3BFGA

Class a beta-lactamase sed-g238c complexed with meropenem
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
262
structure length
262
Chain Sequence
VQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-lactamase Sed1
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
molecule tags Hydrolase
total genus 96
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfgA00
4MBFA 2Y2GA 3Q7ZA 2ZQDA 1K6RA 1IYPA 4S2NA 2DRWA 4IEDA 4WEJA 1SDEA 1JTDA 1I2SA 5EVID 3WRZA 4RYEA 3IF6B 4QU3A 2X71A 1K57C 5FQKA 3N8RA 4E6XA 2R9WA 2PBYA 1MXOA 2Y2NA 4OLDA 3W8KA 3OPPA 1LL5A 1VQQA 1YLTA 5HL1A 1GHPA 2Y4AA 4KZAA 2OLUA 3VP4A 1YT4A 4LCLA 3ZG8B 1TDGA 1LLBA 3N8SA 4IBXA 3SH9A 4BL3A 3NCKA 1E3UD 5AQ7A 4WZ5A 1KDSA 1DY6A 3SS4A 4EBNA 1KE0A 4E6WA 2VGKA 3GQZA 1YLZA 2J7VA 5EE8A 2Y2KA 4MEZA 2XFSA 1K4EA 3VMAA 5FAPA 3MZDA 2Y2QA 5KZHA 1MWTA 1FCOA 3UPNA 5L2FA 1ES5A 3UE1A 3O3VA 4E3MA 2WK0A 1QMFA 2XR0A 2ZC4B 3LEZA 4S2KA 5I94A 2HDRA 3MKEA 4KZ5A 1W8YA 4U0TA 5M18A 4ZTKA 2XQZA 1ALQA 2FFFB 2XD5A 2WADA 1IYQA 2WAFA 3Q81A 1CK3A 4KZBA 1DJBA 1ZKJA 2Y2LA 3ZG0A 1ZG4A 2DCFA 5CRFA 4OPZA 1HTZA 1MBLA 1L0DA 4UA6A 1C3BA 4P6BA 1L0GA 5FQJA 3CMZA 5AQBA 5TR7A 3FYZA 2UWXA 1SCWA 4DRTA 2CC1A 5A90A 1BZAA 1CI8A 3MZFA 1K56A 1PIOA 2BG1A 1GHMA 1K57A 3G35A 1BLHA 4KG6A 5GHXA 3WS0A 3IHBA 2V2FF 1GCEA 4GDBA 3BFCA 3HLCA 1FQGA 4N9KA 3QNBA 3B3XA 3SS3A 1IEMA 1KE3A 4E3IA 3IQAA 2V20A 3IF6C 1PI5A 3SH7A 4E3KA 5BOHA 1JVJA 3ZNTA 1FOFA 1YMXA 3SS5A 3VFFA 3LCEA 4QJGA 4JPMA 4HESA 3HLGA 5KMWA 3RJUA 1E25A 2G2WA 4S2NC 4E3LA 5CERA 4ZBEA 3V3RA 3LY3A 4IBRA 4PPRA 4E3OA 1DJCA 4B4ZA 3GRJA 4PM8A 5DF9A 5FI6A 2Y59A 1IYSA 3Q07A 4DE2A 5EOEA 2ZM0A 2HPBA 2XF3A 4WYYA 4DDYA 3G32A 3IXHA 3LO7A 2Y2JA 3MBZA 4WMCD 5CEDA 4XUXA 1ESIA 4WZ5C 4O7DA 5F1FA 1XP4A 3UPOA 4CJNA 1SHVA 4KZ3A 1YMSA 1BSGA 5GL9A 3UPPA 3ZG7B 1W7FA 1N4OA 1MWRA 4KG5A 4R3BA 4FCFA 1BUEA 4QY6A 3HREA 4MNRA 5GHZA 2PU4A 1H8YA 3BFDA 4OH0A 2H5SA 3MXRA 1YM1A 4X6TA 5F83A 1XA7A 2OV5A 5HAQA 4P87A 1L2SA 3G2ZA 1PWDA 3C4OA 3UDIA 3BLMA 5CHUA 3PAEA 4OQIA 4RX3A 2XD1A 4Y0UA 4MBHA 2IWDA 4Q8IA 2OLVA 1W5DA 4DE3A 4WM9A 2ZLYA 3C4PA 4OPQA 2Q9NA 4X56A 4OOMA 3G31A 4R0QA 3VSKA 4FD8A 4LCMA 2HDQA 4K0XA 4KQQA 4DE0A 1RGYA 1N9BA 1JWVA 5JYOA 3ZG5A 3VP1A 2EX2A 5M1AA 3ZHHA 3UE0A 1QMEA 1KGGA 2C6WB 2WZXA 1IELA 4NETA 5AQAA 5EUAA 1HVBA 3VOZA 3PBQA 2XEPA 3TSGA 4D2OA 3Q1FA 3PBTA 4F94A 3MXSA 5FI7A 3JYIA 3ZGAB 3G34A 3UE3A 4JXGA 1LL9A 2ZC5B 2Y91A 1AXBA 2JBFA 3N8LA 5CGWA 1GHIA 1KVLA 3M2KA 1YQSA 4EBPA 1BLCA 3IH8A 5F1GA 1U60A 2Z2LB 5CGSA 1L0EA 3G2YA 3ITBA 1KDWA 4N1HA 5KSHA 3V3SA 2Y2HA 3CG5A 1EWZA 2VGJA 2ZC3B 3OPRA 3WS2A 1XKZA 2FFYA 4DXCA 2Y2PA 4LV3A 4QB8A 3W4PA 1SKFA 3HUOA 3UDXA 3HUMA 3HLDA 2R9XA 2ZJ9A 3BFFA 4GNUA 4KZ6A 1KGFA 4KENB 3RXWA 1LHYA 2WGIA 3A3DA 4OP5A 1FCMA 3M6HA 3O87A 5CHMA 3IF5A 2HDSA 4OP8A 3BECA 4UA7A 4X68A 4N9LA 4E3JA 1TDLA 2P9VA 1CI9A 3E2KA 3G30A 1E4DA 3EQVA 2H0TA 3OPHA 4LV2A 1K56D 3N6IA 4GKUA 2EFXA 4EQIA 3D4FA 4P0MA 3BFGA 4DF6A 1MY8A 4FH2A 4RX2A 1ONHA 5FASA 4GZBA 4BD0A 4R1GA 2P9VB 3V39A 3GTCA 3IXGA 4JF4A 5GHYA 1G68A 4DE1A 4BLMA 3BLSA 4S2IA 1K55A 1Y54A 3I7JA 1H5XA 1O07A 4IVIA 1M40A 1XGJA 3VP0A 2G2UA 1NY0A 1FR1A 3FWLA 4KZ9A 3WWXA 3RXXA 3W4QA 3V5MA 1CEGA 1FSWA 1YLWA 5TFQA 1MWSA 5FA7A 4L0LA 1H8ZA 4R23A 1KVMA 2XDMA 3TG9A 2XLNA 5FI2A 1PWCA 4PM9A 4DKIA 2I72A 3BEBA 4KQOA 3CZDA 1RP5A 1YLPA 2XGNA 5F82A 1PI4A 5FQIA 3EQUA 4HBTA 2Q9MA 3MKFA 3WRTA 1IKIA 3N7WA 1S6RA 3ITAA 4X69A 3PTEA 4X55A 4PM6A 3NC8A 3UNWA 1OMEA 1GA0A 4JF6A 1L0FA 4QHCA 3Q82A 3ZNYA 2XK1A 3UY6A 1BTLA 5GLBA 2ZQAA 3LY4A 2J9PA 4K91A 1BLSA 3GSGA 4EWFA 2ZMAA 3WS5A 3IT9A 4S2MA 1I2WA 3HVFA 3GR2A 2EXBA 1JWPA 3N4IA 5AQ9A 3VP2A 4OPRA 2ZC7A 1NXYA 3IWIA 3UN7A 4DDSA 2WKEA 3QNCA 5A93A 2GDNA 1K54A 3IWOA 4A5RA 3E2LA 2WGWA 4R4RA 5DTKA 2EX6A 4KZ8A 3O86A 1NYMA 2BLSA 4NK3A 2WYXA 4KQRA 5EECA 5KSCA 5FQ9A 3HBRA 5EVLA 4WEKA 3SH8A 5HW3A 1K4FA 4M3KA 4LV1A 4S2PA 3FZCA 4ZJ2A 1YLJA 2C5WB 2H10A 1HZOA 5FATA 2HP5A 2WGWB 3ZVTA 2XFTA 3ISGA 1ES4A 2Z2MB 3DWKA 5FQMA 2X02A 4JF5A 4R3JA 4YINA 5E2EA 1TEMA 5FAOA 4BD1A 1CEFA 1Z6FA 1K6SA 3M6BA 3OC2A 4H8RA 1JTGA 4B4XA 1PYYA 1K38A 4K0WA 1ERQA 5CGXA 1O7EA 3V50A 3NI9A 5A91A 3PBOA 3DWZA 1K55C 4JBFA 1WYBA 1DJAA 3AGFA 5TGFA 4C75A 2WGVA 3C7UA 3PBNA 3MZEA 1Q2QA 1LI9A 2EFUA 4C3QA 2EX9A 3O88A 5EVIA 3S1YA 1RGZA 1SDNA 2J8YA 4RA7A 4EV4A 4OQGA 4GD6A 5DF8A 1MWUA 4KZ7A 4LV0A 3PAGA 4OOLA 2Y2MA 4KZ4A 4XXRA 1NZUA 2E8IA 1ES3A 4ID4A 2ZC6B 4GDNA 3BFEA 3NBLA 2DNSA 3BYDA 4WBGA 3WS4A 4HEFA 5CECA 1PW1A 2QZ6A 3PBRA 1E3UA 4B88A 4OQ0A 5IHVA 5EPHA 4S2OA 1G6AA 2ZQ7A 5EVIB 3UO9A 1GA9A 3GMWA 3P98A 3NDEA 4OVDA 2ZQ9A 4JKTA 2QPNA 4Y7PA 5A92A 2Y2OA 4GB7A 3IXBA 1BLPA 3A3JA 3C7VA 4QY5A 2A49A 1ZG6A 3NY4A 4P85A 1BT5A 1YLYA 3TOIA 1EROA 3A3EA 4GN2A 4JXSA 3OZHA 4YFMA 1WYCA 1FCNA 1XX2A 5JYPA 3P09A 1PZOA 2EXAA 2HP9A 1IYOA 4PM7A 3M2JA 2X01A 5EOOA 4WZ4A 1LI0A 1XPBA 1MKIA 4EUZA 4PMAA 4U3TA 5DF7A 5HAIA 1FR6A 1K54C 1NJ4A 2IWCA 4X53A 4BJPA 2JC7A 5E2GA 4ZJ3A 2JCHA 4IVKA 1S0WA 4C6YA 4OLGA 3HL9A 5CXWA 2WZZA 4FSFA 4Y0OA 4WELA 2WKIA 2J9OA 3VFHA 1VM1A 1K25A 3HUNA 4UAAA 3S4XA 3UDFA 2QMIA 4EBLA 3ZVWA 2P74A 2JE5A 1ONGA 3HLFA 5E2HA 5GLDA 4ZAMA 1XXMA 2OSUA 3OCNA 2RL3A 5GLCA 3ZDJA 3ZFZA 2ZM8A 4JLFA 3VP3A 4BENA 2RCXA 1PWGA 1PZPA 2ZQCA 3GV9A 4LENA 4OPYA 5J8XA 5DVAA 1IKGA 2WKHA 1W79A 1FSYA 1HD8A 1MPLA 1TVFA 2ZQ8A 3BRMA 3CJMA 1KGEA 1Q2PA 2HDUA 1ES2A 4S2JA 4UHUA 4U0XA 3VSLA 3WS1A 4KG2A 2Y2IA 5CTMA 2V1ZA 1ERMA 4N92A 2XH9A 4Z9QA 4Y0TA 3BM6A 3ZCZA 4OKPA 5EVIC 2PU2A 5CHJA 1XA1A 3IHAA 4N1XA 5D3OA 3NIAA 1NYYA 3HLWA 1ZC2A 5HFOA 5FAQA 5CEBA 5G18A 3QHYA 3A3FA 5GLAA 4JXWA 4E3NA 2ZM2A 4MLLA 4S2LA 1ESUA 4UA9A 3HLBA 2H0YA 1NZOA 4CPKA 5U47A 3OPLA 3AGDA 3Q7VA 5DTSA 4WMCA 2A3UA 3DTMA 1EI5A 3W4OA 5HAPA 1BULA 1JWZA 2EX8A 1I5QA 3G4PA 5FQQA 3ZG9B 4FH4A 4PM5A 2B5RA 4R4SA 3AGEA 1PW8A 4JXVA 5DTTA 4DXBA 1KE4A 4HBUA 3OCLA 3HLEA 4GD8A 4OOYA 2Y55A 2ZD8A 3NDGA 1J9MA 3A3IA 3DW0A 3Q7VB 4RVAA 5FDHA 3GVBA 1WE4A 4GOGA 1RCJA 3SOIA 2WAEA 4OQHA 5E43A 1XGIA 3PBSA 3C5AA 3FV7A 3VOYA 2HP6A 1W8QA 1NRFA 3IWQA 3MFDA 2IWBA 5M19A 4ZDXA 4OONA 5FSRA 3IF6A 3S22A 4QD4A 4ZJ1A 3FKVA 4XUZA 1M6KA 5CTNA 3IXDA 5E2FA 3FKWA 5HARA 5HX9A 4MBKA 2WUQA 4BL2A 4BQMA 3IH9A
chains in the Genus database with same CATH superfamily
4S2NA 3DTIA 4IEDA 1JTDA 5EVID 1S67L 4RYEA 4QU3A 3N8RA 2Y2NA 4OLDA 3OPPA 3UE6A 1LL5A 3MXQA 2Y4AA 2OLUA 3VP4A 3ZG8B 2QWSA 1TDGA 3N8SA 4KUOA 4R6LA 1SKOA 4EBNA 4E6WA 1YLZA 2XFSA 5FAPA 3MZDA 2Y2QA 1BYWA 5AVFA 3BQAA 2WK0A 2XR0A 5I94A 4S2KA 2O0YA 2HDRA 3MKEA 4U0TA 2WADA 1VB6A 5F69A 4KZBA 1DJBA 3ZG0A 3ULFA 2P7JA 3CMZA 4G3KA 1SCWA 4DRTA 2FZ0A 3KSHA 2BG1A 3G35A 3ZQ5A 4CLCA 2V2FF 3BFCA 1XJ2A 2HV1A 1KE3A 3IF6C 1IOUA 1PI5A 3SH7A 5BOHA 1S4SA 3VFFA 3HLGA 2G2WA 3FPWA 4CLCE 2QYBA 3GRJA 5DF9A 3HCYA 4NG2A 2Y59A 2P08A 2ZM0A 2HPBA 1OTBA 3G32A 3BW6A 4XUXA 2OOLA 5IS1A 4CJNA 4R3BA 1LSVA 2A24A 3LEQA 2W3DA 1H8YA 3NULA 5F83A 2OV5A 2ZMFA 3UB8A 3G2ZA 1PWDA 1UGUA 4RX3A 4FUWA 4WM9A 4OPQA 4X56A 5HD5A 3KSFA 4FD8A 3QP1A 2HDQA 4K0XA 1RGYA 1N9BA 3LFVA 4F3LB 4XT2A 2JKFA 2EX2A 2XA7M 1YAXA 2WZXA 4NETA 1IELA 5AQAA 3PBQA 4JGOA 2XEPA 5J3WA 3BWLA 3T50A 4D2OA 4GCZA 3PBTA 3JYIA 3G34A 4ARZB 3CITA 2GNXA 2ZC5B 3MR0A 1NLYA 3KO6A 5CGWA 1GHIA 4WUJA 1BLCA 3B33A 5F1GA 3G2YA 1ZTUA 5KSHA 2JKGA 2VGJA 3WS2A 1XKZA 4DXCA 4QB8A 4H6JB 1OJ5A 5TBMA 1F2KA 3HUMA 2ZJ9A 1KGFA 3M6HA 2HDSA 4X68A 2PR5A 4E3JA 1TDLA 2P9VA 4I3AA 1K56D 1F98A 4GW9A 4P0MA 4HI4A 3BFGA 3QP4A 5FASA 4GZBA 3IX3A 5GHYA 1G68A 4S2IA 1K55A 3I7JA 1O07A 1NY0A 1FR1A 1OT6A 3BJNA 4MMNA 3H7WA 3LGOA 1FSWA 4L9GA 5FA7A 4R23A 1H8ZA 3TG9A 2OWJA 4DKIA 2I72A 3BEBA 4HQAA 1YLPA 2W1TA 3NOTC 2XGNA 3UMDA 5G4ZA 3EQUA 4HBTA 2KX6A 1IKIA 3N7WA 1S6RA 3PTEA 3NC8A 3PR6A 3UNWA 1GA0A 1L0FA 3ZNYA 2OAP1 2PDRA 1BLSA 3GSGA 3WS5A 3IT9A 5KIZA 3HVFA 3GR2A 1JWPA 3N4IA 4DN0A 3KX0X 3IWIA 3UN7A 2GDNA 3B47A 3EEAA 4A5RA 5DTKA 1N9NA 3O86A 3T1SA 1NYMA 4NK3A 2XRNA 5FQ9A 5HW3A 4GLQA 1YLJA 2D01A 5FEGA 5FATA 3ZVTA 4HH2A 4JF5A 4O8GA 1TEMA 3M6BA 4B4XA 1JTGA 1K38A 5CGXA 1O7EA 3QP2A 3DWZA 4HH3A 3AGFA 4C75A 3PBNA 3MZEA 1X0OA 3D3OA 1VETA 1MWUA 4HEFA 4RQ9A 3K2NA 1PW1A 3PBRA 4OQ0A 1F9IA 2ZQ7A 2G7UA 5EVIB 4OVDA 2QPNA 4Y7PA 2Y2OA 4YNRA 4M4XA 4GB7A 4KUKA 1BLPA 3A3JA 4BBVA 1ZG6A 1BT5A 3LYXA 2BTFP 3TOIA 1EROA 4JXSA 3NECA 3T4KA 5JYPA 1PZOA 2HP9A 1IYOA 2HJEA 4EUZA 2KLIA 2O9AA 4X53A 2PHYA 4IVKA 1S0WA 5DFXA 4OLGA 5CXWA 2WZZA 4FSFA 4WELA 2J9OA 1F5MA 3ZVWA 5E2HA 1ONGA 4ZAMA 3T12B 2ZOIA 3H82A 2W1RA 2ZM8A 5A8BA 3VP3A 3T4LA 2ZQCA 1YPRA 5J8XA 5DVAA 1W79A 3BRMA 3F1OB 4NXEA 5CTMA 1PRQA 4N92A 4Z9QA 4GJ4A 2PU2A 3A3FA 5HD3A 1ESUA 3HLBA 3MSHA 5U47A 3Q7VA 4WMCA 3DTMA 1EI5A 4CQHA 1I5QA 2B18A 1GSVA 4JXVA 1KE4A 4HBUA 2W3HA 4OOYA 2L1MA 3DW0A 4RVAA 2AVXA 1WE4A 1RCJA 3C5AA 3FV7A 3TJZC 3IWQA 2VV7A 2K31A 4QD4A 5E2FA 2WUQA 4BL2A 3K3CA 4GS9B 3T4OA 2Y2GA 3Q7ZA 1IYPA 2DRWA 4EERA 2V8FA 2X71A 5AVEA 1K57C 2R9WA 2PBYA 1Y4OA 5AJGA 4JGQA 4LCLA 4IBXA 4BL3A 1DY6A 2Y79A 1KE0A 5EE8A 4G3VA 3HJIA 4MEZA 2VK3A 5DFYA 4R3AA 4ESPA 5L2FA 1ES5A 3UE1A 4E3MA 1QMFA 2ZC4B 5DJUA 1TS7A 4KZ5A 1W8YA 2XD5A 4R38A 3JVUA 1IYQA 2J3TD 1CK3A 5G4YA 5I5LA 2K2NA 2Y2LA 5CRFA 3IX4A 1L0DA 5C5KA 1C3BA 1L0GA 5AQBA 1LSWA 5TR7A 2UWXA 4JGRA 2CC1A 3LUQA 1PIOA 1FILA 1K57A 4WN5A 2JKRM 3IHBA 4GDBA 3HLCA 1FQGA 3SW1A 4E3IA 2V20A 4E3KA 4QJGA 4Z1WA 2GJ3A 4HESA 2Y8HA 1E25A 5IT5A 4S2NC 4Y2FA 1NWZA 4E3LA 2LB9A 5CERA 3L9KA 3EOIA 1GSXA 4PM8A 1S1YA 1IYSA 2XF3A 2M1CA 4HIAA 4BBUA 1XP4A 3UPPA 4KZ3A 3ZG7B 1N4OA 3CUEA 4FCFA 4QY6A 2E8JA 4OH0A 2H5SA 1D7EA 4ME4A 4F3LA 3PAEA 4OQIA 4X1MA 2HF6A 4Y0UA 2VGLM 2UV0E 2R78A 1W5DA 3C38A 3C4PA 2Q9NA 3VSKA 4LCMA 4DE0A 3C30A 1JWVA 5FEFA 5JYOA 4ARZA 5M1AA 5IU1A 1DP9A 1KGGA 4CLCC 3TSGA 4F94A 3MXSA 5FI7A 3P01A 4JXGA 1AXBA 2JBFA 3QP6A 4H6JA 2GX5A 3IH8A 4P6ZS 2PYPA 1U60A 1L0EA 4O0PA 2DMWA 1EWZA 3OPRA 3F1PB 4LV3A 3HUOA 3FG8A 3HLDA 2R9XA 3BQ8A 3QP5A 4GNUA 3A3DA 2WGIA 5CHMA 3BECA 4UA7A 4N9LA 1CI9A 4HJ3A 4GKUA 2EFXA 2I9VA 4EQIA 3EGDC 3D4FA 3E98A 1MY8A 4FH2A 5EFWA 1ONHA 3FPVA 3VP0A 4WF0A 1M40A 2G2UA 4KZ9A 3WWXA 4I38A 3W4QA 5F68A 1YLWA 1MWSA 3GECA 2V0UA 1PWCA 4PM9A 4B93A 3CZDA 2VX8A 1ACFA 4MN7A 1LSXA 1PI4A 1G6OA 4L9FA 5FQIA 2Q9MA 3U2AA 3MKFA 4X55A 5HPFA 1OMEA 4JF6A 1T1BA 4ZRRA 2XK1A 3UY6A 5GLBA 1D1JA 3LY4A 4K91A 5HZHA 4EW7A 1N9LA 2EXBA 2ZC7A 2WKEA 5A93A 1K54A 3IWOA 3IX8A 2EX6A 5KSCA 2WYXA 5CX7A 3HBRA 1K4FA 4M3KA 2JKRI 4LV1A 5FL3A 2C5WB 3CPTB 4EESA 1HZOA 4B9OA 2XFTA 3ISGA 3MQOA 3DWKA 2X02A 4YINA 2W0NA 5FAOA 1CEFA 5EM0A 2JKTM 1K6SA 1ERQA 3NI9A 1K55C 1DJAA 3LR5A 2PAVP 3DBAA 1Q2QA 2EFUA 2EX9A 2W3FA 5EVIA 3S1YA 5DF8A 2PBDP 4LV0A 4OOLA 4KZ4A 4XXRA 1ES3A 2ZC6B 4GDNA 1TS0A 3A0SA 1NLZA 3BYDA 4WL9A 2KDKA 5EPHA 4S2OA 3P98A 3IBJA 2ZQ9A 5A92A 4GHIB 3C7VA 4QY5A 2A49A 1P9WA 1YLYA 3A3EA 4GN2A 2W27A 3L7HA 4YFMA 3CI6A 3P09A 4PM7A 3M2JA 5EOOA 4WZ4A 1S1ZA 5DF7A 1NRJA 4BJPA 1VHMA 2JC7A 4ETXA 4C6YA 2WKIA 2IA2A 4UAAA 3F1OA 4I3JA 4IJGA 5HDDA 5J4EA 5GLDA 2OSUA 5GLCA 3ZDJA 3ZFZA 3JVVA 1ZHHB 1PWGA 3GV9A 4LENA 1V9ZA 4EUVA 1IKGA 3NOUC 1FSYA 3DTEA 4UHUA 1HD8A 1MPLA 2D02A 3VSLA 3WS1A 2V1ZA 1ERMA 4Y0TA 3C2WA 1TS6A 4EETB 3JPUA 4IUKA 3PHYA 5CHJA 1XA1A 4N1XA 5D3OA 4EXOA 1NYYA 5FAQA 1MC0A 4JXWA 2H0YA 1NZOA 1CF0A 3OPLA 4HJ6A 4UQIS 5EV0A 2B5RA 3T1RA 4NKPA 1T19A 2VZWA 4GD8A 3HLEA 2ZD8A 3KSGA 4JGPA 3GVBA 4GS9A 5L8MA 2WAEA 4QPRA 5E43A 3MFDA 1NRFA 2IWBA 5HWVA 5L09A 3E0YA 4ZJ1A 3IXDA 5HARA 1ODVA 4BQMA 2ZL1B 4MBFA 2ZQDA 2INWA 1K6RA 1D06A 2WKQA 4HP4A 3G6OA 3BY9A 1I2SA 2W3EA 3IF6B 4E6XA 1MXOA 3W8KA 1VQQA 1YLTA 5HL1A 2M7UA 4KZAA 3RH8B 1YT4A 4Y3IA 1LLBA 3NCKA 1E3UD 1VEUB 5AQ7A 4WZ5A 1KDSA 2O9BA 3SS4A 1SZVA 2VGKA 3GQZA 1YKDA 2Y2KA 1K4EA 3VMAA 5KZHA 1TD5A 2QJ7A 3S7NA 3UPNA 1PFLA 3O3VA 1T1CA 2WKRA 3LEZA 5M18A 2XQZA 1ALQA 1P0ZA 2FFFB 3TRCA 1ZKJA 1ZG4A 2DCFA 4EEPA 3T1XA 4OPZA 3OLOA 5FQJA 3A0RA 2MJ6A 3FYZA 3H9WA 1XFQA 1BZAA 3MZFA 4EEUA 1K56A 4I39A 2JKTI 4N9KA 3B3XA 3SS3A 4O01A 1JVJA 1FOFA 1YMXA 3SS5A 3LCEA 4KQDA 5KMWA 3RJUA 2XROA 3A0VA 4I5SA 2JN7A 3V3RA 5FI6A 3GDIA 3Q07A 4HY8A 2L0WA 4DE2A 2Y2JA 5CEDA 1K0KA 1ESIA 4O7DA 5F1FA 3UPOA 1YMSA 5GL9A 1MWRA 3MFXA 2YKFA 4MNRA 2PU4A 5EM1A 3MXRA 1YM1A 4X6TA 1XA7A 4NEED 5MC7A 4P87A 3K3DA 3LR0A 3UDIA 3VOLA 3BLMA 5CHUA 1TS8A 2XD1A 2OLVA 2HZ5A 5TJJA 2V9AA 4R0QA 3OOVA 4LRXC 1XJ4A 3ZG5A 3ZHHA 4Y5FA 1YSPA 3LI8A 3UE0A 3VOZA 2C6WB 5EUAA 1T18A 4MCWA 4MDZA 4IHQA 3Q1FA 1LL9A 3PYPA 4Y13A 3F1PA 1G28A 2ZMVA 3M2KA 4Q0HA 3TW8A 5CGSA 3ITBA 3EEHA 2FFYA 1CQAA 2Y2PA 3W4PA 3R7WB 3UDXA 3BFFA 4KZ6A 5HPIA 3RXWA 1LHYA 1FCMA 3O87A 3IF5A 1UWPX 3CUEC 3LIEA 1H0MA 3E2KA 3G30A 2EWWA 3EQVA 3OPHA 4LV2A 3N6IA 3F1NB 2VJWA 4DF6A 5DKKA 4BD0A 3V39A 3GTCA 3IXGA 4JF4A 1IFQA 4BLMA 3BLSA 3OBFA 4IVIA 1XGJA 2VKSA 3T1QB 2V1BA 5F5YA 3V5MA 4L0LA 2V0WA 3UMEA 2EWVA 2XLNA 3PXPA 4KQOA 2ZOHA 1RP5A 4X1LA 2VV8A 5HWTA 5F82A 3WRTA 3ITAA 4PM6A 1Y28A 4Y15A 3MQQA 3B42A 4DJ2A 3IS2B 4S2MA 1I2WA 5L07A 3CPTA 4DDSA 3QNCA 1LT0A 4MN5A 2BASA 5HL6A 3DTKA 3BY8A 3MS6A 5EECA 4WEKA 3SH8A 4S2PA 3FZCA 2H10A 2HP5A 2WGWB 5FQMA 4R3JA 1OPXA 2J3TC 4H8RA 1PYYA 4K0WA 1H3QA 3EGXC 5A91A 4JBFA 3PBOA 1WYBA 1HLUP 1V9YA 5TGFA 3IBRA 3C7UA 1LI9A 3O88A 1RGZA 4RA7A 4OQGA 4KZ7A 1DP6A 3PAGA 2Y2MA 4GHIA 2E8IA 4WBGA 1L3LA 5CECA 4HHDA 4B88A 5IHVA 1OT9A 3UO9A 3NDEA 4JKTA 4HJ4A 2XA7S 3UB9A 1DRMA 3NY4A 1YSQA 3LIBA 3OZHA 1WYCA 1FCNA 2EXAA 4NXBA 1LI0A 1XPBA 1MKIA 1W63Q 4PMAA 4U3TA 5HSQA 1K54C 5E2GA 3HL9A 4FOFA 4Y0OA 2PD8A 1K25A 2PYRA 3UDFA 2QMIA 4EBLA 4LFUA 2JE5A 3HLFA 1MKMA 1XXMA 4AFIA 3OCNA 5J7EA 2RL3A 4R70A 3VE4A 4BENA 2RCXA 2VEAA 2WKHA 3V50A 2HDUA 4S2JA 3D9YA 4KG2A 2Y2IA 1XJ6A 3S7OA 2XH9A 4Y17A 3BM6A 3ZCZA 1J3WA 4OKPA 5EVIC 3NOPC 3NIAA 5HFOA 1ZC2A 3QHYA 2XSSA 4E3NA 4S2LA 2O99A 4CPKA 5DTSA 3ZYTA 5EVEA 2A3UA 5HAPA 2L4RA 1BULA 1JWZA 2EX8A 3G4PA 4R4SA 3AGEA 1PW8A 4DXBA 4Q0JA 5L10A 1J9MA 5FDHA 4I3IA 2M7VA 2QKPA 2ZL1A 4P6ZM 4OQHA 3EWKA 3VOYA 2HP6A 5M19A 2OAQ1 3MF0A 3IF6A 4D60A 3FKVA 1EW0A 5CTNA 2J80A 5HX9A 1PNEA 4MBKA 3CHWP 4HNBA 3UB5P 1VEUA 4WEJA 3NJAA 1SDEA 3WRZA 4LRZE 5FQKA 2V1AA 4NXFA 2EA9A 4E04A 1GHPA 1P9RA 3SH9A 1WA9A 2K7SA 1G5UA 3FC7A 3SZTA 3QP8A 2J7VA 1MWTA 2YKHA 1FCOA 2LB5A 1SKOB 3KYQA 1AWIA 2J3WA 1GSWA 1OTEA 4ZTKA 1S4RA 2WAFA 3Q81A 2Q0OA 4PAUA 3KSIA 3P7NA 1HTZA 1MBLA 4UA6A 2B02A 4P6BA 5HDCA 5A90A 1CI8A 3CLOA 3T4TA 1GHMA 2PRFA 1BLHA 2QJ5A 3NHQA 4KG6A 5GHXA 3WS0A 2FH5A 5K5BA 1GCEA 3UB6A 2A2LA 3R4KA 3QNBA 1IEMA 2JHEA 3IQAA 1OJGA 3ZNTA 3KYZA 4JPMA 2O9CA 4CLCB 2NUTC 4ZBEA 3LY3A 4IBRA 4PPRA 4E3OA 1DJCA 4B4ZA 5EOEA 4WYYA 4DDYA 3IXHA 3LO7A 3MBZA 4WMCD 4WZ5C 4YOFA 1SHVA 1BSGA 1W7FA 4KG5A 4X25A 1BUEA 3HREA 5GHZA 2Z6CA 3BFDA 3ICYA 4NXGA 3MQ0A 5HAQA 1L2SA 3C4OA 1MZUA 4MBHA 2IWDA 3V67A 2A24B 1W63M 4Q8IA 4DE3A 2ZLYA 4OOMA 3G31A 4QWOA 3LIFA 4KQQA 4WLAA 4BBTA 3VP1A 2HJ9C 5HWWA 1QMEA 1Z09A 1HVBA 4L9EA 4BWIA 4XT2B 3ZGAB 3UE3A 3RFBA 1CJFA 3LIDA 2Y91A 3N8LA 4LPZA 4UEYA 1KVLA 3R7WA 2CMNA 1YQSA 4EBPA 2WKPA 3VE3A 2Z2LB 1KDWA 4N1HA 3V3SA 2Y2HA 3CG5A 2ZC3B 2H28A 1SKFA 1STZA 3F1NA 4KENB 4OP5A 1T1AA 4OP8A 1JNUA 1DP8A 4LLOB 3HJKA 1E4DA 2H0TA 2V8CA 5TBMB 4LRYC 1N9OA 4RX2A 3VV4A 2B95A 4R1GA 2P9VB 3E4QA 4DE1A 1A0KA 3D72A 1Y54A 1H5XA 4EU0A 3E4OA 1LL8A 3FWLA 3RXXA 4FTXA 4G3WA 4UQIM 1CEGA 5TFQA 4EQ1A 4LGWA 1KVMA 2XDMA 1OTAA 2ZBBA 3MJQA 2KOIA 5FI2A 3S7QA 2QHKA 2VA0A 3H7WB 3IS2A 4X69A 4YWZA 4QHCA 3Q82A 2W1TB 1BTLA 3C8CA 2VLGA 2ZQAA 2J9PA 2ZMAA 5DKLA 3RTYA 3VP2A 5AQ9A 4OPRA 1NXYA 3LICA 2W3GA 3E2LA 2WGWA 4R4RA 4KZ8A 3LI9A 3T4JA 3MMHA 2BLSA 2PR6A 4Q0IA 5F6AA 4KQRA 4DMZA 5EVLA 1OTIA 4ZJ2A 3O5YA 4PKYG 1ES4A 1KOUA 2Z2MB 5E2EA 4BD1A 1Z6FA 1OTDA 3OC2A 3U4LP 1P97A 3CAXA 2WGVA 4HP9A 4C3QA 1SDNA 2J8YA 4EV4A 1UWNX 4K08A 3DAVA 4GD6A 2VGLS 2VV6A 2NUPC 1NZUA 4ID4A 3BFEA 3NBLA 2DNSA 3WS4A 2OWHA 2QZ6A 1E3UA 2Z6DA 5LBRA 1G6AA 3T4QA 1GA9A 3GMWA 1VETB 1TF1A 3IXBA 4P85A 2PT7A 2HGVA 4PHTA 1XX2A 4CLCD 5FDSA 2X01A 3W2ZA 4BMWA 4PKYA 5HAIA 2GZAA 5HDSA 1FR6A 1NJ4A 2IWCA 5DJTA 4ZJ3A 2JCHA 1S66L 3LIAA 3VFHA 1VM1A 3S4XA 3HUNA 2PD7A 4ETZA 2P74A 3CWFA 4JLFA 1H8MA 1PZPA 4OPYA 1TVFA 2ZQ8A 3CJMA 4EWFA 1KGEA 1Q2PA 1ES2A 4U0XA 3TE8A 3H82B 4HOIA 4MN6A 3KYEA 3E4PA 3IHAA 1FIKA 3HLWA 5CEBA 5G18A 3LR4A 5GLAA 1XJ3A 2ZM2A 4MLLA 4UA9A 2P04A 3AGDA 3T4SA 4II7A 3W4OA 5FQQA 3ZG9B 4FH4A 4PM5A 5DTTA 2ACGA 3OCLA 4IUHA 2Y55A 3NDGA 3LR3A 3A3IA 3UB7A 3Q7VB 4GOGA 3SOIA 4DJ3A 1XGIA 3PBSA 3S7PA 1W8QA 4ZDXA 4OONA 5FSRA 3S22A 4XUZA 1M6KA 1XFNA 3FKWA 3IH9A
chains in the Genus database with same CATH topology
4MBFA 2Y2GA 3Q7ZA 2ZQDA 1K6RA 1IYPA 4S2NA 2DRWA 4IEDA 4WEJA 1SDEA 1JTDA 1I2SA 5EVID 3WRZA 4RYEA 3IF6B 4QU3A 2X71A 1K57C 5FQKA 3N8RA 4E6XA 2R9WA 2PBYA 1MXOA 2Y2NA 4OLDA 3W8KA 3OPPA 1LL5A 1VQQA 1YLTA 5HL1A 1GHPA 2Y4AA 4KZAA 2OLUA 3VP4A 1YT4A 4LCLA 3ZG8B 1TDGA 1LLBA 3N8SA 4IBXA 3SH9A 4BL3A 3NCKA 1E3UD 5AQ7A 4WZ5A 1KDSA 1DY6A 3SS4A 4EBNA 1KE0A 4E6WA 2VGKA 3GQZA 1YLZA 2J7VA 5EE8A 2Y2KA 4MEZA 2XFSA 1K4EA 3VMAA 5FAPA 3MZDA 2Y2QA 5KZHA 1MWTA 1FCOA 3UPNA 5L2FA 1ES5A 3UE1A 3O3VA 4E3MA 2WK0A 1QMFA 2XR0A 2ZC4B 3LEZA 4S2KA 5I94A 2HDRA 3MKEA 4KZ5A 1W8YA 4U0TA 5M18A 4ZTKA 2XQZA 1ALQA 2FFFB 2XD5A 2WADA 1IYQA 2WAFA 3Q81A 1CK3A 4KZBA 1DJBA 1ZKJA 2Y2LA 3ZG0A 1ZG4A 2DCFA 5CRFA 4OPZA 1HTZA 1MBLA 1L0DA 4UA6A 1C3BA 4P6BA 1L0GA 5FQJA 3CMZA 5AQBA 5TR7A 3FYZA 2UWXA 1SCWA 4DRTA 2CC1A 5A90A 1BZAA 1CI8A 3MZFA 1K56A 1PIOA 2BG1A 1GHMA 1K57A 3G35A 1BLHA 4KG6A 5GHXA 3WS0A 3IHBA 2V2FF 1GCEA 4GDBA 3BFCA 3HLCA 1FQGA 4N9KA 3QNBA 3B3XA 3SS3A 1IEMA 1KE3A 4E3IA 3IQAA 2V20A 3IF6C 1PI5A 3SH7A 4E3KA 5BOHA 1JVJA 3ZNTA 1FOFA 1YMXA 3SS5A 3VFFA 3LCEA 4QJGA 4JPMA 4HESA 3HLGA 5KMWA 3RJUA 1E25A 2G2WA 4S2NC 4E3LA 5CERA 4ZBEA 3V3RA 3LY3A 4IBRA 4PPRA 4E3OA 1DJCA 4B4ZA 3GRJA 4PM8A 5DF9A 5FI6A 2Y59A 1IYSA 3Q07A 4DE2A 5EOEA 2ZM0A 2HPBA 2XF3A 4WYYA 4DDYA 3G32A 3IXHA 3LO7A 2Y2JA 3MBZA 4WMCD 5CEDA 4XUXA 1ESIA 4WZ5C 4O7DA 5F1FA 1XP4A 3UPOA 4CJNA 1SHVA 4KZ3A 1YMSA 1BSGA 5GL9A 3UPPA 3ZG7B 1W7FA 1N4OA 1MWRA 4KG5A 4R3BA 4FCFA 1BUEA 4QY6A 3HREA 4MNRA 5GHZA 2PU4A 1H8YA 3BFDA 4OH0A 2H5SA 3MXRA 1YM1A 4X6TA 5F83A 1XA7A 2OV5A 5HAQA 4P87A 1L2SA 3G2ZA 1PWDA 3C4OA 3UDIA 3BLMA 5CHUA 3PAEA 4OQIA 4RX3A 2XD1A 4Y0UA 4MBHA 2IWDA 4Q8IA 2OLVA 1W5DA 4DE3A 4WM9A 2ZLYA 3C4PA 4OPQA 2Q9NA 4X56A 4OOMA 3G31A 4R0QA 3VSKA 4FD8A 4LCMA 2HDQA 4K0XA 4KQQA 4DE0A 1RGYA 1N9BA 1JWVA 5JYOA 3ZG5A 3VP1A 2EX2A 5M1AA 3ZHHA 3UE0A 1QMEA 1KGGA 2C6WB 2WZXA 1IELA 4NETA 5AQAA 5EUAA 1HVBA 3VOZA 3PBQA 2XEPA 3TSGA 4D2OA 3Q1FA 3PBTA 4F94A 3MXSA 5FI7A 3JYIA 3ZGAB 3G34A 3UE3A 4JXGA 1LL9A 2ZC5B 2Y91A 1AXBA 2JBFA 3N8LA 5CGWA 1GHIA 1KVLA 3M2KA 1YQSA 4EBPA 1BLCA 3IH8A 5F1GA 1U60A 2Z2LB 5CGSA 1L0EA 3G2YA 3ITBA 1KDWA 4N1HA 5KSHA 3V3SA 2Y2HA 3CG5A 1EWZA 2VGJA 2ZC3B 3OPRA 3WS2A 1XKZA 2FFYA 4DXCA 2Y2PA 4LV3A 4QB8A 3W4PA 1SKFA 3HUOA 3UDXA 3HUMA 3HLDA 2R9XA 2ZJ9A 3BFFA 4GNUA 4KZ6A 1KGFA 4KENB 3RXWA 1LHYA 2WGIA 3A3DA 4OP5A 1FCMA 3M6HA 3O87A 5CHMA 3IF5A 2HDSA 4OP8A 3BECA 4UA7A 4X68A 4N9LA 4E3JA 1TDLA 2P9VA 1CI9A 3E2KA 3G30A 1E4DA 3EQVA 2H0TA 3OPHA 4LV2A 1K56D 3N6IA 4GKUA 2EFXA 4EQIA 3D4FA 4P0MA 3BFGA 4DF6A 1MY8A 4FH2A 4RX2A 1ONHA 5FASA 4GZBA 4BD0A 4R1GA 2P9VB 3V39A 3GTCA 3IXGA 4JF4A 5GHYA 1G68A 4DE1A 4BLMA 3BLSA 4S2IA 1K55A 1Y54A 3I7JA 1H5XA 1O07A 4IVIA 1M40A 1XGJA 3VP0A 2G2UA 1NY0A 1FR1A 3FWLA 4KZ9A 3WWXA 3RXXA 3W4QA 3V5MA 1CEGA 1FSWA 1YLWA 5TFQA 1MWSA 5FA7A 4L0LA 1H8ZA 4R23A 1KVMA 2XDMA 3TG9A 2XLNA 5FI2A 1PWCA 4PM9A 4DKIA 2I72A 3BEBA 4KQOA 3CZDA 1RP5A 1YLPA 2XGNA 5F82A 1PI4A 5FQIA 3EQUA 4HBTA 2Q9MA 3MKFA 3WRTA 1IKIA 3N7WA 1S6RA 3ITAA 4X69A 3PTEA 4X55A 4PM6A 3NC8A 3UNWA 1OMEA 1GA0A 4JF6A 1L0FA 4QHCA 3Q82A 3ZNYA 2XK1A 3UY6A 1BTLA 5GLBA 2ZQAA 3LY4A 2J9PA 4K91A 1BLSA 3GSGA 4EWFA 2ZMAA 3WS5A 3IT9A 4S2MA 1I2WA 3HVFA 3GR2A 2EXBA 1JWPA 3N4IA 5AQ9A 3VP2A 4OPRA 2ZC7A 1NXYA 3IWIA 3UN7A 4DDSA 2WKEA 3QNCA 5A93A 2GDNA 1K54A 3IWOA 4A5RA 3E2LA 2WGWA 4R4RA 5DTKA 2EX6A 4KZ8A 3O86A 1NYMA 2BLSA 4NK3A 2WYXA 4KQRA 5EECA 5KSCA 5FQ9A 3HBRA 5EVLA 4WEKA 3SH8A 5HW3A 1K4FA 4M3KA 4LV1A 4S2PA 3FZCA 4ZJ2A 1YLJA 2C5WB 2H10A 1HZOA 5FATA 2HP5A 2WGWB 3ZVTA 2XFTA 3ISGA 1ES4A 2Z2MB 3DWKA 5FQMA 2X02A 4JF5A 4R3JA 4YINA 5E2EA 1TEMA 5FAOA 4BD1A 1CEFA 1Z6FA 1K6SA 3M6BA 3OC2A 4H8RA 1JTGA 4B4XA 1PYYA 1K38A 4K0WA 1ERQA 5CGXA 1O7EA 3V50A 3NI9A 5A91A 3PBOA 3DWZA 1K55C 4JBFA 1WYBA 1DJAA 3AGFA 5TGFA 4C75A 2WGVA 3C7UA 3PBNA 3MZEA 1Q2QA 1LI9A 2EFUA 4C3QA 2EX9A 3O88A 5EVIA 3S1YA 1RGZA 1SDNA 2J8YA 4RA7A 4EV4A 4OQGA 4GD6A 5DF8A 1MWUA 4KZ7A 4LV0A 3PAGA 4OOLA 2Y2MA 4KZ4A 4XXRA 1NZUA 2E8IA 1ES3A 4ID4A 2ZC6B 4GDNA 3BFEA 3NBLA 2DNSA 3BYDA 4WBGA 3WS4A 4HEFA 5CECA 1PW1A 2QZ6A 3PBRA 1E3UA 4B88A 4OQ0A 5IHVA 5EPHA 4S2OA 1G6AA 2ZQ7A 5EVIB 3UO9A 1GA9A 3GMWA 3P98A 3NDEA 4OVDA 2ZQ9A 4JKTA 2QPNA 4Y7PA 5A92A 2Y2OA 4GB7A 3IXBA 1BLPA 3A3JA 3C7VA 4QY5A 2A49A 1ZG6A 3NY4A 4P85A 1BT5A 1YLYA 3TOIA 1EROA 3A3EA 4GN2A 4JXSA 3OZHA 4YFMA 1WYCA 1FCNA 1XX2A 5JYPA 3P09A 1PZOA 2EXAA 2HP9A 1IYOA 4PM7A 3M2JA 2X01A 5EOOA 4WZ4A 1LI0A 1XPBA 1MKIA 4EUZA 4PMAA 4U3TA 5DF7A 5HAIA 1FR6A 1K54C 1NJ4A 2IWCA 4X53A 4BJPA 2JC7A 5E2GA 4ZJ3A 2JCHA 4IVKA 1S0WA 4C6YA 4OLGA 3HL9A 5CXWA 2WZZA 4FSFA 4Y0OA 4WELA 2WKIA 2J9OA 3VFHA 1VM1A 1K25A 3HUNA 4UAAA 3S4XA 3UDFA 2QMIA 4EBLA 3ZVWA 2P74A 2JE5A 1ONGA 3HLFA 5E2HA 5GLDA 4ZAMA 1XXMA 2OSUA 3OCNA 2RL3A 5GLCA 3ZDJA 3ZFZA 2ZM8A 4JLFA 3VP3A 4BENA 2RCXA 1PWGA 1PZPA 2ZQCA 3GV9A 4LENA 4OPYA 5J8XA 5DVAA 1IKGA 2WKHA 1W79A 1FSYA 1HD8A 1MPLA 1TVFA 2ZQ8A 3BRMA 3CJMA 1KGEA 1Q2PA 2HDUA 1ES2A 4S2JA 4UHUA 4U0XA 3VSLA 3WS1A 4KG2A 2Y2IA 5CTMA 2V1ZA 1ERMA 4N92A 2XH9A 4Z9QA 4Y0TA 3BM6A 3ZCZA 4OKPA 5EVIC 2PU2A 5CHJA 1XA1A 3IHAA 4N1XA 5D3OA 3NIAA 1NYYA 3HLWA 1ZC2A 5HFOA 5FAQA 5CEBA 5G18A 3QHYA 3A3FA 5GLAA 4JXWA 4E3NA 2ZM2A 4MLLA 4S2LA 1ESUA 4UA9A 3HLBA 2H0YA 1NZOA 4CPKA 5U47A 3OPLA 3AGDA 3Q7VA 5DTSA 4WMCA 2A3UA 3DTMA 1EI5A 3W4OA 5HAPA 1BULA 1JWZA 2EX8A 1I5QA 3G4PA 5FQQA 3ZG9B 4FH4A 4PM5A 2B5RA 4R4SA 3AGEA 1PW8A 4JXVA 5DTTA 4DXBA 1KE4A 4HBUA 3OCLA 3HLEA 4GD8A 4OOYA 2Y55A 2ZD8A 3NDGA 1J9MA 3A3IA 3DW0A 3Q7VB 4RVAA 5FDHA 3GVBA 1WE4A 4GOGA 1RCJA 3SOIA 2WAEA 4OQHA 5E43A 1XGIA 3PBSA 3C5AA 3FV7A 3VOYA 2HP6A 1W8QA 1NRFA 3IWQA 3MFDA 2IWBA 5M19A 4ZDXA 4OONA 5FSRA 3IF6A 3S22A 4QD4A 4ZJ1A 3FKVA 4XUZA 1M6KA 5CTNA 3IXDA 5E2FA 3FKWA 5HARA 5HX9A 4MBKA 2WUQA 4BL2A 4BQMA 3IH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBF A;  2Y2G A;  3Q7Z A;  2ZQD A;  1K6R A;  1IYP A;  4S2N A;  2DRW A;  4IED A;  4WEJ A;  1SDE A;  1JTD A;  1I2S A;  5EVI D;  3WRZ A;  4RYE A;  3IF6 B;  4QU3 A;  2X71 A;  1K57 C;  5FQK A;  3N8R A;  4E6X A;  2R9W A;  2PBY A;  1MXO A;  2Y2N A;  4OLD A;  3W8K A;  3OPP A;  1LL5 A;  1VQQ A;  1YLT A;  5HL1 A;  1GHP A;  2Y4A A;  4KZA A;  2OLU A;  3VP4 A;  1YT4 A;  4LCL A;  3ZG8 B;  1TDG A;  1LLB A;  3N8S A;  4IBX A;  3SH9 A;  4BL3 A;  3NCK A;  1E3U D;  5AQ7 A;  4WZ5 A;  1KDS A;  1DY6 A;  3SS4 A;  4EBN A;  1KE0 A;  4E6W A;  2VGK A;  3GQZ A;  1YLZ A;  2J7V A;  5EE8 A;  2Y2K A;  4MEZ A;  2XFS A;  1K4E A;  3VMA A;  5FAP A;  3MZD A;  2Y2Q A;  5KZH A;  1MWT A;  1FCO A;  3UPN A;  5L2F A;  1ES5 A;  3UE1 A;  3O3V A;  4E3M A;  2WK0 A;  1QMF A;  2XR0 A;  2ZC4 B;  3LEZ A;  4S2K A;  5I94 A;  2HDR A;  3MKE A;  4KZ5 A;  1W8Y A;  4U0T A;  5M18 A;  4ZTK A;  2XQZ A;  1ALQ A;  2FFF B;  2XD5 A;  2WAD A;  1IYQ A;  2WAF A;  3Q81 A;  1CK3 A;  4KZB A;  1DJB A;  1ZKJ A;  2Y2L A;  3ZG0 A;  1ZG4 A;  2DCF A;  5CRF A;  4OPZ A;  1HTZ A;  1MBL A;  1L0D A;  4UA6 A;  1C3B A;  4P6B A;  1L0G A;  5FQJ A;  3CMZ A;  5AQB A;  5TR7 A;  3FYZ A;  2UWX A;  1SCW A;  4DRT A;  2CC1 A;  5A90 A;  1BZA A;  1CI8 A;  3MZF A;  1K56 A;  1PIO A;  2BG1 A;  1GHM A;  1K57 A;  3G35 A;  1BLH A;  4KG6 A;  5GHX A;  3WS0 A;  3IHB A;  2V2F F;  1GCE A;  4GDB A;  3BFC A;  3HLC A;  1FQG A;  4N9K A;  3QNB A;  3B3X A;  3SS3 A;  1IEM A;  1KE3 A;  4E3I A;  3IQA A;  2V20 A;  3IF6 C;  1PI5 A;  3SH7 A;  4E3K A;  5BOH A;  1JVJ A;  3ZNT A;  1FOF A;  1YMX A;  3SS5 A;  3VFF A;  3LCE A;  4QJG A;  4JPM A;  4HES A;  3HLG A;  5KMW A;  3RJU A;  1E25 A;  2G2W A;  4S2N C;  4E3L A;  5CER A;  4ZBE A;  3V3R A;  3LY3 A;  4IBR A;  4PPR A;  4E3O A;  1DJC A;  4B4Z A;  3GRJ A;  4PM8 A;  5DF9 A;  5FI6 A;  2Y59 A;  1IYS A;  3Q07 A;  4DE2 A;  5EOE A;  2ZM0 A;  2HPB A;  2XF3 A;  4WYY A;  4DDY A;  3G32 A;  3IXH A;  3LO7 A;  2Y2J A;  3MBZ A;  4WMC D;  5CED A;  4XUX A;  1ESI A;  4WZ5 C;  4O7D A;  5F1F A;  1XP4 A;  3UPO A;  4CJN A;  1SHV A;  4KZ3 A;  1YMS A;  1BSG A;  5GL9 A;  3UPP A;  3ZG7 B;  1W7F A;  1N4O A;  1MWR A;  4KG5 A;  4R3B A;  4FCF A;  1BUE A;  4QY6 A;  3HRE A;  4MNR A;  5GHZ A;  2PU4 A;  1H8Y A;  3BFD A;  4OH0 A;  2H5S A;  3MXR A;  1YM1 A;  4X6T A;  5F83 A;  1XA7 A;  2OV5 A;  5HAQ A;  4P87 A;  1L2S A;  3G2Z A;  1PWD A;  3C4O A;  3UDI A;  3BLM A;  5CHU A;  3PAE A;  4OQI A;  4RX3 A;  2XD1 A;  4Y0U A;  4MBH A;  2IWD A;  4Q8I A;  2OLV A;  1W5D A;  4DE3 A;  4WM9 A;  2ZLY A;  3C4P A;  4OPQ A;  2Q9N A;  4X56 A;  4OOM A;  3G31 A;  4R0Q A;  3VSK A;  4FD8 A;  4LCM A;  2HDQ A;  4K0X A;  4KQQ A;  4DE0 A;  1RGY A;  1N9B A;  1JWV A;  5JYO A;  3ZG5 A;  3VP1 A;  2EX2 A;  5M1A A;  3ZHH A;  3UE0 A;  1QME A;  1KGG A;  2C6W B;  2WZX A;  1IEL A;  4NET A;  5AQA A;  5EUA A;  1HVB A;  3VOZ A;  3PBQ A;  2XEP A;  3TSG A;  4D2O A;  3Q1F A;  3PBT A;  4F94 A;  3MXS A;  5FI7 A;  3JYI A;  3ZGA B;  3G34 A;  3UE3 A;  4JXG A;  1LL9 A;  2ZC5 B;  2Y91 A;  1AXB A;  2JBF A;  3N8L A;  5CGW A;  1GHI A;  1KVL A;  3M2K A;  1YQS A;  4EBP A;  1BLC A;  3IH8 A;  5F1G A;  1U60 A;  2Z2L B;  5CGS A;  1L0E A;  3G2Y A;  3ITB A;  1KDW A;  4N1H A;  5KSH A;  3V3S A;  2Y2H A;  3CG5 A;  1EWZ A;  2VGJ A;  2ZC3 B;  3OPR A;  3WS2 A;  1XKZ A;  2FFY A;  4DXC A;  2Y2P A;  4LV3 A;  4QB8 A;  3W4P A;  1SKF A;  3HUO A;  3UDX A;  3HUM A;  3HLD A;  2R9X A;  2ZJ9 A;  3BFF A;  4GNU A;  4KZ6 A;  1KGF A;  4KEN B;  3RXW A;  1LHY A;  2WGI A;  3A3D A;  4OP5 A;  1FCM A;  3M6H A;  3O87 A;  5CHM A;  3IF5 A;  2HDS A;  4OP8 A;  3BEC A;  4UA7 A;  4X68 A;  4N9L A;  4E3J A;  1TDL A;  2P9V A;  1CI9 A;  3E2K A;  3G30 A;  1E4D A;  3EQV A;  2H0T A;  3OPH A;  4LV2 A;  1K56 D;  3N6I A;  4GKU A;  2EFX A;  4EQI A;  3D4F A;  4P0M A;  3BFG A;  4DF6 A;  1MY8 A;  4FH2 A;  4RX2 A;  1ONH A;  5FAS A;  4GZB A;  4BD0 A;  4R1G A;  2P9V B;  3V39 A;  3GTC A;  3IXG A;  4JF4 A;  5GHY A;  1G68 A;  4DE1 A;  4BLM A;  3BLS A;  4S2I A;  1K55 A;  1Y54 A;  3I7J A;  1H5X A;  1O07 A;  4IVI A;  1M40 A;  1XGJ A;  3VP0 A;  2G2U A;  1NY0 A;  1FR1 A;  3FWL A;  4KZ9 A;  3WWX A;  3RXX A;  3W4Q A;  3V5M A;  1CEG A;  1FSW A;  1YLW A;  5TFQ A;  1MWS A;  5FA7 A;  4L0L A;  1H8Z A;  4R23 A;  1KVM A;  2XDM A;  3TG9 A;  2XLN A;  5FI2 A;  1PWC A;  4PM9 A;  4DKI A;  2I72 A;  3BEB A;  4KQO A;  3CZD A;  1RP5 A;  1YLP A;  2XGN A;  5F82 A;  1PI4 A;  5FQI A;  3EQU A;  4HBT A;  2Q9M A;  3MKF A;  3WRT A;  1IKI A;  3N7W A;  1S6R A;  3ITA A;  4X69 A;  3PTE A;  4X55 A;  4PM6 A;  3NC8 A;  3UNW A;  1OME A;  1GA0 A;  4JF6 A;  1L0F A;  4QHC A;  3Q82 A;  3ZNY A;  2XK1 A;  3UY6 A;  1BTL A;  5GLB A;  2ZQA A;  3LY4 A;  2J9P A;  4K91 A;  1BLS A;  3GSG A;  4EWF A;  2ZMA A;  3WS5 A;  3IT9 A;  4S2M A;  1I2W A;  3HVF A;  3GR2 A;  2EXB A;  1JWP A;  3N4I A;  5AQ9 A;  3VP2 A;  4OPR A;  2ZC7 A;  1NXY A;  3IWI A;  3UN7 A;  4DDS A;  2WKE A;  3QNC A;  5A93 A;  2GDN A;  1K54 A;  3IWO A;  4A5R A;  3E2L A;  2WGW A;  4R4R A;  5DTK A;  2EX6 A;  4KZ8 A;  3O86 A;  1NYM A;  2BLS A;  4NK3 A;  2WYX A;  4KQR A;  5EEC A;  5KSC A;  5FQ9 A;  3HBR A;  5EVL A;  4WEK A;  3SH8 A;  5HW3 A;  1K4F A;  4M3K A;  4LV1 A;  4S2P A;  3FZC A;  4ZJ2 A;  1YLJ A;  2C5W B;  2H10 A;  1HZO A;  5FAT A;  2HP5 A;  2WGW B;  3ZVT A;  2XFT A;  3ISG A;  1ES4 A;  2Z2M B;  3DWK A;  5FQM A;  2X02 A;  4JF5 A;  4R3J A;  4YIN A;  5E2E A;  1TEM A;  5FAO A;  4BD1 A;  1CEF A;  1Z6F A;  1K6S A;  3M6B A;  3OC2 A;  4H8R A;  1JTG A;  4B4X A;  1PYY A;  1K38 A;  4K0W A;  1ERQ A;  5CGX A;  1O7E A;  3V50 A;  3NI9 A;  5A91 A;  3PBO A;  3DWZ A;  1K55 C;  4JBF A;  1WYB A;  1DJA A;  3AGF A;  5TGF A;  4C75 A;  2WGV A;  3C7U A;  3PBN A;  3MZE A;  1Q2Q A;  1LI9 A;  2EFU A;  4C3Q A;  2EX9 A;  3O88 A;  5EVI A;  3S1Y A;  1RGZ A;  1SDN A;  2J8Y A;  4RA7 A;  4EV4 A;  4OQG A;  4GD6 A;  5DF8 A;  1MWU A;  4KZ7 A;  4LV0 A;  3PAG A;  4OOL A;  2Y2M A;  4KZ4 A;  4XXR A;  1NZU A;  2E8I A;  1ES3 A;  4ID4 A;  2ZC6 B;  4GDN A;  3BFE A;  3NBL A;  2DNS A;  3BYD A;  4WBG A;  3WS4 A;  4HEF A;  5CEC A;  1PW1 A;  2QZ6 A;  3PBR A;  1E3U A;  4B88 A;  4OQ0 A;  5IHV A;  5EPH A;  4S2O A;  1G6A A;  2ZQ7 A;  5EVI B;  3UO9 A;  1GA9 A;  3GMW A;  3P98 A;  3NDE A;  4OVD A;  2ZQ9 A;  4JKT A;  2QPN A;  4Y7P A;  5A92 A;  2Y2O A;  4GB7 A;  3IXB A;  1BLP A;  3A3J A;  3C7V A;  4QY5 A;  2A49 A;  1ZG6 A;  3NY4 A;  4P85 A;  1BT5 A;  1YLY A;  3TOI A;  1ERO A;  3A3E A;  4GN2 A;  4JXS A;  3OZH A;  4YFM A;  1WYC A;  1FCN A;  1XX2 A;  5JYP A;  3P09 A;  1PZO A;  2EXA A;  2HP9 A;  1IYO A;  4PM7 A;  3M2J A;  2X01 A;  5EOO A;  4WZ4 A;  1LI0 A;  1XPB A;  1MKI A;  4EUZ A;  4PMA A;  4U3T A;  5DF7 A;  5HAI A;  1FR6 A;  1K54 C;  1NJ4 A;  2IWC A;  4X53 A;  4BJP A;  2JC7 A;  5E2G A;  4ZJ3 A;  2JCH A;  4IVK A;  1S0W A;  4C6Y A;  4OLG A;  3HL9 A;  5CXW A;  2WZZ A;  4FSF A;  4Y0O A;  4WEL A;  2WKI A;  2J9O A;  3VFH A;  1VM1 A;  1K25 A;  3HUN A;  4UAA A;  3S4X A;  3UDF A;  2QMI A;  4EBL A;  3ZVW A;  2P74 A;  2JE5 A;  1ONG A;  3HLF A;  5E2H A;  5GLD A;  4ZAM A;  1XXM A;  2OSU A;  3OCN A;  2RL3 A;  5GLC A;  3ZDJ A;  3ZFZ A;  2ZM8 A;  4JLF A;  3VP3 A;  4BEN A;  2RCX A;  1PWG A;  1PZP A;  2ZQC A;  3GV9 A;  4LEN A;  4OPY A;  5J8X A;  5DVA A;  1IKG A;  2WKH A;  1W79 A;  1FSY A;  1HD8 A;  1MPL A;  1TVF A;  2ZQ8 A;  3BRM A;  3CJM A;  1KGE A;  1Q2P A;  2HDU A;  1ES2 A;  4S2J A;  4UHU A;  4U0X A;  3VSL A;  3WS1 A;  4KG2 A;  2Y2I A;  5CTM A;  2V1Z A;  1ERM A;  4N92 A;  2XH9 A;  4Z9Q A;  4Y0T A;  3BM6 A;  3ZCZ A;  4OKP A;  5EVI C;  2PU2 A;  5CHJ A;  1XA1 A;  3IHA A;  4N1X A;  5D3O A;  3NIA A;  1NYY A;  3HLW A;  1ZC2 A;  5HFO A;  5FAQ A;  5CEB A;  5G18 A;  3QHY A;  3A3F A;  5GLA A;  4JXW A;  4E3N A;  2ZM2 A;  4MLL A;  4S2L A;  1ESU A;  4UA9 A;  3HLB A;  2H0Y A;  1NZO A;  4CPK A;  5U47 A;  3OPL A;  3AGD A;  3Q7V A;  5DTS A;  4WMC A;  2A3U A;  3DTM A;  1EI5 A;  3W4O A;  5HAP A;  1BUL A;  1JWZ A;  2EX8 A;  1I5Q A;  3G4P A;  5FQQ A;  3ZG9 B;  4FH4 A;  4PM5 A;  2B5R A;  4R4S A;  3AGE A;  1PW8 A;  4JXV A;  5DTT A;  4DXB A;  1KE4 A;  4HBU A;  3OCL A;  3HLE A;  4GD8 A;  4OOY A;  2Y55 A;  2ZD8 A;  3NDG A;  1J9M A;  3A3I A;  3DW0 A;  3Q7V B;  4RVA A;  5FDH A;  3GVB A;  1WE4 A;  4GOG A;  1RCJ A;  3SOI A;  2WAE A;  4OQH A;  5E43 A;  1XGI A;  3PBS A;  3C5A A;  3FV7 A;  3VOY A;  2HP6 A;  1W8Q A;  1NRF A;  3IWQ A;  3MFD A;  2IWB A;  5M19 A;  4ZDX A;  4OON A;  5FSR A;  3IF6 A;  3S22 A;  4QD4 A;  4ZJ1 A;  3FKV A;  4XUZ A;  1M6K A;  5CTN A;  3IXD A;  5E2F A;  3FKW A;  5HAR A;  5HX9 A;  4MBK A;  2WUQ A;  4BL2 A;  4BQM A;  3IH9 A; 
#chains in the Genus database with same CATH topology
 4S2N A;  3DTI A;  4IED A;  1JTD A;  5EVI D;  1S67 L;  4RYE A;  4QU3 A;  3N8R A;  2Y2N A;  4OLD A;  3OPP A;  3UE6 A;  1LL5 A;  3MXQ A;  2Y4A A;  2OLU A;  3VP4 A;  3ZG8 B;  2QWS A;  1TDG A;  3N8S A;  4KUO A;  4R6L A;  1SKO A;  4EBN A;  4E6W A;  1YLZ A;  2XFS A;  5FAP A;  3MZD A;  2Y2Q A;  1BYW A;  5AVF A;  3BQA A;  2WK0 A;  2XR0 A;  5I94 A;  4S2K A;  2O0Y A;  2HDR A;  3MKE A;  4U0T A;  2WAD A;  1VB6 A;  5F69 A;  4KZB A;  1DJB A;  3ZG0 A;  3ULF A;  2P7J A;  3CMZ A;  4G3K A;  1SCW A;  4DRT A;  2FZ0 A;  3KSH A;  2BG1 A;  3G35 A;  3ZQ5 A;  4CLC A;  2V2F F;  3BFC A;  1XJ2 A;  2HV1 A;  1KE3 A;  3IF6 C;  1IOU A;  1PI5 A;  3SH7 A;  5BOH A;  1S4S A;  3VFF A;  3HLG A;  2G2W A;  3FPW A;  4CLC E;  2QYB A;  3GRJ A;  5DF9 A;  3HCY A;  4NG2 A;  2Y59 A;  2P08 A;  2ZM0 A;  2HPB A;  1OTB A;  3G32 A;  3BW6 A;  4XUX A;  2OOL A;  5IS1 A;  4CJN A;  4R3B A;  1LSV A;  2A24 A;  3LEQ A;  2W3D A;  1H8Y A;  3NUL A;  5F83 A;  2OV5 A;  2ZMF A;  3UB8 A;  3G2Z A;  1PWD A;  1UGU A;  4RX3 A;  4FUW A;  4WM9 A;  4OPQ A;  4X56 A;  5HD5 A;  3KSF A;  4FD8 A;  3QP1 A;  2HDQ A;  4K0X A;  1RGY A;  1N9B A;  3LFV A;  4F3L B;  4XT2 A;  2JKF A;  2EX2 A;  2XA7 M;  1YAX A;  2WZX A;  4NET A;  1IEL A;  5AQA A;  3PBQ A;  4JGO A;  2XEP A;  5J3W A;  3BWL A;  3T50 A;  4D2O A;  4GCZ A;  3PBT A;  3JYI A;  3G34 A;  4ARZ B;  3CIT A;  2GNX A;  2ZC5 B;  3MR0 A;  1NLY A;  3KO6 A;  5CGW A;  1GHI A;  4WUJ A;  1BLC A;  3B33 A;  5F1G A;  3G2Y A;  1ZTU A;  5KSH A;  2JKG A;  2VGJ A;  3WS2 A;  1XKZ A;  4DXC A;  4QB8 A;  4H6J B;  1OJ5 A;  5TBM A;  1F2K A;  3HUM A;  2ZJ9 A;  1KGF A;  3M6H A;  2HDS A;  4X68 A;  2PR5 A;  4E3J A;  1TDL A;  2P9V A;  4I3A A;  1K56 D;  1F98 A;  4GW9 A;  4P0M A;  4HI4 A;  3BFG A;  3QP4 A;  5FAS A;  4GZB A;  3IX3 A;  5GHY A;  1G68 A;  4S2I A;  1K55 A;  3I7J A;  1O07 A;  1NY0 A;  1FR1 A;  1OT6 A;  3BJN A;  4MMN A;  3H7W A;  3LGO A;  1FSW A;  4L9G A;  5FA7 A;  4R23 A;  1H8Z A;  3TG9 A;  2OWJ A;  4DKI A;  2I72 A;  3BEB A;  4HQA A;  1YLP A;  2W1T A;  3NOT C;  2XGN A;  3UMD A;  5G4Z A;  3EQU A;  4HBT A;  2KX6 A;  1IKI A;  3N7W A;  1S6R A;  3PTE A;  3NC8 A;  3PR6 A;  3UNW A;  1GA0 A;  1L0F A;  3ZNY A;  2OAP 1;  2PDR A;  1BLS A;  3GSG A;  3WS5 A;  3IT9 A;  5KIZ A;  3HVF A;  3GR2 A;  1JWP A;  3N4I A;  4DN0 A;  3KX0 X;  3IWI A;  3UN7 A;  2GDN A;  3B47 A;  3EEA A;  4A5R A;  5DTK A;  1N9N A;  3O86 A;  3T1S A;  1NYM A;  4NK3 A;  2XRN A;  5FQ9 A;  5HW3 A;  4GLQ A;  1YLJ A;  2D01 A;  5FEG A;  5FAT A;  3ZVT A;  4HH2 A;  4JF5 A;  4O8G A;  1TEM A;  3M6B A;  4B4X A;  1JTG A;  1K38 A;  5CGX A;  1O7E A;  3QP2 A;  3DWZ A;  4HH3 A;  3AGF A;  4C75 A;  3PBN A;  3MZE A;  1X0O A;  3D3O A;  1VET A;  1MWU A;  4HEF A;  4RQ9 A;  3K2N A;  1PW1 A;  3PBR A;  4OQ0 A;  1F9I A;  2ZQ7 A;  2G7U A;  5EVI B;  4OVD A;  2QPN A;  4Y7P A;  2Y2O A;  4YNR A;  4M4X A;  4GB7 A;  4KUK A;  1BLP A;  3A3J A;  4BBV A;  1ZG6 A;  1BT5 A;  3LYX A;  2BTF P;  3TOI A;  1ERO A;  4JXS A;  3NEC A;  3T4K A;  5JYP A;  1PZO A;  2HP9 A;  1IYO A;  2HJE A;  4EUZ A;  2KLI A;  2O9A A;  4X53 A;  2PHY A;  4IVK A;  1S0W A;  5DFX A;  4OLG A;  5CXW A;  2WZZ A;  4FSF A;  4WEL A;  2J9O A;  1F5M A;  3ZVW A;  5E2H A;  1ONG A;  4ZAM A;  3T12 B;  2ZOI A;  3H82 A;  2W1R A;  2ZM8 A;  5A8B A;  3VP3 A;  3T4L A;  2ZQC A;  1YPR A;  5J8X A;  5DVA A;  1W79 A;  3BRM A;  3F1O B;  4NXE A;  5CTM A;  1PRQ A;  4N92 A;  4Z9Q A;  4GJ4 A;  2PU2 A;  3A3F A;  5HD3 A;  1ESU A;  3HLB A;  3MSH A;  5U47 A;  3Q7V A;  4WMC A;  3DTM A;  1EI5 A;  4CQH A;  1I5Q A;  2B18 A;  1GSV A;  4JXV A;  1KE4 A;  4HBU A;  2W3H A;  4OOY A;  2L1M A;  3DW0 A;  4RVA A;  2AVX A;  1WE4 A;  1RCJ A;  3C5A A;  3FV7 A;  3TJZ C;  3IWQ A;  2VV7 A;  2K31 A;  4QD4 A;  5E2F A;  2WUQ A;  4BL2 A;  3K3C A;  4GS9 B;  3T4O A;  2Y2G A;  3Q7Z A;  1IYP A;  2DRW A;  4EER A;  2V8F A;  2X71 A;  5AVE A;  1K57 C;  2R9W A;  2PBY A;  1Y4O A;  5AJG A;  4JGQ A;  4LCL A;  4IBX A;  4BL3 A;  1DY6 A;  2Y79 A;  1KE0 A;  5EE8 A;  4G3V A;  3HJI A;  4MEZ A;  2VK3 A;  5DFY A;  4R3A A;  4ESP A;  5L2F A;  1ES5 A;  3UE1 A;  4E3M A;  1QMF A;  2ZC4 B;  5DJU A;  1TS7 A;  4KZ5 A;  1W8Y A;  2XD5 A;  4R38 A;  3JVU A;  1IYQ A;  2J3T D;  1CK3 A;  5G4Y A;  5I5L A;  2K2N A;  2Y2L A;  5CRF A;  3IX4 A;  1L0D A;  5C5K A;  1C3B A;  1L0G A;  5AQB A;  1LSW A;  5TR7 A;  2UWX A;  4JGR A;  2CC1 A;  3LUQ A;  1PIO A;  1FIL A;  1K57 A;  4WN5 A;  2JKR M;  3IHB A;  4GDB A;  3HLC A;  1FQG A;  3SW1 A;  4E3I A;  2V20 A;  4E3K A;  4QJG A;  4Z1W A;  2GJ3 A;  4HES A;  2Y8H A;  1E25 A;  5IT5 A;  4S2N C;  4Y2F A;  1NWZ A;  4E3L A;  2LB9 A;  5CER A;  3L9K A;  3EOI A;  1GSX A;  4PM8 A;  1S1Y A;  1IYS A;  2XF3 A;  2M1C A;  4HIA A;  4BBU A;  1XP4 A;  3UPP A;  4KZ3 A;  3ZG7 B;  1N4O A;  3CUE A;  4FCF A;  4QY6 A;  2E8J A;  4OH0 A;  2H5S A;  1D7E A;  4ME4 A;  4F3L A;  3PAE A;  4OQI A;  4X1M A;  2HF6 A;  4Y0U A;  2VGL M;  2UV0 E;  2R78 A;  1W5D A;  3C38 A;  3C4P A;  2Q9N A;  3VSK A;  4LCM A;  4DE0 A;  3C30 A;  1JWV A;  5FEF A;  5JYO A;  4ARZ A;  5M1A A;  5IU1 A;  1DP9 A;  1KGG A;  4CLC C;  3TSG A;  4F94 A;  3MXS A;  5FI7 A;  3P01 A;  4JXG A;  1AXB A;  2JBF A;  3QP6 A;  4H6J A;  2GX5 A;  3IH8 A;  4P6Z S;  2PYP A;  1U60 A;  1L0E A;  4O0P A;  2DMW A;  1EWZ A;  3OPR A;  3F1P B;  4LV3 A;  3HUO A;  3FG8 A;  3HLD A;  2R9X A;  3BQ8 A;  3QP5 A;  4GNU A;  3A3D A;  2WGI A;  5CHM A;  3BEC A;  4UA7 A;  4N9L A;  1CI9 A;  4HJ3 A;  4GKU A;  2EFX A;  2I9V A;  4EQI A;  3EGD C;  3D4F A;  3E98 A;  1MY8 A;  4FH2 A;  5EFW A;  1ONH A;  3FPV A;  3VP0 A;  4WF0 A;  1M40 A;  2G2U A;  4KZ9 A;  3WWX A;  4I38 A;  3W4Q A;  5F68 A;  1YLW A;  1MWS A;  3GEC A;  2V0U A;  1PWC A;  4PM9 A;  4B93 A;  3CZD A;  2VX8 A;  1ACF A;  4MN7 A;  1LSX A;  1PI4 A;  1G6O A;  4L9F A;  5FQI A;  2Q9M A;  3U2A A;  3MKF A;  4X55 A;  5HPF A;  1OME A;  4JF6 A;  1T1B A;  4ZRR A;  2XK1 A;  3UY6 A;  5GLB A;  1D1J A;  3LY4 A;  4K91 A;  5HZH A;  4EW7 A;  1N9L A;  2EXB A;  2ZC7 A;  2WKE A;  5A93 A;  1K54 A;  3IWO A;  3IX8 A;  2EX6 A;  5KSC A;  2WYX A;  5CX7 A;  3HBR A;  1K4F A;  4M3K A;  2JKR I;  4LV1 A;  5FL3 A;  2C5W B;  3CPT B;  4EES A;  1HZO A;  4B9O A;  2XFT A;  3ISG A;  3MQO A;  3DWK A;  2X02 A;  4YIN A;  2W0N A;  5FAO A;  1CEF A;  5EM0 A;  2JKT M;  1K6S A;  1ERQ A;  3NI9 A;  1K55 C;  1DJA A;  3LR5 A;  2PAV P;  3DBA A;  1Q2Q A;  2EFU A;  2EX9 A;  2W3F A;  5EVI A;  3S1Y A;  5DF8 A;  2PBD P;  4LV0 A;  4OOL A;  4KZ4 A;  4XXR A;  1ES3 A;  2ZC6 B;  4GDN A;  1TS0 A;  3A0S A;  1NLZ A;  3BYD A;  4WL9 A;  2KDK A;  5EPH A;  4S2O A;  3P98 A;  3IBJ A;  2ZQ9 A;  5A92 A;  4GHI B;  3C7V A;  4QY5 A;  2A49 A;  1P9W A;  1YLY A;  3A3E A;  4GN2 A;  2W27 A;  3L7H A;  4YFM A;  3CI6 A;  3P09 A;  4PM7 A;  3M2J A;  5EOO A;  4WZ4 A;  1S1Z A;  5DF7 A;  1NRJ A;  4BJP A;  1VHM A;  2JC7 A;  4ETX A;  4C6Y A;  2WKI A;  2IA2 A;  4UAA A;  3F1O A;  4I3J A;  4IJG A;  5HDD A;  5J4E A;  5GLD A;  2OSU A;  5GLC A;  3ZDJ A;  3ZFZ A;  3JVV A;  1ZHH B;  1PWG A;  3GV9 A;  4LEN A;  1V9Z A;  4EUV A;  1IKG A;  3NOU C;  1FSY A;  3DTE A;  4UHU A;  1HD8 A;  1MPL A;  2D02 A;  3VSL A;  3WS1 A;  2V1Z A;  1ERM A;  4Y0T A;  3C2W A;  1TS6 A;  4EET B;  3JPU A;  4IUK A;  3PHY A;  5CHJ A;  1XA1 A;  4N1X A;  5D3O A;  4EXO A;  1NYY A;  5FAQ A;  1MC0 A;  4JXW A;  2H0Y A;  1NZO A;  1CF0 A;  3OPL A;  4HJ6 A;  4UQI S;  5EV0 A;  2B5R A;  3T1R A;  4NKP A;  1T19 A;  2VZW A;  4GD8 A;  3HLE A;  2ZD8 A;  3KSG A;  4JGP A;  3GVB A;  4GS9 A;  5L8M A;  2WAE A;  4QPR A;  5E43 A;  3MFD A;  1NRF A;  2IWB A;  5HWV A;  5L09 A;  3E0Y A;  4ZJ1 A;  3IXD A;  5HAR A;  1ODV A;  4BQM A;  2ZL1 B;  4MBF A;  2ZQD A;  2INW A;  1K6R A;  1D06 A;  2WKQ A;  4HP4 A;  3G6O A;  3BY9 A;  1I2S A;  2W3E A;  3IF6 B;  4E6X A;  1MXO A;  3W8K A;  1VQQ A;  1YLT A;  5HL1 A;  2M7U A;  4KZA A;  3RH8 B;  1YT4 A;  4Y3I A;  1LLB A;  3NCK A;  1E3U D;  1VEU B;  5AQ7 A;  4WZ5 A;  1KDS A;  2O9B A;  3SS4 A;  1SZV A;  2VGK A;  3GQZ A;  1YKD A;  2Y2K A;  1K4E A;  3VMA A;  5KZH A;  1TD5 A;  2QJ7 A;  3S7N A;  3UPN A;  1PFL A;  3O3V A;  1T1C A;  2WKR A;  3LEZ A;  5M18 A;  2XQZ A;  1ALQ A;  1P0Z A;  2FFF B;  3TRC A;  1ZKJ A;  1ZG4 A;  2DCF A;  4EEP A;  3T1X A;  4OPZ A;  3OLO A;  5FQJ A;  3A0R A;  2MJ6 A;  3FYZ A;  3H9W A;  1XFQ A;  1BZA A;  3MZF A;  4EEU A;  1K56 A;  4I39 A;  2JKT I;  4N9K A;  3B3X A;  3SS3 A;  4O01 A;  1JVJ A;  1FOF A;  1YMX A;  3SS5 A;  3LCE A;  4KQD A;  5KMW A;  3RJU A;  2XRO A;  3A0V A;  4I5S A;  2JN7 A;  3V3R A;  5FI6 A;  3GDI A;  3Q07 A;  4HY8 A;  2L0W A;  4DE2 A;  2Y2J A;  5CED A;  1K0K A;  1ESI A;  4O7D A;  5F1F A;  3UPO A;  1YMS A;  5GL9 A;  1MWR A;  3MFX A;  2YKF A;  4MNR A;  2PU4 A;  5EM1 A;  3MXR A;  1YM1 A;  4X6T A;  1XA7 A;  4NEE D;  5MC7 A;  4P87 A;  3K3D A;  3LR0 A;  3UDI A;  3VOL A;  3BLM A;  5CHU A;  1TS8 A;  2XD1 A;  2OLV A;  2HZ5 A;  5TJJ A;  2V9A A;  4R0Q A;  3OOV A;  4LRX C;  1XJ4 A;  3ZG5 A;  3ZHH A;  4Y5F A;  1YSP A;  3LI8 A;  3UE0 A;  3VOZ A;  2C6W B;  5EUA A;  1T18 A;  4MCW A;  4MDZ A;  4IHQ A;  3Q1F A;  1LL9 A;  3PYP A;  4Y13 A;  3F1P A;  1G28 A;  2ZMV A;  3M2K A;  4Q0H A;  3TW8 A;  5CGS A;  3ITB A;  3EEH A;  2FFY A;  1CQA A;  2Y2P A;  3W4P A;  3R7W B;  3UDX A;  3BFF A;  4KZ6 A;  5HPI A;  3RXW A;  1LHY A;  1FCM A;  3O87 A;  3IF5 A;  1UWP X;  3CUE C;  3LIE A;  1H0M A;  3E2K A;  3G30 A;  2EWW A;  3EQV A;  3OPH A;  4LV2 A;  3N6I A;  3F1N B;  2VJW A;  4DF6 A;  5DKK A;  4BD0 A;  3V39 A;  3GTC A;  3IXG A;  4JF4 A;  1IFQ A;  4BLM A;  3BLS A;  3OBF A;  4IVI A;  1XGJ A;  2VKS A;  3T1Q B;  2V1B A;  5F5Y A;  3V5M A;  4L0L A;  2V0W A;  3UME A;  2EWV A;  2XLN A;  3PXP A;  4KQO A;  2ZOH A;  1RP5 A;  4X1L A;  2VV8 A;  5HWT A;  5F82 A;  3WRT A;  3ITA A;  4PM6 A;  1Y28 A;  4Y15 A;  3MQQ A;  3B42 A;  4DJ2 A;  3IS2 B;  4S2M A;  1I2W A;  5L07 A;  3CPT A;  4DDS A;  3QNC A;  1LT0 A;  4MN5 A;  2BAS A;  5HL6 A;  3DTK A;  3BY8 A;  3MS6 A;  5EEC A;  4WEK A;  3SH8 A;  4S2P A;  3FZC A;  2H10 A;  2HP5 A;  2WGW B;  5FQM A;  4R3J A;  1OPX A;  2J3T C;  4H8R A;  1PYY A;  4K0W A;  1H3Q A;  3EGX C;  5A91 A;  4JBF A;  3PBO A;  1WYB A;  1HLU P;  1V9Y A;  5TGF A;  3IBR A;  3C7U A;  1LI9 A;  3O88 A;  1RGZ A;  4RA7 A;  4OQG A;  4KZ7 A;  1DP6 A;  3PAG A;  2Y2M A;  4GHI A;  2E8I A;  4WBG A;  1L3L A;  5CEC A;  4HHD A;  4B88 A;  5IHV A;  1OT9 A;  3UO9 A;  3NDE A;  4JKT A;  4HJ4 A;  2XA7 S;  3UB9 A;  1DRM A;  3NY4 A;  1YSQ A;  3LIB A;  3OZH A;  1WYC A;  1FCN A;  2EXA A;  4NXB A;  1LI0 A;  1XPB A;  1MKI A;  1W63 Q;  4PMA A;  4U3T A;  5HSQ A;  1K54 C;  5E2G A;  3HL9 A;  4FOF A;  4Y0O A;  2PD8 A;  1K25 A;  2PYR A;  3UDF A;  2QMI A;  4EBL A;  4LFU A;  2JE5 A;  3HLF A;  1MKM A;  1XXM A;  4AFI A;  3OCN A;  5J7E A;  2RL3 A;  4R70 A;  3VE4 A;  4BEN A;  2RCX A;  2VEA A;  2WKH A;  3V50 A;  2HDU A;  4S2J A;  3D9Y A;  4KG2 A;  2Y2I A;  1XJ6 A;  3S7O A;  2XH9 A;  4Y17 A;  3BM6 A;  3ZCZ A;  1J3W A;  4OKP A;  5EVI C;  3NOP C;  3NIA A;  5HFO A;  1ZC2 A;  3QHY A;  2XSS A;  4E3N A;  4S2L A;  2O99 A;  4CPK A;  5DTS A;  3ZYT A;  5EVE A;  2A3U A;  5HAP A;  2L4R A;  1BUL A;  1JWZ A;  2EX8 A;  3G4P A;  4R4S A;  3AGE A;  1PW8 A;  4DXB A;  4Q0J A;  5L10 A;  1J9M A;  5FDH A;  4I3I A;  2M7V A;  2QKP A;  2ZL1 A;  4P6Z M;  4OQH A;  3EWK A;  3VOY A;  2HP6 A;  5M19 A;  2OAQ 1;  3MF0 A;  3IF6 A;  4D60 A;  3FKV A;  1EW0 A;  5CTN A;  2J80 A;  5HX9 A;  1PNE A;  4MBK A;  3CHW P;  4HNB A;  3UB5 P;  1VEU A;  4WEJ A;  3NJA A;  1SDE A;  3WRZ A;  4LRZ E;  5FQK A;  2V1A A;  4NXF A;  2EA9 A;  4E04 A;  1GHP A;  1P9R A;  3SH9 A;  1WA9 A;  2K7S A;  1G5U A;  3FC7 A;  3SZT A;  3QP8 A;  2J7V A;  1MWT A;  2YKH A;  1FCO A;  2LB5 A;  1SKO B;  3KYQ A;  1AWI A;  2J3W A;  1GSW A;  1OTE A;  4ZTK A;  1S4R A;  2WAF A;  3Q81 A;  2Q0O A;  4PAU A;  3KSI A;  3P7N A;  1HTZ A;  1MBL A;  4UA6 A;  2B02 A;  4P6B A;  5HDC A;  5A90 A;  1CI8 A;  3CLO A;  3T4T A;  1GHM A;  2PRF A;  1BLH A;  2QJ5 A;  3NHQ A;  4KG6 A;  5GHX A;  3WS0 A;  2FH5 A;  5K5B A;  1GCE A;  3UB6 A;  2A2L A;  3R4K A;  3QNB A;  1IEM A;  2JHE A;  3IQA A;  1OJG A;  3ZNT A;  3KYZ A;  4JPM A;  2O9C A;  4CLC B;  2NUT C;  4ZBE A;  3LY3 A;  4IBR A;  4PPR A;  4E3O A;  1DJC A;  4B4Z A;  5EOE A;  4WYY A;  4DDY A;  3IXH A;  3LO7 A;  3MBZ A;  4WMC D;  4WZ5 C;  4YOF A;  1SHV A;  1BSG A;  1W7F A;  4KG5 A;  4X25 A;  1BUE A;  3HRE A;  5GHZ A;  2Z6C A;  3BFD A;  3ICY A;  4NXG A;  3MQ0 A;  5HAQ A;  1L2S A;  3C4O A;  1MZU A;  4MBH A;  2IWD A;  3V67 A;  2A24 B;  1W63 M;  4Q8I A;  4DE3 A;  2ZLY A;  4OOM A;  3G31 A;  4QWO A;  3LIF A;  4KQQ A;  4WLA A;  4BBT A;  3VP1 A;  2HJ9 C;  5HWW A;  1QME A;  1Z09 A;  1HVB A;  4L9E A;  4BWI A;  4XT2 B;  3ZGA B;  3UE3 A;  3RFB A;  1CJF A;  3LID A;  2Y91 A;  3N8L A;  4LPZ A;  4UEY A;  1KVL A;  3R7W A;  2CMN A;  1YQS A;  4EBP A;  2WKP A;  3VE3 A;  2Z2L B;  1KDW A;  4N1H A;  3V3S A;  2Y2H A;  3CG5 A;  2ZC3 B;  2H28 A;  1SKF A;  1STZ A;  3F1N A;  4KEN B;  4OP5 A;  1T1A A;  4OP8 A;  1JNU A;  1DP8 A;  4LLO B;  3HJK A;  1E4D A;  2H0T A;  2V8C A;  5TBM B;  4LRY C;  1N9O A;  4RX2 A;  3VV4 A;  2B95 A;  4R1G A;  2P9V B;  3E4Q A;  4DE1 A;  1A0K A;  3D72 A;  1Y54 A;  1H5X A;  4EU0 A;  3E4O A;  1LL8 A;  3FWL A;  3RXX A;  4FTX A;  4G3W A;  4UQI M;  1CEG A;  5TFQ A;  4EQ1 A;  4LGW A;  1KVM A;  2XDM A;  1OTA A;  2ZBB A;  3MJQ A;  2KOI A;  5FI2 A;  3S7Q A;  2QHK A;  2VA0 A;  3H7W B;  3IS2 A;  4X69 A;  4YWZ A;  4QHC A;  3Q82 A;  2W1T B;  1BTL A;  3C8C A;  2VLG A;  2ZQA A;  2J9P A;  2ZMA A;  5DKL A;  3RTY A;  3VP2 A;  5AQ9 A;  4OPR A;  1NXY A;  3LIC A;  2W3G A;  3E2L A;  2WGW A;  4R4R A;  4KZ8 A;  3LI9 A;  3T4J A;  3MMH A;  2BLS A;  2PR6 A;  4Q0I A;  5F6A A;  4KQR A;  4DMZ A;  5EVL A;  1OTI A;  4ZJ2 A;  3O5Y A;  4PKY G;  1ES4 A;  1KOU A;  2Z2M B;  5E2E A;  4BD1 A;  1Z6F A;  1OTD A;  3OC2 A;  3U4L P;  1P97 A;  3CAX A;  2WGV A;  4HP9 A;  4C3Q A;  1SDN A;  2J8Y A;  4EV4 A;  1UWN X;  4K08 A;  3DAV A;  4GD6 A;  2VGL S;  2VV6 A;  2NUP C;  1NZU A;  4ID4 A;  3BFE A;  3NBL A;  2DNS A;  3WS4 A;  2OWH A;  2QZ6 A;  1E3U A;  2Z6D A;  5LBR A;  1G6A A;  3T4Q A;  1GA9 A;  3GMW A;  1VET B;  1TF1 A;  3IXB A;  4P85 A;  2PT7 A;  2HGV A;  4PHT A;  1XX2 A;  4CLC D;  5FDS A;  2X01 A;  3W2Z A;  4BMW A;  4PKY A;  5HAI A;  2GZA A;  5HDS A;  1FR6 A;  1NJ4 A;  2IWC A;  5DJT A;  4ZJ3 A;  2JCH A;  1S66 L;  3LIA A;  3VFH A;  1VM1 A;  3S4X A;  3HUN A;  2PD7 A;  4ETZ A;  2P74 A;  3CWF A;  4JLF A;  1H8M A;  1PZP A;  4OPY A;  1TVF A;  2ZQ8 A;  3CJM A;  4EWF A;  1KGE A;  1Q2P A;  1ES2 A;  4U0X A;  3TE8 A;  3H82 B;  4HOI A;  4MN6 A;  3KYE A;  3E4P A;  3IHA A;  1FIK A;  3HLW A;  5CEB A;  5G18 A;  3LR4 A;  5GLA A;  1XJ3 A;  2ZM2 A;  4MLL A;  4UA9 A;  2P04 A;  3AGD A;  3T4S A;  4II7 A;  3W4O A;  5FQQ A;  3ZG9 B;  4FH4 A;  4PM5 A;  5DTT A;  2ACG A;  3OCL A;  4IUH A;  2Y55 A;  3NDG A;  3LR3 A;  3A3I A;  3UB7 A;  3Q7V B;  4GOG A;  3SOI A;  4DJ3 A;  1XGI A;  3PBS A;  3S7P A;  1W8Q A;  4ZDX A;  4OON A;  5FSR A;  3S22 A;  4XUZ A;  1M6K A;  1XFN A;  3FKW A;  3IH9 A; 
#chains in the Genus database with same CATH homology
 4MBF A;  2Y2G A;  3Q7Z A;  2ZQD A;  1K6R A;  1IYP A;  4S2N A;  2DRW A;  4IED A;  4WEJ A;  1SDE A;  1JTD A;  1I2S A;  5EVI D;  3WRZ A;  4RYE A;  3IF6 B;  4QU3 A;  2X71 A;  1K57 C;  5FQK A;  3N8R A;  4E6X A;  2R9W A;  2PBY A;  1MXO A;  2Y2N A;  4OLD A;  3W8K A;  3OPP A;  1LL5 A;  1VQQ A;  1YLT A;  5HL1 A;  1GHP A;  2Y4A A;  4KZA A;  2OLU A;  3VP4 A;  1YT4 A;  4LCL A;  3ZG8 B;  1TDG A;  1LLB A;  3N8S A;  4IBX A;  3SH9 A;  4BL3 A;  3NCK A;  1E3U D;  5AQ7 A;  4WZ5 A;  1KDS A;  1DY6 A;  3SS4 A;  4EBN A;  1KE0 A;  4E6W A;  2VGK A;  3GQZ A;  1YLZ A;  2J7V A;  5EE8 A;  2Y2K A;  4MEZ A;  2XFS A;  1K4E A;  3VMA A;  5FAP A;  3MZD A;  2Y2Q A;  5KZH A;  1MWT A;  1FCO A;  3UPN A;  5L2F A;  1ES5 A;  3UE1 A;  3O3V A;  4E3M A;  2WK0 A;  1QMF A;  2XR0 A;  2ZC4 B;  3LEZ A;  4S2K A;  5I94 A;  2HDR A;  3MKE A;  4KZ5 A;  1W8Y A;  4U0T A;  5M18 A;  4ZTK A;  2XQZ A;  1ALQ A;  2FFF B;  2XD5 A;  2WAD A;  1IYQ A;  2WAF A;  3Q81 A;  1CK3 A;  4KZB A;  1DJB A;  1ZKJ A;  2Y2L A;  3ZG0 A;  1ZG4 A;  2DCF A;  5CRF A;  4OPZ A;  1HTZ A;  1MBL A;  1L0D A;  4UA6 A;  1C3B A;  4P6B A;  1L0G A;  5FQJ A;  3CMZ A;  5AQB A;  5TR7 A;  3FYZ A;  2UWX A;  1SCW A;  4DRT A;  2CC1 A;  5A90 A;  1BZA A;  1CI8 A;  3MZF A;  1K56 A;  1PIO A;  2BG1 A;  1GHM A;  1K57 A;  3G35 A;  1BLH A;  4KG6 A;  5GHX A;  3WS0 A;  3IHB A;  2V2F F;  1GCE A;  4GDB A;  3BFC A;  3HLC A;  1FQG A;  4N9K A;  3QNB A;  3B3X A;  3SS3 A;  1IEM A;  1KE3 A;  4E3I A;  3IQA A;  2V20 A;  3IF6 C;  1PI5 A;  3SH7 A;  4E3K A;  5BOH A;  1JVJ A;  3ZNT A;  1FOF A;  1YMX A;  3SS5 A;  3VFF A;  3LCE A;  4QJG A;  4JPM A;  4HES A;  3HLG A;  5KMW A;  3RJU A;  1E25 A;  2G2W A;  4S2N C;  4E3L A;  5CER A;  4ZBE A;  3V3R A;  3LY3 A;  4IBR A;  4PPR A;  4E3O A;  1DJC A;  4B4Z A;  3GRJ A;  4PM8 A;  5DF9 A;  5FI6 A;  2Y59 A;  1IYS A;  3Q07 A;  4DE2 A;  5EOE A;  2ZM0 A;  2HPB A;  2XF3 A;  4WYY A;  4DDY A;  3G32 A;  3IXH A;  3LO7 A;  2Y2J A;  3MBZ A;  4WMC D;  5CED A;  4XUX A;  1ESI A;  4WZ5 C;  4O7D A;  5F1F A;  1XP4 A;  3UPO A;  4CJN A;  1SHV A;  4KZ3 A;  1YMS A;  1BSG A;  5GL9 A;  3UPP A;  3ZG7 B;  1W7F A;  1N4O A;  1MWR A;  4KG5 A;  4R3B A;  4FCF A;  1BUE A;  4QY6 A;  3HRE A;  4MNR A;  5GHZ A;  2PU4 A;  1H8Y A;  3BFD A;  4OH0 A;  2H5S A;  3MXR A;  1YM1 A;  4X6T A;  5F83 A;  1XA7 A;  2OV5 A;  5HAQ A;  4P87 A;  1L2S A;  3G2Z A;  1PWD A;  3C4O A;  3UDI A;  3BLM A;  5CHU A;  3PAE A;  4OQI A;  4RX3 A;  2XD1 A;  4Y0U A;  4MBH A;  2IWD A;  4Q8I A;  2OLV A;  1W5D A;  4DE3 A;  4WM9 A;  2ZLY A;  3C4P A;  4OPQ A;  2Q9N A;  4X56 A;  4OOM A;  3G31 A;  4R0Q A;  3VSK A;  4FD8 A;  4LCM A;  2HDQ A;  4K0X A;  4KQQ A;  4DE0 A;  1RGY A;  1N9B A;  1JWV A;  5JYO A;  3ZG5 A;  3VP1 A;  2EX2 A;  5M1A A;  3ZHH A;  3UE0 A;  1QME A;  1KGG A;  2C6W B;  2WZX A;  1IEL A;  4NET A;  5AQA A;  5EUA A;  1HVB A;  3VOZ A;  3PBQ A;  2XEP A;  3TSG A;  4D2O A;  3Q1F A;  3PBT A;  4F94 A;  3MXS A;  5FI7 A;  3JYI A;  3ZGA B;  3G34 A;  3UE3 A;  4JXG A;  1LL9 A;  2ZC5 B;  2Y91 A;  1AXB A;  2JBF A;  3N8L A;  5CGW A;  1GHI A;  1KVL A;  3M2K A;  1YQS A;  4EBP A;  1BLC A;  3IH8 A;  5F1G A;  1U60 A;  2Z2L B;  5CGS A;  1L0E A;  3G2Y A;  3ITB A;  1KDW A;  4N1H A;  5KSH A;  3V3S A;  2Y2H A;  3CG5 A;  1EWZ A;  2VGJ A;  2ZC3 B;  3OPR A;  3WS2 A;  1XKZ A;  2FFY A;  4DXC A;  2Y2P A;  4LV3 A;  4QB8 A;  3W4P A;  1SKF A;  3HUO A;  3UDX A;  3HUM A;  3HLD A;  2R9X A;  2ZJ9 A;  3BFF A;  4GNU A;  4KZ6 A;  1KGF A;  4KEN B;  3RXW A;  1LHY A;  2WGI A;  3A3D A;  4OP5 A;  1FCM A;  3M6H A;  3O87 A;  5CHM A;  3IF5 A;  2HDS A;  4OP8 A;  3BEC A;  4UA7 A;  4X68 A;  4N9L A;  4E3J A;  1TDL A;  2P9V A;  1CI9 A;  3E2K A;  3G30 A;  1E4D A;  3EQV A;  2H0T A;  3OPH A;  4LV2 A;  1K56 D;  3N6I A;  4GKU A;  2EFX A;  4EQI A;  3D4F A;  4P0M A;  3BFG A;  4DF6 A;  1MY8 A;  4FH2 A;  4RX2 A;  1ONH A;  5FAS A;  4GZB A;  4BD0 A;  4R1G A;  2P9V B;  3V39 A;  3GTC A;  3IXG A;  4JF4 A;  5GHY A;  1G68 A;  4DE1 A;  4BLM A;  3BLS A;  4S2I A;  1K55 A;  1Y54 A;  3I7J A;  1H5X A;  1O07 A;  4IVI A;  1M40 A;  1XGJ A;  3VP0 A;  2G2U A;  1NY0 A;  1FR1 A;  3FWL A;  4KZ9 A;  3WWX A;  3RXX A;  3W4Q A;  3V5M A;  1CEG A;  1FSW A;  1YLW A;  5TFQ A;  1MWS A;  5FA7 A;  4L0L A;  1H8Z A;  4R23 A;  1KVM A;  2XDM A;  3TG9 A;  2XLN A;  5FI2 A;  1PWC A;  4PM9 A;  4DKI A;  2I72 A;  3BEB A;  4KQO A;  3CZD A;  1RP5 A;  1YLP A;  2XGN A;  5F82 A;  1PI4 A;  5FQI A;  3EQU A;  4HBT A;  2Q9M A;  3MKF A;  3WRT A;  1IKI A;  3N7W A;  1S6R A;  3ITA A;  4X69 A;  3PTE A;  4X55 A;  4PM6 A;  3NC8 A;  3UNW A;  1OME A;  1GA0 A;  4JF6 A;  1L0F A;  4QHC A;  3Q82 A;  3ZNY A;  2XK1 A;  3UY6 A;  1BTL A;  5GLB A;  2ZQA A;  3LY4 A;  2J9P A;  4K91 A;  1BLS A;  3GSG A;  4EWF A;  2ZMA A;  3WS5 A;  3IT9 A;  4S2M A;  1I2W A;  3HVF A;  3GR2 A;  2EXB A;  1JWP A;  3N4I A;  5AQ9 A;  3VP2 A;  4OPR A;  2ZC7 A;  1NXY A;  3IWI A;  3UN7 A;  4DDS A;  2WKE A;  3QNC A;  5A93 A;  2GDN A;  1K54 A;  3IWO A;  4A5R A;  3E2L A;  2WGW A;  4R4R A;  5DTK A;  2EX6 A;  4KZ8 A;  3O86 A;  1NYM A;  2BLS A;  4NK3 A;  2WYX A;  4KQR A;  5EEC A;  5KSC A;  5FQ9 A;  3HBR A;  5EVL A;  4WEK A;  3SH8 A;  5HW3 A;  1K4F A;  4M3K A;  4LV1 A;  4S2P A;  3FZC A;  4ZJ2 A;  1YLJ A;  2C5W B;  2H10 A;  1HZO A;  5FAT A;  2HP5 A;  2WGW B;  3ZVT A;  2XFT A;  3ISG A;  1ES4 A;  2Z2M B;  3DWK A;  5FQM A;  2X02 A;  4JF5 A;  4R3J A;  4YIN A;  5E2E A;  1TEM A;  5FAO A;  4BD1 A;  1CEF A;  1Z6F A;  1K6S A;  3M6B A;  3OC2 A;  4H8R A;  1JTG A;  4B4X A;  1PYY A;  1K38 A;  4K0W A;  1ERQ A;  5CGX A;  1O7E A;  3V50 A;  3NI9 A;  5A91 A;  3PBO A;  3DWZ A;  1K55 C;  4JBF A;  1WYB A;  1DJA A;  3AGF A;  5TGF A;  4C75 A;  2WGV A;  3C7U A;  3PBN A;  3MZE A;  1Q2Q A;  1LI9 A;  2EFU A;  4C3Q A;  2EX9 A;  3O88 A;  5EVI A;  3S1Y A;  1RGZ A;  1SDN A;  2J8Y A;  4RA7 A;  4EV4 A;  4OQG A;  4GD6 A;  5DF8 A;  1MWU A;  4KZ7 A;  4LV0 A;  3PAG A;  4OOL A;  2Y2M A;  4KZ4 A;  4XXR A;  1NZU A;  2E8I A;  1ES3 A;  4ID4 A;  2ZC6 B;  4GDN A;  3BFE A;  3NBL A;  2DNS A;  3BYD A;  4WBG A;  3WS4 A;  4HEF A;  5CEC A;  1PW1 A;  2QZ6 A;  3PBR A;  1E3U A;  4B88 A;  4OQ0 A;  5IHV A;  5EPH A;  4S2O A;  1G6A A;  2ZQ7 A;  5EVI B;  3UO9 A;  1GA9 A;  3GMW A;  3P98 A;  3NDE A;  4OVD A;  2ZQ9 A;  4JKT A;  2QPN A;  4Y7P A;  5A92 A;  2Y2O A;  4GB7 A;  3IXB A;  1BLP A;  3A3J A;  3C7V A;  4QY5 A;  2A49 A;  1ZG6 A;  3NY4 A;  4P85 A;  1BT5 A;  1YLY A;  3TOI A;  1ERO A;  3A3E A;  4GN2 A;  4JXS A;  3OZH A;  4YFM A;  1WYC A;  1FCN A;  1XX2 A;  5JYP A;  3P09 A;  1PZO A;  2EXA A;  2HP9 A;  1IYO A;  4PM7 A;  3M2J A;  2X01 A;  5EOO A;  4WZ4 A;  1LI0 A;  1XPB A;  1MKI A;  4EUZ A;  4PMA A;  4U3T A;  5DF7 A;  5HAI A;  1FR6 A;  1K54 C;  1NJ4 A;  2IWC A;  4X53 A;  4BJP A;  2JC7 A;  5E2G A;  4ZJ3 A;  2JCH A;  4IVK A;  1S0W A;  4C6Y A;  4OLG A;  3HL9 A;  5CXW A;  2WZZ A;  4FSF A;  4Y0O A;  4WEL A;  2WKI A;  2J9O A;  3VFH A;  1VM1 A;  1K25 A;  3HUN A;  4UAA A;  3S4X A;  3UDF A;  2QMI A;  4EBL A;  3ZVW A;  2P74 A;  2JE5 A;  1ONG A;  3HLF A;  5E2H A;  5GLD A;  4ZAM A;  1XXM A;  2OSU A;  3OCN A;  2RL3 A;  5GLC A;  3ZDJ A;  3ZFZ A;  2ZM8 A;  4JLF A;  3VP3 A;  4BEN A;  2RCX A;  1PWG A;  1PZP A;  2ZQC A;  3GV9 A;  4LEN A;  4OPY A;  5J8X A;  5DVA A;  1IKG A;  2WKH A;  1W79 A;  1FSY A;  1HD8 A;  1MPL A;  1TVF A;  2ZQ8 A;  3BRM A;  3CJM A;  1KGE A;  1Q2P A;  2HDU A;  1ES2 A;  4S2J A;  4UHU A;  4U0X A;  3VSL A;  3WS1 A;  4KG2 A;  2Y2I A;  5CTM A;  2V1Z A;  1ERM A;  4N92 A;  2XH9 A;  4Z9Q A;  4Y0T A;  3BM6 A;  3ZCZ A;  4OKP A;  5EVI C;  2PU2 A;  5CHJ A;  1XA1 A;  3IHA A;  4N1X A;  5D3O A;  3NIA A;  1NYY A;  3HLW A;  1ZC2 A;  5HFO A;  5FAQ A;  5CEB A;  5G18 A;  3QHY A;  3A3F A;  5GLA A;  4JXW A;  4E3N A;  2ZM2 A;  4MLL A;  4S2L A;  1ESU A;  4UA9 A;  3HLB A;  2H0Y A;  1NZO A;  4CPK A;  5U47 A;  3OPL A;  3AGD A;  3Q7V A;  5DTS A;  4WMC A;  2A3U A;  3DTM A;  1EI5 A;  3W4O A;  5HAP A;  1BUL A;  1JWZ A;  2EX8 A;  1I5Q A;  3G4P A;  5FQQ A;  3ZG9 B;  4FH4 A;  4PM5 A;  2B5R A;  4R4S A;  3AGE A;  1PW8 A;  4JXV A;  5DTT A;  4DXB A;  1KE4 A;  4HBU A;  3OCL A;  3HLE A;  4GD8 A;  4OOY A;  2Y55 A;  2ZD8 A;  3NDG A;  1J9M A;  3A3I A;  3DW0 A;  3Q7V B;  4RVA A;  5FDH A;  3GVB A;  1WE4 A;  4GOG A;  1RCJ A;  3SOI A;  2WAE A;  4OQH A;  5E43 A;  1XGI A;  3PBS A;  3C5A A;  3FV7 A;  3VOY A;  2HP6 A;  1W8Q A;  1NRF A;  3IWQ A;  3MFD A;  2IWB A;  5M19 A;  4ZDX A;  4OON A;  5FSR A;  3IF6 A;  3S22 A;  4QD4 A;  4ZJ1 A;  3FKV A;  4XUZ A;  1M6K A;  5CTN A;  3IXD A;  5E2F A;  3FKW A;  5HAR A;  5HX9 A;  4MBK A;  2WUQ A;  4BL2 A;  4BQM A;  3IH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...