3IS2B

2.3 angstrom crystal structure of a cys71 sulfenic acid form of vivid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
149
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Illuminating solution responses of a LOV domain protein with photocoupled small-angle X-ray scattering.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
total genus 34
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3is2B00
4MN6A 3ULFA 1VB6A 4JGPA 3MFXA 3F1NB 3MR0A 1S4SA 3F1PA 2A24B 2EA9A 4XT2B 4HY8A 3T50A 2ZOHA 3LIFA 4KQDA 4EERA 2Z6DA 5F6AA 1BYWA 1TS6A 5F68A 1UWPX 2BASA 1T1CA 4WF0A 1OJGA 4BBUA 4HIAA 4BBTA 4EW7A 1OTBA 5F5YA 1UWNX 4EESA 2WKQA 2WKPA 1GSXA 3K3DA 5F69A 3CWFA 1S1ZA 1X0OA 4I38A 3F1OB 2M1CA 3HJKA 4GHIA 1D7EA 1N9OA 5I5LA 1LSVA 1T1BA 2ZOIA 1OTDA 5HWTA 2W0NA 3C2WA 4B9OA 1T19A 4I3JA 4NXBA 3LUQA 3G6OA 4F3LA 2PDRA 3EWKA 1G28A 1ODVA 4R70A 5DJTA 5DKLA 5A8BA 3MXQA 4JGQA 2PR6A 2HV1A 3VE3A 2VLGA 2JN7A 2QWSA 1TS7A 3IS2A 3IS2B 1DP8A 4H6JA 4WLAA 5TBMA 4R3AA 5TBMB 3E4QA 2YKHA 3NOPC 2OWHA 1GSVA 4JGOA 5EFWA 3CLOA 4YWZA 1F98A 2V9AA 2R78A 4EQ1A 3H7WA 1GSWA 3LIAA 4KUKA 3NOTC 4BBVA 2PR5A 3PYPA 4K08A 1D06A 4GS9A 4GS9B 3H9WA 2PYPA 2V0WA 3UB8A 3F1NA 3NOUC 3NHQA 5G4ZA 2A24A 3UB9A 2GJ3A 4XT2A 3ZQ5A 4NXEA 4GCZA 3P7NA 3A0VA 4HH3A 3E4PA 1XJ4A 1DRMA 3FG8A 2K7SA 2PYRA 4LRYC 3MJQA 4WN5A 1KOUA 5DKKA 1TS8A 5G4YA 3UB6A 3UB7A 4LRXC 2V1AA 4LLOB 4LPZA 3LIEA 2CMNA 3B33A 3UMDA 4HJ3A 3UMEA 3MQOA 3F1OA 3LICA 1OT9A 3E4OA 2PD7A 1S4RA 4NXGA 4EEPA 1OJ5A 4HOIA 1XJ2A 3LYXA 2VV7A 1V9ZA 3IBRA 5AVFA 3A0RA 3LI9A 5J3WA 5J4EA 5J7EA 2L1MA 3D72A 2D02A 1XFNA 3VOLA 2PD8A 2D01A 3KX0X 1F9IA 3ICYA 4DJ3A 4M4XA 4I39A 4MN5A 4NXFA 4I3AA 4RQ9A 1LL8A 2B02A 2QJ5A 5IU1A 1NWZA 5HDDA 2V1BA 2VV6A 4HQAA 1OT6A 1XJ6A 3EEHA 2OWJA 3H82B 4L9EA 4HJ4A 3GDIA 2QKPA 1T18A 1DP9A 4KUOA 2KDKA 3BY9A 1N9NA 2JHEA 5HZHA 1OTEA 1MZUA 1V9YA 3NJAA 4DJ2A 1P0ZA 2I9VA 1S67L 2L4RA 1JNUA 1S1YA 3F1PB 5HWWA 5HWVA 3MQQA 1XJ3A 4PKYG 4L9GA 4HI4A 2QJ7A 1LT0A 3FC7A 1P97A 5DJUA 4HHDA 1WA9A 1N9LA 2QHKA 4EETB 2OOLA 1OTIA 4L9FA 1T1AA 3OLOA 5HSQA 2YKFA 2J80A 3GECA 1S66L 2V0UA 4HP4A 2L0WA 1LSXA 2VV8A 4EEUA 3PHYA 2KX6A 3LIDA 4E04A 4JGRA 1UGUA 4GHIB 3VE4A 1OTAA 4WUJA 4HP9A 5AVEA 3K3CA 2PHYA 5KIZA 3LIBA 1LSWA 4F3LB 2P7JA 5HDCA 3RH8B 3RTYA 2INWA 2VEAA 4I3IA 4GW9A 5HDSA 1Y28A 3UE6A 4WL9A 4EXOA 5HD3A 1TS0A 2ZBBA 3H82A 3LI8A 4PKYA 4H6JB 2H28A 1EW0A 4HJ6A 4R6LA 3BY8A 3CAXA 5HD5A 1DP6A 4HNBA 4I5SA 5IS1A 3A0SA 3HJIA 1XFQA 3C8CA 2WKRA 4HH2A 4LRZE 4R38A 3BWLA 3SW1A 2W27A 3H7WB 2Z6CA
chains in the Genus database with same CATH superfamily
3FV7A 4QB8A 3HLBA 1PI5A 1WYCA 4FTXA 4OQGA 3MR0A 3RFBA 4JKTA 5GHXA 2A24B 4XT2B 4M3KA 4Q0JA 1FSWA 4EERA 3ZG9B 1YSPA 4NKPA 4X1MA 3IXBA 1SDNA 5HL6A 1IKIA 4ZBEA 4WF0A 3ITBA 3SS3A 3SS5A 5TJJA 1BUEA 4ZJ3A 3A3EA 5F5YA 2WKPA 3CUEC 1K6SA 1ES4A 5EVIC 1LI0A 4FCFA 4E3OA 4ESPA 2OAQ1 3QNBA 3K3DA 4X25A 4GD8A 2E8JA 1TDLA 3SH7A 1S1ZA 1ZG6A 1X0OA 1BTLA 1N9OA 2G2WA 2ZM0A 5DFYA 2R9WA 2W1RA 1ES2A 5F82A 2J3TD 2NUPC 4FOFA 4IEDA 3B42A 2VGLS 5EOEA 1CQAA 1OTDA 5E2GA 3PBSA 1K54C 4IUHA 5FQKA 4NXBA 3GRJA 1LLBA 2O9BA 2PDRA 1SKOA 1ODVA 4R70A 3HCYA 5EE8A 3VE3A 4Z9QA 1JWVA 2JN7A 1F2KA 2OV5A 3SH9A 2XH9A 5F1GA 2IWCA 4Y7PA 4Y0OA 2YKHA 4DDSA 3NOPC 1G6AA 2DNSA 3ZVTA 4KZAA 1KE0A 3AGDA 4EBLA 4WYYA 3ZYTA 2R78A 2XFTA 4R4SA 3LIAA 3C5AA 3NOTC 2WGVA 3ZFZA 2PR5A 2Y8HA 3OCNA 1RP5A 3JVVA 4JXGA 5G4ZA 3LY3A 3PBNA 4WEKA 4GCZA 3VP4A 5FATA 3S1YA 3C30A 4P0MA 2WYXA 3ZDJA 3BYDA 3LFVA 2K7SA 5A90A 5EUAA 1YQSA 5G4YA 5HAQA 4A5RA 3UB7A 3IF6C 4P6ZS 4ME4A 5TGFA 2V1AA 1PWCA 2HDSA 4S2IA 1KGFA 3IQAA 3FWLA 1K56A 2WAFA 1GHMA 3Q7VB 4II7A 2C5WB 3PTEA 3UMDA 3JYIA 5DTSA 3V5MA 3LICA 2PD7A 3T4TA 4NXGA 4EEPA 1Q2PA 4HOIA 4WZ5A 1XJ2A 1NYYA 2VV7A 5L10A 1V9ZA 2EFXA 3S22A 4O01A 1ESIA 2AVXA 5EOOA 4N9KA 2WZXA 5AVFA 3MFDA 3LI9A 1GHIA 5J4EA 2VJWA 5J7EA 2L1MA 3PAEA 4GOGA 2Y2PA 1YLJA 4Q0IA 4P87A 2PD8A 4UA6A 1XX2A 2W3HA 4PM9A 3IWIA 3TRCA 3NIAA 1RGYA 2ZQ9A 2JKRM 4DJ3A 4M4XA 2QYBA 1DJCA 4GDBA 1SHVA 1Y54A 2WUQA 4RQ9A 1K6RA 2BLSA 2B02A 5IU1A 1NWZA 4NEED 4X56A 4GB7A 2BG1A 4E3MA 5M18A 4L9EA 2Y2OA 2QKPA 5FQ9A 4YNRA 3GV9A 4MDZA 4KUOA 1ERMA 2PRFA 4S2KA 4R4RA 3DTIA 3UY6A 4ZJ2A 2JHEA 2FFFB 3RJUA 5TFQA 2B95A 3VOZA 5DF7A 3DTKA 3KYQA 3Q82A 4EQIA 3NJAA 3HVFA 4DJ2A 1P0ZA 4BLMA 1KGGA 2I9VA 3PAGA 4FUWA 1S67L 4GKUA 3IH8A 1FSYA 3BFEA 1YAXA 2W3DA 3DTMA 5HWWA 3BLMA 1MC0A 2RL3A 3MQQA 4DMZA 5HWVA 1XJ3A 3MS6A 2EXAA 3ZGAB 3DAVA 1JWPA 1PZOA 4OPRA 1LT0A 4XUZA 5A93A 5DJUA 4HHDA 4DXCA 2QHKA 2Q9MA 3BEBA 5CGSA 3A3JA 1VEUB 1T1AA 3MXRA 3UE0A 4S2LA 2YKFA 2J80A 4NG2A 4R23A 1L0FA 4U0XA 2V0UA 3BECA 3PHYA 4D60A 2KX6A 2K31A 2XGNA 2J8YA 5AQBA 3BW6A 4WUJA 5AVEA 3K3CA 1ALQA 4R3BA 1JVJA 3V67A 3EQVA 1J3WA 2PHYA 4Q8IA 4CLCB 4JXVA 3UPPA 2GX5A 3OPRA 5DVAA 1XGIA 2HDUA 1LSWA 2W1TA 1KE4A 2W1TB 5HDCA 3RTYA 1ONHA 3S7QA 1OPXA 1Y28A 1K55A 3UE6A 5FSRA 2G2UA 3MXSA 1K25A 4PHTA 2WGWA 2ZBBA 2EX2A 1AXBA 5KMWA 1HD8A 3MSHA 1EW0A 1SZVA 5FDHA 3GSGA 2M7UA 1MY8A 3N8LA 1ZG4A 4I5SA 5IS1A 2UWXA 1ERQA 1XFQA 3UDFA 1DY6A 2HP5A 2J9OA 4R38A 4CLCE 5LBRA 4DE1A 1MWUA 4QY5A 3HUOA 5CGXA 4MCWA 2XEPA 2H0YA 1IYOA 4IJGA 4KG5A 5GLDA 1GHPA 4ZDXA 3CMZA 3MFXA 4C6YA 1YM1A 4EWFA 3R7WB 3F1NB 1SDEA 3F1PA 4E6WA 2JKGA 3G35A 2Y2LA 2V2FF 1HLUP 5AJGA 4JXSA 1BLPA 2ZC5B 3QP1A 4WEJA 1YLZA 2ZQDA 1WE4A 4KZ6A 5F6AA 3UPOA 1G6OA 2Y2QA 3OPHA 1K0KA 2BASA 1OJGA 4BBUA 1L2SA 5EVEA 5F1FA 4HBTA 3N7WA 4K0WA 1OTBA 2IA2A 1PW1A 5EECA 1GSXA 3F1OB 4N92A 2M1CA 3HJKA 3IHBA 3ZNYA 1D7EA 4MEZA 5I5LA 5EVID 4MBKA 1LSVA 3CHWP 2Y4AA 1NRJA 5CHUA 5JYPA 1W7FA 5DFXA 4CQHA 4B9OA 2VGLM 4I3JA 2Y91A 4QY6A 3OPPA 4ARZA 5FEGA 1O07A 4RX3A 5DKLA 3SS4A 3IXHA 5A8BA 1VQQA 4B4ZA 2VLGA 1BULA 3T4JA 1TF1A 4D2OA 3T4LA 2Y2GA 4Y0UA 4WZ5C 4GDNA 3NDEA 4BD1A 2O9AA 4WLAA 3KSFA 5FAOA 5GLAA 3TE8A 3QP2A 3VV4A 5EPHA 3TG9A 2OWHA 4JGOA 5EFWA 2HP9A 4YWZA 4ZJ1A 1I2SA 1ZHHB 4CLCD 1W8YA 5TR7A 2M7VA 1GSWA 5FQIA 2HPBA 3P09A 5L09A 3G31A 3H9WA 1PW8A 1W63M 3NOUC 2WKEA 5U47A 3VSKA 2A24A 2X02A 4XT2A 3LCEA 4NXEA 3S7PA 2ZMFA 3A0VA 3W2ZA 1FR1A 2V8FA 3M2KA 1XJ4A 3LR3A 5FI2A 2I72A 2Y55A 4LRYC 3MJQA 3QHYA 2EX6A 4WN5A 1KOUA 3IX4A 5FQMA 1W5DA 1YLPA 1K4EA 3W8KA 4OKPA 3CJMA 1HVBA 3FKVA 1YPRA 2XFSA 4LLOB 3KYZA 3W4PA 4EBNA 2X01A 4DKIA 3QP8A 3HLEA 3Q07A 4KQQA 1MPLA 3LY4A 2ZMAA 3MQOA 2ZQCA 5CERA 1ESUA 5M19A 1S4RA 2H5SA 4OVDA 1OJ5A 3C38A 4C3QA 1PWDA 1H0MA 2Y79A 3IBRA 5FDSA 4FD8A 4RYEA 2V1ZA 1I5QA 1U60A 4NK3A 1ES3A 4G3WA 1FQGA 1XFNA 1TDGA 3CG5A 1EI5A 3E2KA 3VP3A 2JKFA 3KX0X 3N8SA 2H0TA 1CJFA 1FILA 2W3EA 3HBRA 1G5UA 4N1XA 3ICYA 4NETA 2VZWA 3LEQA 4I3AA 5M1AA 3LEZA 1L3LA 5CTNA 5HDDA 3SOIA 3OC2A 2V1BA 2VV6A 4HQAA 3FYZA 4K91A 1JTGA 3LR5A 2OWJA 3H82B 4HJ4A 3GDIA 3WRZA 4QWOA 4B88A 3VFHA 1T18A 2XA7M 3BY9A 4QD4A 1IELA 1NZUA 4U3TA 1K55C 1MZUA 5FL3A 3IWOA 3BFDA 3A3FA 4GNUA 4LV2A 2ZL1A 2ZL1B 2DRWA 3G30A 2L4RA 4OH0A 3IX3A 3VP2A 1JWZA 3IT9A 3BQ8A 4AFIA 3T4OA 2BTFP 4L9GA 5KZHA 2ZC7A 1FCNA 2JKTI 1PWGA 3ZCZA 2A49A 4IBXA 2GZAA 5CRFA 1N9LA 4EETB 3NULA 3L7HA 4KZ3A 1OTIA 3MKEA 4L9FA 3HREA 3Q7VA 5DF9A 1O7EA 3IF5A 3U4LP 4ETZA 4HP4A 4OLGA 1NLZA 2X71A 4MBHA 2VV8A 2HZ5A 1XPBA 5E2FA 2XQZA 4KZ4A 4JF6A 3DW0A 3LIDA 3ZNTA 4B93A 5HW3A 1UGUA 4GHIB 1OTAA 4HP9A 1RCJA 3C4PA 3MKFA 2XD5A 4P85A 2JC7A 4S2OA 3NY4A 4F3LB 2PBYA 5FQQA 1E25A 4I3IA 3N4IA 4LV1A 4WL9A 3GQZA 1NXYA 1P9RA 1EROA 4KZ5A 4U0TA 4UA7A 5HD3A 2ZM2A 3E98A 2XSSA 1TS0A 4BMWA 3MZDA 4UQIS 1CI8A 3FZCA 4H6JB 2Z2MB 3O86A 1IFQA 4S2NA 4R6LA 2JE5A 2LB5A 2QZ6A 3BY8A 3NC8A 1KE3A 5L8MA 1DP6A 4HNBA 4DE3A 1HTZA 3Q81A 4HH2A 2XD1A 3SW1A 4KENB 2PU2A 3H7WB 2Z6CA 2WKHA 3ULFA 1VB6A 2G7UA 1NZOA 3HUNA 4E6XA 4JGPA 4PAUA 5K5BA 3P98A 4OP8A 2ZD8A 1RGZA 1CI9A 5HPIA 1KVLA 4KG2A 4HY8A 3T50A 2ZOHA 3AGFA 4KQDA 5EVIB 3HLWA 4MBFA 2Z6DA 3VP0A 3ISGA 4IVIA 1BYWA 3CITA 3HL9A 1TS6A 3HLCA 5F68A 1UWPX 1VEUA 4ZTKA 2A3UA 1NYMA 4BBTA 2XR0A 1UWNX 2MJ6A 4LGWA 4WMCD 2FH5A 5F69A 4E3JA 3CWFA 4KZ7A 4Z1WA 1L0GA 4Y17A 1XP4A 3TJZC 2XLNA 5HARA 3WS1A 5KSCA 2PBDP 4G3VA 3FKWA 1H5XA 4R0QA 4MLLA 1IKGA 3QP6A 2HP6A 4CLCA 2ZOIA 1IYSA 5HWTA 4CJNA 2W0NA 3G6OA 4EV4A 4DDYA 3EWKA 5HAPA 3M6BA 2V20A 3UPNA 1G28A 4HEFA 1YSQA 3T4KA 1W8QA 3MXQA 3ZG0A 1J9MA 1TS7A 3VSLA 1PYYA 1L0DA 2KOIA 3IHAA 4HESA 3T12B 1DP8A 5HX9A 5E43A 4WBGA 3MZEA 1ZC2A 2VGKA 2Y2HA 3L9KA 5TBMA 4R3AA 2RCXA 5TBMB 1S6RA 2WGIA 3KO6A 4Y5FA 2O0YA 4X53A 1GSVA 5BOHA 3LR4A 3NI9A 1XGJA 2IWDA 4OOMA 2O99A 3T1QB 3T1SA 4EQ1A 3UN7A 4E3KA 4BBVA 2HGVA 3PYPA 1L0EA 1D06A 3W4QA 4P6BA 2V0WA 3GMWA 3R7WA 3UB8A 3UDIA 3F1NA 1CF0A 3IH9A 3LR0A 5CTMA 3BFGA 1TEMA 4UEYA 3O87A 4DN0A 3UB9A 4PM6A 3ZQ5A 4IUKA 1VETB 3P7NA 4L0LA 3E4PA 1ES5A 1W63Q 1DRMA 3FG8A 4E3NA 3ZG8B 2VA0A 2PYRA 4R3JA 1CEGA 4OQ0A 1C3BA 2WZZA 4B4XA 1YMSA 3BJNA 4ZRRA 5J8XA 4EBPA 1DJAA 5E2HA 4PMAA 4WELA 5EM1A 3PBTA 3WRTA 3LIEA 3NBLA 3KYEA 3UE3A 3T4QA 2CMNA 3PBRA 4HJ3A 3UMEA 3F1OA 2P04A 1ZTUA 3OPLA 1OT9A 2EX8A 5A92A 1P9WA 1BLCA 3HLDA 4UAAA 3LYXA 2JKRI 2OLVA 3GVBA 4HBUA 4Y3IA 2JKTM 1WYBA 1Z6FA 3FPVA 3A0RA 5J3WA 3V3RA 4RVAA 3PR6A 1IYPA 1QMFA 2EX9A 2ZQAA 3VOLA 2ZLYA 4QJGA 3T1RA 3ZG5A 1E4DA 3IBJA 3HLFA 2D01A 4JBFA 5FA7A 4BJPA 1S0WA 4EUVA 2HJ9C 4NXFA 4I39A 5CHJA 1M40A 2PAVP 3S7OA 5HFOA 2OSUA 1LL8A 3MF0A 2QJ5A 3E0YA 4QU3A 1YMXA 4DRTA 1XJ6A 3CPTB 1NLYA 3RXWA 5DF8A 2ZC3B 4CPKA 4OPQA 3U2AA 1N9NA 3UO9A 4LFUA 3QP4A 5GHZA 1OTEA 1M6KA 4OQIA 2J7VA 2J3WA 3SH8A 2C6WB 5MC7A 2JBFA 2W3GA 4EUZA 4JXWA 5CHMA 2Q9NA 5GL9A 4OOLA 1SKFA 1JNUA 4S2NC 1XXMA 4OLDA 4RX2A 1ACFA 4XXRA 4IHQA 4DF6A 5FEFA 4YOFA 4HI4A 1YKDA 3O3VA 4OPZA 4OONA 1PIOA 4X55A 3AGEA 4K0XA 1K57A 2VKSA 3FC7A 5IHVA 1P97A 4BD0A 2JCHA 5EM0A 4P6ZM 2OOLA 2A2LA 5FI7A 4JF5A 1H3QA 3OLOA 1W79A 3NDGA 5HSQA 4MMNA 3R4KA 2XF3A 3KSHA 1ZKJA 3GECA 2FZ0A 3IWQA 2L0WA 1LSXA 3NCKA 2VX8A 4WM9A 5HPFA 5KSHA 3UDXA 3OCLA 3M2JA 4DXBA 4E04A 1K38A 2HJEA 4JGRA 3VE4A 4OOYA 5FASA 1ONGA 5FAQA 1JTDA 3IXGA 5C5KA 4GZBA 1GA0A 5L07A 2OAP1 1LL9A 3VOYA 3E2LA 1AWIA 5KIZA 3LIBA 3LO7A 4GN2A 5DTTA 5F83A 3PBQA 2VEAA 1SKOB 3DWZA 4GW9A 5HDSA 1MWSA 1KGEA 3UNWA 4EXOA 1YLWA 4BL3A 4WZ4A 4KQRA 1PZPA 4IVKA 2Y2IA 2Y2MA 3BM6A 1NJ4A 3H82A 3HLGA 4G3KA 3UB5P 3WS0A 3EOIA 4CLCC 3W4OA 2K2NA 2H28A 2ZQ8A 1MWRA 1NRFA 4F94A 4HJ6A 4UQIM 3WS4A 3CAXA 2XROA 1KDWA 3C8CA 4X6TA 3VFFA 3C7UA 3MZFA 4LRZE 4N1HA 1G68A 4LENA 2EFUA 2B18A 2W27A 5GLBA 1H8MA 2EWWA 4RA7A 3GR2A 4MN6A 4WMCA 4BENA 4BQMA 1PNEA 1GCEA 1S4SA 2ZC4B 1E3UD 2EA9A 1FOFA 3LIFA 1QMEA 4FH4A 2Z2LB 3C7VA 4LV3A 3I7JA 3OBFA 2PT7A 1T1CA 1KVMA 1XA7A 3T1XA 1IEMA 4HIAA 2XRNA 3MMHA 3TOIA 4EW7A 4EESA 4S2PA 2J3TC 1XKZA 2WKQA 3IX8A 3SZTA 4H8RA 4KZBA 1TVFA 4FH2A 1A0KA 2WKIA 3G4PA 2J9PA 4JF4A 4X69A 4I38A 2WK0A 4GHIA 5CECA 1Y4OA 4Y13A 1H8ZA 2KLIA 4DE0A 1T1BA 2Q0OA 3EGXC 4PM5A 3WWXA 3G32A 3C2WA 1T19A 3LUQA 1VM1A 4F3LA 3WS5A 5DJTA 2WAEA 3C4OA 4JGQA 2PR6A 2HV1A 2QWSA 5AQAA 2GDNA 1TD5A 3B47A 2PU4A 3IS2A 1SCWA 3IS2B 5CXWA 3N8RA 4H6JA 3CI6A 4MN7A 3E4QA 1HZOA 1BLHA 4KQOA 2ZJ9A 4LCMA 2ZMVA 3CLOA 1PI4A 4IBRA 1F98A 2V9AA 3S7NA 2XA7S 3H7WA 3ITAA 4KUKA 1YT4A 3TW8A 3EEAA 4K08A 4GS9A 4GS9B 2O9CA 1STZA 5IT5A 2PYPA 5GHYA 2EWVA 3NHQA 1BZAA 3BLSA 2GJ3A 4PM8A 5EV0A 3CUEA 2DCFA 5EVIA 5L2FA 4HH3A 2HDRA 5GLCA 1EWZA 2B5RA 4O0PA 3HUMA 3EGDC 2ZC6B 4X1LA 2ACGA 4UA9A 1KDSA 5DKKA 1TS8A 3G2YA 2Y59A 4BWIA 1I2WA 1VHMA 2P9VA 2P9VB 3UB6A 4LRXC 4QPRA 3T4SA 1K54A 4O8GA 4LPZA 2GNXA 4Y15A 2DMWA 3D9YA 4GJ4A 3B33A 4PPRA 4ZAMA 2IWBA 4UHUA 4XUXA 3E4OA 3V3SA 2NUTC 2WADA 1OMEA 3UE1A 5JYOA 2QPNA 5E2EA 4EU0A 3MBZA 1MXOA 5AQ9A 1K57C 4MNRA 5CEDA 2FFYA 4E3LA 1PFLA 3D72A 2D02A 2Y2NA 5DTKA 5CX7A 3BFFA 3OOVA 3RXXA 1GA9A 2CC1A 3A3IA 1F9IA 1FCOA 3LGOA 5D3OA 2OLUA 4JLFA 3JVUA 1F5MA 2HF6A 3Q1FA 4MN5A 4ID4A 1K56D 3GTCA 1FCMA 4S2JA 1Z09A 2HDQA 3B3XA 4C75A 4YINA 3ZG7B 3D4FA 3WS2A 3ZHHA 1OT6A 2WGWB 3EEHA 4KZ8A 2QMIA 1DJBA 2EXBA 5A91A 1D1JA 2UV0E 1DP9A 4O7DA 3DTEA 2KDKA 1MKIA 5I94A 5HAIA 2P08A 5AQ7A 2H10A 5HZHA 3V50A 2VK3A 3D3OA 5FAPA 1V9YA 3IF6A 1FIKA 3IF6B 1CK3A 1LI9A 2V8CA 1VETA 4FSFA 1FR6A 3KSIA 3M6HA 4S2MA 1NY0A 1MWTA 4Y0TA 4E3IA 1N4OA 3A3DA 1S1YA 3F1PB 2Y2JA 3FPWA 4PKYG 3PBOA 2QJ7A 2VGJA 3G2ZA 3S4XA 4Y2FA 5EVLA 1WA9A 3DBAA 2ZQ7A 1PRQA 3BFCA 3TSGA 1H8YA 4PM7A 4Q0HA 1Q2QA 1BT5A 3ZVWA 1S66L 5HL1A 4JPMA 3N6IA 3VP1A 4R1GA 2R9XA 4GD6A 1N9BA 2E8IA 1IYQA 3Q7ZA 4EEUA 1BLSA 5FI6A 5CEBA 3NECA 3VMAA 1MBLA 3O5YA 4KG6A 3CZDA 1LL5A 5G18A 3MQ0A 4QHCA 3OZHA 2Y2KA 3QNCA 2P74A 4ARZB 2P7JA 3RH8B 5CGWA 3QP5A 2INWA 3PXPA 4ETXA 2XK1A 3IXDA 4OQHA 4OPYA 4BL2A 2LB9A 3KSGA 1E3UA 1IOUA 3BQAA 3JPUA 1LHYA 3CPTA 1MKMA 2ZM8A 3LI8A 4PKYA 2W3FA 5FQJA 3G34A 4N9LA 3P01A 1YLTA 3BRMA 3O88A 1CEFA 4GLQA 5HD5A 1YLYA 3A0SA 3V39A 3HJIA 4YFMA 3DWKA 2WKRA 4KZ9A 2XDMA 1K4FA 4OP5A 3K2NA 3EQUA 4X68A 3BWLA 1BSGA 4LV0A 4DE2A 1XA1A 4LCLA
chains in the Genus database with same CATH topology
4IJGA 4MN6A 3ULFA 1VB6A 2G7UA 4JGPA 4PAUA 3MFXA 5K5BA 3R7WB 3F1NB 3MR0A 1S4SA 3RFBA 3F1PA 5HPIA 2A24B 2EA9A 4XT2B 4HY8A 3T50A 2ZOHA 5AJGA 3LIFA 4KQDA 4Q0JA 4WEJA 4EERA 3OBFA 2Z6DA 1YSPA 5F6AA 4NKPA 1BYWA 3CITA 1G6OA 1TS6A 5F68A 2PT7A 5HL6A 1UWPX 2BASA 1T1CA 4WF0A 1OJGA 4BBUA 4HIAA 2XRNA 3MMHA 5TJJA 4BBTA 4EW7A 1OTBA 5F5YA 1UWNX 2IA2A 2MJ6A 4EESA 2J3TC 2WKQA 2WKPA 3CUEC 1GSXA 2OAQ1 3K3DA 2FH5A 5F69A 3CWFA 4Z1WA 1S1ZA 1X0OA 4I38A 3TJZC 3F1OB 2M1CA 3HJKA 4GHIA 1D7EA 1N9OA 5DFYA 4G3VA 2W1RA 2J3TD 2NUPC 4FOFA 3B42A 5I5LA 1LSVA 2KLIA 2VGLS 1T1BA 4CLCA 1NRJA 2ZOIA 1OTDA 5HWTA 2W0NA 3PBSA 5DFXA 4CQHA 3EGXC 4IUHA 3C2WA 4B9OA 1T19A 2VGLM 4I3JA 4NXBA 3LUQA 3G6OA 4ARZA 4F3LA 2O9BA 2PDRA 3EWKA 1G28A 1ODVA 4R70A 3HCYA 1YSQA 5DJTA 5DKLA 3T4KA 5A8BA 3MXQA 4JGQA 2PR6A 2HV1A 3VE3A 2VLGA 2JN7A 2QWSA 1TS7A 3T4JA 1TF1A 3T4LA 1TD5A 3B47A 3IS2A 3IS2B 2KOIA 1DP8A 4H6JA 2O9AA 4WLAA 3CI6A 3KSFA 4MN7A 5TBMA 4R3AA 5TBMB 3TE8A 3E4QA 3VV4A 2YKHA 3KO6A 4Y5FA 2O0YA 3NOPC 2OWHA 1GSVA 4JGOA 4KQOA 5EFWA 3LR4A 2ZMVA 4OOMA 3CLOA 2O99A 4YWZA 1F98A 2V9AA 3ZYTA 3S7NA 2R78A 4EQ1A 1ZHHB 4CLCD 2XA7S 3H7WA 2M7VA 1GSWA 3LIAA 4KUKA 3TW8A 3NOTC 3EEAA 4BBVA 2PR5A 2HGVA 3PYPA 2Y8HA 3OCNA 4K08A 1D06A 4GS9A 4GS9B 2O9CA 1STZA 5IT5A 3H9WA 2PYPA 2V0WA 3R7WA 3UB8A 3F1NA 2EWVA 3JVVA 3LR0A 4UEYA 1W63M 3NOUC 3NHQA 5G4ZA 4DN0A 3PBNA 2A24A 3UB9A 2GJ3A 4XT2A 4WEKA 3ZQ5A 4IUKA 3CUEA 4GCZA 4NXEA 3P7NA 3S7PA 2ZMFA 3A0VA 4HH3A 3C30A 3W2ZA 3E4PA 4L0LA 1W63Q 4O0PA 1XJ4A 3LR3A 1DRMA 3LFVA 3EGDC 3FG8A 2K7SA 2VA0A 2PYRA 4LRYC 3MJQA 4WN5A 1KOUA 5DKKA 1TS8A 4BWIA 5G4YA 1VHMA 3UB6A 3UB7A 3BJNA 4LRXC 4ZRRA 4P6ZS 4ME4A 4QPRA 3T4SA 2V1AA 4O8GA 4LLOB 4LPZA 3KYZA 2GNXA 4WELA 3PBTA 2DMWA 3LIEA 3UE3A 4GJ4A 3T4QA 2CMNA 4II7A 3B33A 3PBRA 3UMDA 4HJ3A 3UMEA 3MQOA 3F1OA 2P04A 1ZTUA 3LICA 1OT9A 3E4OA 2PD7A 3T4TA 1S4RA 4NXGA 1P9WA 4EEPA 1OJ5A 2NUTC 3C38A 4HOIA 1XJ2A 3LYXA 2VV7A 2JKRI 1V9ZA 4EU0A 4O01A 4Y3IA 2JKTM 2Y79A 3IBRA 5AVFA 3FPVA 3A0RA 3LI9A 5J3WA 5J4EA 2VJWA 5J7EA 2L1MA 3D72A 2D02A 3PR6A 4G3WA 5CX7A 1XFNA 3VOLA 4Q0IA 3OOVA 2PD8A 3IBJA 2D01A 3KX0X 1F9IA 2W3HA 3TRCA 2W3EA 4BJPA 2JKRM 3JVUA 1F5MA 2HF6A 4EUVA 3ICYA 4DJ3A 2HJ9C 4M4XA 4I39A 4MN5A 4NXFA 2QYBA 2VZWA 4I3AA 4RQ9A 3S7OA 1LL8A 2B02A 3MF0A 2QJ5A 5IU1A 1NWZA 5HDDA 4NEED 3E0YA 3OC2A 2V1BA 2VV6A 4HQAA 1OT6A 1XJ6A 3EEHA 1NLYA 3LR5A 2OWJA 3H82B 4L9EA 4HJ4A 3GDIA 2QKPA 4YNRA 4MDZA 1T18A 1DP9A 4KUOA 2KDKA 2XA7M 3BY9A 3U2AA 1N9NA 2JHEA 2P08A 5HZHA 1OTEA 3D3OA 1MZUA 1V9YA 5FL3A 3KYQA 2J3WA 3NJAA 5MC7A 4DJ2A 4FSFA 1P0ZA 2W3GA 3KSIA 2I9VA 1S67L 2L4RA 4OOLA 1JNUA 3BQ8A 1S1YA 1YAXA 2W3DA 3F1PB 4AFIA 4IHQA 5HWWA 3T4OA 3FPWA 1MC0A 4DMZA 3MQQA 5HWVA 1XJ3A 4PKYG 4L9GA 4YOFA 4HI4A 1YKDA 3PBOA 2QJ7A 1LT0A 2JKTI 2VKSA 3FC7A 1P97A 2GZAA 4Y2FA 5DJUA 4HHDA 1WA9A 1N9LA 2QHKA 4P6ZM 4EETB 2OOLA 3DBAA 2A2LA 1OTIA 4L9FA 1H3QA 1T1AA 3OLOA 5HSQA 4MMNA 2YKFA 2J80A 3R4KA 5DF9A 4Q0HA 3KSHA 3GECA 1S66L 4ETZA 2V0UA 4HP4A 2FZ0A 2L0WA 1NLZA 1LSXA 2VV8A 2VX8A 5HPFA 5KSHA 4EEUA 3PHYA 2KX6A 2K31A 3OCLA 3LIDA 4B93A 4E04A 2HJEA 3BW6A 4JGRA 1UGUA 4GHIB 3VE4A 1OTAA 3O5YA 4WUJA 4HP9A 5AVEA 3K3CA 3V67A 5C5KA 3EQVA 2PHYA 3MQ0A 2OAP1 4CLCB 2GX5A 5KIZA 3LIBA 1LSWA 2W1TA 2W1TB 4ARZB 4F3LB 2P7JA 5HDCA 3RH8B 3RTYA 3PBQA 4ETXA 2INWA 2VEAA 3PXPA 4I3IA 3S7QA 4GW9A 1OPXA 5HDSA 1Y28A 3UE6A 4WL9A 2LB9A 3KSGA 4EXOA 1P9RA 1IOUA 5HD3A 3BQAA 3E98A 2XSSA 1TS0A 4BMWA 4PHTA 1MKMA 2ZBBA 4UQIS 3H82A 4G3KA 3LI8A 4PKYA 2W3FA 3EOIA 4CLCC 4H6JB 2K2NA 2H28A 1EW0A 3P01A 1IFQA 4HJ6A 4UQIM 4GLQA 4R6LA 2M7UA 2LB5A 3BY8A 5L8MA 3CAXA 5HD5A 1DP6A 4HNBA 4I5SA 5IS1A 2XROA 3A0SA 3HJIA 1XFQA 3C8CA 2WKRA 4HH2A 4LRZE 4R38A 4CLCE 5LBRA 3K2NA 3EQUA 3BWLA 2B18A 3SW1A 2W27A 1H8MA 2EWWA 3H7WB 4MCWA 2Z6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN6 A;  3ULF A;  1VB6 A;  4JGP A;  3MFX A;  3F1N B;  3MR0 A;  1S4S A;  3F1P A;  2A24 B;  2EA9 A;  4XT2 B;  4HY8 A;  3T50 A;  2ZOH A;  3LIF A;  4KQD A;  4EER A;  2Z6D A;  5F6A A;  1BYW A;  1TS6 A;  5F68 A;  1UWP X;  2BAS A;  1T1C A;  4WF0 A;  1OJG A;  4BBU A;  4HIA A;  4BBT A;  4EW7 A;  1OTB A;  5F5Y A;  1UWN X;  4EES A;  2WKQ A;  2WKP A;  1GSX A;  3K3D A;  5F69 A;  3CWF A;  1S1Z A;  1X0O A;  4I38 A;  3F1O B;  2M1C A;  3HJK A;  4GHI A;  1D7E A;  1N9O A;  5I5L A;  1LSV A;  1T1B A;  2ZOI A;  1OTD A;  5HWT A;  2W0N A;  3C2W A;  4B9O A;  1T19 A;  4I3J A;  4NXB A;  3LUQ A;  3G6O A;  4F3L A;  2PDR A;  3EWK A;  1G28 A;  1ODV A;  4R70 A;  5DJT A;  5DKL A;  5A8B A;  3MXQ A;  4JGQ A;  2PR6 A;  2HV1 A;  3VE3 A;  2VLG A;  2JN7 A;  2QWS A;  1TS7 A;  3IS2 A;  3IS2 B;  1DP8 A;  4H6J A;  4WLA A;  5TBM A;  4R3A A;  5TBM B;  3E4Q A;  2YKH A;  3NOP C;  2OWH A;  1GSV A;  4JGO A;  5EFW A;  3CLO A;  4YWZ A;  1F98 A;  2V9A A;  2R78 A;  4EQ1 A;  3H7W A;  1GSW A;  3LIA A;  4KUK A;  3NOT C;  4BBV A;  2PR5 A;  3PYP A;  4K08 A;  1D06 A;  4GS9 A;  4GS9 B;  3H9W A;  2PYP A;  2V0W A;  3UB8 A;  3F1N A;  3NOU C;  3NHQ A;  5G4Z A;  2A24 A;  3UB9 A;  2GJ3 A;  4XT2 A;  3ZQ5 A;  4NXE A;  4GCZ A;  3P7N A;  3A0V A;  4HH3 A;  3E4P A;  1XJ4 A;  1DRM A;  3FG8 A;  2K7S A;  2PYR A;  4LRY C;  3MJQ A;  4WN5 A;  1KOU A;  5DKK A;  1TS8 A;  5G4Y A;  3UB6 A;  3UB7 A;  4LRX C;  2V1A A;  4LLO B;  4LPZ A;  3LIE A;  2CMN A;  3B33 A;  3UMD A;  4HJ3 A;  3UME A;  3MQO A;  3F1O A;  3LIC A;  1OT9 A;  3E4O A;  2PD7 A;  1S4R A;  4NXG A;  4EEP A;  1OJ5 A;  4HOI A;  1XJ2 A;  3LYX A;  2VV7 A;  1V9Z A;  3IBR A;  5AVF A;  3A0R A;  3LI9 A;  5J3W A;  5J4E A;  5J7E A;  2L1M A;  3D72 A;  2D02 A;  1XFN A;  3VOL A;  2PD8 A;  2D01 A;  3KX0 X;  1F9I A;  3ICY A;  4DJ3 A;  4M4X A;  4I39 A;  4MN5 A;  4NXF A;  4I3A A;  4RQ9 A;  1LL8 A;  2B02 A;  2QJ5 A;  5IU1 A;  1NWZ A;  5HDD A;  2V1B A;  2VV6 A;  4HQA A;  1OT6 A;  1XJ6 A;  3EEH A;  2OWJ A;  3H82 B;  4L9E A;  4HJ4 A;  3GDI A;  2QKP A;  1T18 A;  1DP9 A;  4KUO A;  2KDK A;  3BY9 A;  1N9N A;  2JHE A;  5HZH A;  1OTE A;  1MZU A;  1V9Y A;  3NJA A;  4DJ2 A;  1P0Z A;  2I9V A;  1S67 L;  2L4R A;  1JNU A;  1S1Y A;  3F1P B;  5HWW A;  5HWV A;  3MQQ A;  1XJ3 A;  4PKY G;  4L9G A;  4HI4 A;  2QJ7 A;  1LT0 A;  3FC7 A;  1P97 A;  5DJU A;  4HHD A;  1WA9 A;  1N9L A;  2QHK A;  4EET B;  2OOL A;  1OTI A;  4L9F A;  1T1A A;  3OLO A;  5HSQ A;  2YKF A;  2J80 A;  3GEC A;  1S66 L;  2V0U A;  4HP4 A;  2L0W A;  1LSX A;  2VV8 A;  4EEU A;  3PHY A;  2KX6 A;  3LID A;  4E04 A;  4JGR A;  1UGU A;  4GHI B;  3VE4 A;  1OTA A;  4WUJ A;  4HP9 A;  5AVE A;  3K3C A;  2PHY A;  5KIZ A;  3LIB A;  1LSW A;  4F3L B;  2P7J A;  5HDC A;  3RH8 B;  3RTY A;  2INW A;  2VEA A;  4I3I A;  4GW9 A;  5HDS A;  1Y28 A;  3UE6 A;  4WL9 A;  4EXO A;  5HD3 A;  1TS0 A;  2ZBB A;  3H82 A;  3LI8 A;  4PKY A;  4H6J B;  2H28 A;  1EW0 A;  4HJ6 A;  4R6L A;  3BY8 A;  3CAX A;  5HD5 A;  1DP6 A;  4HNB A;  4I5S A;  5IS1 A;  3A0S A;  3HJI A;  1XFQ A;  3C8C A;  2WKR A;  4HH2 A;  4LRZ E;  4R38 A;  3BWL A;  3SW1 A;  2W27 A;  3H7W B;  2Z6C A; 
#chains in the Genus database with same CATH topology
 3FV7 A;  4QB8 A;  3HLB A;  1PI5 A;  1WYC A;  4FTX A;  4OQG A;  3MR0 A;  3RFB A;  4JKT A;  5GHX A;  2A24 B;  4XT2 B;  4M3K A;  4Q0J A;  1FSW A;  4EER A;  3ZG9 B;  1YSP A;  4NKP A;  4X1M A;  3IXB A;  1SDN A;  5HL6 A;  1IKI A;  4ZBE A;  4WF0 A;  3ITB A;  3SS3 A;  3SS5 A;  5TJJ A;  1BUE A;  4ZJ3 A;  3A3E A;  5F5Y A;  2WKP A;  3CUE C;  1K6S A;  1ES4 A;  5EVI C;  1LI0 A;  4FCF A;  4E3O A;  4ESP A;  2OAQ 1;  3QNB A;  3K3D A;  4X25 A;  4GD8 A;  2E8J A;  1TDL A;  3SH7 A;  1S1Z A;  1ZG6 A;  1X0O A;  1BTL A;  1N9O A;  2G2W A;  2ZM0 A;  5DFY A;  2R9W A;  2W1R A;  1ES2 A;  5F82 A;  2J3T D;  2NUP C;  4FOF A;  4IED A;  3B42 A;  2VGL S;  5EOE A;  1CQA A;  1OTD A;  5E2G A;  3PBS A;  1K54 C;  4IUH A;  5FQK A;  4NXB A;  3GRJ A;  1LLB A;  2O9B A;  2PDR A;  1SKO A;  1ODV A;  4R70 A;  3HCY A;  5EE8 A;  3VE3 A;  4Z9Q A;  1JWV A;  2JN7 A;  1F2K A;  2OV5 A;  3SH9 A;  2XH9 A;  5F1G A;  2IWC A;  4Y7P A;  4Y0O A;  2YKH A;  4DDS A;  3NOP C;  1G6A A;  2DNS A;  3ZVT A;  4KZA A;  1KE0 A;  3AGD A;  4EBL A;  4WYY A;  3ZYT A;  2R78 A;  2XFT A;  4R4S A;  3LIA A;  3C5A A;  3NOT C;  2WGV A;  3ZFZ A;  2PR5 A;  2Y8H A;  3OCN A;  1RP5 A;  3JVV A;  4JXG A;  5G4Z A;  3LY3 A;  3PBN A;  4WEK A;  4GCZ A;  3VP4 A;  5FAT A;  3S1Y A;  3C30 A;  4P0M A;  2WYX A;  3ZDJ A;  3BYD A;  3LFV A;  2K7S A;  5A90 A;  5EUA A;  1YQS A;  5G4Y A;  5HAQ A;  4A5R A;  3UB7 A;  3IF6 C;  4P6Z S;  4ME4 A;  5TGF A;  2V1A A;  1PWC A;  2HDS A;  4S2I A;  1KGF A;  3IQA A;  3FWL A;  1K56 A;  2WAF A;  1GHM A;  3Q7V B;  4II7 A;  2C5W B;  3PTE A;  3UMD A;  3JYI A;  5DTS A;  3V5M A;  3LIC A;  2PD7 A;  3T4T A;  4NXG A;  4EEP A;  1Q2P A;  4HOI A;  4WZ5 A;  1XJ2 A;  1NYY A;  2VV7 A;  5L10 A;  1V9Z A;  2EFX A;  3S22 A;  4O01 A;  1ESI A;  2AVX A;  5EOO A;  4N9K A;  2WZX A;  5AVF A;  3MFD A;  3LI9 A;  1GHI A;  5J4E A;  2VJW A;  5J7E A;  2L1M A;  3PAE A;  4GOG A;  2Y2P A;  1YLJ A;  4Q0I A;  4P87 A;  2PD8 A;  4UA6 A;  1XX2 A;  2W3H A;  4PM9 A;  3IWI A;  3TRC A;  3NIA A;  1RGY A;  2ZQ9 A;  2JKR M;  4DJ3 A;  4M4X A;  2QYB A;  1DJC A;  4GDB A;  1SHV A;  1Y54 A;  2WUQ A;  4RQ9 A;  1K6R A;  2BLS A;  2B02 A;  5IU1 A;  1NWZ A;  4NEE D;  4X56 A;  4GB7 A;  2BG1 A;  4E3M A;  5M18 A;  4L9E A;  2Y2O A;  2QKP A;  5FQ9 A;  4YNR A;  3GV9 A;  4MDZ A;  4KUO A;  1ERM A;  2PRF A;  4S2K A;  4R4R A;  3DTI A;  3UY6 A;  4ZJ2 A;  2JHE A;  2FFF B;  3RJU A;  5TFQ A;  2B95 A;  3VOZ A;  5DF7 A;  3DTK A;  3KYQ A;  3Q82 A;  4EQI A;  3NJA A;  3HVF A;  4DJ2 A;  1P0Z A;  4BLM A;  1KGG A;  2I9V A;  3PAG A;  4FUW A;  1S67 L;  4GKU A;  3IH8 A;  1FSY A;  3BFE A;  1YAX A;  2W3D A;  3DTM A;  5HWW A;  3BLM A;  1MC0 A;  2RL3 A;  3MQQ A;  4DMZ A;  5HWV A;  1XJ3 A;  3MS6 A;  2EXA A;  3ZGA B;  3DAV A;  1JWP A;  1PZO A;  4OPR A;  1LT0 A;  4XUZ A;  5A93 A;  5DJU A;  4HHD A;  4DXC A;  2QHK A;  2Q9M A;  3BEB A;  5CGS A;  3A3J A;  1VEU B;  1T1A A;  3MXR A;  3UE0 A;  4S2L A;  2YKF A;  2J80 A;  4NG2 A;  4R23 A;  1L0F A;  4U0X A;  2V0U A;  3BEC A;  3PHY A;  4D60 A;  2KX6 A;  2K31 A;  2XGN A;  2J8Y A;  5AQB A;  3BW6 A;  4WUJ A;  5AVE A;  3K3C A;  1ALQ A;  4R3B A;  1JVJ A;  3V67 A;  3EQV A;  1J3W A;  2PHY A;  4Q8I A;  4CLC B;  4JXV A;  3UPP A;  2GX5 A;  3OPR A;  5DVA A;  1XGI A;  2HDU A;  1LSW A;  2W1T A;  1KE4 A;  2W1T B;  5HDC A;  3RTY A;  1ONH A;  3S7Q A;  1OPX A;  1Y28 A;  1K55 A;  3UE6 A;  5FSR A;  2G2U A;  3MXS A;  1K25 A;  4PHT A;  2WGW A;  2ZBB A;  2EX2 A;  1AXB A;  5KMW A;  1HD8 A;  3MSH A;  1EW0 A;  1SZV A;  5FDH A;  3GSG A;  2M7U A;  1MY8 A;  3N8L A;  1ZG4 A;  4I5S A;  5IS1 A;  2UWX A;  1ERQ A;  1XFQ A;  3UDF A;  1DY6 A;  2HP5 A;  2J9O A;  4R38 A;  4CLC E;  5LBR A;  4DE1 A;  1MWU A;  4QY5 A;  3HUO A;  5CGX A;  4MCW A;  2XEP A;  2H0Y A;  1IYO A;  4IJG A;  4KG5 A;  5GLD A;  1GHP A;  4ZDX A;  3CMZ A;  3MFX A;  4C6Y A;  1YM1 A;  4EWF A;  3R7W B;  3F1N B;  1SDE A;  3F1P A;  4E6W A;  2JKG A;  3G35 A;  2Y2L A;  2V2F F;  1HLU P;  5AJG A;  4JXS A;  1BLP A;  2ZC5 B;  3QP1 A;  4WEJ A;  1YLZ A;  2ZQD A;  1WE4 A;  4KZ6 A;  5F6A A;  3UPO A;  1G6O A;  2Y2Q A;  3OPH A;  1K0K A;  2BAS A;  1OJG A;  4BBU A;  1L2S A;  5EVE A;  5F1F A;  4HBT A;  3N7W A;  4K0W A;  1OTB A;  2IA2 A;  1PW1 A;  5EEC A;  1GSX A;  3F1O B;  4N92 A;  2M1C A;  3HJK A;  3IHB A;  3ZNY A;  1D7E A;  4MEZ A;  5I5L A;  5EVI D;  4MBK A;  1LSV A;  3CHW P;  2Y4A A;  1NRJ A;  5CHU A;  5JYP A;  1W7F A;  5DFX A;  4CQH A;  4B9O A;  2VGL M;  4I3J A;  2Y91 A;  4QY6 A;  3OPP A;  4ARZ A;  5FEG A;  1O07 A;  4RX3 A;  5DKL A;  3SS4 A;  3IXH A;  5A8B A;  1VQQ A;  4B4Z A;  2VLG A;  1BUL A;  3T4J A;  1TF1 A;  4D2O A;  3T4L A;  2Y2G A;  4Y0U A;  4WZ5 C;  4GDN A;  3NDE A;  4BD1 A;  2O9A A;  4WLA A;  3KSF A;  5FAO A;  5GLA A;  3TE8 A;  3QP2 A;  3VV4 A;  5EPH A;  3TG9 A;  2OWH A;  4JGO A;  5EFW A;  2HP9 A;  4YWZ A;  4ZJ1 A;  1I2S A;  1ZHH B;  4CLC D;  1W8Y A;  5TR7 A;  2M7V A;  1GSW A;  5FQI A;  2HPB A;  3P09 A;  5L09 A;  3G31 A;  3H9W A;  1PW8 A;  1W63 M;  3NOU C;  2WKE A;  5U47 A;  3VSK A;  2A24 A;  2X02 A;  4XT2 A;  3LCE A;  4NXE A;  3S7P A;  2ZMF A;  3A0V A;  3W2Z A;  1FR1 A;  2V8F A;  3M2K A;  1XJ4 A;  3LR3 A;  5FI2 A;  2I72 A;  2Y55 A;  4LRY C;  3MJQ A;  3QHY A;  2EX6 A;  4WN5 A;  1KOU A;  3IX4 A;  5FQM A;  1W5D A;  1YLP A;  1K4E A;  3W8K A;  4OKP A;  3CJM A;  1HVB A;  3FKV A;  1YPR A;  2XFS A;  4LLO B;  3KYZ A;  3W4P A;  4EBN A;  2X01 A;  4DKI A;  3QP8 A;  3HLE A;  3Q07 A;  4KQQ A;  1MPL A;  3LY4 A;  2ZMA A;  3MQO A;  2ZQC A;  5CER A;  1ESU A;  5M19 A;  1S4R A;  2H5S A;  4OVD A;  1OJ5 A;  3C38 A;  4C3Q A;  1PWD A;  1H0M A;  2Y79 A;  3IBR A;  5FDS A;  4FD8 A;  4RYE A;  2V1Z A;  1I5Q A;  1U60 A;  4NK3 A;  1ES3 A;  4G3W A;  1FQG A;  1XFN A;  1TDG A;  3CG5 A;  1EI5 A;  3E2K A;  3VP3 A;  2JKF A;  3KX0 X;  3N8S A;  2H0T A;  1CJF A;  1FIL A;  2W3E A;  3HBR A;  1G5U A;  4N1X A;  3ICY A;  4NET A;  2VZW A;  3LEQ A;  4I3A A;  5M1A A;  3LEZ A;  1L3L A;  5CTN A;  5HDD A;  3SOI A;  3OC2 A;  2V1B A;  2VV6 A;  4HQA A;  3FYZ A;  4K91 A;  1JTG A;  3LR5 A;  2OWJ A;  3H82 B;  4HJ4 A;  3GDI A;  3WRZ A;  4QWO A;  4B88 A;  3VFH A;  1T18 A;  2XA7 M;  3BY9 A;  4QD4 A;  1IEL A;  1NZU A;  4U3T A;  1K55 C;  1MZU A;  5FL3 A;  3IWO A;  3BFD A;  3A3F A;  4GNU A;  4LV2 A;  2ZL1 A;  2ZL1 B;  2DRW A;  3G30 A;  2L4R A;  4OH0 A;  3IX3 A;  3VP2 A;  1JWZ A;  3IT9 A;  3BQ8 A;  4AFI A;  3T4O A;  2BTF P;  4L9G A;  5KZH A;  2ZC7 A;  1FCN A;  2JKT I;  1PWG A;  3ZCZ A;  2A49 A;  4IBX A;  2GZA A;  5CRF A;  1N9L A;  4EET B;  3NUL A;  3L7H A;  4KZ3 A;  1OTI A;  3MKE A;  4L9F A;  3HRE A;  3Q7V A;  5DF9 A;  1O7E A;  3IF5 A;  3U4L P;  4ETZ A;  4HP4 A;  4OLG A;  1NLZ A;  2X71 A;  4MBH A;  2VV8 A;  2HZ5 A;  1XPB A;  5E2F A;  2XQZ A;  4KZ4 A;  4JF6 A;  3DW0 A;  3LID A;  3ZNT A;  4B93 A;  5HW3 A;  1UGU A;  4GHI B;  1OTA A;  4HP9 A;  1RCJ A;  3C4P A;  3MKF A;  2XD5 A;  4P85 A;  2JC7 A;  4S2O A;  3NY4 A;  4F3L B;  2PBY A;  5FQQ A;  1E25 A;  4I3I A;  3N4I A;  4LV1 A;  4WL9 A;  3GQZ A;  1NXY A;  1P9R A;  1ERO A;  4KZ5 A;  4U0T A;  4UA7 A;  5HD3 A;  2ZM2 A;  3E98 A;  2XSS A;  1TS0 A;  4BMW A;  3MZD A;  4UQI S;  1CI8 A;  3FZC A;  4H6J B;  2Z2M B;  3O86 A;  1IFQ A;  4S2N A;  4R6L A;  2JE5 A;  2LB5 A;  2QZ6 A;  3BY8 A;  3NC8 A;  1KE3 A;  5L8M A;  1DP6 A;  4HNB A;  4DE3 A;  1HTZ A;  3Q81 A;  4HH2 A;  2XD1 A;  3SW1 A;  4KEN B;  2PU2 A;  3H7W B;  2Z6C A;  2WKH A;  3ULF A;  1VB6 A;  2G7U A;  1NZO A;  3HUN A;  4E6X A;  4JGP A;  4PAU A;  5K5B A;  3P98 A;  4OP8 A;  2ZD8 A;  1RGZ A;  1CI9 A;  5HPI A;  1KVL A;  4KG2 A;  4HY8 A;  3T50 A;  2ZOH A;  3AGF A;  4KQD A;  5EVI B;  3HLW A;  4MBF A;  2Z6D A;  3VP0 A;  3ISG A;  4IVI A;  1BYW A;  3CIT A;  3HL9 A;  1TS6 A;  3HLC A;  5F68 A;  1UWP X;  1VEU A;  4ZTK A;  2A3U A;  1NYM A;  4BBT A;  2XR0 A;  1UWN X;  2MJ6 A;  4LGW A;  4WMC D;  2FH5 A;  5F69 A;  4E3J A;  3CWF A;  4KZ7 A;  4Z1W A;  1L0G A;  4Y17 A;  1XP4 A;  3TJZ C;  2XLN A;  5HAR A;  3WS1 A;  5KSC A;  2PBD P;  4G3V A;  3FKW A;  1H5X A;  4R0Q A;  4MLL A;  1IKG A;  3QP6 A;  2HP6 A;  4CLC A;  2ZOI A;  1IYS A;  5HWT A;  4CJN A;  2W0N A;  3G6O A;  4EV4 A;  4DDY A;  3EWK A;  5HAP A;  3M6B A;  2V20 A;  3UPN A;  1G28 A;  4HEF A;  1YSQ A;  3T4K A;  1W8Q A;  3MXQ A;  3ZG0 A;  1J9M A;  1TS7 A;  3VSL A;  1PYY A;  1L0D A;  2KOI A;  3IHA A;  4HES A;  3T12 B;  1DP8 A;  5HX9 A;  5E43 A;  4WBG A;  3MZE A;  1ZC2 A;  2VGK A;  2Y2H A;  3L9K A;  5TBM A;  4R3A A;  2RCX A;  5TBM B;  1S6R A;  2WGI A;  3KO6 A;  4Y5F A;  2O0Y A;  4X53 A;  1GSV A;  5BOH A;  3LR4 A;  3NI9 A;  1XGJ A;  2IWD A;  4OOM A;  2O99 A;  3T1Q B;  3T1S A;  4EQ1 A;  3UN7 A;  4E3K A;  4BBV A;  2HGV A;  3PYP A;  1L0E A;  1D06 A;  3W4Q A;  4P6B A;  2V0W A;  3GMW A;  3R7W A;  3UB8 A;  3UDI A;  3F1N A;  1CF0 A;  3IH9 A;  3LR0 A;  5CTM A;  3BFG A;  1TEM A;  4UEY A;  3O87 A;  4DN0 A;  3UB9 A;  4PM6 A;  3ZQ5 A;  4IUK A;  1VET B;  3P7N A;  4L0L A;  3E4P A;  1ES5 A;  1W63 Q;  1DRM A;  3FG8 A;  4E3N A;  3ZG8 B;  2VA0 A;  2PYR A;  4R3J A;  1CEG A;  4OQ0 A;  1C3B A;  2WZZ A;  4B4X A;  1YMS A;  3BJN A;  4ZRR A;  5J8X A;  4EBP A;  1DJA A;  5E2H A;  4PMA A;  4WEL A;  5EM1 A;  3PBT A;  3WRT A;  3LIE A;  3NBL A;  3KYE A;  3UE3 A;  3T4Q A;  2CMN A;  3PBR A;  4HJ3 A;  3UME A;  3F1O A;  2P04 A;  1ZTU A;  3OPL A;  1OT9 A;  2EX8 A;  5A92 A;  1P9W A;  1BLC A;  3HLD A;  4UAA A;  3LYX A;  2JKR I;  2OLV A;  3GVB A;  4HBU A;  4Y3I A;  2JKT M;  1WYB A;  1Z6F A;  3FPV A;  3A0R A;  5J3W A;  3V3R A;  4RVA A;  3PR6 A;  1IYP A;  1QMF A;  2EX9 A;  2ZQA A;  3VOL A;  2ZLY A;  4QJG A;  3T1R A;  3ZG5 A;  1E4D A;  3IBJ A;  3HLF A;  2D01 A;  4JBF A;  5FA7 A;  4BJP A;  1S0W A;  4EUV A;  2HJ9 C;  4NXF A;  4I39 A;  5CHJ A;  1M40 A;  2PAV P;  3S7O A;  5HFO A;  2OSU A;  1LL8 A;  3MF0 A;  2QJ5 A;  3E0Y A;  4QU3 A;  1YMX A;  4DRT A;  1XJ6 A;  3CPT B;  1NLY A;  3RXW A;  5DF8 A;  2ZC3 B;  4CPK A;  4OPQ A;  3U2A A;  1N9N A;  3UO9 A;  4LFU A;  3QP4 A;  5GHZ A;  1OTE A;  1M6K A;  4OQI A;  2J7V A;  2J3W A;  3SH8 A;  2C6W B;  5MC7 A;  2JBF A;  2W3G A;  4EUZ A;  4JXW A;  5CHM A;  2Q9N A;  5GL9 A;  4OOL A;  1SKF A;  1JNU A;  4S2N C;  1XXM A;  4OLD A;  4RX2 A;  1ACF A;  4XXR A;  4IHQ A;  4DF6 A;  5FEF A;  4YOF A;  4HI4 A;  1YKD A;  3O3V A;  4OPZ A;  4OON A;  1PIO A;  4X55 A;  3AGE A;  4K0X A;  1K57 A;  2VKS A;  3FC7 A;  5IHV A;  1P97 A;  4BD0 A;  2JCH A;  5EM0 A;  4P6Z M;  2OOL A;  2A2L A;  5FI7 A;  4JF5 A;  1H3Q A;  3OLO A;  1W79 A;  3NDG A;  5HSQ A;  4MMN A;  3R4K A;  2XF3 A;  3KSH A;  1ZKJ A;  3GEC A;  2FZ0 A;  3IWQ A;  2L0W A;  1LSX A;  3NCK A;  2VX8 A;  4WM9 A;  5HPF A;  5KSH A;  3UDX A;  3OCL A;  3M2J A;  4DXB A;  4E04 A;  1K38 A;  2HJE A;  4JGR A;  3VE4 A;  4OOY A;  5FAS A;  1ONG A;  5FAQ A;  1JTD A;  3IXG A;  5C5K A;  4GZB A;  1GA0 A;  5L07 A;  2OAP 1;  1LL9 A;  3VOY A;  3E2L A;  1AWI A;  5KIZ A;  3LIB A;  3LO7 A;  4GN2 A;  5DTT A;  5F83 A;  3PBQ A;  2VEA A;  1SKO B;  3DWZ A;  4GW9 A;  5HDS A;  1MWS A;  1KGE A;  3UNW A;  4EXO A;  1YLW A;  4BL3 A;  4WZ4 A;  4KQR A;  1PZP A;  4IVK A;  2Y2I A;  2Y2M A;  3BM6 A;  1NJ4 A;  3H82 A;  3HLG A;  4G3K A;  3UB5 P;  3WS0 A;  3EOI A;  4CLC C;  3W4O A;  2K2N A;  2H28 A;  2ZQ8 A;  1MWR A;  1NRF A;  4F94 A;  4HJ6 A;  4UQI M;  3WS4 A;  3CAX A;  2XRO A;  1KDW A;  3C8C A;  4X6T A;  3VFF A;  3C7U A;  3MZF A;  4LRZ E;  4N1H A;  1G68 A;  4LEN A;  2EFU A;  2B18 A;  2W27 A;  5GLB A;  1H8M A;  2EWW A;  4RA7 A;  3GR2 A;  4MN6 A;  4WMC A;  4BEN A;  4BQM A;  1PNE A;  1GCE A;  1S4S A;  2ZC4 B;  1E3U D;  2EA9 A;  1FOF A;  3LIF A;  1QME A;  4FH4 A;  2Z2L B;  3C7V A;  4LV3 A;  3I7J A;  3OBF A;  2PT7 A;  1T1C A;  1KVM A;  1XA7 A;  3T1X A;  1IEM A;  4HIA A;  2XRN A;  3MMH A;  3TOI A;  4EW7 A;  4EES A;  4S2P A;  2J3T C;  1XKZ A;  2WKQ A;  3IX8 A;  3SZT A;  4H8R A;  4KZB A;  1TVF A;  4FH2 A;  1A0K A;  2WKI A;  3G4P A;  2J9P A;  4JF4 A;  4X69 A;  4I38 A;  2WK0 A;  4GHI A;  5CEC A;  1Y4O A;  4Y13 A;  1H8Z A;  2KLI A;  4DE0 A;  1T1B A;  2Q0O A;  3EGX C;  4PM5 A;  3WWX A;  3G32 A;  3C2W A;  1T19 A;  3LUQ A;  1VM1 A;  4F3L A;  3WS5 A;  5DJT A;  2WAE A;  3C4O A;  4JGQ A;  2PR6 A;  2HV1 A;  2QWS A;  5AQA A;  2GDN A;  1TD5 A;  3B47 A;  2PU4 A;  3IS2 A;  1SCW A;  3IS2 B;  5CXW A;  3N8R A;  4H6J A;  3CI6 A;  4MN7 A;  3E4Q A;  1HZO A;  1BLH A;  4KQO A;  2ZJ9 A;  4LCM A;  2ZMV A;  3CLO A;  1PI4 A;  4IBR A;  1F98 A;  2V9A A;  3S7N A;  2XA7 S;  3H7W A;  3ITA A;  4KUK A;  1YT4 A;  3TW8 A;  3EEA A;  4K08 A;  4GS9 A;  4GS9 B;  2O9C A;  1STZ A;  5IT5 A;  2PYP A;  5GHY A;  2EWV A;  3NHQ A;  1BZA A;  3BLS A;  2GJ3 A;  4PM8 A;  5EV0 A;  3CUE A;  2DCF A;  5EVI A;  5L2F A;  4HH3 A;  2HDR A;  5GLC A;  1EWZ A;  2B5R A;  4O0P A;  3HUM A;  3EGD C;  2ZC6 B;  4X1L A;  2ACG A;  4UA9 A;  1KDS A;  5DKK A;  1TS8 A;  3G2Y A;  2Y59 A;  4BWI A;  1I2W A;  1VHM A;  2P9V A;  2P9V B;  3UB6 A;  4LRX C;  4QPR A;  3T4S A;  1K54 A;  4O8G A;  4LPZ A;  2GNX A;  4Y15 A;  2DMW A;  3D9Y A;  4GJ4 A;  3B33 A;  4PPR A;  4ZAM A;  2IWB A;  4UHU A;  4XUX A;  3E4O A;  3V3S A;  2NUT C;  2WAD A;  1OME A;  3UE1 A;  5JYO A;  2QPN A;  5E2E A;  4EU0 A;  3MBZ A;  1MXO A;  5AQ9 A;  1K57 C;  4MNR A;  5CED A;  2FFY A;  4E3L A;  1PFL A;  3D72 A;  2D02 A;  2Y2N A;  5DTK A;  5CX7 A;  3BFF A;  3OOV A;  3RXX A;  1GA9 A;  2CC1 A;  3A3I A;  1F9I A;  1FCO A;  3LGO A;  5D3O A;  2OLU A;  4JLF A;  3JVU A;  1F5M A;  2HF6 A;  3Q1F A;  4MN5 A;  4ID4 A;  1K56 D;  3GTC A;  1FCM A;  4S2J A;  1Z09 A;  2HDQ A;  3B3X A;  4C75 A;  4YIN A;  3ZG7 B;  3D4F A;  3WS2 A;  3ZHH A;  1OT6 A;  2WGW B;  3EEH A;  4KZ8 A;  2QMI A;  1DJB A;  2EXB A;  5A91 A;  1D1J A;  2UV0 E;  1DP9 A;  4O7D A;  3DTE A;  2KDK A;  1MKI A;  5I94 A;  5HAI A;  2P08 A;  5AQ7 A;  2H10 A;  5HZH A;  3V50 A;  2VK3 A;  3D3O A;  5FAP A;  1V9Y A;  3IF6 A;  1FIK A;  3IF6 B;  1CK3 A;  1LI9 A;  2V8C A;  1VET A;  4FSF A;  1FR6 A;  3KSI A;  3M6H A;  4S2M A;  1NY0 A;  1MWT A;  4Y0T A;  4E3I A;  1N4O A;  3A3D A;  1S1Y A;  3F1P B;  2Y2J A;  3FPW A;  4PKY G;  3PBO A;  2QJ7 A;  2VGJ A;  3G2Z A;  3S4X A;  4Y2F A;  5EVL A;  1WA9 A;  3DBA A;  2ZQ7 A;  1PRQ A;  3BFC A;  3TSG A;  1H8Y A;  4PM7 A;  4Q0H A;  1Q2Q A;  1BT5 A;  3ZVW A;  1S66 L;  5HL1 A;  4JPM A;  3N6I A;  3VP1 A;  4R1G A;  2R9X A;  4GD6 A;  1N9B A;  2E8I A;  1IYQ A;  3Q7Z A;  4EEU A;  1BLS A;  5FI6 A;  5CEB A;  3NEC A;  3VMA A;  1MBL A;  3O5Y A;  4KG6 A;  3CZD A;  1LL5 A;  5G18 A;  3MQ0 A;  4QHC A;  3OZH A;  2Y2K A;  3QNC A;  2P74 A;  4ARZ B;  2P7J A;  3RH8 B;  5CGW A;  3QP5 A;  2INW A;  3PXP A;  4ETX A;  2XK1 A;  3IXD A;  4OQH A;  4OPY A;  4BL2 A;  2LB9 A;  3KSG A;  1E3U A;  1IOU A;  3BQA A;  3JPU A;  1LHY A;  3CPT A;  1MKM A;  2ZM8 A;  3LI8 A;  4PKY A;  2W3F A;  5FQJ A;  3G34 A;  4N9L A;  3P01 A;  1YLT A;  3BRM A;  3O88 A;  1CEF A;  4GLQ A;  5HD5 A;  1YLY A;  3A0S A;  3V39 A;  3HJI A;  4YFM A;  3DWK A;  2WKR A;  4KZ9 A;  2XDM A;  1K4F A;  4OP5 A;  3K2N A;  3EQU A;  4X68 A;  3BWL A;  1BSG A;  4LV0 A;  4DE2 A;  1XA1 A;  4LCL A; 
#chains in the Genus database with same CATH homology
 4IJG A;  4MN6 A;  3ULF A;  1VB6 A;  2G7U A;  4JGP A;  4PAU A;  3MFX A;  5K5B A;  3R7W B;  3F1N B;  3MR0 A;  1S4S A;  3RFB A;  3F1P A;  5HPI A;  2A24 B;  2EA9 A;  4XT2 B;  4HY8 A;  3T50 A;  2ZOH A;  5AJG A;  3LIF A;  4KQD A;  4Q0J A;  4WEJ A;  4EER A;  3OBF A;  2Z6D A;  1YSP A;  5F6A A;  4NKP A;  1BYW A;  3CIT A;  1G6O A;  1TS6 A;  5F68 A;  2PT7 A;  5HL6 A;  1UWP X;  2BAS A;  1T1C A;  4WF0 A;  1OJG A;  4BBU A;  4HIA A;  2XRN A;  3MMH A;  5TJJ A;  4BBT A;  4EW7 A;  1OTB A;  5F5Y A;  1UWN X;  2IA2 A;  2MJ6 A;  4EES A;  2J3T C;  2WKQ A;  2WKP A;  3CUE C;  1GSX A;  2OAQ 1;  3K3D A;  2FH5 A;  5F69 A;  3CWF A;  4Z1W A;  1S1Z A;  1X0O A;  4I38 A;  3TJZ C;  3F1O B;  2M1C A;  3HJK A;  4GHI A;  1D7E A;  1N9O A;  5DFY A;  4G3V A;  2W1R A;  2J3T D;  2NUP C;  4FOF A;  3B42 A;  5I5L A;  1LSV A;  2KLI A;  2VGL S;  1T1B A;  4CLC A;  1NRJ A;  2ZOI A;  1OTD A;  5HWT A;  2W0N A;  3PBS A;  5DFX A;  4CQH A;  3EGX C;  4IUH A;  3C2W A;  4B9O A;  1T19 A;  2VGL M;  4I3J A;  4NXB A;  3LUQ A;  3G6O A;  4ARZ A;  4F3L A;  2O9B A;  2PDR A;  3EWK A;  1G28 A;  1ODV A;  4R70 A;  3HCY A;  1YSQ A;  5DJT A;  5DKL A;  3T4K A;  5A8B A;  3MXQ A;  4JGQ A;  2PR6 A;  2HV1 A;  3VE3 A;  2VLG A;  2JN7 A;  2QWS A;  1TS7 A;  3T4J A;  1TF1 A;  3T4L A;  1TD5 A;  3B47 A;  3IS2 A;  3IS2 B;  2KOI A;  1DP8 A;  4H6J A;  2O9A A;  4WLA A;  3CI6 A;  3KSF A;  4MN7 A;  5TBM A;  4R3A A;  5TBM B;  3TE8 A;  3E4Q A;  3VV4 A;  2YKH A;  3KO6 A;  4Y5F A;  2O0Y A;  3NOP C;  2OWH A;  1GSV A;  4JGO A;  4KQO A;  5EFW A;  3LR4 A;  2ZMV A;  4OOM A;  3CLO A;  2O99 A;  4YWZ A;  1F98 A;  2V9A A;  3ZYT A;  3S7N A;  2R78 A;  4EQ1 A;  1ZHH B;  4CLC D;  2XA7 S;  3H7W A;  2M7V A;  1GSW A;  3LIA A;  4KUK A;  3TW8 A;  3NOT C;  3EEA A;  4BBV A;  2PR5 A;  2HGV A;  3PYP A;  2Y8H A;  3OCN A;  4K08 A;  1D06 A;  4GS9 A;  4GS9 B;  2O9C A;  1STZ A;  5IT5 A;  3H9W A;  2PYP A;  2V0W A;  3R7W A;  3UB8 A;  3F1N A;  2EWV A;  3JVV A;  3LR0 A;  4UEY A;  1W63 M;  3NOU C;  3NHQ A;  5G4Z A;  4DN0 A;  3PBN A;  2A24 A;  3UB9 A;  2GJ3 A;  4XT2 A;  4WEK A;  3ZQ5 A;  4IUK A;  3CUE A;  4GCZ A;  4NXE A;  3P7N A;  3S7P A;  2ZMF A;  3A0V A;  4HH3 A;  3C30 A;  3W2Z A;  3E4P A;  4L0L A;  1W63 Q;  4O0P A;  1XJ4 A;  3LR3 A;  1DRM A;  3LFV A;  3EGD C;  3FG8 A;  2K7S A;  2VA0 A;  2PYR A;  4LRY C;  3MJQ A;  4WN5 A;  1KOU A;  5DKK A;  1TS8 A;  4BWI A;  5G4Y A;  1VHM A;  3UB6 A;  3UB7 A;  3BJN A;  4LRX C;  4ZRR A;  4P6Z S;  4ME4 A;  4QPR A;  3T4S A;  2V1A A;  4O8G A;  4LLO B;  4LPZ A;  3KYZ A;  2GNX A;  4WEL A;  3PBT A;  2DMW A;  3LIE A;  3UE3 A;  4GJ4 A;  3T4Q A;  2CMN A;  4II7 A;  3B33 A;  3PBR A;  3UMD A;  4HJ3 A;  3UME A;  3MQO A;  3F1O A;  2P04 A;  1ZTU A;  3LIC A;  1OT9 A;  3E4O A;  2PD7 A;  3T4T A;  1S4R A;  4NXG A;  1P9W A;  4EEP A;  1OJ5 A;  2NUT C;  3C38 A;  4HOI A;  1XJ2 A;  3LYX A;  2VV7 A;  2JKR I;  1V9Z A;  4EU0 A;  4O01 A;  4Y3I A;  2JKT M;  2Y79 A;  3IBR A;  5AVF A;  3FPV A;  3A0R A;  3LI9 A;  5J3W A;  5J4E A;  2VJW A;  5J7E A;  2L1M A;  3D72 A;  2D02 A;  3PR6 A;  4G3W A;  5CX7 A;  1XFN A;  3VOL A;  4Q0I A;  3OOV A;  2PD8 A;  3IBJ A;  2D01 A;  3KX0 X;  1F9I A;  2W3H A;  3TRC A;  2W3E A;  4BJP A;  2JKR M;  3JVU A;  1F5M A;  2HF6 A;  4EUV A;  3ICY A;  4DJ3 A;  2HJ9 C;  4M4X A;  4I39 A;  4MN5 A;  4NXF A;  2QYB A;  2VZW A;  4I3A A;  4RQ9 A;  3S7O A;  1LL8 A;  2B02 A;  3MF0 A;  2QJ5 A;  5IU1 A;  1NWZ A;  5HDD A;  4NEE D;  3E0Y A;  3OC2 A;  2V1B A;  2VV6 A;  4HQA A;  1OT6 A;  1XJ6 A;  3EEH A;  1NLY A;  3LR5 A;  2OWJ A;  3H82 B;  4L9E A;  4HJ4 A;  3GDI A;  2QKP A;  4YNR A;  4MDZ A;  1T18 A;  1DP9 A;  4KUO A;  2KDK A;  2XA7 M;  3BY9 A;  3U2A A;  1N9N A;  2JHE A;  2P08 A;  5HZH A;  1OTE A;  3D3O A;  1MZU A;  1V9Y A;  5FL3 A;  3KYQ A;  2J3W A;  3NJA A;  5MC7 A;  4DJ2 A;  4FSF A;  1P0Z A;  2W3G A;  3KSI A;  2I9V A;  1S67 L;  2L4R A;  4OOL A;  1JNU A;  3BQ8 A;  1S1Y A;  1YAX A;  2W3D A;  3F1P B;  4AFI A;  4IHQ A;  5HWW A;  3T4O A;  3FPW A;  1MC0 A;  4DMZ A;  3MQQ A;  5HWV A;  1XJ3 A;  4PKY G;  4L9G A;  4YOF A;  4HI4 A;  1YKD A;  3PBO A;  2QJ7 A;  1LT0 A;  2JKT I;  2VKS A;  3FC7 A;  1P97 A;  2GZA A;  4Y2F A;  5DJU A;  4HHD A;  1WA9 A;  1N9L A;  2QHK A;  4P6Z M;  4EET B;  2OOL A;  3DBA A;  2A2L A;  1OTI A;  4L9F A;  1H3Q A;  1T1A A;  3OLO A;  5HSQ A;  4MMN A;  2YKF A;  2J80 A;  3R4K A;  5DF9 A;  4Q0H A;  3KSH A;  3GEC A;  1S66 L;  4ETZ A;  2V0U A;  4HP4 A;  2FZ0 A;  2L0W A;  1NLZ A;  1LSX A;  2VV8 A;  2VX8 A;  5HPF A;  5KSH A;  4EEU A;  3PHY A;  2KX6 A;  2K31 A;  3OCL A;  3LID A;  4B93 A;  4E04 A;  2HJE A;  3BW6 A;  4JGR A;  1UGU A;  4GHI B;  3VE4 A;  1OTA A;  3O5Y A;  4WUJ A;  4HP9 A;  5AVE A;  3K3C A;  3V67 A;  5C5K A;  3EQV A;  2PHY A;  3MQ0 A;  2OAP 1;  4CLC B;  2GX5 A;  5KIZ A;  3LIB A;  1LSW A;  2W1T A;  2W1T B;  4ARZ B;  4F3L B;  2P7J A;  5HDC A;  3RH8 B;  3RTY A;  3PBQ A;  4ETX A;  2INW A;  2VEA A;  3PXP A;  4I3I A;  3S7Q A;  4GW9 A;  1OPX A;  5HDS A;  1Y28 A;  3UE6 A;  4WL9 A;  2LB9 A;  3KSG A;  4EXO A;  1P9R A;  1IOU A;  5HD3 A;  3BQA A;  3E98 A;  2XSS A;  1TS0 A;  4BMW A;  4PHT A;  1MKM A;  2ZBB A;  4UQI S;  3H82 A;  4G3K A;  3LI8 A;  4PKY A;  2W3F A;  3EOI A;  4CLC C;  4H6J B;  2K2N A;  2H28 A;  1EW0 A;  3P01 A;  1IFQ A;  4HJ6 A;  4UQI M;  4GLQ A;  4R6L A;  2M7U A;  2LB5 A;  3BY8 A;  5L8M A;  3CAX A;  5HD5 A;  1DP6 A;  4HNB A;  4I5S A;  5IS1 A;  2XRO A;  3A0S A;  3HJI A;  1XFQ A;  3C8C A;  2WKR A;  4HH2 A;  4LRZ E;  4R38 A;  4CLC E;  5LBR A;  3K2N A;  3EQU A;  3BWL A;  2B18 A;  3SW1 A;  2W27 A;  1H8M A;  2EWW A;  3H7W B;  4MCW A;  2Z6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...