3BFGA

Class a beta-lactamase sed-g238c complexed with meropenem
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
262
structure length
262
Chain Sequence
VQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-lactamase Sed1
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
molecule tags Hydrolase
total genus 96
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfgA00
2ZC6B 4K0WA 3LY4A 3VP0A 5FASA 5EVID 4B4XA 2OLVA 4ZTKA 1FOFA 4GDNA 4KG6A 4S2OA 4DKIA 5CGSA 2BLSA 4R0QA 3IH9A 3HUOA 2EFUA 4E3OA 4DDSA 2BG1A 1BLHA 2Y2OA 3EQUA 3O88A 1CI9A 1JVJA 2PBYA 5CGXA 1GA9A 1K56A 3V5MA 5G18A 5HL1A 2XQZA 2ZQ9A 3ZG9B 1PIOA 3BECA 1CK3A 4N9LA 5A93A 1HTZA 5DTTA 4R3JA 1KE3A 1SDNA 3HLWA 3OPLA 2WAEA 3FWLA 1YLTA 2A49A 4GB7A 1ESUA 1G6AA 5CEBA 5BOHA 3ISGA 3OPPA 1IYSA 1WYCA 2RL3A 2ZJ9A 5FSRA 5E43A 3ZFZA 4GD6A 4E3MA 4OQ0A 1SCWA 1XGIA 3G35A 3N4IA 2OV5A 3ZNTA 4UA6A 5F82A 3FYZA 4HESA 4LV0A 2JC7A 4LCMA 5KZHA 5KSHA 4QHCA 3AGDA 1XA7A 4DRTA 4EQIA 1ERQA 4HBUA 3V50A 2X71A 1IYPA 4KZAA 4EBLA 4Y7PA 4BJPA 4JBFA 4X53A 1ZG4A 3VMAA 1VM1A 3TSGA 2Y2MA 3IXHA 4R4RA 3ZDJA 1JTGA 3G2YA 4H8RA 3A3FA 4R3BA 4WMCA 4IVIA 2XGNA 4M3KA 5HX9A 4DDYA 1MY8A 2JE5A 1YMSA 1GHMA 2WKEA 1W8YA 3N6IA 3VP1A 1ES5A 4X55A 3UE3A 3PBTA 4S2NC 2X01A 4QJGA 2E8IA 1XA1A 3IF5A 2WUQA 2ZM2A 4JXVA 4X6TA 1MXOA 2H5SA 4YINA 2DNSA 2EXBA 3BFEA 3PBOA 1E3UD 3RXWA 3FKWA 5EPHA 3BFGA 3WRTA 1ES3A 5EOEA 3MFDA 5TGFA 1ES4A 2ZQDA 4FH2A 4OVDA 3QNBA 1L0FA 4E3NA 5DTSA 1ONGA 3PBNA 5AQ9A 5TFQA 4E3KA 1EWZA 3P09A 3PBQA 5HARA 3VOYA 2QZ6A 5EUAA 3SS5A 2V2FF 5JYPA 4GZBA 1SKFA 3TOIA 4JPMA 3SOIA 5GLBA 3VOZA 3W4OA 1O07A 5EVIA 5FA7A 3IT9A 5GLDA 5KMWA 4OOYA 5CRFA 1PI5A 4P87A 2Z2LB 4WZ5C 5FQQA 1YLPA 4IBRA 4NETA 3A3EA 3PTEA 2H10A 1L0EA 4PM9A 1BULA 1BLCA 2Y91A 3OC2A 3E2LA 4LV3A 5EOOA 4BD0A 3VP3A 1I2WA 4X69A 5F83A 4EV4A 2Q9NA 1ESIA 4ZDXA 3C5AA 4UAAA 1YLZA 3Q7VB 4JXSA 5GHYA 2C5WB 3G34A 3PBRA 4UA7A 2PU4A 1Z6FA 1NRFA 1LI9A 3IXBA 1PWDA 3W4PA 3LO7A 3GQZA 1GHPA 2HDSA 5D3OA 1EROA 2Y59A 1TVFA 3OPHA 4U3TA 5AQ7A 4KZ5A 2J9PA 4L0LA 1IEMA 1K55A 1XKZA 2J7VA 3MKEA 1K54C 1RCJA 5GLCA 3EQVA 3SS3A 4LV1A 4KQOA 1KE0A 2ZC4B 4DE1A 1PI4A 4RVAA 4A5RA 4JF6A 2P9VA 4RX3A 3Q81A 1ONHA 1K6SA 3C7UA 3HLDA 1YQSA 1W8QA 4E3IA 4R4SA 1KE4A 1PWGA 1Q2PA 3GMWA 4RYEA 4BL3A 2WK0A 3NDGA 3WWXA 3C4OA 1MBLA 1K38A 1S0WA 4ZJ1A 3UPPA 4JF4A 3UNWA 4D2OA 3OPRA 3HREA 5CTNA 3TG9A 5KSCA 1ZKJA 4E3LA 4KZ6A 3BLSA 1NXYA 3NIAA 4PM8A 2I72A 5GHZA 1H8ZA 4N1HA 1IYOA 4S2LA 4B4ZA 5M1AA 2R9XA 5FI6A 5HAPA 4KZ3A 4GD8A 3WS0A 4OPYA 4MNRA 2WYXA 4QB8A 3OCNA 1NZUA 3UY6A 3IF6B 5M18A 4WZ5A 1RGZA 1KDSA 1DJAA 3UDXA 1LHYA 5AQBA 2H0TA 4ZBEA 3G4PA 1YMXA 2DCFA 2ZQCA 1JWVA 4KQQA 4WEKA 3BM6A 3ZG7B 1K57C 5FQJA 3ZHHA 1N4OA 3DTMA 4OPRA 3OCLA 1KVLA 3UDFA 2Y2NA 3CMZA 1E3UA 2ZMAA 2RCXA 2XF3A 4GN2A 5J8XA 3HLCA 3G30A 1I5QA 3IHAA 5EECA 1RGYA 4OQIA 1FSWA 1GCEA 4XUZA 1FSYA 1LL9A 5U47A 3M2JA 4C3QA 1FCNA 4K91A 2XD5A 1PW1A 2XH9A 4IVKA 4OLGA 3O3VA 3Q7ZA 2ZQ7A 4Y0TA 5GHXA 4P85A 2EX6A 3W4QA 2ZC3B 3NDEA 3IWIA 1XPBA 3G2ZA 4ZJ3A 2A3UA 3Q82A 5GLAA 3S1YA 3ZVWA 5E2HA 3V3SA 1RP5A 3GVBA 4ID4A 4Y0UA 1MKIA 4KENB 3ZCZA 3DWKA 1JWZA 3IWOA 4C75A 3HLGA 5EE8A 2Y2IA 1BUEA 1DJBA 1L0GA 5DTKA 3HLBA 4OONA 2Y2JA 1ES2A 3IXDA 1HD8A 4PPRA 4Q8IA 3AGEA 3HL9A 3WRZA 1MWUA 3ZGAB 4FH4A 2EX2A 3W8KA 2Y2PA 1IKIA 4GKUA 3P98A 4OKPA 3Q1FA 4WYYA 4XXRA 5DF9A 4FCFA 3UDIA 2OLUA 1E25A 2Y2QA 3BFDA 4S2JA 3NBLA 3BRMA 1FR1A 1HVBA 1NYMA 1DJCA 1K57A 3FZCA 3LY3A 1Q2QA 4JF5A 5CGWA 5A91A 1PZOA 1W7FA 4KZ9A 2VGJA 3M6HA 1NY0A 4U0TA 5FAPA 3VSKA 4N1XA 2FFFB 3RJUA 5HAIA 5CTMA 3WS1A 4BL2A 5CECA 4OLDA 4OOMA 3BLMA 4OP8A 3HUNA 2H0YA 3BFCA 3NCKA 4EBNA 3N8SA 4N9KA 4OPQA 5AQAA 1EI5A 4GOGA 4X56A 1HZOA 4QY5A 3MXSA 2IWBA 3IXGA 1YLYA 3GRJA 5E2EA 5FQIA 4O7DA 1K4FA 2B5RA 2Y4AA 4S2PA 5DF7A 4E6XA 3FV7A 4K0XA 3G31A 5GL9A 4OOLA 2JCHA 4N92A 5DVAA 1L0DA 3O86A 5FDHA 4RX2A 1MPLA 1XX2A 1ZG6A 4BQMA 1M6KA 2VGKA 1E4DA 5F1FA 1LI0A 4DE0A 5JYOA 4UA9A 5CHJA 1CEFA 2XD1A 1ZC2A 2IWCA 4S2NA 3M6BA 2ZC5B 1BZAA 4RA7A 2C6WB 2XDMA 5FQMA 1SHVA 3C7VA 3ZG5A 1BT5A 1W5DA 1WYBA 2WGWB 4QD4A 4XUXA 3GV9A 3NY4A 1OMEA 3SH8A 5HW3A 4U0XA 1TDLA 2Y2KA 1YLWA 1NZOA 1YT4A 2CC1A 3IWQA 2XLNA 3N8LA 2EX9A 3UE0A 2HDQA 1ALQA 1BLPA 2WKHA 2ZQ8A 3IF6C 4Y0OA 1FR6A 2WKIA 3WS2A 2DRWA 2HDUA 1KGGA 5E2FA 3Q07A 4FD8A 2OSUA 3M2KA 2GDNA 4WM9A 4NK3A 1XP4A 3RXXA 4BENA 3PBSA 1DY6A 4MEZA 2P74A 5FAOA 4YFMA 3GTCA 4IBXA 2QPNA 3GSGA 4KZ8A 3Q7VA 1J9MA 4ZJ2A 1ERMA 2EX8A 1MWRA 4CJNA 1JWPA 2Y55A 1H5XA 1I2SA 4KZ7A 3MZFA 2EXAA 3UPOA 3BFFA 1PZPA 4OH0A 2J9OA 2HPBA 3DWZA 2WZXA 3HLEA 3OZHA 5IHVA 4JXGA 2R9WA 5FAQA 2V1ZA 3QHYA 4KG5A 3QNCA 5FQ9A 3MZEA 4F94A 2WAFA 1H8YA 2PU2A 5CEDA 1PWCA 3HLFA 4C6YA 3PAEA 2Q9MA 3C4PA 4OP5A 3LCEA 2WGWA 3WS4A 3S4XA 4E3JA 1MWTA 1Y54A 1K54A 5TR7A 1GA0A 4OQGA 4CPKA 1PW8A 5CERA 4DXCA 4R23A 5I94A 3CG5A 3UO9A 3B3XA 3V3RA 4UHUA 1N9BA 5A90A 1W79A 3DW0A 1KDWA 2Y2LA 4GDBA 5FI2A 5FQKA 3UPNA 3CJMA 5FATA 5CHUA 5EVIC 3O87A 3MXRA 2G2UA 1KGEA 1MWSA 3GR2A 1K6RA 3IH8A 2Y2HA 4Z9QA 4P6BA 4PM5A 3CZDA 4LENA 3ITBA 1TDGA 3IF6A 3ITAA 5E2GA 1JTDA 2ZQAA 4JXWA 5A92A 4WZ4A 1GHIA 3IQAA 3UN7A 3MBZA 3HBRA 3I7JA 4OPZA 3NI9A 5EVIB 4EUZA 4PMAA 1KVMA 4HBTA 3A3DA 2X02A 1K56D 1K25A 2FFYA 2UWXA 4MBFA 1IELA 1YM1A 4FSFA 4EWFA 2J8YA 2HDRA 3G32A 5HFOA 3WS5A 5DF8A 1NJ4A 4BD1A 3SH7A 4B88A 1FCOA 1YLJA 2WZZA 3SS4A 4IEDA 2XK1A 3A3JA 3FKVA 3HUMA 2ZM8A 2WADA 4KZBA 1IKGA 1K55C 2ZC7A 4KG2A 4MLLA 3BEBA 4QU3A 3UE1A 2XR0A 3V39A 1XXMA 1U60A 1XGJA 1L2SA 5CXWA 5M19A 3VSLA 3MKFA 1FQGA 4WBGA 2ZM0A 3E2KA 3S22A 2HP5A 2XEPA 1O7EA 1CI8A 4S2KA 3A3IA 3AGFA 4MBHA 4LV2A 3NC8A 4DE2A 3N7WA 3ZNYA 2HP6A 3ZG8B 3ZVTA 2P9VB 1BTLA 2EFXA 2ZD8A 1M40A 4JKTA 4QY6A 4DXBA 2WGVA 4KQRA 4PM6A 3HVFA 2XFTA 2G2WA 1SDEA 1BSGA 3VP4A 4DF6A 4KZ4A 3ZG0A 1WE4A 1IYQA 1CEGA 2IWDA 1AXBA 3N8RA 3VP2A 4S2IA 4WELA 2WGIA 4GNUA 4E6WA 3SH9A 3D4FA 4PM7A 4WMCD 4S2MA 1LL5A 1BLSA 1PYYA 1S6RA 2Z2MB 1KGFA 2QMIA 3PAGA 1TEMA 4MBKA 5HAQA 1C3BA 3IHBA 1QMFA 5L2FA 2XFSA 3LEZA 4JLFA 4EBPA 2HP9A 3VFFA 2V20A 5F1GA 2JBFA 3VFHA 3MZDA 1G68A 1FCMA 4X68A 4BLMA 4OQHA 5CHMA 1LLBA 1VQQA 4WEJA 4ZAMA 5FI7A 2ZLYA 4DE3A 3BYDA 4P0MA 1NYYA 4LCLA 4HEFA 3JYIA 2Y2GA 4R1GA 5EVLA 1K4EA 1QMEA
chains in the Genus database with same CATH superfamily
2ZC6B 3EEAA 3K3CA 3VP0A 2OLVA 2CMNA 1XFNA 4ZTKA 1FOFA 3BY8A 4E3OA 4DDSA 3EQUA 1BLHA 2Y2OA 3O88A 1CI9A 1K56A 4GCZA 5HL1A 1LSVA 1PIOA 3LI8A 5DTTA 4R3JA 1SDNA 5IS1A 3CITA 2NUTC 4WUJA 3TRCA 3NULA 1G6AA 3ISGA 5E43A 3G35A 1OTAA 2LB9A 4LV0A 2WKPA 2V0UA 4GJ4A 4IUKA 4QHCA 3FC7A 1OTDA 3V50A 4EBLA 3BY9A 4Y7PA 2QJ7A 4JBFA 4X53A 1ZG4A 3VMAA 1VM1A 3TSGA 3IXHA 5L10A 2D02A 1JTGA 3A3FA 4MN6A 4M3KA 3UB5P 1MY8A 4EEUA 1GHMA 4X55A 3HCYA 4NXEA 2X01A 2E8IA 2BASA 4EU0A 4JXVA 2UV0E 4YINA 2DNSA 3PBOA 5EPHA 3WRTA 4IJGA 2ZQDA 1SKFA 1O07A 5EVIA 5FA7A 4OOYA 1GSWA 3BQAA 4IBRA 3A3EA 2H10A 2V1BA 1BLCA 2W1TB 2Y91A 3E2LA 3IX3A 2FH5A 2Q9NA 2BTFP 1YLZA 2PU4A 2OAP1 1Z6FA 3JPUA 3H82B 3LIFA 2HDSA 1TVFA 4EETB 3MJQA 4KZ5A 2VZWA 1K55A 1RCJA 1KE0A 3MQQA 4WF0A 2P9VA 4RX3A 3Q81A 3C7UA 2M1CA 4BL3A 4RYEA 1T1CA 3NDGA 3WWXA 3C4OA 1K38A 4ZJ1A 4LPZA 1PFLA 5KSCA 4KZ6A 4PM8A 1NXYA 1H8ZA 2R9XA 3MF0A 4HI4A 1GSXA 4OPYA 4MNRA 3IF6B 4HP9A 4WZ5A 1KDSA 1OPXA 4FTXA 2J80A 2PD7A 4P6ZM 3H82A 3TE8A 5FQJA 3OCLA 1KVLA 5DFYA 4MDZA 1DP6A 5J8XA 4M4XA 1LSXA 1RGYA 1FSYA 1ODVA 2O0YA 1FCNA 4K91A 2XD5A 1OTEA 3W4QA 5EV0A 1S4SA 3Q82A 3QP2A 1S67L 1RP5A 3DWKA 3IX8A 3DAVA 4GHIA 3GECA 4OONA 3IXDA 1HD8A 4PPRA 3AGEA 2YKHA 2EX2A 3Q1FA 4HHDA 4UAAA 3BRMA 3FZCA 3ZQ5A 1DJCA 4JF5A 3CHWP 4U0TA 1W7FA 5FAPA 2VGJA 4JGPA 3VSKA 2VJWA 2FFFB 3N8SA 4N9KA 1F98A 5AQAA 4K08A 3MXSA 2IWBA 5E2EA 3LFVA 1K4FA 2B02A 2B5RA 2Y4AA 4K0XA 4I5SA 5GL9A 5FDHA 1E4DA 5F1FA 1LI0A 5JYOA 1XFQA 2XD1A 5FEGA 3LR0A 3BWLA 4U0XA 2CC1A 2EX9A 1ALQA 1BLPA 2WKHA 3IF6C 4Y0OA 2DRWA 1SZVA 1KGGA 5E2FA 3Q07A 4WM9A 1XP4A 4MEZA 2O9AA 3TW8A 4KZ8A 2QPNA 1N9OA 3GSGA 1J9MA 2EX8A 3UPOA 3BFFA 4OH0A 3HLEA 2R9WA 3H7WB 4HY8A 2PBDP 4KG5A 3MZEA 2PU2A 5CEDA 3HLFA 4Y2FA 1GA0A 4DXCA 4R23A 4GS9B 4X25A 1KDWA 5FQKA 4CLCE 2Z6CA 3MXRA 1MWSA 3IH8A 1K6RA 4Z9QA 2Y2HA 3CZDA 4LENA 4EW7A 2ZQAA 1HLUP 4WZ4A 3I7JA 3ULFA 3CUEA 3EGXC 2X02A 1K56D 2FFYA 1IELA 2HDRA 3G32A 2EWVA 5DF8A 4B88A 1YLJA 4E04A 2WZZA 3SS4A 1BYWA 3A3JA 3HUMA 5GLBA 2XROA 3UE1A 2XR0A 1JNUA 1U60A 2WKRA 1L2SA 1UGUA 3MKFA 2ZM0A 5HD5A 5L07A 3S22A 4LRXC 1OJ5A 3C30A 2XEPA 3VOLA 2PT7A 4WLAA 4LV2A 4DE2A 3N7WA 2HP6A 4WL9A 3ZG8B 4PM6A 3UMDA 1S66L 4KZ4A 3O5YA 1CEGA 1XJ6A 3N8RA 1S6RA 2L0WA 2QMIA 3PAGA 5DKKA 3IHBA 1QMFA 2OWHA 4JLFA 5FL3A 5HPIA 1TD5A 1ZHHB 3UB7A 4HH2A 5HDSA 5CHMA 4DE3A 3MR0A 2Y2GA 4R1GA 3SW1A 1QMEA 3VP4A 3LY4A 5EVID 3L7HA 4GDNA 4O0PA 4S2OA 3IH9A 2VK3A 3R7WB 3LI9A 2PYPA 5CGXA 3NOPC 4N9LA 2D01A 5A93A 4PAUA 3T1SA 1KE3A 3OPLA 1YLTA 4GB7A 1ESUA 3D9YA 5CEBA 5BOHA 2INWA 3MSHA 1WYCA 4GD6A 4E3MA 1XGIA 1FIKA 3E0YA 2WKQA 4UA6A 2A24B 5KZHA 4IHQA 3UB6A 2JKRM 1X0OA 4HBUA 3KX0X 4HJ6A 4BBTA 3R7WA 2Y2MA 3ZDJA 3G2YA 3UMEA 4WMCA 2XGNA 4Y3IA 1YMSA 2K2NA 4S2NC 1D06A 2Y79A 1XA1A 3C8CA 1MXOA 2H5SA 3BFEA 4MN7A 3RXWA 1KOUA 3T4QA 2A24A 4HH3A 1ES3A 3MFDA 1ES4A 1L0FA 4E3NA 3MFXA 1EWZA 1P0ZA 1NRJA 2M7VA 3VOZA 3EWKA 1UWPX 2H28A 3IT9A 3T1XA 4NETA 3PTEA 1L0EA 3B42A 3OC2A 5L09A 1CQAA 4BD0A 4EV4A 5GHYA 3E4OA 3IXBA 3R4KA 4HOIA 5D3OA 3NHQA 3OPHA 5AJGA 4L0LA 1IEMA 2Q0OA 1XKZA 4ZRRA 1K54C 2ZL1B 5AVFA 4I38A 3KYEA 5EM1A 3LIBA 1XJ4A 3HLDA 1PWGA 1Q2PA 3GMWA 2XA7S 1MBLA 1S0WA 1FILA 4D2OA 3HREA 3TG9A 1ZKJA 5GHZA 3NIAA 5AVEA 4S2LA 3QP1A 5HAPA 4KZ3A 2HJ9C 2WYXA 1NZUA 2O9BA 3T12B 5EVEA 3UDXA 5AQBA 2HV1A 2PD8A 1JWVA 4WEKA 1K57C 3U2AA 4OPRA 2J3TD 3UDFA 1E3UA 2XF3A 3HLCA 3IHAA 4OQIA 3G6OA 5U47A 3M2JA 4L9EA 4C3QA 4IVKA 4OLGA 3O3VA 2V8FA 5GHXA 4P85A 3LEQA 3K3DA 3G2ZA 2A3UA 1YSPA 3S1YA 3GVBA 2HJEA 4ID4A 3HJKA 3MS6A 4NKPA 3HLGA 5DTKA 3HLBA 1MC0A 1A0KA 3HL9A 3WRZA 4DJ2A 1MWUA 4FH4A 2Y2PA 3S7OA 3P98A 4OKPA 4I39A 1STZA 2Y2QA 5DJUA 3BFDA 4UEYA 1IFQA 1Q2QA 3M6HA 1VHMA 1PNEA 4N1XA 1G6OA 4MCWA 5HAIA 4OLDA 1N9LA 4OP8A 2H0YA 1SKOB 4QWOA 4EBNA 1YSQA 3B47A 3VE4A 4NXFA 1HZOA 4HNBA 2FZ0A 5J3WA 2VA0A 3IXGA 1YLYA 1H3QA 3G31A 4N92A 1L0DA 2A2LA 2M7UA 1VEUB 1ZG6A 2O9CA 5J4EA 4UA9A 2P04A 3M6BA 2ZC5B 4RA7A 2C6WB 3LUQA 5FQMA 3C7VA 4II7A 1BT5A 1WYBA 1OMEA 1TS8A 2ZOIA 2GJ3A 5HW3A 1TDLA 1YT4A 2XLNA 2V1AA 3WS2A 2JKFA 3F1PB 2W1TA 5FAOA 4ZJ2A 1ERMA 3RH8B 1OJGA 1I2SA 2Y8HA 5KIZA 2WZXA 3CAXA 3OZHA 4LFUA 4JXGA 4X1MA 3PYPA 3QHYA 3LIAA 1WA9A 3PAEA 2Q9MA 3S4XA 4GLQA 1Y54A 3F1OB 2V0WA 5CERA 3UO9A 3V3RA 3JVVA 4UHUA 3T1QB 5A90A 3DW0A 3F1PA 3UPNA 5EVIC 4EXOA 3O87A 2G2UA 2QJ5A 1KGEA 3GR2A 4PM5A 1TDGA 3IF6A 4JXWA 2W1RA 5C5KA 1GHIA 3IQAA 4PMAA 2V9AA 3EGDC 4LLOB 1K25A 2QKPA 4MBFA 4WN5A 5I5LA 4FSFA 2J8YA 2KLIA 1OT9A 2O99A 3EOIA 4I3IA 4NXBA 4I3JA 1TS6A 3FKVA 2J3WA 4KZBA 2KOIA 1K55C 2ZC7A 3NOUC 4QU3A 4ETXA 3U4LP 5J7EA 5K5BA 3T4JA 3F1OA 1XGJA 4O8GA 3JVUA 5CXWA 3VSLA 2L1MA 5DFXA 3ZNYA 2KX6A 4CLCD 1BTLA 2EFXA 4QY6A 3UE6A 1OTIA 1SDEA 3LIEA 4DF6A 1WE4A 2ZMFA 5TBMB 4GNUA 1OT6A 3SH9A 4PM7A 4WMCD 1BLSA 4X1LA 1PYYA 1XJ2A 4MBKA 4B93A 2HGVA 3LEZA 2JBFA 3VFHA 4X68A 1DRMA 3KSGA 3FG8A 1K0KA 4WEJA 5FI7A 4AFIA 3BYDA 4RQ9A 2VLGA 1K4EA 3S7QA 5FASA 5LBRA 4KG6A 4DKIA 2BLSA 3HUOA 2EFUA 5TBMA 4I3AA 1JVJA 2PBYA 2VEAA 3V5MA 5G18A 2XQZA 2ZQ9A 3BECA 3CLOA 1HTZA 2WAEA 2A49A 4H6JB 3BQ8A 3OPPA 1IYSA 4HJ4A 1F9IA 2RL3A 4GW9A 5G4YA 4IUHA 1G28A 1SCWA 3N4IA 4G3KA 4HESA 1YPRA 3QP5A 4LCMA 2VV7A 5KSHA 3AGDA 1W63M 4DRTA 4EQIA 2JKGA 3D3OA 1IYPA 3IBJA 3UB8A 4QPRA 3KSIA 3E4QA 3H7WA 5HD3A 5G4ZA 1V9ZA 2WKEA 1W8YA 3VP1A 3UE3A 3PBTA 4QJGA 2J3TC 3FPVA 2ZM2A 4GS9A 2EXBA 4YOFA 3KO6A 3T4TA 1E3UD 3BFGA 4EQ1A 5EOEA 2B95A 3QNBA 1Z09A 5DTSA 2VV8A 5AQ9A 4E3KA 3PBQA 3VOYA 2QHKA 4G3WA 5EUAA 2V2FF 3V67A 4GZBA 3TOIA 5A8BA 3SOIA 1T1BA 5GLDA 2AVXA 1PI5A 4Y15A 3T4KA 1NLZA 2PDRA 4PM9A 3S7NA 1BULA 4DN0A 5EOOA 2B18A 3VP3A 1I2WA 4X69A 1ESIA 3RTYA 3C5AA 3Q7VB 1OTBA 2C5WB 3PBRA 3CPTB 1LI9A 1PWDA 3S7PA 3W4PA 4U3TA 1G5UA 3MKEA 4LV1A 1PI4A 4RVAA 4EERA 1ONHA 1K6SA 1W8QA 4E3IA 4R4SA 1KE4A 2WK0A 3UPPA 3IS2B 4JF4A 3LR4A 1D7EA 3UNWA 3OPRA 5CTNA 4JGOA 5HWVA 2I72A 4PKYA 4R6LA 2HZ5A 5M1AA 1H0MA 5FI6A 1T18A 4GD8A 3F1NB 3OCNA 2DMWA 3UY6A 2XA7M 1DJAA 3W2ZA 1LHYA 2H0TA 5F5YA 4ZBEA 3G4PA 3DBAA 2YKFA 2VV6A 3ZHHA 1N4OA 3DTMA 2W3DA 3PHYA 4R3AA 1I5QA 5EECA 5TJJA 1GCEA 3D72A 3HJIA 2ZQ7A 2W3HA 1L3LA 1YAXA 1Y4OA 3KSHA 2EX6A 2ZC3B 3FPWA 4NEED 1P97A 4Y0UA 1MKIA 3MMHA 4KENB 3ZCZA 2W3EA 1JWZA 2VGLS 2I9VA 3BJNA 4C75A 2EWWA 5EE8A 2Y2IA 1DJBA 3DTKA 2G7UA 2OOLA 3LR5A 4YWZA 4CQHA 1ES2A 4Q8IA 5IU1A 4HIAA 4G3VA 3ZGAB 2R78A 4XXRA 1IKIA 4GKUA 4WYYA 2PRFA 3UDIA 1E25A 4S2JA 4UQIS 5CGWA 1HVBA 1K57A 5A91A 3MQ0A 4KZ9A 2K7SA 3RJUA 5CECA 4BL2A 1PRQA 3HUNA 3ZYTA 2QYBA 1H8MA 4Q0JA 5FDSA 3NCKA 4KUOA 4OPQA 1EI5A 4GOGA 3OLOA 5F69A 2VKSA 3GRJA 1ACFA 4S2PA 5DF7A 5HL6A 3FV7A 4E6XA 1GSVA 4OOLA 5DVAA 4RX2A 1MPLA 1XX2A 4BQMA 2VGKA 4DE0A 5CHJA 1ZC2A 2IWCA 2PYRA 4FOFA 3ZG5A 2WGWB 4QD4A 3SH8A 3B33A 2Y2KA 1YLWA 3N8LA 3E4PA 4CLCC 2ZQ8A 1FR6A 2HDUA 3P7NA 4FD8A 2OSUA 3M2KA 2GDNA 1ZTUA 4O01A 3GTCA 1N9NA 4PKYG 4CJNA 1MWRA 1JWPA 1AWIA 3QP4A 2PHYA 4KZ7A 4LRYC 2EXAA 3P01A 4HQAA 2IA2A 3DWZA 5FEFA 5IHVA 5FAQA 2ZL1A 2V1ZA 5FQ9A 4F94A 1H8YA 3H9WA 1PWCA 3C4PA 3LCEA 2WGWA 4E3JA 1MWTA 3IX4A 5TR7A 4HJ3A 4CPKA 5HWWA 1PW8A 5I94A 3B3XA 2GZAA 4Z1WA 1W79A 4GDBA 2Y2LA 5DJTA 4EEPA 1MKMA 2E8JA 4P6BA 4ARZB 3ITAA 1P9RA 2PAVP 3UN7A 1NWZA 4OPZA 3NI9A 5EVIB 4EUZA 3T50A 3SZTA 2UWXA 2ACGA 2NUPC 1YM1A 1YKDA 3KSFA 3LYXA 4EWFA 1NJ4A 3SH7A 1FCOA 1W63Q 5FATA 1IKGA 3V39A 1XXMA 4NXGA 5M19A 2OAQ1 3L9KA 3EEHA 2HP5A 1O7EA 1CI8A 3A3IA 2W27A 3A0VA 3ZVTA 2P9VB 1TS7A 2ZD8A 4ARZA 1VB6A 2XFTA 1BSGA 3ZG0A 1IYQA 2IWDA 1DP9A 1CF0A 2JKTI 4S2IA 3BW6A 3D4FA 4S2MA 1LL5A 1KGFA 3DTEA 1TEMA 5HAQA 1C3BA 5L2FA 2XFSA 1NLYA 1MZUA 4EBPA 4Y5FA 3MZDA 1G68A 1FCMA 4BLMA 4DMZA 3CWFA 3PXPA 3QP6A 3TJZC 4ZAMA 4P0MA 1TS0A 4HEFA 1F5MA 1SKOA 3JYIA 2JHEA 4K0WA 4B4XA 3LICA 5CGSA 4R0QA 2BG1A 1VEUA 2JKRI 5DKLA 1GA9A 1UWNX 3ZG9B 2ZOHA 5F6AA 1CK3A 2HF6A 1LSWA 3HLWA 3FWLA 4B9OA 4GHIB 2ZJ9A 5FSRA 3ZFZA 3VV4A 4OQ0A 4Y17A 3ZNTA 2OV5A 5F82A 3FYZA 2JC7A 3NJAA 3T4OA 5F68A 2GX5A 1Y28A 1F2KA 1XA7A 3T1RA 2EA9A 4KQDA 5HDDA 1TF1A 2ZBBA 1ERQA 1VETB 2X71A 4KZAA 3OOVA 4BJPA 4R70A 4D60A 3C2WA 4R4RA 4H8RA 4R3BA 4IVIA 5HX9A 3KYZA 4ME4A 4DDYA 2JE5A 1T19A 3N6IA 5EFWA 1ES5A 4YNRA 4L9GA 3IF5A 2WUQA 2P08A 4DJ3A 4X6TA 3FKWA 5MC7A 2GNXA 5EM0A 5TGFA 4FH2A 4OVDA 4JGRA 1ONGA 3PBNA 4PHTA 5L8MA 5TFQA 3P09A 5HARA 2QZ6A 3SS5A 5HSQA 5JYPA 4JPMA 1VETA 3W4OA 5KMWA 5CRFA 4JGQA 4P87A 4WZ5C 5FQQA 1YLPA 2K31A 2VX8A 3MQOA 2OWJA 2XRNA 3OBFA 3T4SA 4LV3A 5F83A 4ZDXA 4JXSA 3G34A 3MXQA 4UA7A 1NRFA 2W3FA 3LO7A 3GQZA 1GHPA 5AQ7A 1EROA 2Y59A 2J9PA 3ICYA 2J7VA 5GLCA 3EQVA 3SS3A 4DE1A 4KQOA 2ZC4B 4A5RA 4JF6A 1D1JA 3A0SA 1YQSA 5CX7A 3LR3A 4P6ZS 4EESA 4E3LA 3LIDA 3BLSA 5HWTA 3NECA 4N1HA 1IYOA 4B4ZA 4NG2A 3WS0A 4QB8A 2Z6DA 4LGWA 5M18A 1RGZA 4F3LB 1YMXA 2DCFA 2ZQCA 4KQQA 3BM6A 3A0RA 3ZG7B 2Y2NA 3CMZA 2ZMAA 2RCXA 4GN2A 4MMNA 3G30A 1FSWA 3PR6A 4XUZA 1LL9A 1S1YA 2XSSA 3T4LA 3VE3A 1T1AA 1PW1A 2XH9A 3Q7ZA 4Y0TA 3NDEA 3IWIA 1XPBA 4ZJ3A 5GLAA 3ZVWA 5E2HA 3V3SA 1V9YA 4KUKA 3DTIA 3CI6A 3IWOA 4BBVA 4H6JA 1BUEA 4F3LA 1LT0A 2P7JA 1L0GA 2Y2JA 2ZMVA 2KDKA 1IOUA 3W8KA 5DF9A 4FCFA 2OLUA 3NBLA 1FR1A 1NYMA 3LY3A 1PZOA 2VGLM 1NY0A 4BBUA 2LB5A 5CTMA 3WS1A 4OOMA 3BLMA 3BFCA 5HDCA 4UQIM 4X56A 4QY5A 1EW0A 4EUVA 2L4RA 5FQIA 4O7DA 2V8CA 5HZHA 2JCHA 3O86A 1M6KA 1CEFA 4XT2B 4S2NA 1BZAA 2XDMA 1SHVA 1W5DA 4XUXA 3GV9A 3NY4A 3QP8A 3E98A 1NZOA 3IWQA 3UE0A 2HDQA 1S1ZA 2WKIA 1J3WA 4NK3A 4BENA 3RXXA 3CUEC 3PBSA 1DY6A 2JKTM 4CLCB 2P74A 4YFMA 3GDIA 4IBXA 3Q7VA 2Y55A 1H5XA 3CPTA 3MZFA 4ESPA 1PZPA 1LL8A 2J9OA 2HPBA 3UB9A 4XT2A 3QNCA 4MN5A 3C38A 1S4RA 2WAFA 4C6YA 4OP5A 3WS4A 3RFBA 1K54A 4OQGA 3IS2A 4Q0HA 3CG5A 4R38A 2MJ6A 2PR6A 1N9BA 5FI2A 3CJMA 5CHUA 1XJ3A 3F1NA 4CLCA 3ITBA 5E2GA 4L9FA 1JTDA 5A92A 2W0NA 3MBZA 3HBRA 2JN7A 1KVMA 4HBTA 3A3DA 3K2NA 2QWSA 5HFOA 3WS5A 4BD1A 4BMWA 4IEDA 2XK1A 5HPFA 4MLLA 2ZM8A 2WADA 3NOTC 4KG2A 3BEBA 1FQGA 4WBGA 3E2KA 4Q0IA 4S2KA 3AGFA 4MBHA 3NC8A 1M40A 4JKTA 2PR5A 4DXBA 2WGVA 4KQRA 4LRZE 3HVFA 2G2WA 1AXBA 3VP2A 4WELA 2WGIA 4E6WA 2Z2MB 4BWIA 3KYQA 2HP9A 3VFFA 4ETZA 2V20A 5F1GA 3IBRA 3LGOA 4OQHA 1CJFA 1LLBA 4HP4A 1VQQA 2ZLYA 4Y13A 1DP8A 2W3GA 1NYYA 4LCLA 5IT5A 4FUWA 5EVLA 2Z2LB 1P9WA
chains in the Genus database with same CATH topology
2ZC6B 4K0WA 3LY4A 3VP0A 5FASA 5EVID 4B4XA 2OLVA 4ZTKA 1FOFA 4GDNA 4KG6A 4S2OA 4DKIA 5CGSA 2BLSA 4R0QA 3IH9A 3HUOA 2EFUA 4E3OA 4DDSA 2BG1A 1BLHA 2Y2OA 3EQUA 3O88A 1CI9A 1JVJA 2PBYA 5CGXA 1GA9A 1K56A 3V5MA 5G18A 5HL1A 2XQZA 2ZQ9A 3ZG9B 1PIOA 3BECA 1CK3A 4N9LA 5A93A 1HTZA 5DTTA 4R3JA 1KE3A 1SDNA 3HLWA 3OPLA 2WAEA 3FWLA 1YLTA 2A49A 4GB7A 1ESUA 1G6AA 5CEBA 5BOHA 3ISGA 3OPPA 1IYSA 1WYCA 2RL3A 2ZJ9A 5FSRA 5E43A 3ZFZA 4GD6A 4E3MA 4OQ0A 1SCWA 1XGIA 3G35A 3N4IA 2OV5A 3ZNTA 4UA6A 5F82A 3FYZA 4HESA 4LV0A 2JC7A 4LCMA 5KZHA 5KSHA 4QHCA 3AGDA 1XA7A 4DRTA 4EQIA 1ERQA 4HBUA 3V50A 2X71A 1IYPA 4KZAA 4EBLA 4Y7PA 4BJPA 4JBFA 4X53A 1ZG4A 3VMAA 1VM1A 3TSGA 2Y2MA 3IXHA 4R4RA 3ZDJA 1JTGA 3G2YA 4H8RA 3A3FA 4R3BA 4WMCA 4IVIA 2XGNA 4M3KA 5HX9A 4DDYA 1MY8A 2JE5A 1YMSA 1GHMA 2WKEA 1W8YA 3N6IA 3VP1A 1ES5A 4X55A 3UE3A 3PBTA 4S2NC 2X01A 4QJGA 2E8IA 1XA1A 3IF5A 2WUQA 2ZM2A 4JXVA 4X6TA 1MXOA 2H5SA 4YINA 2DNSA 2EXBA 3BFEA 3PBOA 1E3UD 3RXWA 3FKWA 5EPHA 3BFGA 3WRTA 1ES3A 5EOEA 3MFDA 5TGFA 1ES4A 2ZQDA 4FH2A 4OVDA 3QNBA 1L0FA 4E3NA 5DTSA 1ONGA 3PBNA 5AQ9A 5TFQA 4E3KA 1EWZA 3P09A 3PBQA 5HARA 3VOYA 2QZ6A 5EUAA 3SS5A 2V2FF 5JYPA 4GZBA 1SKFA 3TOIA 4JPMA 3SOIA 5GLBA 3VOZA 3W4OA 1O07A 5EVIA 5FA7A 3IT9A 5GLDA 5KMWA 4OOYA 5CRFA 1PI5A 4P87A 2Z2LB 4WZ5C 5FQQA 1YLPA 4IBRA 4NETA 3A3EA 3PTEA 2H10A 1L0EA 4PM9A 1BULA 1BLCA 2Y91A 3OC2A 3E2LA 4LV3A 5EOOA 4BD0A 3VP3A 1I2WA 4X69A 5F83A 4EV4A 2Q9NA 1ESIA 4ZDXA 3C5AA 4UAAA 1YLZA 3Q7VB 4JXSA 5GHYA 2C5WB 3G34A 3PBRA 4UA7A 2PU4A 1Z6FA 1NRFA 1LI9A 3IXBA 1PWDA 3W4PA 3LO7A 3GQZA 1GHPA 2HDSA 5D3OA 1EROA 2Y59A 1TVFA 3OPHA 4U3TA 5AQ7A 4KZ5A 2J9PA 4L0LA 1IEMA 1K55A 1XKZA 2J7VA 3MKEA 1K54C 1RCJA 5GLCA 3EQVA 3SS3A 4LV1A 4KQOA 1KE0A 2ZC4B 4DE1A 1PI4A 4RVAA 4A5RA 4JF6A 2P9VA 4RX3A 3Q81A 1ONHA 1K6SA 3C7UA 3HLDA 1YQSA 1W8QA 4E3IA 4R4SA 1KE4A 1PWGA 1Q2PA 3GMWA 4RYEA 4BL3A 2WK0A 3NDGA 3WWXA 3C4OA 1MBLA 1K38A 1S0WA 4ZJ1A 3UPPA 4JF4A 3UNWA 4D2OA 3OPRA 3HREA 5CTNA 3TG9A 5KSCA 1ZKJA 4E3LA 4KZ6A 3BLSA 1NXYA 3NIAA 4PM8A 2I72A 5GHZA 1H8ZA 4N1HA 1IYOA 4S2LA 4B4ZA 5M1AA 2R9XA 5FI6A 5HAPA 4KZ3A 4GD8A 3WS0A 4OPYA 4MNRA 2WYXA 4QB8A 3OCNA 1NZUA 3UY6A 3IF6B 5M18A 4WZ5A 1RGZA 1KDSA 1DJAA 3UDXA 1LHYA 5AQBA 2H0TA 4ZBEA 3G4PA 1YMXA 2DCFA 2ZQCA 1JWVA 4KQQA 4WEKA 3BM6A 3ZG7B 1K57C 5FQJA 3ZHHA 1N4OA 3DTMA 4OPRA 3OCLA 1KVLA 3UDFA 2Y2NA 3CMZA 1E3UA 2ZMAA 2RCXA 2XF3A 4GN2A 5J8XA 3HLCA 3G30A 1I5QA 3IHAA 5EECA 1RGYA 4OQIA 1FSWA 1GCEA 4XUZA 1FSYA 1LL9A 5U47A 3M2JA 4C3QA 1FCNA 4K91A 2XD5A 1PW1A 2XH9A 4IVKA 4OLGA 3O3VA 3Q7ZA 2ZQ7A 4Y0TA 5GHXA 4P85A 2EX6A 3W4QA 2ZC3B 3NDEA 3IWIA 1XPBA 3G2ZA 4ZJ3A 2A3UA 3Q82A 5GLAA 3S1YA 3ZVWA 5E2HA 3V3SA 1RP5A 3GVBA 4ID4A 4Y0UA 1MKIA 4KENB 3ZCZA 3DWKA 1JWZA 3IWOA 4C75A 3HLGA 5EE8A 2Y2IA 1BUEA 1DJBA 1L0GA 5DTKA 3HLBA 4OONA 2Y2JA 1ES2A 3IXDA 1HD8A 4PPRA 4Q8IA 3AGEA 3HL9A 3WRZA 1MWUA 3ZGAB 4FH4A 2EX2A 3W8KA 2Y2PA 1IKIA 4GKUA 3P98A 4OKPA 3Q1FA 4WYYA 4XXRA 5DF9A 4FCFA 3UDIA 2OLUA 1E25A 2Y2QA 3BFDA 4S2JA 3NBLA 3BRMA 1FR1A 1HVBA 1NYMA 1DJCA 1K57A 3FZCA 3LY3A 1Q2QA 4JF5A 5CGWA 5A91A 1PZOA 1W7FA 4KZ9A 2VGJA 3M6HA 1NY0A 4U0TA 5FAPA 3VSKA 4N1XA 2FFFB 3RJUA 5HAIA 5CTMA 3WS1A 4BL2A 5CECA 4OLDA 4OOMA 3BLMA 4OP8A 3HUNA 2H0YA 3BFCA 3NCKA 4EBNA 3N8SA 4N9KA 4OPQA 5AQAA 1EI5A 4GOGA 4X56A 1HZOA 4QY5A 3MXSA 2IWBA 3IXGA 1YLYA 3GRJA 5E2EA 5FQIA 4O7DA 1K4FA 2B5RA 2Y4AA 4S2PA 5DF7A 4E6XA 3FV7A 4K0XA 3G31A 5GL9A 4OOLA 2JCHA 4N92A 5DVAA 1L0DA 3O86A 5FDHA 4RX2A 1MPLA 1XX2A 1ZG6A 4BQMA 1M6KA 2VGKA 1E4DA 5F1FA 1LI0A 4DE0A 5JYOA 4UA9A 5CHJA 1CEFA 2XD1A 1ZC2A 2IWCA 4S2NA 3M6BA 2ZC5B 1BZAA 4RA7A 2C6WB 2XDMA 5FQMA 1SHVA 3C7VA 3ZG5A 1BT5A 1W5DA 1WYBA 2WGWB 4QD4A 4XUXA 3GV9A 3NY4A 1OMEA 3SH8A 5HW3A 4U0XA 1TDLA 2Y2KA 1YLWA 1NZOA 1YT4A 2CC1A 3IWQA 2XLNA 3N8LA 2EX9A 3UE0A 2HDQA 1ALQA 1BLPA 2WKHA 2ZQ8A 3IF6C 4Y0OA 1FR6A 2WKIA 3WS2A 2DRWA 2HDUA 1KGGA 5E2FA 3Q07A 4FD8A 2OSUA 3M2KA 2GDNA 4WM9A 4NK3A 1XP4A 3RXXA 4BENA 3PBSA 1DY6A 4MEZA 2P74A 5FAOA 4YFMA 3GTCA 4IBXA 2QPNA 3GSGA 4KZ8A 3Q7VA 1J9MA 4ZJ2A 1ERMA 2EX8A 1MWRA 4CJNA 1JWPA 2Y55A 1H5XA 1I2SA 4KZ7A 3MZFA 2EXAA 3UPOA 3BFFA 1PZPA 4OH0A 2J9OA 2HPBA 3DWZA 2WZXA 3HLEA 3OZHA 5IHVA 4JXGA 2R9WA 5FAQA 2V1ZA 3QHYA 4KG5A 3QNCA 5FQ9A 3MZEA 4F94A 2WAFA 1H8YA 2PU2A 5CEDA 1PWCA 3HLFA 4C6YA 3PAEA 2Q9MA 3C4PA 4OP5A 3LCEA 2WGWA 3WS4A 3S4XA 4E3JA 1MWTA 1Y54A 1K54A 5TR7A 1GA0A 4OQGA 4CPKA 1PW8A 5CERA 4DXCA 4R23A 5I94A 3CG5A 3UO9A 3B3XA 3V3RA 4UHUA 1N9BA 5A90A 1W79A 3DW0A 1KDWA 2Y2LA 4GDBA 5FI2A 5FQKA 3UPNA 3CJMA 5FATA 5CHUA 5EVIC 3O87A 3MXRA 2G2UA 1KGEA 1MWSA 3GR2A 1K6RA 3IH8A 2Y2HA 4Z9QA 4P6BA 4PM5A 3CZDA 4LENA 3ITBA 1TDGA 3IF6A 3ITAA 5E2GA 1JTDA 2ZQAA 4JXWA 5A92A 4WZ4A 1GHIA 3IQAA 3UN7A 3MBZA 3HBRA 3I7JA 4OPZA 3NI9A 5EVIB 4EUZA 4PMAA 1KVMA 4HBTA 3A3DA 2X02A 1K56D 1K25A 2FFYA 2UWXA 4MBFA 1IELA 1YM1A 4FSFA 4EWFA 2J8YA 2HDRA 3G32A 5HFOA 3WS5A 5DF8A 1NJ4A 4BD1A 3SH7A 4B88A 1FCOA 1YLJA 2WZZA 3SS4A 4IEDA 2XK1A 3A3JA 3FKVA 3HUMA 2ZM8A 2WADA 4KZBA 1IKGA 1K55C 2ZC7A 4KG2A 4MLLA 3BEBA 4QU3A 3UE1A 2XR0A 3V39A 1XXMA 1U60A 1XGJA 1L2SA 5CXWA 5M19A 3VSLA 3MKFA 1FQGA 4WBGA 2ZM0A 3E2KA 3S22A 2HP5A 2XEPA 1O7EA 1CI8A 4S2KA 3A3IA 3AGFA 4MBHA 4LV2A 3NC8A 4DE2A 3N7WA 3ZNYA 2HP6A 3ZG8B 3ZVTA 2P9VB 1BTLA 2EFXA 2ZD8A 1M40A 4JKTA 4QY6A 4DXBA 2WGVA 4KQRA 4PM6A 3HVFA 2XFTA 2G2WA 1SDEA 1BSGA 3VP4A 4DF6A 4KZ4A 3ZG0A 1WE4A 1IYQA 1CEGA 2IWDA 1AXBA 3N8RA 3VP2A 4S2IA 4WELA 2WGIA 4GNUA 4E6WA 3SH9A 3D4FA 4PM7A 4WMCD 4S2MA 1LL5A 1BLSA 1PYYA 1S6RA 2Z2MB 1KGFA 2QMIA 3PAGA 1TEMA 4MBKA 5HAQA 1C3BA 3IHBA 1QMFA 5L2FA 2XFSA 3LEZA 4JLFA 4EBPA 2HP9A 3VFFA 2V20A 5F1GA 2JBFA 3VFHA 3MZDA 1G68A 1FCMA 4X68A 4BLMA 4OQHA 5CHMA 1LLBA 1VQQA 4WEJA 4ZAMA 5FI7A 2ZLYA 4DE3A 3BYDA 4P0MA 1NYYA 4LCLA 4HEFA 3JYIA 2Y2GA 4R1GA 5EVLA 1K4EA 1QMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZC6 B;  4K0W A;  3LY4 A;  3VP0 A;  5FAS A;  5EVI D;  4B4X A;  2OLV A;  4ZTK A;  1FOF A;  4GDN A;  4KG6 A;  4S2O A;  4DKI A;  5CGS A;  2BLS A;  4R0Q A;  3IH9 A;  3HUO A;  2EFU A;  4E3O A;  4DDS A;  2BG1 A;  1BLH A;  2Y2O A;  3EQU A;  3O88 A;  1CI9 A;  1JVJ A;  2PBY A;  5CGX A;  1GA9 A;  1K56 A;  3V5M A;  5G18 A;  5HL1 A;  2XQZ A;  2ZQ9 A;  3ZG9 B;  1PIO A;  3BEC A;  1CK3 A;  4N9L A;  5A93 A;  1HTZ A;  5DTT A;  4R3J A;  1KE3 A;  1SDN A;  3HLW A;  3OPL A;  2WAE A;  3FWL A;  1YLT A;  2A49 A;  4GB7 A;  1ESU A;  1G6A A;  5CEB A;  5BOH A;  3ISG A;  3OPP A;  1IYS A;  1WYC A;  2RL3 A;  2ZJ9 A;  5FSR A;  5E43 A;  3ZFZ A;  4GD6 A;  4E3M A;  4OQ0 A;  1SCW A;  1XGI A;  3G35 A;  3N4I A;  2OV5 A;  3ZNT A;  4UA6 A;  5F82 A;  3FYZ A;  4HES A;  4LV0 A;  2JC7 A;  4LCM A;  5KZH A;  5KSH A;  4QHC A;  3AGD A;  1XA7 A;  4DRT A;  4EQI A;  1ERQ A;  4HBU A;  3V50 A;  2X71 A;  1IYP A;  4KZA A;  4EBL A;  4Y7P A;  4BJP A;  4JBF A;  4X53 A;  1ZG4 A;  3VMA A;  1VM1 A;  3TSG A;  2Y2M A;  3IXH A;  4R4R A;  3ZDJ A;  1JTG A;  3G2Y A;  4H8R A;  3A3F A;  4R3B A;  4WMC A;  4IVI A;  2XGN A;  4M3K A;  5HX9 A;  4DDY A;  1MY8 A;  2JE5 A;  1YMS A;  1GHM A;  2WKE A;  1W8Y A;  3N6I A;  3VP1 A;  1ES5 A;  4X55 A;  3UE3 A;  3PBT A;  4S2N C;  2X01 A;  4QJG A;  2E8I A;  1XA1 A;  3IF5 A;  2WUQ A;  2ZM2 A;  4JXV A;  4X6T A;  1MXO A;  2H5S A;  4YIN A;  2DNS A;  2EXB A;  3BFE A;  3PBO A;  1E3U D;  3RXW A;  3FKW A;  5EPH A;  3BFG A;  3WRT A;  1ES3 A;  5EOE A;  3MFD A;  5TGF A;  1ES4 A;  2ZQD A;  4FH2 A;  4OVD A;  3QNB A;  1L0F A;  4E3N A;  5DTS A;  1ONG A;  3PBN A;  5AQ9 A;  5TFQ A;  4E3K A;  1EWZ A;  3P09 A;  3PBQ A;  5HAR A;  3VOY A;  2QZ6 A;  5EUA A;  3SS5 A;  2V2F F;  5JYP A;  4GZB A;  1SKF A;  3TOI A;  4JPM A;  3SOI A;  5GLB A;  3VOZ A;  3W4O A;  1O07 A;  5EVI A;  5FA7 A;  3IT9 A;  5GLD A;  5KMW A;  4OOY A;  5CRF A;  1PI5 A;  4P87 A;  2Z2L B;  4WZ5 C;  5FQQ A;  1YLP A;  4IBR A;  4NET A;  3A3E A;  3PTE A;  2H10 A;  1L0E A;  4PM9 A;  1BUL A;  1BLC A;  2Y91 A;  3OC2 A;  3E2L A;  4LV3 A;  5EOO A;  4BD0 A;  3VP3 A;  1I2W A;  4X69 A;  5F83 A;  4EV4 A;  2Q9N A;  1ESI A;  4ZDX A;  3C5A A;  4UAA A;  1YLZ A;  3Q7V B;  4JXS A;  5GHY A;  2C5W B;  3G34 A;  3PBR A;  4UA7 A;  2PU4 A;  1Z6F A;  1NRF A;  1LI9 A;  3IXB A;  1PWD A;  3W4P A;  3LO7 A;  3GQZ A;  1GHP A;  2HDS A;  5D3O A;  1ERO A;  2Y59 A;  1TVF A;  3OPH A;  4U3T A;  5AQ7 A;  4KZ5 A;  2J9P A;  4L0L A;  1IEM A;  1K55 A;  1XKZ A;  2J7V A;  3MKE A;  1K54 C;  1RCJ A;  5GLC A;  3EQV A;  3SS3 A;  4LV1 A;  4KQO A;  1KE0 A;  2ZC4 B;  4DE1 A;  1PI4 A;  4RVA A;  4A5R A;  4JF6 A;  2P9V A;  4RX3 A;  3Q81 A;  1ONH A;  1K6S A;  3C7U A;  3HLD A;  1YQS A;  1W8Q A;  4E3I A;  4R4S A;  1KE4 A;  1PWG A;  1Q2P A;  3GMW A;  4RYE A;  4BL3 A;  2WK0 A;  3NDG A;  3WWX A;  3C4O A;  1MBL A;  1K38 A;  1S0W A;  4ZJ1 A;  3UPP A;  4JF4 A;  3UNW A;  4D2O A;  3OPR A;  3HRE A;  5CTN A;  3TG9 A;  5KSC A;  1ZKJ A;  4E3L A;  4KZ6 A;  3BLS A;  1NXY A;  3NIA A;  4PM8 A;  2I72 A;  5GHZ A;  1H8Z A;  4N1H A;  1IYO A;  4S2L A;  4B4Z A;  5M1A A;  2R9X A;  5FI6 A;  5HAP A;  4KZ3 A;  4GD8 A;  3WS0 A;  4OPY A;  4MNR A;  2WYX A;  4QB8 A;  3OCN A;  1NZU A;  3UY6 A;  3IF6 B;  5M18 A;  4WZ5 A;  1RGZ A;  1KDS A;  1DJA A;  3UDX A;  1LHY A;  5AQB A;  2H0T A;  4ZBE A;  3G4P A;  1YMX A;  2DCF A;  2ZQC A;  1JWV A;  4KQQ A;  4WEK A;  3BM6 A;  3ZG7 B;  1K57 C;  5FQJ A;  3ZHH A;  1N4O A;  3DTM A;  4OPR A;  3OCL A;  1KVL A;  3UDF A;  2Y2N A;  3CMZ A;  1E3U A;  2ZMA A;  2RCX A;  2XF3 A;  4GN2 A;  5J8X A;  3HLC A;  3G30 A;  1I5Q A;  3IHA A;  5EEC A;  1RGY A;  4OQI A;  1FSW A;  1GCE A;  4XUZ A;  1FSY A;  1LL9 A;  5U47 A;  3M2J A;  4C3Q A;  1FCN A;  4K91 A;  2XD5 A;  1PW1 A;  2XH9 A;  4IVK A;  4OLG A;  3O3V A;  3Q7Z A;  2ZQ7 A;  4Y0T A;  5GHX A;  4P85 A;  2EX6 A;  3W4Q A;  2ZC3 B;  3NDE A;  3IWI A;  1XPB A;  3G2Z A;  4ZJ3 A;  2A3U A;  3Q82 A;  5GLA A;  3S1Y A;  3ZVW A;  5E2H A;  3V3S A;  1RP5 A;  3GVB A;  4ID4 A;  4Y0U A;  1MKI A;  4KEN B;  3ZCZ A;  3DWK A;  1JWZ A;  3IWO A;  4C75 A;  3HLG A;  5EE8 A;  2Y2I A;  1BUE A;  1DJB A;  1L0G A;  5DTK A;  3HLB A;  4OON A;  2Y2J A;  1ES2 A;  3IXD A;  1HD8 A;  4PPR A;  4Q8I A;  3AGE A;  3HL9 A;  3WRZ A;  1MWU A;  3ZGA B;  4FH4 A;  2EX2 A;  3W8K A;  2Y2P A;  1IKI A;  4GKU A;  3P98 A;  4OKP A;  3Q1F A;  4WYY A;  4XXR A;  5DF9 A;  4FCF A;  3UDI A;  2OLU A;  1E25 A;  2Y2Q A;  3BFD A;  4S2J A;  3NBL A;  3BRM A;  1FR1 A;  1HVB A;  1NYM A;  1DJC A;  1K57 A;  3FZC A;  3LY3 A;  1Q2Q A;  4JF5 A;  5CGW A;  5A91 A;  1PZO A;  1W7F A;  4KZ9 A;  2VGJ A;  3M6H A;  1NY0 A;  4U0T A;  5FAP A;  3VSK A;  4N1X A;  2FFF B;  3RJU A;  5HAI A;  5CTM A;  3WS1 A;  4BL2 A;  5CEC A;  4OLD A;  4OOM A;  3BLM A;  4OP8 A;  3HUN A;  2H0Y A;  3BFC A;  3NCK A;  4EBN A;  3N8S A;  4N9K A;  4OPQ A;  5AQA A;  1EI5 A;  4GOG A;  4X56 A;  1HZO A;  4QY5 A;  3MXS A;  2IWB A;  3IXG A;  1YLY A;  3GRJ A;  5E2E A;  5FQI A;  4O7D A;  1K4F A;  2B5R A;  2Y4A A;  4S2P A;  5DF7 A;  4E6X A;  3FV7 A;  4K0X A;  3G31 A;  5GL9 A;  4OOL A;  2JCH A;  4N92 A;  5DVA A;  1L0D A;  3O86 A;  5FDH A;  4RX2 A;  1MPL A;  1XX2 A;  1ZG6 A;  4BQM A;  1M6K A;  2VGK A;  1E4D A;  5F1F A;  1LI0 A;  4DE0 A;  5JYO A;  4UA9 A;  5CHJ A;  1CEF A;  2XD1 A;  1ZC2 A;  2IWC A;  4S2N A;  3M6B A;  2ZC5 B;  1BZA A;  4RA7 A;  2C6W B;  2XDM A;  5FQM A;  1SHV A;  3C7V A;  3ZG5 A;  1BT5 A;  1W5D A;  1WYB A;  2WGW B;  4QD4 A;  4XUX A;  3GV9 A;  3NY4 A;  1OME A;  3SH8 A;  5HW3 A;  4U0X A;  1TDL A;  2Y2K A;  1YLW A;  1NZO A;  1YT4 A;  2CC1 A;  3IWQ A;  2XLN A;  3N8L A;  2EX9 A;  3UE0 A;  2HDQ A;  1ALQ A;  1BLP A;  2WKH A;  2ZQ8 A;  3IF6 C;  4Y0O A;  1FR6 A;  2WKI A;  3WS2 A;  2DRW A;  2HDU A;  1KGG A;  5E2F A;  3Q07 A;  4FD8 A;  2OSU A;  3M2K A;  2GDN A;  4WM9 A;  4NK3 A;  1XP4 A;  3RXX A;  4BEN A;  3PBS A;  1DY6 A;  4MEZ A;  2P74 A;  5FAO A;  4YFM A;  3GTC A;  4IBX A;  2QPN A;  3GSG A;  4KZ8 A;  3Q7V A;  1J9M A;  4ZJ2 A;  1ERM A;  2EX8 A;  1MWR A;  4CJN A;  1JWP A;  2Y55 A;  1H5X A;  1I2S A;  4KZ7 A;  3MZF A;  2EXA A;  3UPO A;  3BFF A;  1PZP A;  4OH0 A;  2J9O A;  2HPB A;  3DWZ A;  2WZX A;  3HLE A;  3OZH A;  5IHV A;  4JXG A;  2R9W A;  5FAQ A;  2V1Z A;  3QHY A;  4KG5 A;  3QNC A;  5FQ9 A;  3MZE A;  4F94 A;  2WAF A;  1H8Y A;  2PU2 A;  5CED A;  1PWC A;  3HLF A;  4C6Y A;  3PAE A;  2Q9M A;  3C4P A;  4OP5 A;  3LCE A;  2WGW A;  3WS4 A;  3S4X A;  4E3J A;  1MWT A;  1Y54 A;  1K54 A;  5TR7 A;  1GA0 A;  4OQG A;  4CPK A;  1PW8 A;  5CER A;  4DXC A;  4R23 A;  5I94 A;  3CG5 A;  3UO9 A;  3B3X A;  3V3R A;  4UHU A;  1N9B A;  5A90 A;  1W79 A;  3DW0 A;  1KDW A;  2Y2L A;  4GDB A;  5FI2 A;  5FQK A;  3UPN A;  3CJM A;  5FAT A;  5CHU A;  5EVI C;  3O87 A;  3MXR A;  2G2U A;  1KGE A;  1MWS A;  3GR2 A;  1K6R A;  3IH8 A;  2Y2H A;  4Z9Q A;  4P6B A;  4PM5 A;  3CZD A;  4LEN A;  3ITB A;  1TDG A;  3IF6 A;  3ITA A;  5E2G A;  1JTD A;  2ZQA A;  4JXW A;  5A92 A;  4WZ4 A;  1GHI A;  3IQA A;  3UN7 A;  3MBZ A;  3HBR A;  3I7J A;  4OPZ A;  3NI9 A;  5EVI B;  4EUZ A;  4PMA A;  1KVM A;  4HBT A;  3A3D A;  2X02 A;  1K56 D;  1K25 A;  2FFY A;  2UWX A;  4MBF A;  1IEL A;  1YM1 A;  4FSF A;  4EWF A;  2J8Y A;  2HDR A;  3G32 A;  5HFO A;  3WS5 A;  5DF8 A;  1NJ4 A;  4BD1 A;  3SH7 A;  4B88 A;  1FCO A;  1YLJ A;  2WZZ A;  3SS4 A;  4IED A;  2XK1 A;  3A3J A;  3FKV A;  3HUM A;  2ZM8 A;  2WAD A;  4KZB A;  1IKG A;  1K55 C;  2ZC7 A;  4KG2 A;  4MLL A;  3BEB A;  4QU3 A;  3UE1 A;  2XR0 A;  3V39 A;  1XXM A;  1U60 A;  1XGJ A;  1L2S A;  5CXW A;  5M19 A;  3VSL A;  3MKF A;  1FQG A;  4WBG A;  2ZM0 A;  3E2K A;  3S22 A;  2HP5 A;  2XEP A;  1O7E A;  1CI8 A;  4S2K A;  3A3I A;  3AGF A;  4MBH A;  4LV2 A;  3NC8 A;  4DE2 A;  3N7W A;  3ZNY A;  2HP6 A;  3ZG8 B;  3ZVT A;  2P9V B;  1BTL A;  2EFX A;  2ZD8 A;  1M40 A;  4JKT A;  4QY6 A;  4DXB A;  2WGV A;  4KQR A;  4PM6 A;  3HVF A;  2XFT A;  2G2W A;  1SDE A;  1BSG A;  3VP4 A;  4DF6 A;  4KZ4 A;  3ZG0 A;  1WE4 A;  1IYQ A;  1CEG A;  2IWD A;  1AXB A;  3N8R A;  3VP2 A;  4S2I A;  4WEL A;  2WGI A;  4GNU A;  4E6W A;  3SH9 A;  3D4F A;  4PM7 A;  4WMC D;  4S2M A;  1LL5 A;  1BLS A;  1PYY A;  1S6R A;  2Z2M B;  1KGF A;  2QMI A;  3PAG A;  1TEM A;  4MBK A;  5HAQ A;  1C3B A;  3IHB A;  1QMF A;  5L2F A;  2XFS A;  3LEZ A;  4JLF A;  4EBP A;  2HP9 A;  3VFF A;  2V20 A;  5F1G A;  2JBF A;  3VFH A;  3MZD A;  1G68 A;  1FCM A;  4X68 A;  4BLM A;  4OQH A;  5CHM A;  1LLB A;  1VQQ A;  4WEJ A;  4ZAM A;  5FI7 A;  2ZLY A;  4DE3 A;  3BYD A;  4P0M A;  1NYY A;  4LCL A;  4HEF A;  3JYI A;  2Y2G A;  4R1G A;  5EVL A;  1K4E A;  1QME A; 
#chains in the Genus database with same CATH topology
 2ZC6 B;  3EEA A;  3K3C A;  3VP0 A;  2OLV A;  2CMN A;  1XFN A;  4ZTK A;  1FOF A;  3BY8 A;  4E3O A;  4DDS A;  3EQU A;  1BLH A;  2Y2O A;  3O88 A;  1CI9 A;  1K56 A;  4GCZ A;  5HL1 A;  1LSV A;  1PIO A;  3LI8 A;  5DTT A;  4R3J A;  1SDN A;  5IS1 A;  3CIT A;  2NUT C;  4WUJ A;  3TRC A;  3NUL A;  1G6A A;  3ISG A;  5E43 A;  3G35 A;  1OTA A;  2LB9 A;  4LV0 A;  2WKP A;  2V0U A;  4GJ4 A;  4IUK A;  4QHC A;  3FC7 A;  1OTD A;  3V50 A;  4EBL A;  3BY9 A;  4Y7P A;  2QJ7 A;  4JBF A;  4X53 A;  1ZG4 A;  3VMA A;  1VM1 A;  3TSG A;  3IXH A;  5L10 A;  2D02 A;  1JTG A;  3A3F A;  4MN6 A;  4M3K A;  3UB5 P;  1MY8 A;  4EEU A;  1GHM A;  4X55 A;  3HCY A;  4NXE A;  2X01 A;  2E8I A;  2BAS A;  4EU0 A;  4JXV A;  2UV0 E;  4YIN A;  2DNS A;  3PBO A;  5EPH A;  3WRT A;  4IJG A;  2ZQD A;  1SKF A;  1O07 A;  5EVI A;  5FA7 A;  4OOY A;  1GSW A;  3BQA A;  4IBR A;  3A3E A;  2H10 A;  2V1B A;  1BLC A;  2W1T B;  2Y91 A;  3E2L A;  3IX3 A;  2FH5 A;  2Q9N A;  2BTF P;  1YLZ A;  2PU4 A;  2OAP 1;  1Z6F A;  3JPU A;  3H82 B;  3LIF A;  2HDS A;  1TVF A;  4EET B;  3MJQ A;  4KZ5 A;  2VZW A;  1K55 A;  1RCJ A;  1KE0 A;  3MQQ A;  4WF0 A;  2P9V A;  4RX3 A;  3Q81 A;  3C7U A;  2M1C A;  4BL3 A;  4RYE A;  1T1C A;  3NDG A;  3WWX A;  3C4O A;  1K38 A;  4ZJ1 A;  4LPZ A;  1PFL A;  5KSC A;  4KZ6 A;  4PM8 A;  1NXY A;  1H8Z A;  2R9X A;  3MF0 A;  4HI4 A;  1GSX A;  4OPY A;  4MNR A;  3IF6 B;  4HP9 A;  4WZ5 A;  1KDS A;  1OPX A;  4FTX A;  2J80 A;  2PD7 A;  4P6Z M;  3H82 A;  3TE8 A;  5FQJ A;  3OCL A;  1KVL A;  5DFY A;  4MDZ A;  1DP6 A;  5J8X A;  4M4X A;  1LSX A;  1RGY A;  1FSY A;  1ODV A;  2O0Y A;  1FCN A;  4K91 A;  2XD5 A;  1OTE A;  3W4Q A;  5EV0 A;  1S4S A;  3Q82 A;  3QP2 A;  1S67 L;  1RP5 A;  3DWK A;  3IX8 A;  3DAV A;  4GHI A;  3GEC A;  4OON A;  3IXD A;  1HD8 A;  4PPR A;  3AGE A;  2YKH A;  2EX2 A;  3Q1F A;  4HHD A;  4UAA A;  3BRM A;  3FZC A;  3ZQ5 A;  1DJC A;  4JF5 A;  3CHW P;  4U0T A;  1W7F A;  5FAP A;  2VGJ A;  4JGP A;  3VSK A;  2VJW A;  2FFF B;  3N8S A;  4N9K A;  1F98 A;  5AQA A;  4K08 A;  3MXS A;  2IWB A;  5E2E A;  3LFV A;  1K4F A;  2B02 A;  2B5R A;  2Y4A A;  4K0X A;  4I5S A;  5GL9 A;  5FDH A;  1E4D A;  5F1F A;  1LI0 A;  5JYO A;  1XFQ A;  2XD1 A;  5FEG A;  3LR0 A;  3BWL A;  4U0X A;  2CC1 A;  2EX9 A;  1ALQ A;  1BLP A;  2WKH A;  3IF6 C;  4Y0O A;  2DRW A;  1SZV A;  1KGG A;  5E2F A;  3Q07 A;  4WM9 A;  1XP4 A;  4MEZ A;  2O9A A;  3TW8 A;  4KZ8 A;  2QPN A;  1N9O A;  3GSG A;  1J9M A;  2EX8 A;  3UPO A;  3BFF A;  4OH0 A;  3HLE A;  2R9W A;  3H7W B;  4HY8 A;  2PBD P;  4KG5 A;  3MZE A;  2PU2 A;  5CED A;  3HLF A;  4Y2F A;  1GA0 A;  4DXC A;  4R23 A;  4GS9 B;  4X25 A;  1KDW A;  5FQK A;  4CLC E;  2Z6C A;  3MXR A;  1MWS A;  3IH8 A;  1K6R A;  4Z9Q A;  2Y2H A;  3CZD A;  4LEN A;  4EW7 A;  2ZQA A;  1HLU P;  4WZ4 A;  3I7J A;  3ULF A;  3CUE A;  3EGX C;  2X02 A;  1K56 D;  2FFY A;  1IEL A;  2HDR A;  3G32 A;  2EWV A;  5DF8 A;  4B88 A;  1YLJ A;  4E04 A;  2WZZ A;  3SS4 A;  1BYW A;  3A3J A;  3HUM A;  5GLB A;  2XRO A;  3UE1 A;  2XR0 A;  1JNU A;  1U60 A;  2WKR A;  1L2S A;  1UGU A;  3MKF A;  2ZM0 A;  5HD5 A;  5L07 A;  3S22 A;  4LRX C;  1OJ5 A;  3C30 A;  2XEP A;  3VOL A;  2PT7 A;  4WLA A;  4LV2 A;  4DE2 A;  3N7W A;  2HP6 A;  4WL9 A;  3ZG8 B;  4PM6 A;  3UMD A;  1S66 L;  4KZ4 A;  3O5Y A;  1CEG A;  1XJ6 A;  3N8R A;  1S6R A;  2L0W A;  2QMI A;  3PAG A;  5DKK A;  3IHB A;  1QMF A;  2OWH A;  4JLF A;  5FL3 A;  5HPI A;  1TD5 A;  1ZHH B;  3UB7 A;  4HH2 A;  5HDS A;  5CHM A;  4DE3 A;  3MR0 A;  2Y2G A;  4R1G A;  3SW1 A;  1QME A;  3VP4 A;  3LY4 A;  5EVI D;  3L7H A;  4GDN A;  4O0P A;  4S2O A;  3IH9 A;  2VK3 A;  3R7W B;  3LI9 A;  2PYP A;  5CGX A;  3NOP C;  4N9L A;  2D01 A;  5A93 A;  4PAU A;  3T1S A;  1KE3 A;  3OPL A;  1YLT A;  4GB7 A;  1ESU A;  3D9Y A;  5CEB A;  5BOH A;  2INW A;  3MSH A;  1WYC A;  4GD6 A;  4E3M A;  1XGI A;  1FIK A;  3E0Y A;  2WKQ A;  4UA6 A;  2A24 B;  5KZH A;  4IHQ A;  3UB6 A;  2JKR M;  1X0O A;  4HBU A;  3KX0 X;  4HJ6 A;  4BBT A;  3R7W A;  2Y2M A;  3ZDJ A;  3G2Y A;  3UME A;  4WMC A;  2XGN A;  4Y3I A;  1YMS A;  2K2N A;  4S2N C;  1D06 A;  2Y79 A;  1XA1 A;  3C8C A;  1MXO A;  2H5S A;  3BFE A;  4MN7 A;  3RXW A;  1KOU A;  3T4Q A;  2A24 A;  4HH3 A;  1ES3 A;  3MFD A;  1ES4 A;  1L0F A;  4E3N A;  3MFX A;  1EWZ A;  1P0Z A;  1NRJ A;  2M7V A;  3VOZ A;  3EWK A;  1UWP X;  2H28 A;  3IT9 A;  3T1X A;  4NET A;  3PTE A;  1L0E A;  3B42 A;  3OC2 A;  5L09 A;  1CQA A;  4BD0 A;  4EV4 A;  5GHY A;  3E4O A;  3IXB A;  3R4K A;  4HOI A;  5D3O A;  3NHQ A;  3OPH A;  5AJG A;  4L0L A;  1IEM A;  2Q0O A;  1XKZ A;  4ZRR A;  1K54 C;  2ZL1 B;  5AVF A;  4I38 A;  3KYE A;  5EM1 A;  3LIB A;  1XJ4 A;  3HLD A;  1PWG A;  1Q2P A;  3GMW A;  2XA7 S;  1MBL A;  1S0W A;  1FIL A;  4D2O A;  3HRE A;  3TG9 A;  1ZKJ A;  5GHZ A;  3NIA A;  5AVE A;  4S2L A;  3QP1 A;  5HAP A;  4KZ3 A;  2HJ9 C;  2WYX A;  1NZU A;  2O9B A;  3T12 B;  5EVE A;  3UDX A;  5AQB A;  2HV1 A;  2PD8 A;  1JWV A;  4WEK A;  1K57 C;  3U2A A;  4OPR A;  2J3T D;  3UDF A;  1E3U A;  2XF3 A;  3HLC A;  3IHA A;  4OQI A;  3G6O A;  5U47 A;  3M2J A;  4L9E A;  4C3Q A;  4IVK A;  4OLG A;  3O3V A;  2V8F A;  5GHX A;  4P85 A;  3LEQ A;  3K3D A;  3G2Z A;  2A3U A;  1YSP A;  3S1Y A;  3GVB A;  2HJE A;  4ID4 A;  3HJK A;  3MS6 A;  4NKP A;  3HLG A;  5DTK A;  3HLB A;  1MC0 A;  1A0K A;  3HL9 A;  3WRZ A;  4DJ2 A;  1MWU A;  4FH4 A;  2Y2P A;  3S7O A;  3P98 A;  4OKP A;  4I39 A;  1STZ A;  2Y2Q A;  5DJU A;  3BFD A;  4UEY A;  1IFQ A;  1Q2Q A;  3M6H A;  1VHM A;  1PNE A;  4N1X A;  1G6O A;  4MCW A;  5HAI A;  4OLD A;  1N9L A;  4OP8 A;  2H0Y A;  1SKO B;  4QWO A;  4EBN A;  1YSQ A;  3B47 A;  3VE4 A;  4NXF A;  1HZO A;  4HNB A;  2FZ0 A;  5J3W A;  2VA0 A;  3IXG A;  1YLY A;  1H3Q A;  3G31 A;  4N92 A;  1L0D A;  2A2L A;  2M7U A;  1VEU B;  1ZG6 A;  2O9C A;  5J4E A;  4UA9 A;  2P04 A;  3M6B A;  2ZC5 B;  4RA7 A;  2C6W B;  3LUQ A;  5FQM A;  3C7V A;  4II7 A;  1BT5 A;  1WYB A;  1OME A;  1TS8 A;  2ZOI A;  2GJ3 A;  5HW3 A;  1TDL A;  1YT4 A;  2XLN A;  2V1A A;  3WS2 A;  2JKF A;  3F1P B;  2W1T A;  5FAO A;  4ZJ2 A;  1ERM A;  3RH8 B;  1OJG A;  1I2S A;  2Y8H A;  5KIZ A;  2WZX A;  3CAX A;  3OZH A;  4LFU A;  4JXG A;  4X1M A;  3PYP A;  3QHY A;  3LIA A;  1WA9 A;  3PAE A;  2Q9M A;  3S4X A;  4GLQ A;  1Y54 A;  3F1O B;  2V0W A;  5CER A;  3UO9 A;  3V3R A;  3JVV A;  4UHU A;  3T1Q B;  5A90 A;  3DW0 A;  3F1P A;  3UPN A;  5EVI C;  4EXO A;  3O87 A;  2G2U A;  2QJ5 A;  1KGE A;  3GR2 A;  4PM5 A;  1TDG A;  3IF6 A;  4JXW A;  2W1R A;  5C5K A;  1GHI A;  3IQA A;  4PMA A;  2V9A A;  3EGD C;  4LLO B;  1K25 A;  2QKP A;  4MBF A;  4WN5 A;  5I5L A;  4FSF A;  2J8Y A;  2KLI A;  1OT9 A;  2O99 A;  3EOI A;  4I3I A;  4NXB A;  4I3J A;  1TS6 A;  3FKV A;  2J3W A;  4KZB A;  2KOI A;  1K55 C;  2ZC7 A;  3NOU C;  4QU3 A;  4ETX A;  3U4L P;  5J7E A;  5K5B A;  3T4J A;  3F1O A;  1XGJ A;  4O8G A;  3JVU A;  5CXW A;  3VSL A;  2L1M A;  5DFX A;  3ZNY A;  2KX6 A;  4CLC D;  1BTL A;  2EFX A;  4QY6 A;  3UE6 A;  1OTI A;  1SDE A;  3LIE A;  4DF6 A;  1WE4 A;  2ZMF A;  5TBM B;  4GNU A;  1OT6 A;  3SH9 A;  4PM7 A;  4WMC D;  1BLS A;  4X1L A;  1PYY A;  1XJ2 A;  4MBK A;  4B93 A;  2HGV A;  3LEZ A;  2JBF A;  3VFH A;  4X68 A;  1DRM A;  3KSG A;  3FG8 A;  1K0K A;  4WEJ A;  5FI7 A;  4AFI A;  3BYD A;  4RQ9 A;  2VLG A;  1K4E A;  3S7Q A;  5FAS A;  5LBR A;  4KG6 A;  4DKI A;  2BLS A;  3HUO A;  2EFU A;  5TBM A;  4I3A A;  1JVJ A;  2PBY A;  2VEA A;  3V5M A;  5G18 A;  2XQZ A;  2ZQ9 A;  3BEC A;  3CLO A;  1HTZ A;  2WAE A;  2A49 A;  4H6J B;  3BQ8 A;  3OPP A;  1IYS A;  4HJ4 A;  1F9I A;  2RL3 A;  4GW9 A;  5G4Y A;  4IUH A;  1G28 A;  1SCW A;  3N4I A;  4G3K A;  4HES A;  1YPR A;  3QP5 A;  4LCM A;  2VV7 A;  5KSH A;  3AGD A;  1W63 M;  4DRT A;  4EQI A;  2JKG A;  3D3O A;  1IYP A;  3IBJ A;  3UB8 A;  4QPR A;  3KSI A;  3E4Q A;  3H7W A;  5HD3 A;  5G4Z A;  1V9Z A;  2WKE A;  1W8Y A;  3VP1 A;  3UE3 A;  3PBT A;  4QJG A;  2J3T C;  3FPV A;  2ZM2 A;  4GS9 A;  2EXB A;  4YOF A;  3KO6 A;  3T4T A;  1E3U D;  3BFG A;  4EQ1 A;  5EOE A;  2B95 A;  3QNB A;  1Z09 A;  5DTS A;  2VV8 A;  5AQ9 A;  4E3K A;  3PBQ A;  3VOY A;  2QHK A;  4G3W A;  5EUA A;  2V2F F;  3V67 A;  4GZB A;  3TOI A;  5A8B A;  3SOI A;  1T1B A;  5GLD A;  2AVX A;  1PI5 A;  4Y15 A;  3T4K A;  1NLZ A;  2PDR A;  4PM9 A;  3S7N A;  1BUL A;  4DN0 A;  5EOO A;  2B18 A;  3VP3 A;  1I2W A;  4X69 A;  1ESI A;  3RTY A;  3C5A A;  3Q7V B;  1OTB A;  2C5W B;  3PBR A;  3CPT B;  1LI9 A;  1PWD A;  3S7P A;  3W4P A;  4U3T A;  1G5U A;  3MKE A;  4LV1 A;  1PI4 A;  4RVA A;  4EER A;  1ONH A;  1K6S A;  1W8Q A;  4E3I A;  4R4S A;  1KE4 A;  2WK0 A;  3UPP A;  3IS2 B;  4JF4 A;  3LR4 A;  1D7E A;  3UNW A;  3OPR A;  5CTN A;  4JGO A;  5HWV A;  2I72 A;  4PKY A;  4R6L A;  2HZ5 A;  5M1A A;  1H0M A;  5FI6 A;  1T18 A;  4GD8 A;  3F1N B;  3OCN A;  2DMW A;  3UY6 A;  2XA7 M;  1DJA A;  3W2Z A;  1LHY A;  2H0T A;  5F5Y A;  4ZBE A;  3G4P A;  3DBA A;  2YKF A;  2VV6 A;  3ZHH A;  1N4O A;  3DTM A;  2W3D A;  3PHY A;  4R3A A;  1I5Q A;  5EEC A;  5TJJ A;  1GCE A;  3D72 A;  3HJI A;  2ZQ7 A;  2W3H A;  1L3L A;  1YAX A;  1Y4O A;  3KSH A;  2EX6 A;  2ZC3 B;  3FPW A;  4NEE D;  1P97 A;  4Y0U A;  1MKI A;  3MMH A;  4KEN B;  3ZCZ A;  2W3E A;  1JWZ A;  2VGL S;  2I9V A;  3BJN A;  4C75 A;  2EWW A;  5EE8 A;  2Y2I A;  1DJB A;  3DTK A;  2G7U A;  2OOL A;  3LR5 A;  4YWZ A;  4CQH A;  1ES2 A;  4Q8I A;  5IU1 A;  4HIA A;  4G3V A;  3ZGA B;  2R78 A;  4XXR A;  1IKI A;  4GKU A;  4WYY A;  2PRF A;  3UDI A;  1E25 A;  4S2J A;  4UQI S;  5CGW A;  1HVB A;  1K57 A;  5A91 A;  3MQ0 A;  4KZ9 A;  2K7S A;  3RJU A;  5CEC A;  4BL2 A;  1PRQ A;  3HUN A;  3ZYT A;  2QYB A;  1H8M A;  4Q0J A;  5FDS A;  3NCK A;  4KUO A;  4OPQ A;  1EI5 A;  4GOG A;  3OLO A;  5F69 A;  2VKS A;  3GRJ A;  1ACF A;  4S2P A;  5DF7 A;  5HL6 A;  3FV7 A;  4E6X A;  1GSV A;  4OOL A;  5DVA A;  4RX2 A;  1MPL A;  1XX2 A;  4BQM A;  2VGK A;  4DE0 A;  5CHJ A;  1ZC2 A;  2IWC A;  2PYR A;  4FOF A;  3ZG5 A;  2WGW B;  4QD4 A;  3SH8 A;  3B33 A;  2Y2K A;  1YLW A;  3N8L A;  3E4P A;  4CLC C;  2ZQ8 A;  1FR6 A;  2HDU A;  3P7N A;  4FD8 A;  2OSU A;  3M2K A;  2GDN A;  1ZTU A;  4O01 A;  3GTC A;  1N9N A;  4PKY G;  4CJN A;  1MWR A;  1JWP A;  1AWI A;  3QP4 A;  2PHY A;  4KZ7 A;  4LRY C;  2EXA A;  3P01 A;  4HQA A;  2IA2 A;  3DWZ A;  5FEF A;  5IHV A;  5FAQ A;  2ZL1 A;  2V1Z A;  5FQ9 A;  4F94 A;  1H8Y A;  3H9W A;  1PWC A;  3C4P A;  3LCE A;  2WGW A;  4E3J A;  1MWT A;  3IX4 A;  5TR7 A;  4HJ3 A;  4CPK A;  5HWW A;  1PW8 A;  5I94 A;  3B3X A;  2GZA A;  4Z1W A;  1W79 A;  4GDB A;  2Y2L A;  5DJT A;  4EEP A;  1MKM A;  2E8J A;  4P6B A;  4ARZ B;  3ITA A;  1P9R A;  2PAV P;  3UN7 A;  1NWZ A;  4OPZ A;  3NI9 A;  5EVI B;  4EUZ A;  3T50 A;  3SZT A;  2UWX A;  2ACG A;  2NUP C;  1YM1 A;  1YKD A;  3KSF A;  3LYX A;  4EWF A;  1NJ4 A;  3SH7 A;  1FCO A;  1W63 Q;  5FAT A;  1IKG A;  3V39 A;  1XXM A;  4NXG A;  5M19 A;  2OAQ 1;  3L9K A;  3EEH A;  2HP5 A;  1O7E A;  1CI8 A;  3A3I A;  2W27 A;  3A0V A;  3ZVT A;  2P9V B;  1TS7 A;  2ZD8 A;  4ARZ A;  1VB6 A;  2XFT A;  1BSG A;  3ZG0 A;  1IYQ A;  2IWD A;  1DP9 A;  1CF0 A;  2JKT I;  4S2I A;  3BW6 A;  3D4F A;  4S2M A;  1LL5 A;  1KGF A;  3DTE A;  1TEM A;  5HAQ A;  1C3B A;  5L2F A;  2XFS A;  1NLY A;  1MZU A;  4EBP A;  4Y5F A;  3MZD A;  1G68 A;  1FCM A;  4BLM A;  4DMZ A;  3CWF A;  3PXP A;  3QP6 A;  3TJZ C;  4ZAM A;  4P0M A;  1TS0 A;  4HEF A;  1F5M A;  1SKO A;  3JYI A;  2JHE A;  4K0W A;  4B4X A;  3LIC A;  5CGS A;  4R0Q A;  2BG1 A;  1VEU A;  2JKR I;  5DKL A;  1GA9 A;  1UWN X;  3ZG9 B;  2ZOH A;  5F6A A;  1CK3 A;  2HF6 A;  1LSW A;  3HLW A;  3FWL A;  4B9O A;  4GHI B;  2ZJ9 A;  5FSR A;  3ZFZ A;  3VV4 A;  4OQ0 A;  4Y17 A;  3ZNT A;  2OV5 A;  5F82 A;  3FYZ A;  2JC7 A;  3NJA A;  3T4O A;  5F68 A;  2GX5 A;  1Y28 A;  1F2K A;  1XA7 A;  3T1R A;  2EA9 A;  4KQD A;  5HDD A;  1TF1 A;  2ZBB A;  1ERQ A;  1VET B;  2X71 A;  4KZA A;  3OOV A;  4BJP A;  4R70 A;  4D60 A;  3C2W A;  4R4R A;  4H8R A;  4R3B A;  4IVI A;  5HX9 A;  3KYZ A;  4ME4 A;  4DDY A;  2JE5 A;  1T19 A;  3N6I A;  5EFW A;  1ES5 A;  4YNR A;  4L9G A;  3IF5 A;  2WUQ A;  2P08 A;  4DJ3 A;  4X6T A;  3FKW A;  5MC7 A;  2GNX A;  5EM0 A;  5TGF A;  4FH2 A;  4OVD A;  4JGR A;  1ONG A;  3PBN A;  4PHT A;  5L8M A;  5TFQ A;  3P09 A;  5HAR A;  2QZ6 A;  3SS5 A;  5HSQ A;  5JYP A;  4JPM A;  1VET A;  3W4O A;  5KMW A;  5CRF A;  4JGQ A;  4P87 A;  4WZ5 C;  5FQQ A;  1YLP A;  2K31 A;  2VX8 A;  3MQO A;  2OWJ A;  2XRN A;  3OBF A;  3T4S A;  4LV3 A;  5F83 A;  4ZDX A;  4JXS A;  3G34 A;  3MXQ A;  4UA7 A;  1NRF A;  2W3F A;  3LO7 A;  3GQZ A;  1GHP A;  5AQ7 A;  1ERO A;  2Y59 A;  2J9P A;  3ICY A;  2J7V A;  5GLC A;  3EQV A;  3SS3 A;  4DE1 A;  4KQO A;  2ZC4 B;  4A5R A;  4JF6 A;  1D1J A;  3A0S A;  1YQS A;  5CX7 A;  3LR3 A;  4P6Z S;  4EES A;  4E3L A;  3LID A;  3BLS A;  5HWT A;  3NEC A;  4N1H A;  1IYO A;  4B4Z A;  4NG2 A;  3WS0 A;  4QB8 A;  2Z6D A;  4LGW A;  5M18 A;  1RGZ A;  4F3L B;  1YMX A;  2DCF A;  2ZQC A;  4KQQ A;  3BM6 A;  3A0R A;  3ZG7 B;  2Y2N A;  3CMZ A;  2ZMA A;  2RCX A;  4GN2 A;  4MMN A;  3G30 A;  1FSW A;  3PR6 A;  4XUZ A;  1LL9 A;  1S1Y A;  2XSS A;  3T4L A;  3VE3 A;  1T1A A;  1PW1 A;  2XH9 A;  3Q7Z A;  4Y0T A;  3NDE A;  3IWI A;  1XPB A;  4ZJ3 A;  5GLA A;  3ZVW A;  5E2H A;  3V3S A;  1V9Y A;  4KUK A;  3DTI A;  3CI6 A;  3IWO A;  4BBV A;  4H6J A;  1BUE A;  4F3L A;  1LT0 A;  2P7J A;  1L0G A;  2Y2J A;  2ZMV A;  2KDK A;  1IOU A;  3W8K A;  5DF9 A;  4FCF A;  2OLU A;  3NBL A;  1FR1 A;  1NYM A;  3LY3 A;  1PZO A;  2VGL M;  1NY0 A;  4BBU A;  2LB5 A;  5CTM A;  3WS1 A;  4OOM A;  3BLM A;  3BFC A;  5HDC A;  4UQI M;  4X56 A;  4QY5 A;  1EW0 A;  4EUV A;  2L4R A;  5FQI A;  4O7D A;  2V8C A;  5HZH A;  2JCH A;  3O86 A;  1M6K A;  1CEF A;  4XT2 B;  4S2N A;  1BZA A;  2XDM A;  1SHV A;  1W5D A;  4XUX A;  3GV9 A;  3NY4 A;  3QP8 A;  3E98 A;  1NZO A;  3IWQ A;  3UE0 A;  2HDQ A;  1S1Z A;  2WKI A;  1J3W A;  4NK3 A;  4BEN A;  3RXX A;  3CUE C;  3PBS A;  1DY6 A;  2JKT M;  4CLC B;  2P74 A;  4YFM A;  3GDI A;  4IBX A;  3Q7V A;  2Y55 A;  1H5X A;  3CPT A;  3MZF A;  4ESP A;  1PZP A;  1LL8 A;  2J9O A;  2HPB A;  3UB9 A;  4XT2 A;  3QNC A;  4MN5 A;  3C38 A;  1S4R A;  2WAF A;  4C6Y A;  4OP5 A;  3WS4 A;  3RFB A;  1K54 A;  4OQG A;  3IS2 A;  4Q0H A;  3CG5 A;  4R38 A;  2MJ6 A;  2PR6 A;  1N9B A;  5FI2 A;  3CJM A;  5CHU A;  1XJ3 A;  3F1N A;  4CLC A;  3ITB A;  5E2G A;  4L9F A;  1JTD A;  5A92 A;  2W0N A;  3MBZ A;  3HBR A;  2JN7 A;  1KVM A;  4HBT A;  3A3D A;  3K2N A;  2QWS A;  5HFO A;  3WS5 A;  4BD1 A;  4BMW A;  4IED A;  2XK1 A;  5HPF A;  4MLL A;  2ZM8 A;  2WAD A;  3NOT C;  4KG2 A;  3BEB A;  1FQG A;  4WBG A;  3E2K A;  4Q0I A;  4S2K A;  3AGF A;  4MBH A;  3NC8 A;  1M40 A;  4JKT A;  2PR5 A;  4DXB A;  2WGV A;  4KQR A;  4LRZ E;  3HVF A;  2G2W A;  1AXB A;  3VP2 A;  4WEL A;  2WGI A;  4E6W A;  2Z2M B;  4BWI A;  3KYQ A;  2HP9 A;  3VFF A;  4ETZ A;  2V20 A;  5F1G A;  3IBR A;  3LGO A;  4OQH A;  1CJF A;  1LLB A;  4HP4 A;  1VQQ A;  2ZLY A;  4Y13 A;  1DP8 A;  2W3G A;  1NYY A;  4LCL A;  5IT5 A;  4FUW A;  5EVL A;  2Z2L B;  1P9W A; 
#chains in the Genus database with same CATH homology
 2ZC6 B;  4K0W A;  3LY4 A;  3VP0 A;  5FAS A;  5EVI D;  4B4X A;  2OLV A;  4ZTK A;  1FOF A;  4GDN A;  4KG6 A;  4S2O A;  4DKI A;  5CGS A;  2BLS A;  4R0Q A;  3IH9 A;  3HUO A;  2EFU A;  4E3O A;  4DDS A;  2BG1 A;  1BLH A;  2Y2O A;  3EQU A;  3O88 A;  1CI9 A;  1JVJ A;  2PBY A;  5CGX A;  1GA9 A;  1K56 A;  3V5M A;  5G18 A;  5HL1 A;  2XQZ A;  2ZQ9 A;  3ZG9 B;  1PIO A;  3BEC A;  1CK3 A;  4N9L A;  5A93 A;  1HTZ A;  5DTT A;  4R3J A;  1KE3 A;  1SDN A;  3HLW A;  3OPL A;  2WAE A;  3FWL A;  1YLT A;  2A49 A;  4GB7 A;  1ESU A;  1G6A A;  5CEB A;  5BOH A;  3ISG A;  3OPP A;  1IYS A;  1WYC A;  2RL3 A;  2ZJ9 A;  5FSR A;  5E43 A;  3ZFZ A;  4GD6 A;  4E3M A;  4OQ0 A;  1SCW A;  1XGI A;  3G35 A;  3N4I A;  2OV5 A;  3ZNT A;  4UA6 A;  5F82 A;  3FYZ A;  4HES A;  4LV0 A;  2JC7 A;  4LCM A;  5KZH A;  5KSH A;  4QHC A;  3AGD A;  1XA7 A;  4DRT A;  4EQI A;  1ERQ A;  4HBU A;  3V50 A;  2X71 A;  1IYP A;  4KZA A;  4EBL A;  4Y7P A;  4BJP A;  4JBF A;  4X53 A;  1ZG4 A;  3VMA A;  1VM1 A;  3TSG A;  2Y2M A;  3IXH A;  4R4R A;  3ZDJ A;  1JTG A;  3G2Y A;  4H8R A;  3A3F A;  4R3B A;  4WMC A;  4IVI A;  2XGN A;  4M3K A;  5HX9 A;  4DDY A;  1MY8 A;  2JE5 A;  1YMS A;  1GHM A;  2WKE A;  1W8Y A;  3N6I A;  3VP1 A;  1ES5 A;  4X55 A;  3UE3 A;  3PBT A;  4S2N C;  2X01 A;  4QJG A;  2E8I A;  1XA1 A;  3IF5 A;  2WUQ A;  2ZM2 A;  4JXV A;  4X6T A;  1MXO A;  2H5S A;  4YIN A;  2DNS A;  2EXB A;  3BFE A;  3PBO A;  1E3U D;  3RXW A;  3FKW A;  5EPH A;  3BFG A;  3WRT A;  1ES3 A;  5EOE A;  3MFD A;  5TGF A;  1ES4 A;  2ZQD A;  4FH2 A;  4OVD A;  3QNB A;  1L0F A;  4E3N A;  5DTS A;  1ONG A;  3PBN A;  5AQ9 A;  5TFQ A;  4E3K A;  1EWZ A;  3P09 A;  3PBQ A;  5HAR A;  3VOY A;  2QZ6 A;  5EUA A;  3SS5 A;  2V2F F;  5JYP A;  4GZB A;  1SKF A;  3TOI A;  4JPM A;  3SOI A;  5GLB A;  3VOZ A;  3W4O A;  1O07 A;  5EVI A;  5FA7 A;  3IT9 A;  5GLD A;  5KMW A;  4OOY A;  5CRF A;  1PI5 A;  4P87 A;  2Z2L B;  4WZ5 C;  5FQQ A;  1YLP A;  4IBR A;  4NET A;  3A3E A;  3PTE A;  2H10 A;  1L0E A;  4PM9 A;  1BUL A;  1BLC A;  2Y91 A;  3OC2 A;  3E2L A;  4LV3 A;  5EOO A;  4BD0 A;  3VP3 A;  1I2W A;  4X69 A;  5F83 A;  4EV4 A;  2Q9N A;  1ESI A;  4ZDX A;  3C5A A;  4UAA A;  1YLZ A;  3Q7V B;  4JXS A;  5GHY A;  2C5W B;  3G34 A;  3PBR A;  4UA7 A;  2PU4 A;  1Z6F A;  1NRF A;  1LI9 A;  3IXB A;  1PWD A;  3W4P A;  3LO7 A;  3GQZ A;  1GHP A;  2HDS A;  5D3O A;  1ERO A;  2Y59 A;  1TVF A;  3OPH A;  4U3T A;  5AQ7 A;  4KZ5 A;  2J9P A;  4L0L A;  1IEM A;  1K55 A;  1XKZ A;  2J7V A;  3MKE A;  1K54 C;  1RCJ A;  5GLC A;  3EQV A;  3SS3 A;  4LV1 A;  4KQO A;  1KE0 A;  2ZC4 B;  4DE1 A;  1PI4 A;  4RVA A;  4A5R A;  4JF6 A;  2P9V A;  4RX3 A;  3Q81 A;  1ONH A;  1K6S A;  3C7U A;  3HLD A;  1YQS A;  1W8Q A;  4E3I A;  4R4S A;  1KE4 A;  1PWG A;  1Q2P A;  3GMW A;  4RYE A;  4BL3 A;  2WK0 A;  3NDG A;  3WWX A;  3C4O A;  1MBL A;  1K38 A;  1S0W A;  4ZJ1 A;  3UPP A;  4JF4 A;  3UNW A;  4D2O A;  3OPR A;  3HRE A;  5CTN A;  3TG9 A;  5KSC A;  1ZKJ A;  4E3L A;  4KZ6 A;  3BLS A;  1NXY A;  3NIA A;  4PM8 A;  2I72 A;  5GHZ A;  1H8Z A;  4N1H A;  1IYO A;  4S2L A;  4B4Z A;  5M1A A;  2R9X A;  5FI6 A;  5HAP A;  4KZ3 A;  4GD8 A;  3WS0 A;  4OPY A;  4MNR A;  2WYX A;  4QB8 A;  3OCN A;  1NZU A;  3UY6 A;  3IF6 B;  5M18 A;  4WZ5 A;  1RGZ A;  1KDS A;  1DJA A;  3UDX A;  1LHY A;  5AQB A;  2H0T A;  4ZBE A;  3G4P A;  1YMX A;  2DCF A;  2ZQC A;  1JWV A;  4KQQ A;  4WEK A;  3BM6 A;  3ZG7 B;  1K57 C;  5FQJ A;  3ZHH A;  1N4O A;  3DTM A;  4OPR A;  3OCL A;  1KVL A;  3UDF A;  2Y2N A;  3CMZ A;  1E3U A;  2ZMA A;  2RCX A;  2XF3 A;  4GN2 A;  5J8X A;  3HLC A;  3G30 A;  1I5Q A;  3IHA A;  5EEC A;  1RGY A;  4OQI A;  1FSW A;  1GCE A;  4XUZ A;  1FSY A;  1LL9 A;  5U47 A;  3M2J A;  4C3Q A;  1FCN A;  4K91 A;  2XD5 A;  1PW1 A;  2XH9 A;  4IVK A;  4OLG A;  3O3V A;  3Q7Z A;  2ZQ7 A;  4Y0T A;  5GHX A;  4P85 A;  2EX6 A;  3W4Q A;  2ZC3 B;  3NDE A;  3IWI A;  1XPB A;  3G2Z A;  4ZJ3 A;  2A3U A;  3Q82 A;  5GLA A;  3S1Y A;  3ZVW A;  5E2H A;  3V3S A;  1RP5 A;  3GVB A;  4ID4 A;  4Y0U A;  1MKI A;  4KEN B;  3ZCZ A;  3DWK A;  1JWZ A;  3IWO A;  4C75 A;  3HLG A;  5EE8 A;  2Y2I A;  1BUE A;  1DJB A;  1L0G A;  5DTK A;  3HLB A;  4OON A;  2Y2J A;  1ES2 A;  3IXD A;  1HD8 A;  4PPR A;  4Q8I A;  3AGE A;  3HL9 A;  3WRZ A;  1MWU A;  3ZGA B;  4FH4 A;  2EX2 A;  3W8K A;  2Y2P A;  1IKI A;  4GKU A;  3P98 A;  4OKP A;  3Q1F A;  4WYY A;  4XXR A;  5DF9 A;  4FCF A;  3UDI A;  2OLU A;  1E25 A;  2Y2Q A;  3BFD A;  4S2J A;  3NBL A;  3BRM A;  1FR1 A;  1HVB A;  1NYM A;  1DJC A;  1K57 A;  3FZC A;  3LY3 A;  1Q2Q A;  4JF5 A;  5CGW A;  5A91 A;  1PZO A;  1W7F A;  4KZ9 A;  2VGJ A;  3M6H A;  1NY0 A;  4U0T A;  5FAP A;  3VSK A;  4N1X A;  2FFF B;  3RJU A;  5HAI A;  5CTM A;  3WS1 A;  4BL2 A;  5CEC A;  4OLD A;  4OOM A;  3BLM A;  4OP8 A;  3HUN A;  2H0Y A;  3BFC A;  3NCK A;  4EBN A;  3N8S A;  4N9K A;  4OPQ A;  5AQA A;  1EI5 A;  4GOG A;  4X56 A;  1HZO A;  4QY5 A;  3MXS A;  2IWB A;  3IXG A;  1YLY A;  3GRJ A;  5E2E A;  5FQI A;  4O7D A;  1K4F A;  2B5R A;  2Y4A A;  4S2P A;  5DF7 A;  4E6X A;  3FV7 A;  4K0X A;  3G31 A;  5GL9 A;  4OOL A;  2JCH A;  4N92 A;  5DVA A;  1L0D A;  3O86 A;  5FDH A;  4RX2 A;  1MPL A;  1XX2 A;  1ZG6 A;  4BQM A;  1M6K A;  2VGK A;  1E4D A;  5F1F A;  1LI0 A;  4DE0 A;  5JYO A;  4UA9 A;  5CHJ A;  1CEF A;  2XD1 A;  1ZC2 A;  2IWC A;  4S2N A;  3M6B A;  2ZC5 B;  1BZA A;  4RA7 A;  2C6W B;  2XDM A;  5FQM A;  1SHV A;  3C7V A;  3ZG5 A;  1BT5 A;  1W5D A;  1WYB A;  2WGW B;  4QD4 A;  4XUX A;  3GV9 A;  3NY4 A;  1OME A;  3SH8 A;  5HW3 A;  4U0X A;  1TDL A;  2Y2K A;  1YLW A;  1NZO A;  1YT4 A;  2CC1 A;  3IWQ A;  2XLN A;  3N8L A;  2EX9 A;  3UE0 A;  2HDQ A;  1ALQ A;  1BLP A;  2WKH A;  2ZQ8 A;  3IF6 C;  4Y0O A;  1FR6 A;  2WKI A;  3WS2 A;  2DRW A;  2HDU A;  1KGG A;  5E2F A;  3Q07 A;  4FD8 A;  2OSU A;  3M2K A;  2GDN A;  4WM9 A;  4NK3 A;  1XP4 A;  3RXX A;  4BEN A;  3PBS A;  1DY6 A;  4MEZ A;  2P74 A;  5FAO A;  4YFM A;  3GTC A;  4IBX A;  2QPN A;  3GSG A;  4KZ8 A;  3Q7V A;  1J9M A;  4ZJ2 A;  1ERM A;  2EX8 A;  1MWR A;  4CJN A;  1JWP A;  2Y55 A;  1H5X A;  1I2S A;  4KZ7 A;  3MZF A;  2EXA A;  3UPO A;  3BFF A;  1PZP A;  4OH0 A;  2J9O A;  2HPB A;  3DWZ A;  2WZX A;  3HLE A;  3OZH A;  5IHV A;  4JXG A;  2R9W A;  5FAQ A;  2V1Z A;  3QHY A;  4KG5 A;  3QNC A;  5FQ9 A;  3MZE A;  4F94 A;  2WAF A;  1H8Y A;  2PU2 A;  5CED A;  1PWC A;  3HLF A;  4C6Y A;  3PAE A;  2Q9M A;  3C4P A;  4OP5 A;  3LCE A;  2WGW A;  3WS4 A;  3S4X A;  4E3J A;  1MWT A;  1Y54 A;  1K54 A;  5TR7 A;  1GA0 A;  4OQG A;  4CPK A;  1PW8 A;  5CER A;  4DXC A;  4R23 A;  5I94 A;  3CG5 A;  3UO9 A;  3B3X A;  3V3R A;  4UHU A;  1N9B A;  5A90 A;  1W79 A;  3DW0 A;  1KDW A;  2Y2L A;  4GDB A;  5FI2 A;  5FQK A;  3UPN A;  3CJM A;  5FAT A;  5CHU A;  5EVI C;  3O87 A;  3MXR A;  2G2U A;  1KGE A;  1MWS A;  3GR2 A;  1K6R A;  3IH8 A;  2Y2H A;  4Z9Q A;  4P6B A;  4PM5 A;  3CZD A;  4LEN A;  3ITB A;  1TDG A;  3IF6 A;  3ITA A;  5E2G A;  1JTD A;  2ZQA A;  4JXW A;  5A92 A;  4WZ4 A;  1GHI A;  3IQA A;  3UN7 A;  3MBZ A;  3HBR A;  3I7J A;  4OPZ A;  3NI9 A;  5EVI B;  4EUZ A;  4PMA A;  1KVM A;  4HBT A;  3A3D A;  2X02 A;  1K56 D;  1K25 A;  2FFY A;  2UWX A;  4MBF A;  1IEL A;  1YM1 A;  4FSF A;  4EWF A;  2J8Y A;  2HDR A;  3G32 A;  5HFO A;  3WS5 A;  5DF8 A;  1NJ4 A;  4BD1 A;  3SH7 A;  4B88 A;  1FCO A;  1YLJ A;  2WZZ A;  3SS4 A;  4IED A;  2XK1 A;  3A3J A;  3FKV A;  3HUM A;  2ZM8 A;  2WAD A;  4KZB A;  1IKG A;  1K55 C;  2ZC7 A;  4KG2 A;  4MLL A;  3BEB A;  4QU3 A;  3UE1 A;  2XR0 A;  3V39 A;  1XXM A;  1U60 A;  1XGJ A;  1L2S A;  5CXW A;  5M19 A;  3VSL A;  3MKF A;  1FQG A;  4WBG A;  2ZM0 A;  3E2K A;  3S22 A;  2HP5 A;  2XEP A;  1O7E A;  1CI8 A;  4S2K A;  3A3I A;  3AGF A;  4MBH A;  4LV2 A;  3NC8 A;  4DE2 A;  3N7W A;  3ZNY A;  2HP6 A;  3ZG8 B;  3ZVT A;  2P9V B;  1BTL A;  2EFX A;  2ZD8 A;  1M40 A;  4JKT A;  4QY6 A;  4DXB A;  2WGV A;  4KQR A;  4PM6 A;  3HVF A;  2XFT A;  2G2W A;  1SDE A;  1BSG A;  3VP4 A;  4DF6 A;  4KZ4 A;  3ZG0 A;  1WE4 A;  1IYQ A;  1CEG A;  2IWD A;  1AXB A;  3N8R A;  3VP2 A;  4S2I A;  4WEL A;  2WGI A;  4GNU A;  4E6W A;  3SH9 A;  3D4F A;  4PM7 A;  4WMC D;  4S2M A;  1LL5 A;  1BLS A;  1PYY A;  1S6R A;  2Z2M B;  1KGF A;  2QMI A;  3PAG A;  1TEM A;  4MBK A;  5HAQ A;  1C3B A;  3IHB A;  1QMF A;  5L2F A;  2XFS A;  3LEZ A;  4JLF A;  4EBP A;  2HP9 A;  3VFF A;  2V20 A;  5F1G A;  2JBF A;  3VFH A;  3MZD A;  1G68 A;  1FCM A;  4X68 A;  4BLM A;  4OQH A;  5CHM A;  1LLB A;  1VQQ A;  4WEJ A;  4ZAM A;  5FI7 A;  2ZLY A;  4DE3 A;  3BYD A;  4P0M A;  1NYY A;  4LCL A;  4HEF A;  3JYI A;  2Y2G A;  4R1G A;  5EVL A;  1K4E A;  1QME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...