5TGFA

Crystal structure of putative beta-lactamase from bacteroides dorei dsm 17855
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
333
structure length
333
Chain Sequence
TYDFTPLDSIISSWMDKGYYPGGAICVVKNDSVLFEKAYGSFTGDTKVYVASAGKWVAAAVIGAVVDRTDLSWDDPVEKWLPQFRGDAKGGILLRQLLSHTSGVRPYLPAPRVDNYNHLDSAVTEILSLDTVFTPGTRFEYGGLAMQIAGRMAEVAMGKEFEPLFQELIAAPLGMTHSHFAPVNTDGGHAPMLGGGLCTTLNDYIRFLKMIYHNGRSGNREILKPETVQTMQADQVRNAVVAPGEYVEKALGQHHTSIYGLGEWRELVDEATGEAYQISSPGWAGAYPWINKRDGVYGFFIAHVQGEANKKDGFSSFYGSPVLSETVTKIVNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a beta-lactamase from Bacteroides dorei DSM 17855
rcsb
source organism Bacteroides dorei dsm 17855
molecule tags Hydrolase
total genus 100
structure length 333
sequence length 333
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5tgfA00
2Y2LA 2PU2A 4KG2A 5EUAA 1ALQA 3BLSA 1KE3A 2XD1A 5FATA 4QY5A 4EV4A 2ZQDA 4E3OA 2J8YA 3O88A 4RVAA 5J8XA 5FQMA 3PAEA 4IBXA 1YMXA 3HVFA 3O86A 3ZVTA 5FQJA 1M6KA 3E2KA 2ZC6B 3N8LA 3OPPA 2Y2QA 4OLDA 4KQQA 3LY3A 3LO7A 4NETA 4D2OA 3MXSA 5CEBA 3UO9A 3HLCA 3IWOA 1YQSA 5CXWA 3UDXA 1SDEA 2ZQ8A 1HZOA 3HL9A 4BD1A 3HLDA 2OLVA 5FQKA 5DF7A 2C5WB 1JWPA 3IXHA 4HESA 3MBZA 3FYZA 3PBSA 5FI2A 5FI7A 4WM9A 3NCKA 4RA7A 4LCLA 3SH7A 4OPZA 4R3JA 2Y2PA 1DY6A 4RYEA 1WYBA 1XA7A 3UN7A 4Y0OA 4OQIA 2HDSA 1DJAA 4R0QA 1KE0A 1KGEA 2G2WA 2A3UA 2DNSA 3G30A 3O87A 3UDIA 4JLFA 3ZG9B 1CI8A 4F94A 2P74A 3FKVA 4OP5A 5L2FA 4JBFA 3N7WA 4R4RA 5M19A 1FOFA 1Q2PA 3EQUA 3WRZA 3G32A 1XXMA 4R23A 1MXOA 3IXDA 3VP3A 4MBHA 1XGIA 4S2NA 3DW0A 1K4FA 4ZJ2A 4WEKA 3GQZA 3A3EA 3UY6A 1AXBA 5CTNA 1ONHA 2XD5A 1K55A 1LL5A 1PWGA 2Y59A 4ID4A 1PYYA 2ZM2A 3QHYA 1BLSA 4K91A 4E6WA 2WKHA 2ZLYA 1FCNA 2Y2IA 3IWIA 1NXYA 4P85A 3ZG7B 2ZQ9A 2HDQA 2PBYA 1YLWA 4DDSA 5I94A 3BYDA 5GLDA 2HPBA 5GHZA 4HBUA 5A91A 2BLSA 2PU4A 2Z2MB 4FSFA 4GD6A 4OVDA 3SS4A 5CECA 3IXBA 3MZEA 3VOZA 2ZJ9A 4ZJ1A 2B5RA 2H0YA 4KZ8A 1E25A 1NYMA 5E2FA 2XLNA 5FAOA 2JE5A 4EWFA 2Q9NA 2XEPA 3A3IA 3ZVWA 1S6RA 3HLWA 3O3VA 2JBFA 4FH2A 2FFFB 3W8KA 2BG1A 1ES4A 4RX2A 5F1FA 1K55C 3BEBA 1W79A 4B4ZA 3LEZA 1L0FA 2ZC7A 3G35A 4FCFA 3IQAA 5E2GA 5GHYA 1LLBA 1MWSA 1ZG4A 4PM6A 4X68A 4GZBA 5DTKA 1JTDA 2WZZA 1FSYA 1K56D 3PBTA 5DVAA 2Q9MA 3BFFA 4WBGA 4JXGA 4DE1A 3HLBA 2HP6A 4BJPA 4OOMA 4IVIA 5F83A 1KGFA 3IWQA 2XF3A 1YLZA 1ES5A 2H0TA 3OPLA 4OPYA 3GVBA 3Q81A 3SS3A 1L0GA 5F1GA 3DWKA 5GLBA 4S2KA 3WS4A 1EI5A 1K56A 3BM6A 4X69A 4K0WA 2OLUA 1ONGA 2WGWB 4N9KA 1LL9A 2FFYA 3HLFA 3N8RA 2Y4AA 3MKFA 3G34A 5A90A 4JF4A 4N1HA 4MNRA 3BFGA 2XH9A 4LV1A 3TSGA 3IF5A 4UA7A 1K54A 3N4IA 3V5MA 1KVMA 5EECA 4S2MA 5TR7A 2P9VB 3HREA 3S22A 3UPOA 5CGXA 1XP4A 3TOIA 3GRJA 3IF6C 4X6TA 2Y2HA 4QJGA 4Y0UA 4EQIA 4KG5A 1XKZA 3P98A 5M18A 4OOYA 5HARA 1IKGA 4JF5A 4QY6A 3CZDA 2C6WB 3UDFA 4IVKA 3TG9A 2JC7A 4JXSA 4Q8IA 1GHMA 1PZPA 3E2LA 3LY4A 3Q1FA 4LV3A 2Y2KA 2Y2GA 3VMAA 2JCHA 5EVLA 2H10A 3WS2A 1TDLA 2ZC4B 3V3SA 1IYSA 1QMFA 3IHBA 1HD8A 5EVIA 4LENA 3NBLA 5DF9A 1ZKJA 4MBKA 3A3JA 4E3LA 4C3QA 1LI0A 2HDRA 1SHVA 4PM8A 3OPRA 5AQ9A 1FSWA 3NY4A 2ZQCA 4S2IA 1PI5A 2V2FF 5CERA 3G2YA 1CEGA 4BENA 3C5AA 1NYYA 3UPPA 2HP5A 4OPQA 2J7VA 3N6IA 5TGFA 1ZC2A 3PBOA 3EQVA 4N9LA 4OKPA 1PZOA 1W8QA 4YFMA 3IH8A 2R9WA 3WS1A 5IHVA 2QZ6A 3C7UA 3M6BA 4KG6A 3S1YA 2EX6A 4KZ6A 1C3BA 4LCMA 1RGZA 3ZNYA 4JKTA 3VP2A 3Q07A 2Y91A 1LI9A 1OMEA 3Q7VB 3VP0A 2Y2JA 3OC2A 3NI9A 3PBNA 2ZD8A 2WGWA 2J9OA 3MFDA 1CK3A 1VM1A 2X71A 2VGKA 3VFFA 3VP1A 1W7FA 1YMSA 2I72A 1N9BA 2UWXA 4WMCD 1K57A 5AQ7A 3ZGAB 4EBNA 3A3FA 1LHYA 1DJBA 1MY8A 2WK0A 3BRMA 2P9VA 3SOIA 4BQMA 4BL2A 1KGGA 4CPKA 1JWZA 2RL3A 1FR1A 4BL3A 4E3NA 1BLHA 5AQAA 5A92A 1H8YA 1GCEA 3AGDA 4WMCA 3IT9A 5CTMA 2WKIA 4R4SA 4S2PA 1FCMA 1ESIA 2WAEA 3HUNA 4Y0TA 1I5QA 5FASA 1H5XA 3P09A 4GB7A 4KQOA 1N4OA 1ERMA 4OQGA 5EVIB 5HAQA 5KZHA 4S2NC 2J9PA 1NZUA 3GMWA 5E43A 1E3UD 4UA6A 1O7EA 2WAFA 3MZFA 3DTMA 3UE3A 4NK3A 5FA7A 1BULA 4GKUA 2EXBA 3VSLA 1ES3A 2Y55A 1S0WA 1YLJA 1BLPA 2EFUA 2ZM0A 5CGSA 1FR6A 1G68A 1TVFA 4PPRA 4Z9QA 5DF8A 1L2SA 3V50A 2IWCA 3ZHHA 1BT5A 3Q7ZA 5CRFA 2EX2A 1XPBA 3IXGA 1E3UA 3VFHA 2WGVA 4DE0A 2Y2NA 1L0EA 2WYXA 4U0XA 4PM9A 4BD0A 1ES2A 4FH4A 3HUMA 4LV0A 3W4PA 3JYIA 1K38A 3A3DA 3ITAA 1XX2A 5CHJA 2RCXA 3SS5A 5GL9A 4BLMA 5EPHA 4YINA 3PAGA 4KZ7A 3Q7VA 3ZDJA 2EFXA 3UNWA 1G6AA 1RCJA 3N8SA 4QHCA 3V39A 3SH8A 1IYOA 3OZHA 3S4XA 3FZCA 2ZQ7A 5FI6A 1RP5A 2HDUA 4KZ3A 1RGYA 1Y54A 4KQRA 2ZC5B 4PM5A 1WYCA 4ZDXA 1W8YA 3PBRA 3C4PA 4LV2A 2A49A 2ZMAA 3WRTA 3FWLA 1NJ4A 1DJCA 1U60A 1GA0A 1JVJA 1IELA 2WADA 3HBRA 5EVID 4K0XA 4A5RA 1KDSA 3BECA 4DE3A 1JTGA 5KMWA 4QB8A 1K25A 1Z6FA 2XK1A 5DTTA 3ZCZA 2ZC3B 4KZAA 1PWCA 4S2LA 3M6HA 4GDNA 5TFQA 1GA9A 5CGWA 1PIOA 5GLCA 2Y2MA 3UE0A 5FQQA 3CMZA 2Y2OA 4U0TA 2EX8A 4P6BA 3CJMA 3C7VA 2IWBA 2ZM8A 3UPNA 4QU3A 1MWTA 4Y7PA 4DXCA 5JYOA 1IKIA 1IYQA 3GR2A 1EWZA 1XGJA 2QMIA 4C75A 2GDNA 1FQGA 1WE4A 3Q82A 5CEDA 3UE1A 5HX9A 5FSRA 5G18A 2QPNA 2XQZA 5GHXA 1K54C 4WEJA 1K4EA 1JWVA 5E2EA 2Z2LB 3WS0A 3BFEA 1K6RA 5HAPA 4EBPA 1SDNA 3RXXA 3SH9A 4X56A 5U47A 5EOOA 4DKIA 1YLPA 3B3XA 3VP4A 4KZ5A 4M3KA 1SKFA 4MBFA 4R1GA 5CHUA 1KE4A 2H5SA 4ZAMA 5HL1A 4UA9A 4XUZA 5KSHA 3MZDA 4UAAA 1NY0A 4B88A 3OCNA 3NDEA 1BUEA 5A93A 4KZ9A 5BOHA 1YM1A 3C4OA 4GDBA 1BZAA 1E4DA 1GHPA 4JXWA 4X55A 4P0MA 2DCFA 5EVIC 4WELA 3M2JA 3NC8A 5M1AA 3IF6B 4R3BA 1GHIA 3HLEA 4ZJ3A 1MWRA 2X02A 3G31A 4N92A 3WS5A 4OOLA 4E3JA 4OLGA 1TEMA 3VSKA 5E2HA 1CI9A 4HEFA 3GSGA 2DRWA 4L0LA 1YT4A 2IWDA 2WUQA 3OCLA 4KZBA 2WKEA 4S2JA 1MBLA 2CC1A 1PI4A 1CEFA 2EX9A 1KVLA 1BLCA 3ISGA 4U3TA 3CG5A 4KZ4A 5EE8A 4EBLA 4OONA 5CHMA 3WWXA 3NIAA 3BFCA 4OQ0A 4MEZA 4WYYA 1NRFA 1ESUA 4OH0A 4IBRA 3QNBA 4PMAA 1YLTA 1K6SA 2ZQAA 4XUXA 4N1XA 1O07A 5AQBA 1MKIA 2R9XA 3BLMA 4MLLA 4S2OA 1I2SA 4C6YA 1PW1A 1TDGA 4GN2A 2G2UA 3V3RA 1BSGA 4E3KA 4PM7A 3GV9A 1W5DA 4IEDA 3ZG8B 4JXVA 1I2WA 4X53A 1MPLA 2XGNA 3DWZA 2E8IA 1KDWA 4WZ4A 1K57C 3ZNTA 4B4XA 4OPRA 3W4OA 1M40A 2OV5A 1J9MA 2HP9A 3NDGA 2V20A 1ZG6A 2XR0A 4XXRA 5FAPA 3GTCA 5JYPA 2XFTA 5D3OA 5EOEA 3LCEA 4H8RA 5FDHA 4ZBEA 5GLAA 1VQQA 4JF6A 1L0DA 2OSUA 1YLYA 2VGJA 3MKEA 4GOGA 4HBTA 3AGFA 3D4FA 3MXRA 4ZTKA 1IEMA 2EXAA 4DXBA 3G4PA 3BFDA 3M2KA 3RXWA 4WZ5A 2X01A 4RX3A 4DE2A 1H8ZA 3PBQA 4OP8A 5HW3A 4E6XA 5FQ9A 3G2ZA 3ZFZA 4DF6A 5F82A 1PW8A 1EROA 1SCWA 3IF6A 1Q2QA 3ZG5A 1NZOA 1HVBA 4DRTA 4O7DA 3RJUA 2WZXA 3ITBA 4JPMA 2V1ZA 1BTLA 3VOYA 5HAIA 4UHUA 3PTEA 3IHAA 3FV7A 1ERQA 4CJNA 4FD8A 1HTZA 2XFSA 3HLGA 3ZG0A 4P87A 3FKWA 4QD4A 4EUZA 5HFOA 5FQIA 3OPHA 4E3MA 5DTSA 2XDMA 1XA1A 3IH9A 1PWDA 4GNUA 1QMEA 1MWUA 4OQHA 4E3IA 4GD8A 4DDYA 4KENB 5KSCA 1IYPA 4WZ5C 3QNCA 5FAQA 1FCOA 2WGIA 3I7JA 3HUOA 3AGEA 3W4QA
chains in the Genus database with same CATH superfamily
2PU2A 5EUAA 1ALQA 1KE3A 4CLCD 1TS7A 5FATA 3BQAA 4RVAA 3NOPC 3T4TA 5J8XA 3HVFA 3OPPA 2ZC6B 2Y2QA 4OLDA 2V8FA 4D2OA 3MXSA 5CEBA 5TJJA 3IWOA 4CLCA 1YQSA 1HZOA 5FQKA 1TF1A 2C5WB 3T4SA 4HESA 1JNUA 3FYZA 5FI7A 4RA7A 4LCLA 4Q0JA 3MMHA 2Y2PA 2PR5A 4Y0OA 3ICYA 4GHIB 2KDKA 1KGEA 1VETB 2XA7M 3IS2A 2DNSA 3UDIA 5I5LA 2O9CA 1XJ2A 5L2FA 2OWJA 2W3FA 5FL3A 4R4RA 5M19A 3G32A 2VGLS 3VP3A 3DW0A 4UQIS 1PWGA 2XD5A 4LFUA 3QP4A 2ZLYA 2Y2IA 3IWIA 4NXGA 4HBUA 1GSXA 1MZUA 3EGDC 2Z2MB 3SS4A 4OVDA 5HWWA 2INWA 3IXBA 2A24B 1TS6A 4HIAA 4ZJ1A 4KZ8A 2XEPA 3A3IA 2FFFB 4I39A 3UMDA 3BEBA 1W79A 5KIZA 1W63M 3IQAA 5EV0A 4PM6A 4X68A 4GZBA 3BFFA 4WBGA 4JXGA 4BJPA 3IWQA 4Q0HA 4EUVA 1D06A 1ES5A 3Q81A 4G3VA 4S2KA 3BM6A 2WGWB 4MN5A 2Y4AA 2P04A 4JF4A 3S7PA 3B33A 4F3LB 4S2MA 5TR7A 2P9VB 3IF6C 4EQIA 4KG5A 4DJ2A 4HJ4A 3UDFA 2PRFA 4HOIA 4Q0IA 4JXSA 2Y2KA 3VMAA 3K3CA 1TDLA 4PAUA 1IYSA 1ODVA 4WUJA 3V3SA 2VV8A 3A0VA 5EVIA 4LENA 1ZKJA 3A3JA 4E3LA 3JVVA 2Z6CA 4GLQA 4S2IA 5CERA 3G2YA 4FUWA 3S7OA 4MCWA 3E4OA 1AWIA 5TGFA 3EQVA 2XSSA 2Y8HA 3NULA 1C3BA 2B95A 3LYXA 4JKTA 3VP2A 2V0UA 1LI9A 3O5YA 3Q7VB 3NI9A 3T50A 3F1PB 2J9OA 3VP1A 3P7NA 4HI4A 4JGQA 4WMCD 2M1CA 5HDSA 1Y4OA 2WK0A 5HPIA 3EOIA 1KGGA 3EWKA 1ACFA 3MS6A 1N9LA 4WMCA 5CTMA 4R4SA 3D9YA 1ESIA 1I5QA 5FASA 4GB7A 1N4OA 3EGXC 5EVIB 4S2NC 2J9PA 1NZUA 4UA6A 4EW7A 2J3WA 1PNEA 4NK3A 5FA7A 4GKUA 1YLJA 2ZM0A 4YOFA 1G68A 2QJ7A 1DP6A 5DF8A 3BWLA 5CRFA 3IXGA 3VFHA 2WGVA 4R3AA 3R7WA 2Y2NA 1L0EA 2V8CA 5L8MA 4FH4A 3HUMA 4IHQA 5G4ZA 5EM1A 1K38A 5CHJA 1G28A 5GL9A 4BLMA 5EPHA 4I38A 2QYBA 2PDRA 3KSHA 3V39A 1YSPA 1LSVA 4CLCE 3OZHA 2MJ6A 4KZ3A 1DP9A 2J3TD 3KSFA 4GJ4A 2NUTC 1A0KA 1WYCA 3B42A 3BJNA 4ZDXA 3PBRA 1OPXA 3GECA 2A49A 1CF0A 1NJ4A 4A5RA 5KMWA 4IUHA 1PWCA 2AVXA 4EERA 4O8GA 1PIOA 2B02A 2LB5A 3CMZA 4U0TA 3UPNA 4DN0A 5JYOA 1MWTA 5F6AA 3GR2A 1XGJA 1WE4A 3Q82A 5HD5A 4X1LA 2QPNA 2XQZA 4EESA 4WEJA 1K6RA 4Y17A 4EU0A 3RXXA 3SH9A 4X56A 5U47A 1YLPA 4FOFA 1SKFA 4MBFA 5DKKA 2H5SA 2KX6A 2P7JA 4XUZA 3MZDA 3OCNA 3C2WA 5A93A 1S1YA 4KZ9A 1E4DA 2DCFA 4P6ZS 4WELA 1GHIA 1TD5A 3G31A 4MN6A 3T4OA 2L0WA 4HEFA 2FH5A 3GSGA 2WUQA 2IWDA 3OCLA 1S66L 1MBLA 3DBAA 1CEFA 5FEFA 1KVLA 3ISGA 4LRZE 1STZA 3MXQA 3CG5A 4KZ4A 3WWXA 3NIAA 3BFCA 3H82A 4WYYA 4ZRRA 2ZQAA 4G3KA 1O07A 1MKIA 3RFBA 4BWIA 3BLMA 4HH2A 4ARZA 2O9AA 4C6YA 1PW1A 3V3RA 1BSGA 3DWZA 2XGNA 2E8IA 1K57C 4B4XA 1M40A 5EVEA 2CMNA 3DTIA 3K2NA 1SKOA 3NDGA 2M7VA 3GTCA 5EOEA 3BY8A 3MKEA 4ZTKA 3AGFA 3G4PA 4WZ5A 1H8MA 4DE2A 3G2ZA 4DF6A 1EROA 1SCWA 3IF6A 3KYEA 4ETZA 1BYWA 4DRTA 4O7DA 2WZXA 1BTLA 2PD7A 3VOYA 5HAIA 3PTEA 3FV7A 4CJNA 4L9GA 2W1TA 5C5KA 3ZG0A 2E8JA 1XFQA 3IH9A 4GNUA 1TS8A 4E3IA 4KENB 1IYPA 4LRYC 4I3AA 3C8CA 3HUOA 2VV6A 2Y2LA 4KG2A 4L9EA 3SZTA 3PAEA 1YMXA 1N9NA 3ZVTA 1M6KA 3E2KA 3N8LA 5HPFA 3LY3A 3TRCA 4Y3IA 1MC0A 5CXWA 1SDEA 1F98A 3S7NA 4Y13A 4MMNA 2JN7A 1OT6A 4WM9A 3T1XA 5HSQA 3SH7A 2OAP1 4R3JA 2KLIA 4LLOB 3LR0A 3UN7A 1V9YA 4JLFA 3DTEA 2W1TB 3FKVA 2JKTI 2GJ3A 4JBFA 3N7WA 1Q2PA 1MXOA 3IXDA 3D72A 1XGIA 4S2NA 4YWZA 1K4FA 4ZJ2A 3A3EA 2QHKA 3PXPA 5TBMB 1K55A 4DJ3A 1P9RA 4ID4A 1PYYA 3U2AA 2D01A 3QHYA 1BLSA 4K91A 4E6WA 1FCNA 1NXYA 3ZG7B 5I94A 5GLDA 2HPBA 3A0RA 2P08A 3LEQA 2BLSA 3T4KA 4FSFA 4GD6A 5CECA 3VOZA 5FDSA 2H0YA 4EEUA 1NRJA 5E2FA 5FAOA 2Q9NA 3ZVWA 4HHDA 4FH2A 1H3QA 2UV0E 2ZC7A 4FCFA 5GHYA 5DTKA 1JTDA 2WZZA 2Q9MA 4GHIA 1VETA 1CJFA 1KGFA 1K0KA 2XF3A 2WKPA 3GVBA 3ZYTA 4X69A 4K0WA 4Y15A 1ONGA 3N8RA 4D60A 3G34A 2JKTM 4MNRA 3BFGA 2XH9A 2D02A 4UA7A 3IX4A 3N4IA 1KVMA 3V5MA 5EECA 3HREA 3S22A 3UPOA 3QP2A 3TOIA 1L3LA 1YPRA 4X6TA 2Y2HA 4QJGA 4Y0UA 1XKZA 4QY6A 4KUOA 4IVKA 1DP8A 3TG9A 3JVUA 2H28A 1PZPA 3E2LA 3LY4A 3Q1FA 4LPZA 4LV3A 2A24A 4KQDA 5EVLA 4DMZA 3WS2A 2YKFA 3LIBA 2ZMVA 3OPRA 4MDZA 4BENA 2EA9A 2J7VA 3N6IA 3OOVA 1ZC2A 4OKPA 2R9WA 2ZMFA 3C7UA 2EX6A 4KZ6A 1RGZA 3A0SA 3OBFA 2Y91A 3G6OA 3VP0A 4WL9A 4HP9A 2ZD8A 2HF6A 2WGWA 3BQ8A 4PKYG 2VGKA 3CUEA 1N9BA 2Q0OA 1K57A 3CITA 1DJBA 4F3LA 3FG8A 2P9VA 3SOIA 4BQMA 4CPKA 2RL3A 3NOTC 4E3NA 2K7SA 1OTDA 2HV1A 4IJGA 2B18A 2WKIA 1IOUA 3P09A 3L7HA 5HAQA 3QP6A 3GMWA 1E3UD 2WAFA 3UE3A 1BULA 1OTAA 1S0WA 1BLPA 2VK3A 4Z9QA 2IWCA 1BT5A 2OWHA 1E3UA 1PRQA 4U0XA 4BD0A 3R4KA 3JYIA 1P0ZA 4I3JA 3NHQA 3PAGA 3Q7VA 2EFXA 3UNWA 1G6AA 1RCJA 3N8SA 3QP1A 5K5BA 5IU1A 3F1PA 5HWVA 1W8YA 4NXEA 3C4PA 2ZMAA 3WRTA 1DJCA 1U60A 1GA0A 1T1AA 5EVID 1LSWA 2QJ5A 1K25A 2XK1A 4GDNA 5GLCA 1KOUA 2Y2OA 2IWBA 3CJMA 2ZM8A 4QU3A 2QWSA 4Y7PA 5HD3A 1IYQA 1EWZA 1NLZA 1FQGA 2W1RA 4WF0A 3UB6A 5HX9A 5GHXA 3B47A 1JWVA 3WS0A 3BFEA 1T1CA 1LSXA 4DKIA 3B3XA 4R1GA 3KO6A 2PR6A 1YM1A 4GDBA 4X55A 5M1AA 4R3BA 4ZJ3A 2FZ0A 4GS9B 3T1RA 1TEMA 1CI9A 4L0LA 4KZBA 3VV4A 3PYPA 2CC1A 2KOIA 2EX9A 4U3TA 5L07A 4QWOA 4MEZA 4OH0A 3QNBA 4PMAA 1YLTA 1LL8A 5AQBA 4E3KA 2ZBBA 4IEDA 1I2WA 4WZ4A 1UWPX 3W4OA 2VV7A 2V20A 4XXRA 3T4JA 1XJ3A 5JYPA 3VE3A 4HH3A 5D3OA 4I5SA 4H8RA 5GLAA 4JF6A 1L0DA 1YLYA 4HBTA 2L4RA 3MXRA 3BFDA 3UB7A 4E6XA 3T12B 1PW8A 3ZG5A 3V67A 3NJAA 4FD8A 1HTZA 3E4PA 4QD4A 5HFOA 4E3MA 5DTSA 2GX5A 2M7UA 4GD8A 5KSCA 3NECA 1X0OA 1UGUA 1FCOA 3DAVA 2PD8A 3I7JA 4NG2A 4HP4A 3LIAA 3BLSA 2XD1A 4E3OA 5A8BA 1XFNA 4AFIA 2J8YA 3LR4A 2O0YA 3O86A 2VGLM 3TJZC 4H6JB 4EQ1A 3LO7A 4NETA 3LI9A 3PR6A 4UQIM 1CQAA 3HLCA 5G4YA 3UDXA 2ZQ8A 4BD1A 2OLVA 1JWPA 4WN5A 3MBZA 5J7EA 5FI2A 1DY6A 4RYEA 1VEUB 4OQIA 2HDSA 4ESPA 1DJAA 3BW6A 2A3UA 3G30A 3O87A 3LUQA 3ZG9B 1CI8A 5HDDA 4F94A 3L9KA 4CLCC 2ZL1A 3WRZA 1D7EA 3UY6A 1AXBA 5AJGA 2Y59A 1UWNX 4Y5FA 2ZM2A 4CQHA 3K3DA 3MF0A 4P85A 2ZQ9A 3BYDA 1P97A 2PYPA 5A91A 3MZEA 2HJEA 1GSVA 2J80A 2ZJ9A 4YNRA 2XA7S 1E25A 1NYMA 2XLNA 5J3WA 2JBFA 2OOLA 3W8KA 2BG1A 1OTIA 4R6LA 4B4ZA 3LEZA 1L0FA 3UB8A 2XROA 5E2GA 1LLBA 1MWSA 1SZVA 1ZG4A 1FSYA 3PBTA 3HLBA 2HP6A 2XRNA 5F83A 3UE6A 1F5MA 1YLZA 2H0TA 4OPYA 5L09A 2ZL1B 3SS3A 5F1GA 3VOLA 1P9WA 3WS4A 1EI5A 4N9KA 4JGOA 2FFYA 1OJGA 2PYRA 3HLFA 3E0YA 3MKFA 4N1HA 1S4SA 3FC7A 3TSGA 3MR0A 3IF5A 5TBMA 3S7QA 1XP4A 3GRJA 4X1MA 2HGVA 3P98A 5M18A 3IX8A 5HARA 3CZDA 2C6WB 1F2KA 4Q8IA 1GHMA 4X25A 3HJIA 1YAXA 2H10A 4R38A 2ZC4B 3IHBA 1HD8A 4FTXA 4EEPA 3NBLA 4WLAA 4MBKA 2HDRA 4PM8A 5AQ9A 1FSWA 5AVFA 1OTEA 4HNBA 3C5AA 1NYYA 2HP5A 3IBJA 3PBOA 3WS1A 2QZ6A 4KG6A 3S1YA 2R78A 4LCMA 3ZNYA 4IUKA 3F1OB 1VM1A 2V1AA 4XT2B 1YMSA 3KSIA 2UWXA 3H7WA 5AQ7A 3JPUA 5DJUA 4EBNA 1MY8A 1TS0A 3BRMA 3ULFA 1N9OA 5MC7A 2NUPC 5AQAA 5A92A 2JKGA 4S2PA 3HUNA 4Y0TA 4KQOA 1ERMA 4OQGA 2W0NA 1O7EA 3MZFA 5F69A 3DTMA 3C30A 3UB9A 2EFUA 5CGSA 1NWZA 3PHYA 1L2SA 4PHTA 3CAXA 1G6OA 2OAQ1 2EX2A 2DMWA 4PM9A 3F1NB 4ETXA 3ITAA 3SS5A 3FPVA 4YINA 3ZDJA 3FPWA 4BMWA 2ZQ7A 1RP5A 1RGYA 3H7WB 3T4LA 3LR5A 4KQRA 2ZC5B 2ZOHA 4LV2A 3E98A 3FWLA 5EM0A 4K0XA 1KDSA 2W3GA 4DE3A 4P6ZM 3ZCZA 2ZC3B 5TFQA 5FQQA 2EX8A 4P6BA 4DXCA 3VE4A 1IKIA 2QMIA 4C75A 5CEDA 5FSRA 5G18A 2K2NA 1S67L 1K54C 1K4EA 5E2EA 4EBPA 4BBTA 2HJ9C 2WKRA 5L10A 5HL1A 4UA9A 2J3TC 4NEED 3NDEA 3RH8B 1BUEA 4GW9A 3MQOA 4MN7A 1BZAA 4BBUA 4JXWA 4P0MA 4O01A 3M2JA 1Z09A 1MWRA 2W27A 3WS5A 1V9ZA 5LBRA 4M4XA 4OLGA 1WA9A 2VA0A 2PAVP 5E2HA 1Y28A 2V1BA 2VEAA 2JKRM 1BLCA 5EE8A 4EBLA 4OONA 1ESUA 4IBRA 2W3HA 1NLYA 1VHMA 2R9XA 3LICA 2ZOIA 4S2OA 1TDGA 2G2UA 4PM7A 1HLUP 1W5DA 4JXVA 4X53A 2WKQA 3IX3A 3ZNTA 3MQ0A 2HP9A 2LB9A 4CLCB 2XFTA 3TE8A 3LCEA 4ZBEA 1VQQA 2A2LA 4EWFA 1IEMA 4DXBA 3M2KA 4B93A 2X01A 4RX3A 1H8ZA 3PBQA 4OP8A 3ZFZA 3UB5P 3W2ZA 5J4EA 5F82A 1Q2QA 3KYQA 1S1ZA 1NZOA 3IS2B 3KX0X 4GS9A 3MSHA 4II7A 3RJUA 4JPMA 2V1ZA 4UHUA 5HZHA 1ERQA 3HLGA 3UMEA 3FKWA 4EUZA 5FQIA 3MFXA 2BTFP 4EXOA 1PWDA 5EFWA 5FEGA 2ACGA 4WZ5C 3QNCA 2WGIA 3AGEA 2W3EA 5DKLA 1T1BA 4QY5A 4EV4A 2ZQDA 3O88A 5FQMA 4IBXA 5FQJA 4KQQA 3MQQA 5AVEA 3UO9A 4LRXC 4UEYA 3HL9A 1OJ5A 3HLDA 4NXBA 5DF7A 3IXHA 3PBSA 3NCKA 4OPZA 3T1QB 4R70A 1WYBA 1XA7A 4R0QA 4HY8A 1KE0A 4NXFA 4E04A 2G2WA 2GNXA 2P74A 4OP5A 3LFVA 1FOFA 3EQUA 4R23A 1XXMA 2VJWA 2W3DA 4MBHA 4B9OA 2VZWA 3CWFA 4WEKA 3GQZA 1ZTUA 3P01A 5CTNA 1ONHA 2PHYA 1LL5A 4K08A 2WKHA 2G7UA 2HDQA 2PBYA 1YLWA 4DDSA 3DTKA 5GHZA 3ZQ5A 2PU4A 4H6JA 2B5RA 2V9AA 1D1JA 2JE5A 1S6RA 3HLWA 3O3VA 1ES4A 1ZHHB 4RX2A 5F1FA 1K55C 4RQ9A 1XJ4A 3G35A 3OLOA 1T18A 1VEUA 5DVAA 1K56D 1J3WA 3D3OA 4DE1A 4OOMA 4IVIA 1EW0A 3EEHA 3OPLA 1L0GA 4NKPA 1VB6A 3DWKA 5GLBA 1K56A 2OLUA 1LL9A 5A90A 3CPTA 4LV1A 1K54A 3EEAA 2O9BA 5CGXA 1F9IA 4OOYA 1IKGA 4JF5A 4HJ3A 3KYZA 2JC7A 4LGWA 4HJ6A 3CLOA 2Y2GA 2JCHA 2JHEA 1G5UA 5IS1A 1QMFA 5DF9A 1W63Q 3GDIA 4C3QA 1LI0A 1SHVA 3NY4A 2ZQCA 1PI5A 2V2FF 1CEGA 3R7WB 2QKPA 1OT9A 3UPPA 4OPQA 4N9LA 1PZOA 1W8QA 4YFMA 3IH8A 2Z6DA 5IHVA 3M6BA 3HJKA 4ME4A 1FIKA 3LR3A 3Q07A 1OMEA 2JKFA 2Y2JA 3OC2A 3PBNA 5F5YA 3CPTB 1CK3A 3MFDA 2X71A 3VFFA 3TW8A 1W7FA 2I72A 3ZGAB 1LT0A 3A3FA 1LHYA 3SW1A 4BL2A 1JWZA 2K31A 1FILA 1FR1A 4BL3A 4PKYA 1BLHA 1H8YA 1GCEA 3AGDA 4O0PA 2GZAA 3IT9A 2L1MA 4BBVA 1FCMA 2WAEA 2PT7A 2EWVA 5F68A 1H5XA 4Z1WA 5KZHA 4QPRA 5E43A 1MKMA 2EWWA 3VSLA 2EXBA 1ES3A 2Y55A 3LIFA 3CUEC 5HL6A 1IFQA 1FR6A 1TVFA 4PPRA 3V50A 3ZHHA 1OTBA 3Q7ZA 1YSQA 3IBRA 1XPBA 4DE0A 4EETB 2WYXA 1H0MA 1ES2A 4LV0A 3W4PA 3A3DA 1XX2A 2RCXA 3CI6A 3F1OA 4L9FA 1YKDA 4KZ7A 2VLGA 4QHCA 4Y2FA 3SH8A 1IYOA 3S4XA 3FZCA 5FI6A 2HDUA 1Y54A 4XT2A 1GSWA 4PM5A 2YKHA 1JVJA 1IELA 2WADA 1PFLA 3HBRA 3BECA 1JTGA 2V0WA 4QB8A 1Z6FA 4GCZA 5DTTA 4KZAA 3H82B 4S2LA 3M6HA 1GA9A 5CGWA 3UE0A 2O99A 2Y2MA 3T4QA 3C7VA 4ARZB 2GDNA 3UE1A 5HAPA 2Z2LB 1SDNA 1SKOB 3U4LP 5EOOA 4KUKA 3QP8A 2BASA 3VP4A 4KZ5A 4M3KA 5CHUA 4ZAMA 1KE4A 3C38A 5KSHA 4UAAA 1NY0A 4B88A 3F1NA 5BOHA 3LI8A 3C4OA 2IA2A 1GHPA 3NOUC 5EVIC 3NC8A 5HDCA 3IF6B 3HLEA 2X02A 4N92A 5DJTA 4OOLA 4E3JA 1S4RA 5DFXA 5HWTA 3VSKA 2DRWA 3LIDA 1YT4A 2WKEA 4S2JA 1PI4A 3BY9A 5CHMA 4OQ0A 1NRFA 1K6SA 4XUXA 4N1XA 3QP5A 5CX7A 3KSGA 4MLLA 5IT5A 1I2SA 4GN2A 2VKSA 3HCYA 3GV9A 3MJQA 3ZG8B 1MPLA 4JGPA 1KDWA 2VX8A 4OPRA 3CHWP 2OV5A 1J9MA 1ZG6A 2XR0A 5FAPA 2HZ5A 3RTYA 3H9WA 4G3WA 5FDHA 1DRMA 2OSUA 4GOGA 2VGJA 3D4FA 2EXAA 2I9VA 3RXWA 5HW3A 2JKRI 5FQ9A 5DFYA 1HVBA 4I3IA 3ITBA 3E4QA 3IHAA 2XFSA 4P87A 4HQAA 3LGOA 3OPHA 2XDMA 1T19A 1XA1A 3LIEA 4OQHA 1QMEA 1MWUA 4JGRA 2Y79A 4DDYA 2PBDP 5FAQA 1XJ6A 3T1SA 3W4QA
chains in the Genus database with same CATH topology
2Y2LA 2PU2A 4KG2A 5EUAA 1ALQA 3BLSA 1KE3A 2XD1A 5FATA 4QY5A 4EV4A 2ZQDA 4E3OA 2J8YA 3O88A 4RVAA 5J8XA 5FQMA 3PAEA 4IBXA 1YMXA 3HVFA 3O86A 3ZVTA 5FQJA 1M6KA 3E2KA 2ZC6B 3N8LA 3OPPA 2Y2QA 4OLDA 4KQQA 3LY3A 3LO7A 4NETA 4D2OA 3MXSA 5CEBA 3UO9A 3HLCA 3IWOA 1YQSA 5CXWA 3UDXA 1SDEA 2ZQ8A 1HZOA 3HL9A 4BD1A 3HLDA 2OLVA 5FQKA 5DF7A 2C5WB 1JWPA 3IXHA 4HESA 3MBZA 3FYZA 3PBSA 5FI2A 5FI7A 4WM9A 3NCKA 4RA7A 4LCLA 3SH7A 4OPZA 4R3JA 2Y2PA 1DY6A 4RYEA 1WYBA 1XA7A 3UN7A 4Y0OA 4OQIA 2HDSA 1DJAA 4R0QA 1KE0A 1KGEA 2G2WA 2A3UA 2DNSA 3G30A 3O87A 3UDIA 4JLFA 3ZG9B 1CI8A 4F94A 2P74A 3FKVA 4OP5A 5L2FA 4JBFA 3N7WA 4R4RA 5M19A 1FOFA 1Q2PA 3EQUA 3WRZA 3G32A 1XXMA 4R23A 1MXOA 3IXDA 3VP3A 4MBHA 1XGIA 4S2NA 3DW0A 1K4FA 4ZJ2A 4WEKA 3GQZA 3A3EA 3UY6A 1AXBA 5CTNA 1ONHA 2XD5A 1K55A 1LL5A 1PWGA 2Y59A 4ID4A 1PYYA 2ZM2A 3QHYA 1BLSA 4K91A 4E6WA 2WKHA 2ZLYA 1FCNA 2Y2IA 3IWIA 1NXYA 4P85A 3ZG7B 2ZQ9A 2HDQA 2PBYA 1YLWA 4DDSA 5I94A 3BYDA 5GLDA 2HPBA 5GHZA 4HBUA 5A91A 2BLSA 2PU4A 2Z2MB 4FSFA 4GD6A 4OVDA 3SS4A 5CECA 3IXBA 3MZEA 3VOZA 2ZJ9A 4ZJ1A 2B5RA 2H0YA 4KZ8A 1E25A 1NYMA 5E2FA 2XLNA 5FAOA 2JE5A 4EWFA 2Q9NA 2XEPA 3A3IA 3ZVWA 1S6RA 3HLWA 3O3VA 2JBFA 4FH2A 2FFFB 3W8KA 2BG1A 1ES4A 4RX2A 5F1FA 1K55C 3BEBA 1W79A 4B4ZA 3LEZA 1L0FA 2ZC7A 3G35A 4FCFA 3IQAA 5E2GA 5GHYA 1LLBA 1MWSA 1ZG4A 4PM6A 4X68A 4GZBA 5DTKA 1JTDA 2WZZA 1FSYA 1K56D 3PBTA 5DVAA 2Q9MA 3BFFA 4WBGA 4JXGA 4DE1A 3HLBA 2HP6A 4BJPA 4OOMA 4IVIA 5F83A 1KGFA 3IWQA 2XF3A 1YLZA 1ES5A 2H0TA 3OPLA 4OPYA 3GVBA 3Q81A 3SS3A 1L0GA 5F1GA 3DWKA 5GLBA 4S2KA 3WS4A 1EI5A 1K56A 3BM6A 4X69A 4K0WA 2OLUA 1ONGA 2WGWB 4N9KA 1LL9A 2FFYA 3HLFA 3N8RA 2Y4AA 3MKFA 3G34A 5A90A 4JF4A 4N1HA 4MNRA 3BFGA 2XH9A 4LV1A 3TSGA 3IF5A 4UA7A 1K54A 3N4IA 3V5MA 1KVMA 5EECA 4S2MA 5TR7A 2P9VB 3HREA 3S22A 3UPOA 5CGXA 1XP4A 3TOIA 3GRJA 3IF6C 4X6TA 2Y2HA 4QJGA 4Y0UA 4EQIA 4KG5A 1XKZA 3P98A 5M18A 4OOYA 5HARA 1IKGA 4JF5A 4QY6A 3CZDA 2C6WB 3UDFA 4IVKA 3TG9A 2JC7A 4JXSA 4Q8IA 1GHMA 1PZPA 3E2LA 3LY4A 3Q1FA 4LV3A 2Y2KA 2Y2GA 3VMAA 2JCHA 5EVLA 2H10A 3WS2A 1TDLA 2ZC4B 3V3SA 1IYSA 1QMFA 3IHBA 1HD8A 5EVIA 4LENA 3NBLA 5DF9A 1ZKJA 4MBKA 3A3JA 4E3LA 4C3QA 1LI0A 2HDRA 1SHVA 4PM8A 3OPRA 5AQ9A 1FSWA 3NY4A 2ZQCA 4S2IA 1PI5A 2V2FF 5CERA 3G2YA 1CEGA 4BENA 3C5AA 1NYYA 3UPPA 2HP5A 4OPQA 2J7VA 3N6IA 5TGFA 1ZC2A 3PBOA 3EQVA 4N9LA 4OKPA 1PZOA 1W8QA 4YFMA 3IH8A 2R9WA 3WS1A 5IHVA 2QZ6A 3C7UA 3M6BA 4KG6A 3S1YA 2EX6A 4KZ6A 1C3BA 4LCMA 1RGZA 3ZNYA 4JKTA 3VP2A 3Q07A 2Y91A 1LI9A 1OMEA 3Q7VB 3VP0A 2Y2JA 3OC2A 3NI9A 3PBNA 2ZD8A 2WGWA 2J9OA 3MFDA 1CK3A 1VM1A 2X71A 2VGKA 3VFFA 3VP1A 1W7FA 1YMSA 2I72A 1N9BA 2UWXA 4WMCD 1K57A 5AQ7A 3ZGAB 4EBNA 3A3FA 1LHYA 1DJBA 1MY8A 2WK0A 3BRMA 2P9VA 3SOIA 4BQMA 4BL2A 1KGGA 4CPKA 1JWZA 2RL3A 1FR1A 4BL3A 4E3NA 1BLHA 5AQAA 5A92A 1H8YA 1GCEA 3AGDA 4WMCA 3IT9A 5CTMA 2WKIA 4R4SA 4S2PA 1FCMA 1ESIA 2WAEA 3HUNA 4Y0TA 1I5QA 5FASA 1H5XA 3P09A 4GB7A 4KQOA 1N4OA 1ERMA 4OQGA 5EVIB 5HAQA 5KZHA 4S2NC 2J9PA 1NZUA 3GMWA 5E43A 1E3UD 4UA6A 1O7EA 2WAFA 3MZFA 3DTMA 3UE3A 4NK3A 5FA7A 1BULA 4GKUA 2EXBA 3VSLA 1ES3A 2Y55A 1S0WA 1YLJA 1BLPA 2EFUA 2ZM0A 5CGSA 1FR6A 1G68A 1TVFA 4PPRA 4Z9QA 5DF8A 1L2SA 3V50A 2IWCA 3ZHHA 1BT5A 3Q7ZA 5CRFA 2EX2A 1XPBA 3IXGA 1E3UA 3VFHA 2WGVA 4DE0A 2Y2NA 1L0EA 2WYXA 4U0XA 4PM9A 4BD0A 1ES2A 4FH4A 3HUMA 4LV0A 3W4PA 3JYIA 1K38A 3A3DA 3ITAA 1XX2A 5CHJA 2RCXA 3SS5A 5GL9A 4BLMA 5EPHA 4YINA 3PAGA 4KZ7A 3Q7VA 3ZDJA 2EFXA 3UNWA 1G6AA 1RCJA 3N8SA 4QHCA 3V39A 3SH8A 1IYOA 3OZHA 3S4XA 3FZCA 2ZQ7A 5FI6A 1RP5A 2HDUA 4KZ3A 1RGYA 1Y54A 4KQRA 2ZC5B 4PM5A 1WYCA 4ZDXA 1W8YA 3PBRA 3C4PA 4LV2A 2A49A 2ZMAA 3WRTA 3FWLA 1NJ4A 1DJCA 1U60A 1GA0A 1JVJA 1IELA 2WADA 3HBRA 5EVID 4K0XA 4A5RA 1KDSA 3BECA 4DE3A 1JTGA 5KMWA 4QB8A 1K25A 1Z6FA 2XK1A 5DTTA 3ZCZA 2ZC3B 4KZAA 1PWCA 4S2LA 3M6HA 4GDNA 5TFQA 1GA9A 5CGWA 1PIOA 5GLCA 2Y2MA 3UE0A 5FQQA 3CMZA 2Y2OA 4U0TA 2EX8A 4P6BA 3CJMA 3C7VA 2IWBA 2ZM8A 3UPNA 4QU3A 1MWTA 4Y7PA 4DXCA 5JYOA 1IKIA 1IYQA 3GR2A 1EWZA 1XGJA 2QMIA 4C75A 2GDNA 1FQGA 1WE4A 3Q82A 5CEDA 3UE1A 5HX9A 5FSRA 5G18A 2QPNA 2XQZA 5GHXA 1K54C 4WEJA 1K4EA 1JWVA 5E2EA 2Z2LB 3WS0A 3BFEA 1K6RA 5HAPA 4EBPA 1SDNA 3RXXA 3SH9A 4X56A 5U47A 5EOOA 4DKIA 1YLPA 3B3XA 3VP4A 4KZ5A 4M3KA 1SKFA 4MBFA 4R1GA 5CHUA 1KE4A 2H5SA 4ZAMA 5HL1A 4UA9A 4XUZA 5KSHA 3MZDA 4UAAA 1NY0A 4B88A 3OCNA 3NDEA 1BUEA 5A93A 4KZ9A 5BOHA 1YM1A 3C4OA 4GDBA 1BZAA 1E4DA 1GHPA 4JXWA 4X55A 4P0MA 2DCFA 5EVIC 4WELA 3M2JA 3NC8A 5M1AA 3IF6B 4R3BA 1GHIA 3HLEA 4ZJ3A 1MWRA 2X02A 3G31A 4N92A 3WS5A 4OOLA 4E3JA 4OLGA 1TEMA 3VSKA 5E2HA 1CI9A 4HEFA 3GSGA 2DRWA 4L0LA 1YT4A 2IWDA 2WUQA 3OCLA 4KZBA 2WKEA 4S2JA 1MBLA 2CC1A 1PI4A 1CEFA 2EX9A 1KVLA 1BLCA 3ISGA 4U3TA 3CG5A 4KZ4A 5EE8A 4EBLA 4OONA 5CHMA 3WWXA 3NIAA 3BFCA 4OQ0A 4MEZA 4WYYA 1NRFA 1ESUA 4OH0A 4IBRA 3QNBA 4PMAA 1YLTA 1K6SA 2ZQAA 4XUXA 4N1XA 1O07A 5AQBA 1MKIA 2R9XA 3BLMA 4MLLA 4S2OA 1I2SA 4C6YA 1PW1A 1TDGA 4GN2A 2G2UA 3V3RA 1BSGA 4E3KA 4PM7A 3GV9A 1W5DA 4IEDA 3ZG8B 4JXVA 1I2WA 4X53A 1MPLA 2XGNA 3DWZA 2E8IA 1KDWA 4WZ4A 1K57C 3ZNTA 4B4XA 4OPRA 3W4OA 1M40A 2OV5A 1J9MA 2HP9A 3NDGA 2V20A 1ZG6A 2XR0A 4XXRA 5FAPA 3GTCA 5JYPA 2XFTA 5D3OA 5EOEA 3LCEA 4H8RA 5FDHA 4ZBEA 5GLAA 1VQQA 4JF6A 1L0DA 2OSUA 1YLYA 2VGJA 3MKEA 4GOGA 4HBTA 3AGFA 3D4FA 3MXRA 4ZTKA 1IEMA 2EXAA 4DXBA 3G4PA 3BFDA 3M2KA 3RXWA 4WZ5A 2X01A 4RX3A 4DE2A 1H8ZA 3PBQA 4OP8A 5HW3A 4E6XA 5FQ9A 3G2ZA 3ZFZA 4DF6A 5F82A 1PW8A 1EROA 1SCWA 3IF6A 1Q2QA 3ZG5A 1NZOA 1HVBA 4DRTA 4O7DA 3RJUA 2WZXA 3ITBA 4JPMA 2V1ZA 1BTLA 3VOYA 5HAIA 4UHUA 3PTEA 3IHAA 3FV7A 1ERQA 4CJNA 4FD8A 1HTZA 2XFSA 3HLGA 3ZG0A 4P87A 3FKWA 4QD4A 4EUZA 5HFOA 5FQIA 3OPHA 4E3MA 5DTSA 2XDMA 1XA1A 3IH9A 1PWDA 4GNUA 1QMEA 1MWUA 4OQHA 4E3IA 4GD8A 4DDYA 4KENB 5KSCA 1IYPA 4WZ5C 3QNCA 5FAQA 1FCOA 2WGIA 3I7JA 3HUOA 3AGEA 3W4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y2L A;  2PU2 A;  4KG2 A;  5EUA A;  1ALQ A;  3BLS A;  1KE3 A;  2XD1 A;  5FAT A;  4QY5 A;  4EV4 A;  2ZQD A;  4E3O A;  2J8Y A;  3O88 A;  4RVA A;  5J8X A;  5FQM A;  3PAE A;  4IBX A;  1YMX A;  3HVF A;  3O86 A;  3ZVT A;  5FQJ A;  1M6K A;  3E2K A;  2ZC6 B;  3N8L A;  3OPP A;  2Y2Q A;  4OLD A;  4KQQ A;  3LY3 A;  3LO7 A;  4NET A;  4D2O A;  3MXS A;  5CEB A;  3UO9 A;  3HLC A;  3IWO A;  1YQS A;  5CXW A;  3UDX A;  1SDE A;  2ZQ8 A;  1HZO A;  3HL9 A;  4BD1 A;  3HLD A;  2OLV A;  5FQK A;  5DF7 A;  2C5W B;  1JWP A;  3IXH A;  4HES A;  3MBZ A;  3FYZ A;  3PBS A;  5FI2 A;  5FI7 A;  4WM9 A;  3NCK A;  4RA7 A;  4LCL A;  3SH7 A;  4OPZ A;  4R3J A;  2Y2P A;  1DY6 A;  4RYE A;  1WYB A;  1XA7 A;  3UN7 A;  4Y0O A;  4OQI A;  2HDS A;  1DJA A;  4R0Q A;  1KE0 A;  1KGE A;  2G2W A;  2A3U A;  2DNS A;  3G30 A;  3O87 A;  3UDI A;  4JLF A;  3ZG9 B;  1CI8 A;  4F94 A;  2P74 A;  3FKV A;  4OP5 A;  5L2F A;  4JBF A;  3N7W A;  4R4R A;  5M19 A;  1FOF A;  1Q2P A;  3EQU A;  3WRZ A;  3G32 A;  1XXM A;  4R23 A;  1MXO A;  3IXD A;  3VP3 A;  4MBH A;  1XGI A;  4S2N A;  3DW0 A;  1K4F A;  4ZJ2 A;  4WEK A;  3GQZ A;  3A3E A;  3UY6 A;  1AXB A;  5CTN A;  1ONH A;  2XD5 A;  1K55 A;  1LL5 A;  1PWG A;  2Y59 A;  4ID4 A;  1PYY A;  2ZM2 A;  3QHY A;  1BLS A;  4K91 A;  4E6W A;  2WKH A;  2ZLY A;  1FCN A;  2Y2I A;  3IWI A;  1NXY A;  4P85 A;  3ZG7 B;  2ZQ9 A;  2HDQ A;  2PBY A;  1YLW A;  4DDS A;  5I94 A;  3BYD A;  5GLD A;  2HPB A;  5GHZ A;  4HBU A;  5A91 A;  2BLS A;  2PU4 A;  2Z2M B;  4FSF A;  4GD6 A;  4OVD A;  3SS4 A;  5CEC A;  3IXB A;  3MZE A;  3VOZ A;  2ZJ9 A;  4ZJ1 A;  2B5R A;  2H0Y A;  4KZ8 A;  1E25 A;  1NYM A;  5E2F A;  2XLN A;  5FAO A;  2JE5 A;  4EWF A;  2Q9N A;  2XEP A;  3A3I A;  3ZVW A;  1S6R A;  3HLW A;  3O3V A;  2JBF A;  4FH2 A;  2FFF B;  3W8K A;  2BG1 A;  1ES4 A;  4RX2 A;  5F1F A;  1K55 C;  3BEB A;  1W79 A;  4B4Z A;  3LEZ A;  1L0F A;  2ZC7 A;  3G35 A;  4FCF A;  3IQA A;  5E2G A;  5GHY A;  1LLB A;  1MWS A;  1ZG4 A;  4PM6 A;  4X68 A;  4GZB A;  5DTK A;  1JTD A;  2WZZ A;  1FSY A;  1K56 D;  3PBT A;  5DVA A;  2Q9M A;  3BFF A;  4WBG A;  4JXG A;  4DE1 A;  3HLB A;  2HP6 A;  4BJP A;  4OOM A;  4IVI A;  5F83 A;  1KGF A;  3IWQ A;  2XF3 A;  1YLZ A;  1ES5 A;  2H0T A;  3OPL A;  4OPY A;  3GVB A;  3Q81 A;  3SS3 A;  1L0G A;  5F1G A;  3DWK A;  5GLB A;  4S2K A;  3WS4 A;  1EI5 A;  1K56 A;  3BM6 A;  4X69 A;  4K0W A;  2OLU A;  1ONG A;  2WGW B;  4N9K A;  1LL9 A;  2FFY A;  3HLF A;  3N8R A;  2Y4A A;  3MKF A;  3G34 A;  5A90 A;  4JF4 A;  4N1H A;  4MNR A;  3BFG A;  2XH9 A;  4LV1 A;  3TSG A;  3IF5 A;  4UA7 A;  1K54 A;  3N4I A;  3V5M A;  1KVM A;  5EEC A;  4S2M A;  5TR7 A;  2P9V B;  3HRE A;  3S22 A;  3UPO A;  5CGX A;  1XP4 A;  3TOI A;  3GRJ A;  3IF6 C;  4X6T A;  2Y2H A;  4QJG A;  4Y0U A;  4EQI A;  4KG5 A;  1XKZ A;  3P98 A;  5M18 A;  4OOY A;  5HAR A;  1IKG A;  4JF5 A;  4QY6 A;  3CZD A;  2C6W B;  3UDF A;  4IVK A;  3TG9 A;  2JC7 A;  4JXS A;  4Q8I A;  1GHM A;  1PZP A;  3E2L A;  3LY4 A;  3Q1F A;  4LV3 A;  2Y2K A;  2Y2G A;  3VMA A;  2JCH A;  5EVL A;  2H10 A;  3WS2 A;  1TDL A;  2ZC4 B;  3V3S A;  1IYS A;  1QMF A;  3IHB A;  1HD8 A;  5EVI A;  4LEN A;  3NBL A;  5DF9 A;  1ZKJ A;  4MBK A;  3A3J A;  4E3L A;  4C3Q A;  1LI0 A;  2HDR A;  1SHV A;  4PM8 A;  3OPR A;  5AQ9 A;  1FSW A;  3NY4 A;  2ZQC A;  4S2I A;  1PI5 A;  2V2F F;  5CER A;  3G2Y A;  1CEG A;  4BEN A;  3C5A A;  1NYY A;  3UPP A;  2HP5 A;  4OPQ A;  2J7V A;  3N6I A;  5TGF A;  1ZC2 A;  3PBO A;  3EQV A;  4N9L A;  4OKP A;  1PZO A;  1W8Q A;  4YFM A;  3IH8 A;  2R9W A;  3WS1 A;  5IHV A;  2QZ6 A;  3C7U A;  3M6B A;  4KG6 A;  3S1Y A;  2EX6 A;  4KZ6 A;  1C3B A;  4LCM A;  1RGZ A;  3ZNY A;  4JKT A;  3VP2 A;  3Q07 A;  2Y91 A;  1LI9 A;  1OME A;  3Q7V B;  3VP0 A;  2Y2J A;  3OC2 A;  3NI9 A;  3PBN A;  2ZD8 A;  2WGW A;  2J9O A;  3MFD A;  1CK3 A;  1VM1 A;  2X71 A;  2VGK A;  3VFF A;  3VP1 A;  1W7F A;  1YMS A;  2I72 A;  1N9B A;  2UWX A;  4WMC D;  1K57 A;  5AQ7 A;  3ZGA B;  4EBN A;  3A3F A;  1LHY A;  1DJB A;  1MY8 A;  2WK0 A;  3BRM A;  2P9V A;  3SOI A;  4BQM A;  4BL2 A;  1KGG A;  4CPK A;  1JWZ A;  2RL3 A;  1FR1 A;  4BL3 A;  4E3N A;  1BLH A;  5AQA A;  5A92 A;  1H8Y A;  1GCE A;  3AGD A;  4WMC A;  3IT9 A;  5CTM A;  2WKI A;  4R4S A;  4S2P A;  1FCM A;  1ESI A;  2WAE A;  3HUN A;  4Y0T A;  1I5Q A;  5FAS A;  1H5X A;  3P09 A;  4GB7 A;  4KQO A;  1N4O A;  1ERM A;  4OQG A;  5EVI B;  5HAQ A;  5KZH A;  4S2N C;  2J9P A;  1NZU A;  3GMW A;  5E43 A;  1E3U D;  4UA6 A;  1O7E A;  2WAF A;  3MZF A;  3DTM A;  3UE3 A;  4NK3 A;  5FA7 A;  1BUL A;  4GKU A;  2EXB A;  3VSL A;  1ES3 A;  2Y55 A;  1S0W A;  1YLJ A;  1BLP A;  2EFU A;  2ZM0 A;  5CGS A;  1FR6 A;  1G68 A;  1TVF A;  4PPR A;  4Z9Q A;  5DF8 A;  1L2S A;  3V50 A;  2IWC A;  3ZHH A;  1BT5 A;  3Q7Z A;  5CRF A;  2EX2 A;  1XPB A;  3IXG A;  1E3U A;  3VFH A;  2WGV A;  4DE0 A;  2Y2N A;  1L0E A;  2WYX A;  4U0X A;  4PM9 A;  4BD0 A;  1ES2 A;  4FH4 A;  3HUM A;  4LV0 A;  3W4P A;  3JYI A;  1K38 A;  3A3D A;  3ITA A;  1XX2 A;  5CHJ A;  2RCX A;  3SS5 A;  5GL9 A;  4BLM A;  5EPH A;  4YIN A;  3PAG A;  4KZ7 A;  3Q7V A;  3ZDJ A;  2EFX A;  3UNW A;  1G6A A;  1RCJ A;  3N8S A;  4QHC A;  3V39 A;  3SH8 A;  1IYO A;  3OZH A;  3S4X A;  3FZC A;  2ZQ7 A;  5FI6 A;  1RP5 A;  2HDU A;  4KZ3 A;  1RGY A;  1Y54 A;  4KQR A;  2ZC5 B;  4PM5 A;  1WYC A;  4ZDX A;  1W8Y A;  3PBR A;  3C4P A;  4LV2 A;  2A49 A;  2ZMA A;  3WRT A;  3FWL A;  1NJ4 A;  1DJC A;  1U60 A;  1GA0 A;  1JVJ A;  1IEL A;  2WAD A;  3HBR A;  5EVI D;  4K0X A;  4A5R A;  1KDS A;  3BEC A;  4DE3 A;  1JTG A;  5KMW A;  4QB8 A;  1K25 A;  1Z6F A;  2XK1 A;  5DTT A;  3ZCZ A;  2ZC3 B;  4KZA A;  1PWC A;  4S2L A;  3M6H A;  4GDN A;  5TFQ A;  1GA9 A;  5CGW A;  1PIO A;  5GLC A;  2Y2M A;  3UE0 A;  5FQQ A;  3CMZ A;  2Y2O A;  4U0T A;  2EX8 A;  4P6B A;  3CJM A;  3C7V A;  2IWB A;  2ZM8 A;  3UPN A;  4QU3 A;  1MWT A;  4Y7P A;  4DXC A;  5JYO A;  1IKI A;  1IYQ A;  3GR2 A;  1EWZ A;  1XGJ A;  2QMI A;  4C75 A;  2GDN A;  1FQG A;  1WE4 A;  3Q82 A;  5CED A;  3UE1 A;  5HX9 A;  5FSR A;  5G18 A;  2QPN A;  2XQZ A;  5GHX A;  1K54 C;  4WEJ A;  1K4E A;  1JWV A;  5E2E A;  2Z2L B;  3WS0 A;  3BFE A;  1K6R A;  5HAP A;  4EBP A;  1SDN A;  3RXX A;  3SH9 A;  4X56 A;  5U47 A;  5EOO A;  4DKI A;  1YLP A;  3B3X A;  3VP4 A;  4KZ5 A;  4M3K A;  1SKF A;  4MBF A;  4R1G A;  5CHU A;  1KE4 A;  2H5S A;  4ZAM A;  5HL1 A;  4UA9 A;  4XUZ A;  5KSH A;  3MZD A;  4UAA A;  1NY0 A;  4B88 A;  3OCN A;  3NDE A;  1BUE A;  5A93 A;  4KZ9 A;  5BOH A;  1YM1 A;  3C4O A;  4GDB A;  1BZA A;  1E4D A;  1GHP A;  4JXW A;  4X55 A;  4P0M A;  2DCF A;  5EVI C;  4WEL A;  3M2J A;  3NC8 A;  5M1A A;  3IF6 B;  4R3B A;  1GHI A;  3HLE A;  4ZJ3 A;  1MWR A;  2X02 A;  3G31 A;  4N92 A;  3WS5 A;  4OOL A;  4E3J A;  4OLG A;  1TEM A;  3VSK A;  5E2H A;  1CI9 A;  4HEF A;  3GSG A;  2DRW A;  4L0L A;  1YT4 A;  2IWD A;  2WUQ A;  3OCL A;  4KZB A;  2WKE A;  4S2J A;  1MBL A;  2CC1 A;  1PI4 A;  1CEF A;  2EX9 A;  1KVL A;  1BLC A;  3ISG A;  4U3T A;  3CG5 A;  4KZ4 A;  5EE8 A;  4EBL A;  4OON A;  5CHM A;  3WWX A;  3NIA A;  3BFC A;  4OQ0 A;  4MEZ A;  4WYY A;  1NRF A;  1ESU A;  4OH0 A;  4IBR A;  3QNB A;  4PMA A;  1YLT A;  1K6S A;  2ZQA A;  4XUX A;  4N1X A;  1O07 A;  5AQB A;  1MKI A;  2R9X A;  3BLM A;  4MLL A;  4S2O A;  1I2S A;  4C6Y A;  1PW1 A;  1TDG A;  4GN2 A;  2G2U A;  3V3R A;  1BSG A;  4E3K A;  4PM7 A;  3GV9 A;  1W5D A;  4IED A;  3ZG8 B;  4JXV A;  1I2W A;  4X53 A;  1MPL A;  2XGN A;  3DWZ A;  2E8I A;  1KDW A;  4WZ4 A;  1K57 C;  3ZNT A;  4B4X A;  4OPR A;  3W4O A;  1M40 A;  2OV5 A;  1J9M A;  2HP9 A;  3NDG A;  2V20 A;  1ZG6 A;  2XR0 A;  4XXR A;  5FAP A;  3GTC A;  5JYP A;  2XFT A;  5D3O A;  5EOE A;  3LCE A;  4H8R A;  5FDH A;  4ZBE A;  5GLA A;  1VQQ A;  4JF6 A;  1L0D A;  2OSU A;  1YLY A;  2VGJ A;  3MKE A;  4GOG A;  4HBT A;  3AGF A;  3D4F A;  3MXR A;  4ZTK A;  1IEM A;  2EXA A;  4DXB A;  3G4P A;  3BFD A;  3M2K A;  3RXW A;  4WZ5 A;  2X01 A;  4RX3 A;  4DE2 A;  1H8Z A;  3PBQ A;  4OP8 A;  5HW3 A;  4E6X A;  5FQ9 A;  3G2Z A;  3ZFZ A;  4DF6 A;  5F82 A;  1PW8 A;  1ERO A;  1SCW A;  3IF6 A;  1Q2Q A;  3ZG5 A;  1NZO A;  1HVB A;  4DRT A;  4O7D A;  3RJU A;  2WZX A;  3ITB A;  4JPM A;  2V1Z A;  1BTL A;  3VOY A;  5HAI A;  4UHU A;  3PTE A;  3IHA A;  3FV7 A;  1ERQ A;  4CJN A;  4FD8 A;  1HTZ A;  2XFS A;  3HLG A;  3ZG0 A;  4P87 A;  3FKW A;  4QD4 A;  4EUZ A;  5HFO A;  5FQI A;  3OPH A;  4E3M A;  5DTS A;  2XDM A;  1XA1 A;  3IH9 A;  1PWD A;  4GNU A;  1QME A;  1MWU A;  4OQH A;  4E3I A;  4GD8 A;  4DDY A;  4KEN B;  5KSC A;  1IYP A;  4WZ5 C;  3QNC A;  5FAQ A;  1FCO A;  2WGI A;  3I7J A;  3HUO A;  3AGE A;  3W4Q A; 
#chains in the Genus database with same CATH topology
 2PU2 A;  5EUA A;  1ALQ A;  1KE3 A;  4CLC D;  1TS7 A;  5FAT A;  3BQA A;  4RVA A;  3NOP C;  3T4T A;  5J8X A;  3HVF A;  3OPP A;  2ZC6 B;  2Y2Q A;  4OLD A;  2V8F A;  4D2O A;  3MXS A;  5CEB A;  5TJJ A;  3IWO A;  4CLC A;  1YQS A;  1HZO A;  5FQK A;  1TF1 A;  2C5W B;  3T4S A;  4HES A;  1JNU A;  3FYZ A;  5FI7 A;  4RA7 A;  4LCL A;  4Q0J A;  3MMH A;  2Y2P A;  2PR5 A;  4Y0O A;  3ICY A;  4GHI B;  2KDK A;  1KGE A;  1VET B;  2XA7 M;  3IS2 A;  2DNS A;  3UDI A;  5I5L A;  2O9C A;  1XJ2 A;  5L2F A;  2OWJ A;  2W3F A;  5FL3 A;  4R4R A;  5M19 A;  3G32 A;  2VGL S;  3VP3 A;  3DW0 A;  4UQI S;  1PWG A;  2XD5 A;  4LFU A;  3QP4 A;  2ZLY A;  2Y2I A;  3IWI A;  4NXG A;  4HBU A;  1GSX A;  1MZU A;  3EGD C;  2Z2M B;  3SS4 A;  4OVD A;  5HWW A;  2INW A;  3IXB A;  2A24 B;  1TS6 A;  4HIA A;  4ZJ1 A;  4KZ8 A;  2XEP A;  3A3I A;  2FFF B;  4I39 A;  3UMD A;  3BEB A;  1W79 A;  5KIZ A;  1W63 M;  3IQA A;  5EV0 A;  4PM6 A;  4X68 A;  4GZB A;  3BFF A;  4WBG A;  4JXG A;  4BJP A;  3IWQ A;  4Q0H A;  4EUV A;  1D06 A;  1ES5 A;  3Q81 A;  4G3V A;  4S2K A;  3BM6 A;  2WGW B;  4MN5 A;  2Y4A A;  2P04 A;  4JF4 A;  3S7P A;  3B33 A;  4F3L B;  4S2M A;  5TR7 A;  2P9V B;  3IF6 C;  4EQI A;  4KG5 A;  4DJ2 A;  4HJ4 A;  3UDF A;  2PRF A;  4HOI A;  4Q0I A;  4JXS A;  2Y2K A;  3VMA A;  3K3C A;  1TDL A;  4PAU A;  1IYS A;  1ODV A;  4WUJ A;  3V3S A;  2VV8 A;  3A0V A;  5EVI A;  4LEN A;  1ZKJ A;  3A3J A;  4E3L A;  3JVV A;  2Z6C A;  4GLQ A;  4S2I A;  5CER A;  3G2Y A;  4FUW A;  3S7O A;  4MCW A;  3E4O A;  1AWI A;  5TGF A;  3EQV A;  2XSS A;  2Y8H A;  3NUL A;  1C3B A;  2B95 A;  3LYX A;  4JKT A;  3VP2 A;  2V0U A;  1LI9 A;  3O5Y A;  3Q7V B;  3NI9 A;  3T50 A;  3F1P B;  2J9O A;  3VP1 A;  3P7N A;  4HI4 A;  4JGQ A;  4WMC D;  2M1C A;  5HDS A;  1Y4O A;  2WK0 A;  5HPI A;  3EOI A;  1KGG A;  3EWK A;  1ACF A;  3MS6 A;  1N9L A;  4WMC A;  5CTM A;  4R4S A;  3D9Y A;  1ESI A;  1I5Q A;  5FAS A;  4GB7 A;  1N4O A;  3EGX C;  5EVI B;  4S2N C;  2J9P A;  1NZU A;  4UA6 A;  4EW7 A;  2J3W A;  1PNE A;  4NK3 A;  5FA7 A;  4GKU A;  1YLJ A;  2ZM0 A;  4YOF A;  1G68 A;  2QJ7 A;  1DP6 A;  5DF8 A;  3BWL A;  5CRF A;  3IXG A;  3VFH A;  2WGV A;  4R3A A;  3R7W A;  2Y2N A;  1L0E A;  2V8C A;  5L8M A;  4FH4 A;  3HUM A;  4IHQ A;  5G4Z A;  5EM1 A;  1K38 A;  5CHJ A;  1G28 A;  5GL9 A;  4BLM A;  5EPH A;  4I38 A;  2QYB A;  2PDR A;  3KSH A;  3V39 A;  1YSP A;  1LSV A;  4CLC E;  3OZH A;  2MJ6 A;  4KZ3 A;  1DP9 A;  2J3T D;  3KSF A;  4GJ4 A;  2NUT C;  1A0K A;  1WYC A;  3B42 A;  3BJN A;  4ZDX A;  3PBR A;  1OPX A;  3GEC A;  2A49 A;  1CF0 A;  1NJ4 A;  4A5R A;  5KMW A;  4IUH A;  1PWC A;  2AVX A;  4EER A;  4O8G A;  1PIO A;  2B02 A;  2LB5 A;  3CMZ A;  4U0T A;  3UPN A;  4DN0 A;  5JYO A;  1MWT A;  5F6A A;  3GR2 A;  1XGJ A;  1WE4 A;  3Q82 A;  5HD5 A;  4X1L A;  2QPN A;  2XQZ A;  4EES A;  4WEJ A;  1K6R A;  4Y17 A;  4EU0 A;  3RXX A;  3SH9 A;  4X56 A;  5U47 A;  1YLP A;  4FOF A;  1SKF A;  4MBF A;  5DKK A;  2H5S A;  2KX6 A;  2P7J A;  4XUZ A;  3MZD A;  3OCN A;  3C2W A;  5A93 A;  1S1Y A;  4KZ9 A;  1E4D A;  2DCF A;  4P6Z S;  4WEL A;  1GHI A;  1TD5 A;  3G31 A;  4MN6 A;  3T4O A;  2L0W A;  4HEF A;  2FH5 A;  3GSG A;  2WUQ A;  2IWD A;  3OCL A;  1S66 L;  1MBL A;  3DBA A;  1CEF A;  5FEF A;  1KVL A;  3ISG A;  4LRZ E;  1STZ A;  3MXQ A;  3CG5 A;  4KZ4 A;  3WWX A;  3NIA A;  3BFC A;  3H82 A;  4WYY A;  4ZRR A;  2ZQA A;  4G3K A;  1O07 A;  1MKI A;  3RFB A;  4BWI A;  3BLM A;  4HH2 A;  4ARZ A;  2O9A A;  4C6Y A;  1PW1 A;  3V3R A;  1BSG A;  3DWZ A;  2XGN A;  2E8I A;  1K57 C;  4B4X A;  1M40 A;  5EVE A;  2CMN A;  3DTI A;  3K2N A;  1SKO A;  3NDG A;  2M7V A;  3GTC A;  5EOE A;  3BY8 A;  3MKE A;  4ZTK A;  3AGF A;  3G4P A;  4WZ5 A;  1H8M A;  4DE2 A;  3G2Z A;  4DF6 A;  1ERO A;  1SCW A;  3IF6 A;  3KYE A;  4ETZ A;  1BYW A;  4DRT A;  4O7D A;  2WZX A;  1BTL A;  2PD7 A;  3VOY A;  5HAI A;  3PTE A;  3FV7 A;  4CJN A;  4L9G A;  2W1T A;  5C5K A;  3ZG0 A;  2E8J A;  1XFQ A;  3IH9 A;  4GNU A;  1TS8 A;  4E3I A;  4KEN B;  1IYP A;  4LRY C;  4I3A A;  3C8C A;  3HUO A;  2VV6 A;  2Y2L A;  4KG2 A;  4L9E A;  3SZT A;  3PAE A;  1YMX A;  1N9N A;  3ZVT A;  1M6K A;  3E2K A;  3N8L A;  5HPF A;  3LY3 A;  3TRC A;  4Y3I A;  1MC0 A;  5CXW A;  1SDE A;  1F98 A;  3S7N A;  4Y13 A;  4MMN A;  2JN7 A;  1OT6 A;  4WM9 A;  3T1X A;  5HSQ A;  3SH7 A;  2OAP 1;  4R3J A;  2KLI A;  4LLO B;  3LR0 A;  3UN7 A;  1V9Y A;  4JLF A;  3DTE A;  2W1T B;  3FKV A;  2JKT I;  2GJ3 A;  4JBF A;  3N7W A;  1Q2P A;  1MXO A;  3IXD A;  3D72 A;  1XGI A;  4S2N A;  4YWZ A;  1K4F A;  4ZJ2 A;  3A3E A;  2QHK A;  3PXP A;  5TBM B;  1K55 A;  4DJ3 A;  1P9R A;  4ID4 A;  1PYY A;  3U2A A;  2D01 A;  3QHY A;  1BLS A;  4K91 A;  4E6W A;  1FCN A;  1NXY A;  3ZG7 B;  5I94 A;  5GLD A;  2HPB A;  3A0R A;  2P08 A;  3LEQ A;  2BLS A;  3T4K A;  4FSF A;  4GD6 A;  5CEC A;  3VOZ A;  5FDS A;  2H0Y A;  4EEU A;  1NRJ A;  5E2F A;  5FAO A;  2Q9N A;  3ZVW A;  4HHD A;  4FH2 A;  1H3Q A;  2UV0 E;  2ZC7 A;  4FCF A;  5GHY A;  5DTK A;  1JTD A;  2WZZ A;  2Q9M A;  4GHI A;  1VET A;  1CJF A;  1KGF A;  1K0K A;  2XF3 A;  2WKP A;  3GVB A;  3ZYT A;  4X69 A;  4K0W A;  4Y15 A;  1ONG A;  3N8R A;  4D60 A;  3G34 A;  2JKT M;  4MNR A;  3BFG A;  2XH9 A;  2D02 A;  4UA7 A;  3IX4 A;  3N4I A;  1KVM A;  3V5M A;  5EEC A;  3HRE A;  3S22 A;  3UPO A;  3QP2 A;  3TOI A;  1L3L A;  1YPR A;  4X6T A;  2Y2H A;  4QJG A;  4Y0U A;  1XKZ A;  4QY6 A;  4KUO A;  4IVK A;  1DP8 A;  3TG9 A;  3JVU A;  2H28 A;  1PZP A;  3E2L A;  3LY4 A;  3Q1F A;  4LPZ A;  4LV3 A;  2A24 A;  4KQD A;  5EVL A;  4DMZ A;  3WS2 A;  2YKF A;  3LIB A;  2ZMV A;  3OPR A;  4MDZ A;  4BEN A;  2EA9 A;  2J7V A;  3N6I A;  3OOV A;  1ZC2 A;  4OKP A;  2R9W A;  2ZMF A;  3C7U A;  2EX6 A;  4KZ6 A;  1RGZ A;  3A0S A;  3OBF A;  2Y91 A;  3G6O A;  3VP0 A;  4WL9 A;  4HP9 A;  2ZD8 A;  2HF6 A;  2WGW A;  3BQ8 A;  4PKY G;  2VGK A;  3CUE A;  1N9B A;  2Q0O A;  1K57 A;  3CIT A;  1DJB A;  4F3L A;  3FG8 A;  2P9V A;  3SOI A;  4BQM A;  4CPK A;  2RL3 A;  3NOT C;  4E3N A;  2K7S A;  1OTD A;  2HV1 A;  4IJG A;  2B18 A;  2WKI A;  1IOU A;  3P09 A;  3L7H A;  5HAQ A;  3QP6 A;  3GMW A;  1E3U D;  2WAF A;  3UE3 A;  1BUL A;  1OTA A;  1S0W A;  1BLP A;  2VK3 A;  4Z9Q A;  2IWC A;  1BT5 A;  2OWH A;  1E3U A;  1PRQ A;  4U0X A;  4BD0 A;  3R4K A;  3JYI A;  1P0Z A;  4I3J A;  3NHQ A;  3PAG A;  3Q7V A;  2EFX A;  3UNW A;  1G6A A;  1RCJ A;  3N8S A;  3QP1 A;  5K5B A;  5IU1 A;  3F1P A;  5HWV A;  1W8Y A;  4NXE A;  3C4P A;  2ZMA A;  3WRT A;  1DJC A;  1U60 A;  1GA0 A;  1T1A A;  5EVI D;  1LSW A;  2QJ5 A;  1K25 A;  2XK1 A;  4GDN A;  5GLC A;  1KOU A;  2Y2O A;  2IWB A;  3CJM A;  2ZM8 A;  4QU3 A;  2QWS A;  4Y7P A;  5HD3 A;  1IYQ A;  1EWZ A;  1NLZ A;  1FQG A;  2W1R A;  4WF0 A;  3UB6 A;  5HX9 A;  5GHX A;  3B47 A;  1JWV A;  3WS0 A;  3BFE A;  1T1C A;  1LSX A;  4DKI A;  3B3X A;  4R1G A;  3KO6 A;  2PR6 A;  1YM1 A;  4GDB A;  4X55 A;  5M1A A;  4R3B A;  4ZJ3 A;  2FZ0 A;  4GS9 B;  3T1R A;  1TEM A;  1CI9 A;  4L0L A;  4KZB A;  3VV4 A;  3PYP A;  2CC1 A;  2KOI A;  2EX9 A;  4U3T A;  5L07 A;  4QWO A;  4MEZ A;  4OH0 A;  3QNB A;  4PMA A;  1YLT A;  1LL8 A;  5AQB A;  4E3K A;  2ZBB A;  4IED A;  1I2W A;  4WZ4 A;  1UWP X;  3W4O A;  2VV7 A;  2V20 A;  4XXR A;  3T4J A;  1XJ3 A;  5JYP A;  3VE3 A;  4HH3 A;  5D3O A;  4I5S A;  4H8R A;  5GLA A;  4JF6 A;  1L0D A;  1YLY A;  4HBT A;  2L4R A;  3MXR A;  3BFD A;  3UB7 A;  4E6X A;  3T12 B;  1PW8 A;  3ZG5 A;  3V67 A;  3NJA A;  4FD8 A;  1HTZ A;  3E4P A;  4QD4 A;  5HFO A;  4E3M A;  5DTS A;  2GX5 A;  2M7U A;  4GD8 A;  5KSC A;  3NEC A;  1X0O A;  1UGU A;  1FCO A;  3DAV A;  2PD8 A;  3I7J A;  4NG2 A;  4HP4 A;  3LIA A;  3BLS A;  2XD1 A;  4E3O A;  5A8B A;  1XFN A;  4AFI A;  2J8Y A;  3LR4 A;  2O0Y A;  3O86 A;  2VGL M;  3TJZ C;  4H6J B;  4EQ1 A;  3LO7 A;  4NET A;  3LI9 A;  3PR6 A;  4UQI M;  1CQA A;  3HLC A;  5G4Y A;  3UDX A;  2ZQ8 A;  4BD1 A;  2OLV A;  1JWP A;  4WN5 A;  3MBZ A;  5J7E A;  5FI2 A;  1DY6 A;  4RYE A;  1VEU B;  4OQI A;  2HDS A;  4ESP A;  1DJA A;  3BW6 A;  2A3U A;  3G30 A;  3O87 A;  3LUQ A;  3ZG9 B;  1CI8 A;  5HDD A;  4F94 A;  3L9K A;  4CLC C;  2ZL1 A;  3WRZ A;  1D7E A;  3UY6 A;  1AXB A;  5AJG A;  2Y59 A;  1UWN X;  4Y5F A;  2ZM2 A;  4CQH A;  3K3D A;  3MF0 A;  4P85 A;  2ZQ9 A;  3BYD A;  1P97 A;  2PYP A;  5A91 A;  3MZE A;  2HJE A;  1GSV A;  2J80 A;  2ZJ9 A;  4YNR A;  2XA7 S;  1E25 A;  1NYM A;  2XLN A;  5J3W A;  2JBF A;  2OOL A;  3W8K A;  2BG1 A;  1OTI A;  4R6L A;  4B4Z A;  3LEZ A;  1L0F A;  3UB8 A;  2XRO A;  5E2G A;  1LLB A;  1MWS A;  1SZV A;  1ZG4 A;  1FSY A;  3PBT A;  3HLB A;  2HP6 A;  2XRN A;  5F83 A;  3UE6 A;  1F5M A;  1YLZ A;  2H0T A;  4OPY A;  5L09 A;  2ZL1 B;  3SS3 A;  5F1G A;  3VOL A;  1P9W A;  3WS4 A;  1EI5 A;  4N9K A;  4JGO A;  2FFY A;  1OJG A;  2PYR A;  3HLF A;  3E0Y A;  3MKF A;  4N1H A;  1S4S A;  3FC7 A;  3TSG A;  3MR0 A;  3IF5 A;  5TBM A;  3S7Q A;  1XP4 A;  3GRJ A;  4X1M A;  2HGV A;  3P98 A;  5M18 A;  3IX8 A;  5HAR A;  3CZD A;  2C6W B;  1F2K A;  4Q8I A;  1GHM A;  4X25 A;  3HJI A;  1YAX A;  2H10 A;  4R38 A;  2ZC4 B;  3IHB A;  1HD8 A;  4FTX A;  4EEP A;  3NBL A;  4WLA A;  4MBK A;  2HDR A;  4PM8 A;  5AQ9 A;  1FSW A;  5AVF A;  1OTE A;  4HNB A;  3C5A A;  1NYY A;  2HP5 A;  3IBJ A;  3PBO A;  3WS1 A;  2QZ6 A;  4KG6 A;  3S1Y A;  2R78 A;  4LCM A;  3ZNY A;  4IUK A;  3F1O B;  1VM1 A;  2V1A A;  4XT2 B;  1YMS A;  3KSI A;  2UWX A;  3H7W A;  5AQ7 A;  3JPU A;  5DJU A;  4EBN A;  1MY8 A;  1TS0 A;  3BRM A;  3ULF A;  1N9O A;  5MC7 A;  2NUP C;  5AQA A;  5A92 A;  2JKG A;  4S2P A;  3HUN A;  4Y0T A;  4KQO A;  1ERM A;  4OQG A;  2W0N A;  1O7E A;  3MZF A;  5F69 A;  3DTM A;  3C30 A;  3UB9 A;  2EFU A;  5CGS A;  1NWZ A;  3PHY A;  1L2S A;  4PHT A;  3CAX A;  1G6O A;  2OAQ 1;  2EX2 A;  2DMW A;  4PM9 A;  3F1N B;  4ETX A;  3ITA A;  3SS5 A;  3FPV A;  4YIN A;  3ZDJ A;  3FPW A;  4BMW A;  2ZQ7 A;  1RP5 A;  1RGY A;  3H7W B;  3T4L A;  3LR5 A;  4KQR A;  2ZC5 B;  2ZOH A;  4LV2 A;  3E98 A;  3FWL A;  5EM0 A;  4K0X A;  1KDS A;  2W3G A;  4DE3 A;  4P6Z M;  3ZCZ A;  2ZC3 B;  5TFQ A;  5FQQ A;  2EX8 A;  4P6B A;  4DXC A;  3VE4 A;  1IKI A;  2QMI A;  4C75 A;  5CED A;  5FSR A;  5G18 A;  2K2N A;  1S67 L;  1K54 C;  1K4E A;  5E2E A;  4EBP A;  4BBT A;  2HJ9 C;  2WKR A;  5L10 A;  5HL1 A;  4UA9 A;  2J3T C;  4NEE D;  3NDE A;  3RH8 B;  1BUE A;  4GW9 A;  3MQO A;  4MN7 A;  1BZA A;  4BBU A;  4JXW A;  4P0M A;  4O01 A;  3M2J A;  1Z09 A;  1MWR A;  2W27 A;  3WS5 A;  1V9Z A;  5LBR A;  4M4X A;  4OLG A;  1WA9 A;  2VA0 A;  2PAV P;  5E2H A;  1Y28 A;  2V1B A;  2VEA A;  2JKR M;  1BLC A;  5EE8 A;  4EBL A;  4OON A;  1ESU A;  4IBR A;  2W3H A;  1NLY A;  1VHM A;  2R9X A;  3LIC A;  2ZOI A;  4S2O A;  1TDG A;  2G2U A;  4PM7 A;  1HLU P;  1W5D A;  4JXV A;  4X53 A;  2WKQ A;  3IX3 A;  3ZNT A;  3MQ0 A;  2HP9 A;  2LB9 A;  4CLC B;  2XFT A;  3TE8 A;  3LCE A;  4ZBE A;  1VQQ A;  2A2L A;  4EWF A;  1IEM A;  4DXB A;  3M2K A;  4B93 A;  2X01 A;  4RX3 A;  1H8Z A;  3PBQ A;  4OP8 A;  3ZFZ A;  3UB5 P;  3W2Z A;  5J4E A;  5F82 A;  1Q2Q A;  3KYQ A;  1S1Z A;  1NZO A;  3IS2 B;  3KX0 X;  4GS9 A;  3MSH A;  4II7 A;  3RJU A;  4JPM A;  2V1Z A;  4UHU A;  5HZH A;  1ERQ A;  3HLG A;  3UME A;  3FKW A;  4EUZ A;  5FQI A;  3MFX A;  2BTF P;  4EXO A;  1PWD A;  5EFW A;  5FEG A;  2ACG A;  4WZ5 C;  3QNC A;  2WGI A;  3AGE A;  2W3E A;  5DKL A;  1T1B A;  4QY5 A;  4EV4 A;  2ZQD A;  3O88 A;  5FQM A;  4IBX A;  5FQJ A;  4KQQ A;  3MQQ A;  5AVE A;  3UO9 A;  4LRX C;  4UEY A;  3HL9 A;  1OJ5 A;  3HLD A;  4NXB A;  5DF7 A;  3IXH A;  3PBS A;  3NCK A;  4OPZ A;  3T1Q B;  4R70 A;  1WYB A;  1XA7 A;  4R0Q A;  4HY8 A;  1KE0 A;  4NXF A;  4E04 A;  2G2W A;  2GNX A;  2P74 A;  4OP5 A;  3LFV A;  1FOF A;  3EQU A;  4R23 A;  1XXM A;  2VJW A;  2W3D A;  4MBH A;  4B9O A;  2VZW A;  3CWF A;  4WEK A;  3GQZ A;  1ZTU A;  3P01 A;  5CTN A;  1ONH A;  2PHY A;  1LL5 A;  4K08 A;  2WKH A;  2G7U A;  2HDQ A;  2PBY A;  1YLW A;  4DDS A;  3DTK A;  5GHZ A;  3ZQ5 A;  2PU4 A;  4H6J A;  2B5R A;  2V9A A;  1D1J A;  2JE5 A;  1S6R A;  3HLW A;  3O3V A;  1ES4 A;  1ZHH B;  4RX2 A;  5F1F A;  1K55 C;  4RQ9 A;  1XJ4 A;  3G35 A;  3OLO A;  1T18 A;  1VEU A;  5DVA A;  1K56 D;  1J3W A;  3D3O A;  4DE1 A;  4OOM A;  4IVI A;  1EW0 A;  3EEH A;  3OPL A;  1L0G A;  4NKP A;  1VB6 A;  3DWK A;  5GLB A;  1K56 A;  2OLU A;  1LL9 A;  5A90 A;  3CPT A;  4LV1 A;  1K54 A;  3EEA A;  2O9B A;  5CGX A;  1F9I A;  4OOY A;  1IKG A;  4JF5 A;  4HJ3 A;  3KYZ A;  2JC7 A;  4LGW A;  4HJ6 A;  3CLO A;  2Y2G A;  2JCH A;  2JHE A;  1G5U A;  5IS1 A;  1QMF A;  5DF9 A;  1W63 Q;  3GDI A;  4C3Q A;  1LI0 A;  1SHV A;  3NY4 A;  2ZQC A;  1PI5 A;  2V2F F;  1CEG A;  3R7W B;  2QKP A;  1OT9 A;  3UPP A;  4OPQ A;  4N9L A;  1PZO A;  1W8Q A;  4YFM A;  3IH8 A;  2Z6D A;  5IHV A;  3M6B A;  3HJK A;  4ME4 A;  1FIK A;  3LR3 A;  3Q07 A;  1OME A;  2JKF A;  2Y2J A;  3OC2 A;  3PBN A;  5F5Y A;  3CPT B;  1CK3 A;  3MFD A;  2X71 A;  3VFF A;  3TW8 A;  1W7F A;  2I72 A;  3ZGA B;  1LT0 A;  3A3F A;  1LHY A;  3SW1 A;  4BL2 A;  1JWZ A;  2K31 A;  1FIL A;  1FR1 A;  4BL3 A;  4PKY A;  1BLH A;  1H8Y A;  1GCE A;  3AGD A;  4O0P A;  2GZA A;  3IT9 A;  2L1M A;  4BBV A;  1FCM A;  2WAE A;  2PT7 A;  2EWV A;  5F68 A;  1H5X A;  4Z1W A;  5KZH A;  4QPR A;  5E43 A;  1MKM A;  2EWW A;  3VSL A;  2EXB A;  1ES3 A;  2Y55 A;  3LIF A;  3CUE C;  5HL6 A;  1IFQ A;  1FR6 A;  1TVF A;  4PPR A;  3V50 A;  3ZHH A;  1OTB A;  3Q7Z A;  1YSQ A;  3IBR A;  1XPB A;  4DE0 A;  4EET B;  2WYX A;  1H0M A;  1ES2 A;  4LV0 A;  3W4P A;  3A3D A;  1XX2 A;  2RCX A;  3CI6 A;  3F1O A;  4L9F A;  1YKD A;  4KZ7 A;  2VLG A;  4QHC A;  4Y2F A;  3SH8 A;  1IYO A;  3S4X A;  3FZC A;  5FI6 A;  2HDU A;  1Y54 A;  4XT2 A;  1GSW A;  4PM5 A;  2YKH A;  1JVJ A;  1IEL A;  2WAD A;  1PFL A;  3HBR A;  3BEC A;  1JTG A;  2V0W A;  4QB8 A;  1Z6F A;  4GCZ A;  5DTT A;  4KZA A;  3H82 B;  4S2L A;  3M6H A;  1GA9 A;  5CGW A;  3UE0 A;  2O99 A;  2Y2M A;  3T4Q A;  3C7V A;  4ARZ B;  2GDN A;  3UE1 A;  5HAP A;  2Z2L B;  1SDN A;  1SKO B;  3U4L P;  5EOO A;  4KUK A;  3QP8 A;  2BAS A;  3VP4 A;  4KZ5 A;  4M3K A;  5CHU A;  4ZAM A;  1KE4 A;  3C38 A;  5KSH A;  4UAA A;  1NY0 A;  4B88 A;  3F1N A;  5BOH A;  3LI8 A;  3C4O A;  2IA2 A;  1GHP A;  3NOU C;  5EVI C;  3NC8 A;  5HDC A;  3IF6 B;  3HLE A;  2X02 A;  4N92 A;  5DJT A;  4OOL A;  4E3J A;  1S4R A;  5DFX A;  5HWT A;  3VSK A;  2DRW A;  3LID A;  1YT4 A;  2WKE A;  4S2J A;  1PI4 A;  3BY9 A;  5CHM A;  4OQ0 A;  1NRF A;  1K6S A;  4XUX A;  4N1X A;  3QP5 A;  5CX7 A;  3KSG A;  4MLL A;  5IT5 A;  1I2S A;  4GN2 A;  2VKS A;  3HCY A;  3GV9 A;  3MJQ A;  3ZG8 B;  1MPL A;  4JGP A;  1KDW A;  2VX8 A;  4OPR A;  3CHW P;  2OV5 A;  1J9M A;  1ZG6 A;  2XR0 A;  5FAP A;  2HZ5 A;  3RTY A;  3H9W A;  4G3W A;  5FDH A;  1DRM A;  2OSU A;  4GOG A;  2VGJ A;  3D4F A;  2EXA A;  2I9V A;  3RXW A;  5HW3 A;  2JKR I;  5FQ9 A;  5DFY A;  1HVB A;  4I3I A;  3ITB A;  3E4Q A;  3IHA A;  2XFS A;  4P87 A;  4HQA A;  3LGO A;  3OPH A;  2XDM A;  1T19 A;  1XA1 A;  3LIE A;  4OQH A;  1QME A;  1MWU A;  4JGR A;  2Y79 A;  4DDY A;  2PBD P;  5FAQ A;  1XJ6 A;  3T1S A;  3W4Q A; 
#chains in the Genus database with same CATH homology
 2Y2L A;  2PU2 A;  4KG2 A;  5EUA A;  1ALQ A;  3BLS A;  1KE3 A;  2XD1 A;  5FAT A;  4QY5 A;  4EV4 A;  2ZQD A;  4E3O A;  2J8Y A;  3O88 A;  4RVA A;  5J8X A;  5FQM A;  3PAE A;  4IBX A;  1YMX A;  3HVF A;  3O86 A;  3ZVT A;  5FQJ A;  1M6K A;  3E2K A;  2ZC6 B;  3N8L A;  3OPP A;  2Y2Q A;  4OLD A;  4KQQ A;  3LY3 A;  3LO7 A;  4NET A;  4D2O A;  3MXS A;  5CEB A;  3UO9 A;  3HLC A;  3IWO A;  1YQS A;  5CXW A;  3UDX A;  1SDE A;  2ZQ8 A;  1HZO A;  3HL9 A;  4BD1 A;  3HLD A;  2OLV A;  5FQK A;  5DF7 A;  2C5W B;  1JWP A;  3IXH A;  4HES A;  3MBZ A;  3FYZ A;  3PBS A;  5FI2 A;  5FI7 A;  4WM9 A;  3NCK A;  4RA7 A;  4LCL A;  3SH7 A;  4OPZ A;  4R3J A;  2Y2P A;  1DY6 A;  4RYE A;  1WYB A;  1XA7 A;  3UN7 A;  4Y0O A;  4OQI A;  2HDS A;  1DJA A;  4R0Q A;  1KE0 A;  1KGE A;  2G2W A;  2A3U A;  2DNS A;  3G30 A;  3O87 A;  3UDI A;  4JLF A;  3ZG9 B;  1CI8 A;  4F94 A;  2P74 A;  3FKV A;  4OP5 A;  5L2F A;  4JBF A;  3N7W A;  4R4R A;  5M19 A;  1FOF A;  1Q2P A;  3EQU A;  3WRZ A;  3G32 A;  1XXM A;  4R23 A;  1MXO A;  3IXD A;  3VP3 A;  4MBH A;  1XGI A;  4S2N A;  3DW0 A;  1K4F A;  4ZJ2 A;  4WEK A;  3GQZ A;  3A3E A;  3UY6 A;  1AXB A;  5CTN A;  1ONH A;  2XD5 A;  1K55 A;  1LL5 A;  1PWG A;  2Y59 A;  4ID4 A;  1PYY A;  2ZM2 A;  3QHY A;  1BLS A;  4K91 A;  4E6W A;  2WKH A;  2ZLY A;  1FCN A;  2Y2I A;  3IWI A;  1NXY A;  4P85 A;  3ZG7 B;  2ZQ9 A;  2HDQ A;  2PBY A;  1YLW A;  4DDS A;  5I94 A;  3BYD A;  5GLD A;  2HPB A;  5GHZ A;  4HBU A;  5A91 A;  2BLS A;  2PU4 A;  2Z2M B;  4FSF A;  4GD6 A;  4OVD A;  3SS4 A;  5CEC A;  3IXB A;  3MZE A;  3VOZ A;  2ZJ9 A;  4ZJ1 A;  2B5R A;  2H0Y A;  4KZ8 A;  1E25 A;  1NYM A;  5E2F A;  2XLN A;  5FAO A;  2JE5 A;  4EWF A;  2Q9N A;  2XEP A;  3A3I A;  3ZVW A;  1S6R A;  3HLW A;  3O3V A;  2JBF A;  4FH2 A;  2FFF B;  3W8K A;  2BG1 A;  1ES4 A;  4RX2 A;  5F1F A;  1K55 C;  3BEB A;  1W79 A;  4B4Z A;  3LEZ A;  1L0F A;  2ZC7 A;  3G35 A;  4FCF A;  3IQA A;  5E2G A;  5GHY A;  1LLB A;  1MWS A;  1ZG4 A;  4PM6 A;  4X68 A;  4GZB A;  5DTK A;  1JTD A;  2WZZ A;  1FSY A;  1K56 D;  3PBT A;  5DVA A;  2Q9M A;  3BFF A;  4WBG A;  4JXG A;  4DE1 A;  3HLB A;  2HP6 A;  4BJP A;  4OOM A;  4IVI A;  5F83 A;  1KGF A;  3IWQ A;  2XF3 A;  1YLZ A;  1ES5 A;  2H0T A;  3OPL A;  4OPY A;  3GVB A;  3Q81 A;  3SS3 A;  1L0G A;  5F1G A;  3DWK A;  5GLB A;  4S2K A;  3WS4 A;  1EI5 A;  1K56 A;  3BM6 A;  4X69 A;  4K0W A;  2OLU A;  1ONG A;  2WGW B;  4N9K A;  1LL9 A;  2FFY A;  3HLF A;  3N8R A;  2Y4A A;  3MKF A;  3G34 A;  5A90 A;  4JF4 A;  4N1H A;  4MNR A;  3BFG A;  2XH9 A;  4LV1 A;  3TSG A;  3IF5 A;  4UA7 A;  1K54 A;  3N4I A;  3V5M A;  1KVM A;  5EEC A;  4S2M A;  5TR7 A;  2P9V B;  3HRE A;  3S22 A;  3UPO A;  5CGX A;  1XP4 A;  3TOI A;  3GRJ A;  3IF6 C;  4X6T A;  2Y2H A;  4QJG A;  4Y0U A;  4EQI A;  4KG5 A;  1XKZ A;  3P98 A;  5M18 A;  4OOY A;  5HAR A;  1IKG A;  4JF5 A;  4QY6 A;  3CZD A;  2C6W B;  3UDF A;  4IVK A;  3TG9 A;  2JC7 A;  4JXS A;  4Q8I A;  1GHM A;  1PZP A;  3E2L A;  3LY4 A;  3Q1F A;  4LV3 A;  2Y2K A;  2Y2G A;  3VMA A;  2JCH A;  5EVL A;  2H10 A;  3WS2 A;  1TDL A;  2ZC4 B;  3V3S A;  1IYS A;  1QMF A;  3IHB A;  1HD8 A;  5EVI A;  4LEN A;  3NBL A;  5DF9 A;  1ZKJ A;  4MBK A;  3A3J A;  4E3L A;  4C3Q A;  1LI0 A;  2HDR A;  1SHV A;  4PM8 A;  3OPR A;  5AQ9 A;  1FSW A;  3NY4 A;  2ZQC A;  4S2I A;  1PI5 A;  2V2F F;  5CER A;  3G2Y A;  1CEG A;  4BEN A;  3C5A A;  1NYY A;  3UPP A;  2HP5 A;  4OPQ A;  2J7V A;  3N6I A;  5TGF A;  1ZC2 A;  3PBO A;  3EQV A;  4N9L A;  4OKP A;  1PZO A;  1W8Q A;  4YFM A;  3IH8 A;  2R9W A;  3WS1 A;  5IHV A;  2QZ6 A;  3C7U A;  3M6B A;  4KG6 A;  3S1Y A;  2EX6 A;  4KZ6 A;  1C3B A;  4LCM A;  1RGZ A;  3ZNY A;  4JKT A;  3VP2 A;  3Q07 A;  2Y91 A;  1LI9 A;  1OME A;  3Q7V B;  3VP0 A;  2Y2J A;  3OC2 A;  3NI9 A;  3PBN A;  2ZD8 A;  2WGW A;  2J9O A;  3MFD A;  1CK3 A;  1VM1 A;  2X71 A;  2VGK A;  3VFF A;  3VP1 A;  1W7F A;  1YMS A;  2I72 A;  1N9B A;  2UWX A;  4WMC D;  1K57 A;  5AQ7 A;  3ZGA B;  4EBN A;  3A3F A;  1LHY A;  1DJB A;  1MY8 A;  2WK0 A;  3BRM A;  2P9V A;  3SOI A;  4BQM A;  4BL2 A;  1KGG A;  4CPK A;  1JWZ A;  2RL3 A;  1FR1 A;  4BL3 A;  4E3N A;  1BLH A;  5AQA A;  5A92 A;  1H8Y A;  1GCE A;  3AGD A;  4WMC A;  3IT9 A;  5CTM A;  2WKI A;  4R4S A;  4S2P A;  1FCM A;  1ESI A;  2WAE A;  3HUN A;  4Y0T A;  1I5Q A;  5FAS A;  1H5X A;  3P09 A;  4GB7 A;  4KQO A;  1N4O A;  1ERM A;  4OQG A;  5EVI B;  5HAQ A;  5KZH A;  4S2N C;  2J9P A;  1NZU A;  3GMW A;  5E43 A;  1E3U D;  4UA6 A;  1O7E A;  2WAF A;  3MZF A;  3DTM A;  3UE3 A;  4NK3 A;  5FA7 A;  1BUL A;  4GKU A;  2EXB A;  3VSL A;  1ES3 A;  2Y55 A;  1S0W A;  1YLJ A;  1BLP A;  2EFU A;  2ZM0 A;  5CGS A;  1FR6 A;  1G68 A;  1TVF A;  4PPR A;  4Z9Q A;  5DF8 A;  1L2S A;  3V50 A;  2IWC A;  3ZHH A;  1BT5 A;  3Q7Z A;  5CRF A;  2EX2 A;  1XPB A;  3IXG A;  1E3U A;  3VFH A;  2WGV A;  4DE0 A;  2Y2N A;  1L0E A;  2WYX A;  4U0X A;  4PM9 A;  4BD0 A;  1ES2 A;  4FH4 A;  3HUM A;  4LV0 A;  3W4P A;  3JYI A;  1K38 A;  3A3D A;  3ITA A;  1XX2 A;  5CHJ A;  2RCX A;  3SS5 A;  5GL9 A;  4BLM A;  5EPH A;  4YIN A;  3PAG A;  4KZ7 A;  3Q7V A;  3ZDJ A;  2EFX A;  3UNW A;  1G6A A;  1RCJ A;  3N8S A;  4QHC A;  3V39 A;  3SH8 A;  1IYO A;  3OZH A;  3S4X A;  3FZC A;  2ZQ7 A;  5FI6 A;  1RP5 A;  2HDU A;  4KZ3 A;  1RGY A;  1Y54 A;  4KQR A;  2ZC5 B;  4PM5 A;  1WYC A;  4ZDX A;  1W8Y A;  3PBR A;  3C4P A;  4LV2 A;  2A49 A;  2ZMA A;  3WRT A;  3FWL A;  1NJ4 A;  1DJC A;  1U60 A;  1GA0 A;  1JVJ A;  1IEL A;  2WAD A;  3HBR A;  5EVI D;  4K0X A;  4A5R A;  1KDS A;  3BEC A;  4DE3 A;  1JTG A;  5KMW A;  4QB8 A;  1K25 A;  1Z6F A;  2XK1 A;  5DTT A;  3ZCZ A;  2ZC3 B;  4KZA A;  1PWC A;  4S2L A;  3M6H A;  4GDN A;  5TFQ A;  1GA9 A;  5CGW A;  1PIO A;  5GLC A;  2Y2M A;  3UE0 A;  5FQQ A;  3CMZ A;  2Y2O A;  4U0T A;  2EX8 A;  4P6B A;  3CJM A;  3C7V A;  2IWB A;  2ZM8 A;  3UPN A;  4QU3 A;  1MWT A;  4Y7P A;  4DXC A;  5JYO A;  1IKI A;  1IYQ A;  3GR2 A;  1EWZ A;  1XGJ A;  2QMI A;  4C75 A;  2GDN A;  1FQG A;  1WE4 A;  3Q82 A;  5CED A;  3UE1 A;  5HX9 A;  5FSR A;  5G18 A;  2QPN A;  2XQZ A;  5GHX A;  1K54 C;  4WEJ A;  1K4E A;  1JWV A;  5E2E A;  2Z2L B;  3WS0 A;  3BFE A;  1K6R A;  5HAP A;  4EBP A;  1SDN A;  3RXX A;  3SH9 A;  4X56 A;  5U47 A;  5EOO A;  4DKI A;  1YLP A;  3B3X A;  3VP4 A;  4KZ5 A;  4M3K A;  1SKF A;  4MBF A;  4R1G A;  5CHU A;  1KE4 A;  2H5S A;  4ZAM A;  5HL1 A;  4UA9 A;  4XUZ A;  5KSH A;  3MZD A;  4UAA A;  1NY0 A;  4B88 A;  3OCN A;  3NDE A;  1BUE A;  5A93 A;  4KZ9 A;  5BOH A;  1YM1 A;  3C4O A;  4GDB A;  1BZA A;  1E4D A;  1GHP A;  4JXW A;  4X55 A;  4P0M A;  2DCF A;  5EVI C;  4WEL A;  3M2J A;  3NC8 A;  5M1A A;  3IF6 B;  4R3B A;  1GHI A;  3HLE A;  4ZJ3 A;  1MWR A;  2X02 A;  3G31 A;  4N92 A;  3WS5 A;  4OOL A;  4E3J A;  4OLG A;  1TEM A;  3VSK A;  5E2H A;  1CI9 A;  4HEF A;  3GSG A;  2DRW A;  4L0L A;  1YT4 A;  2IWD A;  2WUQ A;  3OCL A;  4KZB A;  2WKE A;  4S2J A;  1MBL A;  2CC1 A;  1PI4 A;  1CEF A;  2EX9 A;  1KVL A;  1BLC A;  3ISG A;  4U3T A;  3CG5 A;  4KZ4 A;  5EE8 A;  4EBL A;  4OON A;  5CHM A;  3WWX A;  3NIA A;  3BFC A;  4OQ0 A;  4MEZ A;  4WYY A;  1NRF A;  1ESU A;  4OH0 A;  4IBR A;  3QNB A;  4PMA A;  1YLT A;  1K6S A;  2ZQA A;  4XUX A;  4N1X A;  1O07 A;  5AQB A;  1MKI A;  2R9X A;  3BLM A;  4MLL A;  4S2O A;  1I2S A;  4C6Y A;  1PW1 A;  1TDG A;  4GN2 A;  2G2U A;  3V3R A;  1BSG A;  4E3K A;  4PM7 A;  3GV9 A;  1W5D A;  4IED A;  3ZG8 B;  4JXV A;  1I2W A;  4X53 A;  1MPL A;  2XGN A;  3DWZ A;  2E8I A;  1KDW A;  4WZ4 A;  1K57 C;  3ZNT A;  4B4X A;  4OPR A;  3W4O A;  1M40 A;  2OV5 A;  1J9M A;  2HP9 A;  3NDG A;  2V20 A;  1ZG6 A;  2XR0 A;  4XXR A;  5FAP A;  3GTC A;  5JYP A;  2XFT A;  5D3O A;  5EOE A;  3LCE A;  4H8R A;  5FDH A;  4ZBE A;  5GLA A;  1VQQ A;  4JF6 A;  1L0D A;  2OSU A;  1YLY A;  2VGJ A;  3MKE A;  4GOG A;  4HBT A;  3AGF A;  3D4F A;  3MXR A;  4ZTK A;  1IEM A;  2EXA A;  4DXB A;  3G4P A;  3BFD A;  3M2K A;  3RXW A;  4WZ5 A;  2X01 A;  4RX3 A;  4DE2 A;  1H8Z A;  3PBQ A;  4OP8 A;  5HW3 A;  4E6X A;  5FQ9 A;  3G2Z A;  3ZFZ A;  4DF6 A;  5F82 A;  1PW8 A;  1ERO A;  1SCW A;  3IF6 A;  1Q2Q A;  3ZG5 A;  1NZO A;  1HVB A;  4DRT A;  4O7D A;  3RJU A;  2WZX A;  3ITB A;  4JPM A;  2V1Z A;  1BTL A;  3VOY A;  5HAI A;  4UHU A;  3PTE A;  3IHA A;  3FV7 A;  1ERQ A;  4CJN A;  4FD8 A;  1HTZ A;  2XFS A;  3HLG A;  3ZG0 A;  4P87 A;  3FKW A;  4QD4 A;  4EUZ A;  5HFO A;  5FQI A;  3OPH A;  4E3M A;  5DTS A;  2XDM A;  1XA1 A;  3IH9 A;  1PWD A;  4GNU A;  1QME A;  1MWU A;  4OQH A;  4E3I A;  4GD8 A;  4DDY A;  4KEN B;  5KSC A;  1IYP A;  4WZ5 C;  3QNC A;  5FAQ A;  1FCO A;  2WGI A;  3I7J A;  3HUO A;  3AGE A;  3W4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...