3IS2B

2.3 angstrom crystal structure of a cys71 sulfenic acid form of vivid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
149
structure length
149
Chain Sequence
MHTLYAPGGYDIMGYLIQIMNRPNPQVELGPVDTSCALILCDLKQKDTPIVYASEAFLYMTGYSNAEVLGRNCRFLQSPDGMVKPKSTRKYVDSNTINTMRKAIDRNAEVQVEVVNFKKNGQRFVNFLTMIPVRDETGEYRYSMGFQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vivid PAS protein VVD
publication title Illuminating solution responses of a LOV domain protein with photocoupled small-angle X-ray scattering.
pubmed doi rcsb
source organism Neurospora crassa
molecule tags Signaling protein
total genus 34
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3is2B00
2PR5A 3ULFA 4GCZA 5IS1A 4HIAA 4HHDA 3RH8B 1S67L 4HY8A 2PYPA 3LI8A 5HDCA 4HI4A 1KOUA 2V1BA 4EXOA 3NJAA 1ODVA 4EETB 2BASA 4GW9A 2OWJA 1N9LA 2PD7A 4JGOA 5J3WA 3LI9A 3A0SA 1S4SA 5DKLA 2QJ5A 5AVFA 4PKYA 2WKRA 1BYWA 3RTYA 3SW1A 5EFWA 2PR6A 2V1AA 3H9WA 2ZOIA 4RQ9A 4YWZA 2A24B 1GSXA 3NOPC 4HP4A 5HWTA 1T19A 3LIAA 3KX0X 4H6JA 1DP8A 4F3LA 5F68A 3BY9A 4LRZE 4MN6A 4B9OA 1T1BA 3F1NB 3MFXA 2Z6DA 5HSQA 3MXQA 4DJ2A 1TS6A 1Y28A 2YKHA 4KQDA 4LRXC 4EW7A 5J7EA 1UWNX 4KUOA 2VEAA 4HH3A 3ICYA 1GSWA 4NXFA 2CMNA 5G4ZA 2KDKA 3G6OA 3GECA 3A0RA 2PDRA 5IU1A 3PYPA 1XJ2A 4GS9A 4HP9A 3UB9A 5J4EA 2W27A 2JN7A 3LICA 2H28A 5F6AA 4EEPA 2R78A 1S66L 2YKFA 3E4QA 1DP6A 4XT2B 2VV8A 3IS2A 3LUQA 2QWSA 4L9GA 3H7WA 1T1CA 3GDIA 3CWFA 1OTIA 4BBVA 5HD3A 1T18A 5HWWA 1OJ5A 4WN5A 3EEHA 4HNBA 3MQOA 1XFQA 4HJ4A 5F5YA 3NOUC 4BBUA 3LIFA 4XT2A 4JGRA 4H6JB 3LYXA 4F3LB 2I9VA 1D7EA 3F1PA 3UE6A 5HDDA 5TBMA 4WF0A 2VLGA 1UGUA 2L0WA 3K3DA 1OTBA 5DKKA 1JNUA 1XJ3A 3F1OA 2PYRA 4NXBA 4NXEA 4HOIA 3D72A 1OT9A 4WLAA 1XJ4A 4R6LA 1N9NA 5DJUA 3CAXA 4K08A 3HJKA 4L9EA 1UWPX 2QKPA 3NOTC 1LSXA 4I38A 1T1AA 2V0UA 1MZUA 4I3IA 4LPZA 2L1MA 5F69A 4HJ6A 2K7SA 4JGPA 1TS7A 2L4RA 2QJ7A 4GS9B 5HDSA 4L9FA 3LIEA 3VOLA 4GHIA 2V9AA 2ZOHA 1VB6A 4MN5A 1TS0A 5HWVA 1OT6A 3CLOA 4HH2A 3A0VA 3H82A 3IS2B 1LT0A 3LIBA 3H7WB 1OJGA 1P97A 4WUJA 1D06A 2EA9A 2ZBBA 2J80A 2JHEA 1NWZA 2OWHA 4DJ3A 3K3CA 3MR0A 3LIDA 2OOLA 3P7NA 2D02A 1S1ZA 4LRYC 3PHYA 3UMDA 4R38A 1S1YA 3F1PB 5A8BA 3BWLA 5TBMB 2WKPA 1XJ6A 2QHKA 1OTDA 3FG8A 2B02A 4HQAA 1P0ZA 1GSVA 3NHQA 3F1OB 4KUKA 2Z6CA 1F98A 3MJQA 1LSVA 4PKYG 5DJTA 4M4XA 4EQ1A 3UB7A 2VV6A 4BBTA 3ZQ5A 2P7JA 5HZHA 1TS8A 3C2WA 3UMEA 3B33A 3OLOA 4WL9A 1EW0A 3MQQA 4E04A 1S4RA 1WA9A 4R3AA 4GHIB 1V9ZA 3VE4A 2V0WA 1DP9A 3HJIA 3VE3A 3EWKA 1LSWA 1G28A 1N9OA 1DRMA 2D01A 2INWA 3H82B 2VV7A 3UB8A 4R70A 5HD5A 4I39A 3UB6A 1LL8A 5G4YA 3BY8A 4EERA 1V9YA 3E4OA 2GJ3A 1XFNA 2A24A 5AVEA 3FC7A 4I3AA 5KIZA 4I5SA 4EEUA 4HJ3A 3IBRA 4JGQA 4EESA 3T50A 4I3JA 2M1CA 2PHYA 2PD8A 2KX6A 4LLOB 1OTAA 2W0NA 1F9IA 4NXGA 5I5LA 3F1NA 1X0OA 3E4PA 1OTEA 2WKQA 3C8CA 2HV1A
chains in the Genus database with same CATH superfamily
3ZNYA 2JKTI 4IEDA 1PWCA 5HPIA 3MZDA 1K57C 4WMCA 2VZWA 4HIAA 4R23A 5CHMA 4PM9A 2M7VA 2NUTC 3C4OA 5F1GA 5G18A 5HDCA 4HI4A 1CF0A 1ESUA 4WBGA 3TW8A 4KQOA 4EXOA 2WKHA 3NJAA 1ODVA 1K25A 1CJFA 2Y2LA 1NYMA 1H8MA 2OWJA 2PU4A 3IXBA 3JVVA 1NXYA 4Z9QA 3V67A 1BSGA 5J3WA 3VOYA 3VSLA 4UA6A 4B93A 5GHZA 1RGYA 5AVFA 4PKYA 3T1QB 2WKRA 3UB5P 3NDEA 4QWOA 3C5AA 5F82A 3OPRA 5EFWA 3CG5A 3PAEA 1ES4A 3H9WA 3PBTA 3WS4A 1KE3A 1LHYA 4X55A 3NOPC 4EQIA 3ISGA 5CHJA 4KZ5A 3VP4A 4UA7A 4X69A 3RXWA 4RYEA 5EV0A 1ZG6A 2RL3A 2ZM8A 4LRZE 1Y54A 5L07A 5EVID 3SS3A 4B9OA 5M19A 4JXSA 1T1BA 1TDLA 2WADA 1PRQA 3RXXA 3F1NB 2GX5A 2OV5A 3KSGA 3O86A 5HSQA 1NRJA 1L3LA 1TS6A 4O8GA 4ZAMA 2BLSA 1Y28A 3OPHA 1FR6A 2WGWB 2W3DA 2G7UA 2J7VA 4MBKA 1XXMA 1SKOA 5EE8A 1GSWA 1BZAA 5EOOA 2KDKA 3G6OA 1H3QA 4KZAA 5IU1A 3QNBA 5J4EA 2Y2NA 1IEMA 5GLCA 3N8SA 4E6WA 3LICA 5HPFA 5DFXA 1YMSA 3OPPA 1IFQA 2OAP1 3S7NA 1IYQA 4A5RA 1F5MA 3HLBA 3UDXA 3ZG0A 4E3IA 1ZKJA 3GSGA 3CWFA 4S2MA 5TR7A 4P0MA 4MMNA 1M6KA 3BEBA 1OJ5A 2R9WA 4ETZA 1GA9A 5F5YA 3LIFA 1HTZA 4H6JB 5FI7A 4LCLA 3DWZA 4F3LB 1SKFA 2FFFB 4WMCD 1D7EA 2XD1A 4KZ7A 3F1PA 3UE6A 4KZ9A 3PBNA 1BLSA 2HP5A 4QB8A 4L0LA 2Y2IA 1OTBA 4ZBEA 2B18A 1VEUA 3L9KA 4OPRA 4CLCB 2V8FA 3S4XA 4NXBA 3PBQA 4HOIA 4X56A 1NJ4A 3D72A 3IH9A 4WLAA 4GDNA 5FQ9A 4RX3A 2ZMAA 1NRFA 1LSXA 4I38A 4BENA 3T4TA 4JXGA 3NIAA 3R4KA 2L1MA 5F69A 2K7SA 4JGPA 3TE8A 3CZDA 1SDNA 3PBSA 3KSHA 1ES3A 3ZCZA 3T4OA 4GD6A 3EGDC 5E2FA 3VFHA 3ZHHA 3BLMA 3ZDJA 4MN5A 1TS0A 4OLGA 2AVXA 1NY0A 3D9YA 5M1AA 2FH5A 4HH2A 1K56A 4RX2A 1KGFA 3VP3A 2VGLM 3H7WB 2HJ9C 1IKGA 2Y2OA 1STZA 3DTKA 2ZQAA 5AJGA 4YOFA 3W4PA 1P97A 2HDRA 4WEJA 3FPVA 3BLSA 3S7PA 2JKGA 3KYZA 2EFXA 2ZBBA 3PBRA 2A49A 2KOIA 1FQGA 1JTDA 4DJ3A 3LIDA 5CRFA 2V2FF 3LCEA 5GLBA 1W5DA 3PHYA 3UMDA 4JPMA 4LCMA 3AGFA 5TBMB 4R4SA 3UDIA 4CJNA 1XJ6A 4HESA 2ZM2A 4Y3IA 2B02A 3KYEA 4C6YA 1EROA 3T4KA 4PMAA 4KUKA 1TF1A 4GNUA 4Y0OA 2W3HA 4X53A 2PAVP 4EWFA 2ZL1A 3UE3A 4DRTA 4BMWA 4OVDA 4FTXA 5DJTA 2VJWA 4UAAA 2VV6A 2EXBA 4BBTA 2EWWA 3GQZA 4R4RA 2P7JA 3NI9A 3ZG5A 5HZHA 3HLDA 2Y91A 1ZTUA 4OQHA 3C2WA 3G32A 2C5WB 5AQBA 4OQ0A 5HARA 2XGNA 4GB7A 1EW0A 3MQQA 3BFFA 4E04A 3EQUA 1WA9A 3T4LA 3DAVA 1YLJA 4IUKA 4DDYA 4GZBA 3VE4A 1DP9A 4B4XA 3HJIA 1D1JA 5DTTA 1G28A 2ZC5B 5FASA 1YLWA 3IF6B 5K5BA 3G31A 2VV7A 4PM8A 4U0TA 5TGFA 4E3LA 1J9MA 3CMZA 2W3EA 2XA7S 4Y0UA 5DF8A 2JKRM 4GD8A 4II7A 3E4OA 4WELA 2GJ3A 1XFNA 1S0WA 4I3AA 4LFUA 1GA0A 4BL3A 4DKIA 3WRZA 3MFDA 5J8XA 4PAUA 4X68A 5DF9A 3UPOA 2PHYA 3SS5A 4Y2FA 1FSYA 5F83A 3ITAA 1F9IA 2VA0A 4NXGA 1DJBA 2XQZA 2P9VA 2ZJ9A 3HUOA 4MBHA 3AGDA 2XH9A 1XGJA 5CERA 3LR3A 3Q7ZA 1TDGA 5E43A 4D2OA 1ERQA 2WKQA 3R7WB 3LY4A 1N4OA 1WE4A 2HP9A 3ZVTA 1BLHA 1ACFA 4BD1A 4IBXA 3C4PA 4ZJ1A 5HAPA 1S67L 1SDEA 1DY6A 3O87A 2K31A 3R7WA 1KOUA 4F94A 4JF5A 1EWZA 4G3VA 4O01A 4X6TA 4EETB 4E3OA 3M2JA 1GHIA 3BFCA 3MMHA 1N9BA 4UHUA 1PZOA 2Z2LB 3HBRA 4JGOA 1PYYA 3MZFA 1Y4OA 2OSUA 2HZ5A 4QJGA 3A0SA 1S4SA 3G2YA 4ZJ2A 2QJ5A 4D60A 2V8CA 4LV2A 2IWDA 1W8YA 1BYWA 3RTYA 4CLCE 2G2WA 3SW1A 3S7QA 2PR6A 3TSGA 3E0YA 2ZOIA 3WS5A 2A24B 1E3UA 4HP4A 4NG2A 2LB9A 4XUZA 1RCJA 2EFUA 4DE0A 3KX0X 1DP8A 3BYDA 4MN6A 1ZG4A 1KVLA 2WZXA 1IYSA 3UO9A 2Y4AA 3G35A 4WZ4A 4FD8A 3FV7A 3IWOA 3NULA 3T12B 3PXPA 2J9PA 4X1LA 1L0FA 3CPTA 2WKIA 4EW7A 5A91A 3E98A 1YLPA 4E6XA 3GV9A 4KUOA 3BQ8A 2VEAA 3VFFA 3MXSA 5C5KA 5G4ZA 3ZG7B 1JWVA 3ZYTA 5FDSA 3PYPA 4G3KA 3A3DA 2WAEA 1XJ2A 3MBZA 3W8KA 5FA7A 3QP4A 4ARZA 1HZOA 2XRNA 4XUXA 3HLGA 3TOIA 5CGXA 3HVFA 5F6AA 2WK0A 2YKFA 5CX7A 5JYOA 3DTMA 2QYBA 4EBPA 4K0XA 1KVMA 4QPRA 4Y15A 3IXGA 3LUQA 4MCWA 4L9GA 4H8RA 2MJ6A 1W63Q 1OTIA 3CJMA 5HD3A 1QMFA 1T18A 5CEDA 5HL1A 5HWWA 2WGIA 3IWQA 3ZG9B 1KDWA 2O9CA 3GTCA 1XFQA 4HJ4A 3T4QA 3ZGAB 4WEKA 3WS1A 4S2IA 1LL9A 3VSKA 5I94A 3L7HA 1JWZA 4S2KA 2I9VA 2B95A 1PW8A 1YPRA 4Y7PA 3LFVA 1ERMA 4WM9A 3DW0A 5HDDA 1WYCA 2V20A 5CGWA 3LR4A 5F1FA 2W3FA 5JYPA 5DKKA 4MBFA 2ZQ7A 4DE1A 4RA7A 2PYRA 3ZNTA 4O7DA 5BOHA 1XJ4A 1G68A 4GLQA 2EXAA 4DN0A 4Q0JA 4R6LA 2JKTM 5DJUA 2ZC3B 3CAXA 4K08A 1SKOB 5CXWA 3NOTC 3IF5A 3A3EA 4LENA 4EUVA 2V0UA 3KSIA 4BD0A 1FCOA 1XA7A 1MWUA 4IVKA 4BLMA 3B3XA 1MPLA 1TS7A 4GDBA 1MKIA 4GHIA 2V9AA 3T4SA 2ZOHA 1E3UD 3UY6A 1L2SA 5IT5A 1OT6A 3EQVA 3C7UA 1AWIA 3EGXC 3H82A 5FAPA 4WZ5A 3LIBA 4QY6A 3IX8A 4KG6A 2UWXA 1L0DA 4Q0HA 2HP6A 4E3MA 2HDUA 3WRTA 1U60A 4DXCA 4WZ5C 3TG9A 3HLEA 3PTEA 5DTKA 3K3CA 1I2WA 4PM5A 5FEGA 1MC0A 2OOLA 3OCLA 3P7NA 3M6HA 4LRYC 3VV4A 5FI2A 3F1PB 5A8BA 3BWLA 5CTMA 4Q0IA 2WKPA 2O99A 1OTDA 2HPBA 2ZMFA 4HQAA 3HUMA 3Q7VA 1ES5A 1GSVA 3ZFZA 1VEUB 2OLUA 2Y2JA 3NHQA 3O5YA 2WAFA 3E2LA 3RFBA 5HAIA 4JXWA 2BTFP 3QP2A 3BFGA 2W3GA 2Y59A 3BM6A 3B42A 5IHVA 1G6AA 1F98A 2XD5A 2X02A 2ZC7A 1LSVA 3GR2A 3FWLA 5CGSA 4B4ZA 1G6OA 3ZQ5A 3P09A 1TS8A 2B5RA 1XPBA 3GRJA 1FILA 3ZG8B 1XP4A 2P08A 4R3AA 1W8QA 1P9WA 3AGEA 1V9ZA 3VE3A 1S6RA 3N6IA 1DRMA 1EI5A 1MXOA 4JF4A 5A92A 1HVBA 1NYYA 4R70A 5HL6A 1K54A 4OONA 4I39A 2PT7A 1K4EA 2H0YA 1W7FA 3NY4A 5EM1A 1V9YA 2K2NA 4UEYA 5AQAA 4LV1A 5AVEA 1K54C 1YT4A 3Q82A 5CTNA 2VGLS 2XEPA 4X1MA 4I5SA 1W63M 3VMAA 4HJ3A 3QHYA 3EEAA 1NLYA 5KZHA 1PFLA 4OQGA 3HLFA 1I2SA 3HLWA 4OPQA 1OTAA 1G5UA 2J9OA 1QMEA 3E4PA 1H8ZA 2QPNA 5E2EA 3S1YA 3UE1A 3N7WA 3P98A 4GCZA 2ZL1B 1GCEA 5IS1A 1LL5A 4KG5A 4HHDA 1LI9A 3W4OA 5FQJA 1XGIA 3C7VA 2W1RA 3LI8A 1MWTA 3BW6A 4YINA 2V1BA 3JYIA 2RCXA 5EVLA 2VK3A 1Q2PA 4B88A 2M7UA 1FCNA 1K6RA 4GW9A 4GJ4A 4GN2A 2OLVA 2ZC4B 3IT9A 3PAGA 3CUEA 4OKPA 2PRFA 4WYYA 5GL9A 4CPKA 5FL3A 3LI9A 5DKLA 3FKWA 1PZPA 2E8JA 5FQKA 3CUEC 4EV4A 5FDHA 3V3SA 4RQ9A 3QP8A 2XF3A 2DMWA 4JBFA 5HWTA 3LIAA 3OCNA 3JVUA 4OOYA 3DWKA 5FATA 3LY3A 5U47A 5DF7A 1KE0A 2DNSA 3HCYA 2ZLYA 3T1SA 1WYBA 3CITA 3IXDA 2P9VB 3SZTA 4MN7A 2Z6DA 3KSFA 3GVBA 4P87A 5L8MA 3O3VA 2YKHA 2ZQDA 2P74A 4KQDA 2ZQCA 4ZJ3A 3IHAA 1YAXA 3UE0A 1TVFA 5J7EA 2W1TB 4ID4A 3I7JA 3E2KA 4HH3A 3ICYA 1HD8A 2A2LA 2Y8HA 2CC1A 3CI6A 4K91A 2CMNA 4DE3A 3IQAA 5FQIA 2J3TD 1K55A 1FIKA 3A0RA 3DBAA 1BULA 2WKEA 2X01A 4GS9A 4HP9A 4R1GA 1KE4A 1PWDA 2W27A 3MKEA 2JN7A 1K55C 3MQ0A 2W1TA 2Y79A 5CEBA 2R78A 1K56D 3E4QA 1DP6A 4XT2B 4R3JA 3IS2A 3NC8A 4GKUA 1M40A 3GDIA 4BBVA 3WWXA 1P9RA 5EM0A 4ZDXA 2XR0A 4KZ6A 4MEZA 2JKFA 3EEHA 4HNBA 4DMZA 1CQAA 1BTLA 1VHMA 3NOUC 2WYXA 4XT2A 2G2UA 2ZMVA 4JGRA 4P6ZS 1XKZA 3WS2A 2H0TA 1OPXA 4P85A 4S2LA 1NZOA 5E2HA 1PNEA 4UA9A 1DJAA 5EVIA 5FQQA 1Z6FA 2VLGA 1UGUA 3TJZC 1H5XA 3K3DA 3T1RA 1JNUA 1GHMA 1XJ3A 3F1OA 4HBTA 1VETA 1JTGA 2Y2HA 1OT9A 3MZEA 3CPTB 2GZAA 3OZHA 1FCMA 1N9NA 1SHVA 4Y13A 4MNRA 1JWPA 5L09A 3HJKA 2EX9A 2QKPA 1T1AA 1MZUA 4I3IA 1PI5A 4LPZA 1DJCA 2L4RA 2FZ0A 2P04A 4ARZB 4DXBA 3LIEA 5MC7A 3VOLA 5KSHA 4Q8IA 5L10A 3U2AA 1ZHHB 5HWVA 5A93A 3CLOA 4N1XA 3V5MA 3TRCA 3LR0A 4OP8A 4DDSA 4GOGA 2IWBA 1OJGA 2O9BA 1IKIA 1F2KA 1D06A 4KQQA 2J80A 5AQ7A 1YSPA 1JVJA 2JHEA 1NWZA 1O07A 2OWHA 3MR0A 2HF6A 4YFMA 2IA2A 4NEED 1K57A 1YLZA 4UQIM 1C3BA 4EBLA 5HW3A 1S1ZA 2HDQA 4KZ8A 4R38A 1S1YA 1K4FA 3M2KA 1AXBA 2Y2GA 4HBUA 4OPZA 3D4FA 1P0ZA 2HGVA 3K2NA 1RGZA 4IHQA 3B47A 4ESPA 4S2PA 4S2JA 3MJQA 4DF6A 1XX2A 4LGWA 2EX8A 3A3FA 4EU0A 1YM1A 2UV0E 3B33A 3PBOA 2ZD8A 1GHPA 4FOFA 4NETA 2Y2MA 4MDZA 5GLDA 1YSQA 4GHIB 2QMIA 4ZTKA 4N1HA 1BT5A 3EWKA 1LSWA 4G3WA 4HEFA 5D3OA 3UPPA 4IBRA 2INWA 3H82B 3G2ZA 5HD5A 4S2OA 3C30A 4NKPA 2JE5A 2EX6A 3DTEA 1LL8A 3BY8A 4LV0A 2DCFA 2JBFA 3JPUA 4IVIA 5KIZA 4JLFA 4EEUA 4JGQA 4EESA 5GLAA 4I3JA 2M1CA 3C38A 3FZCA 2ZM0A 1OMEA 3OBFA 1A0KA 5EUAA 1IOUA 4KENB 1H0MA 4LLOB 5DTSA 2XROA 3G4PA 1YLTA 2Y55A 4E3JA 3F1NA 5CHUA 3G30A 1X0OA 3LO7A 3MS6A 3Q7VB 2Y2QA 4FSFA 1YKDA 3BECA 3HLCA 3MKFA 5HAQA 2WGWA 2PR5A 3P01A 4PM7A 4U3TA 1FOFA 4Y0TA 4IUHA 3FPWA 3ULFA 5L2FA 5LBRA 4E3KA 4C3QA 4E3NA 3FYZA 3BFEA 3N4IA 1ES2A 3RH8B 3RJUA 3NDGA 4HY8A 2Q9NA 2Q0OA 2A3UA 5AQ9A 1K38A 2PYPA 4ME4A 5GHXA 2XFTA 5FEFA 2BASA 5TFQA 2ZC6B 1LI0A 3Q81A 1Q2QA 4PM6A 1N9LA 2XK1A 4P6BA 2PBDP 2XLNA 2PD7A 4PPRA 1H8YA 4QY5A 4N92A 4BJPA 2JCHA 2C6WB 1FSWA 3KO6A 3IWIA 4XXRA 1IELA 1IYPA 2VGKA 3VP2A 3O88A 2GNXA 3A3JA 4M3KA 1IYOA 2X71A 4YNRA 2V1AA 4DE2A 3S22A 2ZQ9A 4YWZA 5EOEA 2NUPC 1GSXA 4KZ4A 2JC7A 1T19A 5FQMA 2I72A 4H6JA 5DVAA 2WUQA 4F3LA 5F68A 3IBJA 3BY9A 1RP5A 1MY8A 3FKVA 3IX4A 1K0KA 4R0QA 2O0YA 3N8LA 2J3TC 2VKSA 3MFXA 3OPLA 3VOZA 1K6SA 1ONHA 3MXQA 4CLCA 4LV3A 4DJ2A 2XDMA 4U0XA 4NK3A 3WS0A 4LRXC 1W79A 1UWNX 5HX9A 3HUNA 3W4QA 4CLCC 3S7OA 4FH2A 4NXFA 5FI6A 1E4DA 2LB5A 3GECA 3UN7A 2PDRA 2H5SA 3UB9A 3QP1A 2PU2A 3CHWP 2ZQ8A 3U4LP 2WGVA 1CI8A 3BJNA 2H28A 5HFOA 1HLUP 2XFSA 3V3RA 3IXHA 4EEPA 1S66L 3W2ZA 2Q9MA 3QP5A 1ONGA 2ACGA 1XA1A 2VV8A 3IX3A 2FFYA 2QWSA 1PI4A 1T1CA 2GDNA 3H7WA 2XSSA 1CI9A 5FSRA 2JKRI 4K0WA 1YMXA 1Z09A 4WN5A 5E2GA 3SOIA 3OOVA 1PWGA 3MQOA 5KSCA 1PW1A 4BBUA 5FAOA 3LEQA 3UDFA 3LYXA 2E8IA 3UPNA 4OOLA 4KZ3A 5TBMA 2KLIA 2J8YA 4WF0A 1CEGA 1KDSA 1NLZA 2L0WA 1O7EA 4RVAA 1SZVA 4EBNA 2Y2PA 4N9LA 4NXEA 3PR6A 3Q07A 1LLBA 4OP5A 4FUWA 4L9EA 1UWPX 4Z1WA 1E25A 1MKMA 4FCFA 5M18A 1BLCA 3QP6A 2VGJA 3KYQA 2PBYA 3LGOA 1MWSA 4HJ6A 2QJ7A 4GS9B 2HDSA 1PIOA 5HDSA 4L9FA 3IHBA 2IWCA 2OAQ1 3ZVWA 4JKTA 1VB6A 2XA7M 4Y5FA 4KG2A 3DTIA 3V50A 1BUEA 3ITBA 1J3WA 3A0VA 5CECA 3NCKA 2Y2KA 3IF6A 1SCWA 3IS2B 1LT0A 4MLLA 1MWRA 4WUJA 1KGGA 4OOMA 2EA9A 3M6BA 3N8RA 5EVEA 2R9XA 3IF6C 3NECA 3UNWA 4CLCD 1CK3A 4EUZA 5EECA 4KQRA 2D02A 4O0PA 1YLYA 5DFYA 2VX8A 5FAQA 4OH0A 3VP0A 3EOIA 3SH7A 5EVIB 1ESIA 2QHKA 3D3OA 3V39A 4S2NA 2EX2A 4BWIA 3FG8A 2QZ6A 1FR1A 1YQSA 2HJEA 4KZBA 4QD4A 4QU3A 3F1OB 5EPHA 1VETB 4ZRRA 4JXVA 3BFDA 3Q1FA 2O9AA 1CEFA 4IJGA 4BL2A 4S2NC 2BG1A 2Z2MB 3MF0A 5TJJA 2Z6CA 4JF6A 3HREA 4PKYG 4OLDA 3QNCA 4M4XA 4EQ1A 3UB7A 2V1ZA 1BLPA 3A3IA 3T1XA 1KGEA 1NZUA 1L0GA 3UMEA 3OLOA 4OQIA 4WL9A 5EVIC 4P6ZM 1S4RA 5GHYA 3VP1A 3MSHA 3MXRA 3LR5A 2V0WA 1I5QA 3SS4A 3LEZA 1ALQA 3SH9A 1TD5A 1N9OA 2D01A 2EWVA 4Y17A 3UB8A 3OC2A 3NBLA 4BQMA 3SH8A 3UB6A 1TEMA 2WZZA 5G4YA 4EERA 4PHTA 4AFIA 3HL9A 3T4JA 1L0EA 2J3WA 2H10A 2A24A 4FH4A 3FC7A 3BQAA 4OPYA 3IBRA 3T50A 3G34A 4QHCA 2PD8A 5KMWA 2KX6A 4CQHA 4ETXA 5A90A 2DRWA 3GMWA 2W0NA 4N9KA 1VQQA 5I5LA 3IH8A 4UQIS 1VM1A 1MBLA 4R3BA 4C75A 1OTEA 3BRMA 4X25A 1ZC2A 3C8CA 2HV1A
chains in the Genus database with same CATH topology
2PR5A 3P01A 2JKTI 4IUHA 3FPWA 3ULFA 5LBRA 4GCZA 5HPIA 5IS1A 2VZWA 4HIAA 4HHDA 3RH8B 1S67L 4HY8A 2M7VA 2NUTC 2K31A 2W1RA 2PYPA 3LI8A 4ME4A 5HDCA 4HI4A 3R7WA 3BW6A 1KOUA 2V1BA 3TW8A 4KQOA 4EXOA 3NJAA 1ODVA 4G3VA 4O01A 4EETB 2BASA 2M7UA 1H8MA 3MMHA 4GW9A 4GJ4A 2OWJA 1N9LA 3JVVA 3CUEA 2PD7A 4JGOA 4BJPA 3V67A 5J3WA 3KO6A 4B93A 5FL3A 3LI9A 3A0SA 1S4SA 5DKLA 2QJ5A 5AVFA 4PKYA 3CUEC 2WKRA 2GNXA 1BYWA 3RTYA 4CLCE 4YNRA 3SW1A 5EFWA 3S7QA 2PR6A 2V1AA 3E0YA 3H9WA 2ZOIA 4RQ9A 4YWZA 3PBTA 2NUPC 2A24B 1GSXA 3NOPC 4HP4A 2DMWA 5HWTA 2LB9A 1T19A 3LIAA 3OCNA 3JVUA 3KX0X 4H6JA 1DP8A 4F3LA 5F68A 3IBJA 3BY9A 4LRZE 4MN6A 4B9OA 3HCYA 1T1BA 3CITA 2O0YA 3F1NB 2J3TC 2GX5A 4MN7A 2VKSA 3KSGA 3MFXA 2Z6DA 3KSFA 5HSQA 1NRJA 3MXQA 4CLCA 5L8MA 4DJ2A 1TS6A 4O8GA 1Y28A 3PXPA 2YKHA 4KQDA 4LRXC 1YAXA 2W3DA 4EW7A 5J7EA 1UWNX 3E98A 2W1TB 4CLCC 2G7UA 4KUOA 3BQ8A 2VEAA 4HH3A 3ICYA 3S7OA 2A2LA 1GSWA 4NXFA 2Y8HA 5C5KA 3CI6A 2CMNA 5G4ZA 2KDKA 2LB5A 2J3TD 3G6OA 3GECA 3A0RA 2PDRA 3DBAA 1H3QA 3ZYTA 5IU1A 3PYPA 4G3KA 1XJ2A 4GS9A 4HP9A 3UB9A 5J4EA 2W27A 4ARZA 2JN7A 3LICA 5HPFA 5DFXA 2XRNA 3MQ0A 2W1TA 1IFQA 3BJNA 2H28A 2Y79A 2OAP1 3S7NA 1F5MA 5F6AA 4EEPA 2R78A 1S66L 3W2ZA 2YKFA 5CX7A 3E4QA 1DP6A 4XT2B 2QYBA 2VV8A 3IS2A 4QPRA 3LUQA 4MCWA 2QWSA 4L9GA 3H7WA 1T1CA 2MJ6A 2XSSA 1W63Q 3GDIA 3CWFA 1OTIA 4BBVA 5HD3A 2JKRI 1T18A 1P9RA 5HWWA 4MMNA 2O9CA 1OJ5A 4WN5A 3OOVA 4ETZA 3EEHA 4HNBA 4DMZA 3MQOA 1XFQA 1VHMA 4HJ4A 5F5YA 3NOUC 4BBUA 3T4QA 3LIFA 4XT2A 2ZMVA 4JGRA 4WEKA 4P6ZS 4H6JB 3LYXA 4F3LB 2I9VA 1OPXA 1D7EA 4OOLA 3F1PA 3LFVA 3UE6A 5HDDA 3PBNA 5TBMA 2KLIA 4WF0A 2VLGA 1UGUA 3TJZC 4L0LA 1NLZA 3LR4A 2L0WA 2W3FA 3K3DA 1OTBA 2B18A 5DKKA 1JNUA 1XJ3A 3F1OA 4CLCB 2PYRA 4NXEA 3PBQA 4HOIA 4NXBA 3D72A 1OT9A 3PR6A 4WLAA 1XJ4A 2GZAA 4GLQA 4DN0A 4Q0JA 1N9NA 4R6LA 2JKTM 5DJUA 3CAXA 4K08A 3HJKA 4L9EA 1UWPX 2QKPA 4Z1WA 1MKMA 3NOTC 1LSXA 4I38A 1T1AA 4EUVA 2V0UA 3KSIA 1MZUA 4I3IA 3T4TA 3R4KA 3KYQA 2L1MA 4LPZA 5F69A 4HJ6A 2K7SA 4JGPA 3TE8A 1TS7A 3PBSA 2L4RA 2QJ7A 3KSHA 4GS9B 5HDSA 2FZ0A 2P04A 4L9FA 3T4OA 4ARZB 3EGDC 3LIEA 5MC7A 3VOLA 4GHIA 2V9AA 5KSHA 2OAQ1 3T4SA 2ZOHA 1VB6A 2XA7M 4Y5FA 3U2AA 1ZHHB 4MN5A 1TS0A 5HWVA 5IT5A 1OT6A 3EQVA 3CLOA 2FH5A 3A0VA 4HH2A 3EGXC 3H82A 3TRCA 3IS2B 1LT0A 3LIBA 3LR0A 2VGLM 3H7WB 2HJ9C 1STZA 5AJGA 4YOFA 1OJGA 2O9BA 1P97A 4WEJA 3FPVA 4WUJA 4Q0HA 4OOMA 3S7PA 1D06A 2EA9A 3KYZA 2ZBBA 3PBRA 2J80A 1YSPA 2KOIA 2JHEA 4CLCD 1NWZA 2OWHA 4DJ3A 3K3CA 3MR0A 2HF6A 3LIDA 2IA2A 4NEED 1MC0A 2OOLA 3OCLA 4UQIM 3P7NA 2D02A 4O0PA 5DFYA 1S1ZA 2VX8A 4LRYC 3VV4A 3PHYA 3EOIA 3UMDA 4R38A 1S1YA 3F1PB 5A8BA 3BWLA 4Q0IA 5TBMB 2WKPA 1XJ6A 2QHKA 3D3OA 2O99A 1OTDA 4Y3IA 2ZMFA 3FG8A 4BWIA 2B02A 4HQAA 1P0ZA 1GSVA 2HGVA 2HJEA 3K2NA 3T4KA 3NHQA 3O5YA 3F1OB 4IHQA 4ZRRA 4KUKA 3RFBA 1TF1A 3B47A 2O9AA 4IJGA 2W3HA 2W3GA 3MF0A 5TJJA 3B42A 2Z6CA 1F98A 3UE3A 3MJQA 1LSVA 4PKYG 4BMWA 5DJTA 2VJWA 4M4XA 4EQ1A 3UB7A 2VV6A 4BBTA 2EWWA 1G6OA 3ZQ5A 2P7JA 5HZHA 1TS8A 1ZTUA 4EU0A 3C2WA 3UMEA 3B33A 3PBOA 4FOFA 3OLOA 4WL9A 1EW0A 3MQQA 4MDZA 4P6ZM 4E04A 1S4RA 3EQUA 1WA9A 1YSQA 2P08A 4R3AA 3T4LA 4GHIB 4IUKA 1P9WA 1V9ZA 3LR5A 3VE4A 2V0WA 1DP9A 3HJIA 3VE3A 3EWKA 1LSWA 4G3WA 1TD5A 1G28A 1N9OA 1DRMA 2D01A 5K5BA 2EWVA 2INWA 3H82B 2VV7A 3UB8A 3OC2A 4R70A 5HL6A 5HD5A 3C30A 4I39A 2PT7A 3UB6A 2W3EA 4NKPA 2XA7S 1LL8A 5G4YA 3BY8A 4PHTA 4AFIA 4EERA 3T4JA 2JKRM 4II7A 1V9YA 3E4OA 4WELA 2K2NA 2J3WA 2GJ3A 4UEYA 1XFNA 2A24A 5AVEA 3FC7A 4I3AA 3BQAA 2VGLS 5KIZA 4I5SA 1W63M 4EEUA 4HJ3A 3IBRA 4JGQA 4EESA 3T50A 4I3JA 4PAUA 5DF9A 2M1CA 3C38A 3EEAA 1NLYA 2PHYA 3OBFA 2PD8A 2KX6A 1IOUA 4CQHA 4LLOB 4ETXA 1OTAA 4Y2FA 2XROA 2W0NA 1F9IA 2VA0A 4NXGA 5I5LA 3F1NA 1X0OA 3E4PA 4UQIS 3LR3A 4FSFA 1YKDA 1OTEA 2WKQA 3R7WB 3C8CA 2HV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PR5 A;  3ULF A;  4GCZ A;  5IS1 A;  4HIA A;  4HHD A;  3RH8 B;  1S67 L;  4HY8 A;  2PYP A;  3LI8 A;  5HDC A;  4HI4 A;  1KOU A;  2V1B A;  4EXO A;  3NJA A;  1ODV A;  4EET B;  2BAS A;  4GW9 A;  2OWJ A;  1N9L A;  2PD7 A;  4JGO A;  5J3W A;  3LI9 A;  3A0S A;  1S4S A;  5DKL A;  2QJ5 A;  5AVF A;  4PKY A;  2WKR A;  1BYW A;  3RTY A;  3SW1 A;  5EFW A;  2PR6 A;  2V1A A;  3H9W A;  2ZOI A;  4RQ9 A;  4YWZ A;  2A24 B;  1GSX A;  3NOP C;  4HP4 A;  5HWT A;  1T19 A;  3LIA A;  3KX0 X;  4H6J A;  1DP8 A;  4F3L A;  5F68 A;  3BY9 A;  4LRZ E;  4MN6 A;  4B9O A;  1T1B A;  3F1N B;  3MFX A;  2Z6D A;  5HSQ A;  3MXQ A;  4DJ2 A;  1TS6 A;  1Y28 A;  2YKH A;  4KQD A;  4LRX C;  4EW7 A;  5J7E A;  1UWN X;  4KUO A;  2VEA A;  4HH3 A;  3ICY A;  1GSW A;  4NXF A;  2CMN A;  5G4Z A;  2KDK A;  3G6O A;  3GEC A;  3A0R A;  2PDR A;  5IU1 A;  3PYP A;  1XJ2 A;  4GS9 A;  4HP9 A;  3UB9 A;  5J4E A;  2W27 A;  2JN7 A;  3LIC A;  2H28 A;  5F6A A;  4EEP A;  2R78 A;  1S66 L;  2YKF A;  3E4Q A;  1DP6 A;  4XT2 B;  2VV8 A;  3IS2 A;  3LUQ A;  2QWS A;  4L9G A;  3H7W A;  1T1C A;  3GDI A;  3CWF A;  1OTI A;  4BBV A;  5HD3 A;  1T18 A;  5HWW A;  1OJ5 A;  4WN5 A;  3EEH A;  4HNB A;  3MQO A;  1XFQ A;  4HJ4 A;  5F5Y A;  3NOU C;  4BBU A;  3LIF A;  4XT2 A;  4JGR A;  4H6J B;  3LYX A;  4F3L B;  2I9V A;  1D7E A;  3F1P A;  3UE6 A;  5HDD A;  5TBM A;  4WF0 A;  2VLG A;  1UGU A;  2L0W A;  3K3D A;  1OTB A;  5DKK A;  1JNU A;  1XJ3 A;  3F1O A;  2PYR A;  4NXB A;  4NXE A;  4HOI A;  3D72 A;  1OT9 A;  4WLA A;  1XJ4 A;  4R6L A;  1N9N A;  5DJU A;  3CAX A;  4K08 A;  3HJK A;  4L9E A;  1UWP X;  2QKP A;  3NOT C;  1LSX A;  4I38 A;  1T1A A;  2V0U A;  1MZU A;  4I3I A;  4LPZ A;  2L1M A;  5F69 A;  4HJ6 A;  2K7S A;  4JGP A;  1TS7 A;  2L4R A;  2QJ7 A;  4GS9 B;  5HDS A;  4L9F A;  3LIE A;  3VOL A;  4GHI A;  2V9A A;  2ZOH A;  1VB6 A;  4MN5 A;  1TS0 A;  5HWV A;  1OT6 A;  3CLO A;  4HH2 A;  3A0V A;  3H82 A;  3IS2 B;  1LT0 A;  3LIB A;  3H7W B;  1OJG A;  1P97 A;  4WUJ A;  1D06 A;  2EA9 A;  2ZBB A;  2J80 A;  2JHE A;  1NWZ A;  2OWH A;  4DJ3 A;  3K3C A;  3MR0 A;  3LID A;  2OOL A;  3P7N A;  2D02 A;  1S1Z A;  4LRY C;  3PHY A;  3UMD A;  4R38 A;  1S1Y A;  3F1P B;  5A8B A;  3BWL A;  5TBM B;  2WKP A;  1XJ6 A;  2QHK A;  1OTD A;  3FG8 A;  2B02 A;  4HQA A;  1P0Z A;  1GSV A;  3NHQ A;  3F1O B;  4KUK A;  2Z6C A;  1F98 A;  3MJQ A;  1LSV A;  4PKY G;  5DJT A;  4M4X A;  4EQ1 A;  3UB7 A;  2VV6 A;  4BBT A;  3ZQ5 A;  2P7J A;  5HZH A;  1TS8 A;  3C2W A;  3UME A;  3B33 A;  3OLO A;  4WL9 A;  1EW0 A;  3MQQ A;  4E04 A;  1S4R A;  1WA9 A;  4R3A A;  4GHI B;  1V9Z A;  3VE4 A;  2V0W A;  1DP9 A;  3HJI A;  3VE3 A;  3EWK A;  1LSW A;  1G28 A;  1N9O A;  1DRM A;  2D01 A;  2INW A;  3H82 B;  2VV7 A;  3UB8 A;  4R70 A;  5HD5 A;  4I39 A;  3UB6 A;  1LL8 A;  5G4Y A;  3BY8 A;  4EER A;  1V9Y A;  3E4O A;  2GJ3 A;  1XFN A;  2A24 A;  5AVE A;  3FC7 A;  4I3A A;  5KIZ A;  4I5S A;  4EEU A;  4HJ3 A;  3IBR A;  4JGQ A;  4EES A;  3T50 A;  4I3J A;  2M1C A;  2PHY A;  2PD8 A;  2KX6 A;  4LLO B;  1OTA A;  2W0N A;  1F9I A;  4NXG A;  5I5L A;  3F1N A;  1X0O A;  3E4P A;  1OTE A;  2WKQ A;  3C8C A;  2HV1 A; 
#chains in the Genus database with same CATH topology
 3ZNY A;  2JKT I;  4IED A;  1PWC A;  5HPI A;  3MZD A;  1K57 C;  4WMC A;  2VZW A;  4HIA A;  4R23 A;  5CHM A;  4PM9 A;  2M7V A;  2NUT C;  3C4O A;  5F1G A;  5G18 A;  5HDC A;  4HI4 A;  1CF0 A;  1ESU A;  4WBG A;  3TW8 A;  4KQO A;  4EXO A;  2WKH A;  3NJA A;  1ODV A;  1K25 A;  1CJF A;  2Y2L A;  1NYM A;  1H8M A;  2OWJ A;  2PU4 A;  3IXB A;  3JVV A;  1NXY A;  4Z9Q A;  3V67 A;  1BSG A;  5J3W A;  3VOY A;  3VSL A;  4UA6 A;  4B93 A;  5GHZ A;  1RGY A;  5AVF A;  4PKY A;  3T1Q B;  2WKR A;  3UB5 P;  3NDE A;  4QWO A;  3C5A A;  5F82 A;  3OPR A;  5EFW A;  3CG5 A;  3PAE A;  1ES4 A;  3H9W A;  3PBT A;  3WS4 A;  1KE3 A;  1LHY A;  4X55 A;  3NOP C;  4EQI A;  3ISG A;  5CHJ A;  4KZ5 A;  3VP4 A;  4UA7 A;  4X69 A;  3RXW A;  4RYE A;  5EV0 A;  1ZG6 A;  2RL3 A;  2ZM8 A;  4LRZ E;  1Y54 A;  5L07 A;  5EVI D;  3SS3 A;  4B9O A;  5M19 A;  4JXS A;  1T1B A;  1TDL A;  2WAD A;  1PRQ A;  3RXX A;  3F1N B;  2GX5 A;  2OV5 A;  3KSG A;  3O86 A;  5HSQ A;  1NRJ A;  1L3L A;  1TS6 A;  4O8G A;  4ZAM A;  2BLS A;  1Y28 A;  3OPH A;  1FR6 A;  2WGW B;  2W3D A;  2G7U A;  2J7V A;  4MBK A;  1XXM A;  1SKO A;  5EE8 A;  1GSW A;  1BZA A;  5EOO A;  2KDK A;  3G6O A;  1H3Q A;  4KZA A;  5IU1 A;  3QNB A;  5J4E A;  2Y2N A;  1IEM A;  5GLC A;  3N8S A;  4E6W A;  3LIC A;  5HPF A;  5DFX A;  1YMS A;  3OPP A;  1IFQ A;  2OAP 1;  3S7N A;  1IYQ A;  4A5R A;  1F5M A;  3HLB A;  3UDX A;  3ZG0 A;  4E3I A;  1ZKJ A;  3GSG A;  3CWF A;  4S2M A;  5TR7 A;  4P0M A;  4MMN A;  1M6K A;  3BEB A;  1OJ5 A;  2R9W A;  4ETZ A;  1GA9 A;  5F5Y A;  3LIF A;  1HTZ A;  4H6J B;  5FI7 A;  4LCL A;  3DWZ A;  4F3L B;  1SKF A;  2FFF B;  4WMC D;  1D7E A;  2XD1 A;  4KZ7 A;  3F1P A;  3UE6 A;  4KZ9 A;  3PBN A;  1BLS A;  2HP5 A;  4QB8 A;  4L0L A;  2Y2I A;  1OTB A;  4ZBE A;  2B18 A;  1VEU A;  3L9K A;  4OPR A;  4CLC B;  2V8F A;  3S4X A;  4NXB A;  3PBQ A;  4HOI A;  4X56 A;  1NJ4 A;  3D72 A;  3IH9 A;  4WLA A;  4GDN A;  5FQ9 A;  4RX3 A;  2ZMA A;  1NRF A;  1LSX A;  4I38 A;  4BEN A;  3T4T A;  4JXG A;  3NIA A;  3R4K A;  2L1M A;  5F69 A;  2K7S A;  4JGP A;  3TE8 A;  3CZD A;  1SDN A;  3PBS A;  3KSH A;  1ES3 A;  3ZCZ A;  3T4O A;  4GD6 A;  3EGD C;  5E2F A;  3VFH A;  3ZHH A;  3BLM A;  3ZDJ A;  4MN5 A;  1TS0 A;  4OLG A;  2AVX A;  1NY0 A;  3D9Y A;  5M1A A;  2FH5 A;  4HH2 A;  1K56 A;  4RX2 A;  1KGF A;  3VP3 A;  2VGL M;  3H7W B;  2HJ9 C;  1IKG A;  2Y2O A;  1STZ A;  3DTK A;  2ZQA A;  5AJG A;  4YOF A;  3W4P A;  1P97 A;  2HDR A;  4WEJ A;  3FPV A;  3BLS A;  3S7P A;  2JKG A;  3KYZ A;  2EFX A;  2ZBB A;  3PBR A;  2A49 A;  2KOI A;  1FQG A;  1JTD A;  4DJ3 A;  3LID A;  5CRF A;  2V2F F;  3LCE A;  5GLB A;  1W5D A;  3PHY A;  3UMD A;  4JPM A;  4LCM A;  3AGF A;  5TBM B;  4R4S A;  3UDI A;  4CJN A;  1XJ6 A;  4HES A;  2ZM2 A;  4Y3I A;  2B02 A;  3KYE A;  4C6Y A;  1ERO A;  3T4K A;  4PMA A;  4KUK A;  1TF1 A;  4GNU A;  4Y0O A;  2W3H A;  4X53 A;  2PAV P;  4EWF A;  2ZL1 A;  3UE3 A;  4DRT A;  4BMW A;  4OVD A;  4FTX A;  5DJT A;  2VJW A;  4UAA A;  2VV6 A;  2EXB A;  4BBT A;  2EWW A;  3GQZ A;  4R4R A;  2P7J A;  3NI9 A;  3ZG5 A;  5HZH A;  3HLD A;  2Y91 A;  1ZTU A;  4OQH A;  3C2W A;  3G32 A;  2C5W B;  5AQB A;  4OQ0 A;  5HAR A;  2XGN A;  4GB7 A;  1EW0 A;  3MQQ A;  3BFF A;  4E04 A;  3EQU A;  1WA9 A;  3T4L A;  3DAV A;  1YLJ A;  4IUK A;  4DDY A;  4GZB A;  3VE4 A;  1DP9 A;  4B4X A;  3HJI A;  1D1J A;  5DTT A;  1G28 A;  2ZC5 B;  5FAS A;  1YLW A;  3IF6 B;  5K5B A;  3G31 A;  2VV7 A;  4PM8 A;  4U0T A;  5TGF A;  4E3L A;  1J9M A;  3CMZ A;  2W3E A;  2XA7 S;  4Y0U A;  5DF8 A;  2JKR M;  4GD8 A;  4II7 A;  3E4O A;  4WEL A;  2GJ3 A;  1XFN A;  1S0W A;  4I3A A;  4LFU A;  1GA0 A;  4BL3 A;  4DKI A;  3WRZ A;  3MFD A;  5J8X A;  4PAU A;  4X68 A;  5DF9 A;  3UPO A;  2PHY A;  3SS5 A;  4Y2F A;  1FSY A;  5F83 A;  3ITA A;  1F9I A;  2VA0 A;  4NXG A;  1DJB A;  2XQZ A;  2P9V A;  2ZJ9 A;  3HUO A;  4MBH A;  3AGD A;  2XH9 A;  1XGJ A;  5CER A;  3LR3 A;  3Q7Z A;  1TDG A;  5E43 A;  4D2O A;  1ERQ A;  2WKQ A;  3R7W B;  3LY4 A;  1N4O A;  1WE4 A;  2HP9 A;  3ZVT A;  1BLH A;  1ACF A;  4BD1 A;  4IBX A;  3C4P A;  4ZJ1 A;  5HAP A;  1S67 L;  1SDE A;  1DY6 A;  3O87 A;  2K31 A;  3R7W A;  1KOU A;  4F94 A;  4JF5 A;  1EWZ A;  4G3V A;  4O01 A;  4X6T A;  4EET B;  4E3O A;  3M2J A;  1GHI A;  3BFC A;  3MMH A;  1N9B A;  4UHU A;  1PZO A;  2Z2L B;  3HBR A;  4JGO A;  1PYY A;  3MZF A;  1Y4O A;  2OSU A;  2HZ5 A;  4QJG A;  3A0S A;  1S4S A;  3G2Y A;  4ZJ2 A;  2QJ5 A;  4D60 A;  2V8C A;  4LV2 A;  2IWD A;  1W8Y A;  1BYW A;  3RTY A;  4CLC E;  2G2W A;  3SW1 A;  3S7Q A;  2PR6 A;  3TSG A;  3E0Y A;  2ZOI A;  3WS5 A;  2A24 B;  1E3U A;  4HP4 A;  4NG2 A;  2LB9 A;  4XUZ A;  1RCJ A;  2EFU A;  4DE0 A;  3KX0 X;  1DP8 A;  3BYD A;  4MN6 A;  1ZG4 A;  1KVL A;  2WZX A;  1IYS A;  3UO9 A;  2Y4A A;  3G35 A;  4WZ4 A;  4FD8 A;  3FV7 A;  3IWO A;  3NUL A;  3T12 B;  3PXP A;  2J9P A;  4X1L A;  1L0F A;  3CPT A;  2WKI A;  4EW7 A;  5A91 A;  3E98 A;  1YLP A;  4E6X A;  3GV9 A;  4KUO A;  3BQ8 A;  2VEA A;  3VFF A;  3MXS A;  5C5K A;  5G4Z A;  3ZG7 B;  1JWV A;  3ZYT A;  5FDS A;  3PYP A;  4G3K A;  3A3D A;  2WAE A;  1XJ2 A;  3MBZ A;  3W8K A;  5FA7 A;  3QP4 A;  4ARZ A;  1HZO A;  2XRN A;  4XUX A;  3HLG A;  3TOI A;  5CGX A;  3HVF A;  5F6A A;  2WK0 A;  2YKF A;  5CX7 A;  5JYO A;  3DTM A;  2QYB A;  4EBP A;  4K0X A;  1KVM A;  4QPR A;  4Y15 A;  3IXG A;  3LUQ A;  4MCW A;  4L9G A;  4H8R A;  2MJ6 A;  1W63 Q;  1OTI A;  3CJM A;  5HD3 A;  1QMF A;  1T18 A;  5CED A;  5HL1 A;  5HWW A;  2WGI A;  3IWQ A;  3ZG9 B;  1KDW A;  2O9C A;  3GTC A;  1XFQ A;  4HJ4 A;  3T4Q A;  3ZGA B;  4WEK A;  3WS1 A;  4S2I A;  1LL9 A;  3VSK A;  5I94 A;  3L7H A;  1JWZ A;  4S2K A;  2I9V A;  2B95 A;  1PW8 A;  1YPR A;  4Y7P A;  3LFV A;  1ERM A;  4WM9 A;  3DW0 A;  5HDD A;  1WYC A;  2V20 A;  5CGW A;  3LR4 A;  5F1F A;  2W3F A;  5JYP A;  5DKK A;  4MBF A;  2ZQ7 A;  4DE1 A;  4RA7 A;  2PYR A;  3ZNT A;  4O7D A;  5BOH A;  1XJ4 A;  1G68 A;  4GLQ A;  2EXA A;  4DN0 A;  4Q0J A;  4R6L A;  2JKT M;  5DJU A;  2ZC3 B;  3CAX A;  4K08 A;  1SKO B;  5CXW A;  3NOT C;  3IF5 A;  3A3E A;  4LEN A;  4EUV A;  2V0U A;  3KSI A;  4BD0 A;  1FCO A;  1XA7 A;  1MWU A;  4IVK A;  4BLM A;  3B3X A;  1MPL A;  1TS7 A;  4GDB A;  1MKI A;  4GHI A;  2V9A A;  3T4S A;  2ZOH A;  1E3U D;  3UY6 A;  1L2S A;  5IT5 A;  1OT6 A;  3EQV A;  3C7U A;  1AWI A;  3EGX C;  3H82 A;  5FAP A;  4WZ5 A;  3LIB A;  4QY6 A;  3IX8 A;  4KG6 A;  2UWX A;  1L0D A;  4Q0H A;  2HP6 A;  4E3M A;  2HDU A;  3WRT A;  1U60 A;  4DXC A;  4WZ5 C;  3TG9 A;  3HLE A;  3PTE A;  5DTK A;  3K3C A;  1I2W A;  4PM5 A;  5FEG A;  1MC0 A;  2OOL A;  3OCL A;  3P7N A;  3M6H A;  4LRY C;  3VV4 A;  5FI2 A;  3F1P B;  5A8B A;  3BWL A;  5CTM A;  4Q0I A;  2WKP A;  2O99 A;  1OTD A;  2HPB A;  2ZMF A;  4HQA A;  3HUM A;  3Q7V A;  1ES5 A;  1GSV A;  3ZFZ A;  1VEU B;  2OLU A;  2Y2J A;  3NHQ A;  3O5Y A;  2WAF A;  3E2L A;  3RFB A;  5HAI A;  4JXW A;  2BTF P;  3QP2 A;  3BFG A;  2W3G A;  2Y59 A;  3BM6 A;  3B42 A;  5IHV A;  1G6A A;  1F98 A;  2XD5 A;  2X02 A;  2ZC7 A;  1LSV A;  3GR2 A;  3FWL A;  5CGS A;  4B4Z A;  1G6O A;  3ZQ5 A;  3P09 A;  1TS8 A;  2B5R A;  1XPB A;  3GRJ A;  1FIL A;  3ZG8 B;  1XP4 A;  2P08 A;  4R3A A;  1W8Q A;  1P9W A;  3AGE A;  1V9Z A;  3VE3 A;  1S6R A;  3N6I A;  1DRM A;  1EI5 A;  1MXO A;  4JF4 A;  5A92 A;  1HVB A;  1NYY A;  4R70 A;  5HL6 A;  1K54 A;  4OON A;  4I39 A;  2PT7 A;  1K4E A;  2H0Y A;  1W7F A;  3NY4 A;  5EM1 A;  1V9Y A;  2K2N A;  4UEY A;  5AQA A;  4LV1 A;  5AVE A;  1K54 C;  1YT4 A;  3Q82 A;  5CTN A;  2VGL S;  2XEP A;  4X1M A;  4I5S A;  1W63 M;  3VMA A;  4HJ3 A;  3QHY A;  3EEA A;  1NLY A;  5KZH A;  1PFL A;  4OQG A;  3HLF A;  1I2S A;  3HLW A;  4OPQ A;  1OTA A;  1G5U A;  2J9O A;  1QME A;  3E4P A;  1H8Z A;  2QPN A;  5E2E A;  3S1Y A;  3UE1 A;  3N7W A;  3P98 A;  4GCZ A;  2ZL1 B;  1GCE A;  5IS1 A;  1LL5 A;  4KG5 A;  4HHD A;  1LI9 A;  3W4O A;  5FQJ A;  1XGI A;  3C7V A;  2W1R A;  3LI8 A;  1MWT A;  3BW6 A;  4YIN A;  2V1B A;  3JYI A;  2RCX A;  5EVL A;  2VK3 A;  1Q2P A;  4B88 A;  2M7U A;  1FCN A;  1K6R A;  4GW9 A;  4GJ4 A;  4GN2 A;  2OLV A;  2ZC4 B;  3IT9 A;  3PAG A;  3CUE A;  4OKP A;  2PRF A;  4WYY A;  5GL9 A;  4CPK A;  5FL3 A;  3LI9 A;  5DKL A;  3FKW A;  1PZP A;  2E8J A;  5FQK A;  3CUE C;  4EV4 A;  5FDH A;  3V3S A;  4RQ9 A;  3QP8 A;  2XF3 A;  2DMW A;  4JBF A;  5HWT A;  3LIA A;  3OCN A;  3JVU A;  4OOY A;  3DWK A;  5FAT A;  3LY3 A;  5U47 A;  5DF7 A;  1KE0 A;  2DNS A;  3HCY A;  2ZLY A;  3T1S A;  1WYB A;  3CIT A;  3IXD A;  2P9V B;  3SZT A;  4MN7 A;  2Z6D A;  3KSF A;  3GVB A;  4P87 A;  5L8M A;  3O3V A;  2YKH A;  2ZQD A;  2P74 A;  4KQD A;  2ZQC A;  4ZJ3 A;  3IHA A;  1YAX A;  3UE0 A;  1TVF A;  5J7E A;  2W1T B;  4ID4 A;  3I7J A;  3E2K A;  4HH3 A;  3ICY A;  1HD8 A;  2A2L A;  2Y8H A;  2CC1 A;  3CI6 A;  4K91 A;  2CMN A;  4DE3 A;  3IQA A;  5FQI A;  2J3T D;  1K55 A;  1FIK A;  3A0R A;  3DBA A;  1BUL A;  2WKE A;  2X01 A;  4GS9 A;  4HP9 A;  4R1G A;  1KE4 A;  1PWD A;  2W27 A;  3MKE A;  2JN7 A;  1K55 C;  3MQ0 A;  2W1T A;  2Y79 A;  5CEB A;  2R78 A;  1K56 D;  3E4Q A;  1DP6 A;  4XT2 B;  4R3J A;  3IS2 A;  3NC8 A;  4GKU A;  1M40 A;  3GDI A;  4BBV A;  3WWX A;  1P9R A;  5EM0 A;  4ZDX A;  2XR0 A;  4KZ6 A;  4MEZ A;  2JKF A;  3EEH A;  4HNB A;  4DMZ A;  1CQA A;  1BTL A;  1VHM A;  3NOU C;  2WYX A;  4XT2 A;  2G2U A;  2ZMV A;  4JGR A;  4P6Z S;  1XKZ A;  3WS2 A;  2H0T A;  1OPX A;  4P85 A;  4S2L A;  1NZO A;  5E2H A;  1PNE A;  4UA9 A;  1DJA A;  5EVI A;  5FQQ A;  1Z6F A;  2VLG A;  1UGU A;  3TJZ C;  1H5X A;  3K3D A;  3T1R A;  1JNU A;  1GHM A;  1XJ3 A;  3F1O A;  4HBT A;  1VET A;  1JTG A;  2Y2H A;  1OT9 A;  3MZE A;  3CPT B;  2GZA A;  3OZH A;  1FCM A;  1N9N A;  1SHV A;  4Y13 A;  4MNR A;  1JWP A;  5L09 A;  3HJK A;  2EX9 A;  2QKP A;  1T1A A;  1MZU A;  4I3I A;  1PI5 A;  4LPZ A;  1DJC A;  2L4R A;  2FZ0 A;  2P04 A;  4ARZ B;  4DXB A;  3LIE A;  5MC7 A;  3VOL A;  5KSH A;  4Q8I A;  5L10 A;  3U2A A;  1ZHH B;  5HWV A;  5A93 A;  3CLO A;  4N1X A;  3V5M A;  3TRC A;  3LR0 A;  4OP8 A;  4DDS A;  4GOG A;  2IWB A;  1OJG A;  2O9B A;  1IKI A;  1F2K A;  1D06 A;  4KQQ A;  2J80 A;  5AQ7 A;  1YSP A;  1JVJ A;  2JHE A;  1NWZ A;  1O07 A;  2OWH A;  3MR0 A;  2HF6 A;  4YFM A;  2IA2 A;  4NEE D;  1K57 A;  1YLZ A;  4UQI M;  1C3B A;  4EBL A;  5HW3 A;  1S1Z A;  2HDQ A;  4KZ8 A;  4R38 A;  1S1Y A;  1K4F A;  3M2K A;  1AXB A;  2Y2G A;  4HBU A;  4OPZ A;  3D4F A;  1P0Z A;  2HGV A;  3K2N A;  1RGZ A;  4IHQ A;  3B47 A;  4ESP A;  4S2P A;  4S2J A;  3MJQ A;  4DF6 A;  1XX2 A;  4LGW A;  2EX8 A;  3A3F A;  4EU0 A;  1YM1 A;  2UV0 E;  3B33 A;  3PBO A;  2ZD8 A;  1GHP A;  4FOF A;  4NET A;  2Y2M A;  4MDZ A;  5GLD A;  1YSQ A;  4GHI B;  2QMI A;  4ZTK A;  4N1H A;  1BT5 A;  3EWK A;  1LSW A;  4G3W A;  4HEF A;  5D3O A;  3UPP A;  4IBR A;  2INW A;  3H82 B;  3G2Z A;  5HD5 A;  4S2O A;  3C30 A;  4NKP A;  2JE5 A;  2EX6 A;  3DTE A;  1LL8 A;  3BY8 A;  4LV0 A;  2DCF A;  2JBF A;  3JPU A;  4IVI A;  5KIZ A;  4JLF A;  4EEU A;  4JGQ A;  4EES A;  5GLA A;  4I3J A;  2M1C A;  3C38 A;  3FZC A;  2ZM0 A;  1OME A;  3OBF A;  1A0K A;  5EUA A;  1IOU A;  4KEN B;  1H0M A;  4LLO B;  5DTS A;  2XRO A;  3G4P A;  1YLT A;  2Y55 A;  4E3J A;  3F1N A;  5CHU A;  3G30 A;  1X0O A;  3LO7 A;  3MS6 A;  3Q7V B;  2Y2Q A;  4FSF A;  1YKD A;  3BEC A;  3HLC A;  3MKF A;  5HAQ A;  2WGW A;  2PR5 A;  3P01 A;  4PM7 A;  4U3T A;  1FOF A;  4Y0T A;  4IUH A;  3FPW A;  3ULF A;  5L2F A;  5LBR A;  4E3K A;  4C3Q A;  4E3N A;  3FYZ A;  3BFE A;  3N4I A;  1ES2 A;  3RH8 B;  3RJU A;  3NDG A;  4HY8 A;  2Q9N A;  2Q0O A;  2A3U A;  5AQ9 A;  1K38 A;  2PYP A;  4ME4 A;  5GHX A;  2XFT A;  5FEF A;  2BAS A;  5TFQ A;  2ZC6 B;  1LI0 A;  3Q81 A;  1Q2Q A;  4PM6 A;  1N9L A;  2XK1 A;  4P6B A;  2PBD P;  2XLN A;  2PD7 A;  4PPR A;  1H8Y A;  4QY5 A;  4N92 A;  4BJP A;  2JCH A;  2C6W B;  1FSW A;  3KO6 A;  3IWI A;  4XXR A;  1IEL A;  1IYP A;  2VGK A;  3VP2 A;  3O88 A;  2GNX A;  3A3J A;  4M3K A;  1IYO A;  2X71 A;  4YNR A;  2V1A A;  4DE2 A;  3S22 A;  2ZQ9 A;  4YWZ A;  5EOE A;  2NUP C;  1GSX A;  4KZ4 A;  2JC7 A;  1T19 A;  5FQM A;  2I72 A;  4H6J A;  5DVA A;  2WUQ A;  4F3L A;  5F68 A;  3IBJ A;  3BY9 A;  1RP5 A;  1MY8 A;  3FKV A;  3IX4 A;  1K0K A;  4R0Q A;  2O0Y A;  3N8L A;  2J3T C;  2VKS A;  3MFX A;  3OPL A;  3VOZ A;  1K6S A;  1ONH A;  3MXQ A;  4CLC A;  4LV3 A;  4DJ2 A;  2XDM A;  4U0X A;  4NK3 A;  3WS0 A;  4LRX C;  1W79 A;  1UWN X;  5HX9 A;  3HUN A;  3W4Q A;  4CLC C;  3S7O A;  4FH2 A;  4NXF A;  5FI6 A;  1E4D A;  2LB5 A;  3GEC A;  3UN7 A;  2PDR A;  2H5S A;  3UB9 A;  3QP1 A;  2PU2 A;  3CHW P;  2ZQ8 A;  3U4L P;  2WGV A;  1CI8 A;  3BJN A;  2H28 A;  5HFO A;  1HLU P;  2XFS A;  3V3R A;  3IXH A;  4EEP A;  1S66 L;  3W2Z A;  2Q9M A;  3QP5 A;  1ONG A;  2ACG A;  1XA1 A;  2VV8 A;  3IX3 A;  2FFY A;  2QWS A;  1PI4 A;  1T1C A;  2GDN A;  3H7W A;  2XSS A;  1CI9 A;  5FSR A;  2JKR I;  4K0W A;  1YMX A;  1Z09 A;  4WN5 A;  5E2G A;  3SOI A;  3OOV A;  1PWG A;  3MQO A;  5KSC A;  1PW1 A;  4BBU A;  5FAO A;  3LEQ A;  3UDF A;  3LYX A;  2E8I A;  3UPN A;  4OOL A;  4KZ3 A;  5TBM A;  2KLI A;  2J8Y A;  4WF0 A;  1CEG A;  1KDS A;  1NLZ A;  2L0W A;  1O7E A;  4RVA A;  1SZV A;  4EBN A;  2Y2P A;  4N9L A;  4NXE A;  3PR6 A;  3Q07 A;  1LLB A;  4OP5 A;  4FUW A;  4L9E A;  1UWP X;  4Z1W A;  1E25 A;  1MKM A;  4FCF A;  5M18 A;  1BLC A;  3QP6 A;  2VGJ A;  3KYQ A;  2PBY A;  3LGO A;  1MWS A;  4HJ6 A;  2QJ7 A;  4GS9 B;  2HDS A;  1PIO A;  5HDS A;  4L9F A;  3IHB A;  2IWC A;  2OAQ 1;  3ZVW A;  4JKT A;  1VB6 A;  2XA7 M;  4Y5F A;  4KG2 A;  3DTI A;  3V50 A;  1BUE A;  3ITB A;  1J3W A;  3A0V A;  5CEC A;  3NCK A;  2Y2K A;  3IF6 A;  1SCW A;  3IS2 B;  1LT0 A;  4MLL A;  1MWR A;  4WUJ A;  1KGG A;  4OOM A;  2EA9 A;  3M6B A;  3N8R A;  5EVE A;  2R9X A;  3IF6 C;  3NEC A;  3UNW A;  4CLC D;  1CK3 A;  4EUZ A;  5EEC A;  4KQR A;  2D02 A;  4O0P A;  1YLY A;  5DFY A;  2VX8 A;  5FAQ A;  4OH0 A;  3VP0 A;  3EOI A;  3SH7 A;  5EVI B;  1ESI A;  2QHK A;  3D3O A;  3V39 A;  4S2N A;  2EX2 A;  4BWI A;  3FG8 A;  2QZ6 A;  1FR1 A;  1YQS A;  2HJE A;  4KZB A;  4QD4 A;  4QU3 A;  3F1O B;  5EPH A;  1VET B;  4ZRR A;  4JXV A;  3BFD A;  3Q1F A;  2O9A A;  1CEF A;  4IJG A;  4BL2 A;  4S2N C;  2BG1 A;  2Z2M B;  3MF0 A;  5TJJ A;  2Z6C A;  4JF6 A;  3HRE A;  4PKY G;  4OLD A;  3QNC A;  4M4X A;  4EQ1 A;  3UB7 A;  2V1Z A;  1BLP A;  3A3I A;  3T1X A;  1KGE A;  1NZU A;  1L0G A;  3UME A;  3OLO A;  4OQI A;  4WL9 A;  5EVI C;  4P6Z M;  1S4R A;  5GHY A;  3VP1 A;  3MSH A;  3MXR A;  3LR5 A;  2V0W A;  1I5Q A;  3SS4 A;  3LEZ A;  1ALQ A;  3SH9 A;  1TD5 A;  1N9O A;  2D01 A;  2EWV A;  4Y17 A;  3UB8 A;  3OC2 A;  3NBL A;  4BQM A;  3SH8 A;  3UB6 A;  1TEM A;  2WZZ A;  5G4Y A;  4EER A;  4PHT A;  4AFI A;  3HL9 A;  3T4J A;  1L0E A;  2J3W A;  2H10 A;  2A24 A;  4FH4 A;  3FC7 A;  3BQA A;  4OPY A;  3IBR A;  3T50 A;  3G34 A;  4QHC A;  2PD8 A;  5KMW A;  2KX6 A;  4CQH A;  4ETX A;  5A90 A;  2DRW A;  3GMW A;  2W0N A;  4N9K A;  1VQQ A;  5I5L A;  3IH8 A;  4UQI S;  1VM1 A;  1MBL A;  4R3B A;  4C75 A;  1OTE A;  3BRM A;  4X25 A;  1ZC2 A;  3C8C A;  2HV1 A; 
#chains in the Genus database with same CATH homology
 2PR5 A;  3P01 A;  2JKT I;  4IUH A;  3FPW A;  3ULF A;  5LBR A;  4GCZ A;  5HPI A;  5IS1 A;  2VZW A;  4HIA A;  4HHD A;  3RH8 B;  1S67 L;  4HY8 A;  2M7V A;  2NUT C;  2K31 A;  2W1R A;  2PYP A;  3LI8 A;  4ME4 A;  5HDC A;  4HI4 A;  3R7W A;  3BW6 A;  1KOU A;  2V1B A;  3TW8 A;  4KQO A;  4EXO A;  3NJA A;  1ODV A;  4G3V A;  4O01 A;  4EET B;  2BAS A;  2M7U A;  1H8M A;  3MMH A;  4GW9 A;  4GJ4 A;  2OWJ A;  1N9L A;  3JVV A;  3CUE A;  2PD7 A;  4JGO A;  4BJP A;  3V67 A;  5J3W A;  3KO6 A;  4B93 A;  5FL3 A;  3LI9 A;  3A0S A;  1S4S A;  5DKL A;  2QJ5 A;  5AVF A;  4PKY A;  3CUE C;  2WKR A;  2GNX A;  1BYW A;  3RTY A;  4CLC E;  4YNR A;  3SW1 A;  5EFW A;  3S7Q A;  2PR6 A;  2V1A A;  3E0Y A;  3H9W A;  2ZOI A;  4RQ9 A;  4YWZ A;  3PBT A;  2NUP C;  2A24 B;  1GSX A;  3NOP C;  4HP4 A;  2DMW A;  5HWT A;  2LB9 A;  1T19 A;  3LIA A;  3OCN A;  3JVU A;  3KX0 X;  4H6J A;  1DP8 A;  4F3L A;  5F68 A;  3IBJ A;  3BY9 A;  4LRZ E;  4MN6 A;  4B9O A;  3HCY A;  1T1B A;  3CIT A;  2O0Y A;  3F1N B;  2J3T C;  2GX5 A;  4MN7 A;  2VKS A;  3KSG A;  3MFX A;  2Z6D A;  3KSF A;  5HSQ A;  1NRJ A;  3MXQ A;  4CLC A;  5L8M A;  4DJ2 A;  1TS6 A;  4O8G A;  1Y28 A;  3PXP A;  2YKH A;  4KQD A;  4LRX C;  1YAX A;  2W3D A;  4EW7 A;  5J7E A;  1UWN X;  3E98 A;  2W1T B;  4CLC C;  2G7U A;  4KUO A;  3BQ8 A;  2VEA A;  4HH3 A;  3ICY A;  3S7O A;  2A2L A;  1GSW A;  4NXF A;  2Y8H A;  5C5K A;  3CI6 A;  2CMN A;  5G4Z A;  2KDK A;  2LB5 A;  2J3T D;  3G6O A;  3GEC A;  3A0R A;  2PDR A;  3DBA A;  1H3Q A;  3ZYT A;  5IU1 A;  3PYP A;  4G3K A;  1XJ2 A;  4GS9 A;  4HP9 A;  3UB9 A;  5J4E A;  2W27 A;  4ARZ A;  2JN7 A;  3LIC A;  5HPF A;  5DFX A;  2XRN A;  3MQ0 A;  2W1T A;  1IFQ A;  3BJN A;  2H28 A;  2Y79 A;  2OAP 1;  3S7N A;  1F5M A;  5F6A A;  4EEP A;  2R78 A;  1S66 L;  3W2Z A;  2YKF A;  5CX7 A;  3E4Q A;  1DP6 A;  4XT2 B;  2QYB A;  2VV8 A;  3IS2 A;  4QPR A;  3LUQ A;  4MCW A;  2QWS A;  4L9G A;  3H7W A;  1T1C A;  2MJ6 A;  2XSS A;  1W63 Q;  3GDI A;  3CWF A;  1OTI A;  4BBV A;  5HD3 A;  2JKR I;  1T18 A;  1P9R A;  5HWW A;  4MMN A;  2O9C A;  1OJ5 A;  4WN5 A;  3OOV A;  4ETZ A;  3EEH A;  4HNB A;  4DMZ A;  3MQO A;  1XFQ A;  1VHM A;  4HJ4 A;  5F5Y A;  3NOU C;  4BBU A;  3T4Q A;  3LIF A;  4XT2 A;  2ZMV A;  4JGR A;  4WEK A;  4P6Z S;  4H6J B;  3LYX A;  4F3L B;  2I9V A;  1OPX A;  1D7E A;  4OOL A;  3F1P A;  3LFV A;  3UE6 A;  5HDD A;  3PBN A;  5TBM A;  2KLI A;  4WF0 A;  2VLG A;  1UGU A;  3TJZ C;  4L0L A;  1NLZ A;  3LR4 A;  2L0W A;  2W3F A;  3K3D A;  1OTB A;  2B18 A;  5DKK A;  1JNU A;  1XJ3 A;  3F1O A;  4CLC B;  2PYR A;  4NXE A;  3PBQ A;  4HOI A;  4NXB A;  3D72 A;  1OT9 A;  3PR6 A;  4WLA A;  1XJ4 A;  2GZA A;  4GLQ A;  4DN0 A;  4Q0J A;  1N9N A;  4R6L A;  2JKT M;  5DJU A;  3CAX A;  4K08 A;  3HJK A;  4L9E A;  1UWP X;  2QKP A;  4Z1W A;  1MKM A;  3NOT C;  1LSX A;  4I38 A;  1T1A A;  4EUV A;  2V0U A;  3KSI A;  1MZU A;  4I3I A;  3T4T A;  3R4K A;  3KYQ A;  2L1M A;  4LPZ A;  5F69 A;  4HJ6 A;  2K7S A;  4JGP A;  3TE8 A;  1TS7 A;  3PBS A;  2L4R A;  2QJ7 A;  3KSH A;  4GS9 B;  5HDS A;  2FZ0 A;  2P04 A;  4L9F A;  3T4O A;  4ARZ B;  3EGD C;  3LIE A;  5MC7 A;  3VOL A;  4GHI A;  2V9A A;  5KSH A;  2OAQ 1;  3T4S A;  2ZOH A;  1VB6 A;  2XA7 M;  4Y5F A;  3U2A A;  1ZHH B;  4MN5 A;  1TS0 A;  5HWV A;  5IT5 A;  1OT6 A;  3EQV A;  3CLO A;  2FH5 A;  3A0V A;  4HH2 A;  3EGX C;  3H82 A;  3TRC A;  3IS2 B;  1LT0 A;  3LIB A;  3LR0 A;  2VGL M;  3H7W B;  2HJ9 C;  1STZ A;  5AJG A;  4YOF A;  1OJG A;  2O9B A;  1P97 A;  4WEJ A;  3FPV A;  4WUJ A;  4Q0H A;  4OOM A;  3S7P A;  1D06 A;  2EA9 A;  3KYZ A;  2ZBB A;  3PBR A;  2J80 A;  1YSP A;  2KOI A;  2JHE A;  4CLC D;  1NWZ A;  2OWH A;  4DJ3 A;  3K3C A;  3MR0 A;  2HF6 A;  3LID A;  2IA2 A;  4NEE D;  1MC0 A;  2OOL A;  3OCL A;  4UQI M;  3P7N A;  2D02 A;  4O0P A;  5DFY A;  1S1Z A;  2VX8 A;  4LRY C;  3VV4 A;  3PHY A;  3EOI A;  3UMD A;  4R38 A;  1S1Y A;  3F1P B;  5A8B A;  3BWL A;  4Q0I A;  5TBM B;  2WKP A;  1XJ6 A;  2QHK A;  3D3O A;  2O99 A;  1OTD A;  4Y3I A;  2ZMF A;  3FG8 A;  4BWI A;  2B02 A;  4HQA A;  1P0Z A;  1GSV A;  2HGV A;  2HJE A;  3K2N A;  3T4K A;  3NHQ A;  3O5Y A;  3F1O B;  4IHQ A;  4ZRR A;  4KUK A;  3RFB A;  1TF1 A;  3B47 A;  2O9A A;  4IJG A;  2W3H A;  2W3G A;  3MF0 A;  5TJJ A;  3B42 A;  2Z6C A;  1F98 A;  3UE3 A;  3MJQ A;  1LSV A;  4PKY G;  4BMW A;  5DJT A;  2VJW A;  4M4X A;  4EQ1 A;  3UB7 A;  2VV6 A;  4BBT A;  2EWW A;  1G6O A;  3ZQ5 A;  2P7J A;  5HZH A;  1TS8 A;  1ZTU A;  4EU0 A;  3C2W A;  3UME A;  3B33 A;  3PBO A;  4FOF A;  3OLO A;  4WL9 A;  1EW0 A;  3MQQ A;  4MDZ A;  4P6Z M;  4E04 A;  1S4R A;  3EQU A;  1WA9 A;  1YSQ A;  2P08 A;  4R3A A;  3T4L A;  4GHI B;  4IUK A;  1P9W A;  1V9Z A;  3LR5 A;  3VE4 A;  2V0W A;  1DP9 A;  3HJI A;  3VE3 A;  3EWK A;  1LSW A;  4G3W A;  1TD5 A;  1G28 A;  1N9O A;  1DRM A;  2D01 A;  5K5B A;  2EWV A;  2INW A;  3H82 B;  2VV7 A;  3UB8 A;  3OC2 A;  4R70 A;  5HL6 A;  5HD5 A;  3C30 A;  4I39 A;  2PT7 A;  3UB6 A;  2W3E A;  4NKP A;  2XA7 S;  1LL8 A;  5G4Y A;  3BY8 A;  4PHT A;  4AFI A;  4EER A;  3T4J A;  2JKR M;  4II7 A;  1V9Y A;  3E4O A;  4WEL A;  2K2N A;  2J3W A;  2GJ3 A;  4UEY A;  1XFN A;  2A24 A;  5AVE A;  3FC7 A;  4I3A A;  3BQA A;  2VGL S;  5KIZ A;  4I5S A;  1W63 M;  4EEU A;  4HJ3 A;  3IBR A;  4JGQ A;  4EES A;  3T50 A;  4I3J A;  4PAU A;  5DF9 A;  2M1C A;  3C38 A;  3EEA A;  1NLY A;  2PHY A;  3OBF A;  2PD8 A;  2KX6 A;  1IOU A;  4CQH A;  4LLO B;  4ETX A;  1OTA A;  4Y2F A;  2XRO A;  2W0N A;  1F9I A;  2VA0 A;  4NXG A;  5I5L A;  3F1N A;  1X0O A;  3E4P A;  4UQI S;  3LR3 A;  4FSF A;  1YKD A;  1OTE A;  2WKQ A;  3R7W B;  3C8C A;  2HV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...