;  4S2L A;  3HLF A;  4MMN A;  4FD8 A;  4K91 A;  3NDE A;  3UMD A;  3C5A A;  2Y55 A;  4WBG A;  4M4X A;  1W63 M;  4F3L B;  3VSK A;  5HAQ A;  3Q07 A;  4BD0 A;  4LCM A;  2HV1 A;  4LRY C;  5DKK A;  3FWL A;  4NK3 A;  1FIK A;  3VSL A;  5C5K A;  3ZG5 A;  1T1B A;  5EUA A;  3ULF A;  2HDR A;  3TOI A;  4UAA A;  3LY3 A;  2O99 A;  3FV7 A;  1PZP A;  1YKD A;  4OPZ A;  1TS7 A;  4JKT A;  3PXP A;  3DTM A;  3A0R A;  4MEZ A;  4JGQ A;  1LI0 A;  5CGS A;  4RX3 A;  3MJQ A;  1VM1 A;  4I39 A;  3BFE A;  3SS5 A;  5KMW A;  2Q0O A;  4L0L A;  4XUZ A;  3MKF A;  3V67 A;  2R9X A;  2JKG A;  1OJ5 A;  2W27 A;  5FA7 A;  3DWK A;  2X71 A;  1KGG A;  1S1Y A;  3H82 A;  1EWZ A;  1T18 A;  4B4Z A;  1NZU A;  3C7U A;  2QKP A;  4JLF A;  1KE0 A;  3UB5 P;  2W0N A;  3T4J A;  1Y54 A;  3SOI A;  3HLE A;  1E4D A;  1W8Q A;  2WKH A;  4OPR A;  5TFQ A;  3OCN A;  3M6H A;  4JBF A;  2BG1 A;  2WKP A;  5J8X A;  3L9K A;  4GLQ A;  4HEF A;  1JWZ A;  5CGX A;  3O88 A;  4QY6 A;  3O87 A;  2K7S A;  3D9Y A;  4EV4 A;  3LIB A;  5CTM A;  2Y59 A;  3V50 A;  3R4K A;  1OJG A;  4N92 A;  4B93 A;  3RH8 B;  4HY8 A;  4JXV A;  2B18 A;  2INW A;  2VKS A;  1K25 A;  1CQA A;  1SDE A;  4K08 A;  3MR0 A;  4BLM A;  2HP5 A;  1YMS A;  3ZG0 A;  1F98 A;  2H5S A;  3F1O A;  5FI7 A;  1YLJ A;  5F5Y A;  1CI9 A;  1D06 A;  3T1S A;  4II7 A;  4U3T A;  4PAU A;  4KQO A;  4ZDX A;  4OQH A;  1WYB A;  2OOL A;  3RJU A;  1NZO A;  1RP5 A;  3T50 A;  3K3D A;  4ESP A;  2P7J A;  1ERM A;  4F3L A;  3JVU A;  1F2K A;  2VGJ A;  2XGN A;  3ZG9 B;  5EOO A;  1FCN A;  3MFD A;  1KDW A;  3SS4 A;  1PIO A;  4EQI A;  2FFF B;  3NY4 A;  4IUH A;  3PBN A;  1ZHH B;  4Z1W A;  3MZD A;  2O9C A;  2ZC5 B;  1MKM A;  3LY4 A;  4BJP A;  3ZQ5 A;  1PWC A;  2UWX A;  1DJA A;  2PDR A;  2V20 A;  1JTG A;  5JYP A;  4KZ7 A;  3SH9 A;  5HZH A;  5J7E A;  2ZL1 B;  4UQI S;  5FDS A;  3S7Q A;  3HJK A;  5HWV A;  4O7D A;  2XK1 A;  1OTI A;  2NUT C;  1KE3 A;  3MXS A;  1TF1 A;  5FEG A;  3G31 A;  3LR4 A;  1L2S A;  3GR2 A;  3UY6 A;  4BL3 A;  1SKO A;  2JKT M;  1VET B;  2WK0 A;  4EUZ A;  1FCM A;  1NRJ A;  1DY6 A;  3PYP A;  1Q2Q A;  2V0U A;  4HI4 A;  3G32 A;  4P85 A;  1FSY A;  3MF0 A;  3RXW A;  1S4S A;  1JNU A;  2ZOH A;  2HDU A;  2QJ5 A;  3OPP A;  4JXW A;  1Q2P A;  5GHY A;  2QJ7 A;  3UO9 A;  1SKF A;  3A0S A;  4CLC D;  4RQ9 A;  4E3J A;  4ID4 A;  3Q81 A;  2Z2L B;  4GHI B;  1M40 A;  5FAT A;  1CF0 A;  3ZGA B;  3T4K A;  5GLB A;  1PW8 A;  3FPW A;  4BMW A;  2JKT I;  2IWC A;  1XA1 A;  1ALQ A;  4L9F A;  3EWK A;  5IT5 A;  3HUO A;  4OP5 A;  5E2H A;  2WAF A;  4EES A;  2KX6 A;  3HJI A;  4WM9 A;  4YNR A;  1S67 L;  3UE6 A;  3D72 A;  4U0T A;  4GW9 A;  4Y2F A;  5F1G A;  5GHX A;  5EV0 A;  2Y2L A;  5A90 A;  4UQI M;  2Y91 A;  4LLO B;  1TDG A;  3IXD A;  2HP9 A;  1BLS A;  2X02 A;  4HJ6 A;  3K3C A;  1XJ2 A;  1SHV A;  1HZO A;  4YOF A;  3UE3 A;  5DF8 A;  3VMA A;  4H6J B;  2PT7 A;  1ESI A;  1UWP X;  2V1Z A;  2ZC3 B;  2M7V A;  3GVB A;  4DXC A;  1PYY A;  4E3O A;  3WS4 A;  3NCK A;  3CMZ A;  4DJ3 A;  1GHP A;  1BUE A;  3UB9 A;  5HDC A;  1XJ3 A;  4IUK A;  2DNS A;  4GS9 B;  4WLA A;  5FQM A;  2QPN A;  2M1C A;  4EEU A;  5GLD A;  2ZL1 A;  1S66 L;  3EQV A;  4QWO A;  3NOP C;  4G3W A;  1ONG A;  2OLV A;  5HPF A;  2JHE A;  3D3O A;  3VP1 A;  4OLG A;  1BYW A;  2E8J A;  5FAO A;  1S4R A;  5KIZ A;  1E3U A;  1VET A;  4Y0O A;  3LIE A;  3FKV A;  4KZ6 A;  2B95 A;  3D4F A;  1XX2 A;  5BOH A;  3HLB A;  2WKR A;  3T12 B;  2OSU A;  1PNE A;  3BFC A;  5AQA A;  3EOI A;  4P0M A;  4B4X A;  4B9O A;  2ZMV A;  1MWU A;  1BZA A;  1ESU A;  4GHI A;  3IT9 A;  3BW6 A;  4EWF A;  4KG2 A;  1OTA A;  3MZF A;  2JE5 A;  4OON A;  2UV0 E;  3O5Y A;  3L7H A;  4IBR A;  4JPM A;  3C8C A;  2Y2H A;  4K0W A;  3IH8 A;  1I2S A;  2JKR I;  1F9I A;  2Y2G A;  3NHQ A;  2XLN A;  2J8Y A;  3UB8 A;  5GLA A;  3RFB A;  5AQ9 A;  2IA2 A;  2ZM2 A;  3IF6 C;  1KVL A;  3IXH A;  1SDN A;  2W3E A;  4OVD A;  5IU1 A;  4FSF A;  3DTI A;  4KZ3 A;  5AQB A;  1TDL A;  3IBJ A;  2V9A A;  5JYO A;  3O86 A;  4DJ2 A;  1ZG4 A;  3N7W A;  2D02 A;  3ZG7 B;  1TS8 A;  3GMW A;  4LV3 A;  4O8G A;  1NJ4 A;  3UNW A;  3CIT A;  4Y13 A;  3IWO A;  2PAV P;  3AGD A;  2VA0 A;  2OAQ 1;  1NWZ A;  3G6O A;  3VV4 A;  1HD8 A;  4DXB A;  1IFQ A;  2PR5 A;  1XP4 A;  4H6J A;  1FQG A;  5CHM A;  4EEP A;  5E43 A;  1C3B A;  2B02 A;  2XH9 A;  1LL5 A;  1YSQ A;  3LFV A;  3IWI A;  5DVA A;  3JPU A;  3HBR A;  2Y2I A;  3GSG A;  3UDI A;  1W7F A;  2J9O A;  3MS6 A;  3SZT A;  3R7W B;  1K4E A;  4GS9 A;  2VV8 A;  1RCJ A;  2C5W B;  2H0T A;  1N9O A;  4HBU A;  4NEE D;  2EX9 A;  3SH8 A;  4A5R A;  1MKI A;  4WEK A;  3RXX A;  4B88 A;  3HUN A;  2V1A A;  2Y2J A;  4EUV A;  1ZKJ A;  4WUJ A;  5DTT A;  3PAG A;  3ZNY A;  4HP4 A;  3BFD A;  3IS2 B;  1I2W A;  4S2K A;  5FEF A;  1MWR A;  2VGL S;  1W79 A;  3IF5 A;  4GD8 A;  4FTX A;  1IYO A;  4IED A;  3LID A;  3LYX A;  2H28 A;  1BLP A;  5CGW A;  4Y17 A;  4Y7P A;  2PBY A;  5CER A;  1KGF A;  1KVM A;  2GX5 A;  2E8I A;  4WZ4 A;  4HJ4 A;  3NIA A;  1YSP A;  5EVI B;  4UHU A;  1NLZ A;  2HF6 A;  3C4P A;  3G2Y A;  4E6X A;  2J7V A;  1GCE A;  2EX8 A;  4KG5 A;  4BD1 A;  2EA9 A;  4OP8 A;  3OBF A;  5E2F A;  1OT6 A;  1IKI A;  2EXB A;  4I3J A;  3P01 A;  5DFY A;  1P0Z A;  1KGE A;  2VZW A;  3UPN A;  4WZ5 C;  2EX2 A;  3LR0 A;  5EVI C;  5TGF A;  4ME4 A;  1FR6 A;  3S22 A;  2PU4 A;  5EFW A;  3MXR A;  3LR3 A;  2IWB A;  4OQ0 A;  1K54 C;  3B42 A;  4IVK A;  4Q0I A;  4WEL A;  1J3W A;  2W1R A;  3ZG8 B;  4E04 A;  1T1A A;  2NUP C;  1PW1 A;  3LCE A;  2A49 A;  1W63 Q;  1BTL A;  4H8R A;  4N9L A;  2HDS A;  1YT4 A;  2VGK A;  4WMC A;  1HVB A;  5HX9 A;  5EE8 A;  2W3F A;  5F6A A;  2PR6 A;  2PYR A;  1SKO B;  1JVJ A;  2C6W B;  2QWS A;  4FUW A;  2LB9 A;  3T4O A;  4LEN A;  2RCX A;  3ITB A;  4BL2 A;  5HD3 A;  2Y2Q A;  1G68 A;  2JCH A;  2M7U A;  3CJM A;  5LBR A;  2XA7 S;  4OLD A;  1PWG A;  3VP3 A;  1NRF A;  3R7W A;  2WGW B;  3W8K A;  5HWW A;  1YMX A;  1N9L A;  1OT9 A;  1JWV A;  4GN2 A;  1XGI A;  5HDS A;  4LV0 A;  3G4P A;  3HRE A;  3KYZ A;  2P9V B;  3ZVT A;  3OPH A;  5L07 A;  2HP6 A;  2A3U A;  4EBL A;  2J80 A;  2A2L A;  2WUQ A;  1G6A A;  3CPT B;  3HUM A;  3IS2 A;  4BBT A;  3EGX C;  4QJG A;  3KYQ A;  3C4O A;  1LSW A;  4I3A A;  2OV5 A;  5DF9 A;  4BBV A;  1LSX A;  1DP6 A;  5TBM B;  2XQZ A;  3TW8 A;  4KZ9 A;  3OLO A;  4N1X A;  4WZ5 A;  3T1Q B;  3UE1 A;  5EVI A;  5A8B A;  2WYX A;  5HW3 A;  2ZMF A;  1OTE A;  1FSW A;  4NXF A;  4GCZ A;  4DDY A;  1T19 A;  3IX8 A;  1NYY A;  2QYB A;  1DP9 A;  1DRM A;  2I72 A;  1MC0 A;  2Q9N A;  1XFQ A;  1GSX A;  4FH4 A;  4O0P A;  1D7E A;  4UA7 A;  2FZ0 A;  3HL9 A;  2WKE A;  3IX3 A;  5CXW A;  1LT0 A;  3CUE C;  2Y2P A;  2ZJ9 A;  3EQU A;  4E3N A;  3E2L A;  4R3J A;  5A92 A;  3HLW A;  4PM5 A;  3GDI A;  1UWN X;  1XGJ A;  2ZQD A;  1L0F A;  1DP8 A;  4BBU A;  3DBA A;  2XA7 M;  4KEN B;  1E3U D;  3G34 A;  1ES5 A;  2PD7 A;  2G2U A;  3LIC A;  4X1L A;  4OKP A;  4R4R A;  1H8M A;  3QHY A;  4DE1 A;  4JGO A;  3EGD C;  3BY8 A;  1MWS A;  4CQH A;  5HL6 A;  3OOV A;  3ZFZ A;  2WAE A;  4OOY A;  4R0Q A;  4S2N C;  1K56 D;  4LV1 A;  4MN6 A;  2EFX A;  1LL9 A;  2PHY A;  2O9B A;  2O9A A;  4FH2 A;  2QMI A;  5EVL A;  2G7U A;  1TS0 A;  2R9W A;  1LLB A;  1ERO A;  4ETZ A;  4R70 A;  4LFU A;  1CI8 A;  2VEA A;  5HAI A;  3HLG A;  4MBF A;  5AVF A;  5L09 A;  4Q0H A;  2WGW A;  3WS5 A;  1HTZ A;  2JKF A;  3HLD A;  5FQI A;  4IHQ A;  2HJ9 C;  5I94 A;  1L0D A;  3DTE A;  4R38 A;  2P9V A;  4R3B A;  2ZLY A;  4LRX C;  5AJG A;  1IEL A;  1YLZ A;  4C75 A;  1VB6 A;  4DMZ A;  3MKE A;  3CPT A;  4RYE A;  4HH2 A;  5CHJ A;  1Z09 A;  3T4Q A;  1IOU A;  1S6R A;  1Y4O A;  5A91 A;  4E3K A;  4ZAM A;  2OLU A;  5TBM A;  3T4L A;  1G28 A;  4OPQ A;  3WRZ A;  1GA0 A;  4Y0T A;  4CLC B;  4YFM A;  1W5D A;  1IKG A;  1DJB A;  1H8Z A;  2WZZ A;  1EW0 A;  1YM1 A;  4EU0 A;  1OTB A;  3BWL A;  2Q9M A;  4EER A;  2ZM8 A;  1L0G A;  1QME A;  1AXB A;  4EXO A;  4DF6 A;  3A0V A;  4LPZ A;  1ES4 A;  3RTY A;  4L9E A;  1QMF A;  4CLC C;  4XT2 A;  1UGU A;  4D2O A;  1LHY A;  3G30 A;  5E2G A;  5FAS A;  2OWJ A;  3UPO A;  4HJ3 A;  5U47 A;  1H8Y A;  1VEU B;  3EEH A;  2J3T D;  1K0K A;  3CHW P;  4DE2 A;  2B5R A;  3ICY A;  4OOL A;  1ZG6 A;  5KZH A;  1PZO A;  5KSC A;  2J9P A;  4QD4 A;  3WS1 A;  5FI6 A;  1P9W A;  1YLY A;  1GA9 A;  3BFF A;  3EEA A;  2D01 A;  3PTE A;  5M19 A;  5IS1 A;  4IVI A;  3PBQ A;  1O7E A;  2HPB A;  1CJF A;  3IBR A;  1JWP A;  3JYI A;  3LO7 A;  4PM8 A;  3BLS A;  2A24 B;  4Q8I A;  3TSG A;  2WZX A;  1L3L A;  4ZJ1 A;  2L4R A;  2ZQC A;  3A3I A;  4EW7 A;  5HAP A;  2W3G A;  1H3Q A;  1YLT A;  2WGI A;  2Y79 A;  4YIN A;  3U2A A;  5EVE A;  2DMW A;  4CJN A;  4WEJ A;  3ITA A;  4Y0U A;  5FL3 A;  3N8S A;  3NOT C;  5KSH A;  1MBL A;  2W3H A;  4WN5 A;  5CEB A;  2FH5 A;  3LUQ A;  2GDN A;  1IYP A;  3TG9 A;  1PI4 A;  3IF6 B;  4R4S A;  5DJU A;  4EBP A;  3VP4 A;  5FI2 A;  4HHD A;  4WYY A;  4X25 A;  2BLS A;  5E2E A;  1N9N A;  2ACG A;  3MQO A;  4MBH A;  3PBT A;  3V3S A;  1YLW A;  4ZJ3 A;  3O3V A;  3UE0 A;  4R6L A;  3E98 A;  4GB7 A;  3OZH A;  3MZE A;  4OH0 A;  4HP9 A;  4KZB A;  2ZOI A;  1BT5 A;  5L8M A;  1ONH A;  5F69 A;  2ZC7 A;  2VX8 A;  4QU3 A;  1VHM A;  1GHM A;  5DKL A;  1Z6F A;  4CLC A;  1K38 A;  5G4Y A;  5EPH A;  3ZYT A;  4GD6 A;  2W1T B;  3UDF A;  3LEQ A;  1X0O A;  3ZDJ A;  1OME A;  4KQD A;  4HBT A;  4IJG A;  3IQA A;  1RGY A;  5CEC A;  5HFO A;  5G4Z A;  1KE4 A;  2Y2M A;  3M2K A;  2ZBB A;  3FPV A;  3FKW A;  4X68 A;  3SS3 A;  3UN7 A;  2DCF A;  1O07 A;  5DFX A;  1TEM A;  5CRF A;  2X01 A;  3QP2 A;  4E6W A;  5FQ9 A;  3S7O A;  5GL9 A;  1VEU A;  3LGO A;  3WWX A;  2Y2K A;  1AWI A;  1FR1 A;  3KSG A;  5GHZ A;  4E3I A;  3E4Q A;  2VV6 A;  4ZRR A;  3BQA A;  3A3D A;  2DRW A;  4RX2 A;  4ARZ B;  4ZTK A;  1BSG A;  2XD5 A;  1LI9 A;  2V1B A;  4XUX A;  3UPP A;  2H10 A;  1WE4 A;  3F1P B;  3DAV A;  4RVA A;  1ES2 A;  2GNX A;  4QHC A;  4KZ5 A;  4JXG A;  5EVI D;  4BWI A;  2A24 A;  4NET A;  1I5Q A;  3CLO A;  2H0Y A;  4GOG A;  2K31 A;  2VJW A;  3LIA A;  4P6B A;  4DKI A;  2L0W A;  1YAX A;  3PHY A;  3VP0 A;  4HNB A;  3QP8 A;  2VK3 A;  1CEF A;  3LI8 A;  3F1N A;  2PRF A;  3HLC A;  5FDH A;  1RGZ A;  1L0E A;  3BLM A;  3IF6 A;  1CK3 A;  3LIF A;  4O01 A;  5M1A A;  3UME A;  3V5M A;  3MQ0 A;  1P9R A;  1NXY A;  1G6O A;  4XXR A;  4QB8 A;  3B3X A;  4ETX A;  2R78 A;  2XSS A;  3QP1 A;  3A3E A;  3DW0 A;  5HDD A;  4IBX A;  3WS0 A;  2ZQ8 A;  2ZQ7 A;  3C7V A;  1PFL A;  4I5S A;  2VLG A;  3NEC A;  5HWT A;  3ZCZ A;  3KYE A;  4MCW A;  4OPY A;  1K4F A;  5HAR A;  3WRT A;  5DJT A;  4PM6 A;  2W1T A;  5CTN A;  4P87 A;  1E25 A;  3S7P A;  1Y28 A;  4QY5 A;  1IYQ A;  1GSW A;  3PAE A;  3FG8 A;  4NXG A;  4K0X A;  3WS2 A;  4Y3I A;  3DTK A;  3PBO A;  3IXB A;  3BQ8 A;  4CLC E;  3Q7Z A;  3VE3 A;  5A93 A;  2L1M A;  1XA7 A;  3TJZ C;  5J3W A;  2OAP 1;  4PM7 A;  2V8F A;  2VGL M;  1NLY A;  4OQI A;  3VOZ A;  3S4X A;  3BRM A;  3CAX A;  2XEP A;  2XDM A;  3Q1F A;  3IH9 A;  4HIA A;  3GRJ A;  4L9G A;  2RL3 A;  1XJ6 A;  2ZQ9 A;  3AGF A;  3JVV A;  4OQG A;  4R23 A;  5F83 A;  4PKY A;  1K6S A;  2XF3 A;  4GZB A;  2XFT A;  4ARZ A;  1ACF A;  2KLI A;  5M18 A;  3BFG A;  3MMH A;  4GDN A;  3VFH A;  3E2K A;  3HCY A;  3T4T A;  2XR0 A;  4R1G A;  2EWW A;  5FSR A;  4NG2 A;  4S2O A;  1FIL A;  3F1P A;  3C38 A;  4HES A;  1H5X A;  2YKH A;  1OPX A;  1ES3 A;  2HJE A;  4MBK A;  1DJC A;  4GNU A;  4ZJ2 A;  1PRQ A;  2PYP A;  3N8L A;  4KQQ A;  5GLC A;  2ZD8 A;  5TJJ A;  4X56 A;  5DTK A;  3T4S A;  5EEC A;  4C6Y A;  1STZ A;  3QP4 A;  3ZHH A;  4ZBE A;  1K54 A;  3SH7 A;  5J4E A;  3PBR A;  4P6Z S;  3M2J A;  2I9V A;  2LB5 A;  5HL1 A;  1YLP A;  5FQK A;  1YPR A;  2KDK A;  3GEC A;  4XT2 B;  1ZTU A;  3TE8 A;  3OPR A;  4MNR A;  4EQ1 A;  4F94 A;  1XFN A;  1PWD A;  3HVF A;  4R3A A;  4YWZ A;  4BEN A;  1VQQ A;  2ZMA A;  3UDX A;  3VFF A;  5FAP A;  4S2J A;  2J3W A;  4UEY A;  4JGP A;  3BY9 A;  3DWZ A;  5EM1 A;  1SZV A;  2WKQ A;  3P09 A;  3ISG A;  3K2N A;  2Y2N A;  2Y4A A;  2HZ5 A;  4X1M A;  3QP6 A;  4Y5F A;  1PI5 A;  1FOF A;  2GZA A;  4KZ4 A;  5CX7 A;  4OOM A;  2QHK A;  2KOI A;  2IWD A;  2XRO A;  2P74 A;  2AVX A;  1XJ4 A;  4AFI A;  1S0W A;  4N9K A;  3BJN A;  5AVE A;  4JF5 A;  2BTF P;  4Y15 A;  3KSF A;  3VE4 A;  2ZC6 B;  2EXA A;  4LRZ E;  2P04 A;  1TVF A;  5K5B A;  3LEZ A;  2JBF A;  3TRC A;  2Y8H A;  3G35 A;  4UA9 A;  2ZM0 A;  3G2Z A;  3NC8 A;  4DN0 A;  1MZU A;  1XPB A;  4FCF A;  3FC7 A;  1EI5 A;  3V3R A;  1MPL A;  2V8C A;  4DE0 A;  4KZA A;  1N4O A;  4FOF A;  3CZD A;  3VOY A;  1V9Y A;  2EFU A;  5L2F A;  3S1Y A;  2JC7 A;  3UB7 A;  5F82 A;  4P6Z M;  4MDZ A;  1XKZ A;  2V0W A;  2XRN A;  3P98 A;  2JN7 A;  3BEC A;  3MBZ A;  2XFS A;  1H0M A;  3MQQ A;  1P97 A;  4JXS A;  2XD1 A;  4Z9Q A;  4DDS A;  1MWT A;  3SW1 A;  4RA7 A;  3CUE A;  3IWQ A;  3NOU C;  5TR7 A;  4GKU A;  4NKP A;  1T1C A;  5FAQ A;  4PMA A;  3NI9 A;  4PHT A;  1BLH A;  3GTC A;  3NJA A;  1WA9 A;  3B47 A;  3IHB A;  1BLC A;  2O0Y A;  4S2P A;  1CEG A;  3W4Q A;  5HD5 A;  1N9B A;  5IHV A;  4EBN A;  3P7N A;  4D60 A;  2YKF A;  1HLU P;  3KSH A;  3U4L P;  3H7W B;  2WGV A;  5F68 A;  3KO6 A;  4MN7 A;  3ZNT A;  5MC7 A;  2BAS A;  4S2N A;  3MFX A;  1D1J A;  4KUK A;  3Q7V B;  5DF7 A;  4WF0 A;  4BQM A;  3A3J A;  3FZC A;  3M6B A;  2CMN A;  5I5L A;  1SCW A;  4PM9 A;  2GJ3 A;  3MSH A;  4QPR A;  1YQS A;  1TD5 A;  3C2W A;  3Q82 A;  4X6T A;  4HOI A;  2MJ6 A;  1S1Z A;  1IEM A;  5CHU A;  1GHI A;  5FQJ A;  3QP5 A;  3PR6 A;  1NYM A;  2HDQ A;  3LR5 A;  5F1F A;  2V2F F;  3GV9 A;  2PU2 A;  4N1H A;  2Z6D A;  4KUO A;  3W2Z A;  2ZC4 B; 
#chains in the Genus database with same CATH homology
 4LV0 A;  3GQZ A;  3G4P A;  4NET A;  1I5Q A;  3HRE A;  3UO9 A;  1SKF A;  2H0Y A;  2P9V B;  3N6I A;  4GOG A;  3OPH A;  3ZVT A;  4E3J A;  2HP6 A;  2A3U A;  4ID4 A;  3Q81 A;  3N8R A;  4EBL A;  2WAD A;  2Y2O A;  3OC2 A;  3PBS A;  4P6B A;  2WUQ A;  1G6A A;  3HUM A;  5EOE A;  2Z2L B;  4DKI A;  1M40 A;  1K55 C;  1K56 A;  1FCO A;  5FAT A;  3VP0 A;  4QJG A;  3ZGA B;  5GLB A;  3C4O A;  1PW8 A;  2OV5 A;  5DF9 A;  1CEF A;  2IWC A;  2XQZ A;  1XA1 A;  3HLC A;  5FDH A;  1RGZ A;  1L0E A;  3BLM A;  3IF6 A;  4KZ9 A;  1ALQ A;  1CK3 A;  4QHC A;  1K57 C;  3OPL A;  4N1X A;  4WZ5 A;  3HUO A;  5M1A A;  3V5M A;  2CC1 A;  3BEB A;  3UE1 A;  4OP5 A;  5EVI A;  1MY8 A;  5E2H A;  1NXY A;  2WAF A;  4WMC D;  2WYX A;  4XXR A;  1BUL A;  3VP2 A;  5HW3 A;  4QB8 A;  2Z2M B;  3B3X A;  4WM9 A;  1FSW A;  4KG6 A;  4UA6 A;  4X53 A;  4GDB A;  3N4I A;  4DDY A;  3A3E A;  3DW0 A;  4DRT A;  1NYY A;  2I72 A;  4IBX A;  4U0T A;  2Q9N A;  3W4O A;  3WS0 A;  3BM6 A;  2ZQ8 A;  5F1G A;  2ZQ7 A;  3C7V A;  4FH4 A;  4UA7 A;  5GHX A;  4MLL A;  4LCL A;  2Y2L A;  3HL9 A;  5A90 A;  2WKE A;  5CXW A;  2Y2P A;  2Y91 A;  4LV2 A;  2ZJ9 A;  3QNB A;  1K6R A;  3ZCZ A;  2QZ6 A;  1TDG A;  3EQU A;  3IXD A;  1K4F A;  4OPY A;  5HAR A;  3WRT A;  4E3N A;  2HP9 A;  4PM6 A;  3FYZ A;  5CTN A;  3E2L A;  4R3J A;  1BLS A;  1J9M A;  2X02 A;  5A92 A;  4P87 A;  1E25 A;  3AGE A;  3IHA A;  4X55 A;  1SHV A;  1HZO A;  4E3L A;  3HLW A;  3UE3 A;  4PM5 A;  4QY5 A;  3V39 A;  1KDS A;  1IYQ A;  3PAE A;  1XGJ A;  2ZQD A;  1L0F A;  5DF8 A;  3VMA A;  4K0X A;  3WS2 A;  3PBO A;  1ESI A;  4KEN B;  1E3U D;  3G34 A;  3IXB A;  1ES5 A;  2V1Z A;  5AQ7 A;  2G2U A;  1W8Y A;  2ZC3 B;  3Q7Z A;  4M3K A;  4OKP A;  4R4R A;  3QHY A;  3BYD A;  3GVB A;  1PYY A;  5G18 A;  4DE1 A;  4DXC A;  5A93 A;  4E3O A;  1XA7 A;  3WS4 A;  3NCK A;  3CMZ A;  3ZVW A;  1MWS A;  1GHP A;  1BUE A;  3Q7V A;  4PM7 A;  2DNS A;  3CG5 A;  5D3O A;  3ZFZ A;  2WAE A;  3A3F A;  4OOY A;  2QPN A;  4R0Q A;  5FQM A;  4S2N C;  4OQI A;  5GLD A;  3VOZ A;  3S4X A;  1K56 D;  4LV1 A;  3BRM A;  2EFX A;  3EQV A;  1LL9 A;  5FQQ A;  2XEP A;  2XDM A;  3Q1F A;  3IH9 A;  1ONG A;  2OLV A;  2G2W A;  3GRJ A;  2RL3 A;  3VP1 A;  5GHY A;  2ZQ9 A;  3AGF A;  3NBL A;  2FFY A;  4FH2 A;  4KQR A;  2QMI A;  4OQG A;  5EVL A;  4OLG A;  4R23 A;  4JF6 A;  4PPR A;  5F83 A;  4CPK A;  5FAO A;  1K6S A;  2XF3 A;  2R9W A;  1E3U A;  1LLB A;  1ERO A;  4GZB A;  4Y0O A;  2XFT A;  1WYC A;  1U60 A;  2ZQA A;  3FKV A;  1CI8 A;  5HAI A;  3HLG A;  4KZ6 A;  4S2I A;  4MBF A;  1JTD A;  5CED A;  5M18 A;  3D4F A;  4E3M A;  4U0X A;  3BFG A;  1XX2 A;  4GDN A;  5BOH A;  5EVI D;  3HLB A;  3E2K A;  1K55 A;  3VFH A;  4DE3 A;  4S2M A;  2WGW A;  2XR0 A;  1ZC2 A;  4R1G A;  5FSR A;  3W4P A;  3WS5 A;  4S2O A;  1HTZ A;  3HLD A;  5FQI A;  2OSU A;  4X69 A;  5I94 A;  3BFC A;  1MXO A;  4HES A;  1H5X A;  5AQA A;  5DTS A;  1NY0 A;  1ES3 A;  1M6K A;  1L0D A;  4MBK A;  1XXM A;  3NDG A;  1DJC A;  4P0M A;  4B4X A;  4JF4 A;  1K57 A;  2P9V A;  4GNU A;  1IYS A;  4R3B A;  3OCL A;  2ZLY A;  4ZJ2 A;  1IEL A;  3IXG A;  1YLZ A;  2EX6 A;  3QNC A;  4C75 A;  1MWU A;  1BZA A;  4C3Q A;  1ESU A;  3MKE A;  3N8L A;  4KZ8 A;  3IT9 A;  4EWF A;  4KG2 A;  4RYE A;  1ERQ A;  3I7J A;  4KQQ A;  5CHJ A;  3MZF A;  5GLC A;  2JE5 A;  2WKI A;  1S6R A;  2ZD8 A;  4OON A;  4X56 A;  4S2L A;  5A91 A;  5DTK A;  4E3K A;  3HLF A;  4IBR A;  4JPM A;  4ZAM A;  2OLU A;  4FD8 A;  5EEC A;  4OPQ A;  3WRZ A;  2Y2H A;  1GA0 A;  4C6Y A;  4Y0T A;  4K91 A;  3ZHH A;  3NDE A;  4K0W A;  4YFM A;  1K54 A;  4ZBE A;  3SH7 A;  3IH8 A;  3C5A A;  1I2S A;  1W5D A;  2Y2G A;  2Y55 A;  1IKG A;  2XLN A;  3M2J A;  3PBR A;  4WBG A;  5HL1 A;  1DJB A;  1H8Z A;  2J8Y A;  1YLP A;  5FQK A;  5GLA A;  2WZZ A;  5AQ9 A;  2ZM2 A;  3IF6 C;  3VSK A;  3OPR A;  4MNR A;  3Q07 A;  1KVL A;  3IXH A;  5HAQ A;  1SDN A;  4BD0 A;  4OVD A;  4LCM A;  1YM1 A;  4FSF A;  4F94 A;  2Q9M A;  2ZM8 A;  1L0G A;  1PWD A;  3FWL A;  4KZ3 A;  4NK3 A;  3VSL A;  1QME A;  1AXB A;  3HVF A;  5AQB A;  1TDL A;  3ZG5 A;  5EUA A;  4BEN A;  4DF6 A;  2HDR A;  3TOI A;  1VQQ A;  1ES4 A;  4UAA A;  1QMF A;  5JYO A;  3LY3 A;  2ZMA A;  3O86 A;  1LHY A;  3UDX A;  5FAP A;  3VFF A;  4S2J A;  4D2O A;  3FV7 A;  1PZP A;  3G30 A;  1ZG4 A;  3N7W A;  5E2G A;  4OPZ A;  4JKT A;  3ZG7 B;  5FAS A;  3UPO A;  3GMW A;  5U47 A;  4LV3 A;  3DTM A;  1NJ4 A;  4MEZ A;  3UNW A;  1LI0 A;  5CGS A;  4RX3 A;  3DWZ A;  1H8Y A;  3IWO A;  1VM1 A;  3AGD A;  3P09 A;  3ISG A;  3BFE A;  2Y2N A;  3SS5 A;  1HD8 A;  4DXB A;  5KMW A;  4DE2 A;  2Y4A A;  4L0L A;  2B5R A;  1XP4 A;  3MKF A;  4XUZ A;  2R9X A;  1FQG A;  5CHM A;  4OOL A;  5E43 A;  1PI5 A;  1C3B A;  1ZG6 A;  1FOF A;  5KZH A;  2XH9 A;  1LL5 A;  1PZO A;  4KZ4 A;  5KSC A;  2J9P A;  5FA7 A;  3DWK A;  3IWI A;  4OOM A;  5DVA A;  4QD4 A;  2X71 A;  3HBR A;  1KGG A;  3WS1 A;  2Y2I A;  2IWD A;  2P74 A;  3GSG A;  3UDI A;  1W7F A;  2J9O A;  5FI6 A;  1K4E A;  1YLY A;  1GA9 A;  3BFF A;  1EWZ A;  3PTE A;  1RCJ A;  5M19 A;  1S0W A;  2C5W B;  2H0T A;  4N9K A;  1NZU A;  4B4Z A;  3C7U A;  4JLF A;  1KE0 A;  4JF5 A;  4IVI A;  3PBQ A;  4HBU A;  1O7E A;  1Y54 A;  2HPB A;  2EX9 A;  2ZC6 B;  2EXA A;  1JWP A;  3SOI A;  3JYI A;  1TVF A;  3LO7 A;  3SH8 A;  3HLE A;  4A5R A;  1MKI A;  4WEK A;  4PM8 A;  3BLS A;  1E4D A;  2JBF A;  1W8Q A;  2WKH A;  3LEZ A;  4OPR A;  3G35 A;  3RXX A;  3HUN A;  4UA9 A;  4B88 A;  3TSG A;  2WZX A;  2ZM0 A;  3G2Z A;  4Q8I A;  5TFQ A;  3OCN A;  4ZJ1 A;  3NC8 A;  2Y2J A;  3M6H A;  4JXW A;  1ZKJ A;  4JBF A;  2BG1 A;  2ZQC A;  1XPB A;  3A3I A;  5HAP A;  5DTT A;  3PAG A;  4FCF A;  5J8X A;  3ZNY A;  1EI5 A;  3BFD A;  2WGI A;  1YLT A;  4YIN A;  3V3R A;  1I2W A;  1MPL A;  4HEF A;  4DE0 A;  4CJN A;  4WEJ A;  3ITA A;  4S2K A;  1JWZ A;  4Y0U A;  1MWR A;  4KZA A;  5CGX A;  1N4O A;  1W79 A;  3N8S A;  3O88 A;  3CZD A;  3IF5 A;  3VOY A;  4QY6 A;  1MBL A;  3O87 A;  4GD8 A;  5KSH A;  2EFU A;  5L2F A;  3S1Y A;  2JC7 A;  5CEB A;  5F82 A;  4EV4 A;  1IYO A;  4IED A;  5CTM A;  2GDN A;  1IYP A;  2Y59 A;  3TG9 A;  3V50 A;  1PI4 A;  1BLP A;  3IF6 B;  4N92 A;  4R4S A;  5CGW A;  4Y7P A;  4EBP A;  3VP4 A;  1XKZ A;  2PBY A;  5FI2 A;  1KGF A;  4JXV A;  5CER A;  1KVM A;  4WYY A;  2E8I A;  4WZ4 A;  3P98 A;  2BLS A;  5E2E A;  3BEC A;  3MBZ A;  2XFS A;  1K25 A;  3NIA A;  5EVI B;  1SDE A;  4MBH A;  3PBT A;  4UHU A;  3G2Y A;  3C4P A;  3V3S A;  4E6X A;  1YLW A;  4BLM A;  4JXS A;  4ZJ3 A;  3O3V A;  2HP5 A;  3UE0 A;  2J7V A;  1YMS A;  3ZG0 A;  1GCE A;  2EX8 A;  2XD1 A;  4Z9Q A;  4KG5 A;  4GB7 A;  4DDS A;  1MWT A;  4OP8 A;  3OZH A;  4BD1 A;  2H5S A;  3MZE A;  4OH0 A;  5E2F A;  4RA7 A;  1IKI A;  5FI7 A;  3IWQ A;  1YLJ A;  4KZB A;  1BT5 A;  5TR7 A;  2EXB A;  4GKU A;  1CI9 A;  1ONH A;  2ZC7 A;  1KGE A;  4QU3 A;  4U3T A;  3UPN A;  4WZ5 C;  1GHM A;  2EX2 A;  4KQO A;  4ZDX A;  5FAQ A;  1Z6F A;  4PMA A;  3NI9 A;  4OQH A;  5EVI C;  1BLH A;  1WYB A;  1K38 A;  5TGF A;  5EPH A;  3S22 A;  1FR6 A;  3RJU A;  1NZO A;  1RP5 A;  2PU4 A;  3GTC A;  3IHB A;  1BLC A;  4S2P A;  1CEG A;  4GD6 A;  3MXR A;  3UDF A;  3W4Q A;  1ERM A;  1N9B A;  5IHV A;  3ZDJ A;  1OME A;  2IWB A;  4OQ0 A;  2VGJ A;  4EBN A;  1K54 C;  4HBT A;  2XGN A;  4IVK A;  3ZG9 B;  5EOO A;  3IQA A;  1RGY A;  4WEL A;  1FCN A;  3MFD A;  5CEC A;  1KDW A;  5HFO A;  3ZG8 B;  3SS4 A;  1PIO A;  4EQI A;  2FFF B;  2WGV A;  1KE4 A;  2Y2M A;  3NY4 A;  3PBN A;  3M2K A;  1PW1 A;  3MZD A;  3ZNT A;  3FKW A;  3LCE A;  2A49 A;  4X68 A;  1BTL A;  3SS3 A;  3UN7 A;  2ZC5 B;  4H8R A;  4S2N A;  3LY4 A;  4N9L A;  2DCF A;  2HDS A;  1O07 A;  4BJP A;  1YT4 A;  2VGK A;  1PWC A;  4WMC A;  2UWX A;  1TEM A;  1DJA A;  1HVB A;  5HX9 A;  2V20 A;  5CRF A;  3Q7V B;  2X01 A;  5EE8 A;  1JTG A;  5DF7 A;  4E6W A;  5JYP A;  5FQ9 A;  4KZ7 A;  5GL9 A;  3SH9 A;  4BQM A;  3A3J A;  3WWX A;  1JVJ A;  2Y2K A;  3FZC A;  1FR1 A;  3M6B A;  5GHZ A;  2C6W B;  1SCW A;  4E3I A;  4O7D A;  4PM9 A;  4LEN A;  2XK1 A;  2RCX A;  3ITB A;  1KE3 A;  4BL2 A;  3MXS A;  2Y2Q A;  1G68 A;  3G31 A;  1YQS A;  2JCH A;  1L2S A;  3GR2 A;  3UY6 A;  4BL3 A;  3Q82 A;  4X6T A;  3CJM A;  3A3D A;  2WK0 A;  4EUZ A;  1FCM A;  2DRW A;  1IEM A;  4RX2 A;  1DY6 A;  4OLD A;  5CHU A;  1GHI A;  1PWG A;  1Q2Q A;  1NRF A;  4ZTK A;  3VP3 A;  1BSG A;  2XD5 A;  5FQJ A;  1NYM A;  1LI9 A;  3G32 A;  2HDQ A;  4XUX A;  3UPP A;  4P85 A;  5F1F A;  2WGW B;  2V2F F;  2H10 A;  3GV9 A;  1WE4 A;  3W8K A;  2PU2 A;  4N1H A;  1FSY A;  1YMX A;  3RXW A;  4RVA A;  1ES2 A;  2ZC4 B;  1JWV A;  2HDU A;  4GN2 A;  4KZ5 A;  4JXG A;  1XGI A;  3OPP A;  1Q2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...