1V9ZA

Crystal structure of the heme pas sensor domain of ec dos (ferrous form)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Heme pas sensor protein
publication title A redox-controlled molecular switch revealed by the crystal structure of a bacterial heme PAS sensor.
pubmed doi rcsb
source organism Escherichia coli
total genus 30
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1v9zA00
5F6AA 1XFQA 2PD8A 1TS0A 4I38A 2VV7A 5F5YA 2W0NA 2V1BA 5HSQA 3K3CA 1ODVA 3H9WA 4JGQA 2K7SA 2L0WA 3E4QA 3FG8A 1N9NA 2OOLA 3C2WA 4JGOA 1UGUA 1TS6A 4BBTA 3MQQA 2W27A 2OWJA 4WL9A 3OLOA 4GCZA 3PHYA 2A24B 1OTEA 1S4RA 2QKPA 4I39A 3UMDA 3RH8B 4RQ9A 3F1PA 1DP8A 3VE3A 5HZHA 4LRYC 4BBVA 4HY8A 5A8BA 5J3WA 4NXGA 4H6JB 5IS1A 3SW1A 1N9OA 4YWZA 5HDDA 3MJQA 1LT0A 1EW0A 1GSXA 4NXEA 1GSWA 3UE6A 3B33A 4KUOA 1P97A 3VOLA 4R3AA 2KDKA 4EEPA 1S1ZA 1T1CA 3ZQ5A 4HQAA 2WKRA 1S1YA 2D01A 4EERA 1OJ5A 4DJ3A 1XJ6A 4NXFA 3H7WA 1X0OA 1D7EA 5TBMA 4GHIB 4R38A 1UWPX 4HH2A 2J80A 4XT2A 4KUKA 4EETB 2ZOIA 4PKYA 4JGPA 3LI8A 4M4XA 3VE4A 2ZOHA 3H82B 3F1NB 5G4ZA 3GDIA 3E4OA 4HHDA 3NOUC 2QWSA 4I3JA 1NWZA 1OTIA 4LRZE 1GSVA 3G6OA 3MQOA 3IBRA 2INWA 4HH3A 5J4EA 2H28A 2YKFA 4HNBA 4WN5A 4EESA 3IS2B 3MFXA 1TS7A 3ICYA 4I3AA 2ZBBA 4MN5A 2PYPA 1V9YA 5HDCA 1VB6A 2A24A 3A0SA 5KIZA 4KQDA 3MXQA 2YKHA 1KOUA 2QHKA 5HWTA 3EEHA 3NOPC 1LSWA 1TS8A 1MZUA 2VV8A 1DP9A 1XJ3A 3HJIA 5DKLA 4I5SA 3LIFA 1OTDA 3D72A 4L9GA 4H6JA 2V0UA 1LL8A 1WA9A 1Y28A 3NHQA 1OT9A 3PYPA 4I3IA 3LUQA 4HJ4A 3UMEA 2WKPA 4WUJA 4F3LB 2EA9A 1UWNX 2JHEA 2Z6DA 3A0VA 1LSVA 4DJ2A 4GS9B 4B9OA 2D02A 2PDRA 3LIEA 3GECA 4BBUA 4HP9A 5DJTA 3UB6A 4EXOA 3UB8A 3LICA 1S4SA 2R78A 4LRXC 1OTBA 2OWHA 3P7NA 4GHIA 5HD3A 2VV6A 3T50A 1XJ2A 4E04A 3F1OB 5F69A 2CMNA 4HI4A 2PHYA 2QJ5A 3BY8A 4NXBA 4LPZA 4HJ6A 3UB7A 4WF0A 2PD7A 3H82A 3F1NA 3FC7A 3NOTC 1G28A 1OT6A 4R6LA 2QJ7A 2Z6CA 1T1BA 2V0WA 3HJKA 4EEUA 1JNUA 5I5LA 3K3DA 4LLOB 3LIDA 3CWFA 3LYXA 2PR6A 4K08A 4EQ1A 2WKQA 5IU1A 4MN6A 2HV1A 3IS2A 4HP4A 5F68A 4JGRA 3LI9A 5EFWA 4HJ3A 3EWKA 1D06A 3F1PB 1T1AA 3CAXA 3BY9A 1BYWA 3MR0A 5AVFA 3RTYA 2PR5A 3UB9A 3LIBA 2KX6A 2I9VA 2PYRA 4HIAA 1LSXA 1DP6A 5HDSA 1S66L 1T18A 1DRMA 2BASA 3ULFA 4L9FA 1S67L 1OTAA 3LIAA 4L9EA 5AVEA 1XFNA 1V9ZA 4HOIA 1F9IA 2P7JA 2JN7A 3CLOA 5HWWA 2M1CA 3NJAA 1OJGA 1N9LA 2GJ3A 3KX0X 4F3LA 2L4RA 3BWLA 5J7EA 2VLGA 3E4PA 5G4YA 2B02A 1P0ZA 3C8CA 3H7WB 4GW9A 4GS9A 4R70A 2VEAA 1T19A 3A0RA 5TBMB 4WLAA 1XJ4A 4PKYG 4EW7A 5HWVA 4XT2B 5DKKA 2V1AA 5DJUA 1F98A 2L1MA 3F1OA 2V9AA 5HD5A
chains in the Genus database with same CATH superfamily
3CUEA 1XFQA 2PD8A 4I38A 1PFLA 1F2KA 4BD0A 2V1BA 3HCYA 4IVKA 4Y13A 1PIOA 5DF8A 1YLPA 4ME4A 1ODVA 3C30A 2K7SA 3QP1A 1MPLA 1N9NA 4RYEA 4B93A 1K55A 1NZUA 2H0TA 2Y55A 1Q2PA 3OCLA 4ZJ1A 2W27A 1YLZA 2JKFA 2OWJA 3OLOA 5AQBA 1CEFA 2FH5A 4BMWA 3PHYA 1N4OA 2QKPA 4I39A 2Y2KA 3ISGA 1FIKA 1BULA 4RQ9A 3O5YA 5MC7A 3DWKA 4PMAA 3VE3A 4IUKA 4S2OA 2V20A 3PR6A 2XRNA 5HZHA 4S2MA 4OP8A 4HY8A 3IWIA 4DXCA 3D4FA 4MBKA 2ZC5B 2W3GA 5IS1A 2O9BA 1XXMA 2GX5A 3KSIA 1KGGA 4OH0A 1LT0A 1GSXA 4NXEA 3OZHA 3HL9A 5GLBA 3T4JA 4WELA 1PW1A 2ZC4B 1HD8A 4Y0UA 2HP6A 2W1TA 4CLCB 1IYQA 1DJAA 3D3OA 2WYXA 2KDKA 4EEPA 2J7VA 1S1ZA 3ZQ5A 3W4QA 3G4PA 2ZC6B 3VP3A 2WKRA 4BQMA 2D01A 4PPRA 4EERA 1OJ5A 1IKGA 4DJ3A 3MKEA 3C7UA 3OCNA 4NXFA 4GN2A 2WUQA 3H7WA 5CGSA 4K0XA 1MWRA 4QY6A 2ZLYA 3TJZC 1E3UD 5TFQA 4GZBA 2WGWB 4OQHA 4R38A 3BQ8A 1PNEA 4LV1A 4XT2A 2A49A 1STZA 4GNUA 2Y2GA 4PKYA 3NCKA 4GLQA 1I2WA 3F1NB 2DNSA 3BFCA 4KZ8A 3NOUC 2HDQA 2W1RA 4ZDXA 3WS1A 2QWSA 1K56A 1GSVA 4P6BA 3OPPA 3MQOA 2R9XA 3WS2A 5J4EA 2GNXA 3CG5A 3T12B 2YKFA 4EESA 4E3IA 4O7DA 4E3KA 1V9YA 2ZQ8A 4KZ7A 4QHCA 5HAPA 2WGIA 5EM1A 3BLSA 1LLBA 4WEJA 5KMWA 3A3IA 3SOIA 5KIZA 2UV0E 1KDSA 2YKHA 2RCXA 3T4OA 4DE2A 4N1HA 2QHKA 2ZM0A 3IHAA 3EEHA 1LSWA 4DE0A 1KE0A 4QU3A 4X1MA 1DP9A 3S7QA 4YNRA 1SDNA 1G68A 3HUNA 4HEFA 1ESUA 3D72A 5E2FA 2B18A 4KZ3A 4NG2A 2E8IA 1L0DA 2WK0A 1H8ZA 2J3TC 1TEMA 3P01A 3PYPA 4ETXA 4F3LB 5E2HA 4CLCA 1CF0A 4CJNA 3DTKA 3A0VA 5CERA 4FH2A 4GS9B 4KZ9A 1XPBA 1RGYA 3CHWP 3Q7VB 1K54A 5DJTA 3UB6A 4DN0A 5EM0A 4QD4A 1OTBA 2VV6A 5FAQA 3T50A 2WGWA 4KZ4A 1ESIA 1XJ2A 4MN7A 1ALQA 4MNRA 5FQQA 1BTLA 5EVID 3BECA 4JF6A 4HJ6A 1VHMA 5DFYA 3UB7A 3E0YA 3F1NA 3FC7A 3NOTC 3UY6A 4DE3A 4BJPA 1S0WA 2O9CA 2Z6CA 3N8RA 1MWTA 5M18A 2X71A 3LEQA 1JNUA 2EWWA 5FDHA 3LIDA 4BL3A 2V8FA 3QNCA 4WZ5A 1YLJA 4Z1WA 3NY4A 4MN6A 1GHPA 3G2YA 1M6KA 2VJWA 3JPUA 4HP4A 2P74A 3V5MA 4JGRA 3WS0A 3NC8A 4BWIA 3LI9A 2Y2OA 1I5QA 1ONHA 3EWKA 2AVXA 2QMIA 3NI9A 5GLDA 3DW0A 4CLCE 1PWCA 1PI5A 1BYWA 2W3FA 5AVFA 3RTYA 4DE1A 2ZMFA 4E3MA 4ZAMA 3V39A 2VGKA 4HIAA 4Q0JA 5CTNA 1DP6A 1PWDA 2A3UA 1T18A 3PBSA 3V3RA 1DRMA 1H5XA 4L9FA 3IF6B 1S67L 4IVIA 3GQZA 4U3TA 4Q8IA 5CGWA 5A90A 4L9EA 2Q9NA 1P9RA 5EVLA 1SHVA 5F83A 1XFNA 1MKIA 4LGWA 1V9ZA 2ACGA 5F1FA 4DXBA 1O7EA 1YLTA 5EOEA 3CLOA 4R23A 5HWWA 1OJGA 4Y0OA 3E2KA 1L3LA 2GJ3A 2VZWA 4F3LA 4R4RA 5EVIB 3SH9A 3BWLA 3MZDA 2VLGA 3HLDA 4X55A 3E4PA 4H8RA 3WWXA 5DTKA 2Y8HA 4M3KA 2Y2MA 4GS9A 2VEAA 3I7JA 1YM1A 3A0RA 3CUEC 4WLAA 2PBDP 1XJ4A 1ERMA 1TD5A 2XLNA 4LCMA 4U0TA 5HPIA 1BSGA 3O86A 3WRTA 1ZTUA 4K0WA 5GHZA 3T4LA 1PW8A 5CRFA 2WZXA 2V9AA 1CK3A 2XSSA 2KLIA 1WE4A 1K55C 5DTTA 4XXRA 2VV7A 3G32A 4D2OA 1MXOA 1SKOB 2ZM8A 4MDZA 3BJNA 4C3QA 4DMZA 4YFMA 4ZRRA 4Y17A 3NIAA 1KVMA 4FSFA 4JGOA 3AGEA 3LR0A 1ES3A 1KE3A 5GLCA 3MQQA 1MWUA 3E2LA 3K2NA 2OSUA 4RX2A 2A24B 3O88A 4BLMA 4MLLA 3OC2A 1DP8A 3V3SA 2A2LA 5FA7A 5FQKA 4EQIA 3GR2A 2MJ6A 5A91A 5EVEA 1JVJA 3PXPA 1EI5A 5A8BA 5J3WA 3W4OA 4BD1A 4OVDA 1AXBA 3B3XA 2Z2MB 1GA9A 3T1XA 4GB7A 3IF6A 3TRCA 3OPHA 4X68A 3HLBA 1BZAA 3FKVA 3UE3A 5IHVA 5CHUA 4NETA 4P87A 2VX8A 3VOLA 4R3AA 2WAFA 5EVIA 4PAUA 2XGNA 4S2NA 2GDNA 4OQ0A 2LB9A 3M6BA 1X0OA 3CPTB 2X01A 4GHIB 2Y2PA 1Q2QA 5LBRA 4HH2A 2J80A 1ZG6A 3FV7A 3SH8A 4KZBA 3KSHA 2IWDA 2OAQ1 1MKMA 1I2SA 3FKWA 1EWZA 4M4XA 4EBLA 3NECA 5G4ZA 3NDGA 2X02A 3C4OA 4OPRA 4Z9QA 4EBNA 4I3JA 4QJGA 1SKOA 1OTIA 2PT7A 5I94A 4LRZE 3VMAA 3IBRA 3L7HA 3LR4A 1KVLA 2H28A 4JXVA 2B5RA 4S2KA 2EX9A 1W8QA 5FAPA 3VFHA 1VB6A 4N1XA 2A24A 1NJ4A 4GDNA 1CEGA 3MXQA 1CI8A 4KG6A 3VSLA 4OOYA 1XJ3A 3V50A 3HJIA 3LFVA 3BYDA 2PU2A 3BFFA 2P9VB 4GDBA 1TF1A 4I5SA 5C5KA 2E8JA 2XDMA 4L9GA 1TDLA 5A93A 4CLCC 3PBTA 2V0UA 3RXWA 3T4SA 1WA9A 3NHQA 4E3JA 3KYEA 4IEDA 3PTEA 1JWZA 3UE0A 4I3IA 2V8CA 3HLFA 3BM6A 3HREA 3W4PA 4HJ4A 3UMEA 1K54C 3IXBA 3W8KA 4WUJA 3N4IA 2EA9A 5L07A 5DF9A 4DDSA 4QWOA 3DTMA 2PBYA 2G2UA 2LB5A 4B4ZA 4FUWA 2EWVA 4IUHA 4CQHA 2XEPA 4S2PA 4PM6A 4X56A 2PDRA 3GECA 4BBUA 3ZHHA 1EROA 5EECA 3UB8A 4GD6A 1DY6A 1HVBA 3CPTA 4LRXC 1KGEA 4GHIA 3WRZA 3UDIA 5HD3A 1MBLA 3EEAA 2XA7M 5DVAA 4E04A 5F69A 2CMNA 4HI4A 4KQQA 3OBFA 5L2FA 4R3JA 4EV4A 4QB8A 5GHXA 4GOGA 4LPZA 4WZ5C 2ZC3B 4MBFA 1FCMA 3Q07A 2J3TD 3GTCA 2WGVA 1G6AA 1YLYA 1T1BA 2OAP1 2V0WA 5I5LA 5FSRA 4FCFA 3IHBA 2VA0A 3SS5A 2PR6A 3O3VA 3HVFA 1MWSA 1KE4A 2EX8A 2J3WA 4UA9A 3A3DA 1GHIA 1CJFA 2EFUA 3SS3A 5F68A 1RGZA 5CX7A 1YKDA 3LCEA 3GSGA 1XA7A 1NXYA 1T1AA 3BY9A 1OMEA 3MR0A 1Y54A 4EWFA 3UB9A 3B42A 2KX6A 4G3VA 3G30A 5HDSA 1S66L 1N9BA 2P9VA 1LHYA 2HPBA 1K57A 1H8MA 3BRMA 4OPYA 3S4XA 3TG9A 2JKTI 4KQOA 3UB5P 1OTAA 5AVEA 2DCFA 2Y2JA 3G35A 2WKEA 3QNBA 3EQUA 5U47A 1FCOA 3WS4A 2G7UA 4LENA 4YOFA 3UDXA 2L4RA 2O99A 5J7EA 3TSGA 2ZL1B 1BLCA 4Y7PA 2XD5A 4R3BA 2QPNA 3VP4A 4R70A 5HL6A 3OPLA 4YINA 4HBUA 5DFXA 3QHYA 5BOHA 3TE8A 2DRWA 3IXHA 4JLFA 2I72A 3ZCZA 5HWVA 4P6ZS 3G34A 2V1AA 3MSHA 5EUAA 4AFIA 4IHQA 3QP4A 3ZYTA 1IFQA 4B88A 5F6AA 2Y2LA 4IBXA 4U0XA 5F1GA 3C38A 3B47A 4ARZB 4QY5A 1FOFA 5F5YA 2HDRA 2W0NA 4C6YA 3K3CA 3H9WA 4XUZA 4JGQA 2VK3A 1L0EA 2L0WA 3E4QA 3QP6A 5E2EA 3CMZA 5CGXA 3FG8A 2OOLA 3C2WA 3SS4A 3HLCA 1L0GA 1UGUA 5DTSA 4KQRA 5JYOA 1TS6A 1LI0A 3SH7A 3ZNYA 5AJGA 2O9AA 3IX8A 4JF4A 4WL9A 1P9WA 3VSKA 3MMHA 2EFXA 4FD8A 1OTEA 3EGDC 1S4RA 4IJGA 2CC1A 3ZNTA 4NKPA 3UPPA 1LL9A 5CXWA 3IF6C 2WKHA 4UHUA 5EOOA 4LRYC 4BBVA 3SZTA 3MKFA 5TJJA 3LR3A 5AQ7A 1JWVA 2QZ6A 4H6JB 1FSYA 3PBRA 3T4TA 1DJBA 1E3UA 5A92A 5EVIC 3SW1A 2JE5A 1N9OA 4ZTKA 4YWZA 5HDDA 2ZC7A 5CHJA 4GKUA 4S2NC 2JKTM 3AGDA 4KUOA 1P97A 2Y4AA 3KYZA 2Q0OA 5HW3A 4P0MA 2HF6A 1ACFA 1NRFA 1S1YA 2M7UA 2ZMAA 4Y0TA 4P6ZM 2PAVP 3Q7VA 2ZL1A 1JTGA 5FL3A 5FASA 4JKTA 4Y2FA 4DRTA 4E6WA 2Y59A 4MEZA 4GJ4A 2W3EA 1IKIA 1FSWA 1YQSA 4KUKA 2Z2LB 3ZG0A 4EETB 1ZKJA 2IA2A 4WZ4A 3ZGAB 3S7NA 4JGPA 3VE4A 3KSGA 4KZ6A 3H82B 1YMXA 2XFSA 4WM9A 4OLDA 5EV0A 2GZAA 1AWIA 4ESPA 3E4OA 4P85A 1A0KA 5E2GA 4HHDA 3DTIA 1D1JA 4B4XA 3IBJA 5K5BA 1W63M 5HFOA 1FCNA 4ARZA 2HP9A 4RX3A 4DKIA 1YSQA 3G6OA 3VFFA 3MFDA 2C5WB 5FATA 4S2JA 1IYSA 2RL3A 5L8MA 4WN5A 4II7A 1YPRA 3BFGA 3IS2B 4FH4A 1K6SA 1TS7A 4I3AA 2ZBBA 3MZFA 2PYPA 4OPZA 5HDCA 5KSHA 2WADA 3G2ZA 1ES2A 5GHYA 4O0PA 4KQDA 3CITA 1KOUA 1GCEA 5HWTA 3NOPC 1G5UA 4XUXA 3HLWA 2VV8A 5FQJA 1K56D 3JVVA 2H10A 2HZ5A 1NZOA 3ZG5A 4KG5A 4NK3A 5FI6A 1L0FA 4G3KA 3LIFA 4UEYA 3RFBA 2K2NA 4KENB 1XA1A 2Y2HA 1ES4A 3U2AA 4H6JA 2C6WB 3ITAA 4JXWA 2ZQAA 1LL8A 1Y28A 1FQGA 4S2IA 2B95A 1K4FA 2ZM2A 3S1YA 1WYCA 3CJMA 4QPRA 1ZC2A 3NULA 1YT4A 2ZJ9A 1C3BA 2XD1A 4E6XA 2JHEA 4DDYA 2H0YA 2O0YA 1LSVA 4OKPA 3NDEA 1FILA 3MXRA 4DJ2A 1DJCA 3HUOA 3LO7A 3LIEA 3CI6A 4R0QA 3M6HA 2ZQCA 3LICA 1S4SA 2EXBA 3P7NA 4HESA 5HAIA 4D60A 5FQIA 2HDUA 2HJEA 4WEKA 1CQAA 2PU4A 3F1OB 3IH8A 1ERQA 4MBHA 3ZG9B 2QJ5A 2V1ZA 4JXSA 3W2ZA 4IBRA 2XA7S 2XQZA 1K0KA 3H82A 4LCLA 3MZEA 3QP2A 2Y2IA 3MF0A 5HPFA 4Y15A 2XH9A 1RP5A 3HUMA 4R6LA 3KYQA 2XK1A 3VP1A 4BL2A 3HJKA 1RCJA 4EEUA 2ZQDA 1H8YA 3IF5A 3K3DA 4FTXA 4LLOB 4Q0HA 1FR6A 3CWFA 1NRJA 1ONGA 4K91A 2M7VA 4EQ1A 1SCWA 1PYYA 1PZOA 3Q82A 2HV1A 3IS2A 4UQIM 4PM5A 1XX2A 3M2KA 1SDEA 1IYOA 4JBFA 3Q81A 1MY8A 5L10A 4HJ3A 1K57C 3S7OA 2H5SA 1YSPA 3F1PB 4CPKA 3CAXA 2PR5A 3VV4A 3P98A 3C7VA 3IXGA 4MCWA 3LIBA 1NLZA 2PYRA 4UAAA 1LSXA 1QMEA 2OV5A 2FFYA 1L2SA 3IH9A 3ULFA 3VOZA 3R7WB 4X6TA 3JVUA 3Q7ZA 5FQMA 4OOMA 4X69A 1W63Q 2OLUA 2JCHA 2P7JA 4E3LA 3Q1FA 4N92A 3T1RA 1N9LA 2NUTC 1YLWA 3PAEA 3IWQA 2HGVA 1PI4A 5G4YA 2NUPC 3ZVWA 3QP8A 1ES5A 1KGFA 5CECA 1HZOA 3FYZA 2HP5A 1IELA 4ID4A 1IYPA 5AQAA 1T19A 4WMCD 2VGLM 4E3NA 4O8GA 5TBMB 3A3EA 4LFUA 4PHTA 1GA0A 3KO6A 3VOYA 5EPHA 4EW7A 4EUVA 5DKKA 2WKIA 2L1MA 4RA7A 3F1OA 1W79A 4ETZA 1BLHA 1K6RA 3PBOA 1TS0A 3OPRA 2W3DA 3ZG7B 4JXGA 1ZHHB 3N8LA 3BFDA 5HSQA 4OOLA 3N6IA 4UA7A 1VM1A 3FZCA 3VP2A 1XGJA 3RXXA 3FPWA 2OLVA 1BT5A 4EBPA 2ZQ9A 4BBTA 5FQ9A 1S6RA 3E98A 1J3WA 3ZFZA 4A5RA 5FEFA 1VEUB 4GCZA 4LV2A 3T4KA 3UMDA 2XR0A 2EX6A 3VP0A 2J9OA 3RH8B 4R4SA 1CI9A 4KG2A 3F1PA 2ZMVA 2JC7A 1BLSA 4S2LA 5GL9A 5KZHA 3A3FA 1SZVA 3DWZA 4NXGA 4X1LA 3EGXC 3ZVTA 2G2WA 1Z6FA 3MJQA 3R7WA 1EW0A 3QP5A 2R9WA 1G6OA 3N7WA 2VGJA 4JF5A 1GSWA 2VKSA 1LL5A 3BQAA 3LGOA 3UE6A 3B33A 4G3WA 1HLUP 2JKRI 3R4KA 4ZJ3A 1U60A 2JBFA 1T1CA 3ITBA 1KDWA 4HQAA 1XJ6A 3UE1A 3BEBA 2XF3A 3DBAA 3UO9A 3DTEA 2WZZA 3O87A 1D7EA 4C75A 5HX9A 1ZG4A 5TBMA 3MXSA 4ZJ2A 3PBNA 1UWPX 3IX4A 1VQQA 4L0LA 2XFTA 2XROA 1F5MA 2ZD8A 2ZOIA 2DMWA 3LI8A 5EE8A 1MC0A 3A3JA 2ZOHA 3LY4A 1PWGA 2BG1A 3EOIA 3MS6A 1NYMA 3GDIA 1NLYA 4OONA 3T4QA 1TDGA 1VETB 4WBGA 4X25A 3ZG8B 1NWZA 5TR7A 5KSCA 2Y79A 2ZQ7A 5FEGA 1XP4A 5FI2A 1J9MA 2V2FF 4RVAA 3CZDA 2INWA 3IX3A 4HH3A 5L09A 4HNBA 3RJUA 4LV3A 2P04A 5FI7A 1PZPA 3MFXA 1W7FA 3ICYA 4MN5A 3TW8A 1XGIA 5DF7A 1VEUA 1IOUA 3JYIA 3UNWA 3A0SA 3HBRA 4OLGA 2EXAA 1GHMA 3DAVA 4BENA 2WAEA 4PM7A 4PM8A 5CEDA 4FOFA 4Y3IA 3FWLA 1K4EA 4EU0A 4R1GA 1TS8A 1MZUA 3FPVA 1YAXA 2P08A 1LI9A 5DKLA 3BFEA 4KZAA 3P09A 2W3HA 1OPXA 5GLAA 1OTDA 1H0MA 2HDSA 3S7PA 3KSFA 5HL1A 3GVBA 5HARA 4X53A 4WMCA 3IXDA 4UA6A 1OT9A 4O01A 5G18A 1E25A 3EQVA 3TOIA 3LUQA 3LEZA 4ZBEA 2WKPA 3HLGA 3GMWA 3T1QB 1UWNX 5FDSA 5HAQA 3T1SA 2JKRM 2Z6DA 5TGFA 1XKZA 5FAOA 3L9KA 3MBZA 4OQGA 3LR5A 3C4PA 4B9OA 2D02A 3MQ0A 4OP5A 3U4LP 1HTZA 4HP9A 5J8XA 2Q9MA 4EXOA 1JTDA 3M2JA 2R78A 1QMFA 2Y2QA 3UN7A 2OWHA 4E3OA 3PBQA 3GV9A 4NEED 4DF6A 2FFFB 4GD8A 3LY3A 2J9PA 2HJ9C 5IT5A 2PHYA 5AQ9A 1JWPA 3BY8A 4NXBA 1WYBA 3IQAA 3GRJA 4WF0A 2PD7A 3S22A 5CHMA 1H3QA 3AGFA 1NYYA 4Y5FA 1W8YA 4OQIA 1G28A 1OT6A 1VETA 3OOVA 2QJ7A 3UPNA 1Y4OA 1IEMA 3NBLA 3WS5A 2IWBA 3HLEA 2J8YA 1Z09A 3PAGA 3LYXA 5F82A 4K08A 2WKQA 5M19A 5IU1A 3D9YA 1FR1A 4MMNA 5D3OA 3G31A 2KOIA 2K31A 4HBTA 5EFWA 4PM9A 1D06A 4UQIS 3C5AA 5JYPA 1M40A 2FZ0A 4N9KA 4JPMA 3BLMA 2I9VA 1BUEA 2IWCA 5CEBA 2UWXA 3N8SA 5CTMA 2BASA 2Y2NA 1W5DA 1YMSA 4F94A 1BLPA 1SKFA 3UPOA 3LIAA 4Q0IA 4HOIA 1F9IA 3IWOA 5M1AA 2EX2A 4OPQA 2JN7A 1NY0A 1TVFA 1O07A 2M1CA 3NJAA 2W1TB 2BTFP 2JKGA 1E4DA 3KX0X 2Y91A 1PRQA 2B02A 1P0ZA 3C8CA 4GW9A 1K25A 2PRFA 2QYBA 3H7WB 3ZDJA 3IT9A 3BW6A 4WYYA 4N9LA 4PKYG 1K38A 3V67A 4KZ5A 4LV0A 4XT2B 5E43A 2VGLS 5DJUA 2BLSA 1F98A 4EUZA 3UDFA 4CLCD 5HD5A
chains in the Genus database with same CATH topology
1IFQA 2KLIA 2XSSA 5F6AA 3CUEA 3PBOA 1XFQA 2PD8A 1TS0A 2W3DA 4I38A 2VV7A 3C38A 1ZHHB 3B47A 4ARZB 5F5YA 2W0NA 2V1BA 3HCYA 4MDZA 5HSQA 4ME4A 3K3CA 1ODVA 3C30A 3H9WA 4JGQA 2K7SA 4OOLA 3BJNA 2L0WA 3E4QA 4DMZA 4ZRRA 3FG8A 1N9NA 4B93A 2OOLA 3FPWA 3C2WA 4FSFA 4JGOA 1UGUA 3LR0A 1TS6A 4BBTA 3MQQA 3E98A 3OCLA 5AJGA 2O9AA 2W27A 3K2NA 2OWJA 4WL9A 1P9WA 3OLOA 3MMHA 4GCZA 4BMWA 2FH5A 3PHYA 2A24B 1OTEA 3EGDC 1S4RA 4IJGA 2QKPA 3T4KA 4I39A 3UMDA 3RH8B 4NKPA 4RQ9A 3F1PA 3O5YA 5MC7A 3OC2A 1DP8A 2A2LA 2ZMVA 3VE3A 4IUKA 3PR6A 2XRNA 5HZHA 4LRYC 4BBVA 2MJ6A 3PXPA 4HY8A 5TJJA 3LR3A 5A8BA 5J3WA 4NXGA 2W3GA 4H6JB 3PBRA 2O9BA 5IS1A 3EGXC 3T4TA 2GX5A 3KSIA 3SW1A 1N9OA 4YWZA 5HDDA 3MJQA 3R7WA 1LT0A 1EW0A 1GSXA 3TRCA 1G6OA 4NXEA 3UE3A 1GSWA 2VKSA 2JKTM 3BQAA 3T4JA 3UE6A 3B33A 4G3WA 2VX8A 1P97A 4KUOA 4WELA 2JKRI 3VOLA 3R4KA 3KYZA 2W1TA 4CLCB 4R3AA 3D3OA 2KDKA 4EEPA 1S1ZA 1T1CA 2HF6A 3ZQ5A 4PAUA 2WKRA 4HQAA 1S1YA 2D01A 2M7UA 4EERA 1OJ5A 4P6ZM 4DJ3A 1XJ6A 3OCNA 4NXFA 2LB9A 5FL3A 3H7WA 3DBAA 1X0OA 4Y2FA 1D7EA 3TJZC 5TBMA 4GHIB 4GJ4A 3PBNA 4R38A 3BQ8A 5LBRA 1UWPX 4HH2A 2J80A 2W3EA 4XT2A 4L0LA 3KSHA 4KUKA 2XROA 1STZA 1F5MA 4EETB 2IA2A 2OAQ1 1MKMA 2ZOIA 4PKYA 4JGPA 2DMWA 3S7NA 3LI8A 4GLQA 1MC0A 4M4XA 3KSGA 2ZOHA 3VE4A 3H82B 3EOIA 3F1NB 5G4ZA 3GDIA 2GZAA 1NLYA 3E4OA 3T4QA 4HHDA 3NOUC 2W1RA 3IBJA 5K5BA 1W63M 2QWSA 4I3JA 4ARZA 1NWZA 1OTIA 2Y79A 2PT7A 4LRZE 1GSVA 1YSQA 3G6OA 3MQOA 3IBRA 3LR4A 2INWA 4HH3A 2GNXA 5J4EA 2H28A 2YKFA 5L8MA 4HNBA 4WN5A 4EESA 4II7A 2P04A 3IS2B 3MFXA 1TS7A 3ICYA 4I3AA 2ZBBA 4MN5A 2PYPA 3TW8A 1V9YA 5HDCA 1IOUA 5KSHA 4WEJA 1VB6A 2A24A 3A0SA 5KIZA 4O0PA 4KQDA 3CITA 2YKHA 3MXQA 3T4OA 1KOUA 4FOFA 2QHKA 4Y3IA 5HWTA 3EEHA 3NOPC 1LSWA 4EU0A 1TS8A 1MZUA 2VV8A 3FPVA 1DP9A 1YAXA 2P08A 1XJ3A 3HJIA 3JVVA 3LFVA 5DKLA 3S7QA 4YNRA 1TF1A 4G3KA 2W3HA 1OPXA 4I5SA 3LIFA 1OTDA 3D72A 4UEYA 2K2NA 5C5KA 3RFBA 3S7PA 2B18A 3KSFA 4L9GA 3U2AA 4CLCC 4H6JA 3PBTA 2V0UA 3T4SA 2J3TC 1LL8A 1WA9A 1Y28A 3NHQA 1OT9A 4O01A 3P01A 3PYPA 4I3IA 3EQVA 3LUQA 4HJ4A 3UMEA 2WKPA 4QPRA 4ETXA 4WUJA 4F3LB 2EA9A 1UWNX 5DF9A 2JKRM 2JHEA 2Z6DA 4CLCA 2LB5A 2O0YA 3A0VA 1LSVA 2EWVA 4DJ2A 4IUHA 3LR5A 4CQHA 4GS9B 4B9OA 2D02A 3MQ0A 2PDRA 3LIEA 3GECA 4BBUA 3CI6A 4HP9A 5DJTA 3UB6A 4DN0A 4EXOA 3UB8A 3LICA 1S4SA 2R78A 4LRXC 1OTBA 2OWHA 3P7NA 4GHIA 5HD3A 3PBQA 2VV6A 4NEED 3T50A 2HJEA 4WEKA 3EEAA 1XJ2A 2XA7M 4E04A 4MN7A 3F1OB 5F69A 2HJ9C 2CMNA 5IT5A 4HI4A 2PHYA 2QJ5A 3OBFA 3BY8A 3W2ZA 4NXBA 4LPZA 4HJ6A 1VHMA 5DFYA 2XA7S 3UB7A 3E0YA 2PD7A 4WF0A 3H82A 3F1NA 3FC7A 1H3QA 2J3TD 4Y5FA 3NOTC 4BJPA 1G28A 3MF0A 5HPFA 1OT6A 3OOVA 4R6LA 3KYQA 2QJ7A 2O9CA 2Z6CA 1T1BA 2OAP1 2V0WA 3HJKA 4EEUA 1JNUA 5I5LA 2EWWA 3K3DA 4LLOB 3LIDA 4Q0HA 3CWFA 2VA0A 1NRJA 3LYXA 2M7VA 2PR6A 4K08A 4EQ1A 4Z1WA 2WKQA 5IU1A 2J3WA 4MN6A 2HV1A 3IS2A 2VJWA 4UQIM 4HP4A 4MMNA 5F68A 4JGRA 4BWIA 3LI9A 5CX7A 2KOIA 1YKDA 2K31A 5EFWA 4HJ3A 3S7OA 3EWKA 1YSPA 1D06A 3F1PB 1T1AA 4CLCE 4UQIS 3CAXA 3BY9A 1BYWA 2W3FA 3MR0A 5AVFA 3RTYA 2PR5A 2FZ0A 3VV4A 2ZMFA 4MCWA 3UB9A 3LIBA 3B42A 2KX6A 4G3VA 2I9VA 1NLZA 2PYRA 4HIAA 1LSXA 4Q0JA 1DP6A 5HDSA 1S66L 1T18A 3PBSA 1DRMA 1H8MA 2BASA 3ULFA 4L9FA 3R7WB 1S67L 3JVUA 2JKTI 4KQOA 4OOMA 1OTAA 1W63Q 3LIAA 1P9RA 4L9EA 5AVEA 1XFNA 1V9ZA 4HOIA 4Q0IA 1F9IA 2P7JA 3EQUA 2JN7A 3CLOA 5HWWA 2M1CA 3NJAA 2W1TB 1OJGA 1N9LA 2NUTC 2GJ3A 2VZWA 2G7UA 3KX0X 4F3LA 4YOFA 2L4RA 2O99A 2HGVA 3BWLA 5J7EA 2VLGA 3E4PA 5G4YA 2NUPC 2B02A 1P0ZA 2Y8HA 3C8CA 3H7WB 4GW9A 2QYBA 4GS9A 4R70A 2VEAA 5HL6A 1T19A 2VGLM 3A0RA 4O8GA 5DFXA 5TBMB 3BW6A 3CUEC 4PHTA 4WLAA 3TE8A 3KO6A 1XJ4A 4PKYG 3V67A 4EW7A 1TD5A 5HWVA 4XT2B 4EUVA 5DKKA 2VGLS 4P6ZS 5HPIA 2V1AA 5DJUA 1F98A 2L1MA 1ZTUA 3F1OA 4AFIA 4IHQA 3T4LA 4ETZA 4CLCD 2V9AA 5HD5A 3ZYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F6A A;  1XFQ A;  2PD8 A;  1TS0 A;  4I38 A;  2VV7 A;  5F5Y A;  2W0N A;  2V1B A;  5HSQ A;  3K3C A;  1ODV A;  3H9W A;  4JGQ A;  2K7S A;  2L0W A;  3E4Q A;  3FG8 A;  1N9N A;  2OOL A;  3C2W A;  4JGO A;  1UGU A;  1TS6 A;  4BBT A;  3MQQ A;  2W27 A;  2OWJ A;  4WL9 A;  3OLO A;  4GCZ A;  3PHY A;  2A24 B;  1OTE A;  1S4R A;  2QKP A;  4I39 A;  3UMD A;  3RH8 B;  4RQ9 A;  3F1P A;  1DP8 A;  3VE3 A;  5HZH A;  4LRY C;  4BBV A;  4HY8 A;  5A8B A;  5J3W A;  4NXG A;  4H6J B;  5IS1 A;  3SW1 A;  1N9O A;  4YWZ A;  5HDD A;  3MJQ A;  1LT0 A;  1EW0 A;  1GSX A;  4NXE A;  1GSW A;  3UE6 A;  3B33 A;  4KUO A;  1P97 A;  3VOL A;  4R3A A;  2KDK A;  4EEP A;  1S1Z A;  1T1C A;  3ZQ5 A;  4HQA A;  2WKR A;  1S1Y A;  2D01 A;  4EER A;  1OJ5 A;  4DJ3 A;  1XJ6 A;  4NXF A;  3H7W A;  1X0O A;  1D7E A;  5TBM A;  4GHI B;  4R38 A;  1UWP X;  4HH2 A;  2J80 A;  4XT2 A;  4KUK A;  4EET B;  2ZOI A;  4PKY A;  4JGP A;  3LI8 A;  4M4X A;  3VE4 A;  2ZOH A;  3H82 B;  3F1N B;  5G4Z A;  3GDI A;  3E4O A;  4HHD A;  3NOU C;  2QWS A;  4I3J A;  1NWZ A;  1OTI A;  4LRZ E;  1GSV A;  3G6O A;  3MQO A;  3IBR A;  2INW A;  4HH3 A;  5J4E A;  2H28 A;  2YKF A;  4HNB A;  4WN5 A;  4EES A;  3IS2 B;  3MFX A;  1TS7 A;  3ICY A;  4I3A A;  2ZBB A;  4MN5 A;  2PYP A;  1V9Y A;  5HDC A;  1VB6 A;  2A24 A;  3A0S A;  5KIZ A;  4KQD A;  3MXQ A;  2YKH A;  1KOU A;  2QHK A;  5HWT A;  3EEH A;  3NOP C;  1LSW A;  1TS8 A;  1MZU A;  2VV8 A;  1DP9 A;  1XJ3 A;  3HJI A;  5DKL A;  4I5S A;  3LIF A;  1OTD A;  3D72 A;  4L9G A;  4H6J A;  2V0U A;  1LL8 A;  1WA9 A;  1Y28 A;  3NHQ A;  1OT9 A;  3PYP A;  4I3I A;  3LUQ A;  4HJ4 A;  3UME A;  2WKP A;  4WUJ A;  4F3L B;  2EA9 A;  1UWN X;  2JHE A;  2Z6D A;  3A0V A;  1LSV A;  4DJ2 A;  4GS9 B;  4B9O A;  2D02 A;  2PDR A;  3LIE A;  3GEC A;  4BBU A;  4HP9 A;  5DJT A;  3UB6 A;  4EXO A;  3UB8 A;  3LIC A;  1S4S A;  2R78 A;  4LRX C;  1OTB A;  2OWH A;  3P7N A;  4GHI A;  5HD3 A;  2VV6 A;  3T50 A;  1XJ2 A;  4E04 A;  3F1O B;  5F69 A;  2CMN A;  4HI4 A;  2PHY A;  2QJ5 A;  3BY8 A;  4NXB A;  4LPZ A;  4HJ6 A;  3UB7 A;  4WF0 A;  2PD7 A;  3H82 A;  3F1N A;  3FC7 A;  3NOT C;  1G28 A;  1OT6 A;  4R6L A;  2QJ7 A;  2Z6C A;  1T1B A;  2V0W A;  3HJK A;  4EEU A;  1JNU A;  5I5L A;  3K3D A;  4LLO B;  3LID A;  3CWF A;  3LYX A;  2PR6 A;  4K08 A;  4EQ1 A;  2WKQ A;  5IU1 A;  4MN6 A;  2HV1 A;  3IS2 A;  4HP4 A;  5F68 A;  4JGR A;  3LI9 A;  5EFW A;  4HJ3 A;  3EWK A;  1D06 A;  3F1P B;  1T1A A;  3CAX A;  3BY9 A;  1BYW A;  3MR0 A;  5AVF A;  3RTY A;  2PR5 A;  3UB9 A;  3LIB A;  2KX6 A;  2I9V A;  2PYR A;  4HIA A;  1LSX A;  1DP6 A;  5HDS A;  1S66 L;  1T18 A;  1DRM A;  2BAS A;  3ULF A;  4L9F A;  1S67 L;  1OTA A;  3LIA A;  4L9E A;  5AVE A;  1XFN A;  1V9Z A;  4HOI A;  1F9I A;  2P7J A;  2JN7 A;  3CLO A;  5HWW A;  2M1C A;  3NJA A;  1OJG A;  1N9L A;  2GJ3 A;  3KX0 X;  4F3L A;  2L4R A;  3BWL A;  5J7E A;  2VLG A;  3E4P A;  5G4Y A;  2B02 A;  1P0Z A;  3C8C A;  3H7W B;  4GW9 A;  4GS9 A;  4R70 A;  2VEA A;  1T19 A;  3A0R A;  5TBM B;  4WLA A;  1XJ4 A;  4PKY G;  4EW7 A;  5HWV A;  4XT2 B;  5DKK A;  2V1A A;  5DJU A;  1F98 A;  2L1M A;  3F1O A;  2V9A A;  5HD5 A; 
#chains in the Genus database with same CATH topology
 3CUE A;  1XFQ A;  2PD8 A;  4I38 A;  1PFL A;  1F2K A;  4BD0 A;  2V1B A;  3HCY A;  4IVK A;  4Y13 A;  1PIO A;  5DF8 A;  1YLP A;  4ME4 A;  1ODV A;  3C30 A;  2K7S A;  3QP1 A;  1MPL A;  1N9N A;  4RYE A;  4B93 A;  1K55 A;  1NZU A;  2H0T A;  2Y55 A;  1Q2P A;  3OCL A;  4ZJ1 A;  2W27 A;  1YLZ A;  2JKF A;  2OWJ A;  3OLO A;  5AQB A;  1CEF A;  2FH5 A;  4BMW A;  3PHY A;  1N4O A;  2QKP A;  4I39 A;  2Y2K A;  3ISG A;  1FIK A;  1BUL A;  4RQ9 A;  3O5Y A;  5MC7 A;  3DWK A;  4PMA A;  3VE3 A;  4IUK A;  4S2O A;  2V20 A;  3PR6 A;  2XRN A;  5HZH A;  4S2M A;  4OP8 A;  4HY8 A;  3IWI A;  4DXC A;  3D4F A;  4MBK A;  2ZC5 B;  2W3G A;  5IS1 A;  2O9B A;  1XXM A;  2GX5 A;  3KSI A;  1KGG A;  4OH0 A;  1LT0 A;  1GSX A;  4NXE A;  3OZH A;  3HL9 A;  5GLB A;  3T4J A;  4WEL A;  1PW1 A;  2ZC4 B;  1HD8 A;  4Y0U A;  2HP6 A;  2W1T A;  4CLC B;  1IYQ A;  1DJA A;  3D3O A;  2WYX A;  2KDK A;  4EEP A;  2J7V A;  1S1Z A;  3ZQ5 A;  3W4Q A;  3G4P A;  2ZC6 B;  3VP3 A;  2WKR A;  4BQM A;  2D01 A;  4PPR A;  4EER A;  1OJ5 A;  1IKG A;  4DJ3 A;  3MKE A;  3C7U A;  3OCN A;  4NXF A;  4GN2 A;  2WUQ A;  3H7W A;  5CGS A;  4K0X A;  1MWR A;  4QY6 A;  2ZLY A;  3TJZ C;  1E3U D;  5TFQ A;  4GZB A;  2WGW B;  4OQH A;  4R38 A;  3BQ8 A;  1PNE A;  4LV1 A;  4XT2 A;  2A49 A;  1STZ A;  4GNU A;  2Y2G A;  4PKY A;  3NCK A;  4GLQ A;  1I2W A;  3F1N B;  2DNS A;  3BFC A;  4KZ8 A;  3NOU C;  2HDQ A;  2W1R A;  4ZDX A;  3WS1 A;  2QWS A;  1K56 A;  1GSV A;  4P6B A;  3OPP A;  3MQO A;  2R9X A;  3WS2 A;  5J4E A;  2GNX A;  3CG5 A;  3T12 B;  2YKF A;  4EES A;  4E3I A;  4O7D A;  4E3K A;  1V9Y A;  2ZQ8 A;  4KZ7 A;  4QHC A;  5HAP A;  2WGI A;  5EM1 A;  3BLS A;  1LLB A;  4WEJ A;  5KMW A;  3A3I A;  3SOI A;  5KIZ A;  2UV0 E;  1KDS A;  2YKH A;  2RCX A;  3T4O A;  4DE2 A;  4N1H A;  2QHK A;  2ZM0 A;  3IHA A;  3EEH A;  1LSW A;  4DE0 A;  1KE0 A;  4QU3 A;  4X1M A;  1DP9 A;  3S7Q A;  4YNR A;  1SDN A;  1G68 A;  3HUN A;  4HEF A;  1ESU A;  3D72 A;  5E2F A;  2B18 A;  4KZ3 A;  4NG2 A;  2E8I A;  1L0D A;  2WK0 A;  1H8Z A;  2J3T C;  1TEM A;  3P01 A;  3PYP A;  4ETX A;  4F3L B;  5E2H A;  4CLC A;  1CF0 A;  4CJN A;  3DTK A;  3A0V A;  5CER A;  4FH2 A;  4GS9 B;  4KZ9 A;  1XPB A;  1RGY A;  3CHW P;  3Q7V B;  1K54 A;  5DJT A;  3UB6 A;  4DN0 A;  5EM0 A;  4QD4 A;  1OTB A;  2VV6 A;  5FAQ A;  3T50 A;  2WGW A;  4KZ4 A;  1ESI A;  1XJ2 A;  4MN7 A;  1ALQ A;  4MNR A;  5FQQ A;  1BTL A;  5EVI D;  3BEC A;  4JF6 A;  4HJ6 A;  1VHM A;  5DFY A;  3UB7 A;  3E0Y A;  3F1N A;  3FC7 A;  3NOT C;  3UY6 A;  4DE3 A;  4BJP A;  1S0W A;  2O9C A;  2Z6C A;  3N8R A;  1MWT A;  5M18 A;  2X71 A;  3LEQ A;  1JNU A;  2EWW A;  5FDH A;  3LID A;  4BL3 A;  2V8F A;  3QNC A;  4WZ5 A;  1YLJ A;  4Z1W A;  3NY4 A;  4MN6 A;  1GHP A;  3G2Y A;  1M6K A;  2VJW A;  3JPU A;  4HP4 A;  2P74 A;  3V5M A;  4JGR A;  3WS0 A;  3NC8 A;  4BWI A;  3LI9 A;  2Y2O A;  1I5Q A;  1ONH A;  3EWK A;  2AVX A;  2QMI A;  3NI9 A;  5GLD A;  3DW0 A;  4CLC E;  1PWC A;  1PI5 A;  1BYW A;  2W3F A;  5AVF A;  3RTY A;  4DE1 A;  2ZMF A;  4E3M A;  4ZAM A;  3V39 A;  2VGK A;  4HIA A;  4Q0J A;  5CTN A;  1DP6 A;  1PWD A;  2A3U A;  1T18 A;  3PBS A;  3V3R A;  1DRM A;  1H5X A;  4L9F A;  3IF6 B;  1S67 L;  4IVI A;  3GQZ A;  4U3T A;  4Q8I A;  5CGW A;  5A90 A;  4L9E A;  2Q9N A;  1P9R A;  5EVL A;  1SHV A;  5F83 A;  1XFN A;  1MKI A;  4LGW A;  1V9Z A;  2ACG A;  5F1F A;  4DXB A;  1O7E A;  1YLT A;  5EOE A;  3CLO A;  4R23 A;  5HWW A;  1OJG A;  4Y0O A;  3E2K A;  1L3L A;  2GJ3 A;  2VZW A;  4F3L A;  4R4R A;  5EVI B;  3SH9 A;  3BWL A;  3MZD A;  2VLG A;  3HLD A;  4X55 A;  3E4P A;  4H8R A;  3WWX A;  5DTK A;  2Y8H A;  4M3K A;  2Y2M A;  4GS9 A;  2VEA A;  3I7J A;  1YM1 A;  3A0R A;  3CUE C;  4WLA A;  2PBD P;  1XJ4 A;  1ERM A;  1TD5 A;  2XLN A;  4LCM A;  4U0T A;  5HPI A;  1BSG A;  3O86 A;  3WRT A;  1ZTU A;  4K0W A;  5GHZ A;  3T4L A;  1PW8 A;  5CRF A;  2WZX A;  2V9A A;  1CK3 A;  2XSS A;  2KLI A;  1WE4 A;  1K55 C;  5DTT A;  4XXR A;  2VV7 A;  3G32 A;  4D2O A;  1MXO A;  1SKO B;  2ZM8 A;  4MDZ A;  3BJN A;  4C3Q A;  4DMZ A;  4YFM A;  4ZRR A;  4Y17 A;  3NIA A;  1KVM A;  4FSF A;  4JGO A;  3AGE A;  3LR0 A;  1ES3 A;  1KE3 A;  5GLC A;  3MQQ A;  1MWU A;  3E2L A;  3K2N A;  2OSU A;  4RX2 A;  2A24 B;  3O88 A;  4BLM A;  4MLL A;  3OC2 A;  1DP8 A;  3V3S A;  2A2L A;  5FA7 A;  5FQK A;  4EQI A;  3GR2 A;  2MJ6 A;  5A91 A;  5EVE A;  1JVJ A;  3PXP A;  1EI5 A;  5A8B A;  5J3W A;  3W4O A;  4BD1 A;  4OVD A;  1AXB A;  3B3X A;  2Z2M B;  1GA9 A;  3T1X A;  4GB7 A;  3IF6 A;  3TRC A;  3OPH A;  4X68 A;  3HLB A;  1BZA A;  3FKV A;  3UE3 A;  5IHV A;  5CHU A;  4NET A;  4P87 A;  2VX8 A;  3VOL A;  4R3A A;  2WAF A;  5EVI A;  4PAU A;  2XGN A;  4S2N A;  2GDN A;  4OQ0 A;  2LB9 A;  3M6B A;  1X0O A;  3CPT B;  2X01 A;  4GHI B;  2Y2P A;  1Q2Q A;  5LBR A;  4HH2 A;  2J80 A;  1ZG6 A;  3FV7 A;  3SH8 A;  4KZB A;  3KSH A;  2IWD A;  2OAQ 1;  1MKM A;  1I2S A;  3FKW A;  1EWZ A;  4M4X A;  4EBL A;  3NEC A;  5G4Z A;  3NDG A;  2X02 A;  3C4O A;  4OPR A;  4Z9Q A;  4EBN A;  4I3J A;  4QJG A;  1SKO A;  1OTI A;  2PT7 A;  5I94 A;  4LRZ E;  3VMA A;  3IBR A;  3L7H A;  3LR4 A;  1KVL A;  2H28 A;  4JXV A;  2B5R A;  4S2K A;  2EX9 A;  1W8Q A;  5FAP A;  3VFH A;  1VB6 A;  4N1X A;  2A24 A;  1NJ4 A;  4GDN A;  1CEG A;  3MXQ A;  1CI8 A;  4KG6 A;  3VSL A;  4OOY A;  1XJ3 A;  3V50 A;  3HJI A;  3LFV A;  3BYD A;  2PU2 A;  3BFF A;  2P9V B;  4GDB A;  1TF1 A;  4I5S A;  5C5K A;  2E8J A;  2XDM A;  4L9G A;  1TDL A;  5A93 A;  4CLC C;  3PBT A;  2V0U A;  3RXW A;  3T4S A;  1WA9 A;  3NHQ A;  4E3J A;  3KYE A;  4IED A;  3PTE A;  1JWZ A;  3UE0 A;  4I3I A;  2V8C A;  3HLF A;  3BM6 A;  3HRE A;  3W4P A;  4HJ4 A;  3UME A;  1K54 C;  3IXB A;  3W8K A;  4WUJ A;  3N4I A;  2EA9 A;  5L07 A;  5DF9 A;  4DDS A;  4QWO A;  3DTM A;  2PBY A;  2G2U A;  2LB5 A;  4B4Z A;  4FUW A;  2EWV A;  4IUH A;  4CQH A;  2XEP A;  4S2P A;  4PM6 A;  4X56 A;  2PDR A;  3GEC A;  4BBU A;  3ZHH A;  1ERO A;  5EEC A;  3UB8 A;  4GD6 A;  1DY6 A;  1HVB A;  3CPT A;  4LRX C;  1KGE A;  4GHI A;  3WRZ A;  3UDI A;  5HD3 A;  1MBL A;  3EEA A;  2XA7 M;  5DVA A;  4E04 A;  5F69 A;  2CMN A;  4HI4 A;  4KQQ A;  3OBF A;  5L2F A;  4R3J A;  4EV4 A;  4QB8 A;  5GHX A;  4GOG A;  4LPZ A;  4WZ5 C;  2ZC3 B;  4MBF A;  1FCM A;  3Q07 A;  2J3T D;  3GTC A;  2WGV A;  1G6A A;  1YLY A;  1T1B A;  2OAP 1;  2V0W A;  5I5L A;  5FSR A;  4FCF A;  3IHB A;  2VA0 A;  3SS5 A;  2PR6 A;  3O3V A;  3HVF A;  1MWS A;  1KE4 A;  2EX8 A;  2J3W A;  4UA9 A;  3A3D A;  1GHI A;  1CJF A;  2EFU A;  3SS3 A;  5F68 A;  1RGZ A;  5CX7 A;  1YKD A;  3LCE A;  3GSG A;  1XA7 A;  1NXY A;  1T1A A;  3BY9 A;  1OME A;  3MR0 A;  1Y54 A;  4EWF A;  3UB9 A;  3B42 A;  2KX6 A;  4G3V A;  3G30 A;  5HDS A;  1S66 L;  1N9B A;  2P9V A;  1LHY A;  2HPB A;  1K57 A;  1H8M A;  3BRM A;  4OPY A;  3S4X A;  3TG9 A;  2JKT I;  4KQO A;  3UB5 P;  1OTA A;  5AVE A;  2DCF A;  2Y2J A;  3G35 A;  2WKE A;  3QNB A;  3EQU A;  5U47 A;  1FCO A;  3WS4 A;  2G7U A;  4LEN A;  4YOF A;  3UDX A;  2L4R A;  2O99 A;  5J7E A;  3TSG A;  2ZL1 B;  1BLC A;  4Y7P A;  2XD5 A;  4R3B A;  2QPN A;  3VP4 A;  4R70 A;  5HL6 A;  3OPL A;  4YIN A;  4HBU A;  5DFX A;  3QHY A;  5BOH A;  3TE8 A;  2DRW A;  3IXH A;  4JLF A;  2I72 A;  3ZCZ A;  5HWV A;  4P6Z S;  3G34 A;  2V1A A;  3MSH A;  5EUA A;  4AFI A;  4IHQ A;  3QP4 A;  3ZYT A;  1IFQ A;  4B88 A;  5F6A A;  2Y2L A;  4IBX A;  4U0X A;  5F1G A;  3C38 A;  3B47 A;  4ARZ B;  4QY5 A;  1FOF A;  5F5Y A;  2HDR A;  2W0N A;  4C6Y A;  3K3C A;  3H9W A;  4XUZ A;  4JGQ A;  2VK3 A;  1L0E A;  2L0W A;  3E4Q A;  3QP6 A;  5E2E A;  3CMZ A;  5CGX A;  3FG8 A;  2OOL A;  3C2W A;  3SS4 A;  3HLC A;  1L0G A;  1UGU A;  5DTS A;  4KQR A;  5JYO A;  1TS6 A;  1LI0 A;  3SH7 A;  3ZNY A;  5AJG A;  2O9A A;  3IX8 A;  4JF4 A;  4WL9 A;  1P9W A;  3VSK A;  3MMH A;  2EFX A;  4FD8 A;  1OTE A;  3EGD C;  1S4R A;  4IJG A;  2CC1 A;  3ZNT A;  4NKP A;  3UPP A;  1LL9 A;  5CXW A;  3IF6 C;  2WKH A;  4UHU A;  5EOO A;  4LRY C;  4BBV A;  3SZT A;  3MKF A;  5TJJ A;  3LR3 A;  5AQ7 A;  1JWV A;  2QZ6 A;  4H6J B;  1FSY A;  3PBR A;  3T4T A;  1DJB A;  1E3U A;  5A92 A;  5EVI C;  3SW1 A;  2JE5 A;  1N9O A;  4ZTK A;  4YWZ A;  5HDD A;  2ZC7 A;  5CHJ A;  4GKU A;  4S2N C;  2JKT M;  3AGD A;  4KUO A;  1P97 A;  2Y4A A;  3KYZ A;  2Q0O A;  5HW3 A;  4P0M A;  2HF6 A;  1ACF A;  1NRF A;  1S1Y A;  2M7U A;  2ZMA A;  4Y0T A;  4P6Z M;  2PAV P;  3Q7V A;  2ZL1 A;  1JTG A;  5FL3 A;  5FAS A;  4JKT A;  4Y2F A;  4DRT A;  4E6W A;  2Y59 A;  4MEZ A;  4GJ4 A;  2W3E A;  1IKI A;  1FSW A;  1YQS A;  4KUK A;  2Z2L B;  3ZG0 A;  4EET B;  1ZKJ A;  2IA2 A;  4WZ4 A;  3ZGA B;  3S7N A;  4JGP A;  3VE4 A;  3KSG A;  4KZ6 A;  3H82 B;  1YMX A;  2XFS A;  4WM9 A;  4OLD A;  5EV0 A;  2GZA A;  1AWI A;  4ESP A;  3E4O A;  4P85 A;  1A0K A;  5E2G A;  4HHD A;  3DTI A;  1D1J A;  4B4X A;  3IBJ A;  5K5B A;  1W63 M;  5HFO A;  1FCN A;  4ARZ A;  2HP9 A;  4RX3 A;  4DKI A;  1YSQ A;  3G6O A;  3VFF A;  3MFD A;  2C5W B;  5FAT A;  4S2J A;  1IYS A;  2RL3 A;  5L8M A;  4WN5 A;  4II7 A;  1YPR A;  3BFG A;  3IS2 B;  4FH4 A;  1K6S A;  1TS7 A;  4I3A A;  2ZBB A;  3MZF A;  2PYP A;  4OPZ A;  5HDC A;  5KSH A;  2WAD A;  3G2Z A;  1ES2 A;  5GHY A;  4O0P A;  4KQD A;  3CIT A;  1KOU A;  1GCE A;  5HWT A;  3NOP C;  1G5U A;  4XUX A;  3HLW A;  2VV8 A;  5FQJ A;  1K56 D;  3JVV A;  2H10 A;  2HZ5 A;  1NZO A;  3ZG5 A;  4KG5 A;  4NK3 A;  5FI6 A;  1L0F A;  4G3K A;  3LIF A;  4UEY A;  3RFB A;  2K2N A;  4KEN B;  1XA1 A;  2Y2H A;  1ES4 A;  3U2A A;  4H6J A;  2C6W B;  3ITA A;  4JXW A;  2ZQA A;  1LL8 A;  1Y28 A;  1FQG A;  4S2I A;  2B95 A;  1K4F A;  2ZM2 A;  3S1Y A;  1WYC A;  3CJM A;  4QPR A;  1ZC2 A;  3NUL A;  1YT4 A;  2ZJ9 A;  1C3B A;  2XD1 A;  4E6X A;  2JHE A;  4DDY A;  2H0Y A;  2O0Y A;  1LSV A;  4OKP A;  3NDE A;  1FIL A;  3MXR A;  4DJ2 A;  1DJC A;  3HUO A;  3LO7 A;  3LIE A;  3CI6 A;  4R0Q A;  3M6H A;  2ZQC A;  3LIC A;  1S4S A;  2EXB A;  3P7N A;  4HES A;  5HAI A;  4D60 A;  5FQI A;  2HDU A;  2HJE A;  4WEK A;  1CQA A;  2PU4 A;  3F1O B;  3IH8 A;  1ERQ A;  4MBH A;  3ZG9 B;  2QJ5 A;  2V1Z A;  4JXS A;  3W2Z A;  4IBR A;  2XA7 S;  2XQZ A;  1K0K A;  3H82 A;  4LCL A;  3MZE A;  3QP2 A;  2Y2I A;  3MF0 A;  5HPF A;  4Y15 A;  2XH9 A;  1RP5 A;  3HUM A;  4R6L A;  3KYQ A;  2XK1 A;  3VP1 A;  4BL2 A;  3HJK A;  1RCJ A;  4EEU A;  2ZQD A;  1H8Y A;  3IF5 A;  3K3D A;  4FTX A;  4LLO B;  4Q0H A;  1FR6 A;  3CWF A;  1NRJ A;  1ONG A;  4K91 A;  2M7V A;  4EQ1 A;  1SCW A;  1PYY A;  1PZO A;  3Q82 A;  2HV1 A;  3IS2 A;  4UQI M;  4PM5 A;  1XX2 A;  3M2K A;  1SDE A;  1IYO A;  4JBF A;  3Q81 A;  1MY8 A;  5L10 A;  4HJ3 A;  1K57 C;  3S7O A;  2H5S A;  1YSP A;  3F1P B;  4CPK A;  3CAX A;  2PR5 A;  3VV4 A;  3P98 A;  3C7V A;  3IXG A;  4MCW A;  3LIB A;  1NLZ A;  2PYR A;  4UAA A;  1LSX A;  1QME A;  2OV5 A;  2FFY A;  1L2S A;  3IH9 A;  3ULF A;  3VOZ A;  3R7W B;  4X6T A;  3JVU A;  3Q7Z A;  5FQM A;  4OOM A;  4X69 A;  1W63 Q;  2OLU A;  2JCH A;  2P7J A;  4E3L A;  3Q1F A;  4N92 A;  3T1R A;  1N9L A;  2NUT C;  1YLW A;  3PAE A;  3IWQ A;  2HGV A;  1PI4 A;  5G4Y A;  2NUP C;  3ZVW A;  3QP8 A;  1ES5 A;  1KGF A;  5CEC A;  1HZO A;  3FYZ A;  2HP5 A;  1IEL A;  4ID4 A;  1IYP A;  5AQA A;  1T19 A;  4WMC D;  2VGL M;  4E3N A;  4O8G A;  5TBM B;  3A3E A;  4LFU A;  4PHT A;  1GA0 A;  3KO6 A;  3VOY A;  5EPH A;  4EW7 A;  4EUV A;  5DKK A;  2WKI A;  2L1M A;  4RA7 A;  3F1O A;  1W79 A;  4ETZ A;  1BLH A;  1K6R A;  3PBO A;  1TS0 A;  3OPR A;  2W3D A;  3ZG7 B;  4JXG A;  1ZHH B;  3N8L A;  3BFD A;  5HSQ A;  4OOL A;  3N6I A;  4UA7 A;  1VM1 A;  3FZC A;  3VP2 A;  1XGJ A;  3RXX A;  3FPW A;  2OLV A;  1BT5 A;  4EBP A;  2ZQ9 A;  4BBT A;  5FQ9 A;  1S6R A;  3E98 A;  1J3W A;  3ZFZ A;  4A5R A;  5FEF A;  1VEU B;  4GCZ A;  4LV2 A;  3T4K A;  3UMD A;  2XR0 A;  2EX6 A;  3VP0 A;  2J9O A;  3RH8 B;  4R4S A;  1CI9 A;  4KG2 A;  3F1P A;  2ZMV A;  2JC7 A;  1BLS A;  4S2L A;  5GL9 A;  5KZH A;  3A3F A;  1SZV A;  3DWZ A;  4NXG A;  4X1L A;  3EGX C;  3ZVT A;  2G2W A;  1Z6F A;  3MJQ A;  3R7W A;  1EW0 A;  3QP5 A;  2R9W A;  1G6O A;  3N7W A;  2VGJ A;  4JF5 A;  1GSW A;  2VKS A;  1LL5 A;  3BQA A;  3LGO A;  3UE6 A;  3B33 A;  4G3W A;  1HLU P;  2JKR I;  3R4K A;  4ZJ3 A;  1U60 A;  2JBF A;  1T1C A;  3ITB A;  1KDW A;  4HQA A;  1XJ6 A;  3UE1 A;  3BEB A;  2XF3 A;  3DBA A;  3UO9 A;  3DTE A;  2WZZ A;  3O87 A;  1D7E A;  4C75 A;  5HX9 A;  1ZG4 A;  5TBM A;  3MXS A;  4ZJ2 A;  3PBN A;  1UWP X;  3IX4 A;  1VQQ A;  4L0L A;  2XFT A;  2XRO A;  1F5M A;  2ZD8 A;  2ZOI A;  2DMW A;  3LI8 A;  5EE8 A;  1MC0 A;  3A3J A;  2ZOH A;  3LY4 A;  1PWG A;  2BG1 A;  3EOI A;  3MS6 A;  1NYM A;  3GDI A;  1NLY A;  4OON A;  3T4Q A;  1TDG A;  1VET B;  4WBG A;  4X25 A;  3ZG8 B;  1NWZ A;  5TR7 A;  5KSC A;  2Y79 A;  2ZQ7 A;  5FEG A;  1XP4 A;  5FI2 A;  1J9M A;  2V2F F;  4RVA A;  3CZD A;  2INW A;  3IX3 A;  4HH3 A;  5L09 A;  4HNB A;  3RJU A;  4LV3 A;  2P04 A;  5FI7 A;  1PZP A;  3MFX A;  1W7F A;  3ICY A;  4MN5 A;  3TW8 A;  1XGI A;  5DF7 A;  1VEU A;  1IOU A;  3JYI A;  3UNW A;  3A0S A;  3HBR A;  4OLG A;  2EXA A;  1GHM A;  3DAV A;  4BEN A;  2WAE A;  4PM7 A;  4PM8 A;  5CED A;  4FOF A;  4Y3I A;  3FWL A;  1K4E A;  4EU0 A;  4R1G A;  1TS8 A;  1MZU A;  3FPV A;  1YAX A;  2P08 A;  1LI9 A;  5DKL A;  3BFE A;  4KZA A;  3P09 A;  2W3H A;  1OPX A;  5GLA A;  1OTD A;  1H0M A;  2HDS A;  3S7P A;  3KSF A;  5HL1 A;  3GVB A;  5HAR A;  4X53 A;  4WMC A;  3IXD A;  4UA6 A;  1OT9 A;  4O01 A;  5G18 A;  1E25 A;  3EQV A;  3TOI A;  3LUQ A;  3LEZ A;  4ZBE A;  2WKP A;  3HLG A;  3GMW A;  3T1Q B;  1UWN X;  5FDS A;  5HAQ A;  3T1S A;  2JKR M;  2Z6D A;  5TGF A;  1XKZ A;  5FAO A;  3L9K A;  3MBZ A;  4OQG A;  3LR5 A;  3C4P A;  4B9O A;  2D02 A;  3MQ0 A;  4OP5 A;  3U4L P;  1HTZ A;  4HP9 A;  5J8X A;  2Q9M A;  4EXO A;  1JTD A;  3M2J A;  2R78 A;  1QMF A;  2Y2Q A;  3UN7 A;  2OWH A;  4E3O A;  3PBQ A;  3GV9 A;  4NEE D;  4DF6 A;  2FFF B;  4GD8 A;  3LY3 A;  2J9P A;  2HJ9 C;  5IT5 A;  2PHY A;  5AQ9 A;  1JWP A;  3BY8 A;  4NXB A;  1WYB A;  3IQA A;  3GRJ A;  4WF0 A;  2PD7 A;  3S22 A;  5CHM A;  1H3Q A;  3AGF A;  1NYY A;  4Y5F A;  1W8Y A;  4OQI A;  1G28 A;  1OT6 A;  1VET A;  3OOV A;  2QJ7 A;  3UPN A;  1Y4O A;  1IEM A;  3NBL A;  3WS5 A;  2IWB A;  3HLE A;  2J8Y A;  1Z09 A;  3PAG A;  3LYX A;  5F82 A;  4K08 A;  2WKQ A;  5M19 A;  5IU1 A;  3D9Y A;  1FR1 A;  4MMN A;  5D3O A;  3G31 A;  2KOI A;  2K31 A;  4HBT A;  5EFW A;  4PM9 A;  1D06 A;  4UQI S;  3C5A A;  5JYP A;  1M40 A;  2FZ0 A;  4N9K A;  4JPM A;  3BLM A;  2I9V A;  1BUE A;  2IWC A;  5CEB A;  2UWX A;  3N8S A;  5CTM A;  2BAS A;  2Y2N A;  1W5D A;  1YMS A;  4F94 A;  1BLP A;  1SKF A;  3UPO A;  3LIA A;  4Q0I A;  4HOI A;  1F9I A;  3IWO A;  5M1A A;  2EX2 A;  4OPQ A;  2JN7 A;  1NY0 A;  1TVF A;  1O07 A;  2M1C A;  3NJA A;  2W1T B;  2BTF P;  2JKG A;  1E4D A;  3KX0 X;  2Y91 A;  1PRQ A;  2B02 A;  1P0Z A;  3C8C A;  4GW9 A;  1K25 A;  2PRF A;  2QYB A;  3H7W B;  3ZDJ A;  3IT9 A;  3BW6 A;  4WYY A;  4N9L A;  4PKY G;  1K38 A;  3V67 A;  4KZ5 A;  4LV0 A;  4XT2 B;  5E43 A;  2VGL S;  5DJU A;  2BLS A;  1F98 A;  4EUZ A;  3UDF A;  4CLC D;  5HD5 A; 
#chains in the Genus database with same CATH homology
 1IFQ A;  2KLI A;  2XSS A;  5F6A A;  3CUE A;  3PBO A;  1XFQ A;  2PD8 A;  1TS0 A;  2W3D A;  4I38 A;  2VV7 A;  3C38 A;  1ZHH B;  3B47 A;  4ARZ B;  5F5Y A;  2W0N A;  2V1B A;  3HCY A;  4MDZ A;  5HSQ A;  4ME4 A;  3K3C A;  1ODV A;  3C30 A;  3H9W A;  4JGQ A;  2K7S A;  4OOL A;  3BJN A;  2L0W A;  3E4Q A;  4DMZ A;  4ZRR A;  3FG8 A;  1N9N A;  4B93 A;  2OOL A;  3FPW A;  3C2W A;  4FSF A;  4JGO A;  1UGU A;  3LR0 A;  1TS6 A;  4BBT A;  3MQQ A;  3E98 A;  3OCL A;  5AJG A;  2O9A A;  2W27 A;  3K2N A;  2OWJ A;  4WL9 A;  1P9W A;  3OLO A;  3MMH A;  4GCZ A;  4BMW A;  2FH5 A;  3PHY A;  2A24 B;  1OTE A;  3EGD C;  1S4R A;  4IJG A;  2QKP A;  3T4K A;  4I39 A;  3UMD A;  3RH8 B;  4NKP A;  4RQ9 A;  3F1P A;  3O5Y A;  5MC7 A;  3OC2 A;  1DP8 A;  2A2L A;  2ZMV A;  3VE3 A;  4IUK A;  3PR6 A;  2XRN A;  5HZH A;  4LRY C;  4BBV A;  2MJ6 A;  3PXP A;  4HY8 A;  5TJJ A;  3LR3 A;  5A8B A;  5J3W A;  4NXG A;  2W3G A;  4H6J B;  3PBR A;  2O9B A;  5IS1 A;  3EGX C;  3T4T A;  2GX5 A;  3KSI A;  3SW1 A;  1N9O A;  4YWZ A;  5HDD A;  3MJQ A;  3R7W A;  1LT0 A;  1EW0 A;  1GSX A;  3TRC A;  1G6O A;  4NXE A;  3UE3 A;  1GSW A;  2VKS A;  2JKT M;  3BQA A;  3T4J A;  3UE6 A;  3B33 A;  4G3W A;  2VX8 A;  1P97 A;  4KUO A;  4WEL A;  2JKR I;  3VOL A;  3R4K A;  3KYZ A;  2W1T A;  4CLC B;  4R3A A;  3D3O A;  2KDK A;  4EEP A;  1S1Z A;  1T1C A;  2HF6 A;  3ZQ5 A;  4PAU A;  2WKR A;  4HQA A;  1S1Y A;  2D01 A;  2M7U A;  4EER A;  1OJ5 A;  4P6Z M;  4DJ3 A;  1XJ6 A;  3OCN A;  4NXF A;  2LB9 A;  5FL3 A;  3H7W A;  3DBA A;  1X0O A;  4Y2F A;  1D7E A;  3TJZ C;  5TBM A;  4GHI B;  4GJ4 A;  3PBN A;  4R38 A;  3BQ8 A;  5LBR A;  1UWP X;  4HH2 A;  2J80 A;  2W3E A;  4XT2 A;  4L0L A;  3KSH A;  4KUK A;  2XRO A;  1STZ A;  1F5M A;  4EET B;  2IA2 A;  2OAQ 1;  1MKM A;  2ZOI A;  4PKY A;  4JGP A;  2DMW A;  3S7N A;  3LI8 A;  4GLQ A;  1MC0 A;  4M4X A;  3KSG A;  2ZOH A;  3VE4 A;  3H82 B;  3EOI A;  3F1N B;  5G4Z A;  3GDI A;  2GZA A;  1NLY A;  3E4O A;  3T4Q A;  4HHD A;  3NOU C;  2W1R A;  3IBJ A;  5K5B A;  1W63 M;  2QWS A;  4I3J A;  4ARZ A;  1NWZ A;  1OTI A;  2Y79 A;  2PT7 A;  4LRZ E;  1GSV A;  1YSQ A;  3G6O A;  3MQO A;  3IBR A;  3LR4 A;  2INW A;  4HH3 A;  2GNX A;  5J4E A;  2H28 A;  2YKF A;  5L8M A;  4HNB A;  4WN5 A;  4EES A;  4II7 A;  2P04 A;  3IS2 B;  3MFX A;  1TS7 A;  3ICY A;  4I3A A;  2ZBB A;  4MN5 A;  2PYP A;  3TW8 A;  1V9Y A;  5HDC A;  1IOU A;  5KSH A;  4WEJ A;  1VB6 A;  2A24 A;  3A0S A;  5KIZ A;  4O0P A;  4KQD A;  3CIT A;  2YKH A;  3MXQ A;  3T4O A;  1KOU A;  4FOF A;  2QHK A;  4Y3I A;  5HWT A;  3EEH A;  3NOP C;  1LSW A;  4EU0 A;  1TS8 A;  1MZU A;  2VV8 A;  3FPV A;  1DP9 A;  1YAX A;  2P08 A;  1XJ3 A;  3HJI A;  3JVV A;  3LFV A;  5DKL A;  3S7Q A;  4YNR A;  1TF1 A;  4G3K A;  2W3H A;  1OPX A;  4I5S A;  3LIF A;  1OTD A;  3D72 A;  4UEY A;  2K2N A;  5C5K A;  3RFB A;  3S7P A;  2B18 A;  3KSF A;  4L9G A;  3U2A A;  4CLC C;  4H6J A;  3PBT A;  2V0U A;  3T4S A;  2J3T C;  1LL8 A;  1WA9 A;  1Y28 A;  3NHQ A;  1OT9 A;  4O01 A;  3P01 A;  3PYP A;  4I3I A;  3EQV A;  3LUQ A;  4HJ4 A;  3UME A;  2WKP A;  4QPR A;  4ETX A;  4WUJ A;  4F3L B;  2EA9 A;  1UWN X;  5DF9 A;  2JKR M;  2JHE A;  2Z6D A;  4CLC A;  2LB5 A;  2O0Y A;  3A0V A;  1LSV A;  2EWV A;  4DJ2 A;  4IUH A;  3LR5 A;  4CQH A;  4GS9 B;  4B9O A;  2D02 A;  3MQ0 A;  2PDR A;  3LIE A;  3GEC A;  4BBU A;  3CI6 A;  4HP9 A;  5DJT A;  3UB6 A;  4DN0 A;  4EXO A;  3UB8 A;  3LIC A;  1S4S A;  2R78 A;  4LRX C;  1OTB A;  2OWH A;  3P7N A;  4GHI A;  5HD3 A;  3PBQ A;  2VV6 A;  4NEE D;  3T50 A;  2HJE A;  4WEK A;  3EEA A;  1XJ2 A;  2XA7 M;  4E04 A;  4MN7 A;  3F1O B;  5F69 A;  2HJ9 C;  2CMN A;  5IT5 A;  4HI4 A;  2PHY A;  2QJ5 A;  3OBF A;  3BY8 A;  3W2Z A;  4NXB A;  4LPZ A;  4HJ6 A;  1VHM A;  5DFY A;  2XA7 S;  3UB7 A;  3E0Y A;  2PD7 A;  4WF0 A;  3H82 A;  3F1N A;  3FC7 A;  1H3Q A;  2J3T D;  4Y5F A;  3NOT C;  4BJP A;  1G28 A;  3MF0 A;  5HPF A;  1OT6 A;  3OOV A;  4R6L A;  3KYQ A;  2QJ7 A;  2O9C A;  2Z6C A;  1T1B A;  2OAP 1;  2V0W A;  3HJK A;  4EEU A;  1JNU A;  5I5L A;  2EWW A;  3K3D A;  4LLO B;  3LID A;  4Q0H A;  3CWF A;  2VA0 A;  1NRJ A;  3LYX A;  2M7V A;  2PR6 A;  4K08 A;  4EQ1 A;  4Z1W A;  2WKQ A;  5IU1 A;  2J3W A;  4MN6 A;  2HV1 A;  3IS2 A;  2VJW A;  4UQI M;  4HP4 A;  4MMN A;  5F68 A;  4JGR A;  4BWI A;  3LI9 A;  5CX7 A;  2KOI A;  1YKD A;  2K31 A;  5EFW A;  4HJ3 A;  3S7O A;  3EWK A;  1YSP A;  1D06 A;  3F1P B;  1T1A A;  4CLC E;  4UQI S;  3CAX A;  3BY9 A;  1BYW A;  2W3F A;  3MR0 A;  5AVF A;  3RTY A;  2PR5 A;  2FZ0 A;  3VV4 A;  2ZMF A;  4MCW A;  3UB9 A;  3LIB A;  3B42 A;  2KX6 A;  4G3V A;  2I9V A;  1NLZ A;  2PYR A;  4HIA A;  1LSX A;  4Q0J A;  1DP6 A;  5HDS A;  1S66 L;  1T18 A;  3PBS A;  1DRM A;  1H8M A;  2BAS A;  3ULF A;  4L9F A;  3R7W B;  1S67 L;  3JVU A;  2JKT I;  4KQO A;  4OOM A;  1OTA A;  1W63 Q;  3LIA A;  1P9R A;  4L9E A;  5AVE A;  1XFN A;  1V9Z A;  4HOI A;  4Q0I A;  1F9I A;  2P7J A;  3EQU A;  2JN7 A;  3CLO A;  5HWW A;  2M1C A;  3NJA A;  2W1T B;  1OJG A;  1N9L A;  2NUT C;  2GJ3 A;  2VZW A;  2G7U A;  3KX0 X;  4F3L A;  4YOF A;  2L4R A;  2O99 A;  2HGV A;  3BWL A;  5J7E A;  2VLG A;  3E4P A;  5G4Y A;  2NUP C;  2B02 A;  1P0Z A;  2Y8H A;  3C8C A;  3H7W B;  4GW9 A;  2QYB A;  4GS9 A;  4R70 A;  2VEA A;  5HL6 A;  1T19 A;  2VGL M;  3A0R A;  4O8G A;  5DFX A;  5TBM B;  3BW6 A;  3CUE C;  4PHT A;  4WLA A;  3TE8 A;  3KO6 A;  1XJ4 A;  4PKY G;  3V67 A;  4EW7 A;  1TD5 A;  5HWV A;  4XT2 B;  4EUV A;  5DKK A;  2VGL S;  4P6Z S;  5HPI A;  2V1A A;  5DJU A;  1F98 A;  2L1M A;  1ZTU A;  3F1O A;  4AFI A;  4IHQ A;  3T4L A;  4ETZ A;  4CLC D;  2V9A A;  5HD5 A;  3ZYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...