5DJUA

Crystal structure of lov2 (c450a) domain in complex with zdk3
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
145
Chain Sequence
GSLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNARFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Engineered protein, Zdk3 affibody
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 48
structure length 145
sequence length 145
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5djuA00
3EWKA 4K08A 3MXQA 5TBMA 3BY8A 2QHKA 3UB6A 5J3WA 4EETB 3P7NA 2PR6A 1MZUA 4B9OA 3E4PA 2PHYA 4HNBA 1DP8A 4HH2A 2VV6A 4L9GA 1N9OA 3NHQA 3D72A 4MN5A 1S67L 2OOLA 2PYRA 1P0ZA 3G6OA 2QWSA 3VE4A 4EESA 4HOIA 4EQ1A 5F68A 3LIDA 2GJ3A 3BY9A 5AVEA 5HDCA 3K3CA 1TS7A 4EERA 2INWA 2VV7A 4R3AA 1XFNA 1S4RA 5HZHA 4I38A 4GHIA 1OJGA 2WKQA 3FG8A 2QKPA 2HV1A 2BASA 3LUQA 4HIAA 1LL8A 2D01A 2P7JA 3NOPC 4HP9A 3SW1A 2VV8A 3A0SA 1OTIA 1KOUA 3H82A 1T1CA 2VEAA 4PKYG 1S4SA 4I3IA 4JGQA 1TS6A 4HP4A 4H6JA 3H82B 4HJ3A 5HWTA 4DJ2A 1D7EA 3EEHA 4JGOA 3F1OA 2K7SA 5KIZA 5IS1A 3F1NA 1XJ2A 5I5LA 4GW9A 3C2WA 3E4QA 4I5SA 2L0WA 3VOLA 2W0NA 4XT2A 5HDDA 4I39A 4NXFA 2QJ5A 4WF0A 4XT2B 3VE3A 3OLOA 2V0UA 3UB9A 4HHDA 1S1YA 2Z6CA 3MR0A 2PD7A 3IS2B 4R38A 5F6AA 1OTBA 3CAXA 1XJ3A 1TS0A 4GCZA 2YKFA 4HJ6A 4EEUA 5IU1A 5HD3A 5DKLA 5A8BA 2PYPA 1DRMA 1XJ6A 2PDRA 1NWZA 4JGPA 2R78A 3LIEA 4PKYA 4BBUA 5F5YA 4I3AA 3KX0X 4YWZA 3F1PB 1OTAA 1OTDA 1JNUA 4HY8A 3LI8A 4R70A 1Y28A 2V0WA 2VLGA 4E04A 2V1BA 1XJ4A 1T1AA 2V9AA 3PHYA 5DJUA 4F3LB 1OJ5A 4DJ3A 1OTEA 4HI4A 2JN7A 4KUKA 2A24B 2PD8A 3LIAA 4L9FA 1OT9A 1G28A 1P97A 1BYWA 1GSXA 5DJTA 3HJIA 2EA9A 2OWJA 4GS9A 4NXBA 4WUJA 1VB6A 2M1CA 1F9IA 5F69A 3NOUC 1T19A 2J80A 4LPZA 1D06A 1UWNX 4GS9B 4RQ9A 1UGUA 2L4RA 1EW0A 4BBVA 3UMEA 1GSWA 4L9EA 1F98A 3C8CA 3RTYA 1LSVA 5HWWA 3MJQA 3IS2A 1T18A 1GSVA 1T1BA 3UMDA 2I9VA 3MFXA 1TS8A 4NXGA 3UB8A 3LIFA 4HJ4A 3NOTC 1WA9A 1S1ZA 3ULFA 3UE6A 2V1AA 3H7WB 1XFQA 5HD5A 2QJ7A 3HJKA 1V9ZA 5TBMB 3LICA 3F1PA 4LLOB 2ZOHA 5J4EA 3UB7A 5HSQA 3E4OA 3GDIA 3MQOA 2L1MA 3B33A 2JHEA 1S66L 4WLAA 5J7EA 2KX6A 4NXEA 4HQAA 3BWLA 4F3LA 3H9WA 1UWPX 1ODVA 1LSXA 2OWHA 1N9NA 1LSWA 4BBTA 3NJAA 2A24A 2WKPA 1X0OA 4WN5A 3RH8B 5EFWA 3LI9A 4KUOA 3K3DA 5DKKA 3IBRA 4LRYC 4KQDA 2KDKA 2YKHA 1DP6A 4GHIB 1OT6A 2ZOIA 3CLOA 5HDSA 2H28A 4I3JA 4LRXC 3MQQA 2CMNA 3ICYA 3A0RA 2Z6DA 2B02A 1N9LA 3LYXA 4WL9A 2ZBBA 4LRZE 5G4YA 4EEPA 5HWVA 3GECA 2D02A 5AVFA 5G4ZA 3T50A 4R6LA 1LT0A 2WKRA 2W27A 4HH3A 4H6JB 3PYPA 3CWFA 2PR5A 4EW7A 3ZQ5A 4MN6A 1DP9A 4JGRA 4EXOA 3FC7A 3F1OB 1V9YA 3F1NB 4M4XA 3LIBA 3H7WA 3A0VA
chains in the Genus database with same CATH superfamily
4WM9A 3O87A 1W8QA 1J9MA 4MLLA 4II7A 5A90A 5TR7A 4EETB 4UHUA 5L2FA 2Q9NA 4U3TA 4DMZA 1N9BA 2NUPC 2HDUA 3DWZA 1XGIA 3ZFZA 3BFFA 4OQGA 3D72A 3HLWA 1W63M 4N92A 2PYRA 2FFYA 3VE4A 3HLBA 2VA0A 2ZMAA 1YM1A 3LIDA 3OPLA 3U4LP 3BY9A 1TS7A 4EU0A 4R3AA 4NEED 2CC1A 1XFNA 3V3RA 5HZHA 2E8IA 1OJGA 3ZG7B 3IF6A 2QKPA 2WYXA 3VP1A 2HV1A 4S2NC 4OOYA 2VGJA 3OPRA 1LL8A 3SS3A 4HP9A 2VV8A 4MBKA 1SKOB 2BTFP 4PMAA 3U2AA 4FUWA 4KZBA 1BTLA 1ESUA 1PZOA 5EVIB 3IXDA 1NRJA 1NLYA 3MXSA 5GL9A 1ONHA 1JWZA 2Y55A 4S2NA 3B47A 2Y2KA 4HP4A 3H82B 3ZDJA 1TDGA 4QHCA 3GV9A 1MC0A 3FZCA 2W3FA 2XEPA 2WAFA 1YLJA 2J7VA 2K7SA 2XRNA 5IS1A 2XF3A 1XJ2A 3C2WA 3G32A 1A0KA 4U0XA 4ETXA 4BWIA 2HP6A 1K4EA 4X1MA 3GMWA 4OP5A 3ZNTA 2QJ5A 4GNUA 4WF0A 2VKSA 4GKUA 2M7UA 3CITA 4PM7A 4O0PA 3EGXC 1KVMA 3K2NA 4DKIA 2PD7A 4O7DA 2W1RA 4DE1A 4X69A 1TS0A 1RGZA 2DNSA 5TFQA 4JXSA 1L3LA 3MSHA 3Q1FA 5KMWA 2V20A 2PYPA 3HBRA 1OPXA 3S7QA 3R7WB 2H10A 1XJ6A 2G2UA 4ETZA 1XGJA 4GJ4A 4Y3IA 1GHPA 4UA7A 4B93A 4IUKA 5F5YA 4IVKA 3F1PB 3LO7A 3ZVWA 5CEBA 4HY8A 5EVIA 5HAQA 1XKZA 2V0WA 2VLGA 1JTGA 4GD8A 4KZ8A 4N9LA 3A3EA 1C3BA 1XJ4A 4OQHA 2OAP1 3CPTA 3S4XA 5A92A 2HDRA 3N4IA 2XA7S 2OSUA 3LIAA 1P97A 3D4FA 4IVIA 3HJIA 1DJBA 1PWCA 4X68A 4JXWA 4BL3A 4N9KA 3W8KA 4GS9A 4NXBA 2WUQA 4K91A 4S2KA 2AVXA 2ZQ9A 1CQAA 5FDSA 2JKRM 3MZDA 4ID4A 4DRTA 4EV4A 4NG2A 3G4PA 1FSWA 4MNRA 4P85A 1W8YA 5EM1A 4KQQA 3IHBA 2VGLS 5GLBA 1QMEA 2JKFA 1MPLA 1T18A 1GSVA 3VFFA 1T1BA 3PAGA 1K4FA 3JYIA 4HBTA 3SOIA 3G30A 5EVLA 1Q2QA 4QWOA 2P04A 5FAPA 5AQAA 1ERMA 1G6AA 4HJ4A 1WA9A 2Y91A 5CX7A 4RX3A 3OBFA 2XA7M 3UE6A 3H7WB 4HESA 1H8YA 3KSIA 3BFGA 3BLSA 3IBJA 4NKPA 4PPRA 3PBOA 4X56A 5TBMB 1HD8A 5AQBA 3C38A 3F1PA 5C5KA 4R3BA 4KG6A 5J4EA 3PXPA 2A49A 2DRWA 3JVVA 4OPYA 3ZHHA 1SHVA 5FQQA 1W63Q 1Z09A 2BLSA 4ARZB 2V8CA 3MQOA 3IQAA 5FQKA 4OOLA 2IWDA 1FCNA 2H5SA 3JPUA 1E25A 4U0TA 3T1SA 4DE3A 4B4XA 1W79A 3H9WA 3AGFA 4UA6A 3T12B 3IX4A 3VOYA 1EROA 3QNBA 1KGGA 2VGLM 1LL9A 5U47A 5DVAA 1IFQA 3K3DA 1BLSA 1JVJA 5GLDA 3BFEA 3IBRA 4LRYC 1DP6A 3PBNA 3CLOA 1K6SA 2Y8HA 4LV2A 1YLWA 3IH9A 4I3JA 3IWQA 3T4OA 2HP5A 4A5RA 4B4ZA 2ZMVA 1MBLA 5FQIA 4EEPA 1E3UA 4GLQA 1SZVA 2H0TA 1KGFA 2XQZA 2DCFA 2JC7A 4CLCC 3EQVA 5CGWA 1K54A 4CLCE 4Q8IA 3MBZA 4UA9A 3CWFA 4BD0A 4GB7A 4YINA 3ZQ5A 4N1XA 5LBRA 3NI9A 3FC7A 3F1OB 4P6ZS 3H7WA 3A0VA 1PWDA 3CG5A 4LGWA 3MXQA 3FPWA 3VV4A 2B95A 3KO6A 4X25A 5TBMA 3UB6A 2GX5A 4BMWA 3QNCA 5EM0A 4E3JA 3C5AA 5E2HA 5EPHA 4B9OA 1MWRA 3E4PA 3BECA 1BLHA 4HNBA 3UE1A 4L9GA 1YLPA 3IX8A 1P9RA 2WK0A 1H8ZA 1S67L 3VP0A 1H8MA 4LENA 1XX2A 2W1TB 1XA7A 2Q9MA 4FD8A 1ZC2A 5EECA 5EOEA 2GJ3A 3WS2A 3UO9A 3PR6A 5FQMA 4EERA 2INWA 3OPPA 2VV7A 5EOOA 1S4RA 3UPNA 5CHJA 2ZQCA 4E3MA 3ZYTA 5AQ7A 5G18A 1EWZA 3HUOA 2Y2GA 1BUEA 4HIAA 4P6ZM 5FEFA 3W2ZA 4UEYA 1PW8A 2XSSA 2ZLYA 2X71A 1KOUA 4FTXA 4X6TA 1KE3A 3TE8A 3UDFA 1KE0A 3ISGA 2JE5A 4FH4A 5FATA 3LR3A 4JGQA 3N8SA 1ESIA 4HJ3A 3ZNYA 1S6RA 4R3JA 3Q81A 5HWTA 4X55A 2WGWB 1D7EA 1IYOA 3EEHA 1OMEA 3LY3A 2HJ9C 5FQJA 3F1OA 2IWCA 3S7PA 5I5LA 3FWLA 4WEKA 1YKDA 3WRZA 3E4QA 1ES3A 1WE4A 3VOLA 2W0NA 3AGDA 2PBYA 4ZRRA 5CTNA 4PM6A 4GDNA 4Q0IA 1YAXA 2KOIA 1ES4A 3SZTA 1ERQA 3CJMA 3C4PA 2V0UA 5FASA 3T1QB 4BL2A 4QY5A 5FDHA 4DXBA 3G2ZA 5BOHA 2W1TA 2PT7A 3MZFA 2DMWA 3SS5A 2PAVP 3MXRA 1PNEA 2HDQA 1OTBA 1XJ3A 5F82A 3IF6C 3LEZA 3O86A 5EUAA 3IX3A 4OVDA 3UNWA 2JKRI 3VP2A 4NK3A 1Y54A 5GHYA 1NWZA 4JGPA 3T4QA 1CF0A 1LLBA 1IYQA 1K6RA 3NC8A 3IF5A 3N7WA 4I3AA 2ZC6B 3KX0X 2HP9A 4G3VA 1OTAA 4IUHA 4Y7PA 1PWGA 2ZMFA 3NDGA 5FI2A 1TD5A 2J9OA 2XFTA 3LI8A 2ZC7A 3S1YA 4MMNA 4ESPA 4IEDA 3IXGA 2V1BA 3BRMA 4Y0UA 4E3KA 3KYEA 1T1AA 1I5QA 4F3LB 5KSCA 2EX8A 3UE3A 4DJ3A 2WGWA 1VM1A 2P74A 4HI4A 1YT4A 4JXVA 3WS0A 4M3KA 1K56D 4KUKA 2HDSA 3NULA 3CPTB 3MMHA 4KQRA 1BYWA 2Y2IA 2LB9A 5DJTA 2EA9A 5DF7A 1F5MA 3QP6A 3GSGA 4PM8A 4WUJA 1VB6A 2M1CA 3WWXA 1GCEA 1F9IA 5F69A 1KVLA 4QU3A 1STZA 1VEUA 4GS9B 2HGVA 1IKGA 2W3GA 1UGUA 2XD1A 3UMEA 4OONA 3SH7A 1ALQA 3HUNA 4QPRA 1JWPA 3A3FA 4E3OA 1P9WA 3OCNA 5TGFA 1VHMA 3LEQA 1K55A 2HZ5A 1ZTUA 4Y15A 3V5MA 5FL3A 4S2OA 2I9VA 3UPOA 4ZJ1A 1SKFA 2WKEA 2HJEA 4CLCD 3UB8A 2JKTM 5HARA 4R0QA 4EUVA 3N6IA 3FKWA 4PM5A 3ULFA 1Z6FA 5CGXA 2V1AA 2EXAA 5EVIC 2V2FF 5L8MA 4OLDA 1GHIA 3UPPA 1K38A 4KZ5A 4LCMA 3RXWA 2ZOHA 5HSQA 2J9PA 1FOFA 3GDIA 5CEDA 1NXYA 4XUZA 3IWIA 1FSYA 2P9VB 1S66L 2Y2NA 3AGEA 5J7EA 3UDIA 2KX6A 4NXEA 3BWLA 4F3LA 1G6OA 4OPZA 1HLUP 4ZJ2A 2XFSA 4NETA 2ZQ7A 2OWHA 1N9NA 4WEJA 1D1JA 1LSWA 1XPBA 2ZQAA 3NJAA 2C6WB 4WMCD 4G3KA 2J3WA 2A2LA 2WKPA 3RH8B 4KUOA 3PTEA 3BFCA 4WYYA 4QD4A 4OQIA 1BLPA 2WZXA 2K31A 2KDKA 1VQQA 2YKHA 4R4SA 2ZOIA 3WS1A 5HDSA 4GOGA 5E2FA 2Q0OA 2XGNA 1FQGA 5K5BA 2H28A 4CPKA 2MJ6A 5AQ9A 4Y17A 2Z6DA 1N9LA 4WL9A 4LRZE 2W3EA 5DTSA 1U60A 3GECA 4XUXA 4E3IA 4IBXA 1CI8A 1Y4OA 3DTIA 3E98A 2BG1A 3QP2A 4BENA 2M7VA 3DAVA 1FR6A 3LGOA 4QY6A 5MC7A 3T50A 1M6KA 5EE8A 4EUZA 2IWBA 3KYQA 1MWTA 4R6LA 1MXOA 5J8XA 1L0GA 3T4TA 3PYPA 4IBRA 4GDBA 1FR1A 4Y13A 1TEMA 4EW7A 3LCEA 5FI7A 1NYMA 4S2LA 4JGRA 3PBQA 4EXOA 2NUTC 3ZG8B 1V9YA 4C3QA 3F1NB 4M4XA 3IXHA 2OV5A 4XXRA 4ZTKA 3HL9A 2QHKA 2HF6A 1FCOA 2EX2A 2XK1A 2K2NA 1MZUA 2ZQ8A 1VETB 4GZBA 2PHYA 2ZC3B 4HH2A 5L07A 2VV6A 2EXBA 3MF0A 1GHMA 4FOFA 1N9OA 1MWSA 4GD6A 3PBTA 3NHQA 2P9VA 3IT9A 2XD5A 2OOLA 1P0ZA 3G6OA 1JTDA 4Z9QA 3GTCA 4DE2A 4EESA 3BFDA 3Q07A 5L10A 4ZDXA 3TRCA 4MBHA 5AVEA 5HDCA 3K3CA 3P98A 4D60A 4OQ0A 4I38A 3I7JA 2WKQA 2XH9A 3Q7VA 2BASA 3OCLA 4WBGA 3LUQA 3KYZA 3KSHA 2P7JA 3QP4A 3D3OA 1OTIA 2VJWA 1K54C 3GRJA 5GHXA 3GR2A 4JLFA 5HW3A 3T4SA 5DFXA 2O9AA 1GA9A 1S4SA 4I3IA 3LR5A 4Q0HA 4AFIA 4C75A 1YQSA 1TS6A 3MKEA 1JWVA 4JXGA 2Y4AA 1WYCA 2ZC4B 4DJ2A 3TJZC 4JGOA 1L2SA 2Z2MB 1NLZA 1NY0A 3ITAA 5KIZA 3F1NA 2I72A 1DJCA 4GW9A 1YLYA 2ZJ9A 1S0WA 3UB5P 4I5SA 2FZ0A 3WS4A 4R23A 4EWFA 5F1FA 2ACGA 4IJGA 4UAAA 4XT2A 1XA1A 1IELA 4EBPA 2UWXA 2Y2OA 1KDWA 1VETA 2QMIA 4YFMA 1Q2PA 3OLOA 1DJAA 3UB9A 3S7NA 5KSHA 1ES5A 4HHDA 1SCWA 1S1YA 2EWWA 2W3HA 2Z6CA 1K57A 2O0YA 3O5YA 1PFLA 4R38A 5F6AA 3M6BA 3CAXA 1IYSA 2Y2HA 3DWKA 5EV0A 4LCLA 3SS4A 5IHVA 3UN7A 3S7OA 1ONGA 1BZAA 5A8BA 1CK3A 5FAOA 2PU2A 3P09A 3EOIA 2R78A 3LIEA 4PKYA 1SDEA 1YLZA 4YWZA 3LR4A 1CEFA 3T1XA 1FCMA 1OTDA 1BT5A 3IWOA 1JNUA 5EVID 5M19A 4OLGA 1Y28A 1NYYA 1H5XA 4LV0A 2WAEA 5HPFA 5FI6A 5KZHA 3O88A 5FSRA 3E2KA 3MFDA 2ZL1B 3N8RA 3ZVTA 4E04A 4R1GA 5DTTA 2W3DA 2V9AA 3PHYA 5E43A 1OJ5A 3FYZA 2JKTI 4EBNA 1OTEA 3W4PA 2JN7A 4QB8A 4K0WA 4RVAA 2Y2QA 2FFFB 1PYYA 1OT9A 1G28A 1LI9A 5HFOA 3LY4A 1L0FA 4X53A 2GNXA 3VSKA 2O99A 2OWJA 3C7VA 2ZM2A 3HLEA 4ME4A 1LI0A 1YLTA 3NOUC 1T19A 3QHYA 2J3TC 2J80A 4LPZA 1MKIA 3UDXA 1ZG4A 1D06A 3C30A 3L9KA 4WZ5A 4OH0A 5JYOA 4RQ9A 3G35A 3A3IA 3RJUA 1ZG6A 4KG5A 4RA7A 3CUEA 3NIAA 1VEUB 3PAEA 4L9EA 1F98A 1K0KA 3RTYA 5HWWA 5E2EA 3EQUA 3MJQA 3BM6A 1PIOA 3P01A 1CI9A 3S22A 2UV0E 3QP5A 3VP4A 3OZHA 3VMAA 3B3XA 4JF6A 1I2SA 3NOTC 3BJNA 1S1ZA 4BLMA 3BQAA 3V50A 1YSQA 1HVBA 5A93A 1KDSA 3DTEA 4KZ4A 2QJ7A 1I2WA 1V9ZA 5HPIA 2VX8A 3LICA 2RL3A 5TJJA 1IKIA 3MS6A 4IHQA 4OPQA 2Y79A 2WKIA 4OP8A 3DTKA 2R9XA 3MKFA 2V1ZA 1MWUA 2O9BA 2B5RA 3B33A 2ZL1A 4UQIS 3Q82A 4BJPA 3UY6A 1UWPX 2PU4A 4Y0TA 4BBTA 3IXBA 2Y59A 3NDEA 3A3JA 1KGEA 4MDZA 5CGSA 4E6XA 2WGVA 4F94A 1X0OA 2VK3A 5EFWA 3TOIA 3O3VA 3GQZA 4O8GA 5DKKA 5FAQA 2IA2A 4D2OA 3QP1A 4QJGA 2ZQDA 4GHIB 1OT6A 4PHTA 4KZ7A 3T4KA 4JPMA 1NJ4A 4KG2A 1BULA 4LRXC 3HVFA 2CMNA 3ICYA 3A0RA 4HBUA 3NECA 1N4OA 4Q0JA 1E3UD 3GVBA 2X01A 1K55C 5HL1A 1YMXA 3CHWP 2ZM0A 5G4ZA 4FH2A 3OC2A 4MEZA 4FCFA 2XLNA 4H6JB 4JF5A 4UQIM 5HAPA 2QYBA 2ZC5B 1TDLA 2EX9A 1PRQA 1PZPA 3PBRA 2J8YA 3G2YA 3LIBA 4DE0A 3EWKA 4K08A 2V8FA 4OOMA 5M1AA 2Y2MA 1F2KA 1GA0A 2QPNA 4JBFA 3BY8A 3HCYA 1NZUA 3G31A 5J3WA 3VFHA 3HLDA 3P7NA 2PR6A 3W4QA 1ZHHB 3MZEA 2JBFA 2XR0A 1DP8A 1CJFA 5CHUA 3DW0A 3EGDC 4CQHA 5DF9A 4P87A 4MN5A 5GHZA 2P08A 5HX9A 3HLFA 3KSFA 5M18A 4JF4A 2QWSA 4S2IA 5CHMA 4HOIA 1H0MA 2VZWA 1IYPA 4LV3A 2WKHA 4EQ1A 2C5WB 5F68A 3ZCZA 3M2JA 4KZ3A 1W7FA 3LFVA 5FQ9A 2EWVA 3TW8A 2VGKA 3HREA 1MY8A 5F83A 3G34A 4EQIA 1PI5A 3MQ0A 4GHIA 4L0LA 3DBAA 3FG8A 1SKOA 5A91A 1O07A 4ZAMA 1PI4A 4R4RA 1ES2A 4DDYA 4LFUA 4X1LA 4N1HA 3CI6A 2D01A 4BD1A 3NOPC 2EFXA 3SW1A 1L0DA 3FPVA 3A0SA 3Q7VB 3HLGA 3M6HA 3H82A 4P0MA 1T1CA 2LB5A 2Z2LB 1L0EA 2VEAA 3A3DA 4PKYG 4S2JA 2OLUA 3W4OA 3R4KA 4H6JA 3E0YA 4S2PA 1YSPA 1RP5A 1ZKJA 4GN2A 2Y2JA 4MN7A 3NY4A 4C6YA 4OPRA 5HL6A 3HLCA 4RYEA 1BLCA 2L0WA 1KE4A 2Y2PA 3BEBA 5HDDA 2QZ6A 4I39A 3ITBA 3OOVA 4NXFA 5CRFA 4DF6A 2RCXA 4KZAA 4XT2B 1M40A 3VE3A 4KZ9A 2J3TD 2PBDP 2G2WA 3B42A 1NZOA 2WZZA 3MR0A 1PW1A 3NBLA 1AXBA 4Y5FA 1XXMA 3IS2B 5F1GA 3QP8A 5FA7A 2OAQ1 3R7WA 4GCZA 1HTZA 2JKGA 2YKFA 4HJ6A 4EEUA 1E4DA 4K0XA 5IU1A 5HD3A 5DKLA 5HAIA 3BYDA 1DRMA 4CLCB 2OLVA 3PBSA 5DTKA 1HZOA 3V67A 2PDRA 4MBFA 1NRFA 4BBUA 3VSLA 3V39A 5CTMA 4H8RA 1FIKA 1J3WA 4ZBEA 5AJGA 4O01A 4R70A 3V3SA 3Q7ZA 3WRTA 3JVUA 3SH9A 5CECA 5DJUA 2XDMA 1K56A 2A24B 2PD8A 4LV1A 4L9FA 4HEFA 1AWIA 2WADA 4Z1WA 3KSGA 2PRFA 1GSXA 2EX6A 3BLMA 3IHAA 4WELA 1QMFA 4B88A 2A3UA 3VOZA 4E3NA 3C4OA 4S2MA 1FILA 5EVEA 4FSFA 1TF1A 1UWNX 2ZD8A 1K57C 2L4RA 1EW0A 5CERA 4BBVA 1IEMA 1YPRA 4PAUA 3ZG5A 1O7EA 1GSWA 1LHYA 3C8CA 1LSVA 2G7UA 3IS2A 3E2LA 3UMDA 3N8LA 3IH8A 1K25A 1EI5A 3MFXA 5IT5A 1TS8A 5I94A 3CMZA 1DY6A 4NXGA 3LIFA 4CLCA 4P6BA 3T1RA 1BSGA 4DDSA 4OKPA 2X02A 2GDNA 3SH8A 1XFQA 1H3QA 1LL5A 4ARZA 5HD5A 3HJKA 1G68A 3BQ8A 2R9WA 3DTMA 3M2KA 3OPHA 3C7UA 3CZDA 3ZG9B 4LLOB 4MCWA 1G5UA 2ZM8A 4RX2A 3UB7A 3E4OA 3EEAA 3FV7A 2L1MA 3T4JA 3TG9A 2B18A 4Y0OA 2JHEA 5L09A 4WLAA 3HUMA 3TSGA 4HQAA 4KQOA 2JCHA 1ODVA 5CXWA 5DFYA 1LSXA 1W5DA 3FKVA 2A24A 5FEGA 4WMCA 1MKMA 4EBLA 3RFBA 4WN5A 5D3OA 3LI9A 3D9YA 4E3LA 5DF8A 1RGYA 2XROA 1XP4A 4KQDA 5JYPA 4WZ5C 1ACFA 4CJNA 3ZG0A 4DXCA 2HPBA 3IF6B 1IOUA 5GLCA 2GZAA 3CUEC 3LR0A 3MQQA 2EFUA 2B02A 3LYXA 2ZBBA 3RXXA 1TVFA 3VP3A 2O9CA 5G4YA 5HWVA 2E8JA 3BW6A 4G3WA 1WYBA 2D02A 5AVFA 3WS5A 3L7HA 4KENB 4KZ6A 3T4LA 4DN0A 1LT0A 2H0YA 2FH5A 2WKRA 2W27A 1CEGA 4HH3A 2Y2LA 5GLAA 4WZ4A 2PR5A 1YMSA 4MN6A 4JKTA 4YOFA 1DP9A 2KLIA 4E6WA 4PM9A 3UE0A 1SDNA 4ZJ3A 4BQMA 3NCKA 4YNRA 4Y2FA 5E2GA 2WGIA 1RCJA 3ZGAB
chains in the Genus database with same CATH topology
3EWKA 4K08A 4OOMA 3MXQA 3FPWA 3VV4A 3KO6A 5TBMA 3BY8A 2QHKA 2GX5A 2HF6A 4II7A 3UB6A 3HCYA 4BMWA 5J3WA 4EETB 3P7NA 2PR6A 2K2NA 1MZUA 1ZHHB 4B9OA 3E4PA 2PHYA 4DMZA 4HNBA 1DP8A 4HH2A 2NUPC 3EGDC 2VV6A 3MF0A 4L9GA 4CQHA 4FOFA 1N9OA 5DF9A 1P9RA 3PBTA 3NHQA 3D72A 4MN5A 1S67L 2OOLA 1W63M 2P08A 3KSFA 1H8MA 2PYRA 1P0ZA 3G6OA 2W1TB 2QWSA 3VE4A 4EESA 4HOIA 2VZWA 2VA0A 4EQ1A 5F68A 3LIDA 3LFVA 2GJ3A 3TRCA 3BY9A 2EWVA 5AVEA 5HDCA 3TW8A 3K3CA 3PR6A 1TS7A 4EERA 4EU0A 2INWA 2VV7A 4R3AA 4NEED 1XFNA 1S4RA 5HZHA 4I38A 3MQ0A 4GHIA 1OJGA 2WKQA 4L0LA 3DBAA 3FG8A 3ZYTA 2QKPA 2HV1A 2BASA 3OCLA 3LUQA 3KYZA 4HIAA 1LL8A 4P6ZM 3CI6A 3KSHA 2D01A 2P7JA 3W2ZA 3NOPC 4HP9A 3SW1A 3D3OA 2VV8A 4UEYA 2XSSA 3U2AA 3FPVA 3A0SA 1OTIA 2VJWA 1KOUA 3H82A 1T1CA 2LB5A 1NRJA 1NLYA 3TE8A 2VEAA 4PKYG 5DFXA 3T4SA 2O9AA 1S4SA 4I3IA 3LR5A 4Q0HA 4AFIA 3LR3A 4JGQA 1TS6A 3B47A 3R4KA 4HP4A 4H6JA 3E0YA 3H82B 4HJ3A 5HWTA 1YSPA 4DJ2A 1D7EA 3EEHA 1MC0A 3TJZC 2W3FA 4JGOA 4MN7A 2HJ9C 1NLZA 3F1OA 5HL6A 2K7SA 5KIZA 2XRNA 5IS1A 3F1NA 3S7PA 1XJ2A 5I5LA 4GW9A 4WEKA 1YKDA 3C2WA 3E4QA 4I5SA 2FZ0A 2L0WA 3VOLA 4ETXA 2W0NA 4ZRRA 4BWIA 4IJGA 4XT2A 4Q0IA 1YAXA 5HDDA 2KOIA 4I39A 3OOVA 4NXFA 2QJ5A 4WF0A 2VKSA 4XT2B 3VE3A 3OLOA 2V0UA 3UB9A 2J3TD 2M7UA 3CITA 3S7NA 5KSHA 4O0PA 2W1TA 3B42A 3EGXC 2PT7A 4HHDA 2DMWA 1S1YA 2EWWA 2W3HA 2Z6CA 3K2NA 3MR0A 2O0YA 3O5YA 2PD7A 4Y5FA 3IS2B 4R38A 2W1RA 5F6AA 1OTBA 3CAXA 2OAQ1 3R7WA 1XJ3A 1TS0A 4GCZA 2YKFA 4HJ6A 4EEUA 3S7OA 5IU1A 5HD3A 5DKLA 5A8BA 2PYPA 1DRMA 4CLCB 1OPXA 3S7QA 3R7WB 1XJ6A 2JKRI 3PBSA 4ETZA 3V67A 2PDRA 1NWZA 4JGPA 3T4QA 3EOIA 2R78A 4GJ4A 3LIEA 4Y3IA 4PKYA 4BBUA 4B93A 4IUKA 5F5YA 4I3AA 3KX0X 4YWZA 3LR4A 4G3VA 3F1PB 1OTAA 4IUHA 2ZMFA 5AJGA 4O01A 1TD5A 1OTDA 1JNUA 4HY8A 3LI8A 4R70A 1Y28A 5HPFA 3JVUA 4MMNA 2V0WA 2VLGA 4E04A 2V1BA 2W3DA 1XJ4A 1T1AA 2OAP1 2V9AA 3PHYA 5DJUA 4F3LB 1OJ5A 2JKTI 3UE3A 4DJ3A 1OTEA 4HI4A 2JN7A 2XA7S 4KUKA 2A24B 2PD8A 3LIAA 4L9FA 1OT9A 1G28A 4Z1WA 1P97A 3KSGA 3MMHA 1BYWA 2GNXA 1GSXA 2LB9A 5DJTA 3HJIA 2O99A 2EA9A 2OWJA 4WELA 1F5MA 4GS9A 4NXBA 4WUJA 1VB6A 2M1CA 4ME4A 1F9IA 5F69A 3NOUC 1T19A 2J3TC 2J80A 4LPZA 4FSFA 1D06A 2JKRM 3C30A 1STZA 1TF1A 1UWNX 4GS9B 4RQ9A 2HGVA 2W3GA 1UGUA 2L4RA 1EW0A 4BBVA 4PAUA 3CUEA 3UMEA 1GSWA 4L9EA 4QPRA 1F98A 2VGLS 3C8CA 3RTYA 1LSVA 5HWWA 2G7UA 3EQUA 3MJQA 1P9WA 3IS2A 3OCNA 1T18A 1VHMA 3P01A 1GSVA 1T1BA 1ZTUA 5FL3A 3UMDA 2I9VA 3MFXA 5IT5A 2P04A 1TS8A 4NXGA 2HJEA 4CLCD 3UB8A 3LIFA 4CLCA 4HJ4A 2JKTM 3NOTC 1WA9A 4EUVA 5CX7A 3BJNA 1S1ZA 3OBFA 2XA7M 3UE6A 3ULFA 3BQAA 2V1AA 1YSQA 3H7WB 1XFQA 3KSIA 1H3QA 5L8MA 5HD5A 2QJ7A 3HJKA 4ARZA 3IBJA 1V9ZA 4NKPA 3PBOA 5HPIA 5TBMB 3BQ8A 2VX8A 3LICA 5TJJA 3C38A 3F1PA 5C5KA 4IHQA 2Y79A 4LLOB 4MCWA 2ZOHA 5J4EA 3PXPA 3UB7A 3JVVA 5HSQA 3E4OA 3EEAA 1W63Q 4ARZB 3GDIA 3MQOA 4OOLA 3T4JA 2L1MA 2O9BA 2B18A 3B33A 4UQIS 2JHEA 1S66L 4BJPA 4WLAA 5J7EA 2KX6A 4NXEA 4HQAA 3BWLA 4F3LA 1G6OA 4KQOA 3H9WA 1UWPX 1ODVA 5DFYA 1LSXA 2OWHA 1N9NA 4WEJA 1LSWA 4BBTA 3NJAA 4G3KA 2A24A 2J3WA 2A2LA 2WKPA 4MDZA 1MKMA 3RFBA 2VGLM 1X0OA 4WN5A 3RH8B 5EFWA 3LI9A 4KUOA 1IFQA 3K3DA 4O8GA 5DKKA 2IA2A 3IBRA 4LRYC 2XROA 4KQDA 2K31A 2KDKA 2YKHA 1DP6A 3PBNA 4GHIB 1OT6A 2ZOIA 3CLOA 5HDSA 4PHTA 2Y8HA 3T4KA 5K5BA 1IOUA 2H28A 2GZAA 3CUEC 4I3JA 3LR0A 4LRXC 3T4OA 2MJ6A 3MQQA 2CMNA 3ICYA 3A0RA 2Z6DA 2B02A 1N9LA 3LYXA 4WL9A 2ZMVA 2ZBBA 4LRZE 2O9CA 2W3EA 4Q0JA 5G4YA 4EEPA 4GLQA 5HWVA 3GECA 3BW6A 4G3WA 2D02A 3E98A 5AVFA 5G4ZA 2M7VA 3OC2A 5MC7A 3T50A 3T4LA 4CLCC 4DN0A 3KYQA 3EQVA 1LT0A 2WKRA 2FH5A 4R6LA 2W27A 4HH3A 3T4TA 4CLCE 4H6JB 3PYPA 4UQIM 3CWFA 2PR5A 2QYBA 4EW7A 3ZQ5A 4MN6A 4YOFA 5LBRA 1DP9A 4JGRA 2KLIA 3PBQA 3PBRA 4EXOA 3FC7A 2NUTC 3F1OB 1V9YA 4P6ZS 3F1NB 4Y2FA 4YNRA 4M4XA 3LIBA 3H7WA 3A0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWK A;  4K08 A;  3MXQ A;  5TBM A;  3BY8 A;  2QHK A;  3UB6 A;  5J3W A;  4EET B;  3P7N A;  2PR6 A;  1MZU A;  4B9O A;  3E4P A;  2PHY A;  4HNB A;  1DP8 A;  4HH2 A;  2VV6 A;  4L9G A;  1N9O A;  3NHQ A;  3D72 A;  4MN5 A;  1S67 L;  2OOL A;  2PYR A;  1P0Z A;  3G6O A;  2QWS A;  3VE4 A;  4EES A;  4HOI A;  4EQ1 A;  5F68 A;  3LID A;  2GJ3 A;  3BY9 A;  5AVE A;  5HDC A;  3K3C A;  1TS7 A;  4EER A;  2INW A;  2VV7 A;  4R3A A;  1XFN A;  1S4R A;  5HZH A;  4I38 A;  4GHI A;  1OJG A;  2WKQ A;  3FG8 A;  2QKP A;  2HV1 A;  2BAS A;  3LUQ A;  4HIA A;  1LL8 A;  2D01 A;  2P7J A;  3NOP C;  4HP9 A;  3SW1 A;  2VV8 A;  3A0S A;  1OTI A;  1KOU A;  3H82 A;  1T1C A;  2VEA A;  4PKY G;  1S4S A;  4I3I A;  4JGQ A;  1TS6 A;  4HP4 A;  4H6J A;  3H82 B;  4HJ3 A;  5HWT A;  4DJ2 A;  1D7E A;  3EEH A;  4JGO A;  3F1O A;  2K7S A;  5KIZ A;  5IS1 A;  3F1N A;  1XJ2 A;  5I5L A;  4GW9 A;  3C2W A;  3E4Q A;  4I5S A;  2L0W A;  3VOL A;  2W0N A;  4XT2 A;  5HDD A;  4I39 A;  4NXF A;  2QJ5 A;  4WF0 A;  4XT2 B;  3VE3 A;  3OLO A;  2V0U A;  3UB9 A;  4HHD A;  1S1Y A;  2Z6C A;  3MR0 A;  2PD7 A;  3IS2 B;  4R38 A;  5F6A A;  1OTB A;  3CAX A;  1XJ3 A;  1TS0 A;  4GCZ A;  2YKF A;  4HJ6 A;  4EEU A;  5IU1 A;  5HD3 A;  5DKL A;  5A8B A;  2PYP A;  1DRM A;  1XJ6 A;  2PDR A;  1NWZ A;  4JGP A;  2R78 A;  3LIE A;  4PKY A;  4BBU A;  5F5Y A;  4I3A A;  3KX0 X;  4YWZ A;  3F1P B;  1OTA A;  1OTD A;  1JNU A;  4HY8 A;  3LI8 A;  4R70 A;  1Y28 A;  2V0W A;  2VLG A;  4E04 A;  2V1B A;  1XJ4 A;  1T1A A;  2V9A A;  3PHY A;  5DJU A;  4F3L B;  1OJ5 A;  4DJ3 A;  1OTE A;  4HI4 A;  2JN7 A;  4KUK A;  2A24 B;  2PD8 A;  3LIA A;  4L9F A;  1OT9 A;  1G28 A;  1P97 A;  1BYW A;  1GSX A;  5DJT A;  3HJI A;  2EA9 A;  2OWJ A;  4GS9 A;  4NXB A;  4WUJ A;  1VB6 A;  2M1C A;  1F9I A;  5F69 A;  3NOU C;  1T19 A;  2J80 A;  4LPZ A;  1D06 A;  1UWN X;  4GS9 B;  4RQ9 A;  1UGU A;  2L4R A;  1EW0 A;  4BBV A;  3UME A;  1GSW A;  4L9E A;  1F98 A;  3C8C A;  3RTY A;  1LSV A;  5HWW A;  3MJQ A;  3IS2 A;  1T18 A;  1GSV A;  1T1B A;  3UMD A;  2I9V A;  3MFX A;  1TS8 A;  4NXG A;  3UB8 A;  3LIF A;  4HJ4 A;  3NOT C;  1WA9 A;  1S1Z A;  3ULF A;  3UE6 A;  2V1A A;  3H7W B;  1XFQ A;  5HD5 A;  2QJ7 A;  3HJK A;  1V9Z A;  5TBM B;  3LIC A;  3F1P A;  4LLO B;  2ZOH A;  5J4E A;  3UB7 A;  5HSQ A;  3E4O A;  3GDI A;  3MQO A;  2L1M A;  3B33 A;  2JHE A;  1S66 L;  4WLA A;  5J7E A;  2KX6 A;  4NXE A;  4HQA A;  3BWL A;  4F3L A;  3H9W A;  1UWP X;  1ODV A;  1LSX A;  2OWH A;  1N9N A;  1LSW A;  4BBT A;  3NJA A;  2A24 A;  2WKP A;  1X0O A;  4WN5 A;  3RH8 B;  5EFW A;  3LI9 A;  4KUO A;  3K3D A;  5DKK A;  3IBR A;  4LRY C;  4KQD A;  2KDK A;  2YKH A;  1DP6 A;  4GHI B;  1OT6 A;  2ZOI A;  3CLO A;  5HDS A;  2H28 A;  4I3J A;  4LRX C;  3MQQ A;  2CMN A;  3ICY A;  3A0R A;  2Z6D A;  2B02 A;  1N9L A;  3LYX A;  4WL9 A;  2ZBB A;  4LRZ E;  5G4Y A;  4EEP A;  5HWV A;  3GEC A;  2D02 A;  5AVF A;  5G4Z A;  3T50 A;  4R6L A;  1LT0 A;  2WKR A;  2W27 A;  4HH3 A;  4H6J B;  3PYP A;  3CWF A;  2PR5 A;  4EW7 A;  3ZQ5 A;  4MN6 A;  1DP9 A;  4JGR A;  4EXO A;  3FC7 A;  3F1O B;  1V9Y A;  3F1N B;  4M4X A;  3LIB A;  3H7W A;  3A0V A; 
#chains in the Genus database with same CATH topology
 4WM9 A;  3O87 A;  1W8Q A;  1J9M A;  4MLL A;  4II7 A;  5A90 A;  5TR7 A;  4EET B;  4UHU A;  5L2F A;  2Q9N A;  4U3T A;  4DMZ A;  1N9B A;  2NUP C;  2HDU A;  3DWZ A;  1XGI A;  3ZFZ A;  3BFF A;  4OQG A;  3D72 A;  3HLW A;  1W63 M;  4N92 A;  2PYR A;  2FFY A;  3VE4 A;  3HLB A;  2VA0 A;  2ZMA A;  1YM1 A;  3LID A;  3OPL A;  3U4L P;  3BY9 A;  1TS7 A;  4EU0 A;  4R3A A;  4NEE D;  2CC1 A;  1XFN A;  3V3R A;  5HZH A;  2E8I A;  1OJG A;  3ZG7 B;  3IF6 A;  2QKP A;  2WYX A;  3VP1 A;  2HV1 A;  4S2N C;  4OOY A;  2VGJ A;  3OPR A;  1LL8 A;  3SS3 A;  4HP9 A;  2VV8 A;  4MBK A;  1SKO B;  2BTF P;  4PMA A;  3U2A A;  4FUW A;  4KZB A;  1BTL A;  1ESU A;  1PZO A;  5EVI B;  3IXD A;  1NRJ A;  1NLY A;  3MXS A;  5GL9 A;  1ONH A;  1JWZ A;  2Y55 A;  4S2N A;  3B47 A;  2Y2K A;  4HP4 A;  3H82 B;  3ZDJ A;  1TDG A;  4QHC A;  3GV9 A;  1MC0 A;  3FZC A;  2W3F A;  2XEP A;  2WAF A;  1YLJ A;  2J7V A;  2K7S A;  2XRN A;  5IS1 A;  2XF3 A;  1XJ2 A;  3C2W A;  3G32 A;  1A0K A;  4U0X A;  4ETX A;  4BWI A;  2HP6 A;  1K4E A;  4X1M A;  3GMW A;  4OP5 A;  3ZNT A;  2QJ5 A;  4GNU A;  4WF0 A;  2VKS A;  4GKU A;  2M7U A;  3CIT A;  4PM7 A;  4O0P A;  3EGX C;  1KVM A;  3K2N A;  4DKI A;  2PD7 A;  4O7D A;  2W1R A;  4DE1 A;  4X69 A;  1TS0 A;  1RGZ A;  2DNS A;  5TFQ A;  4JXS A;  1L3L A;  3MSH A;  3Q1F A;  5KMW A;  2V20 A;  2PYP A;  3HBR A;  1OPX A;  3S7Q A;  3R7W B;  2H10 A;  1XJ6 A;  2G2U A;  4ETZ A;  1XGJ A;  4GJ4 A;  4Y3I A;  1GHP A;  4UA7 A;  4B93 A;  4IUK A;  5F5Y A;  4IVK A;  3F1P B;  3LO7 A;  3ZVW A;  5CEB A;  4HY8 A;  5EVI A;  5HAQ A;  1XKZ A;  2V0W A;  2VLG A;  1JTG A;  4GD8 A;  4KZ8 A;  4N9L A;  3A3E A;  1C3B A;  1XJ4 A;  4OQH A;  2OAP 1;  3CPT A;  3S4X A;  5A92 A;  2HDR A;  3N4I A;  2XA7 S;  2OSU A;  3LIA A;  1P97 A;  3D4F A;  4IVI A;  3HJI A;  1DJB A;  1PWC A;  4X68 A;  4JXW A;  4BL3 A;  4N9K A;  3W8K A;  4GS9 A;  4NXB A;  2WUQ A;  4K91 A;  4S2K A;  2AVX A;  2ZQ9 A;  1CQA A;  5FDS A;  2JKR M;  3MZD A;  4ID4 A;  4DRT A;  4EV4 A;  4NG2 A;  3G4P A;  1FSW A;  4MNR A;  4P85 A;  1W8Y A;  5EM1 A;  4KQQ A;  3IHB A;  2VGL S;  5GLB A;  1QME A;  2JKF A;  1MPL A;  1T18 A;  1GSV A;  3VFF A;  1T1B A;  3PAG A;  1K4F A;  3JYI A;  4HBT A;  3SOI A;  3G30 A;  5EVL A;  1Q2Q A;  4QWO A;  2P04 A;  5FAP A;  5AQA A;  1ERM A;  1G6A A;  4HJ4 A;  1WA9 A;  2Y91 A;  5CX7 A;  4RX3 A;  3OBF A;  2XA7 M;  3UE6 A;  3H7W B;  4HES A;  1H8Y A;  3KSI A;  3BFG A;  3BLS A;  3IBJ A;  4NKP A;  4PPR A;  3PBO A;  4X56 A;  5TBM B;  1HD8 A;  5AQB A;  3C38 A;  3F1P A;  5C5K A;  4R3B A;  4KG6 A;  5J4E A;  3PXP A;  2A49 A;  2DRW A;  3JVV A;  4OPY A;  3ZHH A;  1SHV A;  5FQQ A;  1W63 Q;  1Z09 A;  2BLS A;  4ARZ B;  2V8C A;  3MQO A;  3IQA A;  5FQK A;  4OOL A;  2IWD A;  1FCN A;  2H5S A;  3JPU A;  1E25 A;  4U0T A;  3T1S A;  4DE3 A;  4B4X A;  1W79 A;  3H9W A;  3AGF A;  4UA6 A;  3T12 B;  3IX4 A;  3VOY A;  1ERO A;  3QNB A;  1KGG A;  2VGL M;  1LL9 A;  5U47 A;  5DVA A;  1IFQ A;  3K3D A;  1BLS A;  1JVJ A;  5GLD A;  3BFE A;  3IBR A;  4LRY C;  1DP6 A;  3PBN A;  3CLO A;  1K6S A;  2Y8H A;  4LV2 A;  1YLW A;  3IH9 A;  4I3J A;  3IWQ A;  3T4O A;  2HP5 A;  4A5R A;  4B4Z A;  2ZMV A;  1MBL A;  5FQI A;  4EEP A;  1E3U A;  4GLQ A;  1SZV A;  2H0T A;  1KGF A;  2XQZ A;  2DCF A;  2JC7 A;  4CLC C;  3EQV A;  5CGW A;  1K54 A;  4CLC E;  4Q8I A;  3MBZ A;  4UA9 A;  3CWF A;  4BD0 A;  4GB7 A;  4YIN A;  3ZQ5 A;  4N1X A;  5LBR A;  3NI9 A;  3FC7 A;  3F1O B;  4P6Z S;  3H7W A;  3A0V A;  1PWD A;  3CG5 A;  4LGW A;  3MXQ A;  3FPW A;  3VV4 A;  2B95 A;  3KO6 A;  4X25 A;  5TBM A;  3UB6 A;  2GX5 A;  4BMW A;  3QNC A;  5EM0 A;  4E3J A;  3C5A A;  5E2H A;  5EPH A;  4B9O A;  1MWR A;  3E4P A;  3BEC A;  1BLH A;  4HNB A;  3UE1 A;  4L9G A;  1YLP A;  3IX8 A;  1P9R A;  2WK0 A;  1H8Z A;  1S67 L;  3VP0 A;  1H8M A;  4LEN A;  1XX2 A;  2W1T B;  1XA7 A;  2Q9M A;  4FD8 A;  1ZC2 A;  5EEC A;  5EOE A;  2GJ3 A;  3WS2 A;  3UO9 A;  3PR6 A;  5FQM A;  4EER A;  2INW A;  3OPP A;  2VV7 A;  5EOO A;  1S4R A;  3UPN A;  5CHJ A;  2ZQC A;  4E3M A;  3ZYT A;  5AQ7 A;  5G18 A;  1EWZ A;  3HUO A;  2Y2G A;  1BUE A;  4HIA A;  4P6Z M;  5FEF A;  3W2Z A;  4UEY A;  1PW8 A;  2XSS A;  2ZLY A;  2X71 A;  1KOU A;  4FTX A;  4X6T A;  1KE3 A;  3TE8 A;  3UDF A;  1KE0 A;  3ISG A;  2JE5 A;  4FH4 A;  5FAT A;  3LR3 A;  4JGQ A;  3N8S A;  1ESI A;  4HJ3 A;  3ZNY A;  1S6R A;  4R3J A;  3Q81 A;  5HWT A;  4X55 A;  2WGW B;  1D7E A;  1IYO A;  3EEH A;  1OME A;  3LY3 A;  2HJ9 C;  5FQJ A;  3F1O A;  2IWC A;  3S7P A;  5I5L A;  3FWL A;  4WEK A;  1YKD A;  3WRZ A;  3E4Q A;  1ES3 A;  1WE4 A;  3VOL A;  2W0N A;  3AGD A;  2PBY A;  4ZRR A;  5CTN A;  4PM6 A;  4GDN A;  4Q0I A;  1YAX A;  2KOI A;  1ES4 A;  3SZT A;  1ERQ A;  3CJM A;  3C4P A;  2V0U A;  5FAS A;  3T1Q B;  4BL2 A;  4QY5 A;  5FDH A;  4DXB A;  3G2Z A;  5BOH A;  2W1T A;  2PT7 A;  3MZF A;  2DMW A;  3SS5 A;  2PAV P;  3MXR A;  1PNE A;  2HDQ A;  1OTB A;  1XJ3 A;  5F82 A;  3IF6 C;  3LEZ A;  3O86 A;  5EUA A;  3IX3 A;  4OVD A;  3UNW A;  2JKR I;  3VP2 A;  4NK3 A;  1Y54 A;  5GHY A;  1NWZ A;  4JGP A;  3T4Q A;  1CF0 A;  1LLB A;  1IYQ A;  1K6R A;  3NC8 A;  3IF5 A;  3N7W A;  4I3A A;  2ZC6 B;  3KX0 X;  2HP9 A;  4G3V A;  1OTA A;  4IUH A;  4Y7P A;  1PWG A;  2ZMF A;  3NDG A;  5FI2 A;  1TD5 A;  2J9O A;  2XFT A;  3LI8 A;  2ZC7 A;  3S1Y A;  4MMN A;  4ESP A;  4IED A;  3IXG A;  2V1B A;  3BRM A;  4Y0U A;  4E3K A;  3KYE A;  1T1A A;  1I5Q A;  4F3L B;  5KSC A;  2EX8 A;  3UE3 A;  4DJ3 A;  2WGW A;  1VM1 A;  2P74 A;  4HI4 A;  1YT4 A;  4JXV A;  3WS0 A;  4M3K A;  1K56 D;  4KUK A;  2HDS A;  3NUL A;  3CPT B;  3MMH A;  4KQR A;  1BYW A;  2Y2I A;  2LB9 A;  5DJT A;  2EA9 A;  5DF7 A;  1F5M A;  3QP6 A;  3GSG A;  4PM8 A;  4WUJ A;  1VB6 A;  2M1C A;  3WWX A;  1GCE A;  1F9I A;  5F69 A;  1KVL A;  4QU3 A;  1STZ A;  1VEU A;  4GS9 B;  2HGV A;  1IKG A;  2W3G A;  1UGU A;  2XD1 A;  3UME A;  4OON A;  3SH7 A;  1ALQ A;  3HUN A;  4QPR A;  1JWP A;  3A3F A;  4E3O A;  1P9W A;  3OCN A;  5TGF A;  1VHM A;  3LEQ A;  1K55 A;  2HZ5 A;  1ZTU A;  4Y15 A;  3V5M A;  5FL3 A;  4S2O A;  2I9V A;  3UPO A;  4ZJ1 A;  1SKF A;  2WKE A;  2HJE A;  4CLC D;  3UB8 A;  2JKT M;  5HAR A;  4R0Q A;  4EUV A;  3N6I A;  3FKW A;  4PM5 A;  3ULF A;  1Z6F A;  5CGX A;  2V1A A;  2EXA A;  5EVI C;  2V2F F;  5L8M A;  4OLD A;  1GHI A;  3UPP A;  1K38 A;  4KZ5 A;  4LCM A;  3RXW A;  2ZOH A;  5HSQ A;  2J9P A;  1FOF A;  3GDI A;  5CED A;  1NXY A;  4XUZ A;  3IWI A;  1FSY A;  2P9V B;  1S66 L;  2Y2N A;  3AGE A;  5J7E A;  3UDI A;  2KX6 A;  4NXE A;  3BWL A;  4F3L A;  1G6O A;  4OPZ A;  1HLU P;  4ZJ2 A;  2XFS A;  4NET A;  2ZQ7 A;  2OWH A;  1N9N A;  4WEJ A;  1D1J A;  1LSW A;  1XPB A;  2ZQA A;  3NJA A;  2C6W B;  4WMC D;  4G3K A;  2J3W A;  2A2L A;  2WKP A;  3RH8 B;  4KUO A;  3PTE A;  3BFC A;  4WYY A;  4QD4 A;  4OQI A;  1BLP A;  2WZX A;  2K31 A;  2KDK A;  1VQQ A;  2YKH A;  4R4S A;  2ZOI A;  3WS1 A;  5HDS A;  4GOG A;  5E2F A;  2Q0O A;  2XGN A;  1FQG A;  5K5B A;  2H28 A;  4CPK A;  2MJ6 A;  5AQ9 A;  4Y17 A;  2Z6D A;  1N9L A;  4WL9 A;  4LRZ E;  2W3E A;  5DTS A;  1U60 A;  3GEC A;  4XUX A;  4E3I A;  4IBX A;  1CI8 A;  1Y4O A;  3DTI A;  3E98 A;  2BG1 A;  3QP2 A;  4BEN A;  2M7V A;  3DAV A;  1FR6 A;  3LGO A;  4QY6 A;  5MC7 A;  3T50 A;  1M6K A;  5EE8 A;  4EUZ A;  2IWB A;  3KYQ A;  1MWT A;  4R6L A;  1MXO A;  5J8X A;  1L0G A;  3T4T A;  3PYP A;  4IBR A;  4GDB A;  1FR1 A;  4Y13 A;  1TEM A;  4EW7 A;  3LCE A;  5FI7 A;  1NYM A;  4S2L A;  4JGR A;  3PBQ A;  4EXO A;  2NUT C;  3ZG8 B;  1V9Y A;  4C3Q A;  3F1N B;  4M4X A;  3IXH A;  2OV5 A;  4XXR A;  4ZTK A;  3HL9 A;  2QHK A;  2HF6 A;  1FCO A;  2EX2 A;  2XK1 A;  2K2N A;  1MZU A;  2ZQ8 A;  1VET B;  4GZB A;  2PHY A;  2ZC3 B;  4HH2 A;  5L07 A;  2VV6 A;  2EXB A;  3MF0 A;  1GHM A;  4FOF A;  1N9O A;  1MWS A;  4GD6 A;  3PBT A;  3NHQ A;  2P9V A;  3IT9 A;  2XD5 A;  2OOL A;  1P0Z A;  3G6O A;  1JTD A;  4Z9Q A;  3GTC A;  4DE2 A;  4EES A;  3BFD A;  3Q07 A;  5L10 A;  4ZDX A;  3TRC A;  4MBH A;  5AVE A;  5HDC A;  3K3C A;  3P98 A;  4D60 A;  4OQ0 A;  4I38 A;  3I7J A;  2WKQ A;  2XH9 A;  3Q7V A;  2BAS A;  3OCL A;  4WBG A;  3LUQ A;  3KYZ A;  3KSH A;  2P7J A;  3QP4 A;  3D3O A;  1OTI A;  2VJW A;  1K54 C;  3GRJ A;  5GHX A;  3GR2 A;  4JLF A;  5HW3 A;  3T4S A;  5DFX A;  2O9A A;  1GA9 A;  1S4S A;  4I3I A;  3LR5 A;  4Q0H A;  4AFI A;  4C75 A;  1YQS A;  1TS6 A;  3MKE A;  1JWV A;  4JXG A;  2Y4A A;  1WYC A;  2ZC4 B;  4DJ2 A;  3TJZ C;  4JGO A;  1L2S A;  2Z2M B;  1NLZ A;  1NY0 A;  3ITA A;  5KIZ A;  3F1N A;  2I72 A;  1DJC A;  4GW9 A;  1YLY A;  2ZJ9 A;  1S0W A;  3UB5 P;  4I5S A;  2FZ0 A;  3WS4 A;  4R23 A;  4EWF A;  5F1F A;  2ACG A;  4IJG A;  4UAA A;  4XT2 A;  1XA1 A;  1IEL A;  4EBP A;  2UWX A;  2Y2O A;  1KDW A;  1VET A;  2QMI A;  4YFM A;  1Q2P A;  3OLO A;  1DJA A;  3UB9 A;  3S7N A;  5KSH A;  1ES5 A;  4HHD A;  1SCW A;  1S1Y A;  2EWW A;  2W3H A;  2Z6C A;  1K57 A;  2O0Y A;  3O5Y A;  1PFL A;  4R38 A;  5F6A A;  3M6B A;  3CAX A;  1IYS A;  2Y2H A;  3DWK A;  5EV0 A;  4LCL A;  3SS4 A;  5IHV A;  3UN7 A;  3S7O A;  1ONG A;  1BZA A;  5A8B A;  1CK3 A;  5FAO A;  2PU2 A;  3P09 A;  3EOI A;  2R78 A;  3LIE A;  4PKY A;  1SDE A;  1YLZ A;  4YWZ A;  3LR4 A;  1CEF A;  3T1X A;  1FCM A;  1OTD A;  1BT5 A;  3IWO A;  1JNU A;  5EVI D;  5M19 A;  4OLG A;  1Y28 A;  1NYY A;  1H5X A;  4LV0 A;  2WAE A;  5HPF A;  5FI6 A;  5KZH A;  3O88 A;  5FSR A;  3E2K A;  3MFD A;  2ZL1 B;  3N8R A;  3ZVT A;  4E04 A;  4R1G A;  5DTT A;  2W3D A;  2V9A A;  3PHY A;  5E43 A;  1OJ5 A;  3FYZ A;  2JKT I;  4EBN A;  1OTE A;  3W4P A;  2JN7 A;  4QB8 A;  4K0W A;  4RVA A;  2Y2Q A;  2FFF B;  1PYY A;  1OT9 A;  1G28 A;  1LI9 A;  5HFO A;  3LY4 A;  1L0F A;  4X53 A;  2GNX A;  3VSK A;  2O99 A;  2OWJ A;  3C7V A;  2ZM2 A;  3HLE A;  4ME4 A;  1LI0 A;  1YLT A;  3NOU C;  1T19 A;  3QHY A;  2J3T C;  2J80 A;  4LPZ A;  1MKI A;  3UDX A;  1ZG4 A;  1D06 A;  3C30 A;  3L9K A;  4WZ5 A;  4OH0 A;  5JYO A;  4RQ9 A;  3G35 A;  3A3I A;  3RJU A;  1ZG6 A;  4KG5 A;  4RA7 A;  3CUE A;  3NIA A;  1VEU B;  3PAE A;  4L9E A;  1F98 A;  1K0K A;  3RTY A;  5HWW A;  5E2E A;  3EQU A;  3MJQ A;  3BM6 A;  1PIO A;  3P01 A;  1CI9 A;  3S22 A;  2UV0 E;  3QP5 A;  3VP4 A;  3OZH A;  3VMA A;  3B3X A;  4JF6 A;  1I2S A;  3NOT C;  3BJN A;  1S1Z A;  4BLM A;  3BQA A;  3V50 A;  1YSQ A;  1HVB A;  5A93 A;  1KDS A;  3DTE A;  4KZ4 A;  2QJ7 A;  1I2W A;  1V9Z A;  5HPI A;  2VX8 A;  3LIC A;  2RL3 A;  5TJJ A;  1IKI A;  3MS6 A;  4IHQ A;  4OPQ A;  2Y79 A;  2WKI A;  4OP8 A;  3DTK A;  2R9X A;  3MKF A;  2V1Z A;  1MWU A;  2O9B A;  2B5R A;  3B33 A;  2ZL1 A;  4UQI S;  3Q82 A;  4BJP A;  3UY6 A;  1UWP X;  2PU4 A;  4Y0T A;  4BBT A;  3IXB A;  2Y59 A;  3NDE A;  3A3J A;  1KGE A;  4MDZ A;  5CGS A;  4E6X A;  2WGV A;  4F94 A;  1X0O A;  2VK3 A;  5EFW A;  3TOI A;  3O3V A;  3GQZ A;  4O8G A;  5DKK A;  5FAQ A;  2IA2 A;  4D2O A;  3QP1 A;  4QJG A;  2ZQD A;  4GHI B;  1OT6 A;  4PHT A;  4KZ7 A;  3T4K A;  4JPM A;  1NJ4 A;  4KG2 A;  1BUL A;  4LRX C;  3HVF A;  2CMN A;  3ICY A;  3A0R A;  4HBU A;  3NEC A;  1N4O A;  4Q0J A;  1E3U D;  3GVB A;  2X01 A;  1K55 C;  5HL1 A;  1YMX A;  3CHW P;  2ZM0 A;  5G4Z A;  4FH2 A;  3OC2 A;  4MEZ A;  4FCF A;  2XLN A;  4H6J B;  4JF5 A;  4UQI M;  5HAP A;  2QYB A;  2ZC5 B;  1TDL A;  2EX9 A;  1PRQ A;  1PZP A;  3PBR A;  2J8Y A;  3G2Y A;  3LIB A;  4DE0 A;  3EWK A;  4K08 A;  2V8F A;  4OOM A;  5M1A A;  2Y2M A;  1F2K A;  1GA0 A;  2QPN A;  4JBF A;  3BY8 A;  3HCY A;  1NZU A;  3G31 A;  5J3W A;  3VFH A;  3HLD A;  3P7N A;  2PR6 A;  3W4Q A;  1ZHH B;  3MZE A;  2JBF A;  2XR0 A;  1DP8 A;  1CJF A;  5CHU A;  3DW0 A;  3EGD C;  4CQH A;  5DF9 A;  4P87 A;  4MN5 A;  5GHZ A;  2P08 A;  5HX9 A;  3HLF A;  3KSF A;  5M18 A;  4JF4 A;  2QWS A;  4S2I A;  5CHM A;  4HOI A;  1H0M A;  2VZW A;  1IYP A;  4LV3 A;  2WKH A;  4EQ1 A;  2C5W B;  5F68 A;  3ZCZ A;  3M2J A;  4KZ3 A;  1W7F A;  3LFV A;  5FQ9 A;  2EWV A;  3TW8 A;  2VGK A;  3HRE A;  1MY8 A;  5F83 A;  3G34 A;  4EQI A;  1PI5 A;  3MQ0 A;  4GHI A;  4L0L A;  3DBA A;  3FG8 A;  1SKO A;  5A91 A;  1O07 A;  4ZAM A;  1PI4 A;  4R4R A;  1ES2 A;  4DDY A;  4LFU A;  4X1L A;  4N1H A;  3CI6 A;  2D01 A;  4BD1 A;  3NOP C;  2EFX A;  3SW1 A;  1L0D A;  3FPV A;  3A0S A;  3Q7V B;  3HLG A;  3M6H A;  3H82 A;  4P0M A;  1T1C A;  2LB5 A;  2Z2L B;  1L0E A;  2VEA A;  3A3D A;  4PKY G;  4S2J A;  2OLU A;  3W4O A;  3R4K A;  4H6J A;  3E0Y A;  4S2P A;  1YSP A;  1RP5 A;  1ZKJ A;  4GN2 A;  2Y2J A;  4MN7 A;  3NY4 A;  4C6Y A;  4OPR A;  5HL6 A;  3HLC A;  4RYE A;  1BLC A;  2L0W A;  1KE4 A;  2Y2P A;  3BEB A;  5HDD A;  2QZ6 A;  4I39 A;  3ITB A;  3OOV A;  4NXF A;  5CRF A;  4DF6 A;  2RCX A;  4KZA A;  4XT2 B;  1M40 A;  3VE3 A;  4KZ9 A;  2J3T D;  2PBD P;  2G2W A;  3B42 A;  1NZO A;  2WZZ A;  3MR0 A;  1PW1 A;  3NBL A;  1AXB A;  4Y5F A;  1XXM A;  3IS2 B;  5F1G A;  3QP8 A;  5FA7 A;  2OAQ 1;  3R7W A;  4GCZ A;  1HTZ A;  2JKG A;  2YKF A;  4HJ6 A;  4EEU A;  1E4D A;  4K0X A;  5IU1 A;  5HD3 A;  5DKL A;  5HAI A;  3BYD A;  1DRM A;  4CLC B;  2OLV A;  3PBS A;  5DTK A;  1HZO A;  3V67 A;  2PDR A;  4MBF A;  1NRF A;  4BBU A;  3VSL A;  3V39 A;  5CTM A;  4H8R A;  1FIK A;  1J3W A;  4ZBE A;  5AJG A;  4O01 A;  4R70 A;  3V3S A;  3Q7Z A;  3WRT A;  3JVU A;  3SH9 A;  5CEC A;  5DJU A;  2XDM A;  1K56 A;  2A24 B;  2PD8 A;  4LV1 A;  4L9F A;  4HEF A;  1AWI A;  2WAD A;  4Z1W A;  3KSG A;  2PRF A;  1GSX A;  2EX6 A;  3BLM A;  3IHA A;  4WEL A;  1QMF A;  4B88 A;  2A3U A;  3VOZ A;  4E3N A;  3C4O A;  4S2M A;  1FIL A;  5EVE A;  4FSF A;  1TF1 A;  1UWN X;  2ZD8 A;  1K57 C;  2L4R A;  1EW0 A;  5CER A;  4BBV A;  1IEM A;  1YPR A;  4PAU A;  3ZG5 A;  1O7E A;  1GSW A;  1LHY A;  3C8C A;  1LSV A;  2G7U A;  3IS2 A;  3E2L A;  3UMD A;  3N8L A;  3IH8 A;  1K25 A;  1EI5 A;  3MFX A;  5IT5 A;  1TS8 A;  5I94 A;  3CMZ A;  1DY6 A;  4NXG A;  3LIF A;  4CLC A;  4P6B A;  3T1R A;  1BSG A;  4DDS A;  4OKP A;  2X02 A;  2GDN A;  3SH8 A;  1XFQ A;  1H3Q A;  1LL5 A;  4ARZ A;  5HD5 A;  3HJK A;  1G68 A;  3BQ8 A;  2R9W A;  3DTM A;  3M2K A;  3OPH A;  3C7U A;  3CZD A;  3ZG9 B;  4LLO B;  4MCW A;  1G5U A;  2ZM8 A;  4RX2 A;  3UB7 A;  3E4O A;  3EEA A;  3FV7 A;  2L1M A;  3T4J A;  3TG9 A;  2B18 A;  4Y0O A;  2JHE A;  5L09 A;  4WLA A;  3HUM A;  3TSG A;  4HQA A;  4KQO A;  2JCH A;  1ODV A;  5CXW A;  5DFY A;  1LSX A;  1W5D A;  3FKV A;  2A24 A;  5FEG A;  4WMC A;  1MKM A;  4EBL A;  3RFB A;  4WN5 A;  5D3O A;  3LI9 A;  3D9Y A;  4E3L A;  5DF8 A;  1RGY A;  2XRO A;  1XP4 A;  4KQD A;  5JYP A;  4WZ5 C;  1ACF A;  4CJN A;  3ZG0 A;  4DXC A;  2HPB A;  3IF6 B;  1IOU A;  5GLC A;  2GZA A;  3CUE C;  3LR0 A;  3MQQ A;  2EFU A;  2B02 A;  3LYX A;  2ZBB A;  3RXX A;  1TVF A;  3VP3 A;  2O9C A;  5G4Y A;  5HWV A;  2E8J A;  3BW6 A;  4G3W A;  1WYB A;  2D02 A;  5AVF A;  3WS5 A;  3L7H A;  4KEN B;  4KZ6 A;  3T4L A;  4DN0 A;  1LT0 A;  2H0Y A;  2FH5 A;  2WKR A;  2W27 A;  1CEG A;  4HH3 A;  2Y2L A;  5GLA A;  4WZ4 A;  2PR5 A;  1YMS A;  4MN6 A;  4JKT A;  4YOF A;  1DP9 A;  2KLI A;  4E6W A;  4PM9 A;  3UE0 A;  1SDN A;  4ZJ3 A;  4BQM A;  3NCK A;  4YNR A;  4Y2F A;  5E2G A;  2WGI A;  1RCJ A;  3ZGA B; 
#chains in the Genus database with same CATH homology
 3EWK A;  4K08 A;  4OOM A;  3MXQ A;  3FPW A;  3VV4 A;  3KO6 A;  5TBM A;  3BY8 A;  2QHK A;  2GX5 A;  2HF6 A;  4II7 A;  3UB6 A;  3HCY A;  4BMW A;  5J3W A;  4EET B;  3P7N A;  2PR6 A;  2K2N A;  1MZU A;  1ZHH B;  4B9O A;  3E4P A;  2PHY A;  4DMZ A;  4HNB A;  1DP8 A;  4HH2 A;  2NUP C;  3EGD C;  2VV6 A;  3MF0 A;  4L9G A;  4CQH A;  4FOF A;  1N9O A;  5DF9 A;  1P9R A;  3PBT A;  3NHQ A;  3D72 A;  4MN5 A;  1S67 L;  2OOL A;  1W63 M;  2P08 A;  3KSF A;  1H8M A;  2PYR A;  1P0Z A;  3G6O A;  2W1T B;  2QWS A;  3VE4 A;  4EES A;  4HOI A;  2VZW A;  2VA0 A;  4EQ1 A;  5F68 A;  3LID A;  3LFV A;  2GJ3 A;  3TRC A;  3BY9 A;  2EWV A;  5AVE A;  5HDC A;  3TW8 A;  3K3C A;  3PR6 A;  1TS7 A;  4EER A;  4EU0 A;  2INW A;  2VV7 A;  4R3A A;  4NEE D;  1XFN A;  1S4R A;  5HZH A;  4I38 A;  3MQ0 A;  4GHI A;  1OJG A;  2WKQ A;  4L0L A;  3DBA A;  3FG8 A;  3ZYT A;  2QKP A;  2HV1 A;  2BAS A;  3OCL A;  3LUQ A;  3KYZ A;  4HIA A;  1LL8 A;  4P6Z M;  3CI6 A;  3KSH A;  2D01 A;  2P7J A;  3W2Z A;  3NOP C;  4HP9 A;  3SW1 A;  3D3O A;  2VV8 A;  4UEY A;  2XSS A;  3U2A A;  3FPV A;  3A0S A;  1OTI A;  2VJW A;  1KOU A;  3H82 A;  1T1C A;  2LB5 A;  1NRJ A;  1NLY A;  3TE8 A;  2VEA A;  4PKY G;  5DFX A;  3T4S A;  2O9A A;  1S4S A;  4I3I A;  3LR5 A;  4Q0H A;  4AFI A;  3LR3 A;  4JGQ A;  1TS6 A;  3B47 A;  3R4K A;  4HP4 A;  4H6J A;  3E0Y A;  3H82 B;  4HJ3 A;  5HWT A;  1YSP A;  4DJ2 A;  1D7E A;  3EEH A;  1MC0 A;  3TJZ C;  2W3F A;  4JGO A;  4MN7 A;  2HJ9 C;  1NLZ A;  3F1O A;  5HL6 A;  2K7S A;  5KIZ A;  2XRN A;  5IS1 A;  3F1N A;  3S7P A;  1XJ2 A;  5I5L A;  4GW9 A;  4WEK A;  1YKD A;  3C2W A;  3E4Q A;  4I5S A;  2FZ0 A;  2L0W A;  3VOL A;  4ETX A;  2W0N A;  4ZRR A;  4BWI A;  4IJG A;  4XT2 A;  4Q0I A;  1YAX A;  5HDD A;  2KOI A;  4I39 A;  3OOV A;  4NXF A;  2QJ5 A;  4WF0 A;  2VKS A;  4XT2 B;  3VE3 A;  3OLO A;  2V0U A;  3UB9 A;  2J3T D;  2M7U A;  3CIT A;  3S7N A;  5KSH A;  4O0P A;  2W1T A;  3B42 A;  3EGX C;  2PT7 A;  4HHD A;  2DMW A;  1S1Y A;  2EWW A;  2W3H A;  2Z6C A;  3K2N A;  3MR0 A;  2O0Y A;  3O5Y A;  2PD7 A;  4Y5F A;  3IS2 B;  4R38 A;  2W1R A;  5F6A A;  1OTB A;  3CAX A;  2OAQ 1;  3R7W A;  1XJ3 A;  1TS0 A;  4GCZ A;  2YKF A;  4HJ6 A;  4EEU A;  3S7O A;  5IU1 A;  5HD3 A;  5DKL A;  5A8B A;  2PYP A;  1DRM A;  4CLC B;  1OPX A;  3S7Q A;  3R7W B;  1XJ6 A;  2JKR I;  3PBS A;  4ETZ A;  3V67 A;  2PDR A;  1NWZ A;  4JGP A;  3T4Q A;  3EOI A;  2R78 A;  4GJ4 A;  3LIE A;  4Y3I A;  4PKY A;  4BBU A;  4B93 A;  4IUK A;  5F5Y A;  4I3A A;  3KX0 X;  4YWZ A;  3LR4 A;  4G3V A;  3F1P B;  1OTA A;  4IUH A;  2ZMF A;  5AJG A;  4O01 A;  1TD5 A;  1OTD A;  1JNU A;  4HY8 A;  3LI8 A;  4R70 A;  1Y28 A;  5HPF A;  3JVU A;  4MMN A;  2V0W A;  2VLG A;  4E04 A;  2V1B A;  2W3D A;  1XJ4 A;  1T1A A;  2OAP 1;  2V9A A;  3PHY A;  5DJU A;  4F3L B;  1OJ5 A;  2JKT I;  3UE3 A;  4DJ3 A;  1OTE A;  4HI4 A;  2JN7 A;  2XA7 S;  4KUK A;  2A24 B;  2PD8 A;  3LIA A;  4L9F A;  1OT9 A;  1G28 A;  4Z1W A;  1P97 A;  3KSG A;  3MMH A;  1BYW A;  2GNX A;  1GSX A;  2LB9 A;  5DJT A;  3HJI A;  2O99 A;  2EA9 A;  2OWJ A;  4WEL A;  1F5M A;  4GS9 A;  4NXB A;  4WUJ A;  1VB6 A;  2M1C A;  4ME4 A;  1F9I A;  5F69 A;  3NOU C;  1T19 A;  2J3T C;  2J80 A;  4LPZ A;  4FSF A;  1D06 A;  2JKR M;  3C30 A;  1STZ A;  1TF1 A;  1UWN X;  4GS9 B;  4RQ9 A;  2HGV A;  2W3G A;  1UGU A;  2L4R A;  1EW0 A;  4BBV A;  4PAU A;  3CUE A;  3UME A;  1GSW A;  4L9E A;  4QPR A;  1F98 A;  2VGL S;  3C8C A;  3RTY A;  1LSV A;  5HWW A;  2G7U A;  3EQU A;  3MJQ A;  1P9W A;  3IS2 A;  3OCN A;  1T18 A;  1VHM A;  3P01 A;  1GSV A;  1T1B A;  1ZTU A;  5FL3 A;  3UMD A;  2I9V A;  3MFX A;  5IT5 A;  2P04 A;  1TS8 A;  4NXG A;  2HJE A;  4CLC D;  3UB8 A;  3LIF A;  4CLC A;  4HJ4 A;  2JKT M;  3NOT C;  1WA9 A;  4EUV A;  5CX7 A;  3BJN A;  1S1Z A;  3OBF A;  2XA7 M;  3UE6 A;  3ULF A;  3BQA A;  2V1A A;  1YSQ A;  3H7W B;  1XFQ A;  3KSI A;  1H3Q A;  5L8M A;  5HD5 A;  2QJ7 A;  3HJK A;  4ARZ A;  3IBJ A;  1V9Z A;  4NKP A;  3PBO A;  5HPI A;  5TBM B;  3BQ8 A;  2VX8 A;  3LIC A;  5TJJ A;  3C38 A;  3F1P A;  5C5K A;  4IHQ A;  2Y79 A;  4LLO B;  4MCW A;  2ZOH A;  5J4E A;  3PXP A;  3UB7 A;  3JVV A;  5HSQ A;  3E4O A;  3EEA A;  1W63 Q;  4ARZ B;  3GDI A;  3MQO A;  4OOL A;  3T4J A;  2L1M A;  2O9B A;  2B18 A;  3B33 A;  4UQI S;  2JHE A;  1S66 L;  4BJP A;  4WLA A;  5J7E A;  2KX6 A;  4NXE A;  4HQA A;  3BWL A;  4F3L A;  1G6O A;  4KQO A;  3H9W A;  1UWP X;  1ODV A;  5DFY A;  1LSX A;  2OWH A;  1N9N A;  4WEJ A;  1LSW A;  4BBT A;  3NJA A;  4G3K A;  2A24 A;  2J3W A;  2A2L A;  2WKP A;  4MDZ A;  1MKM A;  3RFB A;  2VGL M;  1X0O A;  4WN5 A;  3RH8 B;  5EFW A;  3LI9 A;  4KUO A;  1IFQ A;  3K3D A;  4O8G A;  5DKK A;  2IA2 A;  3IBR A;  4LRY C;  2XRO A;  4KQD A;  2K31 A;  2KDK A;  2YKH A;  1DP6 A;  3PBN A;  4GHI B;  1OT6 A;  2ZOI A;  3CLO A;  5HDS A;  4PHT A;  2Y8H A;  3T4K A;  5K5B A;  1IOU A;  2H28 A;  2GZA A;  3CUE C;  4I3J A;  3LR0 A;  4LRX C;  3T4O A;  2MJ6 A;  3MQQ A;  2CMN A;  3ICY A;  3A0R A;  2Z6D A;  2B02 A;  1N9L A;  3LYX A;  4WL9 A;  2ZMV A;  2ZBB A;  4LRZ E;  2O9C A;  2W3E A;  4Q0J A;  5G4Y A;  4EEP A;  4GLQ A;  5HWV A;  3GEC A;  3BW6 A;  4G3W A;  2D02 A;  3E98 A;  5AVF A;  5G4Z A;  2M7V A;  3OC2 A;  5MC7 A;  3T50 A;  3T4L A;  4CLC C;  4DN0 A;  3KYQ A;  3EQV A;  1LT0 A;  2WKR A;  2FH5 A;  4R6L A;  2W27 A;  4HH3 A;  3T4T A;  4CLC E;  4H6J B;  3PYP A;  4UQI M;  3CWF A;  2PR5 A;  2QYB A;  4EW7 A;  3ZQ5 A;  4MN6 A;  4YOF A;  5LBR A;  1DP9 A;  4JGR A;  2KLI A;  3PBQ A;  3PBR A;  4EXO A;  3FC7 A;  2NUT C;  3F1O B;  1V9Y A;  4P6Z S;  3F1N B;  4Y2F A;  4YNR A;  4M4X A;  3LIB A;  3H7W A;  3A0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...