5DJUA

Crystal structure of lov2 (c450a) domain in complex with zdk3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
145
Chain Sequence
GSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Engineered protein, Zdk3 affibody
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
total genus 48
structure length 145
sequence length 145
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5djuA00
5HWVA 4HHDA 3MQOA 2KX6A 4NXEA 5TBMA 3C2WA 5DJUA 1BYWA 3UB8A 4GS9B 1EW0A 1LSVA 5F68A 4EESA 1N9LA 3UB9A 3H9WA 3D72A 4I39A 2V1BA 2K7SA 5HDSA 1Y28A 2W0NA 5EFWA 2ZBBA 1T19A 4LLOB 2ZOIA 3CLOA 3E4QA 5HZHA 3RTYA 4R70A 5J4EA 5J7EA 3A0RA 2V1AA 4DJ3A 4GS9A 2H28A 3F1OA 4GCZA 1MZUA 4GHIB 4HJ3A 3MFXA 3UB6A 4XT2B 3NOTC 5HSQA 1OTDA 2VV7A 2PD7A 2PYPA 3P7NA 4WN5A 2VLGA 1T1CA 3SW1A 2ZOHA 4NXFA 4GHIA 3UE6A 2M1CA 2KDKA 5HD3A 3IS2B 2PYRA 4HQAA 3LIDA 4HNBA 1S1YA 4EEPA 2L4RA 3H82B 1F9IA 4MN5A 3NHQA 5IU1A 3UMDA 3EWKA 3C8CA 1GSXA 1TS7A 3FC7A 4RQ9A 2WKPA 4HIAA 2V9AA 5A8BA 4EW7A 5IS1A 4WL9A 2Z6DA 2J80A 1S66L 3UB7A 2OOLA 4EXOA 4WLAA 5DKLA 5F6AA 3IS2A 4HI4A 2Z6CA 5J3WA 3GDIA 1LSWA 4E04A 4JGQA 3H82A 2B02A 3F1OB 1V9ZA 3LI8A 3LIFA 2QWSA 1TS6A 1OTAA 4PKYG 1XJ6A 1XFQA 4EQ1A 2EA9A 3NOUC 2VV6A 4PKYA 5AVFA 2QJ5A 3VE3A 5HDCA 4L9GA 4R38A 1LT0A 1VB6A 2JN7A 3MJQA 2L0WA 4HH3A 3ULFA 1D7EA 4BBTA 1UWNX 5G4YA 5HWTA 1TS8A 1XJ3A 5AVEA 3HJKA 1OTEA 1WA9A 4LRXC 4DJ2A 3PYPA 3BWLA 4JGPA 2OWJA 3A0VA 1TS0A 5DJTA 1OJGA 1XJ2A 3G6OA 3F1PB 1T18A 1UGUA 3A0SA 5I5LA 4LPZA 2WKQA 2YKFA 3E4PA 4B9OA 2A24B 3VE4A 2YKHA 4I38A 4LRZE 1UWPX 3LIAA 3EEHA 1F98A 3OLOA 4BBVA 4WUJA 4L9EA 2VV8A 4HH2A 3PHYA 3T50A 3F1PA 4GW9A 1S67L 4K08A 4EEUA 2V0UA 3K3CA 4HJ6A 4YWZA 3BY9A 4HP4A 1N9OA 3FG8A 2D01A 3MQQA 1KOUA 4KUOA 3LUQA 1DP8A 1T1BA 3MR0A 2A24A 4HP9A 4HOIA 5DKKA 1DP9A 2P7JA 1G28A 3KX0X 1OT6A 1V9YA 4HJ4A 2WKRA 2PHYA 2PR6A 1GSVA 1JNUA 1OT9A 4R6LA 3NOPC 5HD5A 2L1MA 3CWFA 3MXQA 1LL8A 1S4SA 4L9FA 4M4XA 4H6JB 3LICA 2CMNA 2PR5A 2JHEA 1LSXA 2V0WA 3B33A 4MN6A 2VEAA 3LIEA 4I5SA 4HY8A 2GJ3A 1XJ4A 3IBRA 3K3DA 4R3AA 4BBUA 3LYXA 4EERA 2QKPA 3H7WB 3VOLA 5KIZA 1ODVA 4H6JA 4LRYC 4WF0A 4JGOA 4NXGA 5F69A 2R78A 2QJ7A 2W27A 2QHKA 4KUKA 3UMEA 3GECA 1OTBA 1X0OA 4KQDA 4F3LB 2PD8A 3F1NB 1P0ZA 5F5YA 1DRMA 3LIBA 3RH8B 3H7WA 1N9NA 3BY8A 5HWWA 1D06A 3CAXA 2I9VA 3E4OA 1OTIA 5G4ZA 4NXBA 1NWZA 5HDDA 2PDRA 1OJ5A 2OWHA 4XT2A 1S4RA 5TBMB 2D02A 1T1AA 4F3LA 1S1ZA 2HV1A 3LI9A 1P97A 3HJIA 3F1NA 4JGRA 3ICYA 3ZQ5A 4I3AA 1XFNA 2BASA 2INWA 4I3IA 1GSWA 1DP6A 3NJAA 4EETB 4I3JA
chains in the Genus database with same CATH superfamily
4LV2A 5M1AA 1K56A 3MQOA 3IT9A 3E0YA 1ALQA 2DCFA 3P09A 4OQGA 1MKMA 3KSHA 1ONHA 3G2ZA 4E3OA 3EQUA 4GS9B 5FEFA 4CLCE 1VETB 4B93A 1LSVA 1DY6A 1BLPA 3IWIA 2XD5A 1FILA 3S7PA 3SH9A 1WYBA 2V1BA 3RFBA 2K7SA 2ZQCA 3BQAA 4HEFA 4X56A 1C3BA 1EROA 3BM6A 1OMEA 1YMXA 1CJFA 2V2FF 2ZOIA 2VGLM 4NKPA 5FAQA 1CEGA 3RTYA 2Q9NA 3O87A 2CC1A 2Y91A 1K38A 3MQ0A 1FR1A 1LL5A 1YM1A 5D3OA 4KG2A 2WGIA 3A3JA 4E3MA 4S2KA 1IYPA 3F1OA 5HPFA 4KQRA 4QU3A 2XDMA 4GHIB 3VP0A 3BLSA 4XT2B 4CLCB 3MXSA 2HP9A 4Q0HA 2PYPA 3P7NA 2WKHA 5DTTA 2WAEA 3IQAA 5EM0A 4DXCA 3TOIA 5E2HA 1ZKJA 3V50A 3N6IA 2ZOHA 4DKIA 2GX5A 2G2WA 3ZG0A 2M1CA 5HD3A 4PAUA 2OV5A 2Z2MB 1K57A 4ZJ2A 5DF9A 5AQAA 1DJCA 3V5MA 1G6OA 2L4RA 1K4EA 3UE0A 4ZBEA 3UMDA 3KSFA 1YSPA 1NRJA 2FH5A 3PXPA 3FKWA 4FD8A 4G3VA 1TS7A 3IBJA 2JKTM 5K5BA 1PWGA 4OPRA 4WL9A 2J80A 4IEDA 5F6AA 4ZRRA 2Z6CA 4PHTA 2JKRI 5I94A 3LEQA 3H82A 1RCJA 1GA9A 1NZOA 2B02A 3F1OB 2VJWA 1FIKA 2X02A 5U47A 1LL9A 3GMWA 2B5RA 3PBTA 1ACFA 2Y59A 1Q2QA 2FFYA 4X1MA 4P6ZS 1YMSA 4M3KA 3R4KA 4EQ1A 2ZC5B 3BFDA 5AVFA 3MSHA 2QJ5A 1HD8A 3QP8A 3VE3A 4L9GA 4R38A 2ZQ7A 5HAQA 1LT0A 3ZG7B 3FWLA 2K31A 1NY0A 4GJ4A 3MZEA 3ULFA 1UWNX 4NETA 2JKGA 5EOOA 1H8MA 2Y2LA 5FSRA 2Y2QA 5TFQA 3ZVTA 3QP6A 3T4SA 4KQQA 5M19A 4DE0A 4GKUA 4KZBA 4N9KA 4OP8A 1KDWA 2XROA 4C3QA 5FAOA 1TS0A 3M2KA 4B88A 1OJGA 1PZPA 3NULA 3WS1A 4EBLA 1ESIA 4H8RA 3UE3A 1HZOA 2ZMVA 3E4PA 4QY5A 4Y7PA 4PPRA 5TR7A 2M7VA 2A24B 5EPHA 2YKHA 5L07A 4YNRA 2V1ZA 4I38A 3NECA 3IWQA 3PBRA 1UWPX 3QP2A 1F98A 3HREA 1QMEA 4KG5A 3T1SA 4BJPA 4WUJA 4HH2A 5FI6A 5FATA 5DTSA 1S67L 2IWBA 4K08A 3VSKA 3GV9A 4EQIA 2OAQ1 1N9OA 3MZDA 2D01A 3MQQA 5GLAA 3ZVWA 1T1BA 4NK3A 3MR0A 4HP9A 1DJBA 1HVBA 2W3FA 2DNSA 2K2NA 3HUNA 1ESUA 3OCNA 3IF6B 4BD0A 3S4XA 2Y2GA 1V9YA 4UEYA 1FCMA 2VZWA 3HLBA 5AJGA 2PHYA 2Y2MA 1GSVA 4Y17A 4R6LA 1LLBA 3NOPC 5KMWA 4Z1WA 1Y54A 1L0GA 1H8ZA 3CJMA 1W63M 3NDGA 4QPRA 3UY6A 3CUEA 1IKIA 2JE5A 2Y2HA 2E8IA 2Q0OA 5EECA 2PR5A 2VGKA 2JHEA 1PIOA 2KLIA 2HJEA 1LSXA 3WWXA 3B33A 4GD8A 1U60A 4L0LA 5L2FA 2HP6A 3LIEA 1AXBA 1XJ4A 4HBUA 3LYXA 4IUKA 4EERA 4KZAA 2PU2A 1I2SA 2GZAA 5KIZA 1ODVA 2W3DA 4H6JA 4JGOA 4ESPA 2H0YA 2QHKA 4OKPA 3GECA 3S7NA 3OCLA 2NUPC 4S2OA 1YT4A 2PD8A 2VGLS 1BULA 2XR0A 1YLPA 5EOEA 1BLSA 1WE4A 3LIBA 5KZHA 3P98A 1TEMA 3M6BA 3H7WA 1N9NA 3GTCA 2Y2NA 1D06A 3CAXA 5FI2A 4MMNA 3E4OA 1PRQA 4OVDA 1OTIA 5F82A 3UE1A 1IFQA 5G4ZA 4NXBA 5FASA 3W4OA 3L7HA 1F2KA 1JWPA 1P9RA 1PI4A 4LCLA 2HV1A 3HJIA 3IXGA 1LI0A 4JGRA 1A0KA 3BRMA 2EWWA 3MF0A 3KSIA 4KZ9A 3MBZA 2ZC3B 4I3AA 4JXGA 3LGOA 1XFNA 3TW8A 1GSWA 1DP6A 1MWTA 2C5WB 4I3JA 2BTFP 5EV0A 1M40A 4HHDA 4IBRA 2WGWB 2KX6A 4MEZA 4NXEA 3FV7A 2J3WA 2PBYA 4EBNA 1XPBA 1K25A 1YLTA 1TDLA 1Z09A 2PT7A 5CXWA 4IHQA 1BYWA 3NDEA 3SS5A 3RXWA 3HLGA 4Q0JA 5E43A 3R7WB 4WMCA 3VP2A 5CGXA 3SOIA 1E3UD 1HLUP 3Q82A 3TE8A 1YLYA 1G5UA 1W63Q 4I39A 5HDSA 3HLDA 4OQHA 4BL3A 2W0NA 2ZQDA 4Y13A 3M2JA 4S2NC 1T19A 3E4QA 3LEZA 2Y2PA 5J4EA 4NG2A 4GS9A 4X6TA 2ZLYA 3UO9A 5FL3A 2IWDA 4KENB 4LGWA 1E4DA 4HJ3A 1L0DA 2XFTA 5HSQA 5CEDA 5DFYA 5DVAA 2HZ5A 5L8MA 3IH9A 1IYQA 4E6WA 2VLGA 4BWIA 3JYIA 2Z2LB 4LV0A 2ZQ8A 4NXFA 5EVLA 4XUZA 4O8GA 4QD4A 2EX8A 4GHIA 4S2LA 1QMFA 3UE6A 4G3KA 1ERMA 3BECA 4CLCA 4Y0TA 1YKDA 2Y79A 3IS2B 4GDBA 3T1XA 4HNBA 3I7JA 3G4PA 2XK1A 1F9IA 1Q2PA 2JKRM 3NHQA 1IOUA 3T4LA 3A3FA 3E98A 3GQZA 5FQIA 3C8CA 1GSXA 2JBFA 2WKPA 2V9AA 3NY4A 2OSUA 2WAFA 5A93A 3PTEA 3ZG5A 3DTEA 4P85A 1IEMA 2Z6DA 3UB7A 2OOLA 4EXOA 3O3VA 1W8QA 4HI4A 1PI5A 5J3WA 5HAIA 1MXOA 5EVID 3E2LA 1ZG6A 3NIAA 4DMZA 3LI8A 2J7VA 4Q8IA 3FPWA 1TS6A 1FCOA 1GHPA 4PKYG 3WS4A 1BSGA 3UPNA 3Q81A 3ZG9B 1BT5A 3KO6A 3NOUC 4R0QA 1SHVA 5HDCA 3MJQA 4X25A 4JKTA 4HH3A 4KQOA 3EGDC 4YINA 5G4YA 2V20A 2EXBA 5JYOA 3UNWA 2VGJA 2UV0E 1KE3A 2ZQ9A 3HJKA 1OTEA 5EVIC 3UDFA 4RX3A 4DDYA 2VX8A 3PYPA 4KZ8A 2WKIA 3DBAA 4JGPA 3S22A 4FTXA 4ZTKA 3TJZC 2EWVA 1YQSA 5CTNA 5DJTA 3UB5P 3IHBA 2KOIA 3CPTB 3HLFA 3G6OA 3T1QB 3A0SA 3T4JA 1VM1A 5I5LA 4ID4A 3B47A 5G18A 3UN7A 3LFVA 4N9LA 3DW0A 1I5QA 5HFOA 4KZ5A 3LIAA 2GDNA 2Y2KA 3T4KA 3OLOA 4BBVA 2H0TA 4CPKA 3DWKA 4GD6A 4L9EA 2HP5A 1KGEA 3IX4A 3T50A 4EV4A 3QNCA 4EEUA 1N4OA 3OPPA 3K3CA 2UWXA 2C6WB 2XA7M 3BY9A 4WEKA 1KE4A 3VOYA 1KOUA 3IHAA 4NEED 4JPMA 2XD1A 3ZGAB 2A24A 3SH8A 3CITA 4Y2FA 3EEAA 2XH9A 3KX0X 5L10A 5FAPA 1OT6A 1VEUB 2ZC4B 2P04A 4A5RA 1H5XA 4GZBA 1JNUA 1JTGA 4KZ4A 1OT9A 1VQQA 5GLBA 4X53A 5HD5A 2G2UA 4BD1A 1XP4A 4L9FA 4YFMA 5FQKA 3PBOA 4RA7A 4ARZB 1H8YA 1ES4A 3SS4A 2HDUA 4P0MA 1TDGA 3IF6A 3MZFA 3C4PA 3D4FA 2V0WA 4HBTA 1N9BA 4KG6A 3PR6A 2AVXA 3BFCA 5CHJA 4OLDA 5HAPA 4ME4A 3GVBA 4LV1A 3WS5A 3K3DA 2J9PA 4R23A 1P9WA 2X71A 3MMHA 3N7WA 5CGWA 4LRYC 3TRCA 3FPVA 3BFGA 4NXGA 5CHMA 3FKVA 3E2KA 4DE1A 4FH2A 3WS2A 2QJ7A 3N8LA 3JVVA 4ETZA 3HUOA 4WYYA 1YAXA 1SKFA 1X0OA 4KQDA 5FQJA 4U0XA 3A3IA 3F1NB 4OOYA 4BMWA 5F5YA 1SCWA 3QP4A 1DRMA 2B18A 4PM8A 4Y15A 2HDSA 4X55A 3BY8A 5GL9A 1K6SA 5HWWA 5EVIB 3CUEC 2ZC6B 2I9VA 2X01A 3AGEA 3ISGA 2PRFA 1YPRA 5HDDA 5HPIA 3BW6A 2ZJ9A 1CI9A 2XSSA 1OJ5A 2OWHA 5TBMB 1S4RA 2D02A 4X68A 1NLZA 3BFEA 3LI9A 4WBGA 3PAEA 4BL2A 1ERQA 3EQVA 5FQ9A 3ZQ5A 5DFXA 5DF8A 1GHIA 1K6RA 4QY6A 3V3RA 2INWA 1KVMA 3HL9A 4DDSA 3U4LP 4FCFA 4QJGA 1J9MA 4BQMA 4DE3A 4R4SA 3U2AA 4KZ6A 1MBLA 1STZA 4PM5A 5CHUA 3C2WA 1S0WA 5TJJA 2XRNA 3BQ8A 3KYZA 4OQ0A 2W3EA 2Y8HA 2Y2OA 5E2EA 1MWRA 5CTMA 2J3TD 5F68A 2EXAA 1M6KA 4EESA 1CQAA 3G31A 3UB9A 4GNUA 2HPBA 1Y28A 4PMAA 2HDQA 3G30A 5A90A 3IH8A 1O7EA 5EFWA 3W2ZA 3ITBA 2ZBBA 3ZNTA 1K55C 2WGWA 4G3WA 3CLOA 2V8CA 3C38A 4JBFA 3T4QA 4R70A 3RXXA 3OPHA 2EFUA 2V1AA 4DJ3A 2H28A 3R7WA 4P6BA 2HJ9C 3VP1A 3C7UA 1YLWA 1G68A 3UB6A 3NOTC 2J3TC 1ZG4A 2LB9A 3Q07A 2VV7A 3BYDA 1GCEA 4JF5A 4OQIA 3HVFA 1MPLA 1CF0A 3W4PA 4D2OA 3AGFA 3VFFA 2WYXA 2PU4A 4FSFA 2IA2A 1NJ4A 4Y0UA 3SZTA 3QHYA 3A3DA 4OH0A 1Z6FA 1AWIA 1WYCA 1IYSA 1CK3A 2Y4AA 4N1HA 2Q9MA 4O0PA 4IVKA 2PYRA 4HQAA 4DN0A 4IVIA 3LIDA 1G6AA 3C4OA 4MN5A 2OAP1 3G35A 5CX7A 2ZMFA 4GOGA 3DAVA 3GSGA 2GNXA 2WZZA 4Y3IA 3FC7A 4HIAA 4OPYA 1XXMA 3OPLA 4EW7A 2W3HA 3GRJA 2Y2JA 1ES5A 2DMWA 1K54C 1YLZA 1S66L 2XEPA 5FDSA 5CECA 2VA0A 2H5SA 3KYQA 5DKLA 3VP3A 1PW8A 3IS2A 3VP4A 1FQGA 2JC7A 4JGQA 1BLHA 3T4OA 4EUZA 3CHWP 4MNRA 1I2WA 1NYMA 4Y5FA 3DTIA 1V9ZA 3LIFA 2QWSA 2XA7S 1OTAA 3CI6A 4EBPA 1DJAA 4O01A 5A92A 4S2IA 1XJ6A 2A2LA 3NCKA 2EA9A 4PKYA 4WZ5C 2VK3A 5AQBA 1PNEA 2JN7A 3BJNA 4E3LA 3IF5A 4UQIM 4FH4A 5EUAA 2HF6A 3DTKA 1TS8A 1L0FA 5CRFA 2I72A 2O99A 1RGYA 4OOMA 4LRXC 3BWLA 2R9XA 1CEFA 3T12B 3M6HA 4D60A 3A0VA 1XJ2A 3EOIA 3F1PB 2W1RA 1T18A 3OBFA 3V67A 3OZHA 1XKZA 2WADA 1JWZA 4RX2A 2WKQA 3ZG8B 4LV3A 3HBRA 3A3EA 4B9OA 3VE4A 4R3BA 3LR5A 1W5DA 4LRZE 3HLWA 2WZXA 4DXBA 5MC7A 4IUHA 3PHYA 1JTDA 3FZCA 3CPTA 2W1TB 4KZ7A 4S2NA 3G34A 2EX9A 3C5AA 4HJ6A 4EWFA 4OPZA 4GDNA 3FG8A 3D3OA 1DP8A 2DRWA 5BOHA 2R9WA 4HOIA 2OLVA 5DKKA 3VFHA 1G28A 4O7DA 1CI8A 3K2NA 1S6RA 4UAAA 3JPUA 5HL1A 4HJ4A 3Q7VB 1E3UA 3W8KA 2WKRA 2PR6A 2ZD8A 5FA7A 1K4FA 4S2JA 1L2SA 3VOZA 1JVJA 3IX3A 4JXSA 3HLEA 2L1MA 3LO7A 4QHCA 3CWFA 1H0MA 1YSQA 4M4XA 1LHYA 2P9VB 2ZL1B 1XX2A 3O86A 3LICA 1K57C 4F94A 4GB7A 3LCEA 4FOFA 4UA6A 2XLNA 1VEUA 2WKEA 1BUEA 4WEJA 4MN6A 3V3SA 2BLSA 3UPPA 3HCYA 3SS3A 3MKEA 3KYEA 4I5SA 4OOLA 1SKOB 2ZM8A 4BBUA 3W4QA 4CQHA 2O9AA 3IWOA 4GLQA 4HESA 2G7UA 1TVFA 3N8SA 3IX8A 4ARZA 5C5KA 4OPQA 4JLFA 4R4RA 1FR6A 5E2GA 2R78A 4X69A 3UMEA 2JKFA 4F3LB 3JVUA 4JXWA 4R3JA 2QMIA 4E3NA 4E3IA 4BLMA 3LY4A 4S2PA 3PBNA 4MN7A 4EUVA 3VSLA 3OC2A 3HLCA 3O88A 5HL6A 3UPOA 4DF6A 1L3LA 1NWZA 3IF6C 1EWZA 2PDRA 4MBFA 2RCXA 4ZAMA 2EX6A 5E2FA 3F1NA 2QYBA 1TD5A 1PYYA 2PBDP 3ICYA 4JF4A 5F1GA 3DTMA 5FQQA 1FCNA 3AGDA 3QP1A 3LR3A 1OPXA 2Y2IA 3IXHA 5EVIA 3NJAA 4EETB 1W79A 5HX9A 5HWVA 1KE0A 4Y0OA 1ZC2A 5HW3A 3BEBA 1NRFA 3T1RA 1NZUA 5TBMA 5A91A 1HTZA 4IJGA 5DJUA 5FI7A 3UB8A 1EW0A 3WRZA 1N9LA 3H9WA 3D72A 4UHUA 3B42A 2JCHA 2E8JA 3T4TA 4LLOB 1ES3A 1MWUA 5HZHA 4LENA 5DTKA 2A49A 5J7EA 3A0RA 1Y4OA 5GHXA 5GHZA 1FSYA 3UDXA 2WK0A 4S2MA 4GCZA 3P01A 3O5YA 1MZUA 3IXBA 1KDSA 2O9BA 3VV4A 2NUTC 3MFXA 2PAVP 4AFIA 1OTDA 4EU0A 4LFUA 2PD7A 1FOFA 4E3JA 1PWCA 3C7VA 4WN5A 4UQIS 3ZFZA 2VKSA 1GA0A 2J9OA 1T1CA 3MKFA 5LBRA 1NLYA 2HGVA 4XUXA 5EVEA 3Q1FA 4OP5A 2KDKA 3C30A 4MCWA 2ZC7A 3VMAA 3BLMA 1JWVA 3BFFA 1S1YA 4EEPA 3H82B 4XXRA 4C75A 3N8RA 5IT5A 4C6YA 5IU1A 3ZDJA 2J8YA 3EWKA 4WM9A 2H10A 3ZCZA 4KZ3A 4RQ9A 5A8BA 4R1GA 5IS1A 3LY3A 4N1XA 4Z9QA 2XFSA 4WLAA 4YOFA 1F5MA 1O07A 3GDIA 1LSWA 4E04A 4K91A 3G32A 3MS6A 4ETXA 5JYPA 3FYZA 5TGFA 2JKTI 1W7FA 5HARA 5KSCA 1W8YA 2LB5A 1XA1A 5FEGA 2QZ6A 1XFQA 1BLCA 2VV6A 4LCMA 2XF3A 4WMCD 5AQ9A 1VB6A 2P08A 1SZVA 2L0WA 4IBXA 1D7EA 4BBTA 1PWDA 2QPNA 1IKGA 1MY8A 5HWTA 2ZM2A 1XJ3A 1NXYA 2HDRA 5AVEA 4CJNA 5DF7A 5KSHA 2RL3A 3WRTA 3MFDA 5F83A 1WA9A 1EI5A 3G2YA 1H3QA 3TG9A 5FQMA 4DJ2A 3WS0A 4P87A 2EX2A 1PZOA 2OWJA 1ZTUA 4QWOA 5F1FA 5IHVA 1IYOA 3NI9A 3ZNYA 1UGUA 4LPZA 4FUWA 1L0EA 2YKFA 5GLDA 2WGVA 2XQZA 4PM7A 1IELA 4QB8A 4ZJ3A 4U3TA 3EEHA 2FFFB 4GN2A 3LR4A 3LR0A 2M7UA 1MC0A 2VV8A 3CZDA 4MDZA 4BENA 3F1PA 1K55A 4GW9A 5AQ7A 2W3GA 1KGGA 4MBKA 2MJ6A 5EM1A 2V0UA 4Q0IA 4YWZA 4HP4A 4DRTA 3CMZA 4JXVA 4CLCD 4KUOA 3LUQA 4P6ZM 1ES2A 4U0TA 2OLUA 1DP9A 2P7JA 1RGZA 1K0KA 1XA7A 4K0XA 4MBHA 3HUMA 1VHMA 3B3XA 4B4XA 2ZMAA 2W1TA 1XGJA 1K56D 3ITAA 3QP5A 3N4IA 3CG5A 4WZ4A 3PBSA 3MXQA 5M18A 3PAGA 3V39A 1LL8A 1S4SA 3IXDA 5FDHA 5CEBA 5L09A 2P74A 3OPRA 1GHMA 4H6JB 4CLCC 1ZHHB 5CERA 2CMNA 1KVLA 5GHYA 3S7QA 4RYEA 3Q7VA 4OLGA 4JF6A 3TSGA 1SDEA 2Y55A 2ZM0A 2VEAA 3QNBA 1XGIA 4HY8A 2GJ3A 3IBRA 2EFXA 1KGFA 4R3AA 2QKPA 4DE2A 3H7WB 3VOLA 3S1YA 1VETA 2P9VA 2ZL1A 4MLLA 4PM6A 4WF0A 2IWCA 3UDIA 5F69A 3NBLA 2XGNA 1K54A 1J3WA 1RP5A 2B95A 2W27A 4KUKA 2ZQAA 3MXRA 4OONA 1OTBA 3OOVA 1LI9A 2FZ0A 3DWZA 5GLCA 4II7A 1P0ZA 1TF1A 4UA9A 1SKOA 4UA7A 3RJUA 4E3KA 1PFLA 2BG1A 3RH8B 1MWSA 1BZAA 1FSWA 2A3UA 1PW1A 3PBQA 1ONGA 1YLJA 1SDNA 4WELA 3SH7A 4ZDXA 3L9KA 2V8FA 1MKIA 3Q7ZA 4B4ZA 4WZ5A 4XT2A 4E6XA 1T1AA 4F3LA 1S1ZA 5J8XA 1P97A 2O9CA 5EE8A 2O0YA 3NC8A 1BTLA 4N92A 4RVAA 3ZYTA 3ZHHA 1D1JA 3D9YA 4ZJ1A 3S7OA 3GR2A 3KSGA 5CGSA 3EGXC 1E25A 2WUQA 4PM9A 1NYYA 2ACGA 4X1LA 2BASA 4I3IA 4K0WA 3SW1A
chains in the Genus database with same CATH topology
5HWVA 4HHDA 3U2AA 3MQOA 2KX6A 1STZA 3E0YA 4NXEA 2J3WA 5TBMA 3C2WA 1MKMA 4IJGA 3KSHA 5TJJA 5DJUA 2PT7A 4IHQA 2XRNA 3BQ8A 1BYWA 3EQUA 3UB8A 3KYZA 2W3EA 2Y8HA 4GS9B 4CLCE 4B93A 4Q0JA 3R7WB 1EW0A 1LSVA 2J3TD 5F68A 4EESA 3TE8A 3S7PA 1N9LA 3UB9A 3H9WA 1W63Q 3D72A 4I39A 2V1BA 3RFBA 2K7SA 5HDSA 1Y28A 3BQAA 2W0NA 3B42A 5EFWA 3T4TA 3W2ZA 2ZBBA 4G3WA 1T19A 4LLOB 2ZOIA 3CLOA 3E4QA 2VGLM 4NKPA 5HZHA 3C38A 3RTYA 3T4QA 4R70A 5J4EA 5J7EA 3A0RA 3MQ0A 2V1AA 4DJ3A 4GS9A 2H28A 3R7WA 3F1OA 4GCZA 5FL3A 5HPFA 2HJ9C 3O5YA 3P01A 1MZUA 2O9BA 4GHIB 3VV4A 4HJ3A 2NUTC 3MFXA 3UB6A 4XT2B 3NOTC 2J3TC 4CLCB 5HSQA 4AFIA 2LB9A 1OTDA 5DFYA 4EU0A 2VV7A 4Q0HA 2PD7A 5L8MA 2PYPA 3P7NA 4WN5A 2VLGA 4BWIA 4UQIS 4FSFA 2IA2A 2VKSA 1T1CA 3SW1A 2ZOHA 4NXFA 5LBRA 4O8GA 1NLYA 2GX5A 2HGVA 4GHIA 3UE6A 2M1CA 2KDKA 4G3KA 5HD3A 4PAUA 3C30A 4CLCA 4MCWA 4O0PA 1YKDA 2Y79A 3IS2B 5DF9A 2PYRA 4HQAA 4DN0A 3LIDA 4HNBA 1G6OA 1S1YA 2L4RA 3H82B 4EEPA 5IT5A 1F9IA 4MN5A 2OAP1 2JKRM 3NHQA 5IU1A 3UMDA 1IOUA 3KSFA 3T4LA 1YSPA 1NRJA 5CX7A 2FH5A 2ZMFA 3EWKA 3PXPA 3E98A 2GNXA 4G3VA 3C8CA 1GSXA 1TS7A 3IBJA 4Y3IA 3FC7A 4RQ9A 2WKPA 4HIAA 2JKTM 2V9AA 5A8BA 5K5BA 4EW7A 5IS1A 2W3HA 2DMWA 4WL9A 2Z6DA 2J80A 1S66L 3UB7A 2VA0A 2OOLA 4EXOA 4WLAA 4YOFA 3KYQA 5DKLA 5F6AA 3IS2A 4HI4A 1F5MA 4ZRRA 2Z6CA 4PHTA 5J3WA 2JKRI 3GDIA 1LSWA 4E04A 4JGQA 3H82A 3T4OA 2B02A 4Y5FA 3F1OB 2VJWA 4ETXA 1V9ZA 4DMZA 3LI8A 3LIFA 2QWSA 3FPWA 1TS6A 2JKTI 2XA7S 1OTAA 3CI6A 3PBTA 4O01A 4PKYG 4P6ZS 2LB5A 1XJ6A 2A2LA 3R4KA 1XFQA 4EQ1A 2EA9A 3KO6A 3NOUC 2VV6A 4PKYA 5AVFA 2QJ5A 3VE3A 5HDCA 4L9GA 4R38A 1LT0A 1VB6A 2JN7A 3MJQA 2P08A 3BJNA 2K31A 4GJ4A 2L0WA 4HH3A 4KQOA 3EGDC 4UQIM 3ULFA 1D7EA 4BBTA 1UWNX 2HF6A 5G4YA 5HWTA 1TS8A 1XJ3A 1H8MA 5AVEA 5KSHA 3HJKA 3T4SA 1OTEA 2O99A 1WA9A 4OOMA 4LRXC 1H3QA 2VX8A 4DJ2A 3PYPA 3BWLA 3DBAA 4JGPA 2XROA 2OWJA 1ZTUA 3TJZC 2EWVA 3A0VA 1TS0A 5DJTA 1OJGA 1XJ2A 3EOIA 2KOIA 3G6OA 3F1PB 2W1RA 1T18A 3OBFA 1UGUA 3A0SA 3T4JA 3V67A 5I5LA 4LPZA 3B47A 3UE3A 2WKQA 2YKFA 3LFVA 2ZMVA 3E4PA 2M7VA 2A24B 3VE4A 4B9OA 3LR5A 2YKHA 4YNRA 4I38A 4LRZE 3PBRA 1UWPX 3LIAA 3EEHA 1F98A 3T4KA 3OLOA 4BBVA 3LR4A 4BJPA 4WUJA 3LR0A 5MC7A 4L9EA 2M7UA 4IUHA 1MC0A 2VV8A 4HH2A 3PHYA 4MDZA 2W1TB 3T50A 3F1PA 4GW9A 1S67L 2W3GA 4K08A 4EEUA 2MJ6A 2V0UA 3K3CA 4HJ6A 4Q0IA 4YWZA 2XA7M 3BY9A 2OAQ1 4HP4A 1N9OA 4WEKA 3FG8A 2D01A 4CLCD 3MQQA 1KOUA 4KUOA 3D3OA 3LUQA 1DP8A 4P6ZM 4NEED 1T1BA 3MR0A 2A24A 4HP9A 4HOIA 2W3FA 3CITA 5DKKA 1DP9A 2P7JA 4Y2FA 2K2NA 3EEAA 1G28A 3K2NA 3KX0X 3OCNA 1OT6A 1VHMA 1V9YA 4UEYA 4HJ4A 2VZWA 2P04A 2WKRA 5AJGA 2PHYA 2PR6A 2W1TA 1GSVA 1JNUA 1OT9A 4R6LA 3NOPC 4Z1WA 5HD5A 2L1MA 3PBSA 3CWFA 3MXQA 1YSQA 1LL8A 1S4SA 4L9FA 4M4XA 1W63M 4QPRA 3CUEA 3PBOA 4H6JB 4CLCC 4ARZB 1ZHHB 3LICA 2CMNA 2PR5A 2JHEA 2KLIA 2HJEA 3S7QA 1LSXA 2V0WA 4FOFA 3B33A 3PR6A 4L0LA 4WEJA 4MN6A 2VEAA 3HCYA 4ME4A 3LIEA 4I5SA 4HY8A 2GJ3A 1XJ4A 4OOLA 3IBRA 3K3DA 4R3AA 1P9WA 3MMHA 4BBUA 3LYXA 4IUKA 4EERA 4CQHA 2O9AA 2QKPA 3H7WB 3VOLA 4GLQA 2GZAA 5KIZA 2G7UA 1ODVA 2W3DA 4H6JA 4LRYC 4WF0A 4ARZA 3TRCA 5C5KA 3FPVA 4JGOA 4NXGA 5F69A 2R78A 2QJ7A 2W27A 2QHKA 4KUKA 3JVVA 3UMEA 3GECA 1OTBA 3OOVA 4ETZA 3S7NA 1YAXA 3OCLA 2NUPC 1X0OA 4KQDA 4F3LB 3JVUA 2PD8A 2FZ0A 2VGLS 3F1NB 4II7A 1P0ZA 4BMWA 1TF1A 5F5YA 1DRMA 2B18A 3LIBA 3RH8B 3H7WA 1N9NA 3BY8A 5HWWA 3PBNA 4MN7A 4EUVA 3CUEC 1D06A 3CAXA 2I9VA 3OC2A 3PBQA 4MMNA 3E4OA 4WELA 5HL6A 1OTIA 1IFQA 5G4ZA 4NXBA 1NWZA 5HDDA 5HPIA 3BW6A 2PDRA 2XSSA 1OJ5A 2OWHA 4XT2A 1S4RA 5TBMB 2D02A 1P9RA 1T1AA 4F3LA 1S1ZA 2HV1A 1NLZA 3LI9A 1P97A 2O9CA 3HJIA 2O0YA 3F1NA 2QYBA 3ZYTA 1TD5A 4JGRA 3ICYA 3EQVA 3S7OA 3KSGA 2EWWA 3ZQ5A 3MF0A 3EGXC 3KSIA 5DFXA 3LR3A 4I3AA 1OPXA 1XFNA 3TW8A 2BASA 2INWA 4I3IA 1GSWA 1DP6A 3NJAA 4EETB 4I3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWV A;  4HHD A;  3MQO A;  2KX6 A;  4NXE A;  5TBM A;  3C2W A;  5DJU A;  1BYW A;  3UB8 A;  4GS9 B;  1EW0 A;  1LSV A;  5F68 A;  4EES A;  1N9L A;  3UB9 A;  3H9W A;  3D72 A;  4I39 A;  2V1B A;  2K7S A;  5HDS A;  1Y28 A;  2W0N A;  5EFW A;  2ZBB A;  1T19 A;  4LLO B;  2ZOI A;  3CLO A;  3E4Q A;  5HZH A;  3RTY A;  4R70 A;  5J4E A;  5J7E A;  3A0R A;  2V1A A;  4DJ3 A;  4GS9 A;  2H28 A;  3F1O A;  4GCZ A;  1MZU A;  4GHI B;  4HJ3 A;  3MFX A;  3UB6 A;  4XT2 B;  3NOT C;  5HSQ A;  1OTD A;  2VV7 A;  2PD7 A;  2PYP A;  3P7N A;  4WN5 A;  2VLG A;  1T1C A;  3SW1 A;  2ZOH A;  4NXF A;  4GHI A;  3UE6 A;  2M1C A;  2KDK A;  5HD3 A;  3IS2 B;  2PYR A;  4HQA A;  3LID A;  4HNB A;  1S1Y A;  4EEP A;  2L4R A;  3H82 B;  1F9I A;  4MN5 A;  3NHQ A;  5IU1 A;  3UMD A;  3EWK A;  3C8C A;  1GSX A;  1TS7 A;  3FC7 A;  4RQ9 A;  2WKP A;  4HIA A;  2V9A A;  5A8B A;  4EW7 A;  5IS1 A;  4WL9 A;  2Z6D A;  2J80 A;  1S66 L;  3UB7 A;  2OOL A;  4EXO A;  4WLA A;  5DKL A;  5F6A A;  3IS2 A;  4HI4 A;  2Z6C A;  5J3W A;  3GDI A;  1LSW A;  4E04 A;  4JGQ A;  3H82 A;  2B02 A;  3F1O B;  1V9Z A;  3LI8 A;  3LIF A;  2QWS A;  1TS6 A;  1OTA A;  4PKY G;  1XJ6 A;  1XFQ A;  4EQ1 A;  2EA9 A;  3NOU C;  2VV6 A;  4PKY A;  5AVF A;  2QJ5 A;  3VE3 A;  5HDC A;  4L9G A;  4R38 A;  1LT0 A;  1VB6 A;  2JN7 A;  3MJQ A;  2L0W A;  4HH3 A;  3ULF A;  1D7E A;  4BBT A;  1UWN X;  5G4Y A;  5HWT A;  1TS8 A;  1XJ3 A;  5AVE A;  3HJK A;  1OTE A;  1WA9 A;  4LRX C;  4DJ2 A;  3PYP A;  3BWL A;  4JGP A;  2OWJ A;  3A0V A;  1TS0 A;  5DJT A;  1OJG A;  1XJ2 A;  3G6O A;  3F1P B;  1T18 A;  1UGU A;  3A0S A;  5I5L A;  4LPZ A;  2WKQ A;  2YKF A;  3E4P A;  4B9O A;  2A24 B;  3VE4 A;  2YKH A;  4I38 A;  4LRZ E;  1UWP X;  3LIA A;  3EEH A;  1F98 A;  3OLO A;  4BBV A;  4WUJ A;  4L9E A;  2VV8 A;  4HH2 A;  3PHY A;  3T50 A;  3F1P A;  4GW9 A;  1S67 L;  4K08 A;  4EEU A;  2V0U A;  3K3C A;  4HJ6 A;  4YWZ A;  3BY9 A;  4HP4 A;  1N9O A;  3FG8 A;  2D01 A;  3MQQ A;  1KOU A;  4KUO A;  3LUQ A;  1DP8 A;  1T1B A;  3MR0 A;  2A24 A;  4HP9 A;  4HOI A;  5DKK A;  1DP9 A;  2P7J A;  1G28 A;  3KX0 X;  1OT6 A;  1V9Y A;  4HJ4 A;  2WKR A;  2PHY A;  2PR6 A;  1GSV A;  1JNU A;  1OT9 A;  4R6L A;  3NOP C;  5HD5 A;  2L1M A;  3CWF A;  3MXQ A;  1LL8 A;  1S4S A;  4L9F A;  4M4X A;  4H6J B;  3LIC A;  2CMN A;  2PR5 A;  2JHE A;  1LSX A;  2V0W A;  3B33 A;  4MN6 A;  2VEA A;  3LIE A;  4I5S A;  4HY8 A;  2GJ3 A;  1XJ4 A;  3IBR A;  3K3D A;  4R3A A;  4BBU A;  3LYX A;  4EER A;  2QKP A;  3H7W B;  3VOL A;  5KIZ A;  1ODV A;  4H6J A;  4LRY C;  4WF0 A;  4JGO A;  4NXG A;  5F69 A;  2R78 A;  2QJ7 A;  2W27 A;  2QHK A;  4KUK A;  3UME A;  3GEC A;  1OTB A;  1X0O A;  4KQD A;  4F3L B;  2PD8 A;  3F1N B;  1P0Z A;  5F5Y A;  1DRM A;  3LIB A;  3RH8 B;  3H7W A;  1N9N A;  3BY8 A;  5HWW A;  1D06 A;  3CAX A;  2I9V A;  3E4O A;  1OTI A;  5G4Z A;  4NXB A;  1NWZ A;  5HDD A;  2PDR A;  1OJ5 A;  2OWH A;  4XT2 A;  1S4R A;  5TBM B;  2D02 A;  1T1A A;  4F3L A;  1S1Z A;  2HV1 A;  3LI9 A;  1P97 A;  3HJI A;  3F1N A;  4JGR A;  3ICY A;  3ZQ5 A;  4I3A A;  1XFN A;  2BAS A;  2INW A;  4I3I A;  1GSW A;  1DP6 A;  3NJA A;  4EET B;  4I3J A; 
#chains in the Genus database with same CATH topology
 4LV2 A;  5M1A A;  1K56 A;  3MQO A;  3IT9 A;  3E0Y A;  1ALQ A;  2DCF A;  3P09 A;  4OQG A;  1MKM A;  3KSH A;  1ONH A;  3G2Z A;  4E3O A;  3EQU A;  4GS9 B;  5FEF A;  4CLC E;  1VET B;  4B93 A;  1LSV A;  1DY6 A;  1BLP A;  3IWI A;  2XD5 A;  1FIL A;  3S7P A;  3SH9 A;  1WYB A;  2V1B A;  3RFB A;  2K7S A;  2ZQC A;  3BQA A;  4HEF A;  4X56 A;  1C3B A;  1ERO A;  3BM6 A;  1OME A;  1YMX A;  1CJF A;  2V2F F;  2ZOI A;  2VGL M;  4NKP A;  5FAQ A;  1CEG A;  3RTY A;  2Q9N A;  3O87 A;  2CC1 A;  2Y91 A;  1K38 A;  3MQ0 A;  1FR1 A;  1LL5 A;  1YM1 A;  5D3O A;  4KG2 A;  2WGI A;  3A3J A;  4E3M A;  4S2K A;  1IYP A;  3F1O A;  5HPF A;  4KQR A;  4QU3 A;  2XDM A;  4GHI B;  3VP0 A;  3BLS A;  4XT2 B;  4CLC B;  3MXS A;  2HP9 A;  4Q0H A;  2PYP A;  3P7N A;  2WKH A;  5DTT A;  2WAE A;  3IQA A;  5EM0 A;  4DXC A;  3TOI A;  5E2H A;  1ZKJ A;  3V50 A;  3N6I A;  2ZOH A;  4DKI A;  2GX5 A;  2G2W A;  3ZG0 A;  2M1C A;  5HD3 A;  4PAU A;  2OV5 A;  2Z2M B;  1K57 A;  4ZJ2 A;  5DF9 A;  5AQA A;  1DJC A;  3V5M A;  1G6O A;  2L4R A;  1K4E A;  3UE0 A;  4ZBE A;  3UMD A;  3KSF A;  1YSP A;  1NRJ A;  2FH5 A;  3PXP A;  3FKW A;  4FD8 A;  4G3V A;  1TS7 A;  3IBJ A;  2JKT M;  5K5B A;  1PWG A;  4OPR A;  4WL9 A;  2J80 A;  4IED A;  5F6A A;  4ZRR A;  2Z6C A;  4PHT A;  2JKR I;  5I94 A;  3LEQ A;  3H82 A;  1RCJ A;  1GA9 A;  1NZO A;  2B02 A;  3F1O B;  2VJW A;  1FIK A;  2X02 A;  5U47 A;  1LL9 A;  3GMW A;  2B5R A;  3PBT A;  1ACF A;  2Y59 A;  1Q2Q A;  2FFY A;  4X1M A;  4P6Z S;  1YMS A;  4M3K A;  3R4K A;  4EQ1 A;  2ZC5 B;  3BFD A;  5AVF A;  3MSH A;  2QJ5 A;  1HD8 A;  3QP8 A;  3VE3 A;  4L9G A;  4R38 A;  2ZQ7 A;  5HAQ A;  1LT0 A;  3ZG7 B;  3FWL A;  2K31 A;  1NY0 A;  4GJ4 A;  3MZE A;  3ULF A;  1UWN X;  4NET A;  2JKG A;  5EOO A;  1H8M A;  2Y2L A;  5FSR A;  2Y2Q A;  5TFQ A;  3ZVT A;  3QP6 A;  3T4S A;  4KQQ A;  5M19 A;  4DE0 A;  4GKU A;  4KZB A;  4N9K A;  4OP8 A;  1KDW A;  2XRO A;  4C3Q A;  5FAO A;  1TS0 A;  3M2K A;  4B88 A;  1OJG A;  1PZP A;  3NUL A;  3WS1 A;  4EBL A;  1ESI A;  4H8R A;  3UE3 A;  1HZO A;  2ZMV A;  3E4P A;  4QY5 A;  4Y7P A;  4PPR A;  5TR7 A;  2M7V A;  2A24 B;  5EPH A;  2YKH A;  5L07 A;  4YNR A;  2V1Z A;  4I38 A;  3NEC A;  3IWQ A;  3PBR A;  1UWP X;  3QP2 A;  1F98 A;  3HRE A;  1QME A;  4KG5 A;  3T1S A;  4BJP A;  4WUJ A;  4HH2 A;  5FI6 A;  5FAT A;  5DTS A;  1S67 L;  2IWB A;  4K08 A;  3VSK A;  3GV9 A;  4EQI A;  2OAQ 1;  1N9O A;  3MZD A;  2D01 A;  3MQQ A;  5GLA A;  3ZVW A;  1T1B A;  4NK3 A;  3MR0 A;  4HP9 A;  1DJB A;  1HVB A;  2W3F A;  2DNS A;  2K2N A;  3HUN A;  1ESU A;  3OCN A;  3IF6 B;  4BD0 A;  3S4X A;  2Y2G A;  1V9Y A;  4UEY A;  1FCM A;  2VZW A;  3HLB A;  5AJG A;  2PHY A;  2Y2M A;  1GSV A;  4Y17 A;  4R6L A;  1LLB A;  3NOP C;  5KMW A;  4Z1W A;  1Y54 A;  1L0G A;  1H8Z A;  3CJM A;  1W63 M;  3NDG A;  4QPR A;  3UY6 A;  3CUE A;  1IKI A;  2JE5 A;  2Y2H A;  2E8I A;  2Q0O A;  5EEC A;  2PR5 A;  2VGK A;  2JHE A;  1PIO A;  2KLI A;  2HJE A;  1LSX A;  3WWX A;  3B33 A;  4GD8 A;  1U60 A;  4L0L A;  5L2F A;  2HP6 A;  3LIE A;  1AXB A;  1XJ4 A;  4HBU A;  3LYX A;  4IUK A;  4EER A;  4KZA A;  2PU2 A;  1I2S A;  2GZA A;  5KIZ A;  1ODV A;  2W3D A;  4H6J A;  4JGO A;  4ESP A;  2H0Y A;  2QHK A;  4OKP A;  3GEC A;  3S7N A;  3OCL A;  2NUP C;  4S2O A;  1YT4 A;  2PD8 A;  2VGL S;  1BUL A;  2XR0 A;  1YLP A;  5EOE A;  1BLS A;  1WE4 A;  3LIB A;  5KZH A;  3P98 A;  1TEM A;  3M6B A;  3H7W A;  1N9N A;  3GTC A;  2Y2N A;  1D06 A;  3CAX A;  5FI2 A;  4MMN A;  3E4O A;  1PRQ A;  4OVD A;  1OTI A;  5F82 A;  3UE1 A;  1IFQ A;  5G4Z A;  4NXB A;  5FAS A;  3W4O A;  3L7H A;  1F2K A;  1JWP A;  1P9R A;  1PI4 A;  4LCL A;  2HV1 A;  3HJI A;  3IXG A;  1LI0 A;  4JGR A;  1A0K A;  3BRM A;  2EWW A;  3MF0 A;  3KSI A;  4KZ9 A;  3MBZ A;  2ZC3 B;  4I3A A;  4JXG A;  3LGO A;  1XFN A;  3TW8 A;  1GSW A;  1DP6 A;  1MWT A;  2C5W B;  4I3J A;  2BTF P;  5EV0 A;  1M40 A;  4HHD A;  4IBR A;  2WGW B;  2KX6 A;  4MEZ A;  4NXE A;  3FV7 A;  2J3W A;  2PBY A;  4EBN A;  1XPB A;  1K25 A;  1YLT A;  1TDL A;  1Z09 A;  2PT7 A;  5CXW A;  4IHQ A;  1BYW A;  3NDE A;  3SS5 A;  3RXW A;  3HLG A;  4Q0J A;  5E43 A;  3R7W B;  4WMC A;  3VP2 A;  5CGX A;  3SOI A;  1E3U D;  1HLU P;  3Q82 A;  3TE8 A;  1YLY A;  1G5U A;  1W63 Q;  4I39 A;  5HDS A;  3HLD A;  4OQH A;  4BL3 A;  2W0N A;  2ZQD A;  4Y13 A;  3M2J A;  4S2N C;  1T19 A;  3E4Q A;  3LEZ A;  2Y2P A;  5J4E A;  4NG2 A;  4GS9 A;  4X6T A;  2ZLY A;  3UO9 A;  5FL3 A;  2IWD A;  4KEN B;  4LGW A;  1E4D A;  4HJ3 A;  1L0D A;  2XFT A;  5HSQ A;  5CED A;  5DFY A;  5DVA A;  2HZ5 A;  5L8M A;  3IH9 A;  1IYQ A;  4E6W A;  2VLG A;  4BWI A;  3JYI A;  2Z2L B;  4LV0 A;  2ZQ8 A;  4NXF A;  5EVL A;  4XUZ A;  4O8G A;  4QD4 A;  2EX8 A;  4GHI A;  4S2L A;  1QMF A;  3UE6 A;  4G3K A;  1ERM A;  3BEC A;  4CLC A;  4Y0T A;  1YKD A;  2Y79 A;  3IS2 B;  4GDB A;  3T1X A;  4HNB A;  3I7J A;  3G4P A;  2XK1 A;  1F9I A;  1Q2P A;  2JKR M;  3NHQ A;  1IOU A;  3T4L A;  3A3F A;  3E98 A;  3GQZ A;  5FQI A;  3C8C A;  1GSX A;  2JBF A;  2WKP A;  2V9A A;  3NY4 A;  2OSU A;  2WAF A;  5A93 A;  3PTE A;  3ZG5 A;  3DTE A;  4P85 A;  1IEM A;  2Z6D A;  3UB7 A;  2OOL A;  4EXO A;  3O3V A;  1W8Q A;  4HI4 A;  1PI5 A;  5J3W A;  5HAI A;  1MXO A;  5EVI D;  3E2L A;  1ZG6 A;  3NIA A;  4DMZ A;  3LI8 A;  2J7V A;  4Q8I A;  3FPW A;  1TS6 A;  1FCO A;  1GHP A;  4PKY G;  3WS4 A;  1BSG A;  3UPN A;  3Q81 A;  3ZG9 B;  1BT5 A;  3KO6 A;  3NOU C;  4R0Q A;  1SHV A;  5HDC A;  3MJQ A;  4X25 A;  4JKT A;  4HH3 A;  4KQO A;  3EGD C;  4YIN A;  5G4Y A;  2V20 A;  2EXB A;  5JYO A;  3UNW A;  2VGJ A;  2UV0 E;  1KE3 A;  2ZQ9 A;  3HJK A;  1OTE A;  5EVI C;  3UDF A;  4RX3 A;  4DDY A;  2VX8 A;  3PYP A;  4KZ8 A;  2WKI A;  3DBA A;  4JGP A;  3S22 A;  4FTX A;  4ZTK A;  3TJZ C;  2EWV A;  1YQS A;  5CTN A;  5DJT A;  3UB5 P;  3IHB A;  2KOI A;  3CPT B;  3HLF A;  3G6O A;  3T1Q B;  3A0S A;  3T4J A;  1VM1 A;  5I5L A;  4ID4 A;  3B47 A;  5G18 A;  3UN7 A;  3LFV A;  4N9L A;  3DW0 A;  1I5Q A;  5HFO A;  4KZ5 A;  3LIA A;  2GDN A;  2Y2K A;  3T4K A;  3OLO A;  4BBV A;  2H0T A;  4CPK A;  3DWK A;  4GD6 A;  4L9E A;  2HP5 A;  1KGE A;  3IX4 A;  3T50 A;  4EV4 A;  3QNC A;  4EEU A;  1N4O A;  3OPP A;  3K3C A;  2UWX A;  2C6W B;  2XA7 M;  3BY9 A;  4WEK A;  1KE4 A;  3VOY A;  1KOU A;  3IHA A;  4NEE D;  4JPM A;  2XD1 A;  3ZGA B;  2A24 A;  3SH8 A;  3CIT A;  4Y2F A;  3EEA A;  2XH9 A;  3KX0 X;  5L10 A;  5FAP A;  1OT6 A;  1VEU B;  2ZC4 B;  2P04 A;  4A5R A;  1H5X A;  4GZB A;  1JNU A;  1JTG A;  4KZ4 A;  1OT9 A;  1VQQ A;  5GLB A;  4X53 A;  5HD5 A;  2G2U A;  4BD1 A;  1XP4 A;  4L9F A;  4YFM A;  5FQK A;  3PBO A;  4RA7 A;  4ARZ B;  1H8Y A;  1ES4 A;  3SS4 A;  2HDU A;  4P0M A;  1TDG A;  3IF6 A;  3MZF A;  3C4P A;  3D4F A;  2V0W A;  4HBT A;  1N9B A;  4KG6 A;  3PR6 A;  2AVX A;  3BFC A;  5CHJ A;  4OLD A;  5HAP A;  4ME4 A;  3GVB A;  4LV1 A;  3WS5 A;  3K3D A;  2J9P A;  4R23 A;  1P9W A;  2X71 A;  3MMH A;  3N7W A;  5CGW A;  4LRY C;  3TRC A;  3FPV A;  3BFG A;  4NXG A;  5CHM A;  3FKV A;  3E2K A;  4DE1 A;  4FH2 A;  3WS2 A;  2QJ7 A;  3N8L A;  3JVV A;  4ETZ A;  3HUO A;  4WYY A;  1YAX A;  1SKF A;  1X0O A;  4KQD A;  5FQJ A;  4U0X A;  3A3I A;  3F1N B;  4OOY A;  4BMW A;  5F5Y A;  1SCW A;  3QP4 A;  1DRM A;  2B18 A;  4PM8 A;  4Y15 A;  2HDS A;  4X55 A;  3BY8 A;  5GL9 A;  1K6S A;  5HWW A;  5EVI B;  3CUE C;  2ZC6 B;  2I9V A;  2X01 A;  3AGE A;  3ISG A;  2PRF A;  1YPR A;  5HDD A;  5HPI A;  3BW6 A;  2ZJ9 A;  1CI9 A;  2XSS A;  1OJ5 A;  2OWH A;  5TBM B;  1S4R A;  2D02 A;  4X68 A;  1NLZ A;  3BFE A;  3LI9 A;  4WBG A;  3PAE A;  4BL2 A;  1ERQ A;  3EQV A;  5FQ9 A;  3ZQ5 A;  5DFX A;  5DF8 A;  1GHI A;  1K6R A;  4QY6 A;  3V3R A;  2INW A;  1KVM A;  3HL9 A;  4DDS A;  3U4L P;  4FCF A;  4QJG A;  1J9M A;  4BQM A;  4DE3 A;  4R4S A;  3U2A A;  4KZ6 A;  1MBL A;  1STZ A;  4PM5 A;  5CHU A;  3C2W A;  1S0W A;  5TJJ A;  2XRN A;  3BQ8 A;  3KYZ A;  4OQ0 A;  2W3E A;  2Y8H A;  2Y2O A;  5E2E A;  1MWR A;  5CTM A;  2J3T D;  5F68 A;  2EXA A;  1M6K A;  4EES A;  1CQA A;  3G31 A;  3UB9 A;  4GNU A;  2HPB A;  1Y28 A;  4PMA A;  2HDQ A;  3G30 A;  5A90 A;  3IH8 A;  1O7E A;  5EFW A;  3W2Z A;  3ITB A;  2ZBB A;  3ZNT A;  1K55 C;  2WGW A;  4G3W A;  3CLO A;  2V8C A;  3C38 A;  4JBF A;  3T4Q A;  4R70 A;  3RXX A;  3OPH A;  2EFU A;  2V1A A;  4DJ3 A;  2H28 A;  3R7W A;  4P6B A;  2HJ9 C;  3VP1 A;  3C7U A;  1YLW A;  1G68 A;  3UB6 A;  3NOT C;  2J3T C;  1ZG4 A;  2LB9 A;  3Q07 A;  2VV7 A;  3BYD A;  1GCE A;  4JF5 A;  4OQI A;  3HVF A;  1MPL A;  1CF0 A;  3W4P A;  4D2O A;  3AGF A;  3VFF A;  2WYX A;  2PU4 A;  4FSF A;  2IA2 A;  1NJ4 A;  4Y0U A;  3SZT A;  3QHY A;  3A3D A;  4OH0 A;  1Z6F A;  1AWI A;  1WYC A;  1IYS A;  1CK3 A;  2Y4A A;  4N1H A;  2Q9M A;  4O0P A;  4IVK A;  2PYR A;  4HQA A;  4DN0 A;  4IVI A;  3LID A;  1G6A A;  3C4O A;  4MN5 A;  2OAP 1;  3G35 A;  5CX7 A;  2ZMF A;  4GOG A;  3DAV A;  3GSG A;  2GNX A;  2WZZ A;  4Y3I A;  3FC7 A;  4HIA A;  4OPY A;  1XXM A;  3OPL A;  4EW7 A;  2W3H A;  3GRJ A;  2Y2J A;  1ES5 A;  2DMW A;  1K54 C;  1YLZ A;  1S66 L;  2XEP A;  5FDS A;  5CEC A;  2VA0 A;  2H5S A;  3KYQ A;  5DKL A;  3VP3 A;  1PW8 A;  3IS2 A;  3VP4 A;  1FQG A;  2JC7 A;  4JGQ A;  1BLH A;  3T4O A;  4EUZ A;  3CHW P;  4MNR A;  1I2W A;  1NYM A;  4Y5F A;  3DTI A;  1V9Z A;  3LIF A;  2QWS A;  2XA7 S;  1OTA A;  3CI6 A;  4EBP A;  1DJA A;  4O01 A;  5A92 A;  4S2I A;  1XJ6 A;  2A2L A;  3NCK A;  2EA9 A;  4PKY A;  4WZ5 C;  2VK3 A;  5AQB A;  1PNE A;  2JN7 A;  3BJN A;  4E3L A;  3IF5 A;  4UQI M;  4FH4 A;  5EUA A;  2HF6 A;  3DTK A;  1TS8 A;  1L0F A;  5CRF A;  2I72 A;  2O99 A;  1RGY A;  4OOM A;  4LRX C;  3BWL A;  2R9X A;  1CEF A;  3T12 B;  3M6H A;  4D60 A;  3A0V A;  1XJ2 A;  3EOI A;  3F1P B;  2W1R A;  1T18 A;  3OBF A;  3V67 A;  3OZH A;  1XKZ A;  2WAD A;  1JWZ A;  4RX2 A;  2WKQ A;  3ZG8 B;  4LV3 A;  3HBR A;  3A3E A;  4B9O A;  3VE4 A;  4R3B A;  3LR5 A;  1W5D A;  4LRZ E;  3HLW A;  2WZX A;  4DXB A;  5MC7 A;  4IUH A;  3PHY A;  1JTD A;  3FZC A;  3CPT A;  2W1T B;  4KZ7 A;  4S2N A;  3G34 A;  2EX9 A;  3C5A A;  4HJ6 A;  4EWF A;  4OPZ A;  4GDN A;  3FG8 A;  3D3O A;  1DP8 A;  2DRW A;  5BOH A;  2R9W A;  4HOI A;  2OLV A;  5DKK A;  3VFH A;  1G28 A;  4O7D A;  1CI8 A;  3K2N A;  1S6R A;  4UAA A;  3JPU A;  5HL1 A;  4HJ4 A;  3Q7V B;  1E3U A;  3W8K A;  2WKR A;  2PR6 A;  2ZD8 A;  5FA7 A;  1K4F A;  4S2J A;  1L2S A;  3VOZ A;  1JVJ A;  3IX3 A;  4JXS A;  3HLE A;  2L1M A;  3LO7 A;  4QHC A;  3CWF A;  1H0M A;  1YSQ A;  4M4X A;  1LHY A;  2P9V B;  2ZL1 B;  1XX2 A;  3O86 A;  3LIC A;  1K57 C;  4F94 A;  4GB7 A;  3LCE A;  4FOF A;  4UA6 A;  2XLN A;  1VEU A;  2WKE A;  1BUE A;  4WEJ A;  4MN6 A;  3V3S A;  2BLS A;  3UPP A;  3HCY A;  3SS3 A;  3MKE A;  3KYE A;  4I5S A;  4OOL A;  1SKO B;  2ZM8 A;  4BBU A;  3W4Q A;  4CQH A;  2O9A A;  3IWO A;  4GLQ A;  4HES A;  2G7U A;  1TVF A;  3N8S A;  3IX8 A;  4ARZ A;  5C5K A;  4OPQ A;  4JLF A;  4R4R A;  1FR6 A;  5E2G A;  2R78 A;  4X69 A;  3UME A;  2JKF A;  4F3L B;  3JVU A;  4JXW A;  4R3J A;  2QMI A;  4E3N A;  4E3I A;  4BLM A;  3LY4 A;  4S2P A;  3PBN A;  4MN7 A;  4EUV A;  3VSL A;  3OC2 A;  3HLC A;  3O88 A;  5HL6 A;  3UPO A;  4DF6 A;  1L3L A;  1NWZ A;  3IF6 C;  1EWZ A;  2PDR A;  4MBF A;  2RCX A;  4ZAM A;  2EX6 A;  5E2F A;  3F1N A;  2QYB A;  1TD5 A;  1PYY A;  2PBD P;  3ICY A;  4JF4 A;  5F1G A;  3DTM A;  5FQQ A;  1FCN A;  3AGD A;  3QP1 A;  3LR3 A;  1OPX A;  2Y2I A;  3IXH A;  5EVI A;  3NJA A;  4EET B;  1W79 A;  5HX9 A;  5HWV A;  1KE0 A;  4Y0O A;  1ZC2 A;  5HW3 A;  3BEB A;  1NRF A;  3T1R A;  1NZU A;  5TBM A;  5A91 A;  1HTZ A;  4IJG A;  5DJU A;  5FI7 A;  3UB8 A;  1EW0 A;  3WRZ A;  1N9L A;  3H9W A;  3D72 A;  4UHU A;  3B42 A;  2JCH A;  2E8J A;  3T4T A;  4LLO B;  1ES3 A;  1MWU A;  5HZH A;  4LEN A;  5DTK A;  2A49 A;  5J7E A;  3A0R A;  1Y4O A;  5GHX A;  5GHZ A;  1FSY A;  3UDX A;  2WK0 A;  4S2M A;  4GCZ A;  3P01 A;  3O5Y A;  1MZU A;  3IXB A;  1KDS A;  2O9B A;  3VV4 A;  2NUT C;  3MFX A;  2PAV P;  4AFI A;  1OTD A;  4EU0 A;  4LFU A;  2PD7 A;  1FOF A;  4E3J A;  1PWC A;  3C7V A;  4WN5 A;  4UQI S;  3ZFZ A;  2VKS A;  1GA0 A;  2J9O A;  1T1C A;  3MKF A;  5LBR A;  1NLY A;  2HGV A;  4XUX A;  5EVE A;  3Q1F A;  4OP5 A;  2KDK A;  3C30 A;  4MCW A;  2ZC7 A;  3VMA A;  3BLM A;  1JWV A;  3BFF A;  1S1Y A;  4EEP A;  3H82 B;  4XXR A;  4C75 A;  3N8R A;  5IT5 A;  4C6Y A;  5IU1 A;  3ZDJ A;  2J8Y A;  3EWK A;  4WM9 A;  2H10 A;  3ZCZ A;  4KZ3 A;  4RQ9 A;  5A8B A;  4R1G A;  5IS1 A;  3LY3 A;  4N1X A;  4Z9Q A;  2XFS A;  4WLA A;  4YOF A;  1F5M A;  1O07 A;  3GDI A;  1LSW A;  4E04 A;  4K91 A;  3G32 A;  3MS6 A;  4ETX A;  5JYP A;  3FYZ A;  5TGF A;  2JKT I;  1W7F A;  5HAR A;  5KSC A;  1W8Y A;  2LB5 A;  1XA1 A;  5FEG A;  2QZ6 A;  1XFQ A;  1BLC A;  2VV6 A;  4LCM A;  2XF3 A;  4WMC D;  5AQ9 A;  1VB6 A;  2P08 A;  1SZV A;  2L0W A;  4IBX A;  1D7E A;  4BBT A;  1PWD A;  2QPN A;  1IKG A;  1MY8 A;  5HWT A;  2ZM2 A;  1XJ3 A;  1NXY A;  2HDR A;  5AVE A;  4CJN A;  5DF7 A;  5KSH A;  2RL3 A;  3WRT A;  3MFD A;  5F83 A;  1WA9 A;  1EI5 A;  3G2Y A;  1H3Q A;  3TG9 A;  5FQM A;  4DJ2 A;  3WS0 A;  4P87 A;  2EX2 A;  1PZO A;  2OWJ A;  1ZTU A;  4QWO A;  5F1F A;  5IHV A;  1IYO A;  3NI9 A;  3ZNY A;  1UGU A;  4LPZ A;  4FUW A;  1L0E A;  2YKF A;  5GLD A;  2WGV A;  2XQZ A;  4PM7 A;  1IEL A;  4QB8 A;  4ZJ3 A;  4U3T A;  3EEH A;  2FFF B;  4GN2 A;  3LR4 A;  3LR0 A;  2M7U A;  1MC0 A;  2VV8 A;  3CZD A;  4MDZ A;  4BEN A;  3F1P A;  1K55 A;  4GW9 A;  5AQ7 A;  2W3G A;  1KGG A;  4MBK A;  2MJ6 A;  5EM1 A;  2V0U A;  4Q0I A;  4YWZ A;  4HP4 A;  4DRT A;  3CMZ A;  4JXV A;  4CLC D;  4KUO A;  3LUQ A;  4P6Z M;  1ES2 A;  4U0T A;  2OLU A;  1DP9 A;  2P7J A;  1RGZ A;  1K0K A;  1XA7 A;  4K0X A;  4MBH A;  3HUM A;  1VHM A;  3B3X A;  4B4X A;  2ZMA A;  2W1T A;  1XGJ A;  1K56 D;  3ITA A;  3QP5 A;  3N4I A;  3CG5 A;  4WZ4 A;  3PBS A;  3MXQ A;  5M18 A;  3PAG A;  3V39 A;  1LL8 A;  1S4S A;  3IXD A;  5FDH A;  5CEB A;  5L09 A;  2P74 A;  3OPR A;  1GHM A;  4H6J B;  4CLC C;  1ZHH B;  5CER A;  2CMN A;  1KVL A;  5GHY A;  3S7Q A;  4RYE A;  3Q7V A;  4OLG A;  4JF6 A;  3TSG A;  1SDE A;  2Y55 A;  2ZM0 A;  2VEA A;  3QNB A;  1XGI A;  4HY8 A;  2GJ3 A;  3IBR A;  2EFX A;  1KGF A;  4R3A A;  2QKP A;  4DE2 A;  3H7W B;  3VOL A;  3S1Y A;  1VET A;  2P9V A;  2ZL1 A;  4MLL A;  4PM6 A;  4WF0 A;  2IWC A;  3UDI A;  5F69 A;  3NBL A;  2XGN A;  1K54 A;  1J3W A;  1RP5 A;  2B95 A;  2W27 A;  4KUK A;  2ZQA A;  3MXR A;  4OON A;  1OTB A;  3OOV A;  1LI9 A;  2FZ0 A;  3DWZ A;  5GLC A;  4II7 A;  1P0Z A;  1TF1 A;  4UA9 A;  1SKO A;  4UA7 A;  3RJU A;  4E3K A;  1PFL A;  2BG1 A;  3RH8 B;  1MWS A;  1BZA A;  1FSW A;  2A3U A;  1PW1 A;  3PBQ A;  1ONG A;  1YLJ A;  1SDN A;  4WEL A;  3SH7 A;  4ZDX A;  3L9K A;  2V8F A;  1MKI A;  3Q7Z A;  4B4Z A;  4WZ5 A;  4XT2 A;  4E6X A;  1T1A A;  4F3L A;  1S1Z A;  5J8X A;  1P97 A;  2O9C A;  5EE8 A;  2O0Y A;  3NC8 A;  1BTL A;  4N92 A;  4RVA A;  3ZYT A;  3ZHH A;  1D1J A;  3D9Y A;  4ZJ1 A;  3S7O A;  3GR2 A;  3KSG A;  5CGS A;  3EGX C;  1E25 A;  2WUQ A;  4PM9 A;  1NYY A;  2ACG A;  4X1L A;  2BAS A;  4I3I A;  4K0W A;  3SW1 A; 
#chains in the Genus database with same CATH homology
 5HWV A;  4HHD A;  3U2A A;  3MQO A;  2KX6 A;  1STZ A;  3E0Y A;  4NXE A;  2J3W A;  5TBM A;  3C2W A;  1MKM A;  4IJG A;  3KSH A;  5TJJ A;  5DJU A;  2PT7 A;  4IHQ A;  2XRN A;  3BQ8 A;  1BYW A;  3EQU A;  3UB8 A;  3KYZ A;  2W3E A;  2Y8H A;  4GS9 B;  4CLC E;  4B93 A;  4Q0J A;  3R7W B;  1EW0 A;  1LSV A;  2J3T D;  5F68 A;  4EES A;  3TE8 A;  3S7P A;  1N9L A;  3UB9 A;  3H9W A;  1W63 Q;  3D72 A;  4I39 A;  2V1B A;  3RFB A;  2K7S A;  5HDS A;  1Y28 A;  3BQA A;  2W0N A;  3B42 A;  5EFW A;  3T4T A;  3W2Z A;  2ZBB A;  4G3W A;  1T19 A;  4LLO B;  2ZOI A;  3CLO A;  3E4Q A;  2VGL M;  4NKP A;  5HZH A;  3C38 A;  3RTY A;  3T4Q A;  4R70 A;  5J4E A;  5J7E A;  3A0R A;  3MQ0 A;  2V1A A;  4DJ3 A;  4GS9 A;  2H28 A;  3R7W A;  3F1O A;  4GCZ A;  5FL3 A;  5HPF A;  2HJ9 C;  3O5Y A;  3P01 A;  1MZU A;  2O9B A;  4GHI B;  3VV4 A;  4HJ3 A;  2NUT C;  3MFX A;  3UB6 A;  4XT2 B;  3NOT C;  2J3T C;  4CLC B;  5HSQ A;  4AFI A;  2LB9 A;  1OTD A;  5DFY A;  4EU0 A;  2VV7 A;  4Q0H A;  2PD7 A;  5L8M A;  2PYP A;  3P7N A;  4WN5 A;  2VLG A;  4BWI A;  4UQI S;  4FSF A;  2IA2 A;  2VKS A;  1T1C A;  3SW1 A;  2ZOH A;  4NXF A;  5LBR A;  4O8G A;  1NLY A;  2GX5 A;  2HGV A;  4GHI A;  3UE6 A;  2M1C A;  2KDK A;  4G3K A;  5HD3 A;  4PAU A;  3C30 A;  4CLC A;  4MCW A;  4O0P A;  1YKD A;  2Y79 A;  3IS2 B;  5DF9 A;  2PYR A;  4HQA A;  4DN0 A;  3LID A;  4HNB A;  1G6O A;  1S1Y A;  2L4R A;  3H82 B;  4EEP A;  5IT5 A;  1F9I A;  4MN5 A;  2OAP 1;  2JKR M;  3NHQ A;  5IU1 A;  3UMD A;  1IOU A;  3KSF A;  3T4L A;  1YSP A;  1NRJ A;  5CX7 A;  2FH5 A;  2ZMF A;  3EWK A;  3PXP A;  3E98 A;  2GNX A;  4G3V A;  3C8C A;  1GSX A;  1TS7 A;  3IBJ A;  4Y3I A;  3FC7 A;  4RQ9 A;  2WKP A;  4HIA A;  2JKT M;  2V9A A;  5A8B A;  5K5B A;  4EW7 A;  5IS1 A;  2W3H A;  2DMW A;  4WL9 A;  2Z6D A;  2J80 A;  1S66 L;  3UB7 A;  2VA0 A;  2OOL A;  4EXO A;  4WLA A;  4YOF A;  3KYQ A;  5DKL A;  5F6A A;  3IS2 A;  4HI4 A;  1F5M A;  4ZRR A;  2Z6C A;  4PHT A;  5J3W A;  2JKR I;  3GDI A;  1LSW A;  4E04 A;  4JGQ A;  3H82 A;  3T4O A;  2B02 A;  4Y5F A;  3F1O B;  2VJW A;  4ETX A;  1V9Z A;  4DMZ A;  3LI8 A;  3LIF A;  2QWS A;  3FPW A;  1TS6 A;  2JKT I;  2XA7 S;  1OTA A;  3CI6 A;  3PBT A;  4O01 A;  4PKY G;  4P6Z S;  2LB5 A;  1XJ6 A;  2A2L A;  3R4K A;  1XFQ A;  4EQ1 A;  2EA9 A;  3KO6 A;  3NOU C;  2VV6 A;  4PKY A;  5AVF A;  2QJ5 A;  3VE3 A;  5HDC A;  4L9G A;  4R38 A;  1LT0 A;  1VB6 A;  2JN7 A;  3MJQ A;  2P08 A;  3BJN A;  2K31 A;  4GJ4 A;  2L0W A;  4HH3 A;  4KQO A;  3EGD C;  4UQI M;  3ULF A;  1D7E A;  4BBT A;  1UWN X;  2HF6 A;  5G4Y A;  5HWT A;  1TS8 A;  1XJ3 A;  1H8M A;  5AVE A;  5KSH A;  3HJK A;  3T4S A;  1OTE A;  2O99 A;  1WA9 A;  4OOM A;  4LRX C;  1H3Q A;  2VX8 A;  4DJ2 A;  3PYP A;  3BWL A;  3DBA A;  4JGP A;  2XRO A;  2OWJ A;  1ZTU A;  3TJZ C;  2EWV A;  3A0V A;  1TS0 A;  5DJT A;  1OJG A;  1XJ2 A;  3EOI A;  2KOI A;  3G6O A;  3F1P B;  2W1R A;  1T18 A;  3OBF A;  1UGU A;  3A0S A;  3T4J A;  3V67 A;  5I5L A;  4LPZ A;  3B47 A;  3UE3 A;  2WKQ A;  2YKF A;  3LFV A;  2ZMV A;  3E4P A;  2M7V A;  2A24 B;  3VE4 A;  4B9O A;  3LR5 A;  2YKH A;  4YNR A;  4I38 A;  4LRZ E;  3PBR A;  1UWP X;  3LIA A;  3EEH A;  1F98 A;  3T4K A;  3OLO A;  4BBV A;  3LR4 A;  4BJP A;  4WUJ A;  3LR0 A;  5MC7 A;  4L9E A;  2M7U A;  4IUH A;  1MC0 A;  2VV8 A;  4HH2 A;  3PHY A;  4MDZ A;  2W1T B;  3T50 A;  3F1P A;  4GW9 A;  1S67 L;  2W3G A;  4K08 A;  4EEU A;  2MJ6 A;  2V0U A;  3K3C A;  4HJ6 A;  4Q0I A;  4YWZ A;  2XA7 M;  3BY9 A;  2OAQ 1;  4HP4 A;  1N9O A;  4WEK A;  3FG8 A;  2D01 A;  4CLC D;  3MQQ A;  1KOU A;  4KUO A;  3D3O A;  3LUQ A;  1DP8 A;  4P6Z M;  4NEE D;  1T1B A;  3MR0 A;  2A24 A;  4HP9 A;  4HOI A;  2W3F A;  3CIT A;  5DKK A;  1DP9 A;  2P7J A;  4Y2F A;  2K2N A;  3EEA A;  1G28 A;  3K2N A;  3KX0 X;  3OCN A;  1OT6 A;  1VHM A;  1V9Y A;  4UEY A;  4HJ4 A;  2VZW A;  2P04 A;  2WKR A;  5AJG A;  2PHY A;  2PR6 A;  2W1T A;  1GSV A;  1JNU A;  1OT9 A;  4R6L A;  3NOP C;  4Z1W A;  5HD5 A;  2L1M A;  3PBS A;  3CWF A;  3MXQ A;  1YSQ A;  1LL8 A;  1S4S A;  4L9F A;  4M4X A;  1W63 M;  4QPR A;  3CUE A;  3PBO A;  4H6J B;  4CLC C;  4ARZ B;  1ZHH B;  3LIC A;  2CMN A;  2PR5 A;  2JHE A;  2KLI A;  2HJE A;  3S7Q A;  1LSX A;  2V0W A;  4FOF A;  3B33 A;  3PR6 A;  4L0L A;  4WEJ A;  4MN6 A;  2VEA A;  3HCY A;  4ME4 A;  3LIE A;  4I5S A;  4HY8 A;  2GJ3 A;  1XJ4 A;  4OOL A;  3IBR A;  3K3D A;  4R3A A;  1P9W A;  3MMH A;  4BBU A;  3LYX A;  4IUK A;  4EER A;  4CQH A;  2O9A A;  2QKP A;  3H7W B;  3VOL A;  4GLQ A;  2GZA A;  5KIZ A;  2G7U A;  1ODV A;  2W3D A;  4H6J A;  4LRY C;  4WF0 A;  4ARZ A;  3TRC A;  5C5K A;  3FPV A;  4JGO A;  4NXG A;  5F69 A;  2R78 A;  2QJ7 A;  2W27 A;  2QHK A;  4KUK A;  3JVV A;  3UME A;  3GEC A;  1OTB A;  3OOV A;  4ETZ A;  3S7N A;  1YAX A;  3OCL A;  2NUP C;  1X0O A;  4KQD A;  4F3L B;  3JVU A;  2PD8 A;  2FZ0 A;  2VGL S;  3F1N B;  4II7 A;  1P0Z A;  4BMW A;  1TF1 A;  5F5Y A;  1DRM A;  2B18 A;  3LIB A;  3RH8 B;  3H7W A;  1N9N A;  3BY8 A;  5HWW A;  3PBN A;  4MN7 A;  4EUV A;  3CUE C;  1D06 A;  3CAX A;  2I9V A;  3OC2 A;  3PBQ A;  4MMN A;  3E4O A;  4WEL A;  5HL6 A;  1OTI A;  1IFQ A;  5G4Z A;  4NXB A;  1NWZ A;  5HDD A;  5HPI A;  3BW6 A;  2PDR A;  2XSS A;  1OJ5 A;  2OWH A;  4XT2 A;  1S4R A;  5TBM B;  2D02 A;  1P9R A;  1T1A A;  4F3L A;  1S1Z A;  2HV1 A;  1NLZ A;  3LI9 A;  1P97 A;  2O9C A;  3HJI A;  2O0Y A;  3F1N A;  2QYB A;  3ZYT A;  1TD5 A;  4JGR A;  3ICY A;  3EQV A;  3S7O A;  3KSG A;  2EWW A;  3ZQ5 A;  3MF0 A;  3EGX C;  3KSI A;  5DFX A;  3LR3 A;  4I3A A;  1OPX A;  1XFN A;  3TW8 A;  2BAS A;  2INW A;  4I3I A;  1GSW A;  1DP6 A;  3NJA A;  4EET B;  4I3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...