3BFGA

Class a beta-lactamase sed-g238c complexed with meropenem
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
262
structure length
262
Chain Sequence
VQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class A beta-lactamase Sed1
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
total genus 96
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfgA00
3DWKA 1PWGA 4EWFA 1BLSA 3UDXA 4N1XA 2H10A 2ZC6B 4BQMA 1QMEA 3A3EA 1MWRA 3P09A 2WGIA 3TSGA 4C6YA 3IF6A 3GVBA 4HESA 3ZG5A 1HVBA 1JWPA 4OP5A 3MXSA 1XXMA 1TDLA 2OLUA 1MY8A 3IH8A 3Q81A 1NZOA 2WGVA 4KZ6A 5AQAA 1ES3A 1MWUA 3PBSA 5FQJA 5CTNA 3ZGAB 4JLFA 4P6BA 3UPPA 3UPNA 1G6AA 3VP0A 3MBZA 4QU3A 1GHPA 5F83A 2Y2KA 1MKIA 4E3KA 3IQAA 4GD8A 3BECA 1JWZA 3UN7A 2Q9MA 4BD0A 4OLDA 5TGFA 4KZ5A 4WZ5C 4NETA 3IXDA 1K4FA 1H8ZA 1KGEA 4OQHA 4OH0A 1K57A 1KE4A 2ZD8A 1CI8A 4K0WA 2P74A 4BJPA 5EUAA 3V39A 1NYYA 2PU4A 4R0QA 2VGKA 5CEBA 4QY5A 2Y2MA 1L0DA 4Y0OA 4JF6A 3OPLA 3AGDA 3BYDA 3GMWA 4JKTA 4WMCD 1K6SA 1M40A 3C4PA 3QHYA 1EI5A 3VFHA 4P0MA 4GNUA 5A93A 3E2KA 3TOIA 3SH9A 3WS0A 5CHUA 5CHJA 5DF7A 3IWIA 4WZ4A 1SKFA 5CRFA 1CEGA 4C3QA 4EQIA 5GLBA 3ZCZA 4RX2A 4N9KA 2EXBA 3S4XA 3V3SA 4F94A 3HLCA 2XD1A 3GTCA 2XDMA 3V5MA 3WS5A 5EVIB 5M18A 4KENB 2H5SA 4Z9QA 3Q7VB 1SHVA 4H8RA 3M2KA 2RL3A 1N9BA 3OPHA 1ES2A 2B5RA 1JTDA 2XK1A 1U60A 4Y7PA 4OPQA 4CJNA 4GZBA 1YMSA 1FR6A 1TDGA 1HD8A 1LI9A 3HUMA 4NK3A 4FH4A 3MZFA 5AQ9A 3G30A 4K0XA 4S2NA 3G34A 5EE8A 4OLGA 2WZXA 5I94A 5CECA 3PBTA 4JXGA 4GB7A 2ZM8A 3PAGA 2PBYA 1ES5A 3BFDA 1PWCA 5FAPA 5AQBA 5EVIA 2Y4AA 3HUOA 3Q7VA 1QMFA 4S2PA 3IWQA 3Q07A 3GRJA 1DJCA 3GV9A 3IXHA 1YLYA 3HUNA 1XX2A 2WKEA 1IYQA 1NYMA 1IYPA 2P9VA 3WS1A 3OZHA 4L0LA 3S22A 4ZJ3A 3SH7A 1K38A 4U3TA 1H8YA 2J7VA 4KZBA 3B3XA 1KDSA 4PM8A 3N8SA 4E3MA 1Z6FA 1Y54A 5BOHA 3N6IA 1K57C 3ZG0A 5KSCA 4DXBA 1GA9A 2HDQA 1TVFA 3IF6B 5L2FA 3A3IA 1VQQA 2G2UA 2GDNA 1AXBA 3A3FA 2ZQCA 4DE0A 3NDEA 3CMZA 1FSWA 2HP9A 1XA7A 1ERQA 4S2IA 4KZ7A 4U0TA 3UDIA 4BD1A 1MWTA 4LV2A 5GHZA 3MZEA 1XKZA 4DE2A 3AGEA 5EPHA 1I2WA 3OCLA 4KQOA 2HP5A 4EV4A 4KG6A 2WK0A 4BL2A 1ESUA 1WYCA 4KQRA 1EROA 1MPLA 2E8IA 3CG5A 5FAQA 3Q82A 4Q8IA 2Y2IA 1JWVA 1K55A 3BM6A 1ES4A 2JCHA 3BFCA 3PTEA 4XXRA 5HL1A 4OQ0A 3BLSA 3ZHHA 1XGJA 4R1GA 1PWDA 1XGIA 3WWXA 5F1FA 2WAFA 1MXOA 4KZ3A 5FI6A 1S0WA 5J8XA 1L0GA 3ZVTA 3HVFA 4WMCA 1OMEA 3Q7ZA 4D2OA 3HLBA 3NCKA 4ID4A 4M3KA 4N9LA 3UY6A 2WKHA 5HARA 1DJAA 3O88A 2IWBA 2EXAA 3Q1FA 2DRWA 3DWZA 1Q2PA 4LCMA 4PM9A 3FV7A 3C7VA 3IWOA 4JF4A 1SDEA 3N8LA 1YT4A 4S2NC 5CXWA 4RA7A 5HAPA 3UPOA 5F82A 1IKIA 1KVMA 2Y2LA 3FZCA 1HTZA 2Y91A 3RXWA 3WS2A 1RGZA 3ZG9B 2X02A 2ZM2A 4JXVA 3GSGA 2WGWA 2Z2MB 3CZDA 3RJUA 2IWDA 3MFDA 3IXGA 5FA7A 2XGNA 2ZJ9A 5EVIC 1PYYA 4OKPA 5GHYA 4R4RA 5GLDA 2QPNA 1GA0A 5E43A 2OV5A 4IBXA 1VM1A 5E2EA 3DW0A 1E3UD 3FKWA 4FSFA 2XFSA 1GHIA 2H0YA 2H0TA 1MBLA 1FQGA 2Y55A 2ZC4B 3ZFZA 5CGSA 1FOFA 4CPKA 4GD6A 4B4ZA 3HLEA 3W4QA 5EVLA 5U47A 1CEFA 1I2SA 4DE3A 3OC2A 5FQKA 4E3OA 2J8YA 1DJBA 2ZQAA 3M2JA 3VSLA 3ZG8B 4OQGA 5CERA 4A5RA 4BL3A 1YQSA 3IT9A 2PU2A 5CGWA 3SS3A 3A3DA 1IEMA 3IHBA 3E2LA 3EQUA 3IF5A 2V2FF 4MEZA 2WADA 3LO7A 3DTMA 5F1GA 4E6XA 3FWLA 3A3JA 1WE4A 1NY0A 4YFMA 4O7DA 5DF9A 3SS5A 4BLMA 4LV1A 3VP1A 1TEMA 4X68A 5FI2A 3VP3A 1IYSA 1W8QA 3FKVA 1DY6A 3QNBA 5GLAA 1IELA 2P9VB 1KVLA 4OP8A 1BUEA 5FI7A 3ZNTA 3WS4A 4KZ8A 3UE0A 3NIAA 4MLLA 2XD5A 4DXCA 4DKIA 4OOYA 2I72A 5FATA 2R9WA 2HPBA 3ZDJA 2XFTA 3IF6C 2HDRA 2XH9A 1KGGA 1L0EA 4GOGA 3HLDA 2XR0A 4GKUA 3G2ZA 2CC1A 5EOEA 1HZOA 3HL9A 4ZJ2A 4WEKA 3SOIA 4B88A 4R3JA 3LY4A 1KE0A 2EFXA 5JYOA 3GR2A 4GDNA 4S2KA 2Y59A 1K25A 4N1HA 1CK3A 4UHUA 3W4PA 3NDGA 2HDUA 3V3RA 4JXWA 3NY4A 2DNSA 5FQQA 2XQZA 5GL9A 3HREA 4E6WA 2ZQDA 4IBRA 1W5DA 1SCWA 2UWXA 1PIOA 2ZQ8A 4FCFA 4E3JA 1XPBA 4DDYA 3MKEA 3UO9A 2QZ6A 4E3LA 3NC8A 4OQIA 2IWCA 5EECA 3SS4A 5JYPA 1H5XA 3TG9A 3UDFA 1K6RA 2G2WA 1NXYA 1C3BA 3CJMA 3AGFA 5D3OA 3BFEA 4BENA 4HEFA 3HLWA 1W8YA 2C6WB 3WRZA 3VMAA 1KE3A 2BLSA 1YLZA 3IH9A 1PI5A 3G35A 4S2LA 5KSHA 3P98A 4DDSA 1J9MA 3NBLA 3PBRA 4KZAA 5HW3A 5FQ9A 2X01A 4DF6A 4ZJ1A 4ZBEA 4E3NA 2EX6A 2Y2QA 4UAAA 1GCEA 4S2MA 3JYIA 2Y2OA 4ZAMA 5DVAA 1S6RA 1M6KA 1ZC2A 2WGWB 3N7WA 2Y2GA 2QMIA 2XEPA 4ZTKA 3BFFA 4KZ4A 3ZG7B 3OCNA 2EFUA 5HX9A 4LV0A 5FASA 1E3UA 1PI4A 1YLWA 2WKIA 4EBNA 1ONGA 3LEZA 1BTLA 3V50A 1LLBA 3C7UA 2Z2LB 3OPPA 3MXRA 1K56D 2ZC3B 5TFQA 2HDSA 4WEJA 1E25A 2Q9NA 2EX2A 4KG2A 5E2GA 1NZUA 5KZHA 2FFYA 4JF5A 1L0FA 2ZQ9A 2V20A 5FSRA 3HBRA 4WM9A 5GLCA 1BSGA 3I7JA 2BG1A 3ISGA 3C5AA 4LENA 5E2HA 2WZZA 5DTTA 3HLGA 1YLJA 3OPRA 4KQQA 5HAQA 1YMXA 1ZG4A 3N8RA 3NI9A 3S1YA 4RX3A 1ZKJA 4MBHA 1K54A 1YM1A 1XP4A 4Y0UA 4HBTA 2R9XA 2JE5A 4OOMA 5HFOA 1FR1A 4X6TA 4LCLA 3PBNA 5M19A 5IHVA 2WUQA 5CGXA 4R3BA 2A49A 3VOYA 4JXSA 4R23A 3SH8A 1KDWA 1IKGA 2C5WB 2EX9A 3N4IA 4YINA 2Y2NA 4OONA 3VP4A 4S2OA 1BLCA 1MWSA 4UA6A 4IVIA 3M6HA 1NJ4A 3GQZA 3PAEA 1N4OA 4IEDA 3G2YA 3MKFA 2X71A 4FH2A 5DF8A 2ZC7A 3MZDA 4XUXA 2FFFB 3M6BA 2A3UA 4X56A 4X55A 3UNWA 1XA1A 1O07A 1WYBA 4IVKA 4C75A 5GHXA 3G31A 1IYOA 2Y2HA 4KZ9A 1JVJA 2JBFA 2ZC5B 1K55C 1LL9A 4QJGA 1GHMA 1E4DA 4EBPA 4RVAA 3LCEA 4JPMA 2DCFA 2V1ZA 2JC7A 1K4EA 3WRTA 4UA7A 1NRFA 4LV3A 3VP2A 1PZPA 2ZLYA 3W4OA 4GDBA 4GN2A 2OSUA 2ZMAA 2J9PA 3O87A 5DTSA 1KGFA 1RP5A 4HBUA 5FDHA 5E2FA 1RGYA 1PW8A 4EUZA 5G18A 3IHAA 3FYZA 1ALQA 4X53A 4MBKA 4QB8A 3O86A 4WBGA 5TR7A 4EBLA 1W7FA 1I5QA 5A90A 1G68A 4QD4A 4PM7A 5HAIA 1EWZA 3BFGA 5FQIA 4DRTA 1L2SA 1FCNA 3EQVA 5A92A 4MBFA 4WZ5A 4MNRA 4E3IA 3UE3A 3VSKA 1RCJA 2VGJA 3BEBA 1BLHA 4OPZA 1K54C 1O7EA 4P85A 2WAEA 1K56A 3ITBA 2Y2PA 4PMAA 5M1AA 2J9OA 1SDNA 4OOLA 2RCXA 4N92A 1LHYA 4QY6A 2ZQ7A 2Y2JA 2HP6A 1JTGA 1ERMA 3G4PA 1FCMA 1LL5A 4PM6A 5FAOA 4Y0TA 1BLPA 3PBQA 4ZDXA 4OVDA 3RXXA 3PBOA 4OPYA 4OPRA 4S2JA 3BLMA 3QNCA 1BULA 3ZVWA 4R4SA 3C4OA 2OLVA 5A91A 1YLPA 1ONHA 4WELA 2WYXA 1LI0A 1BZAA 1PZOA 1Q2QA 1W79A 4B4XA 3ITAA 5DTKA 3BRMA 4K91A 2EX8A 4QHCA 3D4FA 4JBFA 1FCOA 4KG5A 4PPRA 1CI9A 5EOOA 2XLNA 3UE1A 3VOZA 4UA9A 5CEDA 2XF3A 3W8KA 4WYYA 3ZNYA 5AQ7A 4X69A 4XUZA 5CTMA 1BT5A 4RYEA 3IXBA 4FD8A 5EVID 5FQMA 5KMWA 4DE1A 4U0XA 4P87A 3O3VA 3HLFA 1ZG6A 1PW1A 1FSYA 3VFFA 2ZM0A 3LY3A 4PM5A 3G32A 1YLTA 5CHMA 1ESIA
chains in the Genus database with same CATH superfamily
4EWFA 4N1XA 1D1JA 3IF6A 2WKPA 1JWPA 5HSQA 2OLUA 2XA7S 3IH8A 5AQAA 1ES3A 5FQJA 2KDKA 4JLFA 3UPNA 3VP0A 4QU3A 1Y4OA 2Y2KA 3BECA 3KSGA 4ARZA 2Q9MA 4GS9B 5EV0A 4WZ5C 2A24B 1IFQA 2ZD8A 1CI8A 5HD3A 3VV4A 3UB8A 3V39A 4B9OA 2PU4A 5EFWA 2VGKA 2W0NA 1MKMA 4QY5A 4EW7A 3PR6A 4JF6A 2MJ6A 3QP8A 1K6SA 3C4PA 2NUTC 4HP9A 3KYQA 3WS0A 5CHUA 4EETB 4EQIA 5HPIA 3T1QB 2EXBA 1CJFA 3V3SA 5M18A 4UQIS 1S4RA 3IS2A 1P0ZA 1XFNA 5FL3A 1ES2A 1JTDA 2XK1A 4GZBA 1TDGA 3H9WA 1LI9A 5DKKA 1J3WA 3S7PA 3LEQA 5EE8A 5I94A 4X1MA 4Y2FA 5HWTA 2PBYA 3BFDA 5FAPA 2PDRA 1QMFA 3IWQA 3VE4A 1DJCA 3MFXA 3CAXA 3RFBA 1NYMA 3KSIA 2P9VA 4L0LA 4CLCC 4X25A 1Y54A 1K57C 5L07A 1SZVA 5KSCA 5L2FA 1VQQA 2ZQCA 3UDIA 4LV2A 1XKZA 3F1PA 1WYCA 3LICA 1LT0A 2E8IA 3CG5A 5G4ZA 2V8CA 2PT7A 1K55A 4CLCB 1ES4A 1A0KA 1XGJA 1XGIA 1OTBA 2D02A 1S0WA 1L0GA 3ZVTA 3K3DA 3Q7ZA 3NCKA 3UY6A 4BBUA 1ODVA 3DWZA 1G5UA 3FV7A 3IWOA 4R3AA 2V0UA 2Y2LA 2Y91A 5MC7A 3ZG9B 2X02A 4NXGA 4JXVA 2WGWA 2Z2MB 2AVXA 5EVIC 1XJ3A 5E2EA 3C30A 4FSFA 3KYZA 2Y55A 3EOIA 3DTEA 1LL8A 3SW1A 2J3WA 3OC2A 4E3OA 1DJBA 1STZA 2M7VA 3MQQA 2ZQAA 3M2JA 3UB6A 2W3HA 4OQGA 4BL3A 3IT9A 3SS3A 3A3DA 1IEMA 3IHBA 2JN7A 3LO7A 2ZBBA 1WE4A 3SS5A 5FEGA 3MSHA 4LV1A 3VP1A 1IYSA 5GLAA 2Y8HA 2WKRA 2OWJA 3B33A 1OTAA 4MLLA 3IBJA 2I72A 3ZDJA 2HDRA 2XH9A 2Q0OA 1L0EA 1HZOA 3HL9A 1P9RA 4GHIA 4R3JA 4RQ9A 4HI4A 1AWIA 3GR2A 2JKGA 1XJ2A 1K25A 1CK3A 4UHUA 3F1OA 4GLQA 5GL9A 3HREA 3LIFA 4E04A 1T1CA 2R78A 3VOLA 2UWXA 1SCWA 3A0RA 4I3IA 1C3BA 1F98A 3AGFA 4HEFA 1GSXA 3JVUA 1LSXA 2O9CA 1YLZA 3G35A 2XA7M 4B93A 3P98A 5HWVA 3FG8A 4KZAA 5HW3A 5FQ9A 2O9AA 4LRYC 2W3EA 2EX6A 1GCEA 5HDSA 1ZC2A 3ZG7B 1PRQA 2WKQA 3E4PA 2EFUA 5HX9A 1YLWA 1GSWA 3BWLA 2JKTM 2V9AA 1SKOA 2V1AA 2W1TB 3LFVA 2ZC3B 1L3LA 1E25A 5J7EA 4JF5A 4WM9A 5AVEA 3ISGA 3C5AA 1YAXA 5DTTA 1YMXA 1ZKJA 1K0KA 4Y0UA 2R9XA 2W1TA 4X6TA 5IHVA 2WUQA 4UQIM 3D9YA 4HP4A 2M1CA 3QP5A 1YSPA 2B95A 3NOPC 4YINA 4OONA 3RTYA 3MKFA 5L10A 3ULFA 5DF8A 4IVKA 4C75A 5GHXA 3G31A 4LLOB 1IYOA 3C8CA 2JBFA 3LI9A 4QJGA 3LCEA 2DCFA 2V1ZA 1NRFA 2GNXA 3VP2A 4CLCD 4GDBA 2ZMAA 2J9PA 5DTSA 1KGFA 1PFLA 5FDHA 5E2FA 1PW8A 4R38A 2VLGA 3FYZA 1OPXA 4R6LA 4X53A 1LSVA 4QB8A 4QD4A 1UWNX 3BFGA 5FQIA 1L2SA 1X0OA 2PD8A 3IX4A 2QJ5A 4CLCE 2WAEA 1OJGA 4FUWA 5HDCA 4N92A 1CQAA 4LPZA 5EECA 1ERMA 1JTGA 5F68A 4Y0TA 4JGPA 3PBQA 3UB9A 4OPYA 5HDDA 3C4OA 4EEPA 2PR6A 1Q2QA 4B4XA 3ITAA 4K91A 4JBFA 2XLNA 3UE1A 3VOZA 3ZNYA 2W27A 4X69A 5AJGA 5EVID 3IXBA 2ZL1B 3BW6A 5CHMA 1PWGA 3UDXA 2ZC6B 2WGIA 4Y3IA 2PRFA 3GVBA 4C6YA 3ZG5A 4EXOA 3B42A 5KIZA 3CI6A 4OP5A 1MWUA 3PBSA 3MF0A 3NOTC 3MBZA 4E3KA 3IQAA 4GD8A 1DP9A 4BD0A 4OLDA 5K5BA 2PHYA 3IXDA 4KUOA 1KGEA 4OQHA 3T4JA 5TBMA 4BJPA 5EUAA 3TRCA 1ZHHB 4IUHA 5CEBA 3QP4A 1L0DA 1S1YA 3AGDA 3EEHA 4WMCD 4X1LA 1M40A 2H28A 5DF7A 4WZ4A 1H0MA 1CEGA 4PHTA 4C3QA 1YSQA 3S4XA 1DP6A 4KQDA 3V5MA 3WS5A 4HNBA 2J80A 2H5SA 4H8RA 3CLOA 2RL3A 2JKRI 4HJ3A 1U60A 3CUEA 1YMSA 3KSFA 4QWOA 1OTDA 3HUMA 2W3GA 2QHKA 4NK3A 3MZFA 5AQ9A 3G30A 4K0XA 4S2NA 4JXGA 3QP2A 2ZM8A 1MC0A 1T1BA 1ES5A 4BMWA 2VGLS 3HUOA 4S2PA 4YWZA 1V9YA 4QPRA 1YLYA 3BJNA 3WS1A 3OZHA 1K38A 4U3TA 1H8YA 4KZBA 1T18A 4PM8A 4Q0HA 1Z6FA 3ZG0A 1FILA 4DXBA 1S67L 1TS8A 3IF6B 4XT2A 3A3IA 5AVFA 4PAUA 3F1NA 1OTEA 1ERQA 4BD1A 4KZ7A 4ZRRA 5L8MA 4AFIA 4KQOA 4KG6A 3ZQ5A 5IT5A 4ARZB 4Q8IA 1JWVA 3BM6A 5G4YA 2BASA 2Z6CA 4OQ0A 2CMNA 3ZHHA 4KUKA 3WWXA 2WAFA 1MXOA 4KZ3A 5FI6A 4D2OA 4N9LA 1P97A 2IWBA 1VHMA 2EXAA 2LB9A 4JF4A 3G6OA 2PYRA 4MN6A 4DJ2A 2PBDP 3O5YA 3WS2A 1RGZA 2ACGA 3GSGA 3D72A 3CITA 5FA7A 2P04A 3IS2B 5GLDA 1GA0A 4IBXA 1E3UD 2XFSA 2H0TA 4LRZE 3ZFZA 3LR0A 2JKTI 1FOFA 4B4ZA 5U47A 3FPVA 2GX5A 4I5SA 3NULA 2FZ0A 2P7JA 4A5RA 1YQSA 2PU2A 3RH8B 1NLYA 3EQUA 4MEZA 5DFYA 5F1GA 4E6XA 3FWLA 3JVVA 4YFMA 3BQAA 5DF9A 1TEMA 3VP3A 2QYBA 1W8QA 3ZNTA 4OP8A 2P9VB 3WS4A 4LGWA 3NIAA 3EEAA 2XD5A 5FATA 2R9WA 2HPBA 4P6ZS 2XR0A 4GKUA 3G2ZA 4ZJ2A 2GJ3A 3F1PB 4B88A 3LY4A 2UV0E 4GDNA 2ZOHA 2O99A 1TD5A 4HH2A 4HOIA 3NDGA 3V3RA 2ZOIA 2DNSA 2XQZA 3PXPA 4IBRA 4FCFA 2ZQ8A 4DDYA 3MKEA 3H82A 3TG9A 3UDFA 2G2WA 1NXYA 4ME4A 3BFEA 3IX3A 3NECA 3VMAA 2BLSA 2VA0A 1KOUA 4S2LA 2ZMVA 1TS7A 4DDSA 3NBLA 3R4KA 4E3NA 2JKFA 4S2MA 3JYIA 4ZAMA 1M6KA 2WGWB 3MQOA 4BWIA 3H7WA 4NG2A 2Y2GA 2KX6A 2XEPA 3BFFA 4KZ4A 4ZTKA 3OCNA 4EESA 4LV0A 4BBTA 4EBNA 1ONGA 1BTLA 1LLBA 3C7UA 3IBRA 4L9GA 1F2KA 5EVEA 5E2GA 1L0FA 2V20A 5FSRA 3NJAA 4ETZA 5GLCA 3I7JA 4LENA 3HLGA 1YLJA 3E0YA 4MBHA 1XJ6A 1YM1A 4OOMA 5HFOA 1W63Q 4LCLA 3K3CA 5M19A 2EWVA 2HF6A 2KLIA 5TJJA 4HH3A 3VOYA 4JXSA 4R23A 3SH8A 2C5WB 3N4IA 1BLCA 2PR5A 2VX8A 3E4QA 3M6HA 3PAEA 1N4OA 3DTIA 2A2LA 2X71A 4UEYA 3MZDA 4GHIB 4DMZA 4LRXC 1XA1A 1O07A 2Y2HA 2VGLM 3GDIA 2P08A 3F1OB 4RVAA 2JC7A 1K4EA 4UA7A 2EA9A 2ZLYA 3C2WA 2OSUA 3O87A 3TW8A 1RP5A 4HBUA 5J4EA 2W1RA 1W7FA 5A90A 1TS0A 4Y5FA 2QJ7A 4DRTA 1FCNA 3U2AA 4MBFA 3LR5A 3UE3A 3VSKA 1RCJA 3BEBA 3LYXA 1O7EA 1K56A 2K7SA 2J9OA 1SKOB 3G4PA 5FAOA 3L7HA 1BLPA 4S2JA 2G7UA 4JGQA 1YLPA 1ONHA 2VEAA 1S66L 2WYXA 1PZOA 2EX8A 3D4FA 1FCOA 2XF3A 3EWKA 3T4QA 5CTMA 1BT5A 5FQMA 2V8FA 4U0XA 4P87A 3O3VA 3TE8A 1PW1A 1NLZA 1S4SA 1XJ4A 3G32A 1ESIA 1OT6A 3DWKA 4NKPA 3OLOA 1QMEA 3A3EA 5F6AA 3P09A 3S7QA 1PNEA 3TSGA 1XFQA 1HVBA 4MN5A 4R70A 3MXSA 3Q81A 1MY8A 2J3TC 4P6BA 4G3WA 1GHPA 5F83A 1MKIA 1JWZA 3UN7A 3R7WA 4KZ5A 1K4FA 1H8ZA 4OH0A 3T12B 2OWHA 4ESPA 3E98A 4HJ6A 2Y2MA 3GMWA 5DKLA 1EI5A 3BY8A 4P0MA 4GNUA 1Z09A 4MN7A 3IWIA 1YPRA 5CRFA 5C5KA 3C38A 3TJZC 3ZCZA 4N9KA 4F94A 4KENB 4M4XA 3M2KA 3OPHA 3T4SA 4Y7PA 1FR6A 1ZTUA 1HD8A 4FH4A 3G34A 4OLGA 1F9IA 3SZTA 1T19A 3PBTA 3CPTA 3PAGA 2HJ9C 3JPUA 3A0SA 3L9KA 2XRNA 2FH5A 3Q07A 3IXHA 3HUNA 1IYQA 1IYPA 3P7NA 1HLUP 2L0WA 3S22A 3B3XA 1KDSA 3N8SA 4E3MA 1VETA 1GA9A 2HDQA 4PKYG 4F3LA 2G2UA 3A3FA 1YKDA 1AXBA 3CMZA 1FSWA 2HP9A 1XA7A 1MWTA 5GHZA 4DE2A 3AGEA 5EPHA 1I2WA 1EW0A 3OCLA 5FDSA 4BL2A 1ESUA 4KQRA 1EROA 3S7OA 3Q82A 4HIAA 1N9OA 3PTEA 4XXRA 5HL1A 3BLSA 3IX8A 4R1GA 5TBMB 1PWDA 5A8BA 5J8XA 2OOLA 3BY9A 1OMEA 4NEED 4ID4A 2WKHA 3CUEC 5HARA 3T4LA 3O88A 5EM0A 2DRWA 4LCMA 4O0PA 4PM9A 3C7VA 1SDEA 3N8LA 4S2NC 4RA7A 5HAPA 2M7UA 1IKIA 1KVMA 3FZCA 3RXWA 1HTZA 3KX0X 4WN5A 2IWDA 3IXGA 3PHYA 4DJ3A 5GHYA 4R4RA 1VM1A 4I38A 4WF0A 2ZC4B 1MBLA 5CGSA 4CPKA 4GD6A 3W4QA 5EVLA 1CEFA 3ZG8B 5CERA 1VEUA 4PKYA 3DTMA 4HQAA 1D7EA 1NWZA 4X68A 4GCZA 1OJ5A 3FKVA 3LR4A 5FI7A 1KVLA 1BUEA 4KZ8A 5FEFA 4G3VA 3ICYA 2Y79A 5DJUA 2PAVP 4DXCA 4DKIA 4OOYA 5HPFA 4G3KA 2XFTA 3IF6C 4XT2B 1KGGA 3HLDA 3F1NB 5EOEA 1DRMA 2HV1A 2K2NA 1KE0A 2EFXA 4S2KA 2QKPA 4N1HA 3T4KA 3W4PA 2HDUA 3MMHA 4H6JB 3HJKA 3UE6A 4WUJA 2ZQDA 3BQ8A 1W5DA 3UO9A 3NC8A 3EGXC 5JYPA 1H5XA 4I3JA 1K6RA 3CJMA 5D3OA 4ETXA 4JGRA 2C6WB 3WRZA 4IUKA 2O9BA 4L9EA 2J3TD 2HGVA 1J9MA 4ZBEA 4H6JA 2Y2QA 5DVAA 1S6RA 3N7WA 4LFUA 4Y15A 5EM1A 1PI4A 2WKIA 3LEZA 3V50A 2L1MA 2Z2LB 3OPPA 3MXRA 5TFQA 2HDSA 4WEJA 4Y13A 2Q9NA 2EX2A 1NZUA 5KZHA 2FFYA 2ZQ9A 4DN0A 2EWWA 2VV6A 2WZZA 4KQQA 5HAQA 3E4OA 3LR3A 3S1YA 4EQ1A 4RX3A 3LGOA 1K54A 3OBFA 4D60A 2VV7A 2B02A 1KDWA 1IKGA 4S2OA 1NJ4A 2Z6DA 4IEDA 4FH2A 2ZC7A 4IJGA 3M6BA 2A3UA 4X56A 4X55A 3UNWA 1DP8A 4KZ9A 4GS9A 1JVJA 2ZC5B 3A0VA 1K55C 1GHMA 2A24A 4EU0A 1E4DA 4EBPA 1OT9A 4JPMA 4BBVA 3WRTA 2V1BA 1PZPA 5IS1A 4GN2A 3H82B 2YKHA 1RGYA 1FIKA 4MBKA 3LI8A 4WBGA 4EBLA 3KO6A 1H3QA 2HJEA 5A92A 4WZ5A 4E3IA 4JGOA 3H7WB 1BLHA 4P85A 2VJWA 3ITBA 4PMAA 5M1AA 1SDNA 4OOLA 2RCXA 4QY6A 2Y2JA 2HP6A 1FCMA 4PM6A 4ZDXA 4OVDA 3PBOA 4OPRA 3QNCA 4NXEA 4WELA 1LI0A 1BZAA 1W79A 2NUPC 5DTKA 3BRMA 4PPRA 1CI9A 1BYWA 4UA9A 3W8KA 3LIEA 5AQ7A 4RYEA 5J3WA 4Q0IA 3HLFA 1ZG6A 1FSYA 2ZM0A 3LY3A 1YLTA 3FPWA 3UB7A 1BLSA 2H10A 4BQMA 1MWRA 4WLAA 4HESA 3GECA 3B47A 1XXMA 1TDLA 4KZ6A 1NZOA 2WGVA 5CTNA 3ZGAB 3UPPA 1G6AA 4K08A 5TGFA 1V9ZA 2GZAA 4MMNA 3PYPA 4NETA 4CLCA 2VKSA 2DMWA 1K57A 1KE4A 4K0WA 2JKRM 3MJQA 4HHDA 3CHWP 2P74A 2VV8A 1NYYA 4R0QA 2W3DA 4Y0OA 3UMDA 3OPLA 1OTIA 3BYDA 4JKTA 3QHYA 3MR0A 2PD7A 3VFHA 4EERA 5A93A 2PYPA 3E2KA 3TOIA 3SH9A 5CHJA 1SKFA 3DBAA 3V67A 5GLBA 4RX2A 1G28A 2IA2A 3HLCA 1D06A 2XD1A 3GTCA 2XDMA 2XSSA 5EVIB 4Z9QA 3Q7VB 1SHVA 1N9BA 1P9WA 3KSHA 2B5RA 4OPQA 4CJNA 3U4LP 2WZXA 3QP1A 4O01A 2V0WA 5CECA 4MDZA 4GB7A 4O8GA 3UB5P 4WL9A 1PWCA 2E8JA 5AQBA 5EVIA 2Y4AA 3Q7VA 3LIDA 1NRJA 3GRJA 3GV9A 1XX2A 4NXFA 2WKEA 4ZJ3A 3SH7A 2J7VA 5IU1A 2K31A 5BOHA 1UGUA 3N6IA 1TVFA 5HD5A 4MCWA 2GDNA 4DE0A 1LSWA 3NDEA 3HJIA 1TS6A 4S2IA 4U0TA 3MZEA 1S1ZA 2HP5A 4EV4A 2WK0A 1MPLA 5FAQA 3R7WB 2Y2IA 2JCHA 4L9FA 3DAVA 3T4TA 3BFCA 4Y17A 2YKFA 3T50A 2INWA 5F5YA 5F1FA 2O0YA 3HVFA 4WMCA 3HLBA 4M3KA 1DJAA 3Q1FA 3T1SA 1Q2PA 2VK3A 5CXWA 1YT4A 3S7NA 3UPOA 5F82A 5CX7A 3NOUC 2ZM2A 1H8MA 1G6OA 3CZDA 3FC7A 3RJUA 3MFDA 2XGNA 2ZJ9A 3HCYA 1PYYA 2JHEA 4OKPA 2QPNA 5E43A 2OV5A 3DW0A 4P6ZM 3FKWA 1GHIA 2H0YA 1FQGA 1T1AA 3HLEA 1I2SA 4DE3A 5FQKA 3MXQA 2J8YA 3VSLA 3CPTB 1WA9A 5LBRA 5L09A 5CGWA 2QWSA 3E2LA 3IF5A 2V2FF 2WADA 3A3JA 1NY0A 4O7DA 4BLMA 5FI2A 3QP6A 1DY6A 3QNBA 1IELA 3P01A 2B18A 4NXBA 3UE0A 2OAP1 1VETB 1VB6A 4F3LB 4GOGA 2VZWA 2CC1A 4WEKA 5HZHA 3SOIA 2BTFP 5JYOA 2I9VA 3DTKA 2Y59A 4HY8A 4JXWA 3NY4A 2ZMFA 3UMEA 5FQQA 2W3FA 4E6WA 1Y28A 1PIOA 4E3JA 1XPBA 4E3LA 4EEUA 2QZ6A 4OQIA 2IWCA 5DFXA 3SS4A 4BENA 3HLWA 1GSVA 1W8YA 4YOFA 3T4OA 1KE3A 3LIAA 4Z1WA 3IH9A 1PI5A 4II7A 1N9NA 5KSHA 3PBRA 2X01A 4DF6A 4ZJ1A 4UAAA 2Y2OA 4GJ4A 2QMIA 3LUQA 5FASA 1E3UA 1K56D 4KG2A 1UWPX 3ZYTA 3HBRA 1BSGA 2BG1A 5E2HA 2XROA 3OPRA 1ZG4A 5I5LA 3N8RA 3NI9A 1N9LA 1VEUB 2KOIA 1XP4A 3T1RA 2D01A 4HBTA 2JE5A 2LB5A 2OAQ1 1FR1A 3PBNA 2ZL1A 5CGXA 4R3BA 2A49A 1JNUA 3MS6A 2EX9A 2Y2NA 4FOFA 3VP4A 1MWSA 4UA6A 4IVIA 3GQZA 1CF0A 3CWFA 3G2YA 2HZ5A 1ACFA 1W63M 1TF1A 2FFFB 3K2NA 4XUXA 1WYBA 4Q0JA 3LIBA 1LL9A 3MQ0A 4IHQA 3T1XA 4LV3A 3W4OA 4HJ4A 4FTXA 4CQHA 5HL6A 4EUZA 5G18A 3OOVA 3IHAA 1ALQA 3O86A 1IOUA 5TR7A 4EUVA 3VE3A 1I5QA 1G68A 4PM7A 5HAIA 1EWZA 3EQVA 4MNRA 4I39A 4GW9A 2VGJA 4OPZA 1K54C 3NHQA 2Y2PA 3D3OA 5F69A 1LHYA 5HWWA 2ZQ7A 1LL5A 4YNRA 3RXXA 3BLMA 1MZUA 1BULA 3ZVWA 4R4SA 2OLVA 5A91A 3W2ZA 1F5MA 3EGDC 4QHCA 4KG5A 5EOOA 3KYEA 5CEDA 4WYYA 4XUZA 4FD8A 5KMWA 2L4RA 4DE1A 5DJTA 3VFFA 4PM5A 4I3AA
chains in the Genus database with same CATH topology
3DWKA 1PWGA 4EWFA 1BLSA 3UDXA 4N1XA 2H10A 2ZC6B 4BQMA 1QMEA 3A3EA 1MWRA 3P09A 2WGIA 3TSGA 4C6YA 3IF6A 3GVBA 4HESA 3ZG5A 1HVBA 1JWPA 4OP5A 3MXSA 1XXMA 1TDLA 2OLUA 1MY8A 3IH8A 3Q81A 1NZOA 2WGVA 4KZ6A 5AQAA 1ES3A 1MWUA 3PBSA 5FQJA 5CTNA 3ZGAB 4JLFA 4P6BA 3UPPA 3UPNA 1G6AA 3VP0A 3MBZA 4QU3A 1GHPA 5F83A 2Y2KA 1MKIA 4E3KA 3IQAA 4GD8A 3BECA 1JWZA 3UN7A 2Q9MA 4BD0A 4OLDA 5TGFA 4KZ5A 4WZ5C 4NETA 3IXDA 1K4FA 1H8ZA 1KGEA 4OQHA 4OH0A 1K57A 1KE4A 2ZD8A 1CI8A 4K0WA 2P74A 4BJPA 5EUAA 3V39A 1NYYA 2PU4A 4R0QA 2VGKA 5CEBA 4QY5A 2Y2MA 1L0DA 4Y0OA 4JF6A 3OPLA 3AGDA 3BYDA 3GMWA 4JKTA 4WMCD 1K6SA 1M40A 3C4PA 3QHYA 1EI5A 3VFHA 4P0MA 4GNUA 5A93A 3E2KA 3TOIA 3SH9A 3WS0A 5CHUA 5CHJA 5DF7A 3IWIA 4WZ4A 1SKFA 5CRFA 1CEGA 4C3QA 4EQIA 5GLBA 3ZCZA 4RX2A 4N9KA 2EXBA 3S4XA 3V3SA 4F94A 3HLCA 2XD1A 3GTCA 2XDMA 3V5MA 3WS5A 5EVIB 5M18A 4KENB 2H5SA 4Z9QA 3Q7VB 1SHVA 4H8RA 3M2KA 2RL3A 1N9BA 3OPHA 1ES2A 2B5RA 1JTDA 2XK1A 1U60A 4Y7PA 4OPQA 4CJNA 4GZBA 1YMSA 1FR6A 1TDGA 1HD8A 1LI9A 3HUMA 4NK3A 4FH4A 3MZFA 5AQ9A 3G30A 4K0XA 4S2NA 3G34A 5EE8A 4OLGA 2WZXA 5I94A 5CECA 3PBTA 4JXGA 4GB7A 2ZM8A 3PAGA 2PBYA 1ES5A 3BFDA 1PWCA 5FAPA 5AQBA 5EVIA 2Y4AA 3HUOA 3Q7VA 1QMFA 4S2PA 3IWQA 3Q07A 3GRJA 1DJCA 3GV9A 3IXHA 1YLYA 3HUNA 1XX2A 2WKEA 1IYQA 1NYMA 1IYPA 2P9VA 3WS1A 3OZHA 4L0LA 3S22A 4ZJ3A 3SH7A 1K38A 4U3TA 1H8YA 2J7VA 4KZBA 3B3XA 1KDSA 4PM8A 3N8SA 4E3MA 1Z6FA 1Y54A 5BOHA 3N6IA 1K57C 3ZG0A 5KSCA 4DXBA 1GA9A 2HDQA 1TVFA 3IF6B 5L2FA 3A3IA 1VQQA 2G2UA 2GDNA 1AXBA 3A3FA 2ZQCA 4DE0A 3NDEA 3CMZA 1FSWA 2HP9A 1XA7A 1ERQA 4S2IA 4KZ7A 4U0TA 3UDIA 4BD1A 1MWTA 4LV2A 5GHZA 3MZEA 1XKZA 4DE2A 3AGEA 5EPHA 1I2WA 3OCLA 4KQOA 2HP5A 4EV4A 4KG6A 2WK0A 4BL2A 1ESUA 1WYCA 4KQRA 1EROA 1MPLA 2E8IA 3CG5A 5FAQA 3Q82A 4Q8IA 2Y2IA 1JWVA 1K55A 3BM6A 1ES4A 2JCHA 3BFCA 3PTEA 4XXRA 5HL1A 4OQ0A 3BLSA 3ZHHA 1XGJA 4R1GA 1PWDA 1XGIA 3WWXA 5F1FA 2WAFA 1MXOA 4KZ3A 5FI6A 1S0WA 5J8XA 1L0GA 3ZVTA 3HVFA 4WMCA 1OMEA 3Q7ZA 4D2OA 3HLBA 3NCKA 4ID4A 4M3KA 4N9LA 3UY6A 2WKHA 5HARA 1DJAA 3O88A 2IWBA 2EXAA 3Q1FA 2DRWA 3DWZA 1Q2PA 4LCMA 4PM9A 3FV7A 3C7VA 3IWOA 4JF4A 1SDEA 3N8LA 1YT4A 4S2NC 5CXWA 4RA7A 5HAPA 3UPOA 5F82A 1IKIA 1KVMA 2Y2LA 3FZCA 1HTZA 2Y91A 3RXWA 3WS2A 1RGZA 3ZG9B 2X02A 2ZM2A 4JXVA 3GSGA 2WGWA 2Z2MB 3CZDA 3RJUA 2IWDA 3MFDA 3IXGA 5FA7A 2XGNA 2ZJ9A 5EVIC 1PYYA 4OKPA 5GHYA 4R4RA 5GLDA 2QPNA 1GA0A 5E43A 2OV5A 4IBXA 1VM1A 5E2EA 3DW0A 1E3UD 3FKWA 4FSFA 2XFSA 1GHIA 2H0YA 2H0TA 1MBLA 1FQGA 2Y55A 2ZC4B 3ZFZA 5CGSA 1FOFA 4CPKA 4GD6A 4B4ZA 3HLEA 3W4QA 5EVLA 5U47A 1CEFA 1I2SA 4DE3A 3OC2A 5FQKA 4E3OA 2J8YA 1DJBA 2ZQAA 3M2JA 3VSLA 3ZG8B 4OQGA 5CERA 4A5RA 4BL3A 1YQSA 3IT9A 2PU2A 5CGWA 3SS3A 3A3DA 1IEMA 3IHBA 3E2LA 3EQUA 3IF5A 2V2FF 4MEZA 2WADA 3LO7A 3DTMA 5F1GA 4E6XA 3FWLA 3A3JA 1WE4A 1NY0A 4YFMA 4O7DA 5DF9A 3SS5A 4BLMA 4LV1A 3VP1A 1TEMA 4X68A 5FI2A 3VP3A 1IYSA 1W8QA 3FKVA 1DY6A 3QNBA 5GLAA 1IELA 2P9VB 1KVLA 4OP8A 1BUEA 5FI7A 3ZNTA 3WS4A 4KZ8A 3UE0A 3NIAA 4MLLA 2XD5A 4DXCA 4DKIA 4OOYA 2I72A 5FATA 2R9WA 2HPBA 3ZDJA 2XFTA 3IF6C 2HDRA 2XH9A 1KGGA 1L0EA 4GOGA 3HLDA 2XR0A 4GKUA 3G2ZA 2CC1A 5EOEA 1HZOA 3HL9A 4ZJ2A 4WEKA 3SOIA 4B88A 4R3JA 3LY4A 1KE0A 2EFXA 5JYOA 3GR2A 4GDNA 4S2KA 2Y59A 1K25A 4N1HA 1CK3A 4UHUA 3W4PA 3NDGA 2HDUA 3V3RA 4JXWA 3NY4A 2DNSA 5FQQA 2XQZA 5GL9A 3HREA 4E6WA 2ZQDA 4IBRA 1W5DA 1SCWA 2UWXA 1PIOA 2ZQ8A 4FCFA 4E3JA 1XPBA 4DDYA 3MKEA 3UO9A 2QZ6A 4E3LA 3NC8A 4OQIA 2IWCA 5EECA 3SS4A 5JYPA 1H5XA 3TG9A 3UDFA 1K6RA 2G2WA 1NXYA 1C3BA 3CJMA 3AGFA 5D3OA 3BFEA 4BENA 4HEFA 3HLWA 1W8YA 2C6WB 3WRZA 3VMAA 1KE3A 2BLSA 1YLZA 3IH9A 1PI5A 3G35A 4S2LA 5KSHA 3P98A 4DDSA 1J9MA 3NBLA 3PBRA 4KZAA 5HW3A 5FQ9A 2X01A 4DF6A 4ZJ1A 4ZBEA 4E3NA 2EX6A 2Y2QA 4UAAA 1GCEA 4S2MA 3JYIA 2Y2OA 4ZAMA 5DVAA 1S6RA 1M6KA 1ZC2A 2WGWB 3N7WA 2Y2GA 2QMIA 2XEPA 4ZTKA 3BFFA 4KZ4A 3ZG7B 3OCNA 2EFUA 5HX9A 4LV0A 5FASA 1E3UA 1PI4A 1YLWA 2WKIA 4EBNA 1ONGA 3LEZA 1BTLA 3V50A 1LLBA 3C7UA 2Z2LB 3OPPA 3MXRA 1K56D 2ZC3B 5TFQA 2HDSA 4WEJA 1E25A 2Q9NA 2EX2A 4KG2A 5E2GA 1NZUA 5KZHA 2FFYA 4JF5A 1L0FA 2ZQ9A 2V20A 5FSRA 3HBRA 4WM9A 5GLCA 1BSGA 3I7JA 2BG1A 3ISGA 3C5AA 4LENA 5E2HA 2WZZA 5DTTA 3HLGA 1YLJA 3OPRA 4KQQA 5HAQA 1YMXA 1ZG4A 3N8RA 3NI9A 3S1YA 4RX3A 1ZKJA 4MBHA 1K54A 1YM1A 1XP4A 4Y0UA 4HBTA 2R9XA 2JE5A 4OOMA 5HFOA 1FR1A 4X6TA 4LCLA 3PBNA 5M19A 5IHVA 2WUQA 5CGXA 4R3BA 2A49A 3VOYA 4JXSA 4R23A 3SH8A 1KDWA 1IKGA 2C5WB 2EX9A 3N4IA 4YINA 2Y2NA 4OONA 3VP4A 4S2OA 1BLCA 1MWSA 4UA6A 4IVIA 3M6HA 1NJ4A 3GQZA 3PAEA 1N4OA 4IEDA 3G2YA 3MKFA 2X71A 4FH2A 5DF8A 2ZC7A 3MZDA 4XUXA 2FFFB 3M6BA 2A3UA 4X56A 4X55A 3UNWA 1XA1A 1O07A 1WYBA 4IVKA 4C75A 5GHXA 3G31A 1IYOA 2Y2HA 4KZ9A 1JVJA 2JBFA 2ZC5B 1K55C 1LL9A 4QJGA 1GHMA 1E4DA 4EBPA 4RVAA 3LCEA 4JPMA 2DCFA 2V1ZA 2JC7A 1K4EA 3WRTA 4UA7A 1NRFA 4LV3A 3VP2A 1PZPA 2ZLYA 3W4OA 4GDBA 4GN2A 2OSUA 2ZMAA 2J9PA 3O87A 5DTSA 1KGFA 1RP5A 4HBUA 5FDHA 5E2FA 1RGYA 1PW8A 4EUZA 5G18A 3IHAA 3FYZA 1ALQA 4X53A 4MBKA 4QB8A 3O86A 4WBGA 5TR7A 4EBLA 1W7FA 1I5QA 5A90A 1G68A 4QD4A 4PM7A 5HAIA 1EWZA 3BFGA 5FQIA 4DRTA 1L2SA 1FCNA 3EQVA 5A92A 4MBFA 4WZ5A 4MNRA 4E3IA 3UE3A 3VSKA 1RCJA 2VGJA 3BEBA 1BLHA 4OPZA 1K54C 1O7EA 4P85A 2WAEA 1K56A 3ITBA 2Y2PA 4PMAA 5M1AA 2J9OA 1SDNA 4OOLA 2RCXA 4N92A 1LHYA 4QY6A 2ZQ7A 2Y2JA 2HP6A 1JTGA 1ERMA 3G4PA 1FCMA 1LL5A 4PM6A 5FAOA 4Y0TA 1BLPA 3PBQA 4ZDXA 4OVDA 3RXXA 3PBOA 4OPYA 4OPRA 4S2JA 3BLMA 3QNCA 1BULA 3ZVWA 4R4SA 3C4OA 2OLVA 5A91A 1YLPA 1ONHA 4WELA 2WYXA 1LI0A 1BZAA 1PZOA 1Q2QA 1W79A 4B4XA 3ITAA 5DTKA 3BRMA 4K91A 2EX8A 4QHCA 3D4FA 4JBFA 1FCOA 4KG5A 4PPRA 1CI9A 5EOOA 2XLNA 3UE1A 3VOZA 4UA9A 5CEDA 2XF3A 3W8KA 4WYYA 3ZNYA 5AQ7A 4X69A 4XUZA 5CTMA 1BT5A 4RYEA 3IXBA 4FD8A 5EVID 5FQMA 5KMWA 4DE1A 4U0XA 4P87A 3O3VA 3HLFA 1ZG6A 1PW1A 1FSYA 3VFFA 2ZM0A 3LY3A 4PM5A 3G32A 1YLTA 5CHMA 1ESIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWK A;  1PWG A;  4EWF A;  1BLS A;  3UDX A;  4N1X A;  2H10 A;  2ZC6 B;  4BQM A;  1QME A;  3A3E A;  1MWR A;  3P09 A;  2WGI A;  3TSG A;  4C6Y A;  3IF6 A;  3GVB A;  4HES A;  3ZG5 A;  1HVB A;  1JWP A;  4OP5 A;  3MXS A;  1XXM A;  1TDL A;  2OLU A;  1MY8 A;  3IH8 A;  3Q81 A;  1NZO A;  2WGV A;  4KZ6 A;  5AQA A;  1ES3 A;  1MWU A;  3PBS A;  5FQJ A;  5CTN A;  3ZGA B;  4JLF A;  4P6B A;  3UPP A;  3UPN A;  1G6A A;  3VP0 A;  3MBZ A;  4QU3 A;  1GHP A;  5F83 A;  2Y2K A;  1MKI A;  4E3K A;  3IQA A;  4GD8 A;  3BEC A;  1JWZ A;  3UN7 A;  2Q9M A;  4BD0 A;  4OLD A;  5TGF A;  4KZ5 A;  4WZ5 C;  4NET A;  3IXD A;  1K4F A;  1H8Z A;  1KGE A;  4OQH A;  4OH0 A;  1K57 A;  1KE4 A;  2ZD8 A;  1CI8 A;  4K0W A;  2P74 A;  4BJP A;  5EUA A;  3V39 A;  1NYY A;  2PU4 A;  4R0Q A;  2VGK A;  5CEB A;  4QY5 A;  2Y2M A;  1L0D A;  4Y0O A;  4JF6 A;  3OPL A;  3AGD A;  3BYD A;  3GMW A;  4JKT A;  4WMC D;  1K6S A;  1M40 A;  3C4P A;  3QHY A;  1EI5 A;  3VFH A;  4P0M A;  4GNU A;  5A93 A;  3E2K A;  3TOI A;  3SH9 A;  3WS0 A;  5CHU A;  5CHJ A;  5DF7 A;  3IWI A;  4WZ4 A;  1SKF A;  5CRF A;  1CEG A;  4C3Q A;  4EQI A;  5GLB A;  3ZCZ A;  4RX2 A;  4N9K A;  2EXB A;  3S4X A;  3V3S A;  4F94 A;  3HLC A;  2XD1 A;  3GTC A;  2XDM A;  3V5M A;  3WS5 A;  5EVI B;  5M18 A;  4KEN B;  2H5S A;  4Z9Q A;  3Q7V B;  1SHV A;  4H8R A;  3M2K A;  2RL3 A;  1N9B A;  3OPH A;  1ES2 A;  2B5R A;  1JTD A;  2XK1 A;  1U60 A;  4Y7P A;  4OPQ A;  4CJN A;  4GZB A;  1YMS A;  1FR6 A;  1TDG A;  1HD8 A;  1LI9 A;  3HUM A;  4NK3 A;  4FH4 A;  3MZF A;  5AQ9 A;  3G30 A;  4K0X A;  4S2N A;  3G34 A;  5EE8 A;  4OLG A;  2WZX A;  5I94 A;  5CEC A;  3PBT A;  4JXG A;  4GB7 A;  2ZM8 A;  3PAG A;  2PBY A;  1ES5 A;  3BFD A;  1PWC A;  5FAP A;  5AQB A;  5EVI A;  2Y4A A;  3HUO A;  3Q7V A;  1QMF A;  4S2P A;  3IWQ A;  3Q07 A;  3GRJ A;  1DJC A;  3GV9 A;  3IXH A;  1YLY A;  3HUN A;  1XX2 A;  2WKE A;  1IYQ A;  1NYM A;  1IYP A;  2P9V A;  3WS1 A;  3OZH A;  4L0L A;  3S22 A;  4ZJ3 A;  3SH7 A;  1K38 A;  4U3T A;  1H8Y A;  2J7V A;  4KZB A;  3B3X A;  1KDS A;  4PM8 A;  3N8S A;  4E3M A;  1Z6F A;  1Y54 A;  5BOH A;  3N6I A;  1K57 C;  3ZG0 A;  5KSC A;  4DXB A;  1GA9 A;  2HDQ A;  1TVF A;  3IF6 B;  5L2F A;  3A3I A;  1VQQ A;  2G2U A;  2GDN A;  1AXB A;  3A3F A;  2ZQC A;  4DE0 A;  3NDE A;  3CMZ A;  1FSW A;  2HP9 A;  1XA7 A;  1ERQ A;  4S2I A;  4KZ7 A;  4U0T A;  3UDI A;  4BD1 A;  1MWT A;  4LV2 A;  5GHZ A;  3MZE A;  1XKZ A;  4DE2 A;  3AGE A;  5EPH A;  1I2W A;  3OCL A;  4KQO A;  2HP5 A;  4EV4 A;  4KG6 A;  2WK0 A;  4BL2 A;  1ESU A;  1WYC A;  4KQR A;  1ERO A;  1MPL A;  2E8I A;  3CG5 A;  5FAQ A;  3Q82 A;  4Q8I A;  2Y2I A;  1JWV A;  1K55 A;  3BM6 A;  1ES4 A;  2JCH A;  3BFC A;  3PTE A;  4XXR A;  5HL1 A;  4OQ0 A;  3BLS A;  3ZHH A;  1XGJ A;  4R1G A;  1PWD A;  1XGI A;  3WWX A;  5F1F A;  2WAF A;  1MXO A;  4KZ3 A;  5FI6 A;  1S0W A;  5J8X A;  1L0G A;  3ZVT A;  3HVF A;  4WMC A;  1OME A;  3Q7Z A;  4D2O A;  3HLB A;  3NCK A;  4ID4 A;  4M3K A;  4N9L A;  3UY6 A;  2WKH A;  5HAR A;  1DJA A;  3O88 A;  2IWB A;  2EXA A;  3Q1F A;  2DRW A;  3DWZ A;  1Q2P A;  4LCM A;  4PM9 A;  3FV7 A;  3C7V A;  3IWO A;  4JF4 A;  1SDE A;  3N8L A;  1YT4 A;  4S2N C;  5CXW A;  4RA7 A;  5HAP A;  3UPO A;  5F82 A;  1IKI A;  1KVM A;  2Y2L A;  3FZC A;  1HTZ A;  2Y91 A;  3RXW A;  3WS2 A;  1RGZ A;  3ZG9 B;  2X02 A;  2ZM2 A;  4JXV A;  3GSG A;  2WGW A;  2Z2M B;  3CZD A;  3RJU A;  2IWD A;  3MFD A;  3IXG A;  5FA7 A;  2XGN A;  2ZJ9 A;  5EVI C;  1PYY A;  4OKP A;  5GHY A;  4R4R A;  5GLD A;  2QPN A;  1GA0 A;  5E43 A;  2OV5 A;  4IBX A;  1VM1 A;  5E2E A;  3DW0 A;  1E3U D;  3FKW A;  4FSF A;  2XFS A;  1GHI A;  2H0Y A;  2H0T A;  1MBL A;  1FQG A;  2Y55 A;  2ZC4 B;  3ZFZ A;  5CGS A;  1FOF A;  4CPK A;  4GD6 A;  4B4Z A;  3HLE A;  3W4Q A;  5EVL A;  5U47 A;  1CEF A;  1I2S A;  4DE3 A;  3OC2 A;  5FQK A;  4E3O A;  2J8Y A;  1DJB A;  2ZQA A;  3M2J A;  3VSL A;  3ZG8 B;  4OQG A;  5CER A;  4A5R A;  4BL3 A;  1YQS A;  3IT9 A;  2PU2 A;  5CGW A;  3SS3 A;  3A3D A;  1IEM A;  3IHB A;  3E2L A;  3EQU A;  3IF5 A;  2V2F F;  4MEZ A;  2WAD A;  3LO7 A;  3DTM A;  5F1G A;  4E6X A;  3FWL A;  3A3J A;  1WE4 A;  1NY0 A;  4YFM A;  4O7D A;  5DF9 A;  3SS5 A;  4BLM A;  4LV1 A;  3VP1 A;  1TEM A;  4X68 A;  5FI2 A;  3VP3 A;  1IYS A;  1W8Q A;  3FKV A;  1DY6 A;  3QNB A;  5GLA A;  1IEL A;  2P9V B;  1KVL A;  4OP8 A;  1BUE A;  5FI7 A;  3ZNT A;  3WS4 A;  4KZ8 A;  3UE0 A;  3NIA A;  4MLL A;  2XD5 A;  4DXC A;  4DKI A;  4OOY A;  2I72 A;  5FAT A;  2R9W A;  2HPB A;  3ZDJ A;  2XFT A;  3IF6 C;  2HDR A;  2XH9 A;  1KGG A;  1L0E A;  4GOG A;  3HLD A;  2XR0 A;  4GKU A;  3G2Z A;  2CC1 A;  5EOE A;  1HZO A;  3HL9 A;  4ZJ2 A;  4WEK A;  3SOI A;  4B88 A;  4R3J A;  3LY4 A;  1KE0 A;  2EFX A;  5JYO A;  3GR2 A;  4GDN A;  4S2K A;  2Y59 A;  1K25 A;  4N1H A;  1CK3 A;  4UHU A;  3W4P A;  3NDG A;  2HDU A;  3V3R A;  4JXW A;  3NY4 A;  2DNS A;  5FQQ A;  2XQZ A;  5GL9 A;  3HRE A;  4E6W A;  2ZQD A;  4IBR A;  1W5D A;  1SCW A;  2UWX A;  1PIO A;  2ZQ8 A;  4FCF A;  4E3J A;  1XPB A;  4DDY A;  3MKE A;  3UO9 A;  2QZ6 A;  4E3L A;  3NC8 A;  4OQI A;  2IWC A;  5EEC A;  3SS4 A;  5JYP A;  1H5X A;  3TG9 A;  3UDF A;  1K6R A;  2G2W A;  1NXY A;  1C3B A;  3CJM A;  3AGF A;  5D3O A;  3BFE A;  4BEN A;  4HEF A;  3HLW A;  1W8Y A;  2C6W B;  3WRZ A;  3VMA A;  1KE3 A;  2BLS A;  1YLZ A;  3IH9 A;  1PI5 A;  3G35 A;  4S2L A;  5KSH A;  3P98 A;  4DDS A;  1J9M A;  3NBL A;  3PBR A;  4KZA A;  5HW3 A;  5FQ9 A;  2X01 A;  4DF6 A;  4ZJ1 A;  4ZBE A;  4E3N A;  2EX6 A;  2Y2Q A;  4UAA A;  1GCE A;  4S2M A;  3JYI A;  2Y2O A;  4ZAM A;  5DVA A;  1S6R A;  1M6K A;  1ZC2 A;  2WGW B;  3N7W A;  2Y2G A;  2QMI A;  2XEP A;  4ZTK A;  3BFF A;  4KZ4 A;  3ZG7 B;  3OCN A;  2EFU A;  5HX9 A;  4LV0 A;  5FAS A;  1E3U A;  1PI4 A;  1YLW A;  2WKI A;  4EBN A;  1ONG A;  3LEZ A;  1BTL A;  3V50 A;  1LLB A;  3C7U A;  2Z2L B;  3OPP A;  3MXR A;  1K56 D;  2ZC3 B;  5TFQ A;  2HDS A;  4WEJ A;  1E25 A;  2Q9N A;  2EX2 A;  4KG2 A;  5E2G A;  1NZU A;  5KZH A;  2FFY A;  4JF5 A;  1L0F A;  2ZQ9 A;  2V20 A;  5FSR A;  3HBR A;  4WM9 A;  5GLC A;  1BSG A;  3I7J A;  2BG1 A;  3ISG A;  3C5A A;  4LEN A;  5E2H A;  2WZZ A;  5DTT A;  3HLG A;  1YLJ A;  3OPR A;  4KQQ A;  5HAQ A;  1YMX A;  1ZG4 A;  3N8R A;  3NI9 A;  3S1Y A;  4RX3 A;  1ZKJ A;  4MBH A;  1K54 A;  1YM1 A;  1XP4 A;  4Y0U A;  4HBT A;  2R9X A;  2JE5 A;  4OOM A;  5HFO A;  1FR1 A;  4X6T A;  4LCL A;  3PBN A;  5M19 A;  5IHV A;  2WUQ A;  5CGX A;  4R3B A;  2A49 A;  3VOY A;  4JXS A;  4R23 A;  3SH8 A;  1KDW A;  1IKG A;  2C5W B;  2EX9 A;  3N4I A;  4YIN A;  2Y2N A;  4OON A;  3VP4 A;  4S2O A;  1BLC A;  1MWS A;  4UA6 A;  4IVI A;  3M6H A;  1NJ4 A;  3GQZ A;  3PAE A;  1N4O A;  4IED A;  3G2Y A;  3MKF A;  2X71 A;  4FH2 A;  5DF8 A;  2ZC7 A;  3MZD A;  4XUX A;  2FFF B;  3M6B A;  2A3U A;  4X56 A;  4X55 A;  3UNW A;  1XA1 A;  1O07 A;  1WYB A;  4IVK A;  4C75 A;  5GHX A;  3G31 A;  1IYO A;  2Y2H A;  4KZ9 A;  1JVJ A;  2JBF A;  2ZC5 B;  1K55 C;  1LL9 A;  4QJG A;  1GHM A;  1E4D A;  4EBP A;  4RVA A;  3LCE A;  4JPM A;  2DCF A;  2V1Z A;  2JC7 A;  1K4E A;  3WRT A;  4UA7 A;  1NRF A;  4LV3 A;  3VP2 A;  1PZP A;  2ZLY A;  3W4O A;  4GDB A;  4GN2 A;  2OSU A;  2ZMA A;  2J9P A;  3O87 A;  5DTS A;  1KGF A;  1RP5 A;  4HBU A;  5FDH A;  5E2F A;  1RGY A;  1PW8 A;  4EUZ A;  5G18 A;  3IHA A;  3FYZ A;  1ALQ A;  4X53 A;  4MBK A;  4QB8 A;  3O86 A;  4WBG A;  5TR7 A;  4EBL A;  1W7F A;  1I5Q A;  5A90 A;  1G68 A;  4QD4 A;  4PM7 A;  5HAI A;  1EWZ A;  3BFG A;  5FQI A;  4DRT A;  1L2S A;  1FCN A;  3EQV A;  5A92 A;  4MBF A;  4WZ5 A;  4MNR A;  4E3I A;  3UE3 A;  3VSK A;  1RCJ A;  2VGJ A;  3BEB A;  1BLH A;  4OPZ A;  1K54 C;  1O7E A;  4P85 A;  2WAE A;  1K56 A;  3ITB A;  2Y2P A;  4PMA A;  5M1A A;  2J9O A;  1SDN A;  4OOL A;  2RCX A;  4N92 A;  1LHY A;  4QY6 A;  2ZQ7 A;  2Y2J A;  2HP6 A;  1JTG A;  1ERM A;  3G4P A;  1FCM A;  1LL5 A;  4PM6 A;  5FAO A;  4Y0T A;  1BLP A;  3PBQ A;  4ZDX A;  4OVD A;  3RXX A;  3PBO A;  4OPY A;  4OPR A;  4S2J A;  3BLM A;  3QNC A;  1BUL A;  3ZVW A;  4R4S A;  3C4O A;  2OLV A;  5A91 A;  1YLP A;  1ONH A;  4WEL A;  2WYX A;  1LI0 A;  1BZA A;  1PZO A;  1Q2Q A;  1W79 A;  4B4X A;  3ITA A;  5DTK A;  3BRM A;  4K91 A;  2EX8 A;  4QHC A;  3D4F A;  4JBF A;  1FCO A;  4KG5 A;  4PPR A;  1CI9 A;  5EOO A;  2XLN A;  3UE1 A;  3VOZ A;  4UA9 A;  5CED A;  2XF3 A;  3W8K A;  4WYY A;  3ZNY A;  5AQ7 A;  4X69 A;  4XUZ A;  5CTM A;  1BT5 A;  4RYE A;  3IXB A;  4FD8 A;  5EVI D;  5FQM A;  5KMW A;  4DE1 A;  4U0X A;  4P87 A;  3O3V A;  3HLF A;  1ZG6 A;  1PW1 A;  1FSY A;  3VFF A;  2ZM0 A;  3LY3 A;  4PM5 A;  3G32 A;  1YLT A;  5CHM A;  1ESI A; 
#chains in the Genus database with same CATH topology
 4EWF A;  4N1X A;  1D1J A;  3IF6 A;  2WKP A;  1JWP A;  5HSQ A;  2OLU A;  2XA7 S;  3IH8 A;  5AQA A;  1ES3 A;  5FQJ A;  2KDK A;  4JLF A;  3UPN A;  3VP0 A;  4QU3 A;  1Y4O A;  2Y2K A;  3BEC A;  3KSG A;  4ARZ A;  2Q9M A;  4GS9 B;  5EV0 A;  4WZ5 C;  2A24 B;  1IFQ A;  2ZD8 A;  1CI8 A;  5HD3 A;  3VV4 A;  3UB8 A;  3V39 A;  4B9O A;  2PU4 A;  5EFW A;  2VGK A;  2W0N A;  1MKM A;  4QY5 A;  4EW7 A;  3PR6 A;  4JF6 A;  2MJ6 A;  3QP8 A;  1K6S A;  3C4P A;  2NUT C;  4HP9 A;  3KYQ A;  3WS0 A;  5CHU A;  4EET B;  4EQI A;  5HPI A;  3T1Q B;  2EXB A;  1CJF A;  3V3S A;  5M18 A;  4UQI S;  1S4R A;  3IS2 A;  1P0Z A;  1XFN A;  5FL3 A;  1ES2 A;  1JTD A;  2XK1 A;  4GZB A;  1TDG A;  3H9W A;  1LI9 A;  5DKK A;  1J3W A;  3S7P A;  3LEQ A;  5EE8 A;  5I94 A;  4X1M A;  4Y2F A;  5HWT A;  2PBY A;  3BFD A;  5FAP A;  2PDR A;  1QMF A;  3IWQ A;  3VE4 A;  1DJC A;  3MFX A;  3CAX A;  3RFB A;  1NYM A;  3KSI A;  2P9V A;  4L0L A;  4CLC C;  4X25 A;  1Y54 A;  1K57 C;  5L07 A;  1SZV A;  5KSC A;  5L2F A;  1VQQ A;  2ZQC A;  3UDI A;  4LV2 A;  1XKZ A;  3F1P A;  1WYC A;  3LIC A;  1LT0 A;  2E8I A;  3CG5 A;  5G4Z A;  2V8C A;  2PT7 A;  1K55 A;  4CLC B;  1ES4 A;  1A0K A;  1XGJ A;  1XGI A;  1OTB A;  2D02 A;  1S0W A;  1L0G A;  3ZVT A;  3K3D A;  3Q7Z A;  3NCK A;  3UY6 A;  4BBU A;  1ODV A;  3DWZ A;  1G5U A;  3FV7 A;  3IWO A;  4R3A A;  2V0U A;  2Y2L A;  2Y91 A;  5MC7 A;  3ZG9 B;  2X02 A;  4NXG A;  4JXV A;  2WGW A;  2Z2M B;  2AVX A;  5EVI C;  1XJ3 A;  5E2E A;  3C30 A;  4FSF A;  3KYZ A;  2Y55 A;  3EOI A;  3DTE A;  1LL8 A;  3SW1 A;  2J3W A;  3OC2 A;  4E3O A;  1DJB A;  1STZ A;  2M7V A;  3MQQ A;  2ZQA A;  3M2J A;  3UB6 A;  2W3H A;  4OQG A;  4BL3 A;  3IT9 A;  3SS3 A;  3A3D A;  1IEM A;  3IHB A;  2JN7 A;  3LO7 A;  2ZBB A;  1WE4 A;  3SS5 A;  5FEG A;  3MSH A;  4LV1 A;  3VP1 A;  1IYS A;  5GLA A;  2Y8H A;  2WKR A;  2OWJ A;  3B33 A;  1OTA A;  4MLL A;  3IBJ A;  2I72 A;  3ZDJ A;  2HDR A;  2XH9 A;  2Q0O A;  1L0E A;  1HZO A;  3HL9 A;  1P9R A;  4GHI A;  4R3J A;  4RQ9 A;  4HI4 A;  1AWI A;  3GR2 A;  2JKG A;  1XJ2 A;  1K25 A;  1CK3 A;  4UHU A;  3F1O A;  4GLQ A;  5GL9 A;  3HRE A;  3LIF A;  4E04 A;  1T1C A;  2R78 A;  3VOL A;  2UWX A;  1SCW A;  3A0R A;  4I3I A;  1C3B A;  1F98 A;  3AGF A;  4HEF A;  1GSX A;  3JVU A;  1LSX A;  2O9C A;  1YLZ A;  3G35 A;  2XA7 M;  4B93 A;  3P98 A;  5HWV A;  3FG8 A;  4KZA A;  5HW3 A;  5FQ9 A;  2O9A A;  4LRY C;  2W3E A;  2EX6 A;  1GCE A;  5HDS A;  1ZC2 A;  3ZG7 B;  1PRQ A;  2WKQ A;  3E4P A;  2EFU A;  5HX9 A;  1YLW A;  1GSW A;  3BWL A;  2JKT M;  2V9A A;  1SKO A;  2V1A A;  2W1T B;  3LFV A;  2ZC3 B;  1L3L A;  1E25 A;  5J7E A;  4JF5 A;  4WM9 A;  5AVE A;  3ISG A;  3C5A A;  1YAX A;  5DTT A;  1YMX A;  1ZKJ A;  1K0K A;  4Y0U A;  2R9X A;  2W1T A;  4X6T A;  5IHV A;  2WUQ A;  4UQI M;  3D9Y A;  4HP4 A;  2M1C A;  3QP5 A;  1YSP A;  2B95 A;  3NOP C;  4YIN A;  4OON A;  3RTY A;  3MKF A;  5L10 A;  3ULF A;  5DF8 A;  4IVK A;  4C75 A;  5GHX A;  3G31 A;  4LLO B;  1IYO A;  3C8C A;  2JBF A;  3LI9 A;  4QJG A;  3LCE A;  2DCF A;  2V1Z A;  1NRF A;  2GNX A;  3VP2 A;  4CLC D;  4GDB A;  2ZMA A;  2J9P A;  5DTS A;  1KGF A;  1PFL A;  5FDH A;  5E2F A;  1PW8 A;  4R38 A;  2VLG A;  3FYZ A;  1OPX A;  4R6L A;  4X53 A;  1LSV A;  4QB8 A;  4QD4 A;  1UWN X;  3BFG A;  5FQI A;  1L2S A;  1X0O A;  2PD8 A;  3IX4 A;  2QJ5 A;  4CLC E;  2WAE A;  1OJG A;  4FUW A;  5HDC A;  4N92 A;  1CQA A;  4LPZ A;  5EEC A;  1ERM A;  1JTG A;  5F68 A;  4Y0T A;  4JGP A;  3PBQ A;  3UB9 A;  4OPY A;  5HDD A;  3C4O A;  4EEP A;  2PR6 A;  1Q2Q A;  4B4X A;  3ITA A;  4K91 A;  4JBF A;  2XLN A;  3UE1 A;  3VOZ A;  3ZNY A;  2W27 A;  4X69 A;  5AJG A;  5EVI D;  3IXB A;  2ZL1 B;  3BW6 A;  5CHM A;  1PWG A;  3UDX A;  2ZC6 B;  2WGI A;  4Y3I A;  2PRF A;  3GVB A;  4C6Y A;  3ZG5 A;  4EXO A;  3B42 A;  5KIZ A;  3CI6 A;  4OP5 A;  1MWU A;  3PBS A;  3MF0 A;  3NOT C;  3MBZ A;  4E3K A;  3IQA A;  4GD8 A;  1DP9 A;  4BD0 A;  4OLD A;  5K5B A;  2PHY A;  3IXD A;  4KUO A;  1KGE A;  4OQH A;  3T4J A;  5TBM A;  4BJP A;  5EUA A;  3TRC A;  1ZHH B;  4IUH A;  5CEB A;  3QP4 A;  1L0D A;  1S1Y A;  3AGD A;  3EEH A;  4WMC D;  4X1L A;  1M40 A;  2H28 A;  5DF7 A;  4WZ4 A;  1H0M A;  1CEG A;  4PHT A;  4C3Q A;  1YSQ A;  3S4X A;  1DP6 A;  4KQD A;  3V5M A;  3WS5 A;  4HNB A;  2J80 A;  2H5S A;  4H8R A;  3CLO A;  2RL3 A;  2JKR I;  4HJ3 A;  1U60 A;  3CUE A;  1YMS A;  3KSF A;  4QWO A;  1OTD A;  3HUM A;  2W3G A;  2QHK A;  4NK3 A;  3MZF A;  5AQ9 A;  3G30 A;  4K0X A;  4S2N A;  4JXG A;  3QP2 A;  2ZM8 A;  1MC0 A;  1T1B A;  1ES5 A;  4BMW A;  2VGL S;  3HUO A;  4S2P A;  4YWZ A;  1V9Y A;  4QPR A;  1YLY A;  3BJN A;  3WS1 A;  3OZH A;  1K38 A;  4U3T A;  1H8Y A;  4KZB A;  1T18 A;  4PM8 A;  4Q0H A;  1Z6F A;  3ZG0 A;  1FIL A;  4DXB A;  1S67 L;  1TS8 A;  3IF6 B;  4XT2 A;  3A3I A;  5AVF A;  4PAU A;  3F1N A;  1OTE A;  1ERQ A;  4BD1 A;  4KZ7 A;  4ZRR A;  5L8M A;  4AFI A;  4KQO A;  4KG6 A;  3ZQ5 A;  5IT5 A;  4ARZ B;  4Q8I A;  1JWV A;  3BM6 A;  5G4Y A;  2BAS A;  2Z6C A;  4OQ0 A;  2CMN A;  3ZHH A;  4KUK A;  3WWX A;  2WAF A;  1MXO A;  4KZ3 A;  5FI6 A;  4D2O A;  4N9L A;  1P97 A;  2IWB A;  1VHM A;  2EXA A;  2LB9 A;  4JF4 A;  3G6O A;  2PYR A;  4MN6 A;  4DJ2 A;  2PBD P;  3O5Y A;  3WS2 A;  1RGZ A;  2ACG A;  3GSG A;  3D72 A;  3CIT A;  5FA7 A;  2P04 A;  3IS2 B;  5GLD A;  1GA0 A;  4IBX A;  1E3U D;  2XFS A;  2H0T A;  4LRZ E;  3ZFZ A;  3LR0 A;  2JKT I;  1FOF A;  4B4Z A;  5U47 A;  3FPV A;  2GX5 A;  4I5S A;  3NUL A;  2FZ0 A;  2P7J A;  4A5R A;  1YQS A;  2PU2 A;  3RH8 B;  1NLY A;  3EQU A;  4MEZ A;  5DFY A;  5F1G A;  4E6X A;  3FWL A;  3JVV A;  4YFM A;  3BQA A;  5DF9 A;  1TEM A;  3VP3 A;  2QYB A;  1W8Q A;  3ZNT A;  4OP8 A;  2P9V B;  3WS4 A;  4LGW A;  3NIA A;  3EEA A;  2XD5 A;  5FAT A;  2R9W A;  2HPB A;  4P6Z S;  2XR0 A;  4GKU A;  3G2Z A;  4ZJ2 A;  2GJ3 A;  3F1P B;  4B88 A;  3LY4 A;  2UV0 E;  4GDN A;  2ZOH A;  2O99 A;  1TD5 A;  4HH2 A;  4HOI A;  3NDG A;  3V3R A;  2ZOI A;  2DNS A;  2XQZ A;  3PXP A;  4IBR A;  4FCF A;  2ZQ8 A;  4DDY A;  3MKE A;  3H82 A;  3TG9 A;  3UDF A;  2G2W A;  1NXY A;  4ME4 A;  3BFE A;  3IX3 A;  3NEC A;  3VMA A;  2BLS A;  2VA0 A;  1KOU A;  4S2L A;  2ZMV A;  1TS7 A;  4DDS A;  3NBL A;  3R4K A;  4E3N A;  2JKF A;  4S2M A;  3JYI A;  4ZAM A;  1M6K A;  2WGW B;  3MQO A;  4BWI A;  3H7W A;  4NG2 A;  2Y2G A;  2KX6 A;  2XEP A;  3BFF A;  4KZ4 A;  4ZTK A;  3OCN A;  4EES A;  4LV0 A;  4BBT A;  4EBN A;  1ONG A;  1BTL A;  1LLB A;  3C7U A;  3IBR A;  4L9G A;  1F2K A;  5EVE A;  5E2G A;  1L0F A;  2V20 A;  5FSR A;  3NJA A;  4ETZ A;  5GLC A;  3I7J A;  4LEN A;  3HLG A;  1YLJ A;  3E0Y A;  4MBH A;  1XJ6 A;  1YM1 A;  4OOM A;  5HFO A;  1W63 Q;  4LCL A;  3K3C A;  5M19 A;  2EWV A;  2HF6 A;  2KLI A;  5TJJ A;  4HH3 A;  3VOY A;  4JXS A;  4R23 A;  3SH8 A;  2C5W B;  3N4I A;  1BLC A;  2PR5 A;  2VX8 A;  3E4Q A;  3M6H A;  3PAE A;  1N4O A;  3DTI A;  2A2L A;  2X71 A;  4UEY A;  3MZD A;  4GHI B;  4DMZ A;  4LRX C;  1XA1 A;  1O07 A;  2Y2H A;  2VGL M;  3GDI A;  2P08 A;  3F1O B;  4RVA A;  2JC7 A;  1K4E A;  4UA7 A;  2EA9 A;  2ZLY A;  3C2W A;  2OSU A;  3O87 A;  3TW8 A;  1RP5 A;  4HBU A;  5J4E A;  2W1R A;  1W7F A;  5A90 A;  1TS0 A;  4Y5F A;  2QJ7 A;  4DRT A;  1FCN A;  3U2A A;  4MBF A;  3LR5 A;  3UE3 A;  3VSK A;  1RCJ A;  3BEB A;  3LYX A;  1O7E A;  1K56 A;  2K7S A;  2J9O A;  1SKO B;  3G4P A;  5FAO A;  3L7H A;  1BLP A;  4S2J A;  2G7U A;  4JGQ A;  1YLP A;  1ONH A;  2VEA A;  1S66 L;  2WYX A;  1PZO A;  2EX8 A;  3D4F A;  1FCO A;  2XF3 A;  3EWK A;  3T4Q A;  5CTM A;  1BT5 A;  5FQM A;  2V8F A;  4U0X A;  4P87 A;  3O3V A;  3TE8 A;  1PW1 A;  1NLZ A;  1S4S A;  1XJ4 A;  3G32 A;  1ESI A;  1OT6 A;  3DWK A;  4NKP A;  3OLO A;  1QME A;  3A3E A;  5F6A A;  3P09 A;  3S7Q A;  1PNE A;  3TSG A;  1XFQ A;  1HVB A;  4MN5 A;  4R70 A;  3MXS A;  3Q81 A;  1MY8 A;  2J3T C;  4P6B A;  4G3W A;  1GHP A;  5F83 A;  1MKI A;  1JWZ A;  3UN7 A;  3R7W A;  4KZ5 A;  1K4F A;  1H8Z A;  4OH0 A;  3T12 B;  2OWH A;  4ESP A;  3E98 A;  4HJ6 A;  2Y2M A;  3GMW A;  5DKL A;  1EI5 A;  3BY8 A;  4P0M A;  4GNU A;  1Z09 A;  4MN7 A;  3IWI A;  1YPR A;  5CRF A;  5C5K A;  3C38 A;  3TJZ C;  3ZCZ A;  4N9K A;  4F94 A;  4KEN B;  4M4X A;  3M2K A;  3OPH A;  3T4S A;  4Y7P A;  1FR6 A;  1ZTU A;  1HD8 A;  4FH4 A;  3G34 A;  4OLG A;  1F9I A;  3SZT A;  1T19 A;  3PBT A;  3CPT A;  3PAG A;  2HJ9 C;  3JPU A;  3A0S A;  3L9K A;  2XRN A;  2FH5 A;  3Q07 A;  3IXH A;  3HUN A;  1IYQ A;  1IYP A;  3P7N A;  1HLU P;  2L0W A;  3S22 A;  3B3X A;  1KDS A;  3N8S A;  4E3M A;  1VET A;  1GA9 A;  2HDQ A;  4PKY G;  4F3L A;  2G2U A;  3A3F A;  1YKD A;  1AXB A;  3CMZ A;  1FSW A;  2HP9 A;  1XA7 A;  1MWT A;  5GHZ A;  4DE2 A;  3AGE A;  5EPH A;  1I2W A;  1EW0 A;  3OCL A;  5FDS A;  4BL2 A;  1ESU A;  4KQR A;  1ERO A;  3S7O A;  3Q82 A;  4HIA A;  1N9O A;  3PTE A;  4XXR A;  5HL1 A;  3BLS A;  3IX8 A;  4R1G A;  5TBM B;  1PWD A;  5A8B A;  5J8X A;  2OOL A;  3BY9 A;  1OME A;  4NEE D;  4ID4 A;  2WKH A;  3CUE C;  5HAR A;  3T4L A;  3O88 A;  5EM0 A;  2DRW A;  4LCM A;  4O0P A;  4PM9 A;  3C7V A;  1SDE A;  3N8L A;  4S2N C;  4RA7 A;  5HAP A;  2M7U A;  1IKI A;  1KVM A;  3FZC A;  3RXW A;  1HTZ A;  3KX0 X;  4WN5 A;  2IWD A;  3IXG A;  3PHY A;  4DJ3 A;  5GHY A;  4R4R A;  1VM1 A;  4I38 A;  4WF0 A;  2ZC4 B;  1MBL A;  5CGS A;  4CPK A;  4GD6 A;  3W4Q A;  5EVL A;  1CEF A;  3ZG8 B;  5CER A;  1VEU A;  4PKY A;  3DTM A;  4HQA A;  1D7E A;  1NWZ A;  4X68 A;  4GCZ A;  1OJ5 A;  3FKV A;  3LR4 A;  5FI7 A;  1KVL A;  1BUE A;  4KZ8 A;  5FEF A;  4G3V A;  3ICY A;  2Y79 A;  5DJU A;  2PAV P;  4DXC A;  4DKI A;  4OOY A;  5HPF A;  4G3K A;  2XFT A;  3IF6 C;  4XT2 B;  1KGG A;  3HLD A;  3F1N B;  5EOE A;  1DRM A;  2HV1 A;  2K2N A;  1KE0 A;  2EFX A;  4S2K A;  2QKP A;  4N1H A;  3T4K A;  3W4P A;  2HDU A;  3MMH A;  4H6J B;  3HJK A;  3UE6 A;  4WUJ A;  2ZQD A;  3BQ8 A;  1W5D A;  3UO9 A;  3NC8 A;  3EGX C;  5JYP A;  1H5X A;  4I3J A;  1K6R A;  3CJM A;  5D3O A;  4ETX A;  4JGR A;  2C6W B;  3WRZ A;  4IUK A;  2O9B A;  4L9E A;  2J3T D;  2HGV A;  1J9M A;  4ZBE A;  4H6J A;  2Y2Q A;  5DVA A;  1S6R A;  3N7W A;  4LFU A;  4Y15 A;  5EM1 A;  1PI4 A;  2WKI A;  3LEZ A;  3V50 A;  2L1M A;  2Z2L B;  3OPP A;  3MXR A;  5TFQ A;  2HDS A;  4WEJ A;  4Y13 A;  2Q9N A;  2EX2 A;  1NZU A;  5KZH A;  2FFY A;  2ZQ9 A;  4DN0 A;  2EWW A;  2VV6 A;  2WZZ A;  4KQQ A;  5HAQ A;  3E4O A;  3LR3 A;  3S1Y A;  4EQ1 A;  4RX3 A;  3LGO A;  1K54 A;  3OBF A;  4D60 A;  2VV7 A;  2B02 A;  1KDW A;  1IKG A;  4S2O A;  1NJ4 A;  2Z6D A;  4IED A;  4FH2 A;  2ZC7 A;  4IJG A;  3M6B A;  2A3U A;  4X56 A;  4X55 A;  3UNW A;  1DP8 A;  4KZ9 A;  4GS9 A;  1JVJ A;  2ZC5 B;  3A0V A;  1K55 C;  1GHM A;  2A24 A;  4EU0 A;  1E4D A;  4EBP A;  1OT9 A;  4JPM A;  4BBV A;  3WRT A;  2V1B A;  1PZP A;  5IS1 A;  4GN2 A;  3H82 B;  2YKH A;  1RGY A;  1FIK A;  4MBK A;  3LI8 A;  4WBG A;  4EBL A;  3KO6 A;  1H3Q A;  2HJE A;  5A92 A;  4WZ5 A;  4E3I A;  4JGO A;  3H7W B;  1BLH A;  4P85 A;  2VJW A;  3ITB A;  4PMA A;  5M1A A;  1SDN A;  4OOL A;  2RCX A;  4QY6 A;  2Y2J A;  2HP6 A;  1FCM A;  4PM6 A;  4ZDX A;  4OVD A;  3PBO A;  4OPR A;  3QNC A;  4NXE A;  4WEL A;  1LI0 A;  1BZA A;  1W79 A;  2NUP C;  5DTK A;  3BRM A;  4PPR A;  1CI9 A;  1BYW A;  4UA9 A;  3W8K A;  3LIE A;  5AQ7 A;  4RYE A;  5J3W A;  4Q0I A;  3HLF A;  1ZG6 A;  1FSY A;  2ZM0 A;  3LY3 A;  1YLT A;  3FPW A;  3UB7 A;  1BLS A;  2H10 A;  4BQM A;  1MWR A;  4WLA A;  4HES A;  3GEC A;  3B47 A;  1XXM A;  1TDL A;  4KZ6 A;  1NZO A;  2WGV A;  5CTN A;  3ZGA B;  3UPP A;  1G6A A;  4K08 A;  5TGF A;  1V9Z A;  2GZA A;  4MMN A;  3PYP A;  4NET A;  4CLC A;  2VKS A;  2DMW A;  1K57 A;  1KE4 A;  4K0W A;  2JKR M;  3MJQ A;  4HHD A;  3CHW P;  2P74 A;  2VV8 A;  1NYY A;  4R0Q A;  2W3D A;  4Y0O A;  3UMD A;  3OPL A;  1OTI A;  3BYD A;  4JKT A;  3QHY A;  3MR0 A;  2PD7 A;  3VFH A;  4EER A;  5A93 A;  2PYP A;  3E2K A;  3TOI A;  3SH9 A;  5CHJ A;  1SKF A;  3DBA A;  3V67 A;  5GLB A;  4RX2 A;  1G28 A;  2IA2 A;  3HLC A;  1D06 A;  2XD1 A;  3GTC A;  2XDM A;  2XSS A;  5EVI B;  4Z9Q A;  3Q7V B;  1SHV A;  1N9B A;  1P9W A;  3KSH A;  2B5R A;  4OPQ A;  4CJN A;  3U4L P;  2WZX A;  3QP1 A;  4O01 A;  2V0W A;  5CEC A;  4MDZ A;  4GB7 A;  4O8G A;  3UB5 P;  4WL9 A;  1PWC A;  2E8J A;  5AQB A;  5EVI A;  2Y4A A;  3Q7V A;  3LID A;  1NRJ A;  3GRJ A;  3GV9 A;  1XX2 A;  4NXF A;  2WKE A;  4ZJ3 A;  3SH7 A;  2J7V A;  5IU1 A;  2K31 A;  5BOH A;  1UGU A;  3N6I A;  1TVF A;  5HD5 A;  4MCW A;  2GDN A;  4DE0 A;  1LSW A;  3NDE A;  3HJI A;  1TS6 A;  4S2I A;  4U0T A;  3MZE A;  1S1Z A;  2HP5 A;  4EV4 A;  2WK0 A;  1MPL A;  5FAQ A;  3R7W B;  2Y2I A;  2JCH A;  4L9F A;  3DAV A;  3T4T A;  3BFC A;  4Y17 A;  2YKF A;  3T50 A;  2INW A;  5F5Y A;  5F1F A;  2O0Y A;  3HVF A;  4WMC A;  3HLB A;  4M3K A;  1DJA A;  3Q1F A;  3T1S A;  1Q2P A;  2VK3 A;  5CXW A;  1YT4 A;  3S7N A;  3UPO A;  5F82 A;  5CX7 A;  3NOU C;  2ZM2 A;  1H8M A;  1G6O A;  3CZD A;  3FC7 A;  3RJU A;  3MFD A;  2XGN A;  2ZJ9 A;  3HCY A;  1PYY A;  2JHE A;  4OKP A;  2QPN A;  5E43 A;  2OV5 A;  3DW0 A;  4P6Z M;  3FKW A;  1GHI A;  2H0Y A;  1FQG A;  1T1A A;  3HLE A;  1I2S A;  4DE3 A;  5FQK A;  3MXQ A;  2J8Y A;  3VSL A;  3CPT B;  1WA9 A;  5LBR A;  5L09 A;  5CGW A;  2QWS A;  3E2L A;  3IF5 A;  2V2F F;  2WAD A;  3A3J A;  1NY0 A;  4O7D A;  4BLM A;  5FI2 A;  3QP6 A;  1DY6 A;  3QNB A;  1IEL A;  3P01 A;  2B18 A;  4NXB A;  3UE0 A;  2OAP 1;  1VET B;  1VB6 A;  4F3L B;  4GOG A;  2VZW A;  2CC1 A;  4WEK A;  5HZH A;  3SOI A;  2BTF P;  5JYO A;  2I9V A;  3DTK A;  2Y59 A;  4HY8 A;  4JXW A;  3NY4 A;  2ZMF A;  3UME A;  5FQQ A;  2W3F A;  4E6W A;  1Y28 A;  1PIO A;  4E3J A;  1XPB A;  4E3L A;  4EEU A;  2QZ6 A;  4OQI A;  2IWC A;  5DFX A;  3SS4 A;  4BEN A;  3HLW A;  1GSV A;  1W8Y A;  4YOF A;  3T4O A;  1KE3 A;  3LIA A;  4Z1W A;  3IH9 A;  1PI5 A;  4II7 A;  1N9N A;  5KSH A;  3PBR A;  2X01 A;  4DF6 A;  4ZJ1 A;  4UAA A;  2Y2O A;  4GJ4 A;  2QMI A;  3LUQ A;  5FAS A;  1E3U A;  1K56 D;  4KG2 A;  1UWP X;  3ZYT A;  3HBR A;  1BSG A;  2BG1 A;  5E2H A;  2XRO A;  3OPR A;  1ZG4 A;  5I5L A;  3N8R A;  3NI9 A;  1N9L A;  1VEU B;  2KOI A;  1XP4 A;  3T1R A;  2D01 A;  4HBT A;  2JE5 A;  2LB5 A;  2OAQ 1;  1FR1 A;  3PBN A;  2ZL1 A;  5CGX A;  4R3B A;  2A49 A;  1JNU A;  3MS6 A;  2EX9 A;  2Y2N A;  4FOF A;  3VP4 A;  1MWS A;  4UA6 A;  4IVI A;  3GQZ A;  1CF0 A;  3CWF A;  3G2Y A;  2HZ5 A;  1ACF A;  1W63 M;  1TF1 A;  2FFF B;  3K2N A;  4XUX A;  1WYB A;  4Q0J A;  3LIB A;  1LL9 A;  3MQ0 A;  4IHQ A;  3T1X A;  4LV3 A;  3W4O A;  4HJ4 A;  4FTX A;  4CQH A;  5HL6 A;  4EUZ A;  5G18 A;  3OOV A;  3IHA A;  1ALQ A;  3O86 A;  1IOU A;  5TR7 A;  4EUV A;  3VE3 A;  1I5Q A;  1G68 A;  4PM7 A;  5HAI A;  1EWZ A;  3EQV A;  4MNR A;  4I39 A;  4GW9 A;  2VGJ A;  4OPZ A;  1K54 C;  3NHQ A;  2Y2P A;  3D3O A;  5F69 A;  1LHY A;  5HWW A;  2ZQ7 A;  1LL5 A;  4YNR A;  3RXX A;  3BLM A;  1MZU A;  1BUL A;  3ZVW A;  4R4S A;  2OLV A;  5A91 A;  3W2Z A;  1F5M A;  3EGD C;  4QHC A;  4KG5 A;  5EOO A;  3KYE A;  5CED A;  4WYY A;  4XUZ A;  4FD8 A;  5KMW A;  2L4R A;  4DE1 A;  5DJT A;  3VFF A;  4PM5 A;  4I3A A; 
#chains in the Genus database with same CATH homology
 3DWK A;  1PWG A;  4EWF A;  1BLS A;  3UDX A;  4N1X A;  2H10 A;  2ZC6 B;  4BQM A;  1QME A;  3A3E A;  1MWR A;  3P09 A;  2WGI A;  3TSG A;  4C6Y A;  3IF6 A;  3GVB A;  4HES A;  3ZG5 A;  1HVB A;  1JWP A;  4OP5 A;  3MXS A;  1XXM A;  1TDL A;  2OLU A;  1MY8 A;  3IH8 A;  3Q81 A;  1NZO A;  2WGV A;  4KZ6 A;  5AQA A;  1ES3 A;  1MWU A;  3PBS A;  5FQJ A;  5CTN A;  3ZGA B;  4JLF A;  4P6B A;  3UPP A;  3UPN A;  1G6A A;  3VP0 A;  3MBZ A;  4QU3 A;  1GHP A;  5F83 A;  2Y2K A;  1MKI A;  4E3K A;  3IQA A;  4GD8 A;  3BEC A;  1JWZ A;  3UN7 A;  2Q9M A;  4BD0 A;  4OLD A;  5TGF A;  4KZ5 A;  4WZ5 C;  4NET A;  3IXD A;  1K4F A;  1H8Z A;  1KGE A;  4OQH A;  4OH0 A;  1K57 A;  1KE4 A;  2ZD8 A;  1CI8 A;  4K0W A;  2P74 A;  4BJP A;  5EUA A;  3V39 A;  1NYY A;  2PU4 A;  4R0Q A;  2VGK A;  5CEB A;  4QY5 A;  2Y2M A;  1L0D A;  4Y0O A;  4JF6 A;  3OPL A;  3AGD A;  3BYD A;  3GMW A;  4JKT A;  4WMC D;  1K6S A;  1M40 A;  3C4P A;  3QHY A;  1EI5 A;  3VFH A;  4P0M A;  4GNU A;  5A93 A;  3E2K A;  3TOI A;  3SH9 A;  3WS0 A;  5CHU A;  5CHJ A;  5DF7 A;  3IWI A;  4WZ4 A;  1SKF A;  5CRF A;  1CEG A;  4C3Q A;  4EQI A;  5GLB A;  3ZCZ A;  4RX2 A;  4N9K A;  2EXB A;  3S4X A;  3V3S A;  4F94 A;  3HLC A;  2XD1 A;  3GTC A;  2XDM A;  3V5M A;  3WS5 A;  5EVI B;  5M18 A;  4KEN B;  2H5S A;  4Z9Q A;  3Q7V B;  1SHV A;  4H8R A;  3M2K A;  2RL3 A;  1N9B A;  3OPH A;  1ES2 A;  2B5R A;  1JTD A;  2XK1 A;  1U60 A;  4Y7P A;  4OPQ A;  4CJN A;  4GZB A;  1YMS A;  1FR6 A;  1TDG A;  1HD8 A;  1LI9 A;  3HUM A;  4NK3 A;  4FH4 A;  3MZF A;  5AQ9 A;  3G30 A;  4K0X A;  4S2N A;  3G34 A;  5EE8 A;  4OLG A;  2WZX A;  5I94 A;  5CEC A;  3PBT A;  4JXG A;  4GB7 A;  2ZM8 A;  3PAG A;  2PBY A;  1ES5 A;  3BFD A;  1PWC A;  5FAP A;  5AQB A;  5EVI A;  2Y4A A;  3HUO A;  3Q7V A;  1QMF A;  4S2P A;  3IWQ A;  3Q07 A;  3GRJ A;  1DJC A;  3GV9 A;  3IXH A;  1YLY A;  3HUN A;  1XX2 A;  2WKE A;  1IYQ A;  1NYM A;  1IYP A;  2P9V A;  3WS1 A;  3OZH A;  4L0L A;  3S22 A;  4ZJ3 A;  3SH7 A;  1K38 A;  4U3T A;  1H8Y A;  2J7V A;  4KZB A;  3B3X A;  1KDS A;  4PM8 A;  3N8S A;  4E3M A;  1Z6F A;  1Y54 A;  5BOH A;  3N6I A;  1K57 C;  3ZG0 A;  5KSC A;  4DXB A;  1GA9 A;  2HDQ A;  1TVF A;  3IF6 B;  5L2F A;  3A3I A;  1VQQ A;  2G2U A;  2GDN A;  1AXB A;  3A3F A;  2ZQC A;  4DE0 A;  3NDE A;  3CMZ A;  1FSW A;  2HP9 A;  1XA7 A;  1ERQ A;  4S2I A;  4KZ7 A;  4U0T A;  3UDI A;  4BD1 A;  1MWT A;  4LV2 A;  5GHZ A;  3MZE A;  1XKZ A;  4DE2 A;  3AGE A;  5EPH A;  1I2W A;  3OCL A;  4KQO A;  2HP5 A;  4EV4 A;  4KG6 A;  2WK0 A;  4BL2 A;  1ESU A;  1WYC A;  4KQR A;  1ERO A;  1MPL A;  2E8I A;  3CG5 A;  5FAQ A;  3Q82 A;  4Q8I A;  2Y2I A;  1JWV A;  1K55 A;  3BM6 A;  1ES4 A;  2JCH A;  3BFC A;  3PTE A;  4XXR A;  5HL1 A;  4OQ0 A;  3BLS A;  3ZHH A;  1XGJ A;  4R1G A;  1PWD A;  1XGI A;  3WWX A;  5F1F A;  2WAF A;  1MXO A;  4KZ3 A;  5FI6 A;  1S0W A;  5J8X A;  1L0G A;  3ZVT A;  3HVF A;  4WMC A;  1OME A;  3Q7Z A;  4D2O A;  3HLB A;  3NCK A;  4ID4 A;  4M3K A;  4N9L A;  3UY6 A;  2WKH A;  5HAR A;  1DJA A;  3O88 A;  2IWB A;  2EXA A;  3Q1F A;  2DRW A;  3DWZ A;  1Q2P A;  4LCM A;  4PM9 A;  3FV7 A;  3C7V A;  3IWO A;  4JF4 A;  1SDE A;  3N8L A;  1YT4 A;  4S2N C;  5CXW A;  4RA7 A;  5HAP A;  3UPO A;  5F82 A;  1IKI A;  1KVM A;  2Y2L A;  3FZC A;  1HTZ A;  2Y91 A;  3RXW A;  3WS2 A;  1RGZ A;  3ZG9 B;  2X02 A;  2ZM2 A;  4JXV A;  3GSG A;  2WGW A;  2Z2M B;  3CZD A;  3RJU A;  2IWD A;  3MFD A;  3IXG A;  5FA7 A;  2XGN A;  2ZJ9 A;  5EVI C;  1PYY A;  4OKP A;  5GHY A;  4R4R A;  5GLD A;  2QPN A;  1GA0 A;  5E43 A;  2OV5 A;  4IBX A;  1VM1 A;  5E2E A;  3DW0 A;  1E3U D;  3FKW A;  4FSF A;  2XFS A;  1GHI A;  2H0Y A;  2H0T A;  1MBL A;  1FQG A;  2Y55 A;  2ZC4 B;  3ZFZ A;  5CGS A;  1FOF A;  4CPK A;  4GD6 A;  4B4Z A;  3HLE A;  3W4Q A;  5EVL A;  5U47 A;  1CEF A;  1I2S A;  4DE3 A;  3OC2 A;  5FQK A;  4E3O A;  2J8Y A;  1DJB A;  2ZQA A;  3M2J A;  3VSL A;  3ZG8 B;  4OQG A;  5CER A;  4A5R A;  4BL3 A;  1YQS A;  3IT9 A;  2PU2 A;  5CGW A;  3SS3 A;  3A3D A;  1IEM A;  3IHB A;  3E2L A;  3EQU A;  3IF5 A;  2V2F F;  4MEZ A;  2WAD A;  3LO7 A;  3DTM A;  5F1G A;  4E6X A;  3FWL A;  3A3J A;  1WE4 A;  1NY0 A;  4YFM A;  4O7D A;  5DF9 A;  3SS5 A;  4BLM A;  4LV1 A;  3VP1 A;  1TEM A;  4X68 A;  5FI2 A;  3VP3 A;  1IYS A;  1W8Q A;  3FKV A;  1DY6 A;  3QNB A;  5GLA A;  1IEL A;  2P9V B;  1KVL A;  4OP8 A;  1BUE A;  5FI7 A;  3ZNT A;  3WS4 A;  4KZ8 A;  3UE0 A;  3NIA A;  4MLL A;  2XD5 A;  4DXC A;  4DKI A;  4OOY A;  2I72 A;  5FAT A;  2R9W A;  2HPB A;  3ZDJ A;  2XFT A;  3IF6 C;  2HDR A;  2XH9 A;  1KGG A;  1L0E A;  4GOG A;  3HLD A;  2XR0 A;  4GKU A;  3G2Z A;  2CC1 A;  5EOE A;  1HZO A;  3HL9 A;  4ZJ2 A;  4WEK A;  3SOI A;  4B88 A;  4R3J A;  3LY4 A;  1KE0 A;  2EFX A;  5JYO A;  3GR2 A;  4GDN A;  4S2K A;  2Y59 A;  1K25 A;  4N1H A;  1CK3 A;  4UHU A;  3W4P A;  3NDG A;  2HDU A;  3V3R A;  4JXW A;  3NY4 A;  2DNS A;  5FQQ A;  2XQZ A;  5GL9 A;  3HRE A;  4E6W A;  2ZQD A;  4IBR A;  1W5D A;  1SCW A;  2UWX A;  1PIO A;  2ZQ8 A;  4FCF A;  4E3J A;  1XPB A;  4DDY A;  3MKE A;  3UO9 A;  2QZ6 A;  4E3L A;  3NC8 A;  4OQI A;  2IWC A;  5EEC A;  3SS4 A;  5JYP A;  1H5X A;  3TG9 A;  3UDF A;  1K6R A;  2G2W A;  1NXY A;  1C3B A;  3CJM A;  3AGF A;  5D3O A;  3BFE A;  4BEN A;  4HEF A;  3HLW A;  1W8Y A;  2C6W B;  3WRZ A;  3VMA A;  1KE3 A;  2BLS A;  1YLZ A;  3IH9 A;  1PI5 A;  3G35 A;  4S2L A;  5KSH A;  3P98 A;  4DDS A;  1J9M A;  3NBL A;  3PBR A;  4KZA A;  5HW3 A;  5FQ9 A;  2X01 A;  4DF6 A;  4ZJ1 A;  4ZBE A;  4E3N A;  2EX6 A;  2Y2Q A;  4UAA A;  1GCE A;  4S2M A;  3JYI A;  2Y2O A;  4ZAM A;  5DVA A;  1S6R A;  1M6K A;  1ZC2 A;  2WGW B;  3N7W A;  2Y2G A;  2QMI A;  2XEP A;  4ZTK A;  3BFF A;  4KZ4 A;  3ZG7 B;  3OCN A;  2EFU A;  5HX9 A;  4LV0 A;  5FAS A;  1E3U A;  1PI4 A;  1YLW A;  2WKI A;  4EBN A;  1ONG A;  3LEZ A;  1BTL A;  3V50 A;  1LLB A;  3C7U A;  2Z2L B;  3OPP A;  3MXR A;  1K56 D;  2ZC3 B;  5TFQ A;  2HDS A;  4WEJ A;  1E25 A;  2Q9N A;  2EX2 A;  4KG2 A;  5E2G A;  1NZU A;  5KZH A;  2FFY A;  4JF5 A;  1L0F A;  2ZQ9 A;  2V20 A;  5FSR A;  3HBR A;  4WM9 A;  5GLC A;  1BSG A;  3I7J A;  2BG1 A;  3ISG A;  3C5A A;  4LEN A;  5E2H A;  2WZZ A;  5DTT A;  3HLG A;  1YLJ A;  3OPR A;  4KQQ A;  5HAQ A;  1YMX A;  1ZG4 A;  3N8R A;  3NI9 A;  3S1Y A;  4RX3 A;  1ZKJ A;  4MBH A;  1K54 A;  1YM1 A;  1XP4 A;  4Y0U A;  4HBT A;  2R9X A;  2JE5 A;  4OOM A;  5HFO A;  1FR1 A;  4X6T A;  4LCL A;  3PBN A;  5M19 A;  5IHV A;  2WUQ A;  5CGX A;  4R3B A;  2A49 A;  3VOY A;  4JXS A;  4R23 A;  3SH8 A;  1KDW A;  1IKG A;  2C5W B;  2EX9 A;  3N4I A;  4YIN A;  2Y2N A;  4OON A;  3VP4 A;  4S2O A;  1BLC A;  1MWS A;  4UA6 A;  4IVI A;  3M6H A;  1NJ4 A;  3GQZ A;  3PAE A;  1N4O A;  4IED A;  3G2Y A;  3MKF A;  2X71 A;  4FH2 A;  5DF8 A;  2ZC7 A;  3MZD A;  4XUX A;  2FFF B;  3M6B A;  2A3U A;  4X56 A;  4X55 A;  3UNW A;  1XA1 A;  1O07 A;  1WYB A;  4IVK A;  4C75 A;  5GHX A;  3G31 A;  1IYO A;  2Y2H A;  4KZ9 A;  1JVJ A;  2JBF A;  2ZC5 B;  1K55 C;  1LL9 A;  4QJG A;  1GHM A;  1E4D A;  4EBP A;  4RVA A;  3LCE A;  4JPM A;  2DCF A;  2V1Z A;  2JC7 A;  1K4E A;  3WRT A;  4UA7 A;  1NRF A;  4LV3 A;  3VP2 A;  1PZP A;  2ZLY A;  3W4O A;  4GDB A;  4GN2 A;  2OSU A;  2ZMA A;  2J9P A;  3O87 A;  5DTS A;  1KGF A;  1RP5 A;  4HBU A;  5FDH A;  5E2F A;  1RGY A;  1PW8 A;  4EUZ A;  5G18 A;  3IHA A;  3FYZ A;  1ALQ A;  4X53 A;  4MBK A;  4QB8 A;  3O86 A;  4WBG A;  5TR7 A;  4EBL A;  1W7F A;  1I5Q A;  5A90 A;  1G68 A;  4QD4 A;  4PM7 A;  5HAI A;  1EWZ A;  3BFG A;  5FQI A;  4DRT A;  1L2S A;  1FCN A;  3EQV A;  5A92 A;  4MBF A;  4WZ5 A;  4MNR A;  4E3I A;  3UE3 A;  3VSK A;  1RCJ A;  2VGJ A;  3BEB A;  1BLH A;  4OPZ A;  1K54 C;  1O7E A;  4P85 A;  2WAE A;  1K56 A;  3ITB A;  2Y2P A;  4PMA A;  5M1A A;  2J9O A;  1SDN A;  4OOL A;  2RCX A;  4N92 A;  1LHY A;  4QY6 A;  2ZQ7 A;  2Y2J A;  2HP6 A;  1JTG A;  1ERM A;  3G4P A;  1FCM A;  1LL5 A;  4PM6 A;  5FAO A;  4Y0T A;  1BLP A;  3PBQ A;  4ZDX A;  4OVD A;  3RXX A;  3PBO A;  4OPY A;  4OPR A;  4S2J A;  3BLM A;  3QNC A;  1BUL A;  3ZVW A;  4R4S A;  3C4O A;  2OLV A;  5A91 A;  1YLP A;  1ONH A;  4WEL A;  2WYX A;  1LI0 A;  1BZA A;  1PZO A;  1Q2Q A;  1W79 A;  4B4X A;  3ITA A;  5DTK A;  3BRM A;  4K91 A;  2EX8 A;  4QHC A;  3D4F A;  4JBF A;  1FCO A;  4KG5 A;  4PPR A;  1CI9 A;  5EOO A;  2XLN A;  3UE1 A;  3VOZ A;  4UA9 A;  5CED A;  2XF3 A;  3W8K A;  4WYY A;  3ZNY A;  5AQ7 A;  4X69 A;  4XUZ A;  5CTM A;  1BT5 A;  4RYE A;  3IXB A;  4FD8 A;  5EVI D;  5FQM A;  5KMW A;  4DE1 A;  4U0X A;  4P87 A;  3O3V A;  3HLF A;  1ZG6 A;  1PW1 A;  1FSY A;  3VFF A;  2ZM0 A;  3LY3 A;  4PM5 A;  3G32 A;  1YLT A;  5CHM A;  1ESI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...