1V9ZA

Crystal structure of the heme pas sensor domain of ec dos (ferrous form)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heme pas sensor protein
publication title A redox-controlled molecular switch revealed by the crystal structure of a bacterial heme PAS sensor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 30
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1v9zA00
3BWLA 3IS2B 1OT6A 4EXOA 3UMEA 3NHQA 4NXEA 5KIZA 1XJ3A 3LIBA 5HZHA 3BY9A 2PHYA 3IS2A 3H82B 3B33A 1OTIA 3T50A 3SW1A 3F1NA 2B02A 3UB7A 3KX0X 2W0NA 4I38A 3D72A 5HDDA 1LSVA 3H82A 3E4PA 1N9NA 1S1YA 5AVEA 4HIAA 3ICYA 2R78A 1S4RA 2QHKA 2V9AA 3F1OB 3K3CA 4HJ6A 1VB6A 3VE4A 4HHDA 5HWTA 2I9VA 5G4YA 2INWA 1OJGA 1TS0A 1TS6A 1OJ5A 4JGRA 2VV7A 3LICA 3NJAA 4I39A 2QKPA 5TBMB 3GDIA 3UE6A 3HJIA 4I3IA 1T18A 4R6LA 2GJ3A 3CLOA 1EW0A 5HWVA 2KX6A 3UB9A 4JGPA 3LI8A 1ODVA 4I3AA 3IBRA 3NOTC 3ULFA 5TBMA 1TS7A 3NOUC 2OWHA 5F6AA 5J4EA 2A24B 4M4XA 4GHIB 1XFNA 1GSWA 1JNUA 3FG8A 4H6JB 2L0WA 3H9WA 2OWJA 5J7EA 2HV1A 4HY8A 4YWZA 4GHIA 3EWKA 4GW9A 3CWFA 3LIEA 4HP4A 5IS1A 1GSXA 5DJTA 3H7WB 4LPZA 2QWSA 2JN7A 3MQQA 1WA9A 5J3WA 5HSQA 2WKRA 3P7NA 2L1MA 2PYPA 2VV6A 4EETB 4K08A 5DKLA 4R70A 4L9EA 4WF0A 3LUQA 5G4ZA 3MXQA 5HDCA 5I5LA 1D7EA 2VV8A 1DP6A 2H28A 4WLAA 4EERA 2V0UA 3OLOA 5HD5A 4HH2A 4E04A 2YKHA 1T19A 2D02A 3C8CA 4HP9A 5AVFA 4WN5A 4KQDA 5HD3A 1T1CA 2EA9A 1G28A 1LSXA 4BBVA 3MFXA 4HOIA 4JGQA 3PHYA 5HWWA 3NOPC 1DP9A 1UGUA 4WUJA 3F1OA 1TS8A 1N9LA 4EQ1A 2PDRA 4HJ4A 5A8BA 2JHEA 3FC7A 2QJ7A 4PKYG 4WL9A 5F69A 3RH8B 5DJUA 2BASA 2QJ5A 3F1PB 4MN6A 2ZBBA 4I5SA 4DJ3A 1NWZA 1T1AA 1F98A 3UB6A 4HNBA 1XJ2A 1LT0A 2V1BA 4LLOB 2VEAA 2Z6DA 4HQAA 4JGOA 1KOUA 1OTAA 1S4SA 1Y28A 4XT2B 3UB8A 4NXFA 2ZOHA 1P0ZA 3LYXA 1D06A 2A24A 1GSVA 2OOLA 4HI4A 4F3LB 4I3JA 3MQOA 4KUOA 1V9YA 3G6OA 4H6JA 4DJ2A 3RTYA 1XFQA 4EEUA 3E4QA 4B9OA 2WKPA 4LRXC 4F3LA 2K7SA 3GECA 3H7WA 2V1AA 5F5YA 3CAXA 3F1NB 3VE3A 2PR6A 4BBTA 5HDSA 4R3AA 3K3DA 2CMNA 1V9ZA 4PKYA 3LIFA 4NXGA 1OTDA 2Z6CA 3MJQA 4KUKA 3E4OA 1T1BA 2VLGA 2ZOIA 5IU1A 1N9OA 4MN5A 5EFWA 1P97A 2PD8A 4GCZA 3C2WA 3A0SA 1BYWA 1OT9A 3MR0A 3UMDA 1OTBA 2J80A 1F9IA 1OTEA 1DRMA 1LL8A 3LIAA 2L4RA 2D01A 1UWPX 4LRYC 2KDKA 3A0VA 1XJ6A 3ZQ5A 4R38A 3VOLA 2WKQA 1MZUA 2PYRA 1S67L 4LRZE 4BBUA 4EEPA 1XJ4A 1S66L 2M1CA 4L9GA 1S1ZA 3F1PA 2P7JA 3PYPA 2V0WA 4NXBA 3LI9A 2YKFA 3EEHA 4HJ3A 4RQ9A 4HH3A 3BY8A 1UWNX 4L9FA 4EESA 1X0OA 1LSWA 4EW7A 1DP8A 2W27A 4GS9B 5DKKA 2PR5A 4XT2A 2PD7A 3HJKA 5F68A 3A0RA 4GS9A 3LIDA
chains in the Genus database with same CATH superfamily
2RCXA 2Y2QA 1BUEA 3MF0A 1NY0A 3NHQA 3MKEA 5HPIA 5EM0A 4Y0TA 1L0GA 5L2FA 1XJ3A 3LR3A 2JCHA 1XKZA 3BQAA 3LIBA 5HZHA 3B42A 5L09A 1O07A 2XQZA 5CRFA 1OTIA 3ZCZA 2E8IA 3DTMA 1NLZA 3O88A 1XA7A 5JYPA 2ZLYA 2ZM2A 4I38A 2XLNA 4KZ9A 5HDDA 1CJFA 3H82A 3E4PA 4X55A 3LEQA 1FR1A 1N9NA 2NUPC 4OVDA 1S1YA 3F1OB 3K3CA 4S2NC 4CJNA 3VP0A 4WYYA 2HZ5A 5HWTA 2XDMA 1K55A 3SS4A 4U0XA 5CEDA 2HGVA 2INWA 1KGGA 5HARA 5FEFA 3ZFZA 1H3QA 1WYCA 1NLYA 4DE0A 3NJAA 4E3OA 2EX6A 1BTLA 3SH8A 2VGKA 3AGDA 4JKTA 4I3IA 1YPRA 1YMSA 2WKEA 4JGPA 1ODVA 4AFIA 1OMEA 4G3VA 5CGWA 1MWRA 1PW8A 5F6AA 4DE2A 5J4EA 2JKGA 4ARZB 5F82A 2WGWB 4Y2FA 4M4XA 4GHIB 4Z9QA 2VKSA 4H6JB 1ZHHB 4C3QA 2JKFA 4QPRA 2HV1A 3O3VA 5HAIA 1VM1A 4HY8A 2QZ6A 5M1AA 4YWZA 3S7PA 3HLCA 4GW9A 2WUQA 1GSXA 1W63M 1H8MA 3JVVA 1LHYA 1YAXA 3DTEA 3D4FA 5HSQA 5F1GA 2L1MA 3MQ0A 2Q9MA 3G2ZA 2DCFA 2VV6A 5TR7A 3BRMA 4NK3A 3RXXA 5DKLA 3SS3A 4RYEA 2G2UA 2J8YA 1GA9A 3E98A 4O7DA 4QJGA 4ZRRA 3VMAA 3EGDC 3HUMA 1D7EA 2Y2NA 1NRFA 1XXMA 3Q1FA 4S2JA 3VV4A 4BJPA 4LCLA 2R9WA 1E3UD 3V67A 1DP6A 2C5WB 5CERA 1FR6A 4UQIS 2XK1A 4XUZA 1DJAA 3S7OA 1DJBA 3C8CA 2OLUA 4KQDA 1T1CA 1H5XA 2WKIA 2QMIA 2BG1A 3O86A 4KQOA 1LSXA 2KOIA 4Q0JA 2O0YA 2GDNA 4HOIA 3KYQA 3PHYA 3C4PA 3NOPC 4X53A 3Q81A 3IX8A 5F83A 1TDLA 3IBJA 3F1OA 4GB7A 3TJZC 2ZQAA 3IXDA 2OAP1 2ZD8A 2PDRA 1FCNA 3E2KA 4A5RA 3OPPA 3EEAA 3W4OA 1NYMA 3OOVA 3FPVA 4JXWA 3A3EA 4DXBA 2HP9A 3F1PB 1JTDA 4MN6A 4OKPA 3R7WB 3MSHA 2ZBBA 1K38A 1T1AA 1IYOA 4JXGA 1F98A 1ONHA 3KSHA 3UB6A 3NDEA 4FTXA 1FIKA 1XJ2A 4YFMA 2ZQ9A 4G3KA 3HLBA 5HPFA 2J3TC 1KE0A 1PWCA 2IWBA 1A0KA 4XT2B 5L07A 1VETB 3PXPA 4WZ5C 2J9PA 3G30A 2VJWA 3JYIA 3IHBA 1ES4A 4Q0IA 2WGWA 1GSVA 3IT9A 4HI4A 4U3TA 1BLSA 4F3LB 1BLPA 5EVLA 4GN2A 1V9YA 1ERQA 4H6JA 4WEJA 3RTYA 3C5AA 4WELA 2EWVA 1HD8A 3JVUA 1BLCA 4GZBA 1VEUA 3WRTA 1RCJA 1YMXA 1N9BA 3AGFA 2Y79A 3GECA 1LI0A 4S2KA 2V1AA 4FH4A 5GLDA 4Q0HA 3UB5P 1JTGA 1NRJA 5DTKA 2XH9A 4Z1WA 1XA1A 2Y59A 1V9ZA 1PWGA 3DWZA 3EQUA 1L0EA 1TD5A 1M40A 4MEZA 5IU1A 2W3EA 4QY5A 1N9OA 1PNEA 3IF6C 2X71A 1K57C 3A0SA 4ZJ2A 2Q0OA 3DWKA 1G6OA 3S7NA 3MR0A 5LBRA 1OTBA 3IXBA 2W1TB 4LGWA 1DRMA 3QP8A 3GMWA 2FZ0A 2D01A 1UWPX 3IWQA 4HBTA 4OQ0A 4DMZA 1ZG6A 2Y2LA 3TG9A 3A0VA 3C7VA 3SH9A 3PBOA 1Z6FA 2PYRA 4EEPA 2B18A 3WS4A 1NJ4A 3EQVA 4FCFA 1EI5A 4M3KA 4OOLA 4MN7A 4MBFA 3F1PA 5EV0A 2Z2MB 3PYPA 3R7WA 2QYBA 3EEHA 4HJ3A 4Y0OA 3BECA 4HH3A 5GLCA 3BY8A 1UWNX 4EESA 2XA7M 3IXHA 5E2GA 4EW7A 1ES3A 4N9KA 2HPBA 4X56A 1JWZA 3WS2A 4OQIA 2G7UA 1KVMA 3NI9A 3DAVA 4XT2A 2IWDA 3TW8A 1MWTA 4GD8A 4N1XA 4WM9A 5GLBA 2PU2A 5C5KA 2PU4A 4QD4A 5BOHA 3A0RA 4GS9A 3MKFA 5FL3A 1OT6A 2XD5A 4E3NA 4EXOA 1S0WA 4GD6A 2HP5A 1P9WA 5KIZA 2E8JA 4OPRA 4R4RA 4ID4A 3BY9A 5EE8A 2P9VB 2ZL1A 4FOFA 3IS2A 3H82B 4FUWA 1NZUA 3UDXA 4S2LA 4LV1A 3WS1A 3BLMA 4BWIA 3QP5A 1H8YA 3LGOA 1EWZA 3CPTB 3KX0X 3ZG9B 1MWUA 4E3IA 3D72A 3QP1A 3V3RA 4ZDXA 3N6IA 4HIAA 1G6AA 4QB8A 1S4RA 1DY6A 2V9AA 3G35A 4EWFA 1YKDA 3NIAA 1KE4A 4CLCB 4HHDA 2ZC6B 4P0MA 1K6SA 3N8SA 4EBPA 4OQHA 3WS0A 1TS0A 3IWIA 2W1TA 1OJ5A 2VV7A 5EVIB 4I39A 2EFUA 1BULA 1BT5A 1KGEA 1PWDA 2H0YA 2Y2GA 3HJIA 5AQ9A 1T18A 2VK3A 4R6LA 3FZCA 1E4DA 1NYYA 3QP2A 2Y2OA 2Y55A 2Y2PA 1EW0A 3QP4A 5HWVA 3UB9A 1F5MA 3LI8A 3IH9A 4WBGA 4PPRA 4QU3A 3RJUA 4XXRA 5TJJA 1K0KA 1AXBA 1XFNA 4NG2A 2V8FA 1ES2A 1JNUA 1IYSA 4JLFA 3U2AA 2ZM8A 2OWJA 3IXGA 1SKOB 2Y2KA 3WS5A 3OZHA 4PM7A 3EWKA 4C6YA 3CWFA 3LIEA 1FILA 1NZOA 5DJTA 1DJCA 3T4LA 1STZA 4LPZA 3IX3A 2QWSA 2JN7A 1L0DA 3P7NA 3CMZA 3JPUA 5CGSA 1FOFA 2PT7A 2XRNA 4L9EA 4BQMA 1Y54A 3LUQA 5IT5A 2ZJ9A 5HDCA 4JF6A 5FQMA 3KO6A 2HDUA 4O0PA 2Y4AA 5CXWA 2P9VA 4QHCA 3ZNTA 1I5QA 3NCKA 3S1YA 2YKHA 4KQQA 5AVFA 4P6ZM 1CI8A 3CPTA 5HD3A 2Y2IA 2EA9A 5EVEA 4S2PA 2HJEA 4R0QA 2Y2HA 4OOYA 4LENA 3MFXA 4CLCD 1GHMA 4JGQA 2ZM0A 2UWXA 3SZTA 5HWWA 1K56A 1DP9A 1UGUA 2NUTC 2Y2MA 5EOEA 4D2OA 2XEPA 4EQ1A 5HW3A 4CLCA 1SHVA 4HJ4A 4X69A 1YLPA 5EVID 4PKYG 3A3DA 5AQ7A 2BASA 3QHYA 4I5SA 4B88A 4DJ3A 1NWZA 4NETA 4Q8IA 4JBFA 2XF3A 3G34A 5EVIA 3T4TA 2EX2A 4HNBA 2HDSA 4ZAMA 2V1BA 4R3BA 3L7HA 2VEAA 2Z6DA 4II7A 1KOUA 4PM6A 4UHUA 1FSWA 3MZDA 4PAUA 4DDYA 1S6RA 3Q7ZA 1YLJA 3ZYTA 3UB8A 3DTKA 3GVBA 4NXFA 5J8XA 4ESPA 4ZJ1A 4S2IA 4DDSA 3LYXA 3FKWA 1VEUB 3GSGA 3MMHA 3LR4A 4KUOA 3C30A 3G6OA 4GLQA 2VGLM 1MBLA 4DJ2A 1BSGA 1PW1A 5DFXA 1SKOA 4QY6A 5E43A 2HDRA 4EEUA 2VA0A 3E4QA 3HLFA 5EM1A 3T12B 1IYPA 4LRXC 4E3JA 4EBLA 1YT4A 3BLSA 4ETXA 3ZVTA 4B93A 2OAQ1 3CAXA 3HLGA 5CHJA 2WAEA 4B4ZA 2WGIA 2PR6A 5TGFA 3LO7A 2ZMVA 4KENB 4KZ8A 4R3AA 3P09A 4HESA 4PKYA 3LIFA 4MDZA 1IKIA 4LV0A 3PBTA 3E4OA 3C4OA 2VLGA 2ZOIA 3PBSA 5DTSA 3B3XA 2H0TA 1Q2QA 2PD8A 2JC7A 2OLVA 5L8MA 4GCZA 4R3JA 1PI5A 3C2WA 2V2FF 5DVAA 4JXVA 3UMDA 1HVBA 2J80A 2ZC3B 4NEED 3RFBA 3V5MA 5A90A 3LIAA 2EX9A 4X6TA 3UO9A 3HBRA 4X25A 5EUAA 1F2KA 3PBQA 2C6WB 1KVLA 2W3FA 3IF5A 4Y13A 3UNWA 2WKQA 4PHTA 4RVAA 3UN7A 1S66L 5E2FA 2FH5A 4L9GA 4DE3A 3O87A 2V0WA 4NXBA 2CC1A 4XUXA 4Y3IA 2JE5A 3PR6A 3BEBA 4P85A 1X0OA 1LSWA 4KZ6A 2W27A 4GS9B 3M2KA 3O5YA 4KZAA 1XP4A 5FDHA 5EOOA 4Y15A 2DRWA 5F68A 5CECA 2ZL1B 3IS2B 1O7EA 5FQ9A 5HAPA 1HZOA 3W4QA 4O01A 2JKTI 1XGIA 2EXAA 4MBHA 2AVXA 1SZVA 2LB9A 3A3JA 3D3OA 3B33A 4K0WA 2HDQA 3T50A 5CGXA 1QMFA 3HUOA 1LL9A 2W0NA 4OLGA 3V3SA 3EOIA 1YLZA 1K4FA 1NXYA 3ZGAB 5AJGA 3I7JA 3HL9A 3ITAA 3ICYA 2O9BA 2QHKA 4FD8A 4HJ6A 3UPOA 5GHXA 1VB6A 3VE4A 4ZBEA 2ZQ8A 2A3UA 1IFQA 4YINA 1IOUA 2FFFB 4OPZA 2HF6A 2I9VA 2VX8A 3UPNA 3TE8A 3Q7VB 2IA2A 5KSHA 5L10A 1KDSA 1TS6A 3IHAA 3LICA 3S7QA 1ES5A 4MCWA 3UE6A 2K31A 4X68A 5FAQA 5AQAA 5GHZA 3LY3A 2GJ3A 1ZG4A 3CLOA 4IBRA 5HL6A 1GCEA 4KZ5A 4I3AA 3NOTC 5TBMA 1TS7A 1J3WA 1VHMA 1RGZA 1K55C 2A24B 2XROA 5CHMA 3HLEA 1YQSA 1IKGA 3FG8A 2XGNA 4OP8A 2PRFA 2L0WA 1AWIA 1H0MA 5J7EA 3HREA 1TDGA 1TF1A 1WYBA 4EBNA 3IF6B 1PZOA 4UQIM 5IS1A 3H7WB 2V20A 5EVIC 3LEZA 3MQQA 4OPQA 2XR0A 2ZMFA 3C38A 2PYPA 4K08A 1SCWA 4IJGA 4R1GA 4D60A 3CG5A 5G18A 5M18A 4R70A 3ZNYA 5FAPA 4WF0A 2M7VA 1EROA 5AQBA 4Y0UA 5G4ZA 1ALQA 2DNSA 3MXQA 3PBNA 4KZ4A 2WK0A 2VGJA 4MLLA 2VV8A 4BMWA 4OP5A 2Q9NA 2H28A 4WLAA 2V0UA 3OLOA 3T4QA 5HD5A 3N8LA 4GDNA 3PBRA 5F1FA 1T19A 1ESUA 4K0XA 4E3LA 3WWXA 4OLDA 4BBVA 2H10A 3BFFA 2ZC7A 3FWLA 2R9XA 1FQGA 4JXSA 3W2ZA 1K54A 2ZQ7A 3ZVWA 3ZG5A 1PI4A 1N9LA 3VP1A 1K6RA 3T4SA 4KQRA 1FCOA 3BQ8A 2JKRI 5A8BA 4P87A 3FC7A 3TSGA 4WL9A 5F69A 3Q7VA 4JF5A 2XSSA 1CQAA 4O8GA 4H8RA 5DJUA 3HLWA 4E6XA 2EXBA 4GJ4A 5IHVA 3Q82A 1MKIA 2K2NA 4E3MA 2O9AA 4DE1A 2WZZA 4WZ4A 3OCLA 4LLOB 1OTAA 4E3KA 1Z09A 1S4SA 4ZJ3A 1Y28A 4YOFA 2W1RA 4OOMA 2FFYA 2ZOHA 1PRQA 1D06A 2A24A 1OPXA 4FH2A 3FKVA 2OOLA 4KZ7A 2BLSA 4I3JA 3MQOA 1SDNA 3ZG8B 1FSYA 3FYZA 5GHYA 5I94A 2WADA 4MNRA 4X1LA 3GR2A 3ZDJA 4YNRA 3UE3A 3IF6A 1PYYA 3ITBA 4IUKA 1K57A 2K7SA 3HUNA 3H7WA 3NULA 4OQGA 5DFYA 4GKUA 5F5YA 3F1NB 1ACFA 4KG6A 3VE3A 5FQKA 1GHPA 2Y91A 3T4JA 3B47A 1PFLA 2CMNA 3LFVA 1ERMA 4KG2A 1MWSA 1JVJA 1OTDA 2Z6CA 1K25A 1K56D 4EQIA 4BD1A 2XFSA 3G31A 3WRZA 4IVKA 3MS6A 4IBXA 2IWCA 4Y5FA 1P97A 3T1SA 1CF0A 4CQHA 4MMNA 1RP5A 2P04A 4WMCD 1OTEA 1W5DA 3SOIA 1W8QA 1QMEA 3A3FA 1HTZA 1LL8A 2L4RA 2JKTM 3M6BA 4K91A 4WMCA 4LRYC 3DBAA 1Q2PA 1BLHA 2O9CA 4ETZA 1IEMA 3ZQ5A 4R38A 3VOLA 4R23A 4KG5A 3UE1A 3T1XA 1ZTUA 1MZUA 4LRZE 2X01A 2M1CA 2X02A 1S1ZA 4JPMA 5FQQA 5KMWA 3HCYA 3UDIA 4EUZA 3U4LP 1MXOA 2KLIA 4RX3A 4B4XA 3IQAA 1SKFA 1WE4A 4DXCA 3AGEA 1LL5A 4L9FA 2PAVP 3KYEA 2ZMAA 4CPKA 1DP8A 3SS5A 5DKKA 2PR5A 1MY8A 3MXSA 4E6WA 5CEBA 2EX8A 3HJKA 2P74A 1W7FA 2ZC4B 4ZTKA 5EECA 4X1MA 4UA9A 3LIDA 3M2JA 3GTCA 2GX5A 1YLWA 3ZG0A 3BWLA 3CI6A 3NECA 1IELA 4EU0A 3UMEA 3N8RA 4NXEA 3D9YA 3OPLA 2XA7S 3CHWP 5HFOA 4IUHA 4OPYA 1JWVA 2P08A 3E0YA 3FV7A 4OH0A 2HJ9C 4DRTA 2Y2JA 1XX2A 2HP6A 2PHYA 4PMAA 4FSFA 5MC7A 3OCNA 3SW1A 3GRJA 3F1NA 2B02A 1W8YA 3T1RA 1IYQA 3M6HA 3UB7A 5E2EA 3UY6A 3N7WA 1LSVA 4UAAA 3VFHA 3L9KA 5AVEA 1L0FA 1ONGA 3CUEA 2ZC5B 2R78A 2WGVA 2PBYA 1RGYA 1E3UA 4ME4A 1YSQA 4Y7PA 1LI9A 3VP3A 3UPPA 3SH7A 2GZAA 4Y17A 3T4OA 5FAOA 5G4YA 5A91A 1OJGA 3KYZA 3NBLA 4KZBA 2XFTA 4IVIA 5FASA 4GOGA 4JGRA 5KSCA 3T4KA 4DF6A 3MXRA 4S2MA 4P6BA 2QKPA 5TBMB 3NY4A 3GDIA 4KZ3A 3QP6A 3PTEA 3DW0A 1ZKJA 3ZHHA 4HEFA 3IX4A 2KX6A 4F94A 3GQZA 1E25A 3VSLA 1L2SA 3IBRA 3ULFA 4LV3A 2XD1A 2I72A 3NOUC 2OWHA 3BFDA 1JWPA 3RXWA 1K54C 1GSWA 1TEMA 3KSIA 3H9WA 2WYXA 1L3LA 4R4SA 4ARZA 5K5BA 4GHIA 1D1JA 4HBUA 4LCMA 4HP4A 2JKRM 1TVFA 1SDEA 3C7UA 5FDSA 3FPWA 4UEYA 1KDWA 3VP4A 1CEGA 3TOIA 1WA9A 2UV0E 5J3WA 3G2YA 2WKRA 4S2NA 5EPHA 4EETB 4PM9A 4LV2A 3LR0A 5CHUA 1MC0A 2BTFP 3QNCA 5FQJA 1I2SA 2ZQDA 3BYDA 5CTMA 1FCMA 3NC8A 5M19A 5I5LA 3BJNA 1CEFA 3ISGA 5KZHA 4N9LA 5DTTA 3KSGA 3LR5A 1K4EA 2B5RA 4EERA 4BENA 2OV5A 1G5UA 4HH2A 5HAQA 4E04A 1P9RA 4LFUA 2D02A 4HP9A 4WN5A 1W79A 5CTNA 1BZAA 1G28A 5FSRA 4RA7A 1I2WA 2ZQCA 3OPRA 5FA7A 1PIOA 4DKIA 2O99A 2J7VA 4WUJA 3VFFA 3HLDA 4EV4A 1TS8A 4BL2A 2W3DA 3W8KA 1W63Q 1U60A 3Q07A 2QPNA 2JHEA 3BW6A 3VOYA 2QJ7A 1MKMA 4QWOA 3RH8B 2B95A 3CZDA 4P6ZS 2QJ5A 2V8CA 2W3GA 5TFQA 3VSKA 3TRCA 4S2OA 5FEGA 1MPLA 1VQQA 3OBFA 1YSPA 2JBFA 1YLYA 2WZXA 3V39A 1LT0A 1HLUP 3CITA 2H5SA 3PAEA 4HQAA 2V1ZA 4UA6A 4N92A 4JGOA 3G4PA 2M7UA 4CLCC 1J9MA 4CLCE 2G2WA 1P0ZA 1N4OA 2WAFA 3MZFA 2GNXA 4UA7A 3T1QB 1G68A 4GNUA 2DMWA 2VZWA 1PZPA 3MZEA 3P98A 3K2NA 5DF7A 3UDFA 5JYOA 4BL3A 3BFEA 1VETA 3CJMA 1XFQA 3QNBA 4NKPA 5FI2A 3OPHA 4B9OA 1KGFA 5CX7A 3N4IA 2WKPA 5A93A 3E2LA 3S22A 2WKHA 4F3LA 5U47A 3G32A 2Y8HA 4DN0A 1YM1A 2MJ6A 2J3WA 5FATA 4G3WA 4BBTA 2LB5A 1XGJA 3DTIA 1C3BA 3BFGA 3LCEA 3UE0A 1YLTA 5HDSA 3K3DA 4JF4A 2VGLS 4GDBA 3VOZA 2ACGA 4NXGA 2A49A 3MJQA 4BLMA 4OONA 2J3TD 4KUKA 5E2HA 1T1BA 3NDGA 1GA0A 4WEKA 3S4XA 3PAGA 5EFWA 4MN5A 2J9OA 2Z2LB 4PM5A 5DF8A 1M6KA 1GHIA 1BYWA 5FI7A 3GV9A 1OT9A 3V50A 3LY4A 4U0TA 3ZG7B 4N1HA 3IH8A 1F9IA 3EGXC 5GL9A 2W3HA 1H8ZA 4WZ5A 5DF9A 1ESIA 4IEDA 3MBZA 3VP2A 4MBKA 4BD0A 3OC2A 3MFDA 4PM8A 2KDKA 2OSUA 1XJ6A 4C75A 2A2LA 3BFCA 4IHQA 1S67L 4BBUA 1XJ4A 2EFXA 1Y4OA 1ZC2A 3R4KA 2P7JA 3CUEC 3LI9A 2YKFA 4RQ9A 2RL3A 3KSFA 4L0LA 3P01A 3HVFA 4EUVA 1XPBA 5D3OA 1CI9A 2PBDP 5HL1A 3A3IA 2EWWA 5FQIA 1CK3A 2PD7A 5FI6A 5HX9A 4RX2A 5GLAA 1LLBA 1KE3A 3BM6A 5A92A 3W4PA 3IWOA
chains in the Genus database with same CATH topology
3BWLA 3IS2B 5FL3A 1OT6A 3CI6A 4EU0A 3MF0A 4EXOA 3UMEA 3NHQA 5HPIA 4NXEA 1P9WA 5KIZA 4O01A 2JKTI 2XA7S 1XJ3A 3LR3A 3BQAA 3LIBA 5HZHA 4IUHA 2P08A 3B42A 3BY9A 3E0YA 2HJ9C 2PHYA 2LB9A 4FOFA 4FSFA 3IS2A 3OCNA 3H82B 3D3OA 3B33A 5MC7A 1OTIA 3T50A 3SW1A 3F1NA 2B02A 4BWIA 1NLZA 3UB7A 3KX0X 2W0NA 4I38A 3D72A 5HDDA 3EOIA 1LSVA 3H82A 3E4PA 5AJGA 1N9NA 2NUPC 1S1YA 5AVEA 4HIAA 3ICYA 3CUEA 2O9BA 2R78A 1S4RA 2QHKA 2V9AA 3F1OB 3K3CA 1YKDA 4ME4A 4HJ6A 1YSQA 1VB6A 4CLCB 3VE4A 4HHDA 1IFQA 1IOUA 5HWTA 2GZAA 2HF6A 3T4OA 2I9VA 2HGVA 2VX8A 5G4YA 3TE8A 2INWA 1OJGA 3KYZA 2IA2A 1TS0A 5KSHA 2W1TA 1H3QA 1TS6A 1OJ5A 1NLYA 4JGRA 2VV7A 3LICA 3NJAA 3S7QA 3T4KA 4MCWA 4I39A 2QKPA 5TBMB 3GDIA 3UE6A 2K31A 3HJIA 4I3IA 1T18A 4R6LA 2GJ3A 3CLOA 1EW0A 5HWVA 2KX6A 5HL6A 3UB9A 4JGPA 1F5MA 1ODVA 3LI8A 3IBRA 4I3AA 3NOTC 3ULFA 4AFIA 5TBMA 1TS7A 3NOUC 1VHMA 4G3VA 2OWHA 5F6AA 5J4EA 2A24B 4ARZB 2XROA 4Y2FA 4M4XA 4GHIB 5TJJA 1XFNA 1GSWA 3KSIA 2VKSA 1JNUA 3FG8A 4H6JB 1ZHHB 2L0WA 3U2AA 3H9WA 2OWJA 5J7EA 4QPRA 2HV1A 4HY8A 4ARZA 5K5BA 4YWZA 4GHIA 3S7PA 1TF1A 3EWKA 4GW9A 3CWFA 3LIEA 4HP4A 2JKRM 4UQIM 5IS1A 1GSXA 1W63M 5DJTA 3H7WB 3FPWA 4UEYA 1H8MA 3JVVA 3T4LA 1STZA 4LPZA 1YAXA 2QWSA 2JN7A 3MQQA 1WA9A 5J3WA 5HSQA 2WKRA 3P7NA 2L1MA 3MQ0A 2ZMFA 3C38A 2PYPA 2VV6A 4EETB 4K08A 4IJGA 3LR0A 5DKLA 4R70A 2PT7A 2XRNA 4L9EA 4WF0A 2M7VA 1MC0A 3LUQA 5G4ZA 5IT5A 3MXQA 3PBNA 3E98A 5HDCA 4ZRRA 3EGDC 5I5LA 3BJNA 1D7EA 3KO6A 2VV8A 4O0PA 3VV4A 4BMWA 3KSGA 4BJPA 3LR5A 3V67A 1DP6A 2H28A 4WLAA 4EERA 2V0UA 3OLOA 3T4QA 5HD5A 4UQIS 4HH2A 4E04A 3PBRA 1P9RA 2YKHA 3S7OA 1T19A 2D02A 3C8CA 4HP9A 5AVFA 4P6ZM 4WN5A 4KQDA 5HD3A 1T1CA 2EA9A 2HJEA 1G28A 4KQOA 1LSXA 2KOIA 4Q0JA 4BBVA 3MFXA 4CLCD 2O0YA 4HOIA 4JGQA 3KYQA 3PHYA 5HWWA 3NOPC 1DP9A 1UGUA 2NUTC 2O99A 3W2ZA 4WUJA 3IBJA 3F1OA 3TJZC 1TS8A 1N9LA 4EQ1A 2OAP1 4CLCA 2W3DA 2PDRA 1W63Q 3T4SA 4HJ4A 3BQ8A 3EEAA 2JKRI 5A8BA 2JHEA 3BW6A 3FC7A 2QJ7A 3OOVA 1MKMA 4PKYG 4WL9A 5F69A 3RH8B 3FPVA 2XSSA 4O8GA 5DJUA 2BASA 2QJ5A 3F1PB 4P6ZS 2W3GA 4GJ4A 4MN6A 3R7WB 2ZBBA 4I5SA 3TRCA 4DJ3A 1NWZA 1T1AA 1F98A 3KSHA 2K2NA 3UB6A 3OBFA 3T4TA 1YSPA 2O9AA 4HNBA 1XJ2A 1LT0A 4G3KA 3CITA 2V1BA 3OCLA 4LLOB 5HPFA 2VEAA 2Z6DA 4HQAA 2J3TC 4II7A 4JGOA 1KOUA 1OTAA 1S4SA 4PAUA 2M7UA 4CLCC 1Y28A 4YOFA 2W1RA 4XT2B 3ZYTA 3UB8A 4CLCE 4OOMA 3PXPA 4NXFA 2ZOHA 1P0ZA 2VJWA 3LYXA 1D06A 2A24A 4Q0IA 1OPXA 2GNXA 1GSVA 2OOLA 4HI4A 4F3LB 4I3JA 3MQOA 3MMHA 3LR4A 4KUOA 1V9YA 3C30A 2DMWA 3G6OA 2VZWA 4GLQA 3K2NA 4H6JA 2VGLM 4WEJA 4DJ2A 3RTYA 4WELA 5DFXA 1XFQA 2EWVA 4NKPA 4EEUA 2VA0A 3E4QA 4B9OA 3JVUA 5CX7A 2WKPA 4LRXC 4F3LA 4YNRA 3UE3A 2Y8HA 2Y79A 4DN0A 4IUKA 2K7SA 3GECA 3H7WA 2MJ6A 4ETXA 2V1AA 2J3WA 4B93A 5DFYA 2OAQ1 5F5YA 3CAXA 3F1NB 3VE3A 4G3WA 2PR6A 4BBTA 2LB5A 3T4JA 3B47A 4Q0HA 2ZMVA 1NRJA 5HDSA 4Z1WA 4R3AA 3K3DA 2CMNA 3LFVA 2VGLS 1V9ZA 4PKYA 3LIFA 4NXGA 1OTDA 2Z6CA 4MDZA 3MJQA 3EQUA 2J3TD 3PBTA 4KUKA 3E4OA 1TD5A 1T1BA 2VLGA 2ZOIA 5IU1A 2W3EA 4WEKA 3PBSA 1N9OA 4MN5A 5EFWA 4Y5FA 1P97A 2PD8A 4CQHA 4MMNA 5L8MA 4GCZA 3C2WA 2P04A 1BYWA 3A0SA 3S7NA 1G6OA 1OT9A 3MR0A 5LBRA 3UMDA 1OTBA 2W1TB 2J80A 1F9IA 1OTEA 4NEED 3EGXC 1DRMA 3RFBA 2W3HA 2FZ0A 1LL8A 3LIAA 2L4RA 2JKTM 2D01A 5DF9A 1UWPX 3OC2A 4LRYC 4DMZA 3DBAA 2O9CA 2KDKA 3PBQA 4ETZA 3A0VA 1XJ6A 2W3FA 3ZQ5A 4R38A 3VOLA 2A2LA 2WKQA 4PHTA 4IHQA 1ZTUA 1MZUA 2PYRA 1S67L 3PBOA 4LRZE 4BBUA 2B18A 1XJ4A 4EEPA 3EQVA 1S66L 2M1CA 2FH5A 4L9GA 4OOLA 4MN7A 1S1ZA 3F1PA 3R4KA 3HCYA 2P7JA 3PYPA 2V0WA 3CUEC 3R7WA 4NXBA 2QYBA 3LI9A 2YKFA 3EEHA 4HJ3A 4RQ9A 4Y3IA 2KLIA 3KSFA 4L0LA 4HH3A 3P01A 4EUVA 3PR6A 3BY8A 1UWNX 4L9FA 4EESA 2XA7M 1X0OA 1LSWA 4EW7A 1DP8A 2W27A 2G7UA 4GS9B 2EWWA 5DKKA 2PR5A 3O5YA 4XT2A 2PD7A 3TW8A 3HJKA 5F68A 5C5KA 3A0RA 4GS9A 3LIDA 2GX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BWL A;  3IS2 B;  1OT6 A;  4EXO A;  3UME A;  3NHQ A;  4NXE A;  5KIZ A;  1XJ3 A;  3LIB A;  5HZH A;  3BY9 A;  2PHY A;  3IS2 A;  3H82 B;  3B33 A;  1OTI A;  3T50 A;  3SW1 A;  3F1N A;  2B02 A;  3UB7 A;  3KX0 X;  2W0N A;  4I38 A;  3D72 A;  5HDD A;  1LSV A;  3H82 A;  3E4P A;  1N9N A;  1S1Y A;  5AVE A;  4HIA A;  3ICY A;  2R78 A;  1S4R A;  2QHK A;  2V9A A;  3F1O B;  3K3C A;  4HJ6 A;  1VB6 A;  3VE4 A;  4HHD A;  5HWT A;  2I9V A;  5G4Y A;  2INW A;  1OJG A;  1TS0 A;  1TS6 A;  1OJ5 A;  4JGR A;  2VV7 A;  3LIC A;  3NJA A;  4I39 A;  2QKP A;  5TBM B;  3GDI A;  3UE6 A;  3HJI A;  4I3I A;  1T18 A;  4R6L A;  2GJ3 A;  3CLO A;  1EW0 A;  5HWV A;  2KX6 A;  3UB9 A;  4JGP A;  3LI8 A;  1ODV A;  4I3A A;  3IBR A;  3NOT C;  3ULF A;  5TBM A;  1TS7 A;  3NOU C;  2OWH A;  5F6A A;  5J4E A;  2A24 B;  4M4X A;  4GHI B;  1XFN A;  1GSW A;  1JNU A;  3FG8 A;  4H6J B;  2L0W A;  3H9W A;  2OWJ A;  5J7E A;  2HV1 A;  4HY8 A;  4YWZ A;  4GHI A;  3EWK A;  4GW9 A;  3CWF A;  3LIE A;  4HP4 A;  5IS1 A;  1GSX A;  5DJT A;  3H7W B;  4LPZ A;  2QWS A;  2JN7 A;  3MQQ A;  1WA9 A;  5J3W A;  5HSQ A;  2WKR A;  3P7N A;  2L1M A;  2PYP A;  2VV6 A;  4EET B;  4K08 A;  5DKL A;  4R70 A;  4L9E A;  4WF0 A;  3LUQ A;  5G4Z A;  3MXQ A;  5HDC A;  5I5L A;  1D7E A;  2VV8 A;  1DP6 A;  2H28 A;  4WLA A;  4EER A;  2V0U A;  3OLO A;  5HD5 A;  4HH2 A;  4E04 A;  2YKH A;  1T19 A;  2D02 A;  3C8C A;  4HP9 A;  5AVF A;  4WN5 A;  4KQD A;  5HD3 A;  1T1C A;  2EA9 A;  1G28 A;  1LSX A;  4BBV A;  3MFX A;  4HOI A;  4JGQ A;  3PHY A;  5HWW A;  3NOP C;  1DP9 A;  1UGU A;  4WUJ A;  3F1O A;  1TS8 A;  1N9L A;  4EQ1 A;  2PDR A;  4HJ4 A;  5A8B A;  2JHE A;  3FC7 A;  2QJ7 A;  4PKY G;  4WL9 A;  5F69 A;  3RH8 B;  5DJU A;  2BAS A;  2QJ5 A;  3F1P B;  4MN6 A;  2ZBB A;  4I5S A;  4DJ3 A;  1NWZ A;  1T1A A;  1F98 A;  3UB6 A;  4HNB A;  1XJ2 A;  1LT0 A;  2V1B A;  4LLO B;  2VEA A;  2Z6D A;  4HQA A;  4JGO A;  1KOU A;  1OTA A;  1S4S A;  1Y28 A;  4XT2 B;  3UB8 A;  4NXF A;  2ZOH A;  1P0Z A;  3LYX A;  1D06 A;  2A24 A;  1GSV A;  2OOL A;  4HI4 A;  4F3L B;  4I3J A;  3MQO A;  4KUO A;  1V9Y A;  3G6O A;  4H6J A;  4DJ2 A;  3RTY A;  1XFQ A;  4EEU A;  3E4Q A;  4B9O A;  2WKP A;  4LRX C;  4F3L A;  2K7S A;  3GEC A;  3H7W A;  2V1A A;  5F5Y A;  3CAX A;  3F1N B;  3VE3 A;  2PR6 A;  4BBT A;  5HDS A;  4R3A A;  3K3D A;  2CMN A;  1V9Z A;  4PKY A;  3LIF A;  4NXG A;  1OTD A;  2Z6C A;  3MJQ A;  4KUK A;  3E4O A;  1T1B A;  2VLG A;  2ZOI A;  5IU1 A;  1N9O A;  4MN5 A;  5EFW A;  1P97 A;  2PD8 A;  4GCZ A;  3C2W A;  3A0S A;  1BYW A;  1OT9 A;  3MR0 A;  3UMD A;  1OTB A;  2J80 A;  1F9I A;  1OTE A;  1DRM A;  1LL8 A;  3LIA A;  2L4R A;  2D01 A;  1UWP X;  4LRY C;  2KDK A;  3A0V A;  1XJ6 A;  3ZQ5 A;  4R38 A;  3VOL A;  2WKQ A;  1MZU A;  2PYR A;  1S67 L;  4LRZ E;  4BBU A;  4EEP A;  1XJ4 A;  1S66 L;  2M1C A;  4L9G A;  1S1Z A;  3F1P A;  2P7J A;  3PYP A;  2V0W A;  4NXB A;  3LI9 A;  2YKF A;  3EEH A;  4HJ3 A;  4RQ9 A;  4HH3 A;  3BY8 A;  1UWN X;  4L9F A;  4EES A;  1X0O A;  1LSW A;  4EW7 A;  1DP8 A;  2W27 A;  4GS9 B;  5DKK A;  2PR5 A;  4XT2 A;  2PD7 A;  3HJK A;  5F68 A;  3A0R A;  4GS9 A;  3LID A; 
#chains in the Genus database with same CATH topology
 2RCX A;  2Y2Q A;  1BUE A;  3MF0 A;  1NY0 A;  3NHQ A;  3MKE A;  5HPI A;  5EM0 A;  4Y0T A;  1L0G A;  5L2F A;  1XJ3 A;  3LR3 A;  2JCH A;  1XKZ A;  3BQA A;  3LIB A;  5HZH A;  3B42 A;  5L09 A;  1O07 A;  2XQZ A;  5CRF A;  1OTI A;  3ZCZ A;  2E8I A;  3DTM A;  1NLZ A;  3O88 A;  1XA7 A;  5JYP A;  2ZLY A;  2ZM2 A;  4I38 A;  2XLN A;  4KZ9 A;  5HDD A;  1CJF A;  3H82 A;  3E4P A;  4X55 A;  3LEQ A;  1FR1 A;  1N9N A;  2NUP C;  4OVD A;  1S1Y A;  3F1O B;  3K3C A;  4S2N C;  4CJN A;  3VP0 A;  4WYY A;  2HZ5 A;  5HWT A;  2XDM A;  1K55 A;  3SS4 A;  4U0X A;  5CED A;  2HGV A;  2INW A;  1KGG A;  5HAR A;  5FEF A;  3ZFZ A;  1H3Q A;  1WYC A;  1NLY A;  4DE0 A;  3NJA A;  4E3O A;  2EX6 A;  1BTL A;  3SH8 A;  2VGK A;  3AGD A;  4JKT A;  4I3I A;  1YPR A;  1YMS A;  2WKE A;  4JGP A;  1ODV A;  4AFI A;  1OME A;  4G3V A;  5CGW A;  1MWR A;  1PW8 A;  5F6A A;  4DE2 A;  5J4E A;  2JKG A;  4ARZ B;  5F82 A;  2WGW B;  4Y2F A;  4M4X A;  4GHI B;  4Z9Q A;  2VKS A;  4H6J B;  1ZHH B;  4C3Q A;  2JKF A;  4QPR A;  2HV1 A;  3O3V A;  5HAI A;  1VM1 A;  4HY8 A;  2QZ6 A;  5M1A A;  4YWZ A;  3S7P A;  3HLC A;  4GW9 A;  2WUQ A;  1GSX A;  1W63 M;  1H8M A;  3JVV A;  1LHY A;  1YAX A;  3DTE A;  3D4F A;  5HSQ A;  5F1G A;  2L1M A;  3MQ0 A;  2Q9M A;  3G2Z A;  2DCF A;  2VV6 A;  5TR7 A;  3BRM A;  4NK3 A;  3RXX A;  5DKL A;  3SS3 A;  4RYE A;  2G2U A;  2J8Y A;  1GA9 A;  3E98 A;  4O7D A;  4QJG A;  4ZRR A;  3VMA A;  3EGD C;  3HUM A;  1D7E A;  2Y2N A;  1NRF A;  1XXM A;  3Q1F A;  4S2J A;  3VV4 A;  4BJP A;  4LCL A;  2R9W A;  1E3U D;  3V67 A;  1DP6 A;  2C5W B;  5CER A;  1FR6 A;  4UQI S;  2XK1 A;  4XUZ A;  1DJA A;  3S7O A;  1DJB A;  3C8C A;  2OLU A;  4KQD A;  1T1C A;  1H5X A;  2WKI A;  2QMI A;  2BG1 A;  3O86 A;  4KQO A;  1LSX A;  2KOI A;  4Q0J A;  2O0Y A;  2GDN A;  4HOI A;  3KYQ A;  3PHY A;  3C4P A;  3NOP C;  4X53 A;  3Q81 A;  3IX8 A;  5F83 A;  1TDL A;  3IBJ A;  3F1O A;  4GB7 A;  3TJZ C;  2ZQA A;  3IXD A;  2OAP 1;  2ZD8 A;  2PDR A;  1FCN A;  3E2K A;  4A5R A;  3OPP A;  3EEA A;  3W4O A;  1NYM A;  3OOV A;  3FPV A;  4JXW A;  3A3E A;  4DXB A;  2HP9 A;  3F1P B;  1JTD A;  4MN6 A;  4OKP A;  3R7W B;  3MSH A;  2ZBB A;  1K38 A;  1T1A A;  1IYO A;  4JXG A;  1F98 A;  1ONH A;  3KSH A;  3UB6 A;  3NDE A;  4FTX A;  1FIK A;  1XJ2 A;  4YFM A;  2ZQ9 A;  4G3K A;  3HLB A;  5HPF A;  2J3T C;  1KE0 A;  1PWC A;  2IWB A;  1A0K A;  4XT2 B;  5L07 A;  1VET B;  3PXP A;  4WZ5 C;  2J9P A;  3G30 A;  2VJW A;  3JYI A;  3IHB A;  1ES4 A;  4Q0I A;  2WGW A;  1GSV A;  3IT9 A;  4HI4 A;  4U3T A;  1BLS A;  4F3L B;  1BLP A;  5EVL A;  4GN2 A;  1V9Y A;  1ERQ A;  4H6J A;  4WEJ A;  3RTY A;  3C5A A;  4WEL A;  2EWV A;  1HD8 A;  3JVU A;  1BLC A;  4GZB A;  1VEU A;  3WRT A;  1RCJ A;  1YMX A;  1N9B A;  3AGF A;  2Y79 A;  3GEC A;  1LI0 A;  4S2K A;  2V1A A;  4FH4 A;  5GLD A;  4Q0H A;  3UB5 P;  1JTG A;  1NRJ A;  5DTK A;  2XH9 A;  4Z1W A;  1XA1 A;  2Y59 A;  1V9Z A;  1PWG A;  3DWZ A;  3EQU A;  1L0E A;  1TD5 A;  1M40 A;  4MEZ A;  5IU1 A;  2W3E A;  4QY5 A;  1N9O A;  1PNE A;  3IF6 C;  2X71 A;  1K57 C;  3A0S A;  4ZJ2 A;  2Q0O A;  3DWK A;  1G6O A;  3S7N A;  3MR0 A;  5LBR A;  1OTB A;  3IXB A;  2W1T B;  4LGW A;  1DRM A;  3QP8 A;  3GMW A;  2FZ0 A;  2D01 A;  1UWP X;  3IWQ A;  4HBT A;  4OQ0 A;  4DMZ A;  1ZG6 A;  2Y2L A;  3TG9 A;  3A0V A;  3C7V A;  3SH9 A;  3PBO A;  1Z6F A;  2PYR A;  4EEP A;  2B18 A;  3WS4 A;  1NJ4 A;  3EQV A;  4FCF A;  1EI5 A;  4M3K A;  4OOL A;  4MN7 A;  4MBF A;  3F1P A;  5EV0 A;  2Z2M B;  3PYP A;  3R7W A;  2QYB A;  3EEH A;  4HJ3 A;  4Y0O A;  3BEC A;  4HH3 A;  5GLC A;  3BY8 A;  1UWN X;  4EES A;  2XA7 M;  3IXH A;  5E2G A;  4EW7 A;  1ES3 A;  4N9K A;  2HPB A;  4X56 A;  1JWZ A;  3WS2 A;  4OQI A;  2G7U A;  1KVM A;  3NI9 A;  3DAV A;  4XT2 A;  2IWD A;  3TW8 A;  1MWT A;  4GD8 A;  4N1X A;  4WM9 A;  5GLB A;  2PU2 A;  5C5K A;  2PU4 A;  4QD4 A;  5BOH A;  3A0R A;  4GS9 A;  3MKF A;  5FL3 A;  1OT6 A;  2XD5 A;  4E3N A;  4EXO A;  1S0W A;  4GD6 A;  2HP5 A;  1P9W A;  5KIZ A;  2E8J A;  4OPR A;  4R4R A;  4ID4 A;  3BY9 A;  5EE8 A;  2P9V B;  2ZL1 A;  4FOF A;  3IS2 A;  3H82 B;  4FUW A;  1NZU A;  3UDX A;  4S2L A;  4LV1 A;  3WS1 A;  3BLM A;  4BWI A;  3QP5 A;  1H8Y A;  3LGO A;  1EWZ A;  3CPT B;  3KX0 X;  3ZG9 B;  1MWU A;  4E3I A;  3D72 A;  3QP1 A;  3V3R A;  4ZDX A;  3N6I A;  4HIA A;  1G6A A;  4QB8 A;  1S4R A;  1DY6 A;  2V9A A;  3G35 A;  4EWF A;  1YKD A;  3NIA A;  1KE4 A;  4CLC B;  4HHD A;  2ZC6 B;  4P0M A;  1K6S A;  3N8S A;  4EBP A;  4OQH A;  3WS0 A;  1TS0 A;  3IWI A;  2W1T A;  1OJ5 A;  2VV7 A;  5EVI B;  4I39 A;  2EFU A;  1BUL A;  1BT5 A;  1KGE A;  1PWD A;  2H0Y A;  2Y2G A;  3HJI A;  5AQ9 A;  1T18 A;  2VK3 A;  4R6L A;  3FZC A;  1E4D A;  1NYY A;  3QP2 A;  2Y2O A;  2Y55 A;  2Y2P A;  1EW0 A;  3QP4 A;  5HWV A;  3UB9 A;  1F5M A;  3LI8 A;  3IH9 A;  4WBG A;  4PPR A;  4QU3 A;  3RJU A;  4XXR A;  5TJJ A;  1K0K A;  1AXB A;  1XFN A;  4NG2 A;  2V8F A;  1ES2 A;  1JNU A;  1IYS A;  4JLF A;  3U2A A;  2ZM8 A;  2OWJ A;  3IXG A;  1SKO B;  2Y2K A;  3WS5 A;  3OZH A;  4PM7 A;  3EWK A;  4C6Y A;  3CWF A;  3LIE A;  1FIL A;  1NZO A;  5DJT A;  1DJC A;  3T4L A;  1STZ A;  4LPZ A;  3IX3 A;  2QWS A;  2JN7 A;  1L0D A;  3P7N A;  3CMZ A;  3JPU A;  5CGS A;  1FOF A;  2PT7 A;  2XRN A;  4L9E A;  4BQM A;  1Y54 A;  3LUQ A;  5IT5 A;  2ZJ9 A;  5HDC A;  4JF6 A;  5FQM A;  3KO6 A;  2HDU A;  4O0P A;  2Y4A A;  5CXW A;  2P9V A;  4QHC A;  3ZNT A;  1I5Q A;  3NCK A;  3S1Y A;  2YKH A;  4KQQ A;  5AVF A;  4P6Z M;  1CI8 A;  3CPT A;  5HD3 A;  2Y2I A;  2EA9 A;  5EVE A;  4S2P A;  2HJE A;  4R0Q A;  2Y2H A;  4OOY A;  4LEN A;  3MFX A;  4CLC D;  1GHM A;  4JGQ A;  2ZM0 A;  2UWX A;  3SZT A;  5HWW A;  1K56 A;  1DP9 A;  1UGU A;  2NUT C;  2Y2M A;  5EOE A;  4D2O A;  2XEP A;  4EQ1 A;  5HW3 A;  4CLC A;  1SHV A;  4HJ4 A;  4X69 A;  1YLP A;  5EVI D;  4PKY G;  3A3D A;  5AQ7 A;  2BAS A;  3QHY A;  4I5S A;  4B88 A;  4DJ3 A;  1NWZ A;  4NET A;  4Q8I A;  4JBF A;  2XF3 A;  3G34 A;  5EVI A;  3T4T A;  2EX2 A;  4HNB A;  2HDS A;  4ZAM A;  2V1B A;  4R3B A;  3L7H A;  2VEA A;  2Z6D A;  4II7 A;  1KOU A;  4PM6 A;  4UHU A;  1FSW A;  3MZD A;  4PAU A;  4DDY A;  1S6R A;  3Q7Z A;  1YLJ A;  3ZYT A;  3UB8 A;  3DTK A;  3GVB A;  4NXF A;  5J8X A;  4ESP A;  4ZJ1 A;  4S2I A;  4DDS A;  3LYX A;  3FKW A;  1VEU B;  3GSG A;  3MMH A;  3LR4 A;  4KUO A;  3C30 A;  3G6O A;  4GLQ A;  2VGL M;  1MBL A;  4DJ2 A;  1BSG A;  1PW1 A;  5DFX A;  1SKO A;  4QY6 A;  5E43 A;  2HDR A;  4EEU A;  2VA0 A;  3E4Q A;  3HLF A;  5EM1 A;  3T12 B;  1IYP A;  4LRX C;  4E3J A;  4EBL A;  1YT4 A;  3BLS A;  4ETX A;  3ZVT A;  4B93 A;  2OAQ 1;  3CAX A;  3HLG A;  5CHJ A;  2WAE A;  4B4Z A;  2WGI A;  2PR6 A;  5TGF A;  3LO7 A;  2ZMV A;  4KEN B;  4KZ8 A;  4R3A A;  3P09 A;  4HES A;  4PKY A;  3LIF A;  4MDZ A;  1IKI A;  4LV0 A;  3PBT A;  3E4O A;  3C4O A;  2VLG A;  2ZOI A;  3PBS A;  5DTS A;  3B3X A;  2H0T A;  1Q2Q A;  2PD8 A;  2JC7 A;  2OLV A;  5L8M A;  4GCZ A;  4R3J A;  1PI5 A;  3C2W A;  2V2F F;  5DVA A;  4JXV A;  3UMD A;  1HVB A;  2J80 A;  2ZC3 B;  4NEE D;  3RFB A;  3V5M A;  5A90 A;  3LIA A;  2EX9 A;  4X6T A;  3UO9 A;  3HBR A;  4X25 A;  5EUA A;  1F2K A;  3PBQ A;  2C6W B;  1KVL A;  2W3F A;  3IF5 A;  4Y13 A;  3UNW A;  2WKQ A;  4PHT A;  4RVA A;  3UN7 A;  1S66 L;  5E2F A;  2FH5 A;  4L9G A;  4DE3 A;  3O87 A;  2V0W A;  4NXB A;  2CC1 A;  4XUX A;  4Y3I A;  2JE5 A;  3PR6 A;  3BEB A;  4P85 A;  1X0O A;  1LSW A;  4KZ6 A;  2W27 A;  4GS9 B;  3M2K A;  3O5Y A;  4KZA A;  1XP4 A;  5FDH A;  5EOO A;  4Y15 A;  2DRW A;  5F68 A;  5CEC A;  2ZL1 B;  3IS2 B;  1O7E A;  5FQ9 A;  5HAP A;  1HZO A;  3W4Q A;  4O01 A;  2JKT I;  1XGI A;  2EXA A;  4MBH A;  2AVX A;  1SZV A;  2LB9 A;  3A3J A;  3D3O A;  3B33 A;  4K0W A;  2HDQ A;  3T50 A;  5CGX A;  1QMF A;  3HUO A;  1LL9 A;  2W0N A;  4OLG A;  3V3S A;  3EOI A;  1YLZ A;  1K4F A;  1NXY A;  3ZGA B;  5AJG A;  3I7J A;  3HL9 A;  3ITA A;  3ICY A;  2O9B A;  2QHK A;  4FD8 A;  4HJ6 A;  3UPO A;  5GHX A;  1VB6 A;  3VE4 A;  4ZBE A;  2ZQ8 A;  2A3U A;  1IFQ A;  4YIN A;  1IOU A;  2FFF B;  4OPZ A;  2HF6 A;  2I9V A;  2VX8 A;  3UPN A;  3TE8 A;  3Q7V B;  2IA2 A;  5KSH A;  5L10 A;  1KDS A;  1TS6 A;  3IHA A;  3LIC A;  3S7Q A;  1ES5 A;  4MCW A;  3UE6 A;  2K31 A;  4X68 A;  5FAQ A;  5AQA A;  5GHZ A;  3LY3 A;  2GJ3 A;  1ZG4 A;  3CLO A;  4IBR A;  5HL6 A;  1GCE A;  4KZ5 A;  4I3A A;  3NOT C;  5TBM A;  1TS7 A;  1J3W A;  1VHM A;  1RGZ A;  1K55 C;  2A24 B;  2XRO A;  5CHM A;  3HLE A;  1YQS A;  1IKG A;  3FG8 A;  2XGN A;  4OP8 A;  2PRF A;  2L0W A;  1AWI A;  1H0M A;  5J7E A;  3HRE A;  1TDG A;  1TF1 A;  1WYB A;  4EBN A;  3IF6 B;  1PZO A;  4UQI M;  5IS1 A;  3H7W B;  2V20 A;  5EVI C;  3LEZ A;  3MQQ A;  4OPQ A;  2XR0 A;  2ZMF A;  3C38 A;  2PYP A;  4K08 A;  1SCW A;  4IJG A;  4R1G A;  4D60 A;  3CG5 A;  5G18 A;  5M18 A;  4R70 A;  3ZNY A;  5FAP A;  4WF0 A;  2M7V A;  1ERO A;  5AQB A;  4Y0U A;  5G4Z A;  1ALQ A;  2DNS A;  3MXQ A;  3PBN A;  4KZ4 A;  2WK0 A;  2VGJ A;  4MLL A;  2VV8 A;  4BMW A;  4OP5 A;  2Q9N A;  2H28 A;  4WLA A;  2V0U A;  3OLO A;  3T4Q A;  5HD5 A;  3N8L A;  4GDN A;  3PBR A;  5F1F A;  1T19 A;  1ESU A;  4K0X A;  4E3L A;  3WWX A;  4OLD A;  4BBV A;  2H10 A;  3BFF A;  2ZC7 A;  3FWL A;  2R9X A;  1FQG A;  4JXS A;  3W2Z A;  1K54 A;  2ZQ7 A;  3ZVW A;  3ZG5 A;  1PI4 A;  1N9L A;  3VP1 A;  1K6R A;  3T4S A;  4KQR A;  1FCO A;  3BQ8 A;  2JKR I;  5A8B A;  4P87 A;  3FC7 A;  3TSG A;  4WL9 A;  5F69 A;  3Q7V A;  4JF5 A;  2XSS A;  1CQA A;  4O8G A;  4H8R A;  5DJU A;  3HLW A;  4E6X A;  2EXB A;  4GJ4 A;  5IHV A;  3Q82 A;  1MKI A;  2K2N A;  4E3M A;  2O9A A;  4DE1 A;  2WZZ A;  4WZ4 A;  3OCL A;  4LLO B;  1OTA A;  4E3K A;  1Z09 A;  1S4S A;  4ZJ3 A;  1Y28 A;  4YOF A;  2W1R A;  4OOM A;  2FFY A;  2ZOH A;  1PRQ A;  1D06 A;  2A24 A;  1OPX A;  4FH2 A;  3FKV A;  2OOL A;  4KZ7 A;  2BLS A;  4I3J A;  3MQO A;  1SDN A;  3ZG8 B;  1FSY A;  3FYZ A;  5GHY A;  5I94 A;  2WAD A;  4MNR A;  4X1L A;  3GR2 A;  3ZDJ A;  4YNR A;  3UE3 A;  3IF6 A;  1PYY A;  3ITB A;  4IUK A;  1K57 A;  2K7S A;  3HUN A;  3H7W A;  3NUL A;  4OQG A;  5DFY A;  4GKU A;  5F5Y A;  3F1N B;  1ACF A;  4KG6 A;  3VE3 A;  5FQK A;  1GHP A;  2Y91 A;  3T4J A;  3B47 A;  1PFL A;  2CMN A;  3LFV A;  1ERM A;  4KG2 A;  1MWS A;  1JVJ A;  1OTD A;  2Z6C A;  1K25 A;  1K56 D;  4EQI A;  4BD1 A;  2XFS A;  3G31 A;  3WRZ A;  4IVK A;  3MS6 A;  4IBX A;  2IWC A;  4Y5F A;  1P97 A;  3T1S A;  1CF0 A;  4CQH A;  4MMN A;  1RP5 A;  2P04 A;  4WMC D;  1OTE A;  1W5D A;  3SOI A;  1W8Q A;  1QME A;  3A3F A;  1HTZ A;  1LL8 A;  2L4R A;  2JKT M;  3M6B A;  4K91 A;  4WMC A;  4LRY C;  3DBA A;  1Q2P A;  1BLH A;  2O9C A;  4ETZ A;  1IEM A;  3ZQ5 A;  4R38 A;  3VOL A;  4R23 A;  4KG5 A;  3UE1 A;  3T1X A;  1ZTU A;  1MZU A;  4LRZ E;  2X01 A;  2M1C A;  2X02 A;  1S1Z A;  4JPM A;  5FQQ A;  5KMW A;  3HCY A;  3UDI A;  4EUZ A;  3U4L P;  1MXO A;  2KLI A;  4RX3 A;  4B4X A;  3IQA A;  1SKF A;  1WE4 A;  4DXC A;  3AGE A;  1LL5 A;  4L9F A;  2PAV P;  3KYE A;  2ZMA A;  4CPK A;  1DP8 A;  3SS5 A;  5DKK A;  2PR5 A;  1MY8 A;  3MXS A;  4E6W A;  5CEB A;  2EX8 A;  3HJK A;  2P74 A;  1W7F A;  2ZC4 B;  4ZTK A;  5EEC A;  4X1M A;  4UA9 A;  3LID A;  3M2J A;  3GTC A;  2GX5 A;  1YLW A;  3ZG0 A;  3BWL A;  3CI6 A;  3NEC A;  1IEL A;  4EU0 A;  3UME A;  3N8R A;  4NXE A;  3D9Y A;  3OPL A;  2XA7 S;  3CHW P;  5HFO A;  4IUH A;  4OPY A;  1JWV A;  2P08 A;  3E0Y A;  3FV7 A;  4OH0 A;  2HJ9 C;  4DRT A;  2Y2J A;  1XX2 A;  2HP6 A;  2PHY A;  4PMA A;  4FSF A;  5MC7 A;  3OCN A;  3SW1 A;  3GRJ A;  3F1N A;  2B02 A;  1W8Y A;  3T1R A;  1IYQ A;  3M6H A;  3UB7 A;  5E2E A;  3UY6 A;  3N7W A;  1LSV A;  4UAA A;  3VFH A;  3L9K A;  5AVE A;  1L0F A;  1ONG A;  3CUE A;  2ZC5 B;  2R78 A;  2WGV A;  2PBY A;  1RGY A;  1E3U A;  4ME4 A;  1YSQ A;  4Y7P A;  1LI9 A;  3VP3 A;  3UPP A;  3SH7 A;  2GZA A;  4Y17 A;  3T4O A;  5FAO A;  5G4Y A;  5A91 A;  1OJG A;  3KYZ A;  3NBL A;  4KZB A;  2XFT A;  4IVI A;  5FAS A;  4GOG A;  4JGR A;  5KSC A;  3T4K A;  4DF6 A;  3MXR A;  4S2M A;  4P6B A;  2QKP A;  5TBM B;  3NY4 A;  3GDI A;  4KZ3 A;  3QP6 A;  3PTE A;  3DW0 A;  1ZKJ A;  3ZHH A;  4HEF A;  3IX4 A;  2KX6 A;  4F94 A;  3GQZ A;  1E25 A;  3VSL A;  1L2S A;  3IBR A;  3ULF A;  4LV3 A;  2XD1 A;  2I72 A;  3NOU C;  2OWH A;  3BFD A;  1JWP A;  3RXW A;  1K54 C;  1GSW A;  1TEM A;  3KSI A;  3H9W A;  2WYX A;  1L3L A;  4R4S A;  4ARZ A;  5K5B A;  4GHI A;  1D1J A;  4HBU A;  4LCM A;  4HP4 A;  2JKR M;  1TVF A;  1SDE A;  3C7U A;  5FDS A;  3FPW A;  4UEY A;  1KDW A;  3VP4 A;  1CEG A;  3TOI A;  1WA9 A;  2UV0 E;  5J3W A;  3G2Y A;  2WKR A;  4S2N A;  5EPH A;  4EET B;  4PM9 A;  4LV2 A;  3LR0 A;  5CHU A;  1MC0 A;  2BTF P;  3QNC A;  5FQJ A;  1I2S A;  2ZQD A;  3BYD A;  5CTM A;  1FCM A;  3NC8 A;  5M19 A;  5I5L A;  3BJN A;  1CEF A;  3ISG A;  5KZH A;  4N9L A;  5DTT A;  3KSG A;  3LR5 A;  1K4E A;  2B5R A;  4EER A;  4BEN A;  2OV5 A;  1G5U A;  4HH2 A;  5HAQ A;  4E04 A;  1P9R A;  4LFU A;  2D02 A;  4HP9 A;  4WN5 A;  1W79 A;  5CTN A;  1BZA A;  1G28 A;  5FSR A;  4RA7 A;  1I2W A;  2ZQC A;  3OPR A;  5FA7 A;  1PIO A;  4DKI A;  2O99 A;  2J7V A;  4WUJ A;  3VFF A;  3HLD A;  4EV4 A;  1TS8 A;  4BL2 A;  2W3D A;  3W8K A;  1W63 Q;  1U60 A;  3Q07 A;  2QPN A;  2JHE A;  3BW6 A;  3VOY A;  2QJ7 A;  1MKM A;  4QWO A;  3RH8 B;  2B95 A;  3CZD A;  4P6Z S;  2QJ5 A;  2V8C A;  2W3G A;  5TFQ A;  3VSK A;  3TRC A;  4S2O A;  5FEG A;  1MPL A;  1VQQ A;  3OBF A;  1YSP A;  2JBF A;  1YLY A;  2WZX A;  3V39 A;  1LT0 A;  1HLU P;  3CIT A;  2H5S A;  3PAE A;  4HQA A;  2V1Z A;  4UA6 A;  4N92 A;  4JGO A;  3G4P A;  2M7U A;  4CLC C;  1J9M A;  4CLC E;  2G2W A;  1P0Z A;  1N4O A;  2WAF A;  3MZF A;  2GNX A;  4UA7 A;  3T1Q B;  1G68 A;  4GNU A;  2DMW A;  2VZW A;  1PZP A;  3MZE A;  3P98 A;  3K2N A;  5DF7 A;  3UDF A;  5JYO A;  4BL3 A;  3BFE A;  1VET A;  3CJM A;  1XFQ A;  3QNB A;  4NKP A;  5FI2 A;  3OPH A;  4B9O A;  1KGF A;  5CX7 A;  3N4I A;  2WKP A;  5A93 A;  3E2L A;  3S22 A;  2WKH A;  4F3L A;  5U47 A;  3G32 A;  2Y8H A;  4DN0 A;  1YM1 A;  2MJ6 A;  2J3W A;  5FAT A;  4G3W A;  4BBT A;  2LB5 A;  1XGJ A;  3DTI A;  1C3B A;  3BFG A;  3LCE A;  3UE0 A;  1YLT A;  5HDS A;  3K3D A;  4JF4 A;  2VGL S;  4GDB A;  3VOZ A;  2ACG A;  4NXG A;  2A49 A;  3MJQ A;  4BLM A;  4OON A;  2J3T D;  4KUK A;  5E2H A;  1T1B A;  3NDG A;  1GA0 A;  4WEK A;  3S4X A;  3PAG A;  5EFW A;  4MN5 A;  2J9O A;  2Z2L B;  4PM5 A;  5DF8 A;  1M6K A;  1GHI A;  1BYW A;  5FI7 A;  3GV9 A;  1OT9 A;  3V50 A;  3LY4 A;  4U0T A;  3ZG7 B;  4N1H A;  3IH8 A;  1F9I A;  3EGX C;  5GL9 A;  2W3H A;  1H8Z A;  4WZ5 A;  5DF9 A;  1ESI A;  4IED A;  3MBZ A;  3VP2 A;  4MBK A;  4BD0 A;  3OC2 A;  3MFD A;  4PM8 A;  2KDK A;  2OSU A;  1XJ6 A;  4C75 A;  2A2L A;  3BFC A;  4IHQ A;  1S67 L;  4BBU A;  1XJ4 A;  2EFX A;  1Y4O A;  1ZC2 A;  3R4K A;  2P7J A;  3CUE C;  3LI9 A;  2YKF A;  4RQ9 A;  2RL3 A;  3KSF A;  4L0L A;  3P01 A;  3HVF A;  4EUV A;  1XPB A;  5D3O A;  1CI9 A;  2PBD P;  5HL1 A;  3A3I A;  2EWW A;  5FQI A;  1CK3 A;  2PD7 A;  5FI6 A;  5HX9 A;  4RX2 A;  5GLA A;  1LLB A;  1KE3 A;  3BM6 A;  5A92 A;  3W4P A;  3IWO A; 
#chains in the Genus database with same CATH homology
 3BWL A;  3IS2 B;  5FL3 A;  1OT6 A;  3CI6 A;  4EU0 A;  3MF0 A;  4EXO A;  3UME A;  3NHQ A;  5HPI A;  4NXE A;  1P9W A;  5KIZ A;  4O01 A;  2JKT I;  2XA7 S;  1XJ3 A;  3LR3 A;  3BQA A;  3LIB A;  5HZH A;  4IUH A;  2P08 A;  3B42 A;  3BY9 A;  3E0Y A;  2HJ9 C;  2PHY A;  2LB9 A;  4FOF A;  4FSF A;  3IS2 A;  3OCN A;  3H82 B;  3D3O A;  3B33 A;  5MC7 A;  1OTI A;  3T50 A;  3SW1 A;  3F1N A;  2B02 A;  4BWI A;  1NLZ A;  3UB7 A;  3KX0 X;  2W0N A;  4I38 A;  3D72 A;  5HDD A;  3EOI A;  1LSV A;  3H82 A;  3E4P A;  5AJG A;  1N9N A;  2NUP C;  1S1Y A;  5AVE A;  4HIA A;  3ICY A;  3CUE A;  2O9B A;  2R78 A;  1S4R A;  2QHK A;  2V9A A;  3F1O B;  3K3C A;  1YKD A;  4ME4 A;  4HJ6 A;  1YSQ A;  1VB6 A;  4CLC B;  3VE4 A;  4HHD A;  1IFQ A;  1IOU A;  5HWT A;  2GZA A;  2HF6 A;  3T4O A;  2I9V A;  2HGV A;  2VX8 A;  5G4Y A;  3TE8 A;  2INW A;  1OJG A;  3KYZ A;  2IA2 A;  1TS0 A;  5KSH A;  2W1T A;  1H3Q A;  1TS6 A;  1OJ5 A;  1NLY A;  4JGR A;  2VV7 A;  3LIC A;  3NJA A;  3S7Q A;  3T4K A;  4MCW A;  4I39 A;  2QKP A;  5TBM B;  3GDI A;  3UE6 A;  2K31 A;  3HJI A;  4I3I A;  1T18 A;  4R6L A;  2GJ3 A;  3CLO A;  1EW0 A;  5HWV A;  2KX6 A;  5HL6 A;  3UB9 A;  4JGP A;  1F5M A;  1ODV A;  3LI8 A;  3IBR A;  4I3A A;  3NOT C;  3ULF A;  4AFI A;  5TBM A;  1TS7 A;  3NOU C;  1VHM A;  4G3V A;  2OWH A;  5F6A A;  5J4E A;  2A24 B;  4ARZ B;  2XRO A;  4Y2F A;  4M4X A;  4GHI B;  5TJJ A;  1XFN A;  1GSW A;  3KSI A;  2VKS A;  1JNU A;  3FG8 A;  4H6J B;  1ZHH B;  2L0W A;  3U2A A;  3H9W A;  2OWJ A;  5J7E A;  4QPR A;  2HV1 A;  4HY8 A;  4ARZ A;  5K5B A;  4YWZ A;  4GHI A;  3S7P A;  1TF1 A;  3EWK A;  4GW9 A;  3CWF A;  3LIE A;  4HP4 A;  2JKR M;  4UQI M;  5IS1 A;  1GSX A;  1W63 M;  5DJT A;  3H7W B;  3FPW A;  4UEY A;  1H8M A;  3JVV A;  3T4L A;  1STZ A;  4LPZ A;  1YAX A;  2QWS A;  2JN7 A;  3MQQ A;  1WA9 A;  5J3W A;  5HSQ A;  2WKR A;  3P7N A;  2L1M A;  3MQ0 A;  2ZMF A;  3C38 A;  2PYP A;  2VV6 A;  4EET B;  4K08 A;  4IJG A;  3LR0 A;  5DKL A;  4R70 A;  2PT7 A;  2XRN A;  4L9E A;  4WF0 A;  2M7V A;  1MC0 A;  3LUQ A;  5G4Z A;  5IT5 A;  3MXQ A;  3PBN A;  3E98 A;  5HDC A;  4ZRR A;  3EGD C;  5I5L A;  3BJN A;  1D7E A;  3KO6 A;  2VV8 A;  4O0P A;  3VV4 A;  4BMW A;  3KSG A;  4BJP A;  3LR5 A;  3V67 A;  1DP6 A;  2H28 A;  4WLA A;  4EER A;  2V0U A;  3OLO A;  3T4Q A;  5HD5 A;  4UQI S;  4HH2 A;  4E04 A;  3PBR A;  1P9R A;  2YKH A;  3S7O A;  1T19 A;  2D02 A;  3C8C A;  4HP9 A;  5AVF A;  4P6Z M;  4WN5 A;  4KQD A;  5HD3 A;  1T1C A;  2EA9 A;  2HJE A;  1G28 A;  4KQO A;  1LSX A;  2KOI A;  4Q0J A;  4BBV A;  3MFX A;  4CLC D;  2O0Y A;  4HOI A;  4JGQ A;  3KYQ A;  3PHY A;  5HWW A;  3NOP C;  1DP9 A;  1UGU A;  2NUT C;  2O99 A;  3W2Z A;  4WUJ A;  3IBJ A;  3F1O A;  3TJZ C;  1TS8 A;  1N9L A;  4EQ1 A;  2OAP 1;  4CLC A;  2W3D A;  2PDR A;  1W63 Q;  3T4S A;  4HJ4 A;  3BQ8 A;  3EEA A;  2JKR I;  5A8B A;  2JHE A;  3BW6 A;  3FC7 A;  2QJ7 A;  3OOV A;  1MKM A;  4PKY G;  4WL9 A;  5F69 A;  3RH8 B;  3FPV A;  2XSS A;  4O8G A;  5DJU A;  2BAS A;  2QJ5 A;  3F1P B;  4P6Z S;  2W3G A;  4GJ4 A;  4MN6 A;  3R7W B;  2ZBB A;  4I5S A;  3TRC A;  4DJ3 A;  1NWZ A;  1T1A A;  1F98 A;  3KSH A;  2K2N A;  3UB6 A;  3OBF A;  3T4T A;  1YSP A;  2O9A A;  4HNB A;  1XJ2 A;  1LT0 A;  4G3K A;  3CIT A;  2V1B A;  3OCL A;  4LLO B;  5HPF A;  2VEA A;  2Z6D A;  4HQA A;  2J3T C;  4II7 A;  4JGO A;  1KOU A;  1OTA A;  1S4S A;  4PAU A;  2M7U A;  4CLC C;  1Y28 A;  4YOF A;  2W1R A;  4XT2 B;  3ZYT A;  3UB8 A;  4CLC E;  4OOM A;  3PXP A;  4NXF A;  2ZOH A;  1P0Z A;  2VJW A;  3LYX A;  1D06 A;  2A24 A;  4Q0I A;  1OPX A;  2GNX A;  1GSV A;  2OOL A;  4HI4 A;  4F3L B;  4I3J A;  3MQO A;  3MMH A;  3LR4 A;  4KUO A;  1V9Y A;  3C30 A;  2DMW A;  3G6O A;  2VZW A;  4GLQ A;  3K2N A;  4H6J A;  2VGL M;  4WEJ A;  4DJ2 A;  3RTY A;  4WEL A;  5DFX A;  1XFQ A;  2EWV A;  4NKP A;  4EEU A;  2VA0 A;  3E4Q A;  4B9O A;  3JVU A;  5CX7 A;  2WKP A;  4LRX C;  4F3L A;  4YNR A;  3UE3 A;  2Y8H A;  2Y79 A;  4DN0 A;  4IUK A;  2K7S A;  3GEC A;  3H7W A;  2MJ6 A;  4ETX A;  2V1A A;  2J3W A;  4B93 A;  5DFY A;  2OAQ 1;  5F5Y A;  3CAX A;  3F1N B;  3VE3 A;  4G3W A;  2PR6 A;  4BBT A;  2LB5 A;  3T4J A;  3B47 A;  4Q0H A;  2ZMV A;  1NRJ A;  5HDS A;  4Z1W A;  4R3A A;  3K3D A;  2CMN A;  3LFV A;  2VGL S;  1V9Z A;  4PKY A;  3LIF A;  4NXG A;  1OTD A;  2Z6C A;  4MDZ A;  3MJQ A;  3EQU A;  2J3T D;  3PBT A;  4KUK A;  3E4O A;  1TD5 A;  1T1B A;  2VLG A;  2ZOI A;  5IU1 A;  2W3E A;  4WEK A;  3PBS A;  1N9O A;  4MN5 A;  5EFW A;  4Y5F A;  1P97 A;  2PD8 A;  4CQH A;  4MMN A;  5L8M A;  4GCZ A;  3C2W A;  2P04 A;  1BYW A;  3A0S A;  3S7N A;  1G6O A;  1OT9 A;  3MR0 A;  5LBR A;  3UMD A;  1OTB A;  2W1T B;  2J80 A;  1F9I A;  1OTE A;  4NEE D;  3EGX C;  1DRM A;  3RFB A;  2W3H A;  2FZ0 A;  1LL8 A;  3LIA A;  2L4R A;  2JKT M;  2D01 A;  5DF9 A;  1UWP X;  3OC2 A;  4LRY C;  4DMZ A;  3DBA A;  2O9C A;  2KDK A;  3PBQ A;  4ETZ A;  3A0V A;  1XJ6 A;  2W3F A;  3ZQ5 A;  4R38 A;  3VOL A;  2A2L A;  2WKQ A;  4PHT A;  4IHQ A;  1ZTU A;  1MZU A;  2PYR A;  1S67 L;  3PBO A;  4LRZ E;  4BBU A;  2B18 A;  1XJ4 A;  4EEP A;  3EQV A;  1S66 L;  2M1C A;  2FH5 A;  4L9G A;  4OOL A;  4MN7 A;  1S1Z A;  3F1P A;  3R4K A;  3HCY A;  2P7J A;  3PYP A;  2V0W A;  3CUE C;  3R7W A;  4NXB A;  2QYB A;  3LI9 A;  2YKF A;  3EEH A;  4HJ3 A;  4RQ9 A;  4Y3I A;  2KLI A;  3KSF A;  4L0L A;  4HH3 A;  3P01 A;  4EUV A;  3PR6 A;  3BY8 A;  1UWN X;  4L9F A;  4EES A;  2XA7 M;  1X0O A;  1LSW A;  4EW7 A;  1DP8 A;  2W27 A;  2G7U A;  4GS9 B;  2EWW A;  5DKK A;  2PR5 A;  3O5Y A;  4XT2 A;  2PD7 A;  3TW8 A;  3HJK A;  5F68 A;  5C5K A;  3A0R A;  4GS9 A;  3LID A;  2GX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...