5DJUA

Crystal structure of lov2 (c450a) domain in complex with zdk3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
145
Chain Sequence
GSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
molecule keywords Engineered protein, Zdk3 affibody
total genus 48
structure length 145
sequence length 145
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5djuA00
2R78A 4JGQA 1F9IA 4K08A 3LIFA 3RH8B 4HJ3A 4M4XA 2W27A 3IS2A 3E4QA 5HWTA 2A24A 4HP9A 4DJ2A 4EW7A 2A24B 2L4RA 5HD3A 1KOUA 3E4PA 1VB6A 4GHIA 4HH2A 5AVFA 3UMEA 2QWSA 2Z6DA 4GW9A 1F98A 2OOLA 2V1AA 1N9OA 5F6AA 3OLOA 4BBVA 2QKPA 4LLOB 3F1NB 1GSWA 2L1MA 4HHDA 4WL9A 3EWKA 3BY8A 4JGRA 4NXEA 1T1BA 5EFWA 4XT2B 1OTBA 3BWLA 2WKPA 3RTYA 1XJ3A 4R3AA 1UWPX 2OWHA 5KIZA 3PHYA 3MJQA 4BBTA 1N9NA 4I3IA 4WUJA 1OTEA 3A0RA 4EEPA 5IS1A 2VEAA 3NOPC 4E04A 1T1AA 2I9VA 3GDIA 4HNBA 2HV1A 4MN5A 1T1CA 5G4ZA 1ODVA 1GSXA 3NHQA 1LT0A 1LSXA 2EA9A 4EERA 2PHYA 2VV8A 2V9AA 4WN5A 4EEUA 4MN6A 4L9EA 4EXOA 2QJ5A 1OTAA 3H7WB 2PDRA 3H82A 3MR0A 3VE3A 4DJ3A 1S67L 5A8BA 4KQDA 3HJIA 2PYPA 5I5LA 2J80A 1V9ZA 4F3LB 1N9LA 2PD7A 2Z6CA 3LICA 1TS6A 3F1OB 3NJAA 1GSVA 1UGUA 5HDDA 5HDSA 1JNUA 2V1BA 3LI8A 3ULFA 2VV6A 2PR6A 1DP6A 2JN7A 5F5YA 4HOIA 1T18A 4EQ1A 5J4EA 5J3WA 4JGPA 4I3JA 3IBRA 1TS7A 3D72A 3UB9A 1OJ5A 3C8CA 3K3CA 3LUQA 5DKKA 1S4RA 4RQ9A 3BY9A 4KUOA 1DP8A 2W0NA 4HP4A 3F1OA 4WLAA 3A0SA 5F68A 1LSWA 3PYPA 4R6LA 3G6OA 3K3DA 3LIEA 4H6JB 2YKHA 4HJ4A 4H6JA 2KX6A 1S1YA 4HIAA 4R38A 3F1NA 5AVEA 1XJ6A 1LL8A 2D02A 1X0OA 3CWFA 1XFNA 3IS2B 1D7EA 1MZUA 4NXBA 4PKYG 5IU1A 3CLOA 2H28A 4WF0A 4I39A 3VOLA 2WKQA 5DJTA 1XJ2A 4JGOA 1G28A 3HJKA 4L9GA 3CAXA 4EETB 5J7EA 1P97A 1LSVA 2L0WA 1TS0A 2ZOHA 4KUKA 3T50A 2PYRA 3LIAA 1WA9A 2V0UA 4GCZA 5TBMB 5TBMA 4BBUA 3FC7A 4HI4A 4EESA 1OTDA 2K7SA 4LRXC 4NXGA 4XT2A 4LPZA 5HWVA 3LYXA 1TS8A 3FG8A 2ZOIA 1OJGA 2WKRA 3A0VA 1DP9A 2PD8A 1P0ZA 1T19A 3MFXA 1XFQA 2V0WA 5DJUA 5HDCA 2CMNA 3LIDA 3UMDA 4B9OA 3SW1A 4HJ6A 3P7NA 4LRZE 2P7JA 2JHEA 5HZHA 1DRMA 1OT9A 5G4YA 3E4OA 4L9FA 4NXFA 4PKYA 4HQAA 3F1PB 4GS9B 2YKFA 1S1ZA 1V9YA 2VLGA 2BASA 3C2WA 3NOUC 5F69A 3ZQ5A 2KDKA 4HH3A 4R70A 3B33A 3LI9A 5HWWA 3MXQA 2D01A 2GJ3A 1S66L 4F3LA 3UB8A 2ZBBA 1OTIA 4YWZA 3UE6A 1S4SA 1D06A 4I5SA 3UB7A 4I38A 3VE4A 2QJ7A 3F1PA 4GS9A 2QHKA 3MQOA 4LRYC 1OT6A 3EEHA 2M1CA 2OWJA 3H9WA 3KX0X 1EW0A 2VV7A 3H7WA 3H82B 1BYWA 3NOTC 4HY8A 2B02A 3GECA 1Y28A 1NWZA 5HD5A 2INWA 1UWNX 3ICYA 3UB6A 2PR5A 3MQQA 1XJ4A 5HSQA 5DKLA 4I3AA 3LIBA 4GHIB
chains in the Genus database with same CATH superfamily
2Y8HA 3G31A 1FIKA 3G32A 4KZ6A 4PHTA 4LENA 1HD8A 4FOFA 2X01A 4OOYA 2WAEA 3RTYA 2VZWA 3PHYA 1F2KA 3NBLA 2HGVA 4IVKA 3IF6A 3ZFZA 4UA6A 4Y7PA 3BW6A 2VV8A 2ZLYA 2R9XA 2IA2A 4HBTA 1NZUA 4NG2A 4F3LB 1N9LA 3UDXA 1RCJA 4S2NA 2V1BA 4II7A 2JC7A 2JN7A 5FL3A 4EQ1A 2W3DA 2OSUA 3V5MA 4OPZA 3UB9A 1ES3A 1S6RA 1TVFA 3LIEA 2YKHA 4ZTKA 4MEZA 5AVEA 1XJ6A 3M2JA 1L0EA 3OPPA 1K25A 4EETB 2EX2A 4PM7A 2KOIA 2XD5A 5CHUA 4S2MA 5L8MA 1GHMA 3A0VA 4GDBA 3V3RA 3L7HA 3HL9A 3WS5A 5M19A 1J9MA 3UE0A 2Y2GA 5A93A 1E4DA 2WYXA 3NCKA 3K2NA 4RYEA 1GA9A 3KYZA 3V39A 1BZAA 3ITAA 3H82B 4DXBA 4EV4A 2WZZA 1OMEA 3L9KA 3ZGAB 4ZAMA 3OPHA 3PTEA 3NC8A 2ZL1A 2ZQ9A 3JPUA 3BFDA 2ZC7A 5EVIA 3HUMA 3MJQA 1QMEA 2VGLM 3BLMA 1T1AA 4KZ5A 1PRQA 1T1CA 1ODVA 2W1TB 5CEBA 4X6TA 4S2PA 1HLUP 2PHYA 1YAXA 2PDRA 3MR0A 2PBYA 4KQQA 3VP1A 4EBLA 1BLCA 4HOIA 2XF3A 1TS7A 3D72A 3C8CA 3K3CA 3S7PA 2A2LA 1NYMA 5CGXA 1G6AA 5F82A 2Q9NA 1LSWA 4CLCE 2XDMA 3MBZA 2P9VB 4WZ5A 3MQ0A 4E6WA 1MZUA 3C4PA 2NUTC 3B47A 1FSWA 4LGWA 3W4OA 3O88A 1LSVA 4OONA 5E2GA 1K54A 2WGWB 4RVAA 5FAOA 3IHAA 1K0KA 3QP1A 3LR5A 1CF0A 5F69A 4O7DA 3MXQA 2WZXA 4JF4A 5EOEA 5EPHA 1IELA 1I5QA 4OPYA 2XA7M 5E2EA 3F1PA 3MQOA 4EWFA 1EW0A 1NWZA 1NZOA 5M18A 3N8RA 3LY4A 1DJBA 2FFYA 1YLPA 3LIFA 5TFQA 4NKPA 4M4XA 4K0XA 2WAFA 3VP3A 3W4QA 1ES4A 5HD3A 3ZCZA 1YSQA 1CQAA 4HESA 2Z6DA 4E3IA 2C5WB 3A3JA 3S7NA 4BQMA 5KSHA 4DRTA 4NXEA 5FDHA 4QD4A 3GQZA 5M1AA 4S2NC 3Q07A 1L2SA 3UB5P 3ZHHA 4BD0A 2JKTI 3VP4A 1H8MA 1AWIA 1CEFA 3F1OB 5MC7A 3P98A 3ULFA 3B3XA 2JKGA 2IWDA 2OLUA 4EUVA 1S4RA 2LB9A 1ZG6A 4D2OA 1KGFA 1WYBA 3MS6A 3C5AA 3GVBA 2HPBA 2XEPA 1LL8A 1G6OA 3CLOA 2WKQA 3HJKA 3U2AA 4ZBEA 4H8RA 4ESPA 4GDNA 5CGWA 2VX8A 3PBTA 2WKIA 3NECA 5GLDA 4C75A 5F83A 2ZQCA 1SCWA 5DJUA 2Q9MA 3P7NA 3IBJA 4L9FA 4R3JA 1XA7A 1XA1A 5HAQA 2VLGA 3NOUC 4HH3A 4BWIA 4F3LA 1K6RA 4EUZA 4G3VA 1H3QA 3T1XA 2QHKA 3EEHA 4E3OA 2UV0E 4K0WA 2PRFA 4DF6A 4L0LA 4JXSA 3SH8A 4HJ3A 4S2LA 3DWKA 2R9WA 1VB6A 4GHIA 3ZG5A 1M6KA 2B18A 1BSGA 3S4XA 4O8GA 4MNRA 1Z6FA 2Y2MA 3T1SA 4X1LA 2X02A 3IWIA 4DDSA 4I3IA 3A0RA 4EEPA 3MZDA 5FQJA 4N1HA 4CPKA 3NY4A 4YINA 5AQ7A 3CITA 3C4OA 4MBFA 1M40A 1BTLA 3VP2A 3GTCA 3HLCA 2PR6A 5J4EA 4GN2A 5J3WA 4I3JA 4E6XA 1KE3A 3BY9A 3S7OA 3PXPA 4YNRA 1YLJA 4IUHA 1VQQA 2D02A 2JE5A 3LR0A 3OCLA 4WMCD 1ONHA 1TDGA 2P9VA 1SDNA 2HJ9C 2VK3A 3O86A 1ACFA 5I94A 4BJPA 3MZEA 4IEDA 3GMWA 3CUEC 1S0WA 4KZ8A 1PWDA 4B88A 4LCMA 3GR2A 4HJ6A 1Q2PA 4UEYA 1FQGA 3IH9A 4P6ZS 3UDIA 3ZQ5A 1SZVA 4R70A 3B33A 1XGJA 2KLIA 2BTFP 1K57C 1D06A 5HWVA 3T4JA 1IFQA 3H7WA 2J3WA 4Y5FA 4R0QA 3UB6A 1KVMA 1XJ4A 5HSQA 3DTMA 3CHWP 3ZG7B 1O07A 2DNSA 3UPNA 4GW9A 4FD8A 1YQSA 4XXRA 4HEFA 4S2KA 3V3SA 4OP5A 2Y59A 3A3EA 1IYQA 5LBRA 3DTKA 1IKIA 4BD1A 2MJ6A 4KG6A 2PD7A 1MY8A 2XFTA 4ARZA 3SS4A 3NULA 3E2KA 1FOFA 4BL2A 4P6BA 3F1OA 3PYPA 4G3WA 3E98A 2J3TD 3MXSA 3CG5A 3G2ZA 1XFNA 4MMNA 2XK1A 2B5RA 3HUNA 3IWOA 4U0TA 3T50A 2XRNA 5TBMB 1WA9A 4LPZA 5A92A 1SKOA 2PD8A 3OPRA 4WEJA 2O9AA 3AGFA 5HPIA 2P7JA 2H10A 5FSRA 1LHYA 2Y79A 2A49A 2W1TA 4R4SA 1S4SA 5AQAA 3N6IA 3BQAA 1YPRA 1W63Q 1YT4A 2M1CA 3B42A 4Z1WA 2QMIA 1P9RA 2BLSA 1JVJA 3Q1FA 3VOZA 2ZMFA 1XP4A 1EI5A 5AVFA 4Y13A 5A91A 2OAQ1 2EX6A 2GDNA 2VKSA 3HLWA 2ACGA 2VEAA 4Y17A 3GDIA 4CLCC 4WN5A 2WGWA 3A3IA 2IWCA 1OTAA 3EGDC 1FCNA 4DJ3A 3A3FA 5DF9A 1TF1A 3HJIA 3ZG8B 5FQMA 2ZMVA 3CI6A 3WS2A 2HP6A 3C30A 5L07A 4OLDA 4KUOA 5TR7A 4QU3A 5F68A 3N8SA 4OPRA 5FEGA 3G6OA 3VOYA 4Q0IA 3T4QA 2RL3A 1HVBA 1VEUA 3MXRA 2PU2A 4Y0TA 3CUEA 2DMWA 4DE3A 5TBMA 1CI8A 2H5SA 2O99A 4FH2A 3S1YA 1MWSA 4QHCA 4B9OA 3WRTA 1DRMA 2ZC4B 2XGNA 3QP2A 3F1PB 3G30A 1DJCA 2BASA 5D3OA 4Y2FA 4GD6A 1ZTUA 1FR6A 3RFBA 4PMAA 3A3DA 4I38A 4QB8A 5FI2A 4N92A 4LRYC 3OZHA 3AGEA 3NOTC 3GECA 3TRCA 3R4KA 4I3AA 5DKLA 4BBVA 4JXWA 1PWCA 3PAEA 3LR4A 1L0DA 1XKZA 1O7EA 4HP9A 3TJZC 1YMXA 2EX8A 1XPBA 2V1AA 2ZC6B 5E2FA 4JLFA 4EBPA 4KG5A 3OBFA 4ZJ1A 2Y2KA 5EVLA 4YFMA 4N9KA 4EQIA 4MN5A 4OOMA 1LT0A 2H0YA 1OPXA 3VE3A 3H7WB 3MMHA 2PYPA 3UNWA 1JNUA 4BL3A 3HLGA 1W63M 2J8YA 3GV9A 3HLFA 3LUQA 4MBKA 2EX9A 2W0NA 4ARZB 1BLSA 2OAP1 5GLBA 3QNCA 4HJ4A 4NXBA 3HLEA 1YKDA 5J7EA 3CJMA 3UE3A 3Q82A 1H5XA 1PI4A 3LY3A 1TS8A 3Q7VB 4GNUA 5E43A 1T19A 3MKFA 1XFQA 3JYIA 3SH9A 4PKYA 4R3BA 4O01A 2XH9A 1NYYA 5HL1A 4GLQA 1ONGA 3FPVA 4Y15A 3WS4A 2H0TA 5GHXA 1BULA 2HP9A 3ISGA 2PR5A 4GHIB 1LL9A 4Y0OA 2P74A 3ZDJA 4OOLA 1AXBA 3KYEA 4QWOA 3RH8B 2J3TC 3E4QA 5HWTA 1E3UD 1SDEA 4S2OA 1K38A 3KO6A 3NIAA 4KQRA 1TEMA 3PBRA 4PM5A 1TD5A 3BWLA 4OQGA 2JKRM 4BBTA 3QP4A 2XA7S 3W4PA 3BFFA 4CQHA 1HTZA 2EA9A 4GD8A 1D1JA 1CI9A 2ZD8A 4L9EA 2I72A 1FR1A 1V9ZA 2EXBA 3LICA 1GSVA 4UA7A 2P08A 4WZ5C 2K31A 2VV6A 4OQ0A 5FI7A 3IBRA 3HUOA 5CX7A 4ME4A 4QY5A 4RQ9A 3EQUA 1JTGA 2KX6A 1K54C 3IHBA 1X0OA 5TGFA 5DTKA 4R23A 3G2YA 3VMAA 5GL9A 1ALQA 2ZOHA 3P09A 2DRWA 3PR6A 4GOGA 1NRJA 2GNXA 3LIAA 2V0UA 4OQHA 1LI0A 1IEMA 3Q81A 2NUPC 4EESA 5CECA 5HPFA 1BLPA 1K56A 1PYYA 4IHQA 3D4FA 4FSFA 5EOOA 3MFXA 1PZPA 1ERQA 3NI9A 4XUZA 1DJAA 2JHEA 4FH4A 5EM1A 4IVIA 4OLGA 1S1ZA 4KZBA 3UB8A 3T12B 3LGOA 3UE6A 3UPOA 4U3TA 2G7UA 2JCHA 3S22A 4DN0A 5AJGA 3ZG0A 3LIBA 3QNBA 2HF6A 3HVFA 3BJNA 5J8XA 3RXWA 4EW7A 5A90A 1KOUA 3UMEA 2QWSA 3MF0A 1NLZA 5EVIB 2PBDP 1GHPA 1T1BA 4IBRA 2OWHA 5FDSA 3VSLA 5IS1A 3IH8A 5EECA 5CRFA 4QJGA 1LSXA 5HFOA 4MN7A 1TS6A 2ZC3B 2WK0A 1UGUA 1KDSA 1YSPA 4WZ4A 2FFFB 3U4LP 2XD1A 1GA0A 5AQBA 5IT5A 4X56A 4UA9A 2HZ5A 4LV2A 3OPLA 2M7UA 5DTSA 2FZ0A 4H6JB 1TDLA 5FEFA 1BT5A 1S1YA 2VGKA 2WGIA 4R38A 1ERMA 4CJNA 3T4LA 4LCLA 2QYBA 4JGOA 5E2HA 3CAXA 1MKMA 1PW8A 2L0WA 1XXMA 4CLCA 2PYRA 2WGVA 3FC7A 2M7VA 1OTDA 2HDSA 2K7SA 3LCEA 1EWZA 2ZOIA 3EOIA 2O9BA 3BRMA 3PBQA 5HZHA 3WWXA 5CEDA 4P0MA 1E25A 4NEED 2YKFA 2OV5A 3TG9A 2EXAA 4ID4A 4OQIA 3OC2A 5FI6A 3KX0X 2OWJA 3D9YA 4LV0A 2Y2OA 3HCYA 1BUEA 1UWNX 5HL6A 3EQVA 1MWUA 1XGIA 3UDFA 4IJGA 4DJ2A 2ZQ7A 3N8LA 4QY6A 4HBUA 4HH2A 2VA0A 3BFCA 1W5DA 4OPQA 1N9OA 2G2UA 1NLYA 4AFIA 2QPNA 1A0KA 3VFHA 2WKPA 4KQOA 5L2FA 2HP5A 1OTEA 3MKEA 3W2ZA 4E04A 3KSIA 2ZM2A 1CEGA 1JWVA 3JVUA 4P6ZM 1GCEA 5GLCA 3FKWA 5EVEA 3IXHA 4E3MA 2ZQDA 5I5LA 3R7WA 5HDDA 2WADA 1STZA 4JGPA 4EU0A 3TOIA 4MBHA 3M6HA 4H6JA 3T4OA 3E0YA 3CWFA 2C6WB 4WF0A 4I39A 5FA7A 4L9GA 2FH5A 2V8CA 3OCNA 4KUKA 3LO7A 4YOFA 4GCZA 5KSCA 5CGSA 1P9WA 4DKIA 1K57A 1FILA 2RCXA 5EVIC 1K55A 4KENB 1MC0A 1V9YA 3VV4A 4A5RA 4Y0UA 1Y4OA 2XFSA 4DMZA 4I5SA 4GS9A 2VV7A 2DCFA 2AVXA 3BFEA 1F5MA 4JGQA 3BLSA 3BM6A 5F1FA 4X1MA 2ZL1B 2V8FA 1H8YA 4EBNA 1W7FA 3IXBA 4LLOB 3F1NB 3BY8A 2XSSA 4DE0A 3W8KA 5DVAA 3VSKA 4GJ4A 2PAVP 1DY6A 1VHMA 1Q2QA 5KMWA 3KSGA 2J80A 5HDSA 3LR3A 3FYZA 4X68A 2Y55A 4B93A 4BLMA 4HP4A 4FUWA 3ZG9B 2E8IA 5EUAA 1EROA 5FQQA 1ESUA 2EFXA 1LLBA 2J9OA 1CJFA 2G2WA 4PM8A 3Q7VA 1ZG4A 1YLZA 2Y2QA 5HARA 2X71A 1BLHA 3ZYTA 1YMSA 3FKVA 1JWPA 4GB7A 4WYYA 2Y2NA 2EFUA 4HI4A 4LRXC 4ZJ2A 4CLCB 1K56D 3LFVA 4E3LA 3SW1A 4JKTA 4Q8IA 5G4YA 3E4OA 1WYCA 4KZ9A 1IOUA 3P01A 2KDKA 4F94A 5HWWA 3LI9A 4PM9A 1IYOA 3SS5A 1SKFA 2K2NA 3VE4A 2QJ7A 1ZC2A 3T4SA 2B02A 5F1GA 1LI9A 2R78A 3DTEA 1FSYA 4K08A 1JTDA 1W8YA 4Q0JA 3C7VA 1H0MA 2L4RA 3IT9A 3MZFA 1GSWA 3HBRA 2W3GA 1OTBA 1XJ3A 1G68A 1RP5A 1ES2A 1N9NA 4LV3A 3ZVWA 4O0PA 2HV1A 1WE4A 2WKEA 4IBXA 4KZ4A 1FCMA 2UWXA 4EERA 4CLCD 3MFDA 1Y54A 3AGDA 2Z2MB 2O9CA 4JBFA 5F5YA 4WM9A 2Y2HA 3R7WB 4OP8A 3N7WA 4UHUA 3CZDA 3DAVA 4G3KA 3NDGA 4DDYA 4HIAA 3ZNYA 2Y2IA 1I2WA 4PKYG 1XJ2A 1P97A 3RXXA 4UAAA 2XR0A 1ESIA 2V1ZA 3IX3A 4NXGA 4JXVA 3WRZA 3LYXA 3CPTA 2ZC5B 2J7VA 2V0WA 3PBOA 3LIDA 5BOHA 1MWTA 1RGYA 2Y2LA 4M3KA 3IXGA 1NXYA 3UN7A 5HAIA 4KZ7A 5EV0A 4YWZA 4NK3A 1OT6A 5DKKA 2W3EA 2E8JA 3G4PA 2VGLS 5FATA 3FV7A 3TW8A 2W3FA 3G35A 5FASA 4NETA 5AQ9A 4D60A 1KGEA 3Q7ZA 3ZVTA 3IS2A 3UO9A 4S2JA 1H8ZA 1GHIA 2Q0OA 5F6AA 3OLOA 5K5BA 2L1MA 1KGGA 2GX5A 3EWKA 1I2SA 4XT2B 1SKOB 2ZJ9A 2LB5A 4WUJA 3IQAA 4MCWA 4HNBA 5IHVA 3PAGA 4KZ3A 1VM1A 5HAPA 5CHMA 3IF6B 4KQDA 4WMCA 1JWZA 4PPRA 4PAUA 3LI8A 5DF8A 4PM6A 3GSGA 1OJ5A 4UQIM 1DP8A 1XX2A 4BMWA 4ZDXA 3F1NA 1VEUB 1N4OA 3BYDA 3PBSA 4E3JA 1D7EA 1G28A 3HLDA 3IX4A 3T4TA 1TS0A 3TSGA 2VGJA 5FQ9A 5TJJA 3PBNA 3QP5A 5HW3A 3FG8A 3FPWA 5L10A 1OJGA 2WKRA 4UQIS 3SH7A 3BQ8A 1W8QA 4GKUA 3VFFA 4X69A 3DW0A 4LFUA 5FQKA 4DE2A 5HX9A 1E3UA 2GJ3A 3IF6C 3FZCA 1OTIA 1L3LA 2EWVA 3H9WA 4HY8A 2GZAA 5CTNA 1NY0A 3O87A 1Z09A 4OKPA 1KE4A 1IYPA 1G5UA 5GHZA 1CK3A 5FAPA 3KSFA 1K55C 3UPPA 1PWGA 4HHDA 5EFWA 2P04A 4N1XA 5DFYA 1NJ4A 2V2FF 5FAQA 3T1QB 3V67A 3SZTA 1GSXA 4EEUA 3H82A 2A3UA 3FWLA 4R1GA 3C7UA 3IX8A 4OH0A 3NJAA 1IKGA 4E3NA 1T18A 3EGXC 5GHYA 3HLBA 4P87A 5U47A 4JPMA 4FCFA 3BECA 4WLAA 5JYPA 3QHYA 4C6YA 2JKRI 4R6LA 1W79A 2IWBA 4S2IA 3QP6A 1KVLA 5G18A 2O0YA 2EWWA 4RX3A 3VOLA 5A8BA 3UY6A 2W3HA 1YLTA 4N9LA 1VETA 3BEBA 3IF5A 1DP9A 4X25A 4Z9QA 4MDZA 5HDCA 5CTMA 4LRZE 4B4XA 4GS9B 4B4ZA 4DE1A 3O5YA 2HDUA 2D01A 2ZM0A 1S66L 4GZBA 3D3OA 5DTTA 1MWRA 3WS1A 2W1RA 1BYWA 1YLWA 1ZKJA 5DFXA 3LEZA 2INWA 4XUXA 1SHVA 4MLLA 3EEAA 1PIOA 2A24A 4BENA 2V20A 3E4PA 4RA7A 1F98A 1ZHHB 2QKPA 1RGZA 3NDEA 4WL9A 4JGRA 4R4RA 3ITBA 4R3AA 4P85A 1ES5A 2ZQAA 1MXOA 3T1RA 4ZJ3A 2I9VA 1PZOA 2XROA 2XQZA 3DTIA 5EM0A 1YLYA 4MN6A 3KSHA 2CC1A 4EXOA 3C38A 5L09A 1QMFA 3IWQA 3HREA 3WS0A 1DP6A 1K6SA 3O3VA 4E3KA 4JXGA 3JVVA 1NRFA 3A0SA 3K3DA 3IS2B 1PFLA 2H28A 5DJTA 2VJWA 1PNEA 3V50A 1PW1A 5CHJA 4XT2A 2WUQA 3N4IA 2CMNA 4KZAA 1OT9A 1FCOA 4NXFA 4C3QA 5EVID 3CMZA 3IXDA 4IUKA 2JKFA 2ZQ8A 3M2KA 3M6BA 2Y4AA 4FTXA 5HD5A 1PI5A 4KG2A 1N9BA 1KDWA 5GLAA 4JF6A 3BFGA 5EE8A 1F9IA 1HZOA 2XLNA 3ZNTA 2W27A 2A24B 4JF5A 2OOLA 2BG1A 4RX2A 1KE0A 4ZRRA 1UWPX 4DXCA 5KIZA 3RJUA 5KZHA 3NOPC 3LEQA 5G4ZA 3OOVA 5CXWA 3NHQA 2J9PA 5DF7A 2V9AA 3CPTB 2HDRA 3S7QA 2QJ5A 4X53A 2ZMAA 1S67L 2WKHA 4K91A 1K4EA 1L0FA 3KYQA 2Z6CA 3DWZA 2HJEA 4Q0HA 2Y2PA 2HDQA 1U60A 4ETZA 3TE8A 3MSHA 4OVDA 1IYSA 3DBAA 4QPRA 2B95A 1MBLA 3QP8A 4WEKA 3VP0A 3G34A 5JYOA 5IU1A 4WELA 4LV1A 4ETXA 3T4KA 2JKTM 1C3BA 4BBUA 5C5KA 4X55A 5CERA 3SS3A 2PT7A 2Y2JA 2Z2LB 1J3WA 1L0GA 1P0ZA 1MKIA 1LL5A 3UMDA 5FQIA 2QZ6A 1VETB 3UE1A 4HQAA 4Y3IA 3C2WA 3I7JA 2Y91A 4U0XA 1MPLA 1K4FA 2JBFA 2ZBBA 2ZM8A 1YM1A 3UB7A 4WBGA 3SOIA 3GRJA 2OLVA 1Y28A 2PU4A 3E2LA 3ICYA 3MQQA
chains in the Genus database with same CATH topology
2W3FA 2Y8HA 3BJNA 3IS2A 4EW7A 1KOUA 4PHTA 3UMEA 2QWSA 4FOFA 3MF0A 4GW9A 5F6AA 3OLOA 1NLZA 5K5BA 2L1MA 2GX5A 3EWKA 1T1BA 4XT2B 3RTYA 2VZWA 2OWHA 3PHYA 2HGVA 2LB5A 4WUJA 5IS1A 4MCWA 4HNBA 5LBRA 1LSXA 3BW6A 2VV8A 2MJ6A 2IA2A 4KQDA 4MN7A 4F3LB 1N9LA 2PD7A 1TS6A 4PAUA 4ARZA 1UGUA 2V1BA 3LI8A 4II7A 2JN7A 1YSPA 5FL3A 4EQ1A 2W3DA 3UB9A 1OJ5A 4UQIM 5IT5A 1DP8A 3F1OA 3PYPA 4G3WA 2M7UA 3E98A 2FZ0A 3LIEA 4H6JB 2YKHA 2J3TD 4BMWA 1S1YA 4R38A 5AVEA 3F1NA 1XJ6A 3PBSA 3T4LA 1XFNA 1D7EA 2QYBA 4JGOA 1G28A 4MMNA 3CAXA 4EETB 1MKMA 2L0WA 3T4TA 1TS0A 4CLCA 2KOIA 3T50A 2PYRA 2XRNA 1WA9A 5TBMB 3FC7A 2M7VA 5TJJA 1OTDA 2K7SA 3PBNA 5L8MA 4LPZA 3FG8A 3FPWA 2ZOIA 1OJGA 2WKRA 3A0VA 3EOIA 2PD8A 4UQIS 2O9BA 3BQ8A 4WEJA 2O9AA 5HPIA 2P7JA 3PBQA 5HZHA 4NEED 3K2NA 2YKFA 2Y79A 2GJ3A 3KYZA 2W1TA 1OTIA 3OC2A 1S4SA 2EWVA 3BQAA 1W63Q 3KX0X 2M1CA 2OWJA 3H9WA 3H82B 2GZAA 4HY8A 3B42A 4Z1WA 3HCYA 1UWNX 5HL6A 3EQVA 1P9RA 2ZMFA 4IJGA 4DJ2A 3KSFA 4HH2A 2VA0A 5AVFA 1N9OA 1NLYA 4HHDA 5EFWA 4AFIA 2OAQ1 2P04A 2WKPA 5DFYA 4KQOA 3MJQA 2VKSA 2VGLM 1OTEA 2VEAA 4E04A 3W2ZA 1T1AA 3GDIA 3KSIA 1T1CA 3V67A 1ODVA 2W1TB 1GSXA 4CLCC 2PHYA 3JVUA 4P6ZM 4WN5A 4EEUA 1OTAA 1YAXA 2PDRA 3EGDC 3H82A 3MR0A 4DJ3A 5DF9A 1TF1A 3HJIA 5I5LA 3R7WA 2ZMVA 5HDDA 3NJAA 3CI6A 4HOIA 1T18A 3EGXC 1STZA 3C30A 4JGPA 1TS7A 3D72A 4EU0A 3C8CA 3K3CA 3S7PA 2A2LA 4KUOA 4WLAA 5F68A 1LSWA 2JKRI 4R6LA 4CLCE 3G6OA 4H6JA 4Q0IA 3T4QA 2O0YA 3T4OA 2EWWA 3MQ0A 3E0YA 3CWFA 1MZUA 3VOLA 5A8BA 2NUTC 3B47A 4I39A 4WF0A 4L9GA 3CUEA 2FH5A 1LSVA 2DMWA 3OCNA 4KUKA 2W3HA 4YOFA 4GCZA 5TBMA 1DP9A 2O99A 1P9WA 4MDZA 5HDCA 4B9OA 4LRZE 1DRMA 3F1PB 4GS9B 1MC0A 3LR5A 1V9YA 3O5YA 2BASA 5F69A 3VV4A 4Y2FA 3MXQA 1ZTUA 2D01A 4DMZA 3RFBA 1S66L 3D3OA 4I5SA 2XA7M 4I38A 3F1PA 4GS9A 3MQOA 4LRYC 1EW0A 3NOTC 2VV7A 2W1RA 1BYWA 3GECA 1NWZA 5DFXA 2INWA 3TRCA 3R4KA 4I3AA 5DKLA 4BBVA 1F5MA 3LR4A 3EEAA 4JGQA 3LIFA 4NKPA 4M4XA 2A24A 4HP9A 3TJZC 5HD3A 1YSQA 3E4PA 2Z6DA 1F98A 2V1AA 1ZHHB 2QKPA 3S7NA 4LLOB 3F1NB 5KSHA 4WL9A 4JGRA 3BY8A 4NXEA 3OBFA 4R3AA 2XSSA 2I9VA 4MN5A 2XROA 4OOMA 1LT0A 4GJ4A 2JKTI 1VHMA 1OPXA 3KSHA 4MN6A 4EXOA 3VE3A 3H7WB 3C38A 1H8MA 3KSGA 3MMHA 2PYPA 2J80A 5HDSA 3F1OB 5MC7A 3ULFA 1JNUA 3LR3A 1DP6A 1W63M 3LUQA 4EUVA 1S4RA 2LB9A 3JVVA 4B93A 2W0NA 4HP4A 4ARZB 3A0SA 2OAP1 3K3DA 4HJ4A 1LL8A 3IS2B 4NXBA 1G6OA 3CLOA 2H28A 1YKDA 2WKQA 5DJTA 3UE3A 5J7EA 2VJWA 3HJKA 3U2AA 3ZYTA 4HI4A 4LRXC 4XT2A 2VX8A 3PBTA 1TS8A 1T19A 4CLCB 1XFQA 3LFVA 5DJUA 2CMNA 3SW1A 3P7NA 3IBJA 1OT9A 5G4YA 3E4OA 4L9FA 4NXFA 4PKYA 1IOUA 2VLGA 3NOUC 3P01A 4O01A 2KDKA 4HH3A 4IUKA 5HWWA 3LI9A 4GLQA 4BWIA 4F3LA 3FPVA 2K2NA 4G3VA 1H3QA 3VE4A 2QJ7A 2QHKA 3EEHA 3T4SA 2B02A 5HD5A 2PR5A 4GHIB 2R78A 4L0LA 4OOLA 1F9IA 4K08A 3RH8B 4HJ3A 2J3TC 2W27A 3E4QA 4Q0JA 5HWTA 2A24B 2L4RA 1VB6A 4GHIA 2B18A 2OOLA 3KO6A 4ZRRA 4O8GA 1GSWA 3PBRA 1TD5A 2W3GA 1OTBA 3BWLA 1XJ3A 1UWPX 5KIZA 2JKRM 4BBTA 1N9NA 2XA7S 4I3IA 3A0RA 4EEPA 4O0PA 3NOPC 5G4ZA 2HV1A 3OOVA 4CQHA 3NHQA 2EA9A 4EERA 2V9AA 4CLCD 3CITA 4L9EA 2QJ5A 3S7QA 1S67L 1V9ZA 3KYQA 2Z6CA 3LICA 1GSVA 2HJEA 2O9CA 2P08A 2K31A 2PR6A 2VV6A 5F5YA 5J4EA 5J3WA 4Q0HA 4I3JA 3IBRA 5CX7A 4ME4A 4RQ9A 3BY9A 3R7WB 3TE8A 4ETZA 3S7OA 3EQUA 3PXPA 3DBAA 4QPRA 4YNRA 4G3KA 4IUHA 2KX6A 4HIAA 4WEKA 2D02A 1X0OA 4PKYG 5IU1A 3OCLA 3LR0A 1XJ2A 4WELA 1P97A 2ZOHA 4ETXA 3T4KA 2JKTM 2HJ9C 3PR6A 1NRJA 2GNXA 3LIAA 4BBUA 2V0UA 5C5KA 2NUPC 4EESA 4NXGA 4BJPA 2PT7A 5HPFA 3LYXA 4IHQA 1P0ZA 4FSFA 3MFXA 3CUEC 2V0WA 3PBOA 3LIDA 3UMDA 4HJ6A 2JHEA 4UEYA 4HQAA 4Y3IA 1S1ZA 3C2WA 4P6ZS 3ZQ5A 4R70A 3B33A 2KLIA 3UB8A 2ZBBA 3UE6A 4YWZA 1D06A 3UB7A 1OT6A 5DKKA 5HWVA 3T4JA 3H7WA 1IFQA 2W3EA 2VGLS 2G7UA 2J3WA 1Y28A 4DN0A 5AJGA 4Y5FA 3ICYA 3UB6A 3MQQA 1XJ4A 5HSQA 3LIBA 3TW8A 2HF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R78 A;  4JGQ A;  1F9I A;  4K08 A;  3LIF A;  3RH8 B;  4HJ3 A;  4M4X A;  2W27 A;  3IS2 A;  3E4Q A;  5HWT A;  2A24 A;  4HP9 A;  4DJ2 A;  4EW7 A;  2A24 B;  2L4R A;  5HD3 A;  1KOU A;  3E4P A;  1VB6 A;  4GHI A;  4HH2 A;  5AVF A;  3UME A;  2QWS A;  2Z6D A;  4GW9 A;  1F98 A;  2OOL A;  2V1A A;  1N9O A;  5F6A A;  3OLO A;  4BBV A;  2QKP A;  4LLO B;  3F1N B;  1GSW A;  2L1M A;  4HHD A;  4WL9 A;  3EWK A;  3BY8 A;  4JGR A;  4NXE A;  1T1B A;  5EFW A;  4XT2 B;  1OTB A;  3BWL A;  2WKP A;  3RTY A;  1XJ3 A;  4R3A A;  1UWP X;  2OWH A;  5KIZ A;  3PHY A;  3MJQ A;  4BBT A;  1N9N A;  4I3I A;  4WUJ A;  1OTE A;  3A0R A;  4EEP A;  5IS1 A;  2VEA A;  3NOP C;  4E04 A;  1T1A A;  2I9V A;  3GDI A;  4HNB A;  2HV1 A;  4MN5 A;  1T1C A;  5G4Z A;  1ODV A;  1GSX A;  3NHQ A;  1LT0 A;  1LSX A;  2EA9 A;  4EER A;  2PHY A;  2VV8 A;  2V9A A;  4WN5 A;  4EEU A;  4MN6 A;  4L9E A;  4EXO A;  2QJ5 A;  1OTA A;  3H7W B;  2PDR A;  3H82 A;  3MR0 A;  3VE3 A;  4DJ3 A;  1S67 L;  5A8B A;  4KQD A;  3HJI A;  2PYP A;  5I5L A;  2J80 A;  1V9Z A;  4F3L B;  1N9L A;  2PD7 A;  2Z6C A;  3LIC A;  1TS6 A;  3F1O B;  3NJA A;  1GSV A;  1UGU A;  5HDD A;  5HDS A;  1JNU A;  2V1B A;  3LI8 A;  3ULF A;  2VV6 A;  2PR6 A;  1DP6 A;  2JN7 A;  5F5Y A;  4HOI A;  1T18 A;  4EQ1 A;  5J4E A;  5J3W A;  4JGP A;  4I3J A;  3IBR A;  1TS7 A;  3D72 A;  3UB9 A;  1OJ5 A;  3C8C A;  3K3C A;  3LUQ A;  5DKK A;  1S4R A;  4RQ9 A;  3BY9 A;  4KUO A;  1DP8 A;  2W0N A;  4HP4 A;  3F1O A;  4WLA A;  3A0S A;  5F68 A;  1LSW A;  3PYP A;  4R6L A;  3G6O A;  3K3D A;  3LIE A;  4H6J B;  2YKH A;  4HJ4 A;  4H6J A;  2KX6 A;  1S1Y A;  4HIA A;  4R38 A;  3F1N A;  5AVE A;  1XJ6 A;  1LL8 A;  2D02 A;  1X0O A;  3CWF A;  1XFN A;  3IS2 B;  1D7E A;  1MZU A;  4NXB A;  4PKY G;  5IU1 A;  3CLO A;  2H28 A;  4WF0 A;  4I39 A;  3VOL A;  2WKQ A;  5DJT A;  1XJ2 A;  4JGO A;  1G28 A;  3HJK A;  4L9G A;  3CAX A;  4EET B;  5J7E A;  1P97 A;  1LSV A;  2L0W A;  1TS0 A;  2ZOH A;  4KUK A;  3T50 A;  2PYR A;  3LIA A;  1WA9 A;  2V0U A;  4GCZ A;  5TBM B;  5TBM A;  4BBU A;  3FC7 A;  4HI4 A;  4EES A;  1OTD A;  2K7S A;  4LRX C;  4NXG A;  4XT2 A;  4LPZ A;  5HWV A;  3LYX A;  1TS8 A;  3FG8 A;  2ZOI A;  1OJG A;  2WKR A;  3A0V A;  1DP9 A;  2PD8 A;  1P0Z A;  1T19 A;  3MFX A;  1XFQ A;  2V0W A;  5DJU A;  5HDC A;  2CMN A;  3LID A;  3UMD A;  4B9O A;  3SW1 A;  4HJ6 A;  3P7N A;  4LRZ E;  2P7J A;  2JHE A;  5HZH A;  1DRM A;  1OT9 A;  5G4Y A;  3E4O A;  4L9F A;  4NXF A;  4PKY A;  4HQA A;  3F1P B;  4GS9 B;  2YKF A;  1S1Z A;  1V9Y A;  2VLG A;  2BAS A;  3C2W A;  3NOU C;  5F69 A;  3ZQ5 A;  2KDK A;  4HH3 A;  4R70 A;  3B33 A;  3LI9 A;  5HWW A;  3MXQ A;  2D01 A;  2GJ3 A;  1S66 L;  4F3L A;  3UB8 A;  2ZBB A;  1OTI A;  4YWZ A;  3UE6 A;  1S4S A;  1D06 A;  4I5S A;  3UB7 A;  4I38 A;  3VE4 A;  2QJ7 A;  3F1P A;  4GS9 A;  2QHK A;  3MQO A;  4LRY C;  1OT6 A;  3EEH A;  2M1C A;  2OWJ A;  3H9W A;  3KX0 X;  1EW0 A;  2VV7 A;  3H7W A;  3H82 B;  1BYW A;  3NOT C;  4HY8 A;  2B02 A;  3GEC A;  1Y28 A;  1NWZ A;  5HD5 A;  2INW A;  1UWN X;  3ICY A;  3UB6 A;  2PR5 A;  3MQQ A;  1XJ4 A;  5HSQ A;  5DKL A;  4I3A A;  3LIB A;  4GHI B; 
#chains in the Genus database with same CATH topology
 2Y8H A;  3G31 A;  1FIK A;  3G32 A;  4KZ6 A;  4PHT A;  4LEN A;  1HD8 A;  4FOF A;  2X01 A;  4OOY A;  2WAE A;  3RTY A;  2VZW A;  3PHY A;  1F2K A;  3NBL A;  2HGV A;  4IVK A;  3IF6 A;  3ZFZ A;  4UA6 A;  4Y7P A;  3BW6 A;  2VV8 A;  2ZLY A;  2R9X A;  2IA2 A;  4HBT A;  1NZU A;  4NG2 A;  4F3L B;  1N9L A;  3UDX A;  1RCJ A;  4S2N A;  2V1B A;  4II7 A;  2JC7 A;  2JN7 A;  5FL3 A;  4EQ1 A;  2W3D A;  2OSU A;  3V5M A;  4OPZ A;  3UB9 A;  1ES3 A;  1S6R A;  1TVF A;  3LIE A;  2YKH A;  4ZTK A;  4MEZ A;  5AVE A;  1XJ6 A;  3M2J A;  1L0E A;  3OPP A;  1K25 A;  4EET B;  2EX2 A;  4PM7 A;  2KOI A;  2XD5 A;  5CHU A;  4S2M A;  5L8M A;  1GHM A;  3A0V A;  4GDB A;  3V3R A;  3L7H A;  3HL9 A;  3WS5 A;  5M19 A;  1J9M A;  3UE0 A;  2Y2G A;  5A93 A;  1E4D A;  2WYX A;  3NCK A;  3K2N A;  4RYE A;  1GA9 A;  3KYZ A;  3V39 A;  1BZA A;  3ITA A;  3H82 B;  4DXB A;  4EV4 A;  2WZZ A;  1OME A;  3L9K A;  3ZGA B;  4ZAM A;  3OPH A;  3PTE A;  3NC8 A;  2ZL1 A;  2ZQ9 A;  3JPU A;  3BFD A;  2ZC7 A;  5EVI A;  3HUM A;  3MJQ A;  1QME A;  2VGL M;  3BLM A;  1T1A A;  4KZ5 A;  1PRQ A;  1T1C A;  1ODV A;  2W1T B;  5CEB A;  4X6T A;  4S2P A;  1HLU P;  2PHY A;  1YAX A;  2PDR A;  3MR0 A;  2PBY A;  4KQQ A;  3VP1 A;  4EBL A;  1BLC A;  4HOI A;  2XF3 A;  1TS7 A;  3D72 A;  3C8C A;  3K3C A;  3S7P A;  2A2L A;  1NYM A;  5CGX A;  1G6A A;  5F82 A;  2Q9N A;  1LSW A;  4CLC E;  2XDM A;  3MBZ A;  2P9V B;  4WZ5 A;  3MQ0 A;  4E6W A;  1MZU A;  3C4P A;  2NUT C;  3B47 A;  1FSW A;  4LGW A;  3W4O A;  3O88 A;  1LSV A;  4OON A;  5E2G A;  1K54 A;  2WGW B;  4RVA A;  5FAO A;  3IHA A;  1K0K A;  3QP1 A;  3LR5 A;  1CF0 A;  5F69 A;  4O7D A;  3MXQ A;  2WZX A;  4JF4 A;  5EOE A;  5EPH A;  1IEL A;  1I5Q A;  4OPY A;  2XA7 M;  5E2E A;  3F1P A;  3MQO A;  4EWF A;  1EW0 A;  1NWZ A;  1NZO A;  5M18 A;  3N8R A;  3LY4 A;  1DJB A;  2FFY A;  1YLP A;  3LIF A;  5TFQ A;  4NKP A;  4M4X A;  4K0X A;  2WAF A;  3VP3 A;  3W4Q A;  1ES4 A;  5HD3 A;  3ZCZ A;  1YSQ A;  1CQA A;  4HES A;  2Z6D A;  4E3I A;  2C5W B;  3A3J A;  3S7N A;  4BQM A;  5KSH A;  4DRT A;  4NXE A;  5FDH A;  4QD4 A;  3GQZ A;  5M1A A;  4S2N C;  3Q07 A;  1L2S A;  3UB5 P;  3ZHH A;  4BD0 A;  2JKT I;  3VP4 A;  1H8M A;  1AWI A;  1CEF A;  3F1O B;  5MC7 A;  3P98 A;  3ULF A;  3B3X A;  2JKG A;  2IWD A;  2OLU A;  4EUV A;  1S4R A;  2LB9 A;  1ZG6 A;  4D2O A;  1KGF A;  1WYB A;  3MS6 A;  3C5A A;  3GVB A;  2HPB A;  2XEP A;  1LL8 A;  1G6O A;  3CLO A;  2WKQ A;  3HJK A;  3U2A A;  4ZBE A;  4H8R A;  4ESP A;  4GDN A;  5CGW A;  2VX8 A;  3PBT A;  2WKI A;  3NEC A;  5GLD A;  4C75 A;  5F83 A;  2ZQC A;  1SCW A;  5DJU A;  2Q9M A;  3P7N A;  3IBJ A;  4L9F A;  4R3J A;  1XA7 A;  1XA1 A;  5HAQ A;  2VLG A;  3NOU C;  4HH3 A;  4BWI A;  4F3L A;  1K6R A;  4EUZ A;  4G3V A;  1H3Q A;  3T1X A;  2QHK A;  3EEH A;  4E3O A;  2UV0 E;  4K0W A;  2PRF A;  4DF6 A;  4L0L A;  4JXS A;  3SH8 A;  4HJ3 A;  4S2L A;  3DWK A;  2R9W A;  1VB6 A;  4GHI A;  3ZG5 A;  1M6K A;  2B18 A;  1BSG A;  3S4X A;  4O8G A;  4MNR A;  1Z6F A;  2Y2M A;  3T1S A;  4X1L A;  2X02 A;  3IWI A;  4DDS A;  4I3I A;  3A0R A;  4EEP A;  3MZD A;  5FQJ A;  4N1H A;  4CPK A;  3NY4 A;  4YIN A;  5AQ7 A;  3CIT A;  3C4O A;  4MBF A;  1M40 A;  1BTL A;  3VP2 A;  3GTC A;  3HLC A;  2PR6 A;  5J4E A;  4GN2 A;  5J3W A;  4I3J A;  4E6X A;  1KE3 A;  3BY9 A;  3S7O A;  3PXP A;  4YNR A;  1YLJ A;  4IUH A;  1VQQ A;  2D02 A;  2JE5 A;  3LR0 A;  3OCL A;  4WMC D;  1ONH A;  1TDG A;  2P9V A;  1SDN A;  2HJ9 C;  2VK3 A;  3O86 A;  1ACF A;  5I94 A;  4BJP A;  3MZE A;  4IED A;  3GMW A;  3CUE C;  1S0W A;  4KZ8 A;  1PWD A;  4B88 A;  4LCM A;  3GR2 A;  4HJ6 A;  1Q2P A;  4UEY A;  1FQG A;  3IH9 A;  4P6Z S;  3UDI A;  3ZQ5 A;  1SZV A;  4R70 A;  3B33 A;  1XGJ A;  2KLI A;  2BTF P;  1K57 C;  1D06 A;  5HWV A;  3T4J A;  1IFQ A;  3H7W A;  2J3W A;  4Y5F A;  4R0Q A;  3UB6 A;  1KVM A;  1XJ4 A;  5HSQ A;  3DTM A;  3CHW P;  3ZG7 B;  1O07 A;  2DNS A;  3UPN A;  4GW9 A;  4FD8 A;  1YQS A;  4XXR A;  4HEF A;  4S2K A;  3V3S A;  4OP5 A;  2Y59 A;  3A3E A;  1IYQ A;  5LBR A;  3DTK A;  1IKI A;  4BD1 A;  2MJ6 A;  4KG6 A;  2PD7 A;  1MY8 A;  2XFT A;  4ARZ A;  3SS4 A;  3NUL A;  3E2K A;  1FOF A;  4BL2 A;  4P6B A;  3F1O A;  3PYP A;  4G3W A;  3E98 A;  2J3T D;  3MXS A;  3CG5 A;  3G2Z A;  1XFN A;  4MMN A;  2XK1 A;  2B5R A;  3HUN A;  3IWO A;  4U0T A;  3T50 A;  2XRN A;  5TBM B;  1WA9 A;  4LPZ A;  5A92 A;  1SKO A;  2PD8 A;  3OPR A;  4WEJ A;  2O9A A;  3AGF A;  5HPI A;  2P7J A;  2H10 A;  5FSR A;  1LHY A;  2Y79 A;  2A49 A;  2W1T A;  4R4S A;  1S4S A;  5AQA A;  3N6I A;  3BQA A;  1YPR A;  1W63 Q;  1YT4 A;  2M1C A;  3B42 A;  4Z1W A;  2QMI A;  1P9R A;  2BLS A;  1JVJ A;  3Q1F A;  3VOZ A;  2ZMF A;  1XP4 A;  1EI5 A;  5AVF A;  4Y13 A;  5A91 A;  2OAQ 1;  2EX6 A;  2GDN A;  2VKS A;  3HLW A;  2ACG A;  2VEA A;  4Y17 A;  3GDI A;  4CLC C;  4WN5 A;  2WGW A;  3A3I A;  2IWC A;  1OTA A;  3EGD C;  1FCN A;  4DJ3 A;  3A3F A;  5DF9 A;  1TF1 A;  3HJI A;  3ZG8 B;  5FQM A;  2ZMV A;  3CI6 A;  3WS2 A;  2HP6 A;  3C30 A;  5L07 A;  4OLD A;  4KUO A;  5TR7 A;  4QU3 A;  5F68 A;  3N8S A;  4OPR A;  5FEG A;  3G6O A;  3VOY A;  4Q0I A;  3T4Q A;  2RL3 A;  1HVB A;  1VEU A;  3MXR A;  2PU2 A;  4Y0T A;  3CUE A;  2DMW A;  4DE3 A;  5TBM A;  1CI8 A;  2H5S A;  2O99 A;  4FH2 A;  3S1Y A;  1MWS A;  4QHC A;  4B9O A;  3WRT A;  1DRM A;  2ZC4 B;  2XGN A;  3QP2 A;  3F1P B;  3G30 A;  1DJC A;  2BAS A;  5D3O A;  4Y2F A;  4GD6 A;  1ZTU A;  1FR6 A;  3RFB A;  4PMA A;  3A3D A;  4I38 A;  4QB8 A;  5FI2 A;  4N92 A;  4LRY C;  3OZH A;  3AGE A;  3NOT C;  3GEC A;  3TRC A;  3R4K A;  4I3A A;  5DKL A;  4BBV A;  4JXW A;  1PWC A;  3PAE A;  3LR4 A;  1L0D A;  1XKZ A;  1O7E A;  4HP9 A;  3TJZ C;  1YMX A;  2EX8 A;  1XPB A;  2V1A A;  2ZC6 B;  5E2F A;  4JLF A;  4EBP A;  4KG5 A;  3OBF A;  4ZJ1 A;  2Y2K A;  5EVL A;  4YFM A;  4N9K A;  4EQI A;  4MN5 A;  4OOM A;  1LT0 A;  2H0Y A;  1OPX A;  3VE3 A;  3H7W B;  3MMH A;  2PYP A;  3UNW A;  1JNU A;  4BL3 A;  3HLG A;  1W63 M;  2J8Y A;  3GV9 A;  3HLF A;  3LUQ A;  4MBK A;  2EX9 A;  2W0N A;  4ARZ B;  1BLS A;  2OAP 1;  5GLB A;  3QNC A;  4HJ4 A;  4NXB A;  3HLE A;  1YKD A;  5J7E A;  3CJM A;  3UE3 A;  3Q82 A;  1H5X A;  1PI4 A;  3LY3 A;  1TS8 A;  3Q7V B;  4GNU A;  5E43 A;  1T19 A;  3MKF A;  1XFQ A;  3JYI A;  3SH9 A;  4PKY A;  4R3B A;  4O01 A;  2XH9 A;  1NYY A;  5HL1 A;  4GLQ A;  1ONG A;  3FPV A;  4Y15 A;  3WS4 A;  2H0T A;  5GHX A;  1BUL A;  2HP9 A;  3ISG A;  2PR5 A;  4GHI B;  1LL9 A;  4Y0O A;  2P74 A;  3ZDJ A;  4OOL A;  1AXB A;  3KYE A;  4QWO A;  3RH8 B;  2J3T C;  3E4Q A;  5HWT A;  1E3U D;  1SDE A;  4S2O A;  1K38 A;  3KO6 A;  3NIA A;  4KQR A;  1TEM A;  3PBR A;  4PM5 A;  1TD5 A;  3BWL A;  4OQG A;  2JKR M;  4BBT A;  3QP4 A;  2XA7 S;  3W4P A;  3BFF A;  4CQH A;  1HTZ A;  2EA9 A;  4GD8 A;  1D1J A;  1CI9 A;  2ZD8 A;  4L9E A;  2I72 A;  1FR1 A;  1V9Z A;  2EXB A;  3LIC A;  1GSV A;  4UA7 A;  2P08 A;  4WZ5 C;  2K31 A;  2VV6 A;  4OQ0 A;  5FI7 A;  3IBR A;  3HUO A;  5CX7 A;  4ME4 A;  4QY5 A;  4RQ9 A;  3EQU A;  1JTG A;  2KX6 A;  1K54 C;  3IHB A;  1X0O A;  5TGF A;  5DTK A;  4R23 A;  3G2Y A;  3VMA A;  5GL9 A;  1ALQ A;  2ZOH A;  3P09 A;  2DRW A;  3PR6 A;  4GOG A;  1NRJ A;  2GNX A;  3LIA A;  2V0U A;  4OQH A;  1LI0 A;  1IEM A;  3Q81 A;  2NUP C;  4EES A;  5CEC A;  5HPF A;  1BLP A;  1K56 A;  1PYY A;  4IHQ A;  3D4F A;  4FSF A;  5EOO A;  3MFX A;  1PZP A;  1ERQ A;  3NI9 A;  4XUZ A;  1DJA A;  2JHE A;  4FH4 A;  5EM1 A;  4IVI A;  4OLG A;  1S1Z A;  4KZB A;  3UB8 A;  3T12 B;  3LGO A;  3UE6 A;  3UPO A;  4U3T A;  2G7U A;  2JCH A;  3S22 A;  4DN0 A;  5AJG A;  3ZG0 A;  3LIB A;  3QNB A;  2HF6 A;  3HVF A;  3BJN A;  5J8X A;  3RXW A;  4EW7 A;  5A90 A;  1KOU A;  3UME A;  2QWS A;  3MF0 A;  1NLZ A;  5EVI B;  2PBD P;  1GHP A;  1T1B A;  4IBR A;  2OWH A;  5FDS A;  3VSL A;  5IS1 A;  3IH8 A;  5EEC A;  5CRF A;  4QJG A;  1LSX A;  5HFO A;  4MN7 A;  1TS6 A;  2ZC3 B;  2WK0 A;  1UGU A;  1KDS A;  1YSP A;  4WZ4 A;  2FFF B;  3U4L P;  2XD1 A;  1GA0 A;  5AQB A;  5IT5 A;  4X56 A;  4UA9 A;  2HZ5 A;  4LV2 A;  3OPL A;  2M7U A;  5DTS A;  2FZ0 A;  4H6J B;  1TDL A;  5FEF A;  1BT5 A;  1S1Y A;  2VGK A;  2WGI A;  4R38 A;  1ERM A;  4CJN A;  3T4L A;  4LCL A;  2QYB A;  4JGO A;  5E2H A;  3CAX A;  1MKM A;  1PW8 A;  2L0W A;  1XXM A;  4CLC A;  2PYR A;  2WGV A;  3FC7 A;  2M7V A;  1OTD A;  2HDS A;  2K7S A;  3LCE A;  1EWZ A;  2ZOI A;  3EOI A;  2O9B A;  3BRM A;  3PBQ A;  5HZH A;  3WWX A;  5CED A;  4P0M A;  1E25 A;  4NEE D;  2YKF A;  2OV5 A;  3TG9 A;  2EXA A;  4ID4 A;  4OQI A;  3OC2 A;  5FI6 A;  3KX0 X;  2OWJ A;  3D9Y A;  4LV0 A;  2Y2O A;  3HCY A;  1BUE A;  1UWN X;  5HL6 A;  3EQV A;  1MWU A;  1XGI A;  3UDF A;  4IJG A;  4DJ2 A;  2ZQ7 A;  3N8L A;  4QY6 A;  4HBU A;  4HH2 A;  2VA0 A;  3BFC A;  1W5D A;  4OPQ A;  1N9O A;  2G2U A;  1NLY A;  4AFI A;  2QPN A;  1A0K A;  3VFH A;  2WKP A;  4KQO A;  5L2F A;  2HP5 A;  1OTE A;  3MKE A;  3W2Z A;  4E04 A;  3KSI A;  2ZM2 A;  1CEG A;  1JWV A;  3JVU A;  4P6Z M;  1GCE A;  5GLC A;  3FKW A;  5EVE A;  3IXH A;  4E3M A;  2ZQD A;  5I5L A;  3R7W A;  5HDD A;  2WAD A;  1STZ A;  4JGP A;  4EU0 A;  3TOI A;  4MBH A;  3M6H A;  4H6J A;  3T4O A;  3E0Y A;  3CWF A;  2C6W B;  4WF0 A;  4I39 A;  5FA7 A;  4L9G A;  2FH5 A;  2V8C A;  3OCN A;  4KUK A;  3LO7 A;  4YOF A;  4GCZ A;  5KSC A;  5CGS A;  1P9W A;  4DKI A;  1K57 A;  1FIL A;  2RCX A;  5EVI C;  1K55 A;  4KEN B;  1MC0 A;  1V9Y A;  3VV4 A;  4A5R A;  4Y0U A;  1Y4O A;  2XFS A;  4DMZ A;  4I5S A;  4GS9 A;  2VV7 A;  2DCF A;  2AVX A;  3BFE A;  1F5M A;  4JGQ A;  3BLS A;  3BM6 A;  5F1F A;  4X1M A;  2ZL1 B;  2V8F A;  1H8Y A;  4EBN A;  1W7F A;  3IXB A;  4LLO B;  3F1N B;  3BY8 A;  2XSS A;  4DE0 A;  3W8K A;  5DVA A;  3VSK A;  4GJ4 A;  2PAV P;  1DY6 A;  1VHM A;  1Q2Q A;  5KMW A;  3KSG A;  2J80 A;  5HDS A;  3LR3 A;  3FYZ A;  4X68 A;  2Y55 A;  4B93 A;  4BLM A;  4HP4 A;  4FUW A;  3ZG9 B;  2E8I A;  5EUA A;  1ERO A;  5FQQ A;  1ESU A;  2EFX A;  1LLB A;  2J9O A;  1CJF A;  2G2W A;  4PM8 A;  3Q7V A;  1ZG4 A;  1YLZ A;  2Y2Q A;  5HAR A;  2X71 A;  1BLH A;  3ZYT A;  1YMS A;  3FKV A;  1JWP A;  4GB7 A;  4WYY A;  2Y2N A;  2EFU A;  4HI4 A;  4LRX C;  4ZJ2 A;  4CLC B;  1K56 D;  3LFV A;  4E3L A;  3SW1 A;  4JKT A;  4Q8I A;  5G4Y A;  3E4O A;  1WYC A;  4KZ9 A;  1IOU A;  3P01 A;  2KDK A;  4F94 A;  5HWW A;  3LI9 A;  4PM9 A;  1IYO A;  3SS5 A;  1SKF A;  2K2N A;  3VE4 A;  2QJ7 A;  1ZC2 A;  3T4S A;  2B02 A;  5F1G A;  1LI9 A;  2R78 A;  3DTE A;  1FSY A;  4K08 A;  1JTD A;  1W8Y A;  4Q0J A;  3C7V A;  1H0M A;  2L4R A;  3IT9 A;  3MZF A;  1GSW A;  3HBR A;  2W3G A;  1OTB A;  1XJ3 A;  1G68 A;  1RP5 A;  1ES2 A;  1N9N A;  4LV3 A;  3ZVW A;  4O0P A;  2HV1 A;  1WE4 A;  2WKE A;  4IBX A;  4KZ4 A;  1FCM A;  2UWX A;  4EER A;  4CLC D;  3MFD A;  1Y54 A;  3AGD A;  2Z2M B;  2O9C A;  4JBF A;  5F5Y A;  4WM9 A;  2Y2H A;  3R7W B;  4OP8 A;  3N7W A;  4UHU A;  3CZD A;  3DAV A;  4G3K A;  3NDG A;  4DDY A;  4HIA A;  3ZNY A;  2Y2I A;  1I2W A;  4PKY G;  1XJ2 A;  1P97 A;  3RXX A;  4UAA A;  2XR0 A;  1ESI A;  2V1Z A;  3IX3 A;  4NXG A;  4JXV A;  3WRZ A;  3LYX A;  3CPT A;  2ZC5 B;  2J7V A;  2V0W A;  3PBO A;  3LID A;  5BOH A;  1MWT A;  1RGY A;  2Y2L A;  4M3K A;  3IXG A;  1NXY A;  3UN7 A;  5HAI A;  4KZ7 A;  5EV0 A;  4YWZ A;  4NK3 A;  1OT6 A;  5DKK A;  2W3E A;  2E8J A;  3G4P A;  2VGL S;  5FAT A;  3FV7 A;  3TW8 A;  2W3F A;  3G35 A;  5FAS A;  4NET A;  5AQ9 A;  4D60 A;  1KGE A;  3Q7Z A;  3ZVT A;  3IS2 A;  3UO9 A;  4S2J A;  1H8Z A;  1GHI A;  2Q0O A;  5F6A A;  3OLO A;  5K5B A;  2L1M A;  1KGG A;  2GX5 A;  3EWK A;  1I2S A;  4XT2 B;  1SKO B;  2ZJ9 A;  2LB5 A;  4WUJ A;  3IQA A;  4MCW A;  4HNB A;  5IHV A;  3PAG A;  4KZ3 A;  1VM1 A;  5HAP A;  5CHM A;  3IF6 B;  4KQD A;  4WMC A;  1JWZ A;  4PPR A;  4PAU A;  3LI8 A;  5DF8 A;  4PM6 A;  3GSG A;  1OJ5 A;  4UQI M;  1DP8 A;  1XX2 A;  4BMW A;  4ZDX A;  3F1N A;  1VEU B;  1N4O A;  3BYD A;  3PBS A;  4E3J A;  1D7E A;  1G28 A;  3HLD A;  3IX4 A;  3T4T A;  1TS0 A;  3TSG A;  2VGJ A;  5FQ9 A;  5TJJ A;  3PBN A;  3QP5 A;  5HW3 A;  3FG8 A;  3FPW A;  5L10 A;  1OJG A;  2WKR A;  4UQI S;  3SH7 A;  3BQ8 A;  1W8Q A;  4GKU A;  3VFF A;  4X69 A;  3DW0 A;  4LFU A;  5FQK A;  4DE2 A;  5HX9 A;  1E3U A;  2GJ3 A;  3IF6 C;  3FZC A;  1OTI A;  1L3L A;  2EWV A;  3H9W A;  4HY8 A;  2GZA A;  5CTN A;  1NY0 A;  3O87 A;  1Z09 A;  4OKP A;  1KE4 A;  1IYP A;  1G5U A;  5GHZ A;  1CK3 A;  5FAP A;  3KSF A;  1K55 C;  3UPP A;  1PWG A;  4HHD A;  5EFW A;  2P04 A;  4N1X A;  5DFY A;  1NJ4 A;  2V2F F;  5FAQ A;  3T1Q B;  3V67 A;  3SZT A;  1GSX A;  4EEU A;  3H82 A;  2A3U A;  3FWL A;  4R1G A;  3C7U A;  3IX8 A;  4OH0 A;  3NJA A;  1IKG A;  4E3N A;  1T18 A;  3EGX C;  5GHY A;  3HLB A;  4P87 A;  5U47 A;  4JPM A;  4FCF A;  3BEC A;  4WLA A;  5JYP A;  3QHY A;  4C6Y A;  2JKR I;  4R6L A;  1W79 A;  2IWB A;  4S2I A;  3QP6 A;  1KVL A;  5G18 A;  2O0Y A;  2EWW A;  4RX3 A;  3VOL A;  5A8B A;  3UY6 A;  2W3H A;  1YLT A;  4N9L A;  1VET A;  3BEB A;  3IF5 A;  1DP9 A;  4X25 A;  4Z9Q A;  4MDZ A;  5HDC A;  5CTM A;  4LRZ E;  4B4X A;  4GS9 B;  4B4Z A;  4DE1 A;  3O5Y A;  2HDU A;  2D01 A;  2ZM0 A;  1S66 L;  4GZB A;  3D3O A;  5DTT A;  1MWR A;  3WS1 A;  2W1R A;  1BYW A;  1YLW A;  1ZKJ A;  5DFX A;  3LEZ A;  2INW A;  4XUX A;  1SHV A;  4MLL A;  3EEA A;  1PIO A;  2A24 A;  4BEN A;  2V20 A;  3E4P A;  4RA7 A;  1F98 A;  1ZHH B;  2QKP A;  1RGZ A;  3NDE A;  4WL9 A;  4JGR A;  4R4R A;  3ITB A;  4R3A A;  4P85 A;  1ES5 A;  2ZQA A;  1MXO A;  3T1R A;  4ZJ3 A;  2I9V A;  1PZO A;  2XRO A;  2XQZ A;  3DTI A;  5EM0 A;  1YLY A;  4MN6 A;  3KSH A;  2CC1 A;  4EXO A;  3C38 A;  5L09 A;  1QMF A;  3IWQ A;  3HRE A;  3WS0 A;  1DP6 A;  1K6S A;  3O3V A;  4E3K A;  4JXG A;  3JVV A;  1NRF A;  3A0S A;  3K3D A;  3IS2 B;  1PFL A;  2H28 A;  5DJT A;  2VJW A;  1PNE A;  3V50 A;  1PW1 A;  5CHJ A;  4XT2 A;  2WUQ A;  3N4I A;  2CMN A;  4KZA A;  1OT9 A;  1FCO A;  4NXF A;  4C3Q A;  5EVI D;  3CMZ A;  3IXD A;  4IUK A;  2JKF A;  2ZQ8 A;  3M2K A;  3M6B A;  2Y4A A;  4FTX A;  5HD5 A;  1PI5 A;  4KG2 A;  1N9B A;  1KDW A;  5GLA A;  4JF6 A;  3BFG A;  5EE8 A;  1F9I A;  1HZO A;  2XLN A;  3ZNT A;  2W27 A;  2A24 B;  4JF5 A;  2OOL A;  2BG1 A;  4RX2 A;  1KE0 A;  4ZRR A;  1UWP X;  4DXC A;  5KIZ A;  3RJU A;  5KZH A;  3NOP C;  3LEQ A;  5G4Z A;  3OOV A;  5CXW A;  3NHQ A;  2J9P A;  5DF7 A;  2V9A A;  3CPT B;  2HDR A;  3S7Q A;  2QJ5 A;  4X53 A;  2ZMA A;  1S67 L;  2WKH A;  4K91 A;  1K4E A;  1L0F A;  3KYQ A;  2Z6C A;  3DWZ A;  2HJE A;  4Q0H A;  2Y2P A;  2HDQ A;  1U60 A;  4ETZ A;  3TE8 A;  3MSH A;  4OVD A;  1IYS A;  3DBA A;  4QPR A;  2B95 A;  1MBL A;  3QP8 A;  4WEK A;  3VP0 A;  3G34 A;  5JYO A;  5IU1 A;  4WEL A;  4LV1 A;  4ETX A;  3T4K A;  2JKT M;  1C3B A;  4BBU A;  5C5K A;  4X55 A;  5CER A;  3SS3 A;  2PT7 A;  2Y2J A;  2Z2L B;  1J3W A;  1L0G A;  1P0Z A;  1MKI A;  1LL5 A;  3UMD A;  5FQI A;  2QZ6 A;  1VET B;  3UE1 A;  4HQA A;  4Y3I A;  3C2W A;  3I7J A;  2Y91 A;  4U0X A;  1MPL A;  1K4F A;  2JBF A;  2ZBB A;  2ZM8 A;  1YM1 A;  3UB7 A;  4WBG A;  3SOI A;  3GRJ A;  2OLV A;  1Y28 A;  2PU4 A;  3E2L A;  3ICY A;  3MQQ A; 
#chains in the Genus database with same CATH homology
 2W3F A;  2Y8H A;  3BJN A;  3IS2 A;  4EW7 A;  1KOU A;  4PHT A;  3UME A;  2QWS A;  4FOF A;  3MF0 A;  4GW9 A;  5F6A A;  3OLO A;  1NLZ A;  5K5B A;  2L1M A;  2GX5 A;  3EWK A;  1T1B A;  4XT2 B;  3RTY A;  2VZW A;  2OWH A;  3PHY A;  2HGV A;  2LB5 A;  4WUJ A;  5IS1 A;  4MCW A;  4HNB A;  5LBR A;  1LSX A;  3BW6 A;  2VV8 A;  2MJ6 A;  2IA2 A;  4KQD A;  4MN7 A;  4F3L B;  1N9L A;  2PD7 A;  1TS6 A;  4PAU A;  4ARZ A;  1UGU A;  2V1B A;  3LI8 A;  4II7 A;  2JN7 A;  1YSP A;  5FL3 A;  4EQ1 A;  2W3D A;  3UB9 A;  1OJ5 A;  4UQI M;  5IT5 A;  1DP8 A;  3F1O A;  3PYP A;  4G3W A;  2M7U A;  3E98 A;  2FZ0 A;  3LIE A;  4H6J B;  2YKH A;  2J3T D;  4BMW A;  1S1Y A;  4R38 A;  5AVE A;  3F1N A;  1XJ6 A;  3PBS A;  3T4L A;  1XFN A;  1D7E A;  2QYB A;  4JGO A;  1G28 A;  4MMN A;  3CAX A;  4EET B;  1MKM A;  2L0W A;  3T4T A;  1TS0 A;  4CLC A;  2KOI A;  3T50 A;  2PYR A;  2XRN A;  1WA9 A;  5TBM B;  3FC7 A;  2M7V A;  5TJJ A;  1OTD A;  2K7S A;  3PBN A;  5L8M A;  4LPZ A;  3FG8 A;  3FPW A;  2ZOI A;  1OJG A;  2WKR A;  3A0V A;  3EOI A;  2PD8 A;  4UQI S;  2O9B A;  3BQ8 A;  4WEJ A;  2O9A A;  5HPI A;  2P7J A;  3PBQ A;  5HZH A;  4NEE D;  3K2N A;  2YKF A;  2Y79 A;  2GJ3 A;  3KYZ A;  2W1T A;  1OTI A;  3OC2 A;  1S4S A;  2EWV A;  3BQA A;  1W63 Q;  3KX0 X;  2M1C A;  2OWJ A;  3H9W A;  3H82 B;  2GZA A;  4HY8 A;  3B42 A;  4Z1W A;  3HCY A;  1UWN X;  5HL6 A;  3EQV A;  1P9R A;  2ZMF A;  4IJG A;  4DJ2 A;  3KSF A;  4HH2 A;  2VA0 A;  5AVF A;  1N9O A;  1NLY A;  4HHD A;  5EFW A;  4AFI A;  2OAQ 1;  2P04 A;  2WKP A;  5DFY A;  4KQO A;  3MJQ A;  2VKS A;  2VGL M;  1OTE A;  2VEA A;  4E04 A;  3W2Z A;  1T1A A;  3GDI A;  3KSI A;  1T1C A;  3V67 A;  1ODV A;  2W1T B;  1GSX A;  4CLC C;  2PHY A;  3JVU A;  4P6Z M;  4WN5 A;  4EEU A;  1OTA A;  1YAX A;  2PDR A;  3EGD C;  3H82 A;  3MR0 A;  4DJ3 A;  5DF9 A;  1TF1 A;  3HJI A;  5I5L A;  3R7W A;  2ZMV A;  5HDD A;  3NJA A;  3CI6 A;  4HOI A;  1T18 A;  3EGX C;  1STZ A;  3C30 A;  4JGP A;  1TS7 A;  3D72 A;  4EU0 A;  3C8C A;  3K3C A;  3S7P A;  2A2L A;  4KUO A;  4WLA A;  5F68 A;  1LSW A;  2JKR I;  4R6L A;  4CLC E;  3G6O A;  4H6J A;  4Q0I A;  3T4Q A;  2O0Y A;  3T4O A;  2EWW A;  3MQ0 A;  3E0Y A;  3CWF A;  1MZU A;  3VOL A;  5A8B A;  2NUT C;  3B47 A;  4I39 A;  4WF0 A;  4L9G A;  3CUE A;  2FH5 A;  1LSV A;  2DMW A;  3OCN A;  4KUK A;  2W3H A;  4YOF A;  4GCZ A;  5TBM A;  1DP9 A;  2O99 A;  1P9W A;  4MDZ A;  5HDC A;  4B9O A;  4LRZ E;  1DRM A;  3F1P B;  4GS9 B;  1MC0 A;  3LR5 A;  1V9Y A;  3O5Y A;  2BAS A;  5F69 A;  3VV4 A;  4Y2F A;  3MXQ A;  1ZTU A;  2D01 A;  4DMZ A;  3RFB A;  1S66 L;  3D3O A;  4I5S A;  2XA7 M;  4I38 A;  3F1P A;  4GS9 A;  3MQO A;  4LRY C;  1EW0 A;  3NOT C;  2VV7 A;  2W1R A;  1BYW A;  3GEC A;  1NWZ A;  5DFX A;  2INW A;  3TRC A;  3R4K A;  4I3A A;  5DKL A;  4BBV A;  1F5M A;  3LR4 A;  3EEA A;  4JGQ A;  3LIF A;  4NKP A;  4M4X A;  2A24 A;  4HP9 A;  3TJZ C;  5HD3 A;  1YSQ A;  3E4P A;  2Z6D A;  1F98 A;  2V1A A;  1ZHH B;  2QKP A;  3S7N A;  4LLO B;  3F1N B;  5KSH A;  4WL9 A;  4JGR A;  3BY8 A;  4NXE A;  3OBF A;  4R3A A;  2XSS A;  2I9V A;  4MN5 A;  2XRO A;  4OOM A;  1LT0 A;  4GJ4 A;  2JKT I;  1VHM A;  1OPX A;  3KSH A;  4MN6 A;  4EXO A;  3VE3 A;  3H7W B;  3C38 A;  1H8M A;  3KSG A;  3MMH A;  2PYP A;  2J80 A;  5HDS A;  3F1O B;  5MC7 A;  3ULF A;  1JNU A;  3LR3 A;  1DP6 A;  1W63 M;  3LUQ A;  4EUV A;  1S4R A;  2LB9 A;  3JVV A;  4B93 A;  2W0N A;  4HP4 A;  4ARZ B;  3A0S A;  2OAP 1;  3K3D A;  4HJ4 A;  1LL8 A;  3IS2 B;  4NXB A;  1G6O A;  3CLO A;  2H28 A;  1YKD A;  2WKQ A;  5DJT A;  3UE3 A;  5J7E A;  2VJW A;  3HJK A;  3U2A A;  3ZYT A;  4HI4 A;  4LRX C;  4XT2 A;  2VX8 A;  3PBT A;  1TS8 A;  1T19 A;  4CLC B;  1XFQ A;  3LFV A;  5DJU A;  2CMN A;  3SW1 A;  3P7N A;  3IBJ A;  1OT9 A;  5G4Y A;  3E4O A;  4L9F A;  4NXF A;  4PKY A;  1IOU A;  2VLG A;  3NOU C;  3P01 A;  4O01 A;  2KDK A;  4HH3 A;  4IUK A;  5HWW A;  3LI9 A;  4GLQ A;  4BWI A;  4F3L A;  3FPV A;  2K2N A;  4G3V A;  1H3Q A;  3VE4 A;  2QJ7 A;  2QHK A;  3EEH A;  3T4S A;  2B02 A;  5HD5 A;  2PR5 A;  4GHI B;  2R78 A;  4L0L A;  4OOL A;  1F9I A;  4K08 A;  3RH8 B;  4HJ3 A;  2J3T C;  2W27 A;  3E4Q A;  4Q0J A;  5HWT A;  2A24 B;  2L4R A;  1VB6 A;  4GHI A;  2B18 A;  2OOL A;  3KO6 A;  4ZRR A;  4O8G A;  1GSW A;  3PBR A;  1TD5 A;  2W3G A;  1OTB A;  3BWL A;  1XJ3 A;  1UWP X;  5KIZ A;  2JKR M;  4BBT A;  1N9N A;  2XA7 S;  4I3I A;  3A0R A;  4EEP A;  4O0P A;  3NOP C;  5G4Z A;  2HV1 A;  3OOV A;  4CQH A;  3NHQ A;  2EA9 A;  4EER A;  2V9A A;  4CLC D;  3CIT A;  4L9E A;  2QJ5 A;  3S7Q A;  1S67 L;  1V9Z A;  3KYQ A;  2Z6C A;  3LIC A;  1GSV A;  2HJE A;  2O9C A;  2P08 A;  2K31 A;  2PR6 A;  2VV6 A;  5F5Y A;  5J4E A;  5J3W A;  4Q0H A;  4I3J A;  3IBR A;  5CX7 A;  4ME4 A;  4RQ9 A;  3BY9 A;  3R7W B;  3TE8 A;  4ETZ A;  3S7O A;  3EQU A;  3PXP A;  3DBA A;  4QPR A;  4YNR A;  4G3K A;  4IUH A;  2KX6 A;  4HIA A;  4WEK A;  2D02 A;  1X0O A;  4PKY G;  5IU1 A;  3OCL A;  3LR0 A;  1XJ2 A;  4WEL A;  1P97 A;  2ZOH A;  4ETX A;  3T4K A;  2JKT M;  2HJ9 C;  3PR6 A;  1NRJ A;  2GNX A;  3LIA A;  4BBU A;  2V0U A;  5C5K A;  2NUP C;  4EES A;  4NXG A;  4BJP A;  2PT7 A;  5HPF A;  3LYX A;  4IHQ A;  1P0Z A;  4FSF A;  3MFX A;  3CUE C;  2V0W A;  3PBO A;  3LID A;  3UMD A;  4HJ6 A;  2JHE A;  4UEY A;  4HQA A;  4Y3I A;  1S1Z A;  3C2W A;  4P6Z S;  3ZQ5 A;  4R70 A;  3B33 A;  2KLI A;  3UB8 A;  2ZBB A;  3UE6 A;  4YWZ A;  1D06 A;  3UB7 A;  1OT6 A;  5DKK A;  5HWV A;  3T4J A;  3H7W A;  1IFQ A;  2W3E A;  2VGL S;  2G7U A;  2J3W A;  1Y28 A;  4DN0 A;  5AJG A;  4Y5F A;  3ICY A;  3UB6 A;  3MQQ A;  1XJ4 A;  5HSQ A;  3LIB A;  3TW8 A;  2HF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...