1V9ZA

Crystal structure of the heme pas sensor domain of ec dos (ferrous form)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
113
structure length
113
Chain Sequence
GIFFPALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHNREGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGKVYYLALVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heme pas sensor protein
publication title A redox-controlled molecular switch revealed by the crystal structure of a bacterial heme PAS sensor.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 30
structure length 113
sequence length 113
chains with identical sequence B
ec nomenclature ec 3.1.4.52: Cyclic-guanylate-specific phosphodiesterase.
pdb deposition date 2004-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1v9zA00
5DKLA 5F6AA 1XJ3A 4BBUA 3F1NB 5TBMA 1OT9A 4I38A 2VV7A 2W27A 4NXEA 3LYXA 2V0WA 1T1BA 3C2WA 3RTYA 5DKKA 1D06A 2VEAA 1LT0A 3ICYA 2CMNA 4DJ2A 2INWA 4JGPA 4JGRA 5HZHA 2JHEA 1GSXA 1P97A 3LICA 1LSXA 4HI4A 3SW1A 3BWLA 4NXGA 4HOIA 4E04A 3GECA 5HWWA 2GJ3A 4YWZA 1WA9A 4R3AA 1XJ6A 4HH2A 2B02A 1DP6A 1OTAA 4EESA 2ZOIA 1XJ2A 3PHYA 2L4RA 2V0UA 3IS2B 3GDIA 5HDDA 3UE6A 3MXQA 3ULFA 2V1AA 2D02A 2L1MA 3E4QA 1OTDA 4GHIA 4H6JA 4RQ9A 5A8BA 4R6LA 1S4RA 3EWKA 1BYWA 1G28A 3E4OA 5KIZA 3CLOA 4BBTA 3ZQ5A 3B33A 3G6OA 2H28A 3F1NA 3MFXA 3K3CA 2OWHA 1MZUA 4WLAA 1S1ZA 2VV8A 4WL9A 5G4ZA 2L0WA 4HP4A 3A0RA 4HJ3A 3UB8A 4HIAA 4H6JB 1X0OA 3MR0A 4I5SA 3UMEA 2OOLA 5HD5A 4WUJA 2PYPA 2R78A 1LSWA 5DJTA 2A24B 4EEPA 5F5YA 1OTBA 4MN5A 4HP9A 4JGOA 2VLGA 4L9EA 1UWPX 5HDSA 4NXBA 3IS2A 4GCZA 4HJ6A 3KX0X 4HHDA 5G4YA 4DJ3A 4EERA 1XJ4A 2YKFA 3A0VA 1TS6A 3LI9A 4EXOA 3F1OB 3LIBA 4WN5A 3OLOA 4LPZA 3IBRA 4I3IA 2OWJA 2V1BA 3UB7A 3VE3A 3H7WB 1DRMA 3H9WA 2PD8A 4LRXC 1F9IA 1TS7A 2Z6DA 4F3LB 2QHKA 4JGQA 4NXFA 2PHYA 3EEHA 4M4XA 1OTEA 4WF0A 1F98A 2K7SA 5J7EA 4LLOB 5IS1A 5DJUA 4HNBA 2PR5A 1D7EA 5J3WA 3D72A 1S67L 2A24A 3LIFA 1V9YA 4I3AA 2BASA 4EETB 4KUOA 3P7NA 4BBVA 2PR6A 3FC7A 3FG8A 3BY9A 3RH8B 2JN7A 3MQQA 3NOUC 5AVFA 5HSQA 4LRZE 4PKYA 1JNUA 2PD7A 2YKHA 3UB9A 4KUKA 3MQOA 3LIDA 1DP9A 4HJ4A 5HD3A 2PDRA 1TS0A 3F1OA 4KQDA 3MJQA 2KX6A 2WKPA 4I39A 4L9GA 3CWFA 4GW9A 1XFQA 4GS9B 4EQ1A 3H7WA 4HQAA 4R70A 3UB6A 2PYRA 2VV6A 5I5LA 4F3LA 3NJAA 1P0ZA 2QKPA 3H82A 5AVEA 3NHQA 3UMDA 1S4SA 5IU1A 1NWZA 3VE4A 1DP8A 1T18A 3C8CA 4HH3A 1S66L 5HWVA 1V9ZA 3K3DA 1S1YA 3F1PB 2M1CA 3NOTC 4XT2B 1N9LA 3NOPC 5EFWA 4R38A 3A0SA 1N9NA 2D01A 2QWSA 1UWNX 2KDKA 5TBMB 2I9VA 3H82B 4L9FA 5HDCA 4EEUA 3LIAA 1OJ5A 1GSWA 1T19A 3LI8A 3HJIA 2WKRA 4I3JA 1OT6A 2HV1A 5F69A 3T50A 3PYPA 1T1CA 3LIEA 3E4PA 2ZBBA 2QJ5A 2EA9A 2P7JA 4LRYC 4HY8A 2QJ7A 3HJKA 3CAXA 1EW0A 4B9OA 5J4EA 1KOUA 1TS8A 4GS9A 2Z6CA 5F68A 1LL8A 1OTIA 4MN6A 2J80A 4PKYG 1Y28A 1LSVA 1OJGA 4K08A 1XFNA 1ODVA 1GSVA 1T1AA 5HWTA 3VOLA 2V9AA 1VB6A 2ZOHA 4GHIB 3LUQA 3F1PA 3BY8A 1UGUA 4EW7A 2W0NA 4XT2A 2WKQA 1N9OA
chains in the Genus database with same CATH superfamily
1IYPA 4C6YA 1FR1A 2E8IA 5F1GA 3BFEA 3HLGA 4DN0A 1D1JA 3S7QA 1PYYA 2W27A 4PMAA 5EOOA 1KGEA 4NXEA 1L2SA 4R1GA 1K6RA 4OPQA 2J7VA 3O86A 4Y3IA 2GZAA 2A3UA 2CMNA 2INWA 4ETZA 3DBAA 3O88A 3B47A 4JGRA 4NG2A 3OCLA 2JHEA 3VFHA 4CLCA 1GSXA 3LICA 3QP6A 2ZLYA 1SKOA 2HPBA 4E04A 5EE8A 4WELA 2Y2QA 4Y17A 5HWWA 3G31A 2ZC5B 1KE0A 4YWZA 5HARA 4HH2A 3AGDA 4MBKA 1TEMA 3IH9A 4Y7PA 1XJ2A 4IJGA 4X1LA 3C7VA 5EECA 4RX3A 4DMZA 4M3KA 3HLFA 5KMWA 1WE4A 1LLBA 1MWUA 4B88A 4Y0UA 4II7A 1FCMA 4S2NA 2ZQ7A 3CPTB 3U4LP 3OOVA 1HLUP 3BECA 3T4JA 3PBSA 2OSUA 5FEGA 4RQ9A 5TR7A 5FI2A 4EQIA 2QPNA 1NRJA 3SS4A 4QD4A 3EWKA 3BFDA 4N92A 1XX2A 3CLOA 3B33A 3G6OA 2H28A 3L7HA 4X68A 3MFXA 4BWIA 1XGJA 2DMWA 3A3EA 2OWHA 1TDGA 2ZM8A 3SH7A 3PAEA 3KSFA 3IXHA 2VV8A 2HF6A 2V8CA 2X01A 2L0WA 4HP4A 3HUOA 4UAAA 2P9VA 1ONHA 4OQ0A 1KE3A 4GOGA 3MR0A 2OOLA 4P6ZM 4CLCC 2R78A 1LSWA 1H8ZA 2HDUA 1E3UD 1FSYA 3KYQA 3KYEA 3T1XA 5HL6A 1PWDA 3T1SA 4OOYA 4LV1A 4S2KA 3JPUA 3PAGA 4JLFA 3ZFZA 1M6KA 1UWPX 1CI9A 4GCZA 1YMSA 1S0WA 4JF5A 2IWDA 3DWKA 2WKHA 4WEJA 4OPZA 4EUZA 2GX5A 1XJ4A 3L9KA 4KZ8A 1NLYA 1GA9A 4S2NC 5CEBA 1TS6A 4OOLA 4ARZA 3LIBA 3UN7A 3OLOA 4DRTA 4KZAA 4PM8A 4NKPA 3UB7A 3LGOA 3D9YA 1FSWA 3WS5A 4X6TA 1PIOA 4FCFA 2Y2PA 3JYIA 3JVVA 2V1ZA 3SS3A 4JGQA 3CHWP 5CTNA 2PHYA 4RYEA 3EEHA 4UQIM 1PI4A 5U47A 4P6ZS 4WF0A 4LLOB 1D7EA 1NZOA 5J3WA 1FR6A 3D72A 3G32A 1F2KA 2G2WA 5EVLA 2A24A 2XD1A 2QYBA 2XA7M 4DE2A 1YKDA 4R4SA 1V9YA 3TW8A 5CERA 4KUOA 2PR6A 5KZHA 3RFBA 3FG8A 3Q07A 2Y2MA 4G3WA 5FI6A 2K31A 5M1AA 1GA0A 5AVFA 2WZZA 2JBFA 1PWGA 5DF8A 3ZG5A 3QP4A 1BLCA 1RGZA 1Z09A 4KUKA 4K0XA 4S2OA 1L0EA 4UA9A 3LIDA 1JWZA 2X02A 4G3VA 3O87A 3HLEA 3F1OA 4KQDA 3VP2A 2KX6A 1Y54A 1ZHHB 1XFQA 3BFGA 3H7WA 1W63Q 4Y2FA 1YAXA 2VK3A 4IBRA 1W63M 3M2JA 3IHBA 4S2IA 1MWRA 4X53A 1CK3A 3FYZA 1LL5A 4KQQA 3UY6A 4UQIS 3D3OA 1CI8A 5A91A 3G4PA 5HFOA 3HLBA 1DP8A 3AGEA 4HH3A 3C8CA 5L8MA 2NUTC 3GVBA 1V9ZA 4K91A 4KZ9A 1ERQA 3OC2A 1TVFA 2B5RA 4XT2B 1L0GA 1NYMA 1PZOA 1GCEA 2HDQA 1KGGA 2RCXA 1NY0A 3KSGA 3Q81A 5HL1A 1YLWA 1O07A 5E2EA 2I9VA 3H82B 3S4XA 4EEUA 4FH2A 1SZVA 3IF6A 1YLZA 3FV7A 4BD0A 3MZEA 5F69A 3BQAA 3PYPA 1Z6FA 1Q2PA 1T1CA 3P09A 3IBJA 2PBYA 1FQGA 3T1RA 3VV4A 4Y15A 2ZMFA 2QJ5A 4CLCB 2EA9A 3T4LA 4LRYC 4HY8A 3ZG9B 3PBTA 4LV0A 1GHMA 4B9OA 1TS8A 4GS9A 2Y2NA 3C30A 3UPOA 2Z6CA 5J8XA 3IHAA 1VETA 3HLDA 3ZG7B 3WS4A 4MN6A 3N8LA 4FUWA 3UDIA 4R3BA 2EX2A 4GB7A 1T1AA 3TRCA 5L09A 2W3DA 1Q2QA 1P9RA 1M40A 1ACFA 1KVMA 2LB5A 3Q7ZA 2Y2KA 4DE1A 3F1PA 4CQHA 3BY8A 1UGUA 3NI9A 1H8YA 2W0NA 3TE8A 2E8JA 4EV4A 2ZMVA 3NDEA 4QB8A 4BBUA 5TBMA 1OT9A 4I38A 4LFUA 2ZC6B 5D3OA 3C2WA 5EVIA 3RTYA 3IF6C 3DAVA 4Q0HA 3ICYA 2P9VB 3ZG8B 1JTGA 1MC0A 4JGPA 3C38A 5HZHA 2Y2LA 4QU3A 3SW1A 4B4ZA 4ZAMA 3V50A 3LR0A 4N9KA 1ZTUA 1L0DA 1WA9A 4R3AA 5TGFA 3VSKA 4RVAA 1DP6A 2ZOIA 4PM5A 1L0FA 2V0UA 4KQRA 5GLDA 1ZG4A 3MXQA 2Q9MA 3AGFA 3UPNA 1OPXA 3ULFA 2BTFP 2O99A 1QMEA 1JWPA 3MKFA 1NZUA 3ZCZA 1H3QA 2P04A 4H8RA 4ARZB 3CI6A 3GSGA 4R6LA 1S4RA 2WK0A 1BYWA 2H10A 3E4OA 4JXWA 5CGSA 3M2KA 2FFYA 4N9LA 2EFUA 2C5WB 3E0YA 3BLMA 3GQZA 4RA7A 3W2ZA 3K3CA 4GDBA 3M6BA 1IELA 4WLAA 2IA2A 4WMCA 1MPLA 3LY3A 5EVIC 1YSPA 4YNRA 4EBLA 3B42A 3A0RA 4HJ3A 4HIAA 4H6JB 4WYYA 1YQSA 3OPRA 2J9OA 1X0OA 3UDFA 4I5SA 3GMWA 5AQ9A 4OQGA 1XXMA 4KENB 3ZNYA 1F5MA 4WEKA 5DJTA 4ZJ3A 2Y4AA 2ZD8A 1K55A 4PAUA 4S2LA 2PU2A 2A24B 4ZBEA 2BG1A 3KYZA 3BFFA 4MN5A 4OLDA 3N8SA 5GLAA 1VEUA 3R7WB 1K4EA 4JGOA 4L9EA 1BT5A 5HDSA 4NXBA 3IS2A 2Y55A 1W8YA 2KLIA 1K56A 1P9WA 5JYOA 4DJ3A 3FKWA 4JF4A 4HBTA 2WKEA 5FAPA 2YKFA 4JF6A 5F82A 3A0VA 3LI9A 2HP6A 1ZKJA 3F1OB 3GV9A 3VOYA 4CJNA 2Y2IA 3LEZA 4LPZA 5FQMA 3IBRA 2V1BA 1FCNA 3W4QA 4D60A 3H7WB 1DRMA 2PD8A 4KZ5A 4LRXC 1F9IA 3WRTA 4UEYA 1ES5A 1K6SA 4NXFA 3IX3A 2JKGA 4Y5FA 1HZOA 4M4XA 5GLBA 1DY6A 4ZTKA 1OTEA 2ZC4B 2WGWA 2B95A 1KGFA 1PNEA 3MZDA 1K55C 1S67L 4KG2A 5HX9A 1WYCA 1ZG6A 5FATA 4P6BA 1O7EA 2OV5A 5GHZA 3DW0A 3O5YA 1VQQA 1YT4A 3BRMA 3K2NA 1TDLA 1MKMA 2JN7A 3MXSA 1EI5A 1SCWA 4PPRA 1JNUA 2PD7A 4CLCD 3UB9A 4OH0A 2PT7A 1GHPA 3MQOA 4EBPA 2OLVA 3S7PA 5I94A 5EUAA 5JYPA 4I39A 5F1FA 3CWFA 4GW9A 2J9PA 3W8KA 4XUZA 1IOUA 4GS9B 2XH9A 2X71A 1W79A 4K0WA 4FH4A 5A90A 4KZ6A 1VETB 3OPPA 4Q0JA 1WYBA 2PU4A 5M19A 1PI5A 3VP1A 2EX8A 2W3EA 5AVEA 3NHQA 1JWVA 3UMDA 3CITA 4A5RA 4U0TA 1NWZA 4QY6A 3SH8A 4MMNA 3I7JA 1G5UA 1T18A 1W7FA 1S1YA 2PRFA 3F1PB 2M1CA 5CRFA 4L0LA 3QP8A 2Q9NA 5CTMA 4MCWA 1N9BA 4EBNA 1ES4A 3UO9A 3A0SA 2EXAA 2JC7A 4OP5A 2ZC7A 4BQMA 4GNUA 1N9NA 2D01A 2KDKA 3B3XA 3QP5A 5TBMB 3PBQA 2WYXA 4L9FA 4X1MA 4DE3A 5HDCA 1OJ5A 2FFFB 4E3LA 2OLUA 4DKIA 3HJIA 4I3JA 4O7DA 2KOIA 2J3TD 2J3TC 2HP5A 5DTSA 1OMEA 3LIEA 1G6AA 1MWSA 3E4PA 5IHVA 4OPRA 3HJKA 5CECA 4IUKA 1YM1A 3MBZA 1NXYA 2EX6A 4IUHA 1EW0A 5J4EA 1CEFA 2W3HA 2WKIA 3BJNA 5F68A 4DE0A 3VP0A 3T4QA 3A3DA 2Y2OA 2VZWA 1IEMA 2J80A 1IYSA 4GDNA 4KZ3A 5DTKA 1XFNA 2FH5A 3LFVA 4HEFA 1ODVA 1GSVA 4EWFA 4DXBA 1JVJA 3DTEA 2C6WB 4OONA 3LEQA 1FOFA 5HAQA 4MBFA 4IHQA 4GN2A 3LO7A 3IXDA 4ZJ1A 5DKLA 4ZJ2A 1KE4A 2ZQ8A 3KSHA 4CLCE 4RX2A 2VGLM 1FCOA 2VV7A 4YFMA 1IYQA 1NYYA 3LYXA 3BQ8A 1U60A 5CXWA 1D06A 3E2KA 2VEAA 3CJMA 4E3OA 4DJ2A 5FA7A 1NLZA 4LENA 5FDSA 2XEPA 5FI7A 3IWOA 4PM9A 2XA7S 1LSXA 3FPVA 4HI4A 3BWLA 4HOIA 3W4PA 3IX4A 3N6IA 2GJ3A 1XJ6A 4MEZA 4E6WA 4OQHA 2B02A 1OTAA 4GZBA 4EESA 4Z1WA 1YLYA 3IS2B 3GDIA 1XP4A 3CZDA 3UE6A 2G7UA 1SDEA 2V1AA 4E3JA 2L1MA 5FDHA 4WZ5A 3E4QA 1SKOB 1OTDA 2DCFA 5TJJA 3C5AA 1K54A 2AVXA 5FAOA 3IWQA 2HP9A 5A8BA 5AQAA 3GTCA 3RXWA 1G28A 4FTXA 4OP8A 5KIZA 4BBTA 3N4IA 1J3WA 1BLSA 3W4OA 3ZQ5A 3F1NA 3S1YA 2R9WA 3TSGA 1K25A 4LCLA 5CX7A 1S1ZA 4U0XA 3T4OA 4DXCA 1I2SA 1HVBA 2HDRA 4ESPA 4IVIA 3SZTA 4EU0A 3UB8A 2WGWB 5CHUA 3UMEA 4MN7A 4WUJA 1ES2A 3V5MA 2XK1A 2M7UA 4P85A 3IT9A 2Y59A 3Q7VA 5F5YA 4IBXA 4GLQA 1ERMA 3HCYA 2P74A 3LR3A 4HP9A 4DDSA 2WAFA 5DFXA 3EOIA 5FQIA 3OCNA 2VLGA 3QHYA 4B93A 3WRZA 2JKRI 3BLSA 4HJ6A 2XFSA 4HHDA 2HGVA 5G4YA 4E3IA 3DTMA 1DJBA 4F94A 4BD1A 3P01A 1ES3A 3MFDA 3UE1A 4WZ5C 3VP3A 1EWZA 2HDSA 4FOFA 4NETA 2Y8HA 4HESA 4EXOA 1K54C 2W3GA 4C75A 4Y0OA 4BL3A 5KSCA 4WN5A 4I3IA 3UDXA 4MLLA 1YSQA 1BUEA 3H9WA 4Y0TA 3G35A 1EROA 2XR0A 2Z6DA 2XF3A 2QHKA 1NJ4A 3A3JA 3MKEA 1E25A 1S6RA 1SKFA 5A93A 4ZRRA 5AJGA 4JXSA 5FSRA 3DTIA 5CGXA 2WZXA 2K7SA 5DJUA 4HNBA 3LCEA 1XPBA 4GD8A 1K38A 4DF6A 1STZA 4JKTA 3LIFA 5EOEA 3ZVTA 3T4TA 4I3AA 2BASA 2H5SA 1MY8A 3V3RA 3WWXA 4Z9QA 3P98A 5DFYA 3BY9A 1XGIA 3PTEA 3QNCA 4JBFA 5EVID 1VHMA 1CJFA 4OOMA 4LV3A 2QMIA 1QMFA 3Q1FA 4U3TA 1BLHA 3NOUC 1FIKA 3G2ZA 2H0YA 4UA7A 4EUVA 4KZ4A 2J3WA 4R4RA 2Y2HA 3SH9A 1C3BA 2UWXA 1DP9A 2CC1A 2PDRA 1TS0A 3MJQA 4S2PA 2WKPA 3UNWA 4G3KA 5HAPA 1H0MA 4KZBA 2VKSA 3HREA 4R70A 3UB6A 5BOHA 2PYRA 2Y2JA 1K4FA 2ZL1A 2VV6A 2WGVA 4F3LA 3NJAA 1P0ZA 4N1XA 4JPMA 3NCKA 4KG6A 2JKRM 1W5DA 1LL9A 1AWIA 3H82A 4FD8A 2ZQCA 5IU1A 2ZM0A 1LI9A 2QZ6A 5FQQA 3C4PA 3NOTC 3OPLA 1KDSA 3ITBA 1E3UA 3DTKA 4XXRA 1YLJA 3NOPC 3UB5P 5EFWA 4R38A 3OZHA 3NDGA 4WMCD 2QWSA 5HW3A 5FQKA 1GHIA 4KQOA 1PZPA 2EFXA 4ID4A 1GSWA 1T19A 5GL9A 3CG5A 4JXVA 1LHYA 2WKRA 4IEDA 1KVLA 4XUXA 2XROA 5E43A 5LBRA 3NECA 3ZHHA 3BYDA 5E2HA 2B18A 4YOFA 3NC8A 5KSHA 3EEAA 2JCHA 2P08A 3G34A 2Z2LB 4Y13A 3BEBA 1MXOA 2ZC3B 2VA0A 4C3QA 3V3SA 4BENA 3RXXA 3EGXC 3GRJA 1OTIA 4S2JA 2PAVP 3FPWA 3IF6B 1Y28A 4MNRA 1K56D 5HPIA 1OJGA 2Y2GA 4OQIA 4HBUA 3VOZA 3ZYTA 2EX9A 1H8MA 1MWTA 1YLPA 1IYOA 2XLNA 1ZC2A 4QJGA 2ZQ9A 4PM7A 3E2LA 3VOLA 3HBRA 3G30A 2ZOHA 2ZM2A 1PFLA 4IVKA 3PBOA 3WS2A 3LUQA 3RJUA 5CHJA 1XA7A 3PR6A 2Z2MB 3R4KA 5F6AA 2XD5A 4LGWA 1XJ3A 3IWIA 3F1NB 3MF0A 3TG9A 1I2WA 2ZJ9A 2MJ6A 4FSFA 2DRWA 2V0WA 3T4KA 1T1BA 2K2NA 2XDMA 5L07A 3EGDC 4DDYA 3MQ0A 5DKKA 3HLCA 1BTLA 3IF5A 1LT0A 3S7NA 5FASA 2XSSA 2FZ0A 4E3KA 2W1RA 2UV0E 2VGKA 5DVAA 1P97A 2G2UA 3FKVA 5MC7A 4BL2A 2V20A 4GD6A 4KG5A 4NK3A 2XRNA 4NXGA 3S22A 1BULA 4PHTA 4X25A 5E2GA 3GECA 2EWWA 3VP4A 3Q7VB 5HAIA 1HTZA 1H5XA 1ONGA 2OAQ1 5EVIB 2ACGA 3QP1A 3T4SA 4ZDXA 3PHYA 2L4RA 3WS1A 3U2AA 5HDDA 1YLTA 4GKUA 5L10A 2IWBA 2D02A 1CQAA 3S7OA 3MXRA 5AQBA 2W1TA 1BSGA 1BZAA 4GHIA 1VM1A 5FQ9A 2O9BA 4H6JA 2M7VA 3ZGAB 4QY5A 2IWCA 4X55A 5GHXA 3V67A 1NRFA 3C4OA 4Q0IA 4X69A 3KO6A 4R3JA 1BLPA 1MZUA 1CF0A 3BFCA 3R7WA 4WL9A 3LR4A 4GJ4A 4ME4A 5G4ZA 4WZ4A 4UHUA 1PRQA 2RL3A 2WADA 1XKZA 2VGJA 4WBGA 4BLMA 3IH8A 5HD5A 1FILA 2PYPA 4QHCA 5TFQA 3N7WA 3WS0A 4EEPA 2I72A 3NY4A 2V8FA 2VJWA 5GHYA 1OTBA 1ESUA 4OPYA 2GDNA 3DWZA 3TOIA 1MKIA 4LV2A 1PW1A 4JXGA 3KX0X 4O0PA 3A3FA 1Y4OA 5FQJA 4PM6A 4EERA 3VSLA 3SOIA 5CHMA 1TD5A 3CPTA 4BJPA 4E3MA 3HUMA 3VMAA 5IT5A 2XQZA 4P87A 5DTTA 4KZ7A 1IKGA 2Y79A 2OWJA 4MDZA 1VEUB 2BLSA 1MBLA 3IQAA 3VE3A 2EWVA 5FAQA 5G18A 4OLGA 2ZL1B 3LY4A 1TS7A 3PBNA 3FZCA 2HJEA 4P0MA 5CGWA 3VFFA 4F3LB 4OVDA 3HLWA 5DF9A 3ZG0A 1XA1A 2LB9A 2ZQAA 5EPHA 3IXBA 2R9XA 5CEDA 3M6HA 3IXGA 3D4FA 5F83A 3CUEA 1F98A 5J7EA 5IS1A 1E4DA 4MBHA 2PR5A 1AXBA 4CPKA 3E98A 2O9AA 3UE3A 4Q8IA 1RGYA 4BMWA 4B4XA 3NIAA 2VGLS 2JKFA 3A3IA 4EETB 1W8QA 3P7NA 4BBVA 1IFQA 3FC7A 2HJ9C 3ZNTA 4E3NA 1K57A 2JKTI 3RH8B 1ALQA 2HZ5A 3T12B 2WAEA 2Q0OA 1G6OA 3MQQA 1TF1A 5HSQA 1K0KA 1LI0A 4N1HA 3MSHA 4LRZE 4PKYA 4WM9A 2YKHA 1A0KA 5C5KA 1SHVA 4HJ4A 2VX8A 3MZFA 5EV0A 3NBLA 5HD3A 4O8GA 3TJZC 3CMZA 3HVFA 2WGIA 3LR5A 3ZDJA 3EQVA 1J9MA 5EM0A 4L9GA 2ZMAA 4E6XA 5FEFA 5EM1A 4NEED 4EQ1A 2O0YA 3HL9A 2XFTA 4HQAA 4UA6A 2EXBA 3V39A 4QPRA 3N8RA 5I5LA 2O9CA 1ESIA 3QP2A 4D2OA 3FWLA 2QKPA 1DJAA 3QNBA 3UE0A 4O01A 1DJCA 4AFIA 1S4SA 3GR2A 5A92A 5DF7A 2GNXA 4R0QA 3SS5A 3VE4A 1CEGA 3C7UA 3CUEC 1S66L 5HWVA 3K3DA 2H0TA 2V2FF 5EVEA 1JTDA 5GLCA 1L3LA 5M18A 3G2YA 1IKIA 1HD8A 2XGNA 1N9LA 1PWCA 2JE5A 3IX8A 3MMHA 3T1QB 3KSIA 3ITAA 1RP5A 1UWNX 4OKPA 2NUPC 1K57C 2W3FA 3ISGA 4ETXA 5L2FA 3BW6A 3LIAA 4LCMA 3LI8A 1N4OA 2DNSA 1OT6A 1YMXA 3EQUA 1I5QA 2HV1A 2PBDP 5E2FA 3T50A 5HPFA 3BM6A 2J8YA 4R23A 2ZBBA 2P7JA 3NULA 2QJ7A 3HUNA 4QWOA 3CAXA 1YPRA 1KOUA 2A49A 3PXPA 2A2LA 2Y91A 5FL3A 2ZQDA 1PW8A 1LL8A 3MS6A 4S2MA 3OBFA 4PKYG 2JKTM 1LSVA 1SDNA 1RCJA 3Q82A 4K08A 2OAP1 3PBRA 5K5BA 3O3VA 2WUQA 3OPHA 5HWTA 2V9AA 1VB6A 2W1TB 4YINA 4GHIB 5AQ7A 3UPPA 4EW7A 4X56A 1G68A 3JVUA 1KDWA 4XT2A 2WKQA 3ZVWA 1N9OA
chains in the Genus database with same CATH topology
5DKLA 3PR6A 2ZMVA 3R4KA 5F6AA 1XJ3A 4BBUA 3KSHA 3F1NB 3MF0A 4CLCE 4DN0A 3S7QA 2VGLM 5TBMA 1OT9A 4I38A 2VV7A 2W27A 2MJ6A 4FSFA 4NXEA 3LYXA 2V0WA 3BQ8A 3T4KA 1T1BA 2K2NA 3C2WA 3RTYA 3EGDC 4Y3IA 2GZAA 3MQ0A 5DKKA 1D06A 2VEAA 4Q0HA 1LT0A 3ICYA 2CMNA 4DJ2A 3S7NA 2INWA 4ETZA 3DBAA 1NLZA 1MC0A 3B47A 4JGPA 2XSSA 2FZ0A 4JGRA 3C38A 5HZHA 2W1RA 3OCLA 2JHEA 4CLCA 1GSXA 1P97A 2XA7S 1LSXA 3FPVA 3LICA 4HI4A 3BWLA 5MC7A 3SW1A 2XRNA 4NXGA 4HOIA 3LR0A 4E04A 4PHTA 4WELA 3GECA 5HWWA 1ZTUA 2EWWA 2GJ3A 4YWZA 1WA9A 4R3AA 1XJ6A 4HH2A 2B02A 1DP6A 1OTAA 2OAQ1 4EESA 4Z1WA 2ZOIA 1XJ2A 4IJGA 3T4SA 3PHYA 2L4RA 3U2AA 4DMZA 2V0UA 3IS2B 3GDIA 5HDDA 3UE6A 3MXQA 2G7UA 1OPXA 3ULFA 2O99A 2V1AA 2D02A 2L1MA 4II7A 3S7OA 1H3QA 2W1TA 3E4QA 1OTDA 3OOVA 4GHIA 2P04A 5TJJA 2O9BA 3T4JA 3PBSA 4H6JA 4RQ9A 2M7VA 4ARZB 5A8BA 1NRJA 3CI6A 4R6LA 1S4RA 3EWKA 1BYWA 1G28A 3E4OA 5KIZA 3CLOA 4BBTA 3ZQ5A 3V67A 3B33A 3G6OA 3E0YA 2H28A 3F1NA 4Q0IA 3KO6A 3MFXA 3W2ZA 4BWIA 2DMWA 3K3CA 2OWHA 1MZUA 5CX7A 4WLAA 3KSFA 1S1ZA 2IA2A 2VV8A 4WL9A 3R7WA 3LR4A 4GJ4A 3T4OA 4ME4A 5G4ZA 2HF6A 2L0WA 4HP4A 1YSPA 4YNRA 3B42A 3A0RA 4EU0A 4HJ3A 3UB8A 4HIAA 4H6JB 1X0OA 3MR0A 4I5SA 3UMEA 2OOLA 4MN7A 4P6ZM 4WUJA 5HD5A 2PYPA 4CLCC 2R78A 1LSWA 1F5MA 4WEKA 5DJTA 3KYQA 4PAUA 2M7UA 5HL6A 2A24B 4EEPA 5F5YA 3KYZA 2VJWA 4GLQA 1OTBA 3HCYA 4MN5A 3LR3A 4HP9A 3R7WB 5DFXA 3EOIA 4JGOA 3OCNA 2VLGA 4L9EA 4B93A 2JKRI 1UWPX 5HDSA 4NXBA 3IS2A 4GCZA 4HJ6A 3KX0X 4HHDA 2HGVA 2KLIA 1P9WA 4O0PA 5G4YA 4WEJA 4DJ3A 4EERA 3P01A 2GX5A 1XJ4A 1TD5A 2YKFA 4BJPA 1NLYA 4FOFA 3A0VA 2Y8HA 1TS6A 3LI9A 4EXOA 2W3GA 5IT5A 4OOLA 4ARZA 3F1OB 3LIBA 4WN5A 3OLOA 4LPZA 3IBRA 2Y79A 4I3IA 2OWJA 4MDZA 2V1BA 4NKPA 3UB7A 3VE3A 2EWVA 3H7WB 1YSQA 1DRMA 3H9WA 2PD8A 4LRXC 1F9IA 1TS7A 3PBNA 2Z6DA 2HJEA 4F3LB 4UEYA 2QHKA 3JVVA 4JGQA 5DF9A 4ZRRA 4NXFA 4Y5FA 2PHYA 5AJGA 3EEHA 4UQIM 4M4XA 2LB9A 1OTEA 4P6ZS 4WF0A 3CUEA 1F98A 2K7SA 5J7EA 4LLOB 5IS1A 5DJUA 4HNBA 2PR5A 1D7EA 3E98A 2O9AA 5J3WA 3UE3A 3D72A 1S67L 4BMWA 2A24A 2QYBA 2VGLS 2XA7M 1YKDA 1STZA 3LIFA 1V9YA 3T4TA 4I3AA 2BASA 3TW8A 4EETB 4KUOA 3P7NA 4BBVA 1IFQA 2PR6A 3FC7A 2HJ9C 3RFBA 3FG8A 5DFYA 3BY9A 2JKTI 1VHMA 4OOMA 3RH8B 4G3WA 3O5YA 3K2NA 1MKMA 2K31A 2JN7A 1G6OA 3MQQA 3NOUC 1TF1A 5AVFA 5HSQA 4EUVA 4LRZE 4PKYA 1JNUA 2J3WA 2PD7A 2YKHA 4CLCD 3UB9A 2PT7A 5C5KA 4KUKA 3MQOA 3LIDA 1DP9A 4HJ4A 4G3VA 2VX8A 3S7PA 5HD3A 2PDRA 4O8GA 1TS0A 3F1OA 4KQDA 3TJZC 3MJQA 2KX6A 2WKPA 3LR5A 3EQVA 4I39A 4G3KA 4L9GA 3CWFA 4GW9A 1ZHHB 1IOUA 1XFQA 4GS9B 4EQ1A 4NEED 2O0YA 2VKSA 3H7WA 4HQAA 1W63Q 4R70A 4Y2FA 1YAXA 3UB6A 2PYRA 4QPRA 4Q0JA 2VV6A 5I5LA 2O9CA 1W63M 4F3LA 3NJAA 1P0ZA 2QKPA 2JKRM 3H82A 2W3EA 5AVEA 4UQIS 4O01A 3D3OA 3NHQA 3UMDA 4AFIA 1S4SA 5IU1A 3CITA 1NWZA 2GNXA 4MMNA 3VE4A 1DP8A 3CUEC 1T18A 3C8CA 4HH3A 5L8MA 2NUTC 1S66L 5HWVA 1V9ZA 3K3DA 1S1YA 3F1PB 2M1CA 3NOTC 4L0LA 3OC2A 4XT2B 4MCWA 1N9LA 3NOPC 5EFWA 4R38A 3MMHA 3A0SA 3KSGA 1N9NA 3KSIA 2D01A 2QWSA 1UWNX 2KDKA 5TBMB 2NUPC 3PBQA 2I9VA 3H82B 4L9FA 2W3FA 4ETXA 4KQOA 5HDCA 4EEUA 3BW6A 3LIAA 1OJ5A 1GSWA 1T19A 3LI8A 3HJIA 2WKRA 4I3JA 2XROA 1OT6A 5LBRA 3EQUA 2HV1A 2KOIA 5F69A 2J3TD 2J3TC 3BQAA 3PYPA 3T50A 5HPFA 2B18A 4YOFA 1T1CA 3IBJA 3LIEA 5KSHA 3E4PA 3EEAA 3VV4A 2ZBBA 2ZMFA 2QJ5A 4CLCB 2EA9A 2P08A 2P7JA 3T4LA 4LRYC 4HY8A 2QJ7A 3HJKA 3PBTA 4IUKA 4IUHA 3CAXA 1EW0A 4B9OA 5J4EA 1KOUA 1TS8A 2W3HA 4GS9A 3C30A 3PXPA 2VA0A 2A2LA 2Z6CA 3BJNA 5F68A 5FL3A 1LL8A 3EGXC 3T4QA 1OTIA 3FPWA 4MN6A 3OBFA 2VZWA 2J80A 4PKYG 1Y28A 2JKTM 1LSVA 5HPIA 1OJGA 4K08A 1XFNA 2FH5A 3ZYTA 2OAP1 3LFVA 1ODVA 1GSVA 1H8MA 1T1AA 3PBRA 3TRCA 5K5BA 2W3DA 1P9RA 5HWTA 3VOLA 2V9AA 1VB6A 2ZOHA 2W1TB 2LB5A 4GHIB 3PBOA 4IHQA 3LUQA 3F1PA 4CQHA 3BY8A 1UGUA 4EW7A 2W0NA 3JVUA 4XT2A 3TE8A 2WKQA 1N9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DKL A;  5F6A A;  1XJ3 A;  4BBU A;  3F1N B;  5TBM A;  1OT9 A;  4I38 A;  2VV7 A;  2W27 A;  4NXE A;  3LYX A;  2V0W A;  1T1B A;  3C2W A;  3RTY A;  5DKK A;  1D06 A;  2VEA A;  1LT0 A;  3ICY A;  2CMN A;  4DJ2 A;  2INW A;  4JGP A;  4JGR A;  5HZH A;  2JHE A;  1GSX A;  1P97 A;  3LIC A;  1LSX A;  4HI4 A;  3SW1 A;  3BWL A;  4NXG A;  4HOI A;  4E04 A;  3GEC A;  5HWW A;  2GJ3 A;  4YWZ A;  1WA9 A;  4R3A A;  1XJ6 A;  4HH2 A;  2B02 A;  1DP6 A;  1OTA A;  4EES A;  2ZOI A;  1XJ2 A;  3PHY A;  2L4R A;  2V0U A;  3IS2 B;  3GDI A;  5HDD A;  3UE6 A;  3MXQ A;  3ULF A;  2V1A A;  2D02 A;  2L1M A;  3E4Q A;  1OTD A;  4GHI A;  4H6J A;  4RQ9 A;  5A8B A;  4R6L A;  1S4R A;  3EWK A;  1BYW A;  1G28 A;  3E4O A;  5KIZ A;  3CLO A;  4BBT A;  3ZQ5 A;  3B33 A;  3G6O A;  2H28 A;  3F1N A;  3MFX A;  3K3C A;  2OWH A;  1MZU A;  4WLA A;  1S1Z A;  2VV8 A;  4WL9 A;  5G4Z A;  2L0W A;  4HP4 A;  3A0R A;  4HJ3 A;  3UB8 A;  4HIA A;  4H6J B;  1X0O A;  3MR0 A;  4I5S A;  3UME A;  2OOL A;  5HD5 A;  4WUJ A;  2PYP A;  2R78 A;  1LSW A;  5DJT A;  2A24 B;  4EEP A;  5F5Y A;  1OTB A;  4MN5 A;  4HP9 A;  4JGO A;  2VLG A;  4L9E A;  1UWP X;  5HDS A;  4NXB A;  3IS2 A;  4GCZ A;  4HJ6 A;  3KX0 X;  4HHD A;  5G4Y A;  4DJ3 A;  4EER A;  1XJ4 A;  2YKF A;  3A0V A;  1TS6 A;  3LI9 A;  4EXO A;  3F1O B;  3LIB A;  4WN5 A;  3OLO A;  4LPZ A;  3IBR A;  4I3I A;  2OWJ A;  2V1B A;  3UB7 A;  3VE3 A;  3H7W B;  1DRM A;  3H9W A;  2PD8 A;  4LRX C;  1F9I A;  1TS7 A;  2Z6D A;  4F3L B;  2QHK A;  4JGQ A;  4NXF A;  2PHY A;  3EEH A;  4M4X A;  1OTE A;  4WF0 A;  1F98 A;  2K7S A;  5J7E A;  4LLO B;  5IS1 A;  5DJU A;  4HNB A;  2PR5 A;  1D7E A;  5J3W A;  3D72 A;  1S67 L;  2A24 A;  3LIF A;  1V9Y A;  4I3A A;  2BAS A;  4EET B;  4KUO A;  3P7N A;  4BBV A;  2PR6 A;  3FC7 A;  3FG8 A;  3BY9 A;  3RH8 B;  2JN7 A;  3MQQ A;  3NOU C;  5AVF A;  5HSQ A;  4LRZ E;  4PKY A;  1JNU A;  2PD7 A;  2YKH A;  3UB9 A;  4KUK A;  3MQO A;  3LID A;  1DP9 A;  4HJ4 A;  5HD3 A;  2PDR A;  1TS0 A;  3F1O A;  4KQD A;  3MJQ A;  2KX6 A;  2WKP A;  4I39 A;  4L9G A;  3CWF A;  4GW9 A;  1XFQ A;  4GS9 B;  4EQ1 A;  3H7W A;  4HQA A;  4R70 A;  3UB6 A;  2PYR A;  2VV6 A;  5I5L A;  4F3L A;  3NJA A;  1P0Z A;  2QKP A;  3H82 A;  5AVE A;  3NHQ A;  3UMD A;  1S4S A;  5IU1 A;  1NWZ A;  3VE4 A;  1DP8 A;  1T18 A;  3C8C A;  4HH3 A;  1S66 L;  5HWV A;  1V9Z A;  3K3D A;  1S1Y A;  3F1P B;  2M1C A;  3NOT C;  4XT2 B;  1N9L A;  3NOP C;  5EFW A;  4R38 A;  3A0S A;  1N9N A;  2D01 A;  2QWS A;  1UWN X;  2KDK A;  5TBM B;  2I9V A;  3H82 B;  4L9F A;  5HDC A;  4EEU A;  3LIA A;  1OJ5 A;  1GSW A;  1T19 A;  3LI8 A;  3HJI A;  2WKR A;  4I3J A;  1OT6 A;  2HV1 A;  5F69 A;  3T50 A;  3PYP A;  1T1C A;  3LIE A;  3E4P A;  2ZBB A;  2QJ5 A;  2EA9 A;  2P7J A;  4LRY C;  4HY8 A;  2QJ7 A;  3HJK A;  3CAX A;  1EW0 A;  4B9O A;  5J4E A;  1KOU A;  1TS8 A;  4GS9 A;  2Z6C A;  5F68 A;  1LL8 A;  1OTI A;  4MN6 A;  2J80 A;  4PKY G;  1Y28 A;  1LSV A;  1OJG A;  4K08 A;  1XFN A;  1ODV A;  1GSV A;  1T1A A;  5HWT A;  3VOL A;  2V9A A;  1VB6 A;  2ZOH A;  4GHI B;  3LUQ A;  3F1P A;  3BY8 A;  1UGU A;  4EW7 A;  2W0N A;  4XT2 A;  2WKQ A;  1N9O A; 
#chains in the Genus database with same CATH topology
 1IYP A;  4C6Y A;  1FR1 A;  2E8I A;  5F1G A;  3BFE A;  3HLG A;  4DN0 A;  1D1J A;  3S7Q A;  1PYY A;  2W27 A;  4PMA A;  5EOO A;  1KGE A;  4NXE A;  1L2S A;  4R1G A;  1K6R A;  4OPQ A;  2J7V A;  3O86 A;  4Y3I A;  2GZA A;  2A3U A;  2CMN A;  2INW A;  4ETZ A;  3DBA A;  3O88 A;  3B47 A;  4JGR A;  4NG2 A;  3OCL A;  2JHE A;  3VFH A;  4CLC A;  1GSX A;  3LIC A;  3QP6 A;  2ZLY A;  1SKO A;  2HPB A;  4E04 A;  5EE8 A;  4WEL A;  2Y2Q A;  4Y17 A;  5HWW A;  3G31 A;  2ZC5 B;  1KE0 A;  4YWZ A;  5HAR A;  4HH2 A;  3AGD A;  4MBK A;  1TEM A;  3IH9 A;  4Y7P A;  1XJ2 A;  4IJG A;  4X1L A;  3C7V A;  5EEC A;  4RX3 A;  4DMZ A;  4M3K A;  3HLF A;  5KMW A;  1WE4 A;  1LLB A;  1MWU A;  4B88 A;  4Y0U A;  4II7 A;  1FCM A;  4S2N A;  2ZQ7 A;  3CPT B;  3U4L P;  3OOV A;  1HLU P;  3BEC A;  3T4J A;  3PBS A;  2OSU A;  5FEG A;  4RQ9 A;  5TR7 A;  5FI2 A;  4EQI A;  2QPN A;  1NRJ A;  3SS4 A;  4QD4 A;  3EWK A;  3BFD A;  4N92 A;  1XX2 A;  3CLO A;  3B33 A;  3G6O A;  2H28 A;  3L7H A;  4X68 A;  3MFX A;  4BWI A;  1XGJ A;  2DMW A;  3A3E A;  2OWH A;  1TDG A;  2ZM8 A;  3SH7 A;  3PAE A;  3KSF A;  3IXH A;  2VV8 A;  2HF6 A;  2V8C A;  2X01 A;  2L0W A;  4HP4 A;  3HUO A;  4UAA A;  2P9V A;  1ONH A;  4OQ0 A;  1KE3 A;  4GOG A;  3MR0 A;  2OOL A;  4P6Z M;  4CLC C;  2R78 A;  1LSW A;  1H8Z A;  2HDU A;  1E3U D;  1FSY A;  3KYQ A;  3KYE A;  3T1X A;  5HL6 A;  1PWD A;  3T1S A;  4OOY A;  4LV1 A;  4S2K A;  3JPU A;  3PAG A;  4JLF A;  3ZFZ A;  1M6K A;  1UWP X;  1CI9 A;  4GCZ A;  1YMS A;  1S0W A;  4JF5 A;  2IWD A;  3DWK A;  2WKH A;  4WEJ A;  4OPZ A;  4EUZ A;  2GX5 A;  1XJ4 A;  3L9K A;  4KZ8 A;  1NLY A;  1GA9 A;  4S2N C;  5CEB A;  1TS6 A;  4OOL A;  4ARZ A;  3LIB A;  3UN7 A;  3OLO A;  4DRT A;  4KZA A;  4PM8 A;  4NKP A;  3UB7 A;  3LGO A;  3D9Y A;  1FSW A;  3WS5 A;  4X6T A;  1PIO A;  4FCF A;  2Y2P A;  3JYI A;  3JVV A;  2V1Z A;  3SS3 A;  4JGQ A;  3CHW P;  5CTN A;  2PHY A;  4RYE A;  3EEH A;  4UQI M;  1PI4 A;  5U47 A;  4P6Z S;  4WF0 A;  4LLO B;  1D7E A;  1NZO A;  5J3W A;  1FR6 A;  3D72 A;  3G32 A;  1F2K A;  2G2W A;  5EVL A;  2A24 A;  2XD1 A;  2QYB A;  2XA7 M;  4DE2 A;  1YKD A;  4R4S A;  1V9Y A;  3TW8 A;  5CER A;  4KUO A;  2PR6 A;  5KZH A;  3RFB A;  3FG8 A;  3Q07 A;  2Y2M A;  4G3W A;  5FI6 A;  2K31 A;  5M1A A;  1GA0 A;  5AVF A;  2WZZ A;  2JBF A;  1PWG A;  5DF8 A;  3ZG5 A;  3QP4 A;  1BLC A;  1RGZ A;  1Z09 A;  4KUK A;  4K0X A;  4S2O A;  1L0E A;  4UA9 A;  3LID A;  1JWZ A;  2X02 A;  4G3V A;  3O87 A;  3HLE A;  3F1O A;  4KQD A;  3VP2 A;  2KX6 A;  1Y54 A;  1ZHH B;  1XFQ A;  3BFG A;  3H7W A;  1W63 Q;  4Y2F A;  1YAX A;  2VK3 A;  4IBR A;  1W63 M;  3M2J A;  3IHB A;  4S2I A;  1MWR A;  4X53 A;  1CK3 A;  3FYZ A;  1LL5 A;  4KQQ A;  3UY6 A;  4UQI S;  3D3O A;  1CI8 A;  5A91 A;  3G4P A;  5HFO A;  3HLB A;  1DP8 A;  3AGE A;  4HH3 A;  3C8C A;  5L8M A;  2NUT C;  3GVB A;  1V9Z A;  4K91 A;  4KZ9 A;  1ERQ A;  3OC2 A;  1TVF A;  2B5R A;  4XT2 B;  1L0G A;  1NYM A;  1PZO A;  1GCE A;  2HDQ A;  1KGG A;  2RCX A;  1NY0 A;  3KSG A;  3Q81 A;  5HL1 A;  1YLW A;  1O07 A;  5E2E A;  2I9V A;  3H82 B;  3S4X A;  4EEU A;  4FH2 A;  1SZV A;  3IF6 A;  1YLZ A;  3FV7 A;  4BD0 A;  3MZE A;  5F69 A;  3BQA A;  3PYP A;  1Z6F A;  1Q2P A;  1T1C A;  3P09 A;  3IBJ A;  2PBY A;  1FQG A;  3T1R A;  3VV4 A;  4Y15 A;  2ZMF A;  2QJ5 A;  4CLC B;  2EA9 A;  3T4L A;  4LRY C;  4HY8 A;  3ZG9 B;  3PBT A;  4LV0 A;  1GHM A;  4B9O A;  1TS8 A;  4GS9 A;  2Y2N A;  3C30 A;  3UPO A;  2Z6C A;  5J8X A;  3IHA A;  1VET A;  3HLD A;  3ZG7 B;  3WS4 A;  4MN6 A;  3N8L A;  4FUW A;  3UDI A;  4R3B A;  2EX2 A;  4GB7 A;  1T1A A;  3TRC A;  5L09 A;  2W3D A;  1Q2Q A;  1P9R A;  1M40 A;  1ACF A;  1KVM A;  2LB5 A;  3Q7Z A;  2Y2K A;  4DE1 A;  3F1P A;  4CQH A;  3BY8 A;  1UGU A;  3NI9 A;  1H8Y A;  2W0N A;  3TE8 A;  2E8J A;  4EV4 A;  2ZMV A;  3NDE A;  4QB8 A;  4BBU A;  5TBM A;  1OT9 A;  4I38 A;  4LFU A;  2ZC6 B;  5D3O A;  3C2W A;  5EVI A;  3RTY A;  3IF6 C;  3DAV A;  4Q0H A;  3ICY A;  2P9V B;  3ZG8 B;  1JTG A;  1MC0 A;  4JGP A;  3C38 A;  5HZH A;  2Y2L A;  4QU3 A;  3SW1 A;  4B4Z A;  4ZAM A;  3V50 A;  3LR0 A;  4N9K A;  1ZTU A;  1L0D A;  1WA9 A;  4R3A A;  5TGF A;  3VSK A;  4RVA A;  1DP6 A;  2ZOI A;  4PM5 A;  1L0F A;  2V0U A;  4KQR A;  5GLD A;  1ZG4 A;  3MXQ A;  2Q9M A;  3AGF A;  3UPN A;  1OPX A;  3ULF A;  2BTF P;  2O99 A;  1QME A;  1JWP A;  3MKF A;  1NZU A;  3ZCZ A;  1H3Q A;  2P04 A;  4H8R A;  4ARZ B;  3CI6 A;  3GSG A;  4R6L A;  1S4R A;  2WK0 A;  1BYW A;  2H10 A;  3E4O A;  4JXW A;  5CGS A;  3M2K A;  2FFY A;  4N9L A;  2EFU A;  2C5W B;  3E0Y A;  3BLM A;  3GQZ A;  4RA7 A;  3W2Z A;  3K3C A;  4GDB A;  3M6B A;  1IEL A;  4WLA A;  2IA2 A;  4WMC A;  1MPL A;  3LY3 A;  5EVI C;  1YSP A;  4YNR A;  4EBL A;  3B42 A;  3A0R A;  4HJ3 A;  4HIA A;  4H6J B;  4WYY A;  1YQS A;  3OPR A;  2J9O A;  1X0O A;  3UDF A;  4I5S A;  3GMW A;  5AQ9 A;  4OQG A;  1XXM A;  4KEN B;  3ZNY A;  1F5M A;  4WEK A;  5DJT A;  4ZJ3 A;  2Y4A A;  2ZD8 A;  1K55 A;  4PAU A;  4S2L A;  2PU2 A;  2A24 B;  4ZBE A;  2BG1 A;  3KYZ A;  3BFF A;  4MN5 A;  4OLD A;  3N8S A;  5GLA A;  1VEU A;  3R7W B;  1K4E A;  4JGO A;  4L9E A;  1BT5 A;  5HDS A;  4NXB A;  3IS2 A;  2Y55 A;  1W8Y A;  2KLI A;  1K56 A;  1P9W A;  5JYO A;  4DJ3 A;  3FKW A;  4JF4 A;  4HBT A;  2WKE A;  5FAP A;  2YKF A;  4JF6 A;  5F82 A;  3A0V A;  3LI9 A;  2HP6 A;  1ZKJ A;  3F1O B;  3GV9 A;  3VOY A;  4CJN A;  2Y2I A;  3LEZ A;  4LPZ A;  5FQM A;  3IBR A;  2V1B A;  1FCN A;  3W4Q A;  4D60 A;  3H7W B;  1DRM A;  2PD8 A;  4KZ5 A;  4LRX C;  1F9I A;  3WRT A;  4UEY A;  1ES5 A;  1K6S A;  4NXF A;  3IX3 A;  2JKG A;  4Y5F A;  1HZO A;  4M4X A;  5GLB A;  1DY6 A;  4ZTK A;  1OTE A;  2ZC4 B;  2WGW A;  2B95 A;  1KGF A;  1PNE A;  3MZD A;  1K55 C;  1S67 L;  4KG2 A;  5HX9 A;  1WYC A;  1ZG6 A;  5FAT A;  4P6B A;  1O7E A;  2OV5 A;  5GHZ A;  3DW0 A;  3O5Y A;  1VQQ A;  1YT4 A;  3BRM A;  3K2N A;  1TDL A;  1MKM A;  2JN7 A;  3MXS A;  1EI5 A;  1SCW A;  4PPR A;  1JNU A;  2PD7 A;  4CLC D;  3UB9 A;  4OH0 A;  2PT7 A;  1GHP A;  3MQO A;  4EBP A;  2OLV A;  3S7P A;  5I94 A;  5EUA A;  5JYP A;  4I39 A;  5F1F A;  3CWF A;  4GW9 A;  2J9P A;  3W8K A;  4XUZ A;  1IOU A;  4GS9 B;  2XH9 A;  2X71 A;  1W79 A;  4K0W A;  4FH4 A;  5A90 A;  4KZ6 A;  1VET B;  3OPP A;  4Q0J A;  1WYB A;  2PU4 A;  5M19 A;  1PI5 A;  3VP1 A;  2EX8 A;  2W3E A;  5AVE A;  3NHQ A;  1JWV A;  3UMD A;  3CIT A;  4A5R A;  4U0T A;  1NWZ A;  4QY6 A;  3SH8 A;  4MMN A;  3I7J A;  1G5U A;  1T18 A;  1W7F A;  1S1Y A;  2PRF A;  3F1P B;  2M1C A;  5CRF A;  4L0L A;  3QP8 A;  2Q9N A;  5CTM A;  4MCW A;  1N9B A;  4EBN A;  1ES4 A;  3UO9 A;  3A0S A;  2EXA A;  2JC7 A;  4OP5 A;  2ZC7 A;  4BQM A;  4GNU A;  1N9N A;  2D01 A;  2KDK A;  3B3X A;  3QP5 A;  5TBM B;  3PBQ A;  2WYX A;  4L9F A;  4X1M A;  4DE3 A;  5HDC A;  1OJ5 A;  2FFF B;  4E3L A;  2OLU A;  4DKI A;  3HJI A;  4I3J A;  4O7D A;  2KOI A;  2J3T D;  2J3T C;  2HP5 A;  5DTS A;  1OME A;  3LIE A;  1G6A A;  1MWS A;  3E4P A;  5IHV A;  4OPR A;  3HJK A;  5CEC A;  4IUK A;  1YM1 A;  3MBZ A;  1NXY A;  2EX6 A;  4IUH A;  1EW0 A;  5J4E A;  1CEF A;  2W3H A;  2WKI A;  3BJN A;  5F68 A;  4DE0 A;  3VP0 A;  3T4Q A;  3A3D A;  2Y2O A;  2VZW A;  1IEM A;  2J80 A;  1IYS A;  4GDN A;  4KZ3 A;  5DTK A;  1XFN A;  2FH5 A;  3LFV A;  4HEF A;  1ODV A;  1GSV A;  4EWF A;  4DXB A;  1JVJ A;  3DTE A;  2C6W B;  4OON A;  3LEQ A;  1FOF A;  5HAQ A;  4MBF A;  4IHQ A;  4GN2 A;  3LO7 A;  3IXD A;  4ZJ1 A;  5DKL A;  4ZJ2 A;  1KE4 A;  2ZQ8 A;  3KSH A;  4CLC E;  4RX2 A;  2VGL M;  1FCO A;  2VV7 A;  4YFM A;  1IYQ A;  1NYY A;  3LYX A;  3BQ8 A;  1U60 A;  5CXW A;  1D06 A;  3E2K A;  2VEA A;  3CJM A;  4E3O A;  4DJ2 A;  5FA7 A;  1NLZ A;  4LEN A;  5FDS A;  2XEP A;  5FI7 A;  3IWO A;  4PM9 A;  2XA7 S;  1LSX A;  3FPV A;  4HI4 A;  3BWL A;  4HOI A;  3W4P A;  3IX4 A;  3N6I A;  2GJ3 A;  1XJ6 A;  4MEZ A;  4E6W A;  4OQH A;  2B02 A;  1OTA A;  4GZB A;  4EES A;  4Z1W A;  1YLY A;  3IS2 B;  3GDI A;  1XP4 A;  3CZD A;  3UE6 A;  2G7U A;  1SDE A;  2V1A A;  4E3J A;  2L1M A;  5FDH A;  4WZ5 A;  3E4Q A;  1SKO B;  1OTD A;  2DCF A;  5TJJ A;  3C5A A;  1K54 A;  2AVX A;  5FAO A;  3IWQ A;  2HP9 A;  5A8B A;  5AQA A;  3GTC A;  3RXW A;  1G28 A;  4FTX A;  4OP8 A;  5KIZ A;  4BBT A;  3N4I A;  1J3W A;  1BLS A;  3W4O A;  3ZQ5 A;  3F1N A;  3S1Y A;  2R9W A;  3TSG A;  1K25 A;  4LCL A;  5CX7 A;  1S1Z A;  4U0X A;  3T4O A;  4DXC A;  1I2S A;  1HVB A;  2HDR A;  4ESP A;  4IVI A;  3SZT A;  4EU0 A;  3UB8 A;  2WGW B;  5CHU A;  3UME A;  4MN7 A;  4WUJ A;  1ES2 A;  3V5M A;  2XK1 A;  2M7U A;  4P85 A;  3IT9 A;  2Y59 A;  3Q7V A;  5F5Y A;  4IBX A;  4GLQ A;  1ERM A;  3HCY A;  2P74 A;  3LR3 A;  4HP9 A;  4DDS A;  2WAF A;  5DFX A;  3EOI A;  5FQI A;  3OCN A;  2VLG A;  3QHY A;  4B93 A;  3WRZ A;  2JKR I;  3BLS A;  4HJ6 A;  2XFS A;  4HHD A;  2HGV A;  5G4Y A;  4E3I A;  3DTM A;  1DJB A;  4F94 A;  4BD1 A;  3P01 A;  1ES3 A;  3MFD A;  3UE1 A;  4WZ5 C;  3VP3 A;  1EWZ A;  2HDS A;  4FOF A;  4NET A;  2Y8H A;  4HES A;  4EXO A;  1K54 C;  2W3G A;  4C75 A;  4Y0O A;  4BL3 A;  5KSC A;  4WN5 A;  4I3I A;  3UDX A;  4MLL A;  1YSQ A;  1BUE A;  3H9W A;  4Y0T A;  3G35 A;  1ERO A;  2XR0 A;  2Z6D A;  2XF3 A;  2QHK A;  1NJ4 A;  3A3J A;  3MKE A;  1E25 A;  1S6R A;  1SKF A;  5A93 A;  4ZRR A;  5AJG A;  4JXS A;  5FSR A;  3DTI A;  5CGX A;  2WZX A;  2K7S A;  5DJU A;  4HNB A;  3LCE A;  1XPB A;  4GD8 A;  1K38 A;  4DF6 A;  1STZ A;  4JKT A;  3LIF A;  5EOE A;  3ZVT A;  3T4T A;  4I3A A;  2BAS A;  2H5S A;  1MY8 A;  3V3R A;  3WWX A;  4Z9Q A;  3P98 A;  5DFY A;  3BY9 A;  1XGI A;  3PTE A;  3QNC A;  4JBF A;  5EVI D;  1VHM A;  1CJF A;  4OOM A;  4LV3 A;  2QMI A;  1QMF A;  3Q1F A;  4U3T A;  1BLH A;  3NOU C;  1FIK A;  3G2Z A;  2H0Y A;  4UA7 A;  4EUV A;  4KZ4 A;  2J3W A;  4R4R A;  2Y2H A;  3SH9 A;  1C3B A;  2UWX A;  1DP9 A;  2CC1 A;  2PDR A;  1TS0 A;  3MJQ A;  4S2P A;  2WKP A;  3UNW A;  4G3K A;  5HAP A;  1H0M A;  4KZB A;  2VKS A;  3HRE A;  4R70 A;  3UB6 A;  5BOH A;  2PYR A;  2Y2J A;  1K4F A;  2ZL1 A;  2VV6 A;  2WGV A;  4F3L A;  3NJA A;  1P0Z A;  4N1X A;  4JPM A;  3NCK A;  4KG6 A;  2JKR M;  1W5D A;  1LL9 A;  1AWI A;  3H82 A;  4FD8 A;  2ZQC A;  5IU1 A;  2ZM0 A;  1LI9 A;  2QZ6 A;  5FQQ A;  3C4P A;  3NOT C;  3OPL A;  1KDS A;  3ITB A;  1E3U A;  3DTK A;  4XXR A;  1YLJ A;  3NOP C;  3UB5 P;  5EFW A;  4R38 A;  3OZH A;  3NDG A;  4WMC D;  2QWS A;  5HW3 A;  5FQK A;  1GHI A;  4KQO A;  1PZP A;  2EFX A;  4ID4 A;  1GSW A;  1T19 A;  5GL9 A;  3CG5 A;  4JXV A;  1LHY A;  2WKR A;  4IED A;  1KVL A;  4XUX A;  2XRO A;  5E43 A;  5LBR A;  3NEC A;  3ZHH A;  3BYD A;  5E2H A;  2B18 A;  4YOF A;  3NC8 A;  5KSH A;  3EEA A;  2JCH A;  2P08 A;  3G34 A;  2Z2L B;  4Y13 A;  3BEB A;  1MXO A;  2ZC3 B;  2VA0 A;  4C3Q A;  3V3S A;  4BEN A;  3RXX A;  3EGX C;  3GRJ A;  1OTI A;  4S2J A;  2PAV P;  3FPW A;  3IF6 B;  1Y28 A;  4MNR A;  1K56 D;  5HPI A;  1OJG A;  2Y2G A;  4OQI A;  4HBU A;  3VOZ A;  3ZYT A;  2EX9 A;  1H8M A;  1MWT A;  1YLP A;  1IYO A;  2XLN A;  1ZC2 A;  4QJG A;  2ZQ9 A;  4PM7 A;  3E2L A;  3VOL A;  3HBR A;  3G30 A;  2ZOH A;  2ZM2 A;  1PFL A;  4IVK A;  3PBO A;  3WS2 A;  3LUQ A;  3RJU A;  5CHJ A;  1XA7 A;  3PR6 A;  2Z2M B;  3R4K A;  5F6A A;  2XD5 A;  4LGW A;  1XJ3 A;  3IWI A;  3F1N B;  3MF0 A;  3TG9 A;  1I2W A;  2ZJ9 A;  2MJ6 A;  4FSF A;  2DRW A;  2V0W A;  3T4K A;  1T1B A;  2K2N A;  2XDM A;  5L07 A;  3EGD C;  4DDY A;  3MQ0 A;  5DKK A;  3HLC A;  1BTL A;  3IF5 A;  1LT0 A;  3S7N A;  5FAS A;  2XSS A;  2FZ0 A;  4E3K A;  2W1R A;  2UV0 E;  2VGK A;  5DVA A;  1P97 A;  2G2U A;  3FKV A;  5MC7 A;  4BL2 A;  2V20 A;  4GD6 A;  4KG5 A;  4NK3 A;  2XRN A;  4NXG A;  3S22 A;  1BUL A;  4PHT A;  4X25 A;  5E2G A;  3GEC A;  2EWW A;  3VP4 A;  3Q7V B;  5HAI A;  1HTZ A;  1H5X A;  1ONG A;  2OAQ 1;  5EVI B;  2ACG A;  3QP1 A;  3T4S A;  4ZDX A;  3PHY A;  2L4R A;  3WS1 A;  3U2A A;  5HDD A;  1YLT A;  4GKU A;  5L10 A;  2IWB A;  2D02 A;  1CQA A;  3S7O A;  3MXR A;  5AQB A;  2W1T A;  1BSG A;  1BZA A;  4GHI A;  1VM1 A;  5FQ9 A;  2O9B A;  4H6J A;  2M7V A;  3ZGA B;  4QY5 A;  2IWC A;  4X55 A;  5GHX A;  3V67 A;  1NRF A;  3C4O A;  4Q0I A;  4X69 A;  3KO6 A;  4R3J A;  1BLP A;  1MZU A;  1CF0 A;  3BFC A;  3R7W A;  4WL9 A;  3LR4 A;  4GJ4 A;  4ME4 A;  5G4Z A;  4WZ4 A;  4UHU A;  1PRQ A;  2RL3 A;  2WAD A;  1XKZ A;  2VGJ A;  4WBG A;  4BLM A;  3IH8 A;  5HD5 A;  1FIL A;  2PYP A;  4QHC A;  5TFQ A;  3N7W A;  3WS0 A;  4EEP A;  2I72 A;  3NY4 A;  2V8F A;  2VJW A;  5GHY A;  1OTB A;  1ESU A;  4OPY A;  2GDN A;  3DWZ A;  3TOI A;  1MKI A;  4LV2 A;  1PW1 A;  4JXG A;  3KX0 X;  4O0P A;  3A3F A;  1Y4O A;  5FQJ A;  4PM6 A;  4EER A;  3VSL A;  3SOI A;  5CHM A;  1TD5 A;  3CPT A;  4BJP A;  4E3M A;  3HUM A;  3VMA A;  5IT5 A;  2XQZ A;  4P87 A;  5DTT A;  4KZ7 A;  1IKG A;  2Y79 A;  2OWJ A;  4MDZ A;  1VEU B;  2BLS A;  1MBL A;  3IQA A;  3VE3 A;  2EWV A;  5FAQ A;  5G18 A;  4OLG A;  2ZL1 B;  3LY4 A;  1TS7 A;  3PBN A;  3FZC A;  2HJE A;  4P0M A;  5CGW A;  3VFF A;  4F3L B;  4OVD A;  3HLW A;  5DF9 A;  3ZG0 A;  1XA1 A;  2LB9 A;  2ZQA A;  5EPH A;  3IXB A;  2R9X A;  5CED A;  3M6H A;  3IXG A;  3D4F A;  5F83 A;  3CUE A;  1F98 A;  5J7E A;  5IS1 A;  1E4D A;  4MBH A;  2PR5 A;  1AXB A;  4CPK A;  3E98 A;  2O9A A;  3UE3 A;  4Q8I A;  1RGY A;  4BMW A;  4B4X A;  3NIA A;  2VGL S;  2JKF A;  3A3I A;  4EET B;  1W8Q A;  3P7N A;  4BBV A;  1IFQ A;  3FC7 A;  2HJ9 C;  3ZNT A;  4E3N A;  1K57 A;  2JKT I;  3RH8 B;  1ALQ A;  2HZ5 A;  3T12 B;  2WAE A;  2Q0O A;  1G6O A;  3MQQ A;  1TF1 A;  5HSQ A;  1K0K A;  1LI0 A;  4N1H A;  3MSH A;  4LRZ E;  4PKY A;  4WM9 A;  2YKH A;  1A0K A;  5C5K A;  1SHV A;  4HJ4 A;  2VX8 A;  3MZF A;  5EV0 A;  3NBL A;  5HD3 A;  4O8G A;  3TJZ C;  3CMZ A;  3HVF A;  2WGI A;  3LR5 A;  3ZDJ A;  3EQV A;  1J9M A;  5EM0 A;  4L9G A;  2ZMA A;  4E6X A;  5FEF A;  5EM1 A;  4NEE D;  4EQ1 A;  2O0Y A;  3HL9 A;  2XFT A;  4HQA A;  4UA6 A;  2EXB A;  3V39 A;  4QPR A;  3N8R A;  5I5L A;  2O9C A;  1ESI A;  3QP2 A;  4D2O A;  3FWL A;  2QKP A;  1DJA A;  3QNB A;  3UE0 A;  4O01 A;  1DJC A;  4AFI A;  1S4S A;  3GR2 A;  5A92 A;  5DF7 A;  2GNX A;  4R0Q A;  3SS5 A;  3VE4 A;  1CEG A;  3C7U A;  3CUE C;  1S66 L;  5HWV A;  3K3D A;  2H0T A;  2V2F F;  5EVE A;  1JTD A;  5GLC A;  1L3L A;  5M18 A;  3G2Y A;  1IKI A;  1HD8 A;  2XGN A;  1N9L A;  1PWC A;  2JE5 A;  3IX8 A;  3MMH A;  3T1Q B;  3KSI A;  3ITA A;  1RP5 A;  1UWN X;  4OKP A;  2NUP C;  1K57 C;  2W3F A;  3ISG A;  4ETX A;  5L2F A;  3BW6 A;  3LIA A;  4LCM A;  3LI8 A;  1N4O A;  2DNS A;  1OT6 A;  1YMX A;  3EQU A;  1I5Q A;  2HV1 A;  2PBD P;  5E2F A;  3T50 A;  5HPF A;  3BM6 A;  2J8Y A;  4R23 A;  2ZBB A;  2P7J A;  3NUL A;  2QJ7 A;  3HUN A;  4QWO A;  3CAX A;  1YPR A;  1KOU A;  2A49 A;  3PXP A;  2A2L A;  2Y91 A;  5FL3 A;  2ZQD A;  1PW8 A;  1LL8 A;  3MS6 A;  4S2M A;  3OBF A;  4PKY G;  2JKT M;  1LSV A;  1SDN A;  1RCJ A;  3Q82 A;  4K08 A;  2OAP 1;  3PBR A;  5K5B A;  3O3V A;  2WUQ A;  3OPH A;  5HWT A;  2V9A A;  1VB6 A;  2W1T B;  4YIN A;  4GHI B;  5AQ7 A;  3UPP A;  4EW7 A;  4X56 A;  1G68 A;  3JVU A;  1KDW A;  4XT2 A;  2WKQ A;  3ZVW A;  1N9O A; 
#chains in the Genus database with same CATH homology
 5DKL A;  3PR6 A;  2ZMV A;  3R4K A;  5F6A A;  1XJ3 A;  4BBU A;  3KSH A;  3F1N B;  3MF0 A;  4CLC E;  4DN0 A;  3S7Q A;  2VGL M;  5TBM A;  1OT9 A;  4I38 A;  2VV7 A;  2W27 A;  2MJ6 A;  4FSF A;  4NXE A;  3LYX A;  2V0W A;  3BQ8 A;  3T4K A;  1T1B A;  2K2N A;  3C2W A;  3RTY A;  3EGD C;  4Y3I A;  2GZA A;  3MQ0 A;  5DKK A;  1D06 A;  2VEA A;  4Q0H A;  1LT0 A;  3ICY A;  2CMN A;  4DJ2 A;  3S7N A;  2INW A;  4ETZ A;  3DBA A;  1NLZ A;  1MC0 A;  3B47 A;  4JGP A;  2XSS A;  2FZ0 A;  4JGR A;  3C38 A;  5HZH A;  2W1R A;  3OCL A;  2JHE A;  4CLC A;  1GSX A;  1P97 A;  2XA7 S;  1LSX A;  3FPV A;  3LIC A;  4HI4 A;  3BWL A;  5MC7 A;  3SW1 A;  2XRN A;  4NXG A;  4HOI A;  3LR0 A;  4E04 A;  4PHT A;  4WEL A;  3GEC A;  5HWW A;  1ZTU A;  2EWW A;  2GJ3 A;  4YWZ A;  1WA9 A;  4R3A A;  1XJ6 A;  4HH2 A;  2B02 A;  1DP6 A;  1OTA A;  2OAQ 1;  4EES A;  4Z1W A;  2ZOI A;  1XJ2 A;  4IJG A;  3T4S A;  3PHY A;  2L4R A;  3U2A A;  4DMZ A;  2V0U A;  3IS2 B;  3GDI A;  5HDD A;  3UE6 A;  3MXQ A;  2G7U A;  1OPX A;  3ULF A;  2O99 A;  2V1A A;  2D02 A;  2L1M A;  4II7 A;  3S7O A;  1H3Q A;  2W1T A;  3E4Q A;  1OTD A;  3OOV A;  4GHI A;  2P04 A;  5TJJ A;  2O9B A;  3T4J A;  3PBS A;  4H6J A;  4RQ9 A;  2M7V A;  4ARZ B;  5A8B A;  1NRJ A;  3CI6 A;  4R6L A;  1S4R A;  3EWK A;  1BYW A;  1G28 A;  3E4O A;  5KIZ A;  3CLO A;  4BBT A;  3ZQ5 A;  3V67 A;  3B33 A;  3G6O A;  3E0Y A;  2H28 A;  3F1N A;  4Q0I A;  3KO6 A;  3MFX A;  3W2Z A;  4BWI A;  2DMW A;  3K3C A;  2OWH A;  1MZU A;  5CX7 A;  4WLA A;  3KSF A;  1S1Z A;  2IA2 A;  2VV8 A;  4WL9 A;  3R7W A;  3LR4 A;  4GJ4 A;  3T4O A;  4ME4 A;  5G4Z A;  2HF6 A;  2L0W A;  4HP4 A;  1YSP A;  4YNR A;  3B42 A;  3A0R A;  4EU0 A;  4HJ3 A;  3UB8 A;  4HIA A;  4H6J B;  1X0O A;  3MR0 A;  4I5S A;  3UME A;  2OOL A;  4MN7 A;  4P6Z M;  4WUJ A;  5HD5 A;  2PYP A;  4CLC C;  2R78 A;  1LSW A;  1F5M A;  4WEK A;  5DJT A;  3KYQ A;  4PAU A;  2M7U A;  5HL6 A;  2A24 B;  4EEP A;  5F5Y A;  3KYZ A;  2VJW A;  4GLQ A;  1OTB A;  3HCY A;  4MN5 A;  3LR3 A;  4HP9 A;  3R7W B;  5DFX A;  3EOI A;  4JGO A;  3OCN A;  2VLG A;  4L9E A;  4B93 A;  2JKR I;  1UWP X;  5HDS A;  4NXB A;  3IS2 A;  4GCZ A;  4HJ6 A;  3KX0 X;  4HHD A;  2HGV A;  2KLI A;  1P9W A;  4O0P A;  5G4Y A;  4WEJ A;  4DJ3 A;  4EER A;  3P01 A;  2GX5 A;  1XJ4 A;  1TD5 A;  2YKF A;  4BJP A;  1NLY A;  4FOF A;  3A0V A;  2Y8H A;  1TS6 A;  3LI9 A;  4EXO A;  2W3G A;  5IT5 A;  4OOL A;  4ARZ A;  3F1O B;  3LIB A;  4WN5 A;  3OLO A;  4LPZ A;  3IBR A;  2Y79 A;  4I3I A;  2OWJ A;  4MDZ A;  2V1B A;  4NKP A;  3UB7 A;  3VE3 A;  2EWV A;  3H7W B;  1YSQ A;  1DRM A;  3H9W A;  2PD8 A;  4LRX C;  1F9I A;  1TS7 A;  3PBN A;  2Z6D A;  2HJE A;  4F3L B;  4UEY A;  2QHK A;  3JVV A;  4JGQ A;  5DF9 A;  4ZRR A;  4NXF A;  4Y5F A;  2PHY A;  5AJG A;  3EEH A;  4UQI M;  4M4X A;  2LB9 A;  1OTE A;  4P6Z S;  4WF0 A;  3CUE A;  1F98 A;  2K7S A;  5J7E A;  4LLO B;  5IS1 A;  5DJU A;  4HNB A;  2PR5 A;  1D7E A;  3E98 A;  2O9A A;  5J3W A;  3UE3 A;  3D72 A;  1S67 L;  4BMW A;  2A24 A;  2QYB A;  2VGL S;  2XA7 M;  1YKD A;  1STZ A;  3LIF A;  1V9Y A;  3T4T A;  4I3A A;  2BAS A;  3TW8 A;  4EET B;  4KUO A;  3P7N A;  4BBV A;  1IFQ A;  2PR6 A;  3FC7 A;  2HJ9 C;  3RFB A;  3FG8 A;  5DFY A;  3BY9 A;  2JKT I;  1VHM A;  4OOM A;  3RH8 B;  4G3W A;  3O5Y A;  3K2N A;  1MKM A;  2K31 A;  2JN7 A;  1G6O A;  3MQQ A;  3NOU C;  1TF1 A;  5AVF A;  5HSQ A;  4EUV A;  4LRZ E;  4PKY A;  1JNU A;  2J3W A;  2PD7 A;  2YKH A;  4CLC D;  3UB9 A;  2PT7 A;  5C5K A;  4KUK A;  3MQO A;  3LID A;  1DP9 A;  4HJ4 A;  4G3V A;  2VX8 A;  3S7P A;  5HD3 A;  2PDR A;  4O8G A;  1TS0 A;  3F1O A;  4KQD A;  3TJZ C;  3MJQ A;  2KX6 A;  2WKP A;  3LR5 A;  3EQV A;  4I39 A;  4G3K A;  4L9G A;  3CWF A;  4GW9 A;  1ZHH B;  1IOU A;  1XFQ A;  4GS9 B;  4EQ1 A;  4NEE D;  2O0Y A;  2VKS A;  3H7W A;  4HQA A;  1W63 Q;  4R70 A;  4Y2F A;  1YAX A;  3UB6 A;  2PYR A;  4QPR A;  4Q0J A;  2VV6 A;  5I5L A;  2O9C A;  1W63 M;  4F3L A;  3NJA A;  1P0Z A;  2QKP A;  2JKR M;  3H82 A;  2W3E A;  5AVE A;  4UQI S;  4O01 A;  3D3O A;  3NHQ A;  3UMD A;  4AFI A;  1S4S A;  5IU1 A;  3CIT A;  1NWZ A;  2GNX A;  4MMN A;  3VE4 A;  1DP8 A;  3CUE C;  1T18 A;  3C8C A;  4HH3 A;  5L8M A;  2NUT C;  1S66 L;  5HWV A;  1V9Z A;  3K3D A;  1S1Y A;  3F1P B;  2M1C A;  3NOT C;  4L0L A;  3OC2 A;  4XT2 B;  4MCW A;  1N9L A;  3NOP C;  5EFW A;  4R38 A;  3MMH A;  3A0S A;  3KSG A;  1N9N A;  3KSI A;  2D01 A;  2QWS A;  1UWN X;  2KDK A;  5TBM B;  2NUP C;  3PBQ A;  2I9V A;  3H82 B;  4L9F A;  2W3F A;  4ETX A;  4KQO A;  5HDC A;  4EEU A;  3BW6 A;  3LIA A;  1OJ5 A;  1GSW A;  1T19 A;  3LI8 A;  3HJI A;  2WKR A;  4I3J A;  2XRO A;  1OT6 A;  5LBR A;  3EQU A;  2HV1 A;  2KOI A;  5F69 A;  2J3T D;  2J3T C;  3BQA A;  3PYP A;  3T50 A;  5HPF A;  2B18 A;  4YOF A;  1T1C A;  3IBJ A;  3LIE A;  5KSH A;  3E4P A;  3EEA A;  3VV4 A;  2ZBB A;  2ZMF A;  2QJ5 A;  4CLC B;  2EA9 A;  2P08 A;  2P7J A;  3T4L A;  4LRY C;  4HY8 A;  2QJ7 A;  3HJK A;  3PBT A;  4IUK A;  4IUH A;  3CAX A;  1EW0 A;  4B9O A;  5J4E A;  1KOU A;  1TS8 A;  2W3H A;  4GS9 A;  3C30 A;  3PXP A;  2VA0 A;  2A2L A;  2Z6C A;  3BJN A;  5F68 A;  5FL3 A;  1LL8 A;  3EGX C;  3T4Q A;  1OTI A;  3FPW A;  4MN6 A;  3OBF A;  2VZW A;  2J80 A;  4PKY G;  1Y28 A;  2JKT M;  1LSV A;  5HPI A;  1OJG A;  4K08 A;  1XFN A;  2FH5 A;  3ZYT A;  2OAP 1;  3LFV A;  1ODV A;  1GSV A;  1H8M A;  1T1A A;  3PBR A;  3TRC A;  5K5B A;  2W3D A;  1P9R A;  5HWT A;  3VOL A;  2V9A A;  1VB6 A;  2ZOH A;  2W1T B;  2LB5 A;  4GHI B;  3PBO A;  4IHQ A;  3LUQ A;  3F1P A;  4CQH A;  3BY8 A;  1UGU A;  4EW7 A;  2W0N A;  3JVU A;  4XT2 A;  3TE8 A;  2WKQ A;  1N9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...