3IS2B

2.3 angstrom crystal structure of a cys71 sulfenic acid form of vivid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
149
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Vivid PAS protein VVD
publication title Illuminating solution responses of a LOV domain protein with photocoupled small-angle X-ray scattering.
pubmed doi rcsb
source organism Neurospora crassa
total genus 34
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3is2B00
3OLOA 5EFWA 4GHIA 5A8BA 4JGRA 3F1OA 3K3DA 2INWA 4B9OA 4HHDA 4I39A 2KX6A 4LRXC 3CAXA 1OTEA 3VE3A 1MZUA 1S1YA 3IS2B 3E4QA 2VV6A 2V1BA 3VE4A 1F9IA 1T18A 3BY8A 4XT2B 5IU1A 2WKRA 4LRZE 2VEAA 5F69A 1N9LA 3LI8A 4PKYA 5G4YA 4NXFA 5J7EA 5AVEA 2WKPA 4BBTA 5HDSA 1DP6A 3MJQA 4HNBA 4H6JB 1EW0A 2JHEA 4R70A 2OWJA 3HJIA 1GSVA 2OOLA 2PYPA 3IS2A 2P7JA 4JGPA 4XT2A 4LPZA 1X0OA 3G6OA 1LSXA 4LLOB 5HWWA 1OTDA 5HD3A 4BBUA 1DP9A 1TS6A 4WL9A 2VV7A 2QWSA 3K3CA 3NOTC 1XJ3A 3PYPA 2ZOHA 3UE6A 4L9FA 4HI4A 2Z6DA 2GJ3A 3H7WA 4H6JA 1S67L 2ZOIA 4WLAA 4GW9A 3LIFA 3A0SA 4HOIA 4NXGA 2PD8A 3F1PB 5HWVA 1P0ZA 1OT9A 4DJ3A 4I3AA 2OWHA 1GSWA 3H9WA 4GS9B 1NWZA 3H82B 5HSQA 1S4RA 2K7SA 5HDCA 5DKKA 3NHQA 1OJ5A 2PDRA 3ICYA 2B02A 5DJTA 4YWZA 1OTIA 4KUKA 3E4PA 2QJ5A 1S1ZA 3HJKA 3LUQA 3SW1A 2WKQA 2L1MA 4I3JA 4R6LA 5F6AA 1Y28A 2D01A 4R3AA 1UWNX 4L9EA 4HH2A 5KIZA 3RH8B 3C2WA 1DP8A 2PR6A 2PR5A 4HJ3A 4JGQA 3LIEA 2EA9A 4KUOA 3BY9A 3H82A 3NOUC 4I38A 3KX0X 3LIAA 1N9NA 1XJ2A 2VLGA 1WA9A 3CLOA 2A24B 4EW7A 4MN6A 1D7EA 3MR0A 3MFXA 2L0WA 2QHKA 5IS1A 3UMDA 1F98A 1N9OA 1JNUA 3F1NB 4MN5A 4HJ4A 3ULFA 2R78A 3BWLA 4I5SA 1T1CA 3B33A 3UB8A 2V0WA 1XFNA 4NXEA 2L4RA 2KDKA 2YKHA 2I9VA 4EESA 5DKLA 3UB9A 4R38A 1XFQA 1LT0A 2A24A 5J3WA 2M1CA 2V0UA 3FG8A 4GHIB 5I5LA 3FC7A 3IBRA 1OJGA 1T1BA 4WUJA 4EETB 1T19A 2D02A 3LI9A 1VB6A 3ZQ5A 3LIBA 4PKYG 1OTAA 2Z6CA 5J4EA 4HH3A 4WF0A 2V1AA 3F1PA 4F3LB 4HP9A 2VV8A 5G4ZA 2V9AA 4GCZA 4DJ2A 1V9YA 4GS9A 3GECA 3A0VA 4KQDA 1UGUA 5F68A 2CMNA 4NXBA 2ZBBA 3UB6A 4EEUA 2HV1A 2PD7A 5DJUA 4EEPA 4I3IA 3CWFA 1OT6A 1D06A 3D72A 4HIAA 3NOPC 4K08A 4HY8A 2PHYA 3UMEA 1LSWA 3E4OA 5TBMB 2BASA 1TS7A 3LICA 3P7NA 4F3LA 5AVFA 3MQOA 1UWPX 3LIDA 1TS8A 3NJAA 4RQ9A 2W27A 3H7WB 1S4SA 3T50A 2PYRA 3GDIA 1OTBA 3EEHA 4JGOA 4HP4A 3EWKA 2QKPA 2W0NA 2H28A 4BBVA 1XJ6A 3PHYA 5HDDA 5HWTA 3VOLA 2QJ7A 2YKFA 5F5YA 3RTYA 3UB7A 5TBMA 1P97A 3LYXA 2J80A 4E04A 3F1OB 1TS0A 1LL8A 4EERA 1KOUA 4L9GA 1DRMA 3F1NA 3A0RA 1LSVA 1T1AA 3MQQA 4EXOA 1V9ZA 4M4XA 3C8CA 4EQ1A 1XJ4A 1GSXA 4WN5A 1G28A 5HD5A 4HJ6A 3MXQA 4HQAA 1S66L 1ODVA 4LRYC 5HZHA 2JN7A 1BYWA
chains in the Genus database with same CATH superfamily
4WMCD 1NYMA 1ESUA 4GDBA 4OOYA 3K3DA 4HHDA 2OV5A 1DJCA 2VJWA 5HPFA 3CAXA 3IX3A 1G5UA 1ESIA 3R7WB 2Y2IA 3IXHA 2JKTM 2VGLM 4R3BA 3PR6A 5LBRA 2OAQ1 3E4QA 2V1BA 1F9IA 3BY8A 2Q9NA 3ZG8B 5IU1A 5F1FA 2WKRA 3OPHA 2HGVA 3IQAA 2LB5A 1PZPA 1J9MA 2P74A 3I7JA 4JXVA 2J9OA 4OOMA 3KSHA 3HCYA 4BBTA 4E6XA 1KE0A 1IYOA 1EW0A 4BD1A 2JHEA 1L0GA 3ZGAB 2ZC7A 3IS2A 5CEBA 1PI5A 2QZ6A 4XT2A 2WAFA 4LPZA 5HD3A 3S7NA 3PAEA 4MLLA 1OPXA 3LR4A 1DP9A 3BQ8A 4JXSA 1TS6A 3CPTB 3FV7A 1Z6FA 3K3CA 3NOTC 3C5AA 3SH8A 5GLBA 4IVIA 2ZOHA 2DMWA 2W3FA 4HI4A 3ITAA 3HUMA 4H6JA 2ZOIA 3HLGA 4WLAA 1IELA 3LIFA 3A0SA 4NXGA 2R9WA 4ZJ2A 1YSPA 3VP0A 4PHTA 2V8CA 4C6YA 3Q7VA 4L0LA 3ZG0A 3T12B 5HSQA 1S4RA 3FKVA 4Y0OA 4GD6A 4U0TA 5HDCA 1F2KA 1K57C 4ZBEA 2ZL1B 1WYBA 4QPRA 2X02A 2B02A 1TVFA 1Q2PA 3T1QB 1S1ZA 1FOFA 2JBFA 3KYQA 3C7VA 5L2FA 5F6AA 1PNEA 1LLBA 4R3AA 5DFYA 1KE3A 4O0PA 4EUVA 1XPBA 1NLZA 3RH8B 5MC7A 1DP8A 2ZQAA 2EA9A 5AQAA 3NULA 5KSHA 3BY9A 3LY3A 4NETA 2EWWA 5F83A 2P9VB 3IHAA 4MCWA 2EXAA 4UA9A 4IHQA 1Y54A 5HAQA 3BQAA 1KGGA 1N9NA 1H8ZA 4Y0UA 2FFYA 1W8YA 1K4FA 4EBPA 2O99A 2ZQCA 4AFIA 4ESPA 1YMXA 4CPKA 1IYSA 3MFXA 4JF6A 2W3HA 1N9OA 4KG6A 1K56D 5KMWA 4MN5A 3ULFA 2R78A 4MN7A 1E3UD 3DBAA 2V0WA 1BT5A 2G7UA 1S0WA 2H5SA 3FWLA 1CEFA 5EV0A 2L4RA 5KSCA 2YKHA 3OZHA 1KDWA 3Q82A 5DTKA 3UB9A 5FL3A 4CLCE 1HLUP 1WE4A 2WADA 3GV9A 4E3OA 5CHMA 2A24A 3C7UA 1H0MA 2HDRA 5EM0A 3UDFA 2ZMVA 1PWGA 1VETA 2J8YA 1NRFA 3FG8A 4E3MA 3FC7A 5FSRA 4FCFA 4OPZA 4D2OA 2ZQ7A 4WUJA 1T19A 3LI9A 4OPQA 3C4PA 1ZKJA 2JCHA 3TSGA 5CGSA 2VKSA 4EU0A 3PBRA 4HBTA 4R4SA 3NI9A 3LEZA 3QP2A 4KENB 4S2OA 5TJJA 5J4EA 2HPBA 2XGNA 2C6WB 1PWCA 2ACGA 3ZDJA 2IA2A 2VGKA 1XA1A 1Z09A 4IEDA 1ZG4A 3TG9A 4MMNA 2VV8A 4GCZA 3ZHHA 1XP4A 2O0YA 3C30A 3IF5A 4KQDA 4NXBA 3QNCA 3D4FA 4WEKA 2PD7A 5DJUA 4EEPA 3FPVA 2ZC6B 3CWFA 5EM1A 5CTMA 1NJ4A 2WGIA 3TJZC 3UMEA 3ZVWA 3A3IA 1ES3A 2XQZA 5L09A 3T4JA 4LV0A 3P7NA 3KSFA 4F3LA 1G6AA 4EV4A 4LV1A 3LO7A 3HUNA 4ZJ3A 2RCXA 1BLPA 4N9LA 2B18A 2WUQA 3G2YA 3EWKA 3GTCA 4CLCA 2QKPA 2C5WB 4C75A 4BBVA 3Q7VB 5HDDA 1YLYA 2YKFA 5TR7A 2JKGA 2OLVA 2WGWA 4RYEA 2XLNA 4UHUA 3LYXA 1ALQA 1VM1A 5GHYA 3F1OB 4IBRA 4PM8A 1TS0A 5DTTA 3LFVA 3DW0A 4FSFA 4UA7A 5EVEA 1N4OA 1T1AA 2HP9A 3IBJA 5F1GA 3IF6A 5EVLA 4GLQA 5GHXA 1I2SA 4XUZA 1KVMA 2W1TA 1GSXA 3T1SA 3JPUA 2ZC5B 4HJ6A 3OC2A 4FOFA 1ODVA 3K2NA 4BMWA 3ITBA 3A3FA 5HARA 1TF1A 2JN7A 3QHYA 3DTMA 4II7A 3KYEA 4S2MA 4GHIA 4BLMA 2Q9MA 5A8BA 1W79A 2HDQA 3T1XA 4OLGA 4B9OA 3A3JA 2IWDA 4LRXC 5HFOA 2PT7A 4QU3A 4Q0JA 4DDYA 1MZUA 3O87A 5FI2A 5GLDA 2Y2LA 4G3VA 2A3UA 1T18A 4S2KA 5FDHA 1PI4A 1L0FA 4LRZE 2Y2HA 2VEAA 3HLBA 3MF0A 4PKYA 5EE8A 4JKTA 4XUXA 5JYOA 3E2KA 3G34A 4IVKA 4NXFA 4B4ZA 3ZYTA 4LENA 5CX7A 3MZEA 1PW1A 3EEAA 1DP6A 3MJQA 4OP8A 1E4DA 2ZQ9A 1K25A 5FQ9A 1K6RA 4MEZA 1K54A 1K0KA 1K6SA 1VETB 2OOLA 4KZAA 3BRMA 1XGJA 1C3BA 4PMAA 3HUOA 2W3EA 4JGPA 2ZM2A 1X0OA 2JKFA 3G6OA 1LSXA 4DDSA 1YLZA 5EPHA 5TFQA 1YLJA 5CHJA 2NUPC 4WZ5A 1NZUA 3SS4A 2W3DA 4BBUA 3SOIA 1YLTA 4WL9A 2VV7A 3HLCA 5EOOA 3ZNTA 2EX8A 3BM6A 1RP5A 3UE6A 2OLUA 2GJ3A 1S67L 3H7WA 3LR3A 5CGXA 5CXWA 3PTEA 1FCOA 4GW9A 1VEUA 2PD8A 3ZG7B 5HWVA 4DJ3A 4I3AA 3QP8A 3H9WA 3W4PA 1I2WA 4EUZA 4LV2A 3CZDA 3QP6A 4KQRA 5A92A 2K7SA 1E25A 1CEGA 5DKKA 4BJPA 3HLFA 1NY0A 1MPLA 1BSGA 3ICYA 4YWZA 4KUKA 2GDNA 3NECA 3QP1A 3EOIA 3E4PA 3BFEA 4LCLA 3M2JA 4UQIM 4X55A 2D01A 3QNBA 5FAOA 4CLCC 1BUEA 3BLMA 4L9EA 1HVBA 5KIZA 3EQUA 1YLWA 2XF3A 4MBHA 5HL1A 4JGQA 3H82A 2VGJA 4PPRA 2O9AA 3KX0X 4OVDA 3B47A 1SKFA 2J3TD 4BL2A 3IXGA 2EXBA 4N1XA 2Y55A 1CF0A 2ZC4B 3IX4A 3CJMA 3IF6C 2ZLYA 4GKUA 3WS5A 3CI6A 3FYZA 2BLSA 1TDLA 4P6ZM 3T4SA 2O9CA 4MN6A 3TW8A 3DTEA 1EI5A 1KGEA 3MR0A 3PXPA 3T4TA 1FSYA 3UPNA 2QHKA 3EGDC 5FQQA 4OPRA 1JNUA 1W8QA 3BWLA 1T1CA 1XGIA 3M6BA 2EFUA 3OBFA 4JPMA 4YNRA 3D9YA 4ID4A 1FCMA 2I9VA 4EESA 1YAXA 4ZAMA 1FR1A 2LB9A 5FQJA 4KQQA 1H3QA 5JYPA 4EWFA 1N9BA 3S4XA 4S2PA 4QJGA 4GHIB 3ZFZA 1GHPA 3B3XA 2Y2MA 4WELA 3P09A 4Y3IA 3IBRA 4M3KA 3W2ZA 1T1BA 4GZBA 4EETB 2XEPA 2K2NA 4OP5A 4QB8A 4CQHA 4H8RA 1O7EA 1K54C 4A5RA 3ZQ5A 1TD5A 3SS5A 4PKYG 4OOLA 4HH3A 2HP6A 1M6KA 4HEFA 4HP9A 2OAP1 4WZ5C 3VFFA 3VOZA 4P87A 4DJ2A 5E2FA 4MBFA 1V9YA 4GS9A 4BQMA 4GB7A 3A0VA 3L7HA 3E2LA 1MWTA 2CMNA 4Q8IA 5A93A 2ZBBA 3UB6A 4EEUA 5FI7A 2HV1A 1RGYA 5AQBA 1OT6A 1IOUA 2W3GA 1D06A 4YFMA 2HZ5A 3NOPC 4K08A 5K5BA 5U47A 1K38A 4HY8A 1I5QA 1PWDA 4X1MA 3UO9A 1FSWA 2IWBA 2VA0A 2VK3A 1LL9A 2BASA 3GSGA 1NRJA 4D60A 5EECA 3EGXC 1EWZA 3LICA 1MKIA 4ZTKA 1ZG6A 4X6TA 1VQQA 3LIDA 5CERA 4F94A 3Q7ZA 3MFDA 4UAAA 2W1RA 4QD4A 3T4OA 3H7WB 1S4SA 5EOEA 3TOIA 3T50A 1VEUB 3DWKA 1FIKA 4JGOA 1FILA 1NYYA 5AQ7A 4O01A 4FUWA 4JXWA 2ZC3B 1XJ6A 2BTFP 3PHYA 2Y8HA 5EVIA 2QJ7A 3RTYA 3VOYA 5TBMA 3SS3A 1GA0A 2Y2GA 3JVVA 4E04A 3TE8A 1LL8A 1L0EA 1A0KA 1QMEA 3PBNA 3UE0A 4EQIA 4ARZA 5FEGA 1MC0A 3OPRA 4DKIA 4JLFA 4M4XA 4EQ1A 3S7QA 1SHVA 1G6OA 2ZMFA 3W8KA 4DRTA 5HD5A 3NCKA 3MXQA 1S66L 1JWPA 3IH8A 5HZHA 1BYWA 2XROA 3PBOA 4IUHA 3OLOA 3UB5P 3MSHA 5EFWA 3CUEA 4K0XA 4JGRA 2INWA 2K31A 2Y2NA 3ISGA 4I39A 1CQAA 3BJNA 2ZM0A 1OTEA 2O9BA 4X25A 3VE3A 4WEJA 1IYQA 3MZDA 1S1YA 3W4QA 1SDEA 3IS2B 3C4OA 3WRZA 2VV6A 3VE4A 4R0QA 4WMCA 4XT2B 4KZ5A 5HPIA 3CG5A 2AVXA 3S7PA 2ZQ8A 3LCEA 5FI6A 4DMZA 1JVJA 4EBNA 5G4YA 3IH9A 2FZ0A 2VX8A 5J7EA 3HL9A 3O3VA 2WKPA 1AWIA 3TRCA 5HDSA 3V3SA 4H6JB 2XRNA 2M7VA 4ETZA 3R7WA 4R70A 3HJIA 4GN2A 3MBZA 3VP1A 1ES4A 3FPWA 1HTZA 1BLSA 5CECA 4JBFA 2VZWA 1ONHA 5DTSA 1XA7A 3SZTA 5E2HA 3MQ0A 5HWWA 1OTDA 3VP4A 1SKOA 3V3RA 1ZC2A 1IKGA 2PBDP 4S2LA 5E2GA 2G2UA 3MMHA 4C3QA 1J3WA 3QP5A 2J3WA 4OQIA 3PYPA 5GL9A 4S2JA 2XK1A 4L9FA 4LGWA 1BZAA 3IXBA 4HOIA 3N4IA 3T4KA 3GQZA 1P0ZA 2BG1A 3KSIA 2OWHA 2G2WA 2ZM8A 4GS9B 1NWZA 5L10A 1LI9A 4ZJ1A 3GVBA 3NBLA 4QWOA 1YPRA 3HREA 2XSSA 3NHQA 4O7DA 3CPTA 3UN7A 4KZ4A 2PDRA 4NG2A 2QJ5A 1FR6A 5CTNA 2Y2PA 3SW1A 2WKQA 1Y28A 2P04A 1GA9A 4HH2A 5CEDA 1NXYA 2WKHA 4ME4A 2XFTA 5EVIC 1P9RA 3G2ZA 1DJBA 3C2WA 1ZTUA 1XKZA 3S22A 4OQ0A 2Y4AA 1SCWA 3LIEA 4OONA 3OOVA 1JWVA 1YT4A 4BL3A 4I38A 2B5RA 4R3JA 4KZ3A 2R9XA 4GDNA 3MZFA 2HDSA 3PBQA 4YINA 1W5DA 1MWUA 3D3OA 4PM9A 2A24B 5EVIB 4EW7A 1Q2QA 3UY6A 3V67A 3HLDA 3Q81A 3Q1FA 1D7EA 3JVUA 2L0WA 1KDSA 4FH4A 1BTLA 5IS1A 1XX2A 4PM5A 1L3LA 5FEFA 4HJ4A 1ES2A 4GJ4A 3B33A 4ARZB 3VV4A 4OH0A 3CUEC 3SH7A 4FTXA 3UPPA 4NXEA 1MWSA 5HW3A 4HBUA 2KDKA 1H8YA 3V50A 4CJNA 1ERQA 4K0WA 3MKFA 4FH2A 5C5KA 5DKLA 5IT5A 3O88A 1W63Q 1K56A 1LT0A 3WRTA 2PAVP 1E3UA 1IKIA 2EX2A 3N8LA 1H5XA 5I5LA 3ZG9B 4Y2FA 1U60A 3M2KA 3G31A 1CI8A 4ETXA 3WS2A 2E8IA 4DE3A 4Y17A 2PBYA 3M6HA 2KLIA 4E3KA 2HF6A 2Y2JA 1MBLA 3KYZA 1L0DA 1VB6A 3LY4A 1K55A 2E8JA 5FAQA 1PW8A 3VP2A 4UEYA 5F82A 2Z6CA 4JF4A 4WF0A 2V1AA 3IT9A 1SDNA 4NK3A 4X53A 4B88A 3F1PA 4F3LB 5G4ZA 2V9AA 2QYBA 5G18A 3GECA 2HJ9C 5FASA 1DJAA 5AQ9A 4B4XA 5E2EA 3BFGA 1CK3A 4X1LA 3WS0A 3N8RA 4Y7PA 5CGWA 4G3WA 4WYYA 4Y0TA 4K91A 4CLCB 1CI9A 1HZOA 2MJ6A 4HIAA 5DF7A 2OSUA 3JYIA 1RGZA 2PHYA 4UA6A 1DY6A 1KGFA 1LSWA 1SKOB 2J7VA 3E4OA 4U0XA 3O5YA 4E6WA 2WGWB 4KG5A 4CLCD 5HAPA 2XD1A 4DN0A 4Y5FA 3MQOA 1PIOA 1UWPX 3NJAA 1TS8A 1ONGA 4RQ9A 3V5MA 2V1ZA 3DTKA 2JE5A 3IF6B 4ZDXA 1ERMA 5FDSA 5CRFA 4KZ8A 2W1TB 2W0NA 2H28A 2P08A 2FH5A 2KOIA 1YLPA 3UB7A 1CJFA 2V20A 4LV3A 3LGOA 1P97A 2H0YA 3WS4A 4B93A 2DRWA 2WGVA 1ES5A 1YSQA 4DE1A 1PFLA 1KOUA 3F1NA 4R23A 3GR2A 2Y59A 4E3LA 1L2SA 1LSVA 2I72A 2PRFA 5FQIA 3MQQA 3GMWA 1XJ4A 4DXCA 3G4PA 1BLHA 3HVFA 2XFSA 5FATA 4WN5A 3PBSA 2HDUA 3V39A 3NDGA 4HQAA 2ZJ9A 2PU2A 5FAPA 1WYCA 1NLYA 5DFXA 2CC1A 1K4EA 4OPYA 4PAUA 3NIAA 5M18A 4Y13A 3DAVA 2J9PA 3P98A 2QMIA 5A90A 3VMAA 3F1OA 4O8GA 3IWIA 2X71A 2KX6A 1W63M 1IYPA 2JKRI 5BOHA 4GNUA 4IJGA 3S1YA 1TDGA 3CMZA 3U4LP 4LCMA 2GNXA 2HP5A 1D1JA 4OQHA 3KO6A 1FCNA 3BEBA 2ZD8A 3CHWP 1YQSA 3IX8A 2XA7S 5F69A 1N9LA 3LI8A 3Q07A 3AGFA 3RFBA 2WZXA 3R4KA 3ZVTA 4P6BA 5AVEA 4E3NA 4YOFA 4XXRA 1SZVA 3NY4A 1HD8A 4Q0IA 3UDIA 2XD5A 4HNBA 4NKPA 2IWCA 4PM6A 1ACFA 2OWJA 1GSVA 2EX6A 3AGEA 1K55C 2PYPA 1KVLA 4OKPA 2P7JA 3QP4A 3N7WA 5FQKA 4KZ7A 4S2IA 4LLOB 2H0TA 2EFXA 2V8FA 3O86A 2QWSA 1MWRA 2WAEA 5DVAA 1XJ3A 2Y2QA 4GD8A 3LR5A 1EROA 3ZG5A 4R4RA 4QY5A 3L9KA 3ZNYA 2Z6DA 2JKRM 2NUTC 4X56A 4DF6A 4P85A 3U2AA 1BULA 3F1PB 3FZCA 4MBKA 3FKWA 4Y15A 4EBLA 1OT9A 1GSWA 1GHMA 1O07A 2UWXA 1BLCA 5L8MA 4BWIA 3WS1A 4PM7A 4WBGA 3H82B 4ZRRA 4RA7A 4P0MA 3HBRA 1OJ5A 4X69A 4R1GA 4E3JA 3E98A 1GHIA 5DJTA 1OTIA 4BENA 1VHMA 1LHYA 3UDXA 3HJKA 2XH9A 3LUQA 4I3JA 2L1MA 4R6LA 1PYYA 2PU4A 1UWNX 1YKDA 3S7OA 3B42A 2ZQDA 1TEMA 5EUAA 3MXRA 3E0YA 2PR6A 2PR5A 4HJ3A 3VP3A 4KUOA 3A3EA 2FFFB 3SH9A 3NOUC 4GOGA 3VSKA 3LIAA 1STZA 5E43A 1JTDA 4LFUA 4MNRA 4Z9QA 4KQOA 1Y4OA 3UE1A 1XJ2A 2VLGA 4KZ9A 1WA9A 4UQIS 3CLOA 3IHBA 4WM9A 5HX9A 2VGLS 3A3DA 1NZOA 4S2NA 3OPPA 4N1HA 1AXBA 3OCLA 3BW6A 3T4QA 5GHZA 3N6IA 3UMDA 1F98A 2Y2OA 3F1NB 3WWXA 2M7UA 4I5SA 3UB8A 1GCEA 3N8SA 1XFNA 3G32A 2H10A 3PBTA 2Z2MB 1S6RA 1PZOA 1LL5A 2EWVA 4R38A 3DWZA 4P6ZS 2DCFA 1XFQA 5L07A 3MKEA 5J3WA 1M40A 5HL6A 2ZMAA 1W7FA 5M19A 4RX2A 3G35A 2M1CA 5DF8A 2V0UA 4FD8A 1OJGA 4RVAA 1MY8A 4G3KA 5D3OA 5CHUA 2RL3A 4MDZA 4QY6A 3HLWA 2D02A 1G68A 2Y2KA 2WZZA 3KSGA 5J8XA 2QPNA 3LR0A 1RCJA 5KZHA 4Q0HA 3OCNA 3RJUA 4DE0A 3CITA 3ZCZA 3BFCA 3LIBA 4RX3A 2XA7M 1OTAA 1LI0A 2Y79A 3DTIA 3T4LA 2JC7A 4KZBA 2WK0A 4Z1WA 2WKEA 3T1RA 5FQMA 4X68A 4JF5A 2A49A 1UGUA 3UE3A 1H8MA 5F68A 4NEED 1JWZA 1MKMA 3UPOA 3PAGA 3RXXA 4KZ6A 1YMSA 1XXMA 5A91A 1PRQA 5AJGA 4I3IA 2ZL1A 3W4OA 4DE2A 2UV0E 4N9KA 2Y91A 3D72A 1F5MA 3AGDA 3EQVA 1IFQA 3G30A 5GLCA 2Q0OA 2V2FF 1QMFA 5TBMB 1TS7A 3UNWA 5M1AA 1P9WA 4OQGA 2EX9A 5AVFA 2Z2LB 1K57A 1OMEA 2WYXA 3NDEA 5IHVA 5GLAA 5EVID 3GRJA 3RXWA 3MS6A 2W27A 3IWOA 2XR0A 2X01A 2JKTI 2PYRA 3GDIA 2P9VA 1OTBA 3EEHA 4IBXA 4HP4A 4HESA 1MXOA 4QHCA 2GX5A 1KE4A 3BYDA 2XDMA 5HWTA 3IXDA 3VOLA 4IUKA 5F5YA 4N92A 4OLDA 4JXGA 4KG2A 3HLEA 1YM1A 3LEQA 5FA7A 3BFDA 3BFFA 1ZHHB 2J80A 2A2LA 5DF9A 4EERA 3BLSA 4L9GA 1DRMA 1IEMA 3A0RA 4BD0A 2WKIA 4DXBA 4EXOA 2DNSA 1V9ZA 1JTGA 3C8CA 5I94A 5TGFA 3BECA 3VFHA 3P01A 4E3IA 4WZ4A 1G28A 1FQGA 2GZAA 2HJEA 5HAIA 4S2NC 3IWQA 3MXSA 2J3TC 3C38A 3OPLA 3VSLA 4LRYC 2B95A 3NC8A 4U3TA
chains in the Genus database with same CATH topology
4IUHA 4PAUA 3OLOA 5EFWA 4GHIA 3CUEA 5A8BA 4JGRA 3F1OA 3K3DA 2INWA 4B9OA 4HHDA 4O8GA 2K31A 4I39A 2VJWA 2KX6A 1W63M 2JKRI 3BJNA 3CAXA 4LRXC 5HPFA 1OTEA 2O9BA 4IJGA 2PT7A 3R7WB 4Q0JA 3VE3A 4WEJA 1MZUA 1S1YA 2JKTM 2VGLM 2GNXA 3PR6A 5LBRA 3IS2B 2OAQ1 3E4QA 2VV6A 3KO6A 4G3VA 2V1BA 3VE4A 1F9IA 1T18A 3BY8A 4XT2B 5IU1A 2WKRA 4LRZE 2VEAA 5HPIA 2HGVA 3S7PA 2XA7S 5F69A 3MF0A 1N9LA 3LI8A 4PKYA 4DMZA 2LB5A 5G4YA 2FZ0A 2VX8A 3RFBA 4NXFA 3R4KA 5J7EA 3ZYTA 5AVEA 2WKPA 4OOMA 3KSHA 4YOFA 5CX7A 3TRCA 3HCYA 4BBTA 3EEAA 5HDSA 1DP6A 3MJQA 4Q0IA 4HNBA 4NKPA 4H6JB 1EW0A 2XRNA 2M7VA 4ETZA 3R7WA 2JHEA 4R70A 2OWJA 3HJIA 1GSVA 2OOLA 2PYPA 3IS2A 2P7JA 2W3EA 3FPWA 4JGPA 4XT2A 4LPZA 1X0OA 3G6OA 1LSXA 2VZWA 4LLOB 3MQ0A 2NUPC 1OTDA 5HWWA 5HD3A 3S7NA 2W3DA 4BBUA 1OPXA 3LR4A 1DP9A 3BQ8A 1TS6A 3MMHA 4WL9A 2VV7A 2QWSA 3K3CA 3NOTC 1XJ3A 3LR5A 2J3WA 3PYPA 2ZOHA 2DMWA 3UE6A 2W3FA 4L9FA 4HI4A 2Z6DA 2JKRM 2NUTC 2GJ3A 3H7WA 1S67L 3LR3A 2ZOIA 4H6JA 4WLAA 4GW9A 3LIFA 3U2AA 3A0SA 4HOIA 4NXGA 2PD8A 3T4KA 3F1PB 5HWVA 1P0ZA 1OT9A 4DJ3A 3KSIA 4I3AA 2OWHA 1YSPA 1GSWA 3H9WA 4GS9B 4PHTA 5L8MA 1NWZA 4BWIA 4L0LA 3H82B 5HSQA 1S4RA 2K7SA 4ZRRA 5HDCA 5DKKA 2XSSA 4BJPA 3NHQA 1OJ5A 4QPRA 3E98A 2PDRA 3ICYA 2B02A 5DJTA 4YWZA 1OTIA 4KUKA 1VHMA 3EOIA 3E4PA 2QJ5A 1S1ZA 3HJKA 3LUQA 3KYQA 4UQIM 3SW1A 2WKQA 2L1MA 4I3JA 4R6LA 5F6AA 1Y28A 2D01A 2P04A 4R3AA 4CLCC 5DFYA 1UWNX 4L9EA 1YKDA 4HH2A 4O0PA 3S7OA 4EUVA 3B42A 4ME4A 5KIZA 1NLZA 3RH8B 1P9RA 3E0YA 3EQUA 3C2WA 5MC7A 1ZTUA 1DP8A 2PR6A 2PR5A 4HJ3A 4JGQA 3LIEA 3OOVA 2EA9A 4KUOA 5KSHA 3BY9A 3H82A 3NOUC 2O9AA 2EWWA 4I38A 3KX0X 3B47A 4MCWA 3LIAA 1STZA 4IHQA 2J3TD 3PBQA 4KQOA 1N9NA 3BQAA 1XJ2A 2VLGA 3D3OA 1WA9A 4UQIS 3CLOA 2O99A 3CI6A 2A24B 4P6ZM 3T4SA 4AFIA 4EW7A 2O9CA 3V67A 4MN6A 3TW8A 2VGLS 1D7EA 3MR0A 3JVUA 3PXPA 3T4TA 3MFXA 2L0WA 2QHKA 3OCLA 5IS1A 3EGDC 2W3HA 3BW6A 3T4QA 3UMDA 1F98A 1N9OA 1JNUA 3F1NB 4MN5A 4HJ4A 3ULFA 2R78A 3BWLA 4I5SA 1T1CA 4GJ4A 2M7UA 4MN7A 3B33A 3UB8A 3VV4A 4ARZB 3DBAA 3CUEC 2V0WA 3OBFA 2G7UA 4YNRA 1XFNA 4NXEA 3PBTA 2L4RA 2KDKA 2YKHA 2I9VA 4EESA 2EWVA 5C5KA 5DKLA 1YAXA 3UB9A 5IT5A 5FL3A 4R38A 4CLCE 4P6ZS 1XFQA 2LB9A 1W63Q 1LT0A 2A24A 5J3WA 1H3QA 5HL6A 2ZMVA 2M1CA 2V0UA 3FG8A 4GHIB 5I5LA 3FC7A 4WELA 4Y3IA 4Y2FA 3IBRA 1OJGA 4G3KA 3W2ZA 1T1BA 4ETXA 4WUJA 4MDZA 4EETB 1T19A 2D02A 3LI9A 2K2NA 2KLIA 2HF6A 3KSGA 4CQHA 3KYZA 3LR0A 1VB6A 2VKSA 4Q0HA 4EU0A 3PBRA 3OCNA 3ZQ5A 3CITA 1TD5A 3LIBA 4PKYG 4UEYA 5TJJA 2XA7M 4OOLA 1OTAA 2Y79A 2Z6CA 5J4EA 4HH3A 3T4LA 4WF0A 2V1AA 2IA2A 4Z1WA 3F1PA 4MMNA 4F3LB 4HP9A 2VV8A 5G4ZA 2OAP1 2V9AA 2QYBA 4GCZA 4DJ2A 2O0YA 1V9YA 4GS9A 3GECA 3C30A 3A0VA 4KQDA 2HJ9C 1UGUA 3UE3A 1H8MA 5F68A 4NEED 2CMNA 4NXBA 1MKMA 2ZBBA 3UB6A 4EEUA 4WEKA 2HV1A 2PD7A 4G3WA 5DJUA 4EEPA 3FPVA 5AJGA 4I3IA 3CWFA 1OT6A 4CLCB 1IOUA 2W3GA 1D06A 2MJ6A 3D72A 4HIAA 3NOPC 1F5MA 4K08A 3TJZC 5K5BA 4HY8A 2PHYA 3UMEA 3EQVA 1IFQA 1LSWA 2VA0A 3E4OA 3T4JA 5TBMB 2BASA 3O5YA 1NRJA 1TS7A 1P9WA 3EGXC 4CLCD 3LICA 3P7NA 3KSFA 4F3LA 4DN0A 5AVFA 4Y5FA 3MQOA 1UWPX 3LIDA 1TS8A 3NJAA 4RQ9A 2W1RA 2W27A 3T4OA 3H7WB 1S4SA 2JKTI 3T50A 2PYRA 3GDIA 1OTBA 3EEHA 2B18A 4JGOA 4HP4A 3EWKA 4O01A 2W1TB 4CLCA 2QKPA 2W0NA 2H28A 2GX5A 2P08A 4BBVA 1XJ6A 2FH5A 2KOIA 3PHYA 5HDDA 5HWTA 2Y8HA 3VOLA 2QJ7A 2YKFA 4IUKA 5F5YA 3RTYA 3UB7A 5TBMA 1P97A 4B93A 3LYXA 1ZHHB 3JVVA 2J80A 4E04A 3TE8A 2A2LA 3F1OB 1TS0A 1YSQA 1LL8A 5DF9A 4EERA 3LFVA 1KOUA 4FSFA 1DRMA 3F1NA 4L9GA 3A0RA 3PBNA 4ARZA 1LSVA 1T1AA 3IBJA 1MC0A 3MQQA 4GLQA 4EXOA 1V9ZA 4M4XA 3C8CA 4EQ1A 1XJ4A 3S7QA 1G6OA 2W1TA 3P01A 2ZMFA 1GSXA 4WN5A 1G28A 3PBSA 2GZAA 2HJEA 5HD5A 4HJ6A 3OC2A 4FOFA 3MXQA 4HQAA 1S66L 1ODVA 3K2NA 4BMWA 2J3TC 1TF1A 3C38A 1NLYA 4LRYC 5DFXA 5HZHA 2JN7A 1BYWA 2XROA 3PBOA 4II7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OLO A;  5EFW A;  4GHI A;  5A8B A;  4JGR A;  3F1O A;  3K3D A;  2INW A;  4B9O A;  4HHD A;  4I39 A;  2KX6 A;  4LRX C;  3CAX A;  1OTE A;  3VE3 A;  1MZU A;  1S1Y A;  3IS2 B;  3E4Q A;  2VV6 A;  2V1B A;  3VE4 A;  1F9I A;  1T18 A;  3BY8 A;  4XT2 B;  5IU1 A;  2WKR A;  4LRZ E;  2VEA A;  5F69 A;  1N9L A;  3LI8 A;  4PKY A;  5G4Y A;  4NXF A;  5J7E A;  5AVE A;  2WKP A;  4BBT A;  5HDS A;  1DP6 A;  3MJQ A;  4HNB A;  4H6J B;  1EW0 A;  2JHE A;  4R70 A;  2OWJ A;  3HJI A;  1GSV A;  2OOL A;  2PYP A;  3IS2 A;  2P7J A;  4JGP A;  4XT2 A;  4LPZ A;  1X0O A;  3G6O A;  1LSX A;  4LLO B;  5HWW A;  1OTD A;  5HD3 A;  4BBU A;  1DP9 A;  1TS6 A;  4WL9 A;  2VV7 A;  2QWS A;  3K3C A;  3NOT C;  1XJ3 A;  3PYP A;  2ZOH A;  3UE6 A;  4L9F A;  4HI4 A;  2Z6D A;  2GJ3 A;  3H7W A;  4H6J A;  1S67 L;  2ZOI A;  4WLA A;  4GW9 A;  3LIF A;  3A0S A;  4HOI A;  4NXG A;  2PD8 A;  3F1P B;  5HWV A;  1P0Z A;  1OT9 A;  4DJ3 A;  4I3A A;  2OWH A;  1GSW A;  3H9W A;  4GS9 B;  1NWZ A;  3H82 B;  5HSQ A;  1S4R A;  2K7S A;  5HDC A;  5DKK A;  3NHQ A;  1OJ5 A;  2PDR A;  3ICY A;  2B02 A;  5DJT A;  4YWZ A;  1OTI A;  4KUK A;  3E4P A;  2QJ5 A;  1S1Z A;  3HJK A;  3LUQ A;  3SW1 A;  2WKQ A;  2L1M A;  4I3J A;  4R6L A;  5F6A A;  1Y28 A;  2D01 A;  4R3A A;  1UWN X;  4L9E A;  4HH2 A;  5KIZ A;  3RH8 B;  3C2W A;  1DP8 A;  2PR6 A;  2PR5 A;  4HJ3 A;  4JGQ A;  3LIE A;  2EA9 A;  4KUO A;  3BY9 A;  3H82 A;  3NOU C;  4I38 A;  3KX0 X;  3LIA A;  1N9N A;  1XJ2 A;  2VLG A;  1WA9 A;  3CLO A;  2A24 B;  4EW7 A;  4MN6 A;  1D7E A;  3MR0 A;  3MFX A;  2L0W A;  2QHK A;  5IS1 A;  3UMD A;  1F98 A;  1N9O A;  1JNU A;  3F1N B;  4MN5 A;  4HJ4 A;  3ULF A;  2R78 A;  3BWL A;  4I5S A;  1T1C A;  3B33 A;  3UB8 A;  2V0W A;  1XFN A;  4NXE A;  2L4R A;  2KDK A;  2YKH A;  2I9V A;  4EES A;  5DKL A;  3UB9 A;  4R38 A;  1XFQ A;  1LT0 A;  2A24 A;  5J3W A;  2M1C A;  2V0U A;  3FG8 A;  4GHI B;  5I5L A;  3FC7 A;  3IBR A;  1OJG A;  1T1B A;  4WUJ A;  4EET B;  1T19 A;  2D02 A;  3LI9 A;  1VB6 A;  3ZQ5 A;  3LIB A;  4PKY G;  1OTA A;  2Z6C A;  5J4E A;  4HH3 A;  4WF0 A;  2V1A A;  3F1P A;  4F3L B;  4HP9 A;  2VV8 A;  5G4Z A;  2V9A A;  4GCZ A;  4DJ2 A;  1V9Y A;  4GS9 A;  3GEC A;  3A0V A;  4KQD A;  1UGU A;  5F68 A;  2CMN A;  4NXB A;  2ZBB A;  3UB6 A;  4EEU A;  2HV1 A;  2PD7 A;  5DJU A;  4EEP A;  4I3I A;  3CWF A;  1OT6 A;  1D06 A;  3D72 A;  4HIA A;  3NOP C;  4K08 A;  4HY8 A;  2PHY A;  3UME A;  1LSW A;  3E4O A;  5TBM B;  2BAS A;  1TS7 A;  3LIC A;  3P7N A;  4F3L A;  5AVF A;  3MQO A;  1UWP X;  3LID A;  1TS8 A;  3NJA A;  4RQ9 A;  2W27 A;  3H7W B;  1S4S A;  3T50 A;  2PYR A;  3GDI A;  1OTB A;  3EEH A;  4JGO A;  4HP4 A;  3EWK A;  2QKP A;  2W0N A;  2H28 A;  4BBV A;  1XJ6 A;  3PHY A;  5HDD A;  5HWT A;  3VOL A;  2QJ7 A;  2YKF A;  5F5Y A;  3RTY A;  3UB7 A;  5TBM A;  1P97 A;  3LYX A;  2J80 A;  4E04 A;  3F1O B;  1TS0 A;  1LL8 A;  4EER A;  1KOU A;  4L9G A;  1DRM A;  3F1N A;  3A0R A;  1LSV A;  1T1A A;  3MQQ A;  4EXO A;  1V9Z A;  4M4X A;  3C8C A;  4EQ1 A;  1XJ4 A;  1GSX A;  4WN5 A;  1G28 A;  5HD5 A;  4HJ6 A;  3MXQ A;  4HQA A;  1S66 L;  1ODV A;  4LRY C;  5HZH A;  2JN7 A;  1BYW A; 
#chains in the Genus database with same CATH topology
 4WMC D;  1NYM A;  1ESU A;  4GDB A;  4OOY A;  3K3D A;  4HHD A;  2OV5 A;  1DJC A;  2VJW A;  5HPF A;  3CAX A;  3IX3 A;  1G5U A;  1ESI A;  3R7W B;  2Y2I A;  3IXH A;  2JKT M;  2VGL M;  4R3B A;  3PR6 A;  5LBR A;  2OAQ 1;  3E4Q A;  2V1B A;  1F9I A;  3BY8 A;  2Q9N A;  3ZG8 B;  5IU1 A;  5F1F A;  2WKR A;  3OPH A;  2HGV A;  3IQA A;  2LB5 A;  1PZP A;  1J9M A;  2P74 A;  3I7J A;  4JXV A;  2J9O A;  4OOM A;  3KSH A;  3HCY A;  4BBT A;  4E6X A;  1KE0 A;  1IYO A;  1EW0 A;  4BD1 A;  2JHE A;  1L0G A;  3ZGA B;  2ZC7 A;  3IS2 A;  5CEB A;  1PI5 A;  2QZ6 A;  4XT2 A;  2WAF A;  4LPZ A;  5HD3 A;  3S7N A;  3PAE A;  4MLL A;  1OPX A;  3LR4 A;  1DP9 A;  3BQ8 A;  4JXS A;  1TS6 A;  3CPT B;  3FV7 A;  1Z6F A;  3K3C A;  3NOT C;  3C5A A;  3SH8 A;  5GLB A;  4IVI A;  2ZOH A;  2DMW A;  2W3F A;  4HI4 A;  3ITA A;  3HUM A;  4H6J A;  2ZOI A;  3HLG A;  4WLA A;  1IEL A;  3LIF A;  3A0S A;  4NXG A;  2R9W A;  4ZJ2 A;  1YSP A;  3VP0 A;  4PHT A;  2V8C A;  4C6Y A;  3Q7V A;  4L0L A;  3ZG0 A;  3T12 B;  5HSQ A;  1S4R A;  3FKV A;  4Y0O A;  4GD6 A;  4U0T A;  5HDC A;  1F2K A;  1K57 C;  4ZBE A;  2ZL1 B;  1WYB A;  4QPR A;  2X02 A;  2B02 A;  1TVF A;  1Q2P A;  3T1Q B;  1S1Z A;  1FOF A;  2JBF A;  3KYQ A;  3C7V A;  5L2F A;  5F6A A;  1PNE A;  1LLB A;  4R3A A;  5DFY A;  1KE3 A;  4O0P A;  4EUV A;  1XPB A;  1NLZ A;  3RH8 B;  5MC7 A;  1DP8 A;  2ZQA A;  2EA9 A;  5AQA A;  3NUL A;  5KSH A;  3BY9 A;  3LY3 A;  4NET A;  2EWW A;  5F83 A;  2P9V B;  3IHA A;  4MCW A;  2EXA A;  4UA9 A;  4IHQ A;  1Y54 A;  5HAQ A;  3BQA A;  1KGG A;  1N9N A;  1H8Z A;  4Y0U A;  2FFY A;  1W8Y A;  1K4F A;  4EBP A;  2O99 A;  2ZQC A;  4AFI A;  4ESP A;  1YMX A;  4CPK A;  1IYS A;  3MFX A;  4JF6 A;  2W3H A;  1N9O A;  4KG6 A;  1K56 D;  5KMW A;  4MN5 A;  3ULF A;  2R78 A;  4MN7 A;  1E3U D;  3DBA A;  2V0W A;  1BT5 A;  2G7U A;  1S0W A;  2H5S A;  3FWL A;  1CEF A;  5EV0 A;  2L4R A;  5KSC A;  2YKH A;  3OZH A;  1KDW A;  3Q82 A;  5DTK A;  3UB9 A;  5FL3 A;  4CLC E;  1HLU P;  1WE4 A;  2WAD A;  3GV9 A;  4E3O A;  5CHM A;  2A24 A;  3C7U A;  1H0M A;  2HDR A;  5EM0 A;  3UDF A;  2ZMV A;  1PWG A;  1VET A;  2J8Y A;  1NRF A;  3FG8 A;  4E3M A;  3FC7 A;  5FSR A;  4FCF A;  4OPZ A;  4D2O A;  2ZQ7 A;  4WUJ A;  1T19 A;  3LI9 A;  4OPQ A;  3C4P A;  1ZKJ A;  2JCH A;  3TSG A;  5CGS A;  2VKS A;  4EU0 A;  3PBR A;  4HBT A;  4R4S A;  3NI9 A;  3LEZ A;  3QP2 A;  4KEN B;  4S2O A;  5TJJ A;  5J4E A;  2HPB A;  2XGN A;  2C6W B;  1PWC A;  2ACG A;  3ZDJ A;  2IA2 A;  2VGK A;  1XA1 A;  1Z09 A;  4IED A;  1ZG4 A;  3TG9 A;  4MMN A;  2VV8 A;  4GCZ A;  3ZHH A;  1XP4 A;  2O0Y A;  3C30 A;  3IF5 A;  4KQD A;  4NXB A;  3QNC A;  3D4F A;  4WEK A;  2PD7 A;  5DJU A;  4EEP A;  3FPV A;  2ZC6 B;  3CWF A;  5EM1 A;  5CTM A;  1NJ4 A;  2WGI A;  3TJZ C;  3UME A;  3ZVW A;  3A3I A;  1ES3 A;  2XQZ A;  5L09 A;  3T4J A;  4LV0 A;  3P7N A;  3KSF A;  4F3L A;  1G6A A;  4EV4 A;  4LV1 A;  3LO7 A;  3HUN A;  4ZJ3 A;  2RCX A;  1BLP A;  4N9L A;  2B18 A;  2WUQ A;  3G2Y A;  3EWK A;  3GTC A;  4CLC A;  2QKP A;  2C5W B;  4C75 A;  4BBV A;  3Q7V B;  5HDD A;  1YLY A;  2YKF A;  5TR7 A;  2JKG A;  2OLV A;  2WGW A;  4RYE A;  2XLN A;  4UHU A;  3LYX A;  1ALQ A;  1VM1 A;  5GHY A;  3F1O B;  4IBR A;  4PM8 A;  1TS0 A;  5DTT A;  3LFV A;  3DW0 A;  4FSF A;  4UA7 A;  5EVE A;  1N4O A;  1T1A A;  2HP9 A;  3IBJ A;  5F1G A;  3IF6 A;  5EVL A;  4GLQ A;  5GHX A;  1I2S A;  4XUZ A;  1KVM A;  2W1T A;  1GSX A;  3T1S A;  3JPU A;  2ZC5 B;  4HJ6 A;  3OC2 A;  4FOF A;  1ODV A;  3K2N A;  4BMW A;  3ITB A;  3A3F A;  5HAR A;  1TF1 A;  2JN7 A;  3QHY A;  3DTM A;  4II7 A;  3KYE A;  4S2M A;  4GHI A;  4BLM A;  2Q9M A;  5A8B A;  1W79 A;  2HDQ A;  3T1X A;  4OLG A;  4B9O A;  3A3J A;  2IWD A;  4LRX C;  5HFO A;  2PT7 A;  4QU3 A;  4Q0J A;  4DDY A;  1MZU A;  3O87 A;  5FI2 A;  5GLD A;  2Y2L A;  4G3V A;  2A3U A;  1T18 A;  4S2K A;  5FDH A;  1PI4 A;  1L0F A;  4LRZ E;  2Y2H A;  2VEA A;  3HLB A;  3MF0 A;  4PKY A;  5EE8 A;  4JKT A;  4XUX A;  5JYO A;  3E2K A;  3G34 A;  4IVK A;  4NXF A;  4B4Z A;  3ZYT A;  4LEN A;  5CX7 A;  3MZE A;  1PW1 A;  3EEA A;  1DP6 A;  3MJQ A;  4OP8 A;  1E4D A;  2ZQ9 A;  1K25 A;  5FQ9 A;  1K6R A;  4MEZ A;  1K54 A;  1K0K A;  1K6S A;  1VET B;  2OOL A;  4KZA A;  3BRM A;  1XGJ A;  1C3B A;  4PMA A;  3HUO A;  2W3E A;  4JGP A;  2ZM2 A;  1X0O A;  2JKF A;  3G6O A;  1LSX A;  4DDS A;  1YLZ A;  5EPH A;  5TFQ A;  1YLJ A;  5CHJ A;  2NUP C;  4WZ5 A;  1NZU A;  3SS4 A;  2W3D A;  4BBU A;  3SOI A;  1YLT A;  4WL9 A;  2VV7 A;  3HLC A;  5EOO A;  3ZNT A;  2EX8 A;  3BM6 A;  1RP5 A;  3UE6 A;  2OLU A;  2GJ3 A;  1S67 L;  3H7W A;  3LR3 A;  5CGX A;  5CXW A;  3PTE A;  1FCO A;  4GW9 A;  1VEU A;  2PD8 A;  3ZG7 B;  5HWV A;  4DJ3 A;  4I3A A;  3QP8 A;  3H9W A;  3W4P A;  1I2W A;  4EUZ A;  4LV2 A;  3CZD A;  3QP6 A;  4KQR A;  5A92 A;  2K7S A;  1E25 A;  1CEG A;  5DKK A;  4BJP A;  3HLF A;  1NY0 A;  1MPL A;  1BSG A;  3ICY A;  4YWZ A;  4KUK A;  2GDN A;  3NEC A;  3QP1 A;  3EOI A;  3E4P A;  3BFE A;  4LCL A;  3M2J A;  4UQI M;  4X55 A;  2D01 A;  3QNB A;  5FAO A;  4CLC C;  1BUE A;  3BLM A;  4L9E A;  1HVB A;  5KIZ A;  3EQU A;  1YLW A;  2XF3 A;  4MBH A;  5HL1 A;  4JGQ A;  3H82 A;  2VGJ A;  4PPR A;  2O9A A;  3KX0 X;  4OVD A;  3B47 A;  1SKF A;  2J3T D;  4BL2 A;  3IXG A;  2EXB A;  4N1X A;  2Y55 A;  1CF0 A;  2ZC4 B;  3IX4 A;  3CJM A;  3IF6 C;  2ZLY A;  4GKU A;  3WS5 A;  3CI6 A;  3FYZ A;  2BLS A;  1TDL A;  4P6Z M;  3T4S A;  2O9C A;  4MN6 A;  3TW8 A;  3DTE A;  1EI5 A;  1KGE A;  3MR0 A;  3PXP A;  3T4T A;  1FSY A;  3UPN A;  2QHK A;  3EGD C;  5FQQ A;  4OPR A;  1JNU A;  1W8Q A;  3BWL A;  1T1C A;  1XGI A;  3M6B A;  2EFU A;  3OBF A;  4JPM A;  4YNR A;  3D9Y A;  4ID4 A;  1FCM A;  2I9V A;  4EES A;  1YAX A;  4ZAM A;  1FR1 A;  2LB9 A;  5FQJ A;  4KQQ A;  1H3Q A;  5JYP A;  4EWF A;  1N9B A;  3S4X A;  4S2P A;  4QJG A;  4GHI B;  3ZFZ A;  1GHP A;  3B3X A;  2Y2M A;  4WEL A;  3P09 A;  4Y3I A;  3IBR A;  4M3K A;  3W2Z A;  1T1B A;  4GZB A;  4EET B;  2XEP A;  2K2N A;  4OP5 A;  4QB8 A;  4CQH A;  4H8R A;  1O7E A;  1K54 C;  4A5R A;  3ZQ5 A;  1TD5 A;  3SS5 A;  4PKY G;  4OOL A;  4HH3 A;  2HP6 A;  1M6K A;  4HEF A;  4HP9 A;  2OAP 1;  4WZ5 C;  3VFF A;  3VOZ A;  4P87 A;  4DJ2 A;  5E2F A;  4MBF A;  1V9Y A;  4GS9 A;  4BQM A;  4GB7 A;  3A0V A;  3L7H A;  3E2L A;  1MWT A;  2CMN A;  4Q8I A;  5A93 A;  2ZBB A;  3UB6 A;  4EEU A;  5FI7 A;  2HV1 A;  1RGY A;  5AQB A;  1OT6 A;  1IOU A;  2W3G A;  1D06 A;  4YFM A;  2HZ5 A;  3NOP C;  4K08 A;  5K5B A;  5U47 A;  1K38 A;  4HY8 A;  1I5Q A;  1PWD A;  4X1M A;  3UO9 A;  1FSW A;  2IWB A;  2VA0 A;  2VK3 A;  1LL9 A;  2BAS A;  3GSG A;  1NRJ A;  4D60 A;  5EEC A;  3EGX C;  1EWZ A;  3LIC A;  1MKI A;  4ZTK A;  1ZG6 A;  4X6T A;  1VQQ A;  3LID A;  5CER A;  4F94 A;  3Q7Z A;  3MFD A;  4UAA A;  2W1R A;  4QD4 A;  3T4O A;  3H7W B;  1S4S A;  5EOE A;  3TOI A;  3T50 A;  1VEU B;  3DWK A;  1FIK A;  4JGO A;  1FIL A;  1NYY A;  5AQ7 A;  4O01 A;  4FUW A;  4JXW A;  2ZC3 B;  1XJ6 A;  2BTF P;  3PHY A;  2Y8H A;  5EVI A;  2QJ7 A;  3RTY A;  3VOY A;  5TBM A;  3SS3 A;  1GA0 A;  2Y2G A;  3JVV A;  4E04 A;  3TE8 A;  1LL8 A;  1L0E A;  1A0K A;  1QME A;  3PBN A;  3UE0 A;  4EQI A;  4ARZ A;  5FEG A;  1MC0 A;  3OPR A;  4DKI A;  4JLF A;  4M4X A;  4EQ1 A;  3S7Q A;  1SHV A;  1G6O A;  2ZMF A;  3W8K A;  4DRT A;  5HD5 A;  3NCK A;  3MXQ A;  1S66 L;  1JWP A;  3IH8 A;  5HZH A;  1BYW A;  2XRO A;  3PBO A;  4IUH A;  3OLO A;  3UB5 P;  3MSH A;  5EFW A;  3CUE A;  4K0X A;  4JGR A;  2INW A;  2K31 A;  2Y2N A;  3ISG A;  4I39 A;  1CQA A;  3BJN A;  2ZM0 A;  1OTE A;  2O9B A;  4X25 A;  3VE3 A;  4WEJ A;  1IYQ A;  3MZD A;  1S1Y A;  3W4Q A;  1SDE A;  3IS2 B;  3C4O A;  3WRZ A;  2VV6 A;  3VE4 A;  4R0Q A;  4WMC A;  4XT2 B;  4KZ5 A;  5HPI A;  3CG5 A;  2AVX A;  3S7P A;  2ZQ8 A;  3LCE A;  5FI6 A;  4DMZ A;  1JVJ A;  4EBN A;  5G4Y A;  3IH9 A;  2FZ0 A;  2VX8 A;  5J7E A;  3HL9 A;  3O3V A;  2WKP A;  1AWI A;  3TRC A;  5HDS A;  3V3S A;  4H6J B;  2XRN A;  2M7V A;  4ETZ A;  3R7W A;  4R70 A;  3HJI A;  4GN2 A;  3MBZ A;  3VP1 A;  1ES4 A;  3FPW A;  1HTZ A;  1BLS A;  5CEC A;  4JBF A;  2VZW A;  1ONH A;  5DTS A;  1XA7 A;  3SZT A;  5E2H A;  3MQ0 A;  5HWW A;  1OTD A;  3VP4 A;  1SKO A;  3V3R A;  1ZC2 A;  1IKG A;  2PBD P;  4S2L A;  5E2G A;  2G2U A;  3MMH A;  4C3Q A;  1J3W A;  3QP5 A;  2J3W A;  4OQI A;  3PYP A;  5GL9 A;  4S2J A;  2XK1 A;  4L9F A;  4LGW A;  1BZA A;  3IXB A;  4HOI A;  3N4I A;  3T4K A;  3GQZ A;  1P0Z A;  2BG1 A;  3KSI A;  2OWH A;  2G2W A;  2ZM8 A;  4GS9 B;  1NWZ A;  5L10 A;  1LI9 A;  4ZJ1 A;  3GVB A;  3NBL A;  4QWO A;  1YPR A;  3HRE A;  2XSS A;  3NHQ A;  4O7D A;  3CPT A;  3UN7 A;  4KZ4 A;  2PDR A;  4NG2 A;  2QJ5 A;  1FR6 A;  5CTN A;  2Y2P A;  3SW1 A;  2WKQ A;  1Y28 A;  2P04 A;  1GA9 A;  4HH2 A;  5CED A;  1NXY A;  2WKH A;  4ME4 A;  2XFT A;  5EVI C;  1P9R A;  3G2Z A;  1DJB A;  3C2W A;  1ZTU A;  1XKZ A;  3S22 A;  4OQ0 A;  2Y4A A;  1SCW A;  3LIE A;  4OON A;  3OOV A;  1JWV A;  1YT4 A;  4BL3 A;  4I38 A;  2B5R A;  4R3J A;  4KZ3 A;  2R9X A;  4GDN A;  3MZF A;  2HDS A;  3PBQ A;  4YIN A;  1W5D A;  1MWU A;  3D3O A;  4PM9 A;  2A24 B;  5EVI B;  4EW7 A;  1Q2Q A;  3UY6 A;  3V67 A;  3HLD A;  3Q81 A;  3Q1F A;  1D7E A;  3JVU A;  2L0W A;  1KDS A;  4FH4 A;  1BTL A;  5IS1 A;  1XX2 A;  4PM5 A;  1L3L A;  5FEF A;  4HJ4 A;  1ES2 A;  4GJ4 A;  3B33 A;  4ARZ B;  3VV4 A;  4OH0 A;  3CUE C;  3SH7 A;  4FTX A;  3UPP A;  4NXE A;  1MWS A;  5HW3 A;  4HBU A;  2KDK A;  1H8Y A;  3V50 A;  4CJN A;  1ERQ A;  4K0W A;  3MKF A;  4FH2 A;  5C5K A;  5DKL A;  5IT5 A;  3O88 A;  1W63 Q;  1K56 A;  1LT0 A;  3WRT A;  2PAV P;  1E3U A;  1IKI A;  2EX2 A;  3N8L A;  1H5X A;  5I5L A;  3ZG9 B;  4Y2F A;  1U60 A;  3M2K A;  3G31 A;  1CI8 A;  4ETX A;  3WS2 A;  2E8I A;  4DE3 A;  4Y17 A;  2PBY A;  3M6H A;  2KLI A;  4E3K A;  2HF6 A;  2Y2J A;  1MBL A;  3KYZ A;  1L0D A;  1VB6 A;  3LY4 A;  1K55 A;  2E8J A;  5FAQ A;  1PW8 A;  3VP2 A;  4UEY A;  5F82 A;  2Z6C A;  4JF4 A;  4WF0 A;  2V1A A;  3IT9 A;  1SDN A;  4NK3 A;  4X53 A;  4B88 A;  3F1P A;  4F3L B;  5G4Z A;  2V9A A;  2QYB A;  5G18 A;  3GEC A;  2HJ9 C;  5FAS A;  1DJA A;  5AQ9 A;  4B4X A;  5E2E A;  3BFG A;  1CK3 A;  4X1L A;  3WS0 A;  3N8R A;  4Y7P A;  5CGW A;  4G3W A;  4WYY A;  4Y0T A;  4K91 A;  4CLC B;  1CI9 A;  1HZO A;  2MJ6 A;  4HIA A;  5DF7 A;  2OSU A;  3JYI A;  1RGZ A;  2PHY A;  4UA6 A;  1DY6 A;  1KGF A;  1LSW A;  1SKO B;  2J7V A;  3E4O A;  4U0X A;  3O5Y A;  4E6W A;  2WGW B;  4KG5 A;  4CLC D;  5HAP A;  2XD1 A;  4DN0 A;  4Y5F A;  3MQO A;  1PIO A;  1UWP X;  3NJA A;  1TS8 A;  1ONG A;  4RQ9 A;  3V5M A;  2V1Z A;  3DTK A;  2JE5 A;  3IF6 B;  4ZDX A;  1ERM A;  5FDS A;  5CRF A;  4KZ8 A;  2W1T B;  2W0N A;  2H28 A;  2P08 A;  2FH5 A;  2KOI A;  1YLP A;  3UB7 A;  1CJF A;  2V20 A;  4LV3 A;  3LGO A;  1P97 A;  2H0Y A;  3WS4 A;  4B93 A;  2DRW A;  2WGV A;  1ES5 A;  1YSQ A;  4DE1 A;  1PFL A;  1KOU A;  3F1N A;  4R23 A;  3GR2 A;  2Y59 A;  4E3L A;  1L2S A;  1LSV A;  2I72 A;  2PRF A;  5FQI A;  3MQQ A;  3GMW A;  1XJ4 A;  4DXC A;  3G4P A;  1BLH A;  3HVF A;  2XFS A;  5FAT A;  4WN5 A;  3PBS A;  2HDU A;  3V39 A;  3NDG A;  4HQA A;  2ZJ9 A;  2PU2 A;  5FAP A;  1WYC A;  1NLY A;  5DFX A;  2CC1 A;  1K4E A;  4OPY A;  4PAU A;  3NIA A;  5M18 A;  4Y13 A;  3DAV A;  2J9P A;  3P98 A;  2QMI A;  5A90 A;  3VMA A;  3F1O A;  4O8G A;  3IWI A;  2X71 A;  2KX6 A;  1W63 M;  1IYP A;  2JKR I;  5BOH A;  4GNU A;  4IJG A;  3S1Y A;  1TDG A;  3CMZ A;  3U4L P;  4LCM A;  2GNX A;  2HP5 A;  1D1J A;  4OQH A;  3KO6 A;  1FCN A;  3BEB A;  2ZD8 A;  3CHW P;  1YQS A;  3IX8 A;  2XA7 S;  5F69 A;  1N9L A;  3LI8 A;  3Q07 A;  3AGF A;  3RFB A;  2WZX A;  3R4K A;  3ZVT A;  4P6B A;  5AVE A;  4E3N A;  4YOF A;  4XXR A;  1SZV A;  3NY4 A;  1HD8 A;  4Q0I A;  3UDI A;  2XD5 A;  4HNB A;  4NKP A;  2IWC A;  4PM6 A;  1ACF A;  2OWJ A;  1GSV A;  2EX6 A;  3AGE A;  1K55 C;  2PYP A;  1KVL A;  4OKP A;  2P7J A;  3QP4 A;  3N7W A;  5FQK A;  4KZ7 A;  4S2I A;  4LLO B;  2H0T A;  2EFX A;  2V8F A;  3O86 A;  2QWS A;  1MWR A;  2WAE A;  5DVA A;  1XJ3 A;  2Y2Q A;  4GD8 A;  3LR5 A;  1ERO A;  3ZG5 A;  4R4R A;  4QY5 A;  3L9K A;  3ZNY A;  2Z6D A;  2JKR M;  2NUT C;  4X56 A;  4DF6 A;  4P85 A;  3U2A A;  1BUL A;  3F1P B;  3FZC A;  4MBK A;  3FKW A;  4Y15 A;  4EBL A;  1OT9 A;  1GSW A;  1GHM A;  1O07 A;  2UWX A;  1BLC A;  5L8M A;  4BWI A;  3WS1 A;  4PM7 A;  4WBG A;  3H82 B;  4ZRR A;  4RA7 A;  4P0M A;  3HBR A;  1OJ5 A;  4X69 A;  4R1G A;  4E3J A;  3E98 A;  1GHI A;  5DJT A;  1OTI A;  4BEN A;  1VHM A;  1LHY A;  3UDX A;  3HJK A;  2XH9 A;  3LUQ A;  4I3J A;  2L1M A;  4R6L A;  1PYY A;  2PU4 A;  1UWN X;  1YKD A;  3S7O A;  3B42 A;  2ZQD A;  1TEM A;  5EUA A;  3MXR A;  3E0Y A;  2PR6 A;  2PR5 A;  4HJ3 A;  3VP3 A;  4KUO A;  3A3E A;  2FFF B;  3SH9 A;  3NOU C;  4GOG A;  3VSK A;  3LIA A;  1STZ A;  5E43 A;  1JTD A;  4LFU A;  4MNR A;  4Z9Q A;  4KQO A;  1Y4O A;  3UE1 A;  1XJ2 A;  2VLG A;  4KZ9 A;  1WA9 A;  4UQI S;  3CLO A;  3IHB A;  4WM9 A;  5HX9 A;  2VGL S;  3A3D A;  1NZO A;  4S2N A;  3OPP A;  4N1H A;  1AXB A;  3OCL A;  3BW6 A;  3T4Q A;  5GHZ A;  3N6I A;  3UMD A;  1F98 A;  2Y2O A;  3F1N B;  3WWX A;  2M7U A;  4I5S A;  3UB8 A;  1GCE A;  3N8S A;  1XFN A;  3G32 A;  2H10 A;  3PBT A;  2Z2M B;  1S6R A;  1PZO A;  1LL5 A;  2EWV A;  4R38 A;  3DWZ A;  4P6Z S;  2DCF A;  1XFQ A;  5L07 A;  3MKE A;  5J3W A;  1M40 A;  5HL6 A;  2ZMA A;  1W7F A;  5M19 A;  4RX2 A;  3G35 A;  2M1C A;  5DF8 A;  2V0U A;  4FD8 A;  1OJG A;  4RVA A;  1MY8 A;  4G3K A;  5D3O A;  5CHU A;  2RL3 A;  4MDZ A;  4QY6 A;  3HLW A;  2D02 A;  1G68 A;  2Y2K A;  2WZZ A;  3KSG A;  5J8X A;  2QPN A;  3LR0 A;  1RCJ A;  5KZH A;  4Q0H A;  3OCN A;  3RJU A;  4DE0 A;  3CIT A;  3ZCZ A;  3BFC A;  3LIB A;  4RX3 A;  2XA7 M;  1OTA A;  1LI0 A;  2Y79 A;  3DTI A;  3T4L A;  2JC7 A;  4KZB A;  2WK0 A;  4Z1W A;  2WKE A;  3T1R A;  5FQM A;  4X68 A;  4JF5 A;  2A49 A;  1UGU A;  3UE3 A;  1H8M A;  5F68 A;  4NEE D;  1JWZ A;  1MKM A;  3UPO A;  3PAG A;  3RXX A;  4KZ6 A;  1YMS A;  1XXM A;  5A91 A;  1PRQ A;  5AJG A;  4I3I A;  2ZL1 A;  3W4O A;  4DE2 A;  2UV0 E;  4N9K A;  2Y91 A;  3D72 A;  1F5M A;  3AGD A;  3EQV A;  1IFQ A;  3G30 A;  5GLC A;  2Q0O A;  2V2F F;  1QMF A;  5TBM B;  1TS7 A;  3UNW A;  5M1A A;  1P9W A;  4OQG A;  2EX9 A;  5AVF A;  2Z2L B;  1K57 A;  1OME A;  2WYX A;  3NDE A;  5IHV A;  5GLA A;  5EVI D;  3GRJ A;  3RXW A;  3MS6 A;  2W27 A;  3IWO A;  2XR0 A;  2X01 A;  2JKT I;  2PYR A;  3GDI A;  2P9V A;  1OTB A;  3EEH A;  4IBX A;  4HP4 A;  4HES A;  1MXO A;  4QHC A;  2GX5 A;  1KE4 A;  3BYD A;  2XDM A;  5HWT A;  3IXD A;  3VOL A;  4IUK A;  5F5Y A;  4N92 A;  4OLD A;  4JXG A;  4KG2 A;  3HLE A;  1YM1 A;  3LEQ A;  5FA7 A;  3BFD A;  3BFF A;  1ZHH B;  2J80 A;  2A2L A;  5DF9 A;  4EER A;  3BLS A;  4L9G A;  1DRM A;  1IEM A;  3A0R A;  4BD0 A;  2WKI A;  4DXB A;  4EXO A;  2DNS A;  1V9Z A;  1JTG A;  3C8C A;  5I94 A;  5TGF A;  3BEC A;  3VFH A;  3P01 A;  4E3I A;  4WZ4 A;  1G28 A;  1FQG A;  2GZA A;  2HJE A;  5HAI A;  4S2N C;  3IWQ A;  3MXS A;  2J3T C;  3C38 A;  3OPL A;  3VSL A;  4LRY C;  2B95 A;  3NC8 A;  4U3T A; 
#chains in the Genus database with same CATH homology
 4IUH A;  4PAU A;  3OLO A;  5EFW A;  4GHI A;  3CUE A;  5A8B A;  4JGR A;  3F1O A;  3K3D A;  2INW A;  4B9O A;  4HHD A;  4O8G A;  2K31 A;  4I39 A;  2VJW A;  2KX6 A;  1W63 M;  2JKR I;  3BJN A;  3CAX A;  4LRX C;  5HPF A;  1OTE A;  2O9B A;  4IJG A;  2PT7 A;  3R7W B;  4Q0J A;  3VE3 A;  4WEJ A;  1MZU A;  1S1Y A;  2JKT M;  2VGL M;  2GNX A;  3PR6 A;  5LBR A;  3IS2 B;  2OAQ 1;  3E4Q A;  2VV6 A;  3KO6 A;  4G3V A;  2V1B A;  3VE4 A;  1F9I A;  1T18 A;  3BY8 A;  4XT2 B;  5IU1 A;  2WKR A;  4LRZ E;  2VEA A;  5HPI A;  2HGV A;  3S7P A;  2XA7 S;  5F69 A;  3MF0 A;  1N9L A;  3LI8 A;  4PKY A;  4DMZ A;  2LB5 A;  5G4Y A;  2FZ0 A;  2VX8 A;  3RFB A;  4NXF A;  3R4K A;  5J7E A;  3ZYT A;  5AVE A;  2WKP A;  4OOM A;  3KSH A;  4YOF A;  5CX7 A;  3TRC A;  3HCY A;  4BBT A;  3EEA A;  5HDS A;  1DP6 A;  3MJQ A;  4Q0I A;  4HNB A;  4NKP A;  4H6J B;  1EW0 A;  2XRN A;  2M7V A;  4ETZ A;  3R7W A;  2JHE A;  4R70 A;  2OWJ A;  3HJI A;  1GSV A;  2OOL A;  2PYP A;  3IS2 A;  2P7J A;  2W3E A;  3FPW A;  4JGP A;  4XT2 A;  4LPZ A;  1X0O A;  3G6O A;  1LSX A;  2VZW A;  4LLO B;  3MQ0 A;  2NUP C;  1OTD A;  5HWW A;  5HD3 A;  3S7N A;  2W3D A;  4BBU A;  1OPX A;  3LR4 A;  1DP9 A;  3BQ8 A;  1TS6 A;  3MMH A;  4WL9 A;  2VV7 A;  2QWS A;  3K3C A;  3NOT C;  1XJ3 A;  3LR5 A;  2J3W A;  3PYP A;  2ZOH A;  2DMW A;  3UE6 A;  2W3F A;  4L9F A;  4HI4 A;  2Z6D A;  2JKR M;  2NUT C;  2GJ3 A;  3H7W A;  1S67 L;  3LR3 A;  2ZOI A;  4H6J A;  4WLA A;  4GW9 A;  3LIF A;  3U2A A;  3A0S A;  4HOI A;  4NXG A;  2PD8 A;  3T4K A;  3F1P B;  5HWV A;  1P0Z A;  1OT9 A;  4DJ3 A;  3KSI A;  4I3A A;  2OWH A;  1YSP A;  1GSW A;  3H9W A;  4GS9 B;  4PHT A;  5L8M A;  1NWZ A;  4BWI A;  4L0L A;  3H82 B;  5HSQ A;  1S4R A;  2K7S A;  4ZRR A;  5HDC A;  5DKK A;  2XSS A;  4BJP A;  3NHQ A;  1OJ5 A;  4QPR A;  3E98 A;  2PDR A;  3ICY A;  2B02 A;  5DJT A;  4YWZ A;  1OTI A;  4KUK A;  1VHM A;  3EOI A;  3E4P A;  2QJ5 A;  1S1Z A;  3HJK A;  3LUQ A;  3KYQ A;  4UQI M;  3SW1 A;  2WKQ A;  2L1M A;  4I3J A;  4R6L A;  5F6A A;  1Y28 A;  2D01 A;  2P04 A;  4R3A A;  4CLC C;  5DFY A;  1UWN X;  4L9E A;  1YKD A;  4HH2 A;  4O0P A;  3S7O A;  4EUV A;  3B42 A;  4ME4 A;  5KIZ A;  1NLZ A;  3RH8 B;  1P9R A;  3E0Y A;  3EQU A;  3C2W A;  5MC7 A;  1ZTU A;  1DP8 A;  2PR6 A;  2PR5 A;  4HJ3 A;  4JGQ A;  3LIE A;  3OOV A;  2EA9 A;  4KUO A;  5KSH A;  3BY9 A;  3H82 A;  3NOU C;  2O9A A;  2EWW A;  4I38 A;  3KX0 X;  3B47 A;  4MCW A;  3LIA A;  1STZ A;  4IHQ A;  2J3T D;  3PBQ A;  4KQO A;  1N9N A;  3BQA A;  1XJ2 A;  2VLG A;  3D3O A;  1WA9 A;  4UQI S;  3CLO A;  2O99 A;  3CI6 A;  2A24 B;  4P6Z M;  3T4S A;  4AFI A;  4EW7 A;  2O9C A;  3V67 A;  4MN6 A;  3TW8 A;  2VGL S;  1D7E A;  3MR0 A;  3JVU A;  3PXP A;  3T4T A;  3MFX A;  2L0W A;  2QHK A;  3OCL A;  5IS1 A;  3EGD C;  2W3H A;  3BW6 A;  3T4Q A;  3UMD A;  1F98 A;  1N9O A;  1JNU A;  3F1N B;  4MN5 A;  4HJ4 A;  3ULF A;  2R78 A;  3BWL A;  4I5S A;  1T1C A;  4GJ4 A;  2M7U A;  4MN7 A;  3B33 A;  3UB8 A;  3VV4 A;  4ARZ B;  3DBA A;  3CUE C;  2V0W A;  3OBF A;  2G7U A;  4YNR A;  1XFN A;  4NXE A;  3PBT A;  2L4R A;  2KDK A;  2YKH A;  2I9V A;  4EES A;  2EWV A;  5C5K A;  5DKL A;  1YAX A;  3UB9 A;  5IT5 A;  5FL3 A;  4R38 A;  4CLC E;  4P6Z S;  1XFQ A;  2LB9 A;  1W63 Q;  1LT0 A;  2A24 A;  5J3W A;  1H3Q A;  5HL6 A;  2ZMV A;  2M1C A;  2V0U A;  3FG8 A;  4GHI B;  5I5L A;  3FC7 A;  4WEL A;  4Y3I A;  4Y2F A;  3IBR A;  1OJG A;  4G3K A;  3W2Z A;  1T1B A;  4ETX A;  4WUJ A;  4MDZ A;  4EET B;  1T19 A;  2D02 A;  3LI9 A;  2K2N A;  2KLI A;  2HF6 A;  3KSG A;  4CQH A;  3KYZ A;  3LR0 A;  1VB6 A;  2VKS A;  4Q0H A;  4EU0 A;  3PBR A;  3OCN A;  3ZQ5 A;  3CIT A;  1TD5 A;  3LIB A;  4PKY G;  4UEY A;  5TJJ A;  2XA7 M;  4OOL A;  1OTA A;  2Y79 A;  2Z6C A;  5J4E A;  4HH3 A;  3T4L A;  4WF0 A;  2V1A A;  2IA2 A;  4Z1W A;  3F1P A;  4MMN A;  4F3L B;  4HP9 A;  2VV8 A;  5G4Z A;  2OAP 1;  2V9A A;  2QYB A;  4GCZ A;  4DJ2 A;  2O0Y A;  1V9Y A;  4GS9 A;  3GEC A;  3C30 A;  3A0V A;  4KQD A;  2HJ9 C;  1UGU A;  3UE3 A;  1H8M A;  5F68 A;  4NEE D;  2CMN A;  4NXB A;  1MKM A;  2ZBB A;  3UB6 A;  4EEU A;  4WEK A;  2HV1 A;  2PD7 A;  4G3W A;  5DJU A;  4EEP A;  3FPV A;  5AJG A;  4I3I A;  3CWF A;  1OT6 A;  4CLC B;  1IOU A;  2W3G A;  1D06 A;  2MJ6 A;  3D72 A;  4HIA A;  3NOP C;  1F5M A;  4K08 A;  3TJZ C;  5K5B A;  4HY8 A;  2PHY A;  3UME A;  3EQV A;  1IFQ A;  1LSW A;  2VA0 A;  3E4O A;  3T4J A;  5TBM B;  2BAS A;  3O5Y A;  1NRJ A;  1TS7 A;  1P9W A;  3EGX C;  4CLC D;  3LIC A;  3P7N A;  3KSF A;  4F3L A;  4DN0 A;  5AVF A;  4Y5F A;  3MQO A;  1UWP X;  3LID A;  1TS8 A;  3NJA A;  4RQ9 A;  2W1R A;  2W27 A;  3T4O A;  3H7W B;  1S4S A;  2JKT I;  3T50 A;  2PYR A;  3GDI A;  1OTB A;  3EEH A;  2B18 A;  4JGO A;  4HP4 A;  3EWK A;  4O01 A;  2W1T B;  4CLC A;  2QKP A;  2W0N A;  2H28 A;  2GX5 A;  2P08 A;  4BBV A;  1XJ6 A;  2FH5 A;  2KOI A;  3PHY A;  5HDD A;  5HWT A;  2Y8H A;  3VOL A;  2QJ7 A;  2YKF A;  4IUK A;  5F5Y A;  3RTY A;  3UB7 A;  5TBM A;  1P97 A;  4B93 A;  3LYX A;  1ZHH B;  3JVV A;  2J80 A;  4E04 A;  3TE8 A;  2A2L A;  3F1O B;  1TS0 A;  1YSQ A;  1LL8 A;  5DF9 A;  4EER A;  3LFV A;  1KOU A;  4FSF A;  1DRM A;  3F1N A;  4L9G A;  3A0R A;  3PBN A;  4ARZ A;  1LSV A;  1T1A A;  3IBJ A;  1MC0 A;  3MQQ A;  4GLQ A;  4EXO A;  1V9Z A;  4M4X A;  3C8C A;  4EQ1 A;  1XJ4 A;  3S7Q A;  1G6O A;  2W1T A;  3P01 A;  2ZMF A;  1GSX A;  4WN5 A;  1G28 A;  3PBS A;  2GZA A;  2HJE A;  5HD5 A;  4HJ6 A;  3OC2 A;  4FOF A;  3MXQ A;  4HQA A;  1S66 L;  1ODV A;  3K2N A;  4BMW A;  2J3T C;  1TF1 A;  3C38 A;  1NLY A;  4LRY C;  5DFX A;  5HZH A;  2JN7 A;  1BYW A;  2XRO A;  3PBO A;  4II7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...