3BFGA

Class a beta-lactamase sed-g238c complexed with meropenem
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
262
structure length
262
Chain Sequence
VQQVQKKLAALEKQSGGRLGVALINTADNSQVLYRADERFAMCSTSKVMTAAAVLKQSETHDGILQQKMTIKKADLTNWNPVTEKYVGNTMTLAELSAATLQYSDNTAMNKLLAHLGGPGNVTAFARSIGDTTFRLDRKEPELNTAIPGDERDTTSPLAMAKSLRKLTLGDALAGPQRAQLVDWLKGNTTGGQSIRAGLPAHWVVGDKTGACDYGTTNDIAVIWPEDRAPLVLVTYFTQPQQDAKWRKDVLAAAAKIVTEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title acyl-intermediate structures of the class A beta-lactamase SED-G238C
rcsb
source organism Citrobacter sedlakii
molecule tags Hydrolase
molecule keywords Class A beta-lactamase Sed1
total genus 96
structure length 262
sequence length 262
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2007-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3bfgA00
4S2OA 3BFDA 2G2WA 1NYMA 2VGKA 3IWQA 3MZEA 4B4XA 2QZ6A 2RL3A 1S6RA 2WK0A 1GA9A 1EROA 3NC8A 1ERQA 3ZNYA 4OPQA 4JXWA 3PBSA 3UE0A 5CHUA 4BL2A 3SOIA 3B3XA 3O86A 4OONA 3HUMA 2EX9A 4GB7A 4GD8A 1EI5A 3HLWA 3FKWA 2X02A 5CGWA 4DRTA 3P98A 2BLSA 1FCNA 1K54A 3IH8A 3G35A 2WZXA 3D4FA 4WZ4A 3G4PA 4E3JA 4OQ0A 5FSRA 2V2FF 2E8IA 2ZM8A 1DJCA 4Y0OA 4ZDXA 3VP4A 2EXAA 2XGNA 1SDNA 3A3IA 3N6IA 3WS5A 4E3OA 5FQJA 4Y0TA 1SCWA 4IBXA 3N8RA 3PBRA 1Z6FA 4EBPA 4EQIA 4DXCA 4Y0UA 4FD8A 4WMCD 4KZ3A 3UDXA 1NXYA 4ZJ2A 4R3BA 4X69A 1CEGA 3ISGA 2IWCA 3QNCA 4U3TA 2X01A 3ZFZA 1TDLA 1ONGA 4NETA 3IWIA 3Q7ZA 4JF5A 1MWTA 4M3KA 3VOZA 2ZQ9A 4QD4A 4KZ9A 4MBFA 1XP4A 4EWFA 4RYEA 3LY4A 5AQ9A 3UPOA 2Y2NA 1SHVA 1LLBA 3O87A 4UHUA 4ZBEA 1LHYA 1EWZA 2OV5A 2DNSA 2G2UA 5KZHA 1W79A 5GLAA 4MEZA 1JWPA 1NRFA 5KMWA 3S1YA 4OQIA 3WWXA 5EECA 4ZJ3A 3M2JA 1VM1A 3OPRA 4MNRA 4OOMA 2HDQA 1K56A 2Y2PA 1L0EA 3V5MA 1KE3A 1NZUA 4R0QA 5A91A 3V50A 1MY8A 4KZAA 5E2HA 2Y4AA 1YLTA 3E2LA 4B4ZA 2WKIA 1XX2A 1RCJA 4PM5A 1PZPA 4E6XA 4DE2A 2ZC6B 5I94A 1QMEA 1MPLA 2R9XA 1W8YA 5CHJA 1KE4A 1BLCA 2C6WB 1IYPA 1RGZA 2ZLYA 3IHBA 4PM7A 3ZVTA 2WYXA 3HLGA 3C4OA 2Y2JA 4CPKA 4DDSA 1AXBA 4E3MA 1E4DA 1CK3A 1G6AA 1MWSA 5CERA 5CGXA 2HDSA 4JXVA 1CI9A 3Q07A 2Y2KA 5GLBA 3IXGA 4E3NA 1KGFA 4GDBA 4L0LA 4OOLA 5EOOA 3V3SA 4KG5A 1S0WA 4XUXA 2HDRA 1JWVA 2VGJA 5E2GA 5F83A 4GD6A 2ZMAA 4PM9A 2RCXA 5EVID 5FAOA 1GHIA 4GN2A 3W4OA 5M1AA 4WELA 5EUAA 1H5XA 1XA1A 5DVAA 4UA9A 3BFCA 3WS0A 1YQSA 2Q9MA 3M2KA 2Y2GA 3WS2A 4EUZA 1IELA 1K4EA 3VP0A 2ZC5B 3IH9A 4WBGA 2JCHA 1BLPA 4OP5A 4WZ5A 1YM1A 4XXRA 2DRWA 1K6RA 1FQGA 3V3RA 5A92A 5FQIA 3G30A 3C7VA 1PI5A 3ITAA 5TR7A 4Y7PA 2H0TA 1XA7A 1WE4A 3UE3A 4Q8IA 1PWDA 4JXSA 3IXHA 5AQ7A 1FR6A 3G34A 5GLDA 3PAGA 5A93A 5HX9A 5DF9A 3Q7VA 4X55A 3GVBA 1XGIA 3NIAA 4LV2A 1IKGA 3EQVA 5IHVA 3GTCA 3MKFA 2Y2MA 1N9BA 2GDNA 2WGWB 3OZHA 1ESIA 2X71A 2ZQ8A 4KZ8A 5U47A 3IF6C 3UPPA 3SH8A 4GZBA 4C6YA 3UO9A 1YMXA 3TG9A 4KZ7A 3RJUA 5FA7A 5FQKA 4U0XA 1XKZA 1K55A 2P9VB 3G2YA 1ES5A 3IHAA 3N8LA 3OPHA 3LEZA 3VFHA 1FCOA 1K56D 3UE1A 4DE0A 1XXMA 4H8RA 4MBKA 3N4IA 4DE1A 4F94A 5TGFA 3HLCA 2PU2A 4P87A 3SH9A 4E3KA 4DKIA 2XF3A 4EV4A 3S22A 2EX6A 3NDGA 1BLSA 2EXBA 2XLNA 4ZTKA 1YLPA 2EX8A 4PM8A 1RP5A 3BECA 3Q82A 3V39A 2A3UA 1E3UD 4KZ4A 4KZBA 4OLDA 3FYZA 2HPBA 2Y91A 4S2NA 3UPNA 4N9KA 2IWDA 2A49A 1YT4A 2J7VA 2ZC4B 4K0WA 1OMEA 5M18A 5JYPA 5CHMA 4GDNA 3G31A 2ZD8A 4QY5A 4OVDA 4S2LA 1WYCA 4RX3A 5KSCA 4JLFA 5HL1A 1ZC2A 3HLEA 4C3QA 3FV7A 1HD8A 4P85A 5HAIA 1K57A 3PBQA 1DY6A 1W5DA 4BLMA 3UN7A 3SS3A 4D2OA 3MKEA 1E25A 4UA7A 4BD1A 3VSKA 5FAQA 4OQGA 3A3FA 4FH2A 2JE5A 4XUZA 4JPMA 3IF6B 3LY3A 4GOGA 4HBUA 3CMZA 3VMAA 1BTLA 2Y59A 1IKIA 4LV3A 1FSWA 2WADA 5EOEA 3VFFA 2Z2LB 3C7UA 2WZZA 4LENA 5M19A 2JBFA 2P9VA 3BFFA 2IWBA 1LI9A 3GQZA 3Q1FA 4KQQA 4Z9QA 2V20A 3PBTA 4EBNA 4X68A 3ITBA 2OLVA 3CG5A 2Z2MB 2V1ZA 3AGDA 3W8KA 3IWOA 3NBLA 1N4OA 1NY0A 5CTMA 4E3LA 3HVFA 4WEJA 3UDIA 1ERMA 3Q7VB 1SDEA 4PMAA 4RVAA 4HEFA 4KQOA 3ZHHA 4WYYA 4QU3A 3VP2A 2HP6A 2EX2A 1CI8A 3BRMA 4N1HA 4DDYA 3QHYA 1IYSA 1WYBA 5KSHA 3W4QA 3E2KA 5FATA 5HW3A 2WKHA 1LL9A 3BLSA 4LCMA 3WRTA 1PWGA 2Y2OA 3PBNA 1YLWA 1H8YA 3DWZA 3HUOA 5EVIB 1YLZA 3O3VA 2HP5A 3C5AA 4FSFA 2CC1A 3A3JA 1FR1A 1IEMA 3DW0A 3ZG9B 1ZG6A 4YINA 4BJPA 2C5WB 3MZDA 4JXGA 3MXSA 5F1GA 4PM6A 1GA0A 3AGEA 2XDMA 2I72A 5HAPA 3M6HA 5TFQA 1FSYA 2HDUA 1PIOA 3HUNA 5HARA 3W4PA 3BYDA 1Q2PA 4DF6A 3OPPA 5F82A 1K25A 4JKTA 1GHPA 3DTMA 4JBFA 2FFYA 1G68A 2R9WA 5CECA 3S4XA 4UAAA 3FWLA 1TDGA 3ZG5A 4LV1A 4KZ6A 4BD0A 4C75A 3BFGA 3EQUA 4S2KA 5JYOA 3HREA 5AQBA 4E3IA 4DE3A 2ZM2A 2PBYA 3UDFA 3ZG7B 2ZQ7A 5E2EA 2Y2IA 3ZVWA 1K6SA 2XD1A 2Y2QA 5FI2A 1JTDA 4DXBA 5CEBA 2ZQAA 5A90A 1GCEA 1JTGA 3IXDA 4N9LA 3AGFA 1HTZA 2WGVA 4S2IA 4IVIA 2XR0A 3BLMA 3OC2A 3ZDJA 3HLFA 3GMWA 3PTEA 3BEBA 4HESA 3ZG0A 1KGEA 1ES3A 1L0GA 3PAEA 4PPRA 1C3BA 1XPBA 4S2PA 3N7WA 1JVJA 3P09A 4KQRA 3SS4A 3WRZA 2Q9NA 4WM9A 2Y2HA 5CRFA 3GR2A 2XQZA 1JWZA 4LV0A 1GHMA 1ONHA 4BL3A 1KGGA 1Y54A 5CGSA 2B5RA 4LCLA 1K54C 4P0MA 4N92A 4K0XA 3IT9A 5GHXA 3RXWA 5FQMA 1O7EA 4R4SA 5DF8A 3ZGAB 3O88A 5DTSA 3LO7A 3TSGA 2WKEA 2XEPA 2WAEA 3UY6A 4FH4A 4K91A 4S2MA 5EVIA 5FDHA 3G2ZA 4FCFA 5CEDA 4GNUA 1ZKJA 3IQAA 4RX2A 1KVLA 4E6WA 5FI6A 3CJMA 3NDEA 5J8XA 1QMFA 4QB8A 4IVKA 5EE8A 1L2SA 4HBTA 4OPRA 3WS1A 1PI4A 2EFXA 3VP1A 4JF4A 5AQAA 4ZAMA 1BT5A 3MBZA 4OOYA 1BUEA 5CXWA 5GLCA 1LL5A 1ALQA 2JC7A 2XD5A 1PYYA 4OP8A 1BZAA 3CZDA 4OPYA 5HAQA 2WGIA 1W8QA 1Q2QA 4R4RA 4IEDA 1M40A 1SKFA 3DWKA 3GRJA 1HVBA 1PW1A 3HBRA 1VQQA 1I2SA 1MWUA 3QNBA 2PU4A 5CTNA 5FASA 1DJBA 1K4FA 1IYOA 5EVLA 3JYIA 1DJAA 2UWXA 3HL9A 3PBOA 3C4PA 3HLBA 1ES4A 2Y2LA 3NY4A 2DCFA 1CEFA 2ZC3B 1KE0A 4CJNA 1ESUA 1YMSA 4BENA 3A3EA 1BSGA 5FQ9A 4ZJ1A 3FKVA 4OLGA 1KDSA 1L0DA 2QPNA 4WMCA 1NZOA 4WEKA 1K55C 3BM6A 5EVIC 5HFOA 5E2FA 5DTTA 4OQHA 4OPZA 3IXBA 4R23A 1MWRA 3MXRA 4A5RA 1TVFA 2FFFB 4ID4A 4N1XA 3MFDA 1MKIA 4OKPA 1ES2A 1J9MA 1K57C 1NJ4A 2XK1A 3M6BA 2ZJ9A 2XFSA 3MZFA 1NYYA 3GV9A 2QMIA 3I7JA 1IYQA 2J9OA 1I2WA 2P74A 1E3UA 2H0YA 5BOHA 4X6TA 2OLUA 2BG1A 5F1FA 1W7FA 4GKUA 5FQQA 2ZC7A 5FI7A 1H8ZA 3OCLA 1RGYA 1I5QA 4S2JA 5EPHA 1BLHA 4JF6A 1FOFA 1BULA 5DTKA 3SS5A 1K38A 4B88A 2ZQDA 2ZM0A 3FZCA 4RA7A 4KG6A 4IBRA 3VSLA 3TOIA 1FCMA 3HLDA 3OPLA 3NCKA 4MBHA 2H5SA 4UA6A 4P6BA 1KVMA 2EFUA 5G18A 3VOYA 4U0TA 4OH0A 1MXOA 3SH7A 1O07A 4R3JA 1YLYA 4WZ5C 2ZQCA 1LI0A 2H10A 3LCEA 4BQMA 1TEMA 4MLLA 3UNWA 5GHYA 2J8YA 1KDWA 4YFMA 5D3OA 1ZG4A 1MBLA 4R1GA 3WS4A 2WUQA 2XFTA 2WGWA 4EBLA 5GL9A 3RXXA 1PW8A 2Y55A 1U60A 3VP3A 5E43A 1YLJA 3IF5A 3ZCZA 1XGJA 2OSUA 3G32A 3GSGA 3NI9A 4X56A 5GHZA 3ZNTA 3ZG8B 5L2FA 2HP9A 1PWCA 3BFEA 4KENB 3IF6A 3N8SA 4QY6A 4S2NC 2XH9A 3A3DA 5FAPA 3Q81A 4KG2A 4QJGA 2WAFA 1M6KA 4NK3A 4X53A 1L0FA 2J9PA 4O7DA 1PZOA 1HZOA 4QHCA 3OCNA 4KZ5A 5DF7A
chains in the Genus database with same CATH superfamily
2JKTM 1YAXA 1YKDA 4S2OA 3TE8A 3BFDA 2VGKA 1NYMA 2RL3A 2WK0A 5TBMA 1EROA 2ACGA 1P97A 3ZNYA 4OPQA 3PBSA 2W27A 5CHUA 3O86A 3PYPA 3EEAA 2K7SA 4GD8A 4DRTA 3KO6A 1K54A 4GS9A 4OQ0A 2K2NA 2E8IA 1S1ZA 2M7UA 3A3IA 5EM0A 4BBTA 2V8CA 2GX5A 1SCWA 4GCZA 2G7UA 3H82A 3OOVA 2J3TD 2JKGA 4GW9A 4BMWA 3QNCA 4U3TA 3ZFZA 2V9AA 4NETA 3Q7ZA 3VOZA 4QD4A 5AQ9A 2Y2NA 1SHVA 3MQOA 1LHYA 3CITA 1NRFA 3F1OB 4ZJ3A 4OOMA 2HV1A 2PBDP 3KSFA 1L0EA 4R0QA 4BWIA 1PZPA 4NEED 4E6XA 5I94A 2VV6A 4I3JA 2R9XA 2C6WB 1Y4OA 4CPKA 3U4LP 4DDSA 5FDSA 4HIAA 3Q07A 2Y2KA 3IXGA 1KGFA 4CLCC 4GDBA 4XUXA 2HDRA 1JWVA 2OWJA 5TJJA 4PM9A 1XJ4A 3UB7A 5EUAA 4X1LA 1H5XA 1XA1A 4UA9A 5DFXA 3M2KA 2Y2GA 4EUZA 2ZC5B 4WBGA 2JCHA 1BLPA 2DRWA 1DP6A 1DP9A 5TR7A 2H0TA 4RQ9A 1WE4A 1P9WA 2OOLA 4JXSA 1LT0A 5GLDA 5HX9A 1YPRA 5DF9A 3R4KA 1XGIA 2V0WA 5IHVA 2PT7A 2Y2MA 2X71A 2ZQ8A 2JKTI 3IF6C 3UPPA 4GZBA 4C6YA 3L9KA 4UQIM 4HJ4A 5FQKA 3RJUA 4Q0JA 1ES5A 3OPHA 1XJ2A 4DE0A 3N4IA 4UQIS 5TGFA 5AVFA 3T50A 3EEHA 4DKIA 3JPUA 2EX6A 2Q0OA 1RP5A 4KZ4A 4KZBA 2Y91A 4IUKA 3T4OA 2J7VA 2ZC4B 5HL1A 1WA9A 1ZC2A 3FV7A 1DY6A 3MKEA 1E25A 4HBUA 3VMAA 3D3OA 1IKIA 4LV3A 1FSWA 2WADA 3CAXA 3C7UA 4LENA 2O9AA 5EVEA 4MN6A 5M19A 2IWBA 1LI9A 3LIBA 1OJGA 4X68A 2OLVA 3B42A 2Y8HA 3CG5A 2PDRA 3BY8A 3NBLA 1N4OA 1N9OA 2PR6A 3UDIA 4RVAA 3ZHHA 4KQOA 4ETZA 4WYYA 4QU3A 1SZVA 2EX2A 1CI8A 5KSHA 5HW3A 1MC0A 1LL9A 4LCMA 4HHDA 1PWGA 2Y2OA 3HUOA 1YLZA 3LR4A 2HP5A 4BBUA 3A3JA 4H6JB 4LPZA 4YINA 2C5WB 5F1GA 4DJ2A 4WN5A 2YKHA 3M6HA 5TFQA 3BJNA 2HZ5A 1Q2PA 3OPPA 5F82A 1GHPA 2FFYA 1EW0A 3O5YA 4UAAA 1S66L 3FWLA 1TDGA 3ZG5A 4BD0A 4C75A 2HGVA 4LRZE 5AQBA 3ZG7B 5A90A 1GCEA 3C8CA 2OAQ1 1HTZA 4S2IA 1VETB 3QP4A 3IBRA 2XR0A 3OC2A 3BEBA 2BTFP 3MXQA 1ES3A 1TD5A 1C3BA 2KLIA 3WRZA 2Y2HA 3GR2A 1KGGA 4P0MA 3IT9A 5FQMA 1O7EA 3TW8A 2HJ9C 3BY9A 2W3EA 5DTSA 3LO7A 3TSGA 5F6AA 1PFLA 4ARZB 4MCWA 5K5BA 4S2MA 5FDHA 4FCFA 3TRCA 2L4RA 5HPIA 4RX2A 4E6WA 1L2SA 3WS1A 3CHWP 1BUEA 4OP8A 1BZAA 2QJ7A 2WGIA 1W8QA 4R4RA 1SKFA 3LFVA 4G3WA 3CWFA 3QNBA 2PU4A 5CTNA 1K4FA 1DJAA 4XT2A 3PBOA 1YSPA 3HLBA 1ES4A 4CJNA 4OLGA 1L0DA 1KOUA 1LSVA 3BM6A 3LR0A 1XFQA 2QKPA 4CLCD 5HFOA 5E2FA 3MXRA 1TVFA 3MFDA 2XFSA 3MZFA 2QMIA 2PYPA 5DKKA 5CX7A 5J7EA 4HOIA 3OCLA 1I5QA 1ACFA 5EPHA 5HWTA 1BULA 3SS5A 2QWSA 2YKFA 4RA7A 4B88A 3VSLA 1G5UA 3OPLA 2H5SA 4UA6A 4QPRA 3R7WA 2EFUA 3VOYA 4U0TA 1MXOA 3SH7A 5MC7A 4WZ5C 2ZQCA 3LCEA 5GHYA 3MSHA 2J8YA 4X25A 4YFMA 1S4RA 1MBLA 2XA7M 2JHEA 2WUQA 2Z6DA 2Y55A 1U60A 3VP3A 4NXBA 3IF5A 3ZCZA 2OSUA 3GSGA 4QY6A 4KENB 4S2NC 3LR5A 1PZOA 1DRMA 5DF7A 1W63M 3F1NA 2G2WA 4B4XA 2H28A 1TF1A 4K08A 4JXWA 2VLGA 4OONA 1UWPX 4GB7A 4JGQA 1EI5A 1SKOB 3OLOA 2X02A 2BLSA 3NOUC 3IH8A 4EU0A 5FSRA 2J3WA 4AFIA 1DJCA 4ZDXA 2EXAA 2XGNA 1SDNA 2WKQA 3DTEA 3N6IA 3WS5A 4Y0TA 3F1PB 2PAVP 4EQIA 4DXCA 4KUOA 4WMCD 1CQAA 4ZJ2A 4EEUA 2W3FA 4I38A 3ISGA 2IWCA 1ONGA 4JF5A 2ZBBA 3MQ0A 4MBFA 3QP6A 4EWFA 3ICYA 5GLAA 4MEZA 1L3LA 5KMWA 3WWXA 3OPRA 4MNRA 2Y2PA 3V5MA 1KE3A 1MY8A 1YLTA 2WKIA 4PM5A 3QP1A 4DE2A 1QMEA 1MPLA 4YWZA 3RH8B 1IYPA 1RGZA 2VGLM 3OBFA 3IHBA 5HD3A 3ZVTA 3MJQA 5DJUA 1E4DA 1G6AA 1MWSA 1F5MA 4L0LA 2I9VA 5E2GA 4GD6A 5FAOA 2W1RA 2DMWA 5M1AA 5DVAA 3BFCA 1YQSA 1OTDA 3WS2A 3S7NA 4HH2A 3A0SA 3VP0A 3IH9A 3KSHA 4OP5A 4XXRA 5A92A 5FQIA 1PI5A 3ITAA 2INWA 3QP8A 4Q8IA 5IS1A 4ME4A 1PWDA 3PAGA 5A93A 1VEUA 3B47A 5G4ZA 3F1OA 3NIAA 2ZOIA 1IKGA 3EQVA 5L09A 3QP5A 3GTCA 3OZHA 2WGWB 1ESIA 4KZ8A 2MJ6A 4H6JA 3SH8A 3CPTB 4KZ7A 5FA7A 3EGDC 3IHAA 1LL8A 1FCOA 4IUHA 4LRXC 4H8RA 4MBKA 5I5LA 1A0KA 2W3GA 3HLCA 3SH9A 1UGUA 4EV4A 3S22A 1BLSA 4ZTKA 1YLPA 4PM8A 3Q82A 3V39A 2A3UA 1OT6A 4B9OA 5KIZA 2WKRA 1OMEA 2R78A 2VA0A 4GDNA 3G31A 2ZD8A 4RX3A 4OVDA 5KSCA 3IX4A 2VGLS 2NUPC 1K57A 2OWHA 3U2AA 3UN7A 1D06A 3VSKA 1Y28A 3NHQA 4FH2A 5HSQA 3LY3A 3KX0X 4GOGA 1BTLA 1TS7A 5EOEA 3VFFA 2Z2LB 2WZZA 2JBFA 2P9VA 3BFFA 4Z9QA 3PBTA 4EBNA 3ITBA 3CI6A 2FH5A 3AGDA 5IT5A 4EERA 5CTMA 4ESPA 4CQHA 3C38A 4DDYA 3QHYA 4Q0HA 3KSIA 3E2KA 2O0YA 2WKHA 2XRNA 5HPFA 1XJ6A 2LB5A 4FSFA 3DW0A 3NULA 5HWWA 4P6ZS 4BJPA 4JXGA 4LRYC 2I72A 2L1MA 1N9LA 1PIOA 3HUNA 4R38A 5HARA 4DF6A 1D7EA 4JKTA 4JBFA 1G68A 2R9WA 2PD8A 4KZ6A 4E3IA 2ZM2A 5E2EA 2Y2IA 2XD1A 1VETA 1JTDA 4L9EA 2ZQAA 4N9LA 3SW1A 3AGFA 4PKYG 4M4XA 4IVIA 3BLMA 3ZDJA 4HESA 4F3LB 1L0GA 5F5YA 2V1AA 4WM9A 4Y13A 1ONHA 5CGSA 4R4SA 3IX8A 3O88A 4HP9A 2WKEA 2XEPA 3KYEA 3MQQA 2W1TA 3UMEA 4K91A 3NOTC 3KYZA 4BBVA 1ZKJA 3T1SA 3IQAA 5FI6A 5J8XA 4QB8A 1PI4A 4OOYA 3MBZA 4HJ6A 1F9IA 5CXWA 1LL5A 3PXPA 3CZDA 3P01A 1VQQA 1MWUA 4GHIA 2UWXA 4UEYA 2DCFA 4G3VA 4BENA 4ZJ1A 3ZYTA 1DP8A 4WMCA 1NZOA 2PYRA 3KYQA 4EXOA 4FOFA 3VE4A 4EUVA 3G6OA 1VHMA 4GS9B 1MWRA 2KX6A 4ID4A 4OKPA 1K57C 2XK1A 3GV9A 3I7JA 1IYQA 3FPVA 1JNUA 3LEQA 5F1FA 5FI7A 3H7WB 4MN7A 1RGYA 1H3QA 4P6ZM 2ZQDA 3FZCA 3MF0A 4IBRA 4KG6A 1FCMA 3K3CA 3NCKA 1KVMA 5G18A 4OH0A 1O07A 4R3JA 4Y2FA 4MLLA 3UNWA 3T4QA 1YSQA 2XFTA 4EBLA 4WUJA 2M1CA 3T12B 1YLJA 3R7WB 3ZNTA 1PWCA 3IF6A 3A3DA 3PR6A 4DN0A 4KG2A 4NXGA 1L0FA 2J9PA 1HZOA 3L7HA 3OCNA 4KZ5A 1P0ZA 3NECA 3UB6A 3IWQA 3MZEA 2QZ6A 1GA9A 3NC8A 3UE0A 3B3XA 3HUMA 2HJEA 3HLWA 3FKWA 4JGPA 3G35A 3D4FA 4WZ4A 2V2FF 3F1NB 3NJAA 2ZM8A 4Y0OA 4E3OA 1S4SA 5FQJA 4IBXA 3N8RA 3PBRA 4FD8A 5L10A 4KZ3A 3UDXA 1NXYA 4X69A 4EETB 4O0PA 1CEGA 1TDLA 3T1XA 1PNEA 1X0OA 2EA9A 1MWTA 3UMDA 2O9CA 3LY4A 3VOLA 5J4EA 3UPOA 1LLBA 3O87A 4UHUA 1EWZA 3MFXA 3IS2B 2DNSA 3JVVA 1JWPA 4OQIA 5EECA 1VM1A 2HDQA 3K2NA 3V50A 5A91A 4KZAA 2Y4AA 4B4ZA 1RCJA 2W1TB 2ZC6B 4GLQA 4JGOA 1OTAA 5CHJA 1KE4A 2ZLYA 4PM7A 2A24A 1OTEA 2Z6CA 5CERA 2VKSA 2M7VA 2K31A 1CI9A 3E4OA 5EOOA 3V3SA 2VV7A 1S0WA 4KUKA 2VGJA 5F83A 2L0WA 2BASA 4GN2A 2CMNA 3W4OA 3WS0A 3ULFA 4EEPA 1IELA 4Z1WA 4WZ5A 1YM1A 3VV4A 2VJWA 2VV8A 2ZL1A 3UE3A 2VEAA 3IXHA 5AQ7A 1FR6A 3Q7VA 4X55A 1N9BA 2GDNA 3IBJA 5U47A 3IX3A 3UO9A 1YMXA 3TG9A 1K55A 3N8LA 3LEZA 1MKMA 4IHQA 1K56D 1OT9A 3UE1A 4JGRA 3TJZC 4DE1A 3BQ8A 4P87A 4E3KA 1IFQA 2XF3A 3NDGA 2EXBA 2XLNA 4EESA 3BECA 1T1CA 2V0UA 5L8MA 4OLDA 2HPBA 5FEFA 3UPNA 4N9KA 2A49A 5M18A 5JYPA 4HI4A 5CHMA 4QY5A 4S2LA 4E04A 1FILA 5G4YA 1HD8A 5HAIA 3F1PA 3PBQA 3LICA 1W5DA 4BLMA 4D2OA 3MS6A 4UA7A 4BD1A 4OQGA 3A3FA 2JE5A 4XUZA 3IF6B 3CMZA 2Y59A 4Y3IA 2B95A 3RFBA 2ZMVA 3GQZA 2KDKA 3Q1FA 3S7QA 1MZUA 2V1ZA 3ZQ5A 3HVFA 3P7NA 4PMAA 3Q7VB 1SDEA 2HP6A 5C5KA 4N1HA 3C2WA 5LBRA 1IYSA 1WYBA 2PD7A 2WKPA 3W4QA 3K3DA 1YLWA 1H8YA 3DWZA 3O3VA 3C5AA 4HH3A 1FR1A 1IEMA 4KQDA 3MZDA 4PM6A 1GA0A 2XDMA 3W4PA 1K25A 4PHTA 1VEUB 1CF0A 5CECA 3JVUA 3S4XA 4Q0IA 4LV1A 2W0NA 5HDDA 4DE3A 3UDFA 3ZVWA 4DXBA 5CEBA 1JTGA 3IXDA 1GSVA 4ETXA 3GMWA 3PTEA 1KGEA 3BW6A 5FEGA 3PAEA 4PPRA 1XPBA 3PHYA 3HCYA 1OPXA 3D9YA 3N7WA 3P09A 3SS4A 4LV0A 1H0MA 1Y54A 4N92A 4K0XA 5GHXA 3LGOA 3ZGAB 4CLCB 4I3AA 1D1JA 2D02A 1STZA 4MMNA 2IA2A 5CEDA 4GNUA 5EM1A 1XJ3A 3NDEA 2J80A 4HBTA 4OPRA 1BYWA 1S1YA 2EFXA 3VP1A 5AQAA 4R70A 1ALQA 2XD5A 1PYYA 2PR5A 3IS2A 4OPYA 1S67L 3H9WA 4IEDA 1M40A 3GRJA 1HVBA 1PW1A 3HBRA 1F2KA 5FASA 1DJBA 3MMHA 2GJ3A 4ARZA 1IYOA 3JYIA 2Y79A 2D01A 1TS6A 4CLCE 5F68A 3HL9A 2ZC3B 1KE0A 1ESUA 1Z09A 1YMSA 1BSGA 1ZTUA 5FQ9A 3FKVA 2JKFA 4WEKA 4B93A 1K55C 4MN5A 5DTTA 4OQHA 4OPZA 3IXBA 2A2LA 3LI9A 4N1XA 4WEJA 1J9MA 3M6BA 2ZJ9A 1NYYA 1N9NA 2ZOHA 2KOIA 5BOHA 1LSXA 4HJ3A 4X6TA 2OLUA 2BG1A 1W7FA 4DJ3A 4GKUA 5FQQA 1H8ZA 3GDIA 4S2JA 1BLHA 4HP4A 4JF6A 1FOFA 2GNXA 4FTXA 2JKRM 3UE6A 1K38A 2ZM0A 3TOIA 3HLDA 4MBHA 3LIFA 4P6BA 2P08A 3VE3A 2H10A 1TEMA 3LIAA 2W3DA 3WS4A 4R1GA 2JN7A 2WGWA 3RXXA 3A0RA 4LFUA 5E43A 2EWWA 1XGJA 1V9YA 3G32A 4HY8A 3NI9A 5L2FA 3BFEA 3N8SA 2GZAA 3Q81A 1M6KA 4NK3A 4X53A 4O7DA 1IOUA 2OAP1 4YNRA 1S6RA 1ERQA 4BL2A 1VB6A 3SOIA 5FL3A 3DTKA 2EX9A 1OTBA 1GSWA 1P9RA 5CGWA 2XROA 3P98A 1FCNA 2WZXA 4E3JA 3G4PA 4Y15A 5L07A 5HZHA 3VP4A 3EOIA 3RTYA 3D72A 3SZTA 1Z6FA 1XFNA 4EBPA 1ODVA 4Y0UA 4R3BA 4LLOB 1NRJA 2X01A 3UB5P 3IWIA 4M3KA 2QHKA 2ZQ9A 4KZ9A 1XP4A 4RYEA 3T1QB 3B33A 1AWIA 4ZBEA 2OV5A 2G2UA 5KZHA 1W79A 2VX8A 2V8FA 3S1YA 4EQ1A 3GECA 3LR3A 3M2JA 1K56A 1NZUA 5E2HA 3E2LA 3MR0A 1T1BA 1XX2A 2ZL1B 1CJFA 5HL6A 1W8YA 4CLCA 1BLCA 2O99A 2WYXA 3HLGA 3C4OA 2Y2JA 1AXBA 4E3MA 1CK3A 5CGXA 2HDSA 4JXVA 3S7OA 5GLBA 5A8BA 3DTIA 4E3NA 2J3TC 4OOLA 3QP2A 4KG5A 4I3IA 2PHYA 4I39A 3CUEA 2ZMAA 4X1MA 2RCXA 5EVID 1GHIA 1V9ZA 4WELA 5AVEA 2Q9MA 2E8JA 5IU1A 1UWNX 3KSGA 1K4EA 1J3WA 4DMZA 4QWOA 1K6RA 1K0KA 1FQGA 3V3RA 3G30A 3C7VA 1FIKA 4Y7PA 1XA7A 4NG2A 3LIDA 3G34A 4HNBA 4WF0A 4NKPA 4L9GA 3GVBA 4LV2A 1H8MA 3MKFA 3E4PA 4U0XA 1XKZA 2P9VB 3G2YA 4I5SA 3VFHA 4WLAA 1XXMA 4F94A 2PU2A 1NWZA 2XA7S 2P7JA 2JKRI 5J3WA 2EX8A 3W2ZA 5EFWA 2HF6A 1E3UD 1SKOA 3FYZA 4S2NA 3LYXA 2IWDA 4PAUA 1YT4A 4G3KA 4K0WA 4R6LA 1WYCA 4JLFA 4NXFA 3HLEA 4C3QA 2XSSA 4P85A 2O9BA 5F69A 3SS3A 2VK3A 5FAQA 4IJGA 4JPMA 3E0YA 1GSXA 4XT2B 5HD5A 4KQQA 2V20A 5HDSA 2Z2MB 3FC7A 2UV0E 3W8KA 3IWOA 3V67A 1NY0A 1G28A 4E3LA 2B18A 1ERMA 4HEFA 3VP2A 3BRMA 3BQAA 3CLOA 4GJ4A 2QJ5A 5FATA 3BLSA 3WRTA 3PBNA 5EVIB 3UB9A 2CC1A 2EWVA 1LSWA 3ZG9B 1ZG6A 2LB9A 3MXSA 3E98A 4MDZA 3AGEA 5HAPA 1FSYA 2HDUA 1F98A 3BYDA 3DTMA 3E4QA 1OTIA 3S7PA 1G6OA 5HWVA 5JYOA 3BFGA 3EQUA 4S2KA 3HREA 4FUWA 3H7WA 2PBYA 2VZWA 2ZQ7A 1K6SA 4L9FA 2Y2QA 4R3AA 5FI2A 4NXEA 2AVXA 3T4JA 1T1AA 4HQAA 2WGVA 1NLZA 4GHIB 3HLFA 3ZG0A 1ZHHB 3HJIA 5AJGA 3FPWA 4S2PA 2P04A 2V1BA 1JVJA 4KQRA 2Q9NA 5CRFA 2PRFA 3BWLA 2ZMFA 1JWZA 2XQZA 1GHMA 4BL3A 2B5RA 4LCLA 1K54C 3RXWA 5DF8A 3FG8A 3UY6A 2WAEA 1TS0A 4FH4A 5EVIA 3G2ZA 4EW7A 1PRQA 1KVLA 1W63Q 3CJMA 1QMFA 4IVKA 4II7A 5EE8A 3T4KA 3NOPC 4JF4A 4ZAMA 4PKYA 1BT5A 3EWKA 5GLCA 1T19A 2B02A 4Y17A 2JC7A 5HAQA 4F3LA 1Q2QA 3LI8A 3DWKA 5HDCA 4LGWA 1I2SA 5EVLA 4YOFA 3A0VA 3C4PA 2W3HA 4O01A 1TS8A 2Y2LA 3LUQA 3NY4A 1CEFA 3H82B 3A3EA 1KDSA 2QPNA 5DJTA 5EV0A 3HJKA 5EVIC 3T4TA 4Y5FA 4R23A 4WL9A 4A5RA 2FFFB 1MKIA 1ES2A 1NJ4A 2A24B 2J9OA 1I2WA 2P74A 1E3UA 2H0YA 5TBMB 1T18A 2ZC7A 3LIEA 1OJ5A 5DTKA 3T4SA 3T1RA 2FZ0A 2QYBA 3UB8A 1HLUP 1YLYA 2NUTC 1LI0A 4BQMA 3CPTA 1KDWA 5D3OA 1ZG4A 3C30A 5DFYA 5GL9A 4ZRRA 1PW8A 5DKLA 3CUEC 1NLYA 4O8GA 4X56A 5GHZA 3ZG8B 2HP9A 3DAVA 3DBAA 4D60A 2XH9A 5FAPA 3EGXC 4QJGA 2WAFA 4QHCA 3T4LA
chains in the Genus database with same CATH topology
4S2OA 3BFDA 2G2WA 1NYMA 2VGKA 3IWQA 3MZEA 4B4XA 2QZ6A 2RL3A 1S6RA 2WK0A 1GA9A 1EROA 3NC8A 1ERQA 3ZNYA 4OPQA 4JXWA 3PBSA 3UE0A 5CHUA 4BL2A 3SOIA 3B3XA 3O86A 4OONA 3HUMA 2EX9A 4GB7A 4GD8A 1EI5A 3HLWA 3FKWA 2X02A 5CGWA 4DRTA 3P98A 2BLSA 1FCNA 1K54A 3IH8A 3G35A 2WZXA 3D4FA 4WZ4A 3G4PA 4E3JA 4OQ0A 5FSRA 2V2FF 2E8IA 2ZM8A 1DJCA 4Y0OA 4ZDXA 3VP4A 2EXAA 2XGNA 1SDNA 3A3IA 3N6IA 3WS5A 4E3OA 5FQJA 4Y0TA 1SCWA 4IBXA 3N8RA 3PBRA 1Z6FA 4EBPA 4EQIA 4DXCA 4Y0UA 4FD8A 4WMCD 4KZ3A 3UDXA 1NXYA 4ZJ2A 4R3BA 4X69A 1CEGA 3ISGA 2IWCA 3QNCA 4U3TA 2X01A 3ZFZA 1TDLA 1ONGA 4NETA 3IWIA 3Q7ZA 4JF5A 1MWTA 4M3KA 3VOZA 2ZQ9A 4QD4A 4KZ9A 4MBFA 1XP4A 4EWFA 4RYEA 3LY4A 5AQ9A 3UPOA 2Y2NA 1SHVA 1LLBA 3O87A 4UHUA 4ZBEA 1LHYA 1EWZA 2OV5A 2DNSA 2G2UA 5KZHA 1W79A 5GLAA 4MEZA 1JWPA 1NRFA 5KMWA 3S1YA 4OQIA 3WWXA 5EECA 4ZJ3A 3M2JA 1VM1A 3OPRA 4MNRA 4OOMA 2HDQA 1K56A 2Y2PA 1L0EA 3V5MA 1KE3A 1NZUA 4R0QA 5A91A 3V50A 1MY8A 4KZAA 5E2HA 2Y4AA 1YLTA 3E2LA 4B4ZA 2WKIA 1XX2A 1RCJA 4PM5A 1PZPA 4E6XA 4DE2A 2ZC6B 5I94A 1QMEA 1MPLA 2R9XA 1W8YA 5CHJA 1KE4A 1BLCA 2C6WB 1IYPA 1RGZA 2ZLYA 3IHBA 4PM7A 3ZVTA 2WYXA 3HLGA 3C4OA 2Y2JA 4CPKA 4DDSA 1AXBA 4E3MA 1E4DA 1CK3A 1G6AA 1MWSA 5CERA 5CGXA 2HDSA 4JXVA 1CI9A 3Q07A 2Y2KA 5GLBA 3IXGA 4E3NA 1KGFA 4GDBA 4L0LA 4OOLA 5EOOA 3V3SA 4KG5A 1S0WA 4XUXA 2HDRA 1JWVA 2VGJA 5E2GA 5F83A 4GD6A 2ZMAA 4PM9A 2RCXA 5EVID 5FAOA 1GHIA 4GN2A 3W4OA 5M1AA 4WELA 5EUAA 1H5XA 1XA1A 5DVAA 4UA9A 3BFCA 3WS0A 1YQSA 2Q9MA 3M2KA 2Y2GA 3WS2A 4EUZA 1IELA 1K4EA 3VP0A 2ZC5B 3IH9A 4WBGA 2JCHA 1BLPA 4OP5A 4WZ5A 1YM1A 4XXRA 2DRWA 1K6RA 1FQGA 3V3RA 5A92A 5FQIA 3G30A 3C7VA 1PI5A 3ITAA 5TR7A 4Y7PA 2H0TA 1XA7A 1WE4A 3UE3A 4Q8IA 1PWDA 4JXSA 3IXHA 5AQ7A 1FR6A 3G34A 5GLDA 3PAGA 5A93A 5HX9A 5DF9A 3Q7VA 4X55A 3GVBA 1XGIA 3NIAA 4LV2A 1IKGA 3EQVA 5IHVA 3GTCA 3MKFA 2Y2MA 1N9BA 2GDNA 2WGWB 3OZHA 1ESIA 2X71A 2ZQ8A 4KZ8A 5U47A 3IF6C 3UPPA 3SH8A 4GZBA 4C6YA 3UO9A 1YMXA 3TG9A 4KZ7A 3RJUA 5FA7A 5FQKA 4U0XA 1XKZA 1K55A 2P9VB 3G2YA 1ES5A 3IHAA 3N8LA 3OPHA 3LEZA 3VFHA 1FCOA 1K56D 3UE1A 4DE0A 1XXMA 4H8RA 4MBKA 3N4IA 4DE1A 4F94A 5TGFA 3HLCA 2PU2A 4P87A 3SH9A 4E3KA 4DKIA 2XF3A 4EV4A 3S22A 2EX6A 3NDGA 1BLSA 2EXBA 2XLNA 4ZTKA 1YLPA 2EX8A 4PM8A 1RP5A 3BECA 3Q82A 3V39A 2A3UA 1E3UD 4KZ4A 4KZBA 4OLDA 3FYZA 2HPBA 2Y91A 4S2NA 3UPNA 4N9KA 2IWDA 2A49A 1YT4A 2J7VA 2ZC4B 4K0WA 1OMEA 5M18A 5JYPA 5CHMA 4GDNA 3G31A 2ZD8A 4QY5A 4OVDA 4S2LA 1WYCA 4RX3A 5KSCA 4JLFA 5HL1A 1ZC2A 3HLEA 4C3QA 3FV7A 1HD8A 4P85A 5HAIA 1K57A 3PBQA 1DY6A 1W5DA 4BLMA 3UN7A 3SS3A 4D2OA 3MKEA 1E25A 4UA7A 4BD1A 3VSKA 5FAQA 4OQGA 3A3FA 4FH2A 2JE5A 4XUZA 4JPMA 3IF6B 3LY3A 4GOGA 4HBUA 3CMZA 3VMAA 1BTLA 2Y59A 1IKIA 4LV3A 1FSWA 2WADA 5EOEA 3VFFA 2Z2LB 3C7UA 2WZZA 4LENA 5M19A 2JBFA 2P9VA 3BFFA 2IWBA 1LI9A 3GQZA 3Q1FA 4KQQA 4Z9QA 2V20A 3PBTA 4EBNA 4X68A 3ITBA 2OLVA 3CG5A 2Z2MB 2V1ZA 3AGDA 3W8KA 3IWOA 3NBLA 1N4OA 1NY0A 5CTMA 4E3LA 3HVFA 4WEJA 3UDIA 1ERMA 3Q7VB 1SDEA 4PMAA 4RVAA 4HEFA 4KQOA 3ZHHA 4WYYA 4QU3A 3VP2A 2HP6A 2EX2A 1CI8A 3BRMA 4N1HA 4DDYA 3QHYA 1IYSA 1WYBA 5KSHA 3W4QA 3E2KA 5FATA 5HW3A 2WKHA 1LL9A 3BLSA 4LCMA 3WRTA 1PWGA 2Y2OA 3PBNA 1YLWA 1H8YA 3DWZA 3HUOA 5EVIB 1YLZA 3O3VA 2HP5A 3C5AA 4FSFA 2CC1A 3A3JA 1FR1A 1IEMA 3DW0A 3ZG9B 1ZG6A 4YINA 4BJPA 2C5WB 3MZDA 4JXGA 3MXSA 5F1GA 4PM6A 1GA0A 3AGEA 2XDMA 2I72A 5HAPA 3M6HA 5TFQA 1FSYA 2HDUA 1PIOA 3HUNA 5HARA 3W4PA 3BYDA 1Q2PA 4DF6A 3OPPA 5F82A 1K25A 4JKTA 1GHPA 3DTMA 4JBFA 2FFYA 1G68A 2R9WA 5CECA 3S4XA 4UAAA 3FWLA 1TDGA 3ZG5A 4LV1A 4KZ6A 4BD0A 4C75A 3BFGA 3EQUA 4S2KA 5JYOA 3HREA 5AQBA 4E3IA 4DE3A 2ZM2A 2PBYA 3UDFA 3ZG7B 2ZQ7A 5E2EA 2Y2IA 3ZVWA 1K6SA 2XD1A 2Y2QA 5FI2A 1JTDA 4DXBA 5CEBA 2ZQAA 5A90A 1GCEA 1JTGA 3IXDA 4N9LA 3AGFA 1HTZA 2WGVA 4S2IA 4IVIA 2XR0A 3BLMA 3OC2A 3ZDJA 3HLFA 3GMWA 3PTEA 3BEBA 4HESA 3ZG0A 1KGEA 1ES3A 1L0GA 3PAEA 4PPRA 1C3BA 1XPBA 4S2PA 3N7WA 1JVJA 3P09A 4KQRA 3SS4A 3WRZA 2Q9NA 4WM9A 2Y2HA 5CRFA 3GR2A 2XQZA 1JWZA 4LV0A 1GHMA 1ONHA 4BL3A 1KGGA 1Y54A 5CGSA 2B5RA 4LCLA 1K54C 4P0MA 4N92A 4K0XA 3IT9A 5GHXA 3RXWA 5FQMA 1O7EA 4R4SA 5DF8A 3ZGAB 3O88A 5DTSA 3LO7A 3TSGA 2WKEA 2XEPA 2WAEA 3UY6A 4FH4A 4K91A 4S2MA 5EVIA 5FDHA 3G2ZA 4FCFA 5CEDA 4GNUA 1ZKJA 3IQAA 4RX2A 1KVLA 4E6WA 5FI6A 3CJMA 3NDEA 5J8XA 1QMFA 4QB8A 4IVKA 5EE8A 1L2SA 4HBTA 4OPRA 3WS1A 1PI4A 2EFXA 3VP1A 4JF4A 5AQAA 4ZAMA 1BT5A 3MBZA 4OOYA 1BUEA 5CXWA 5GLCA 1LL5A 1ALQA 2JC7A 2XD5A 1PYYA 4OP8A 1BZAA 3CZDA 4OPYA 5HAQA 2WGIA 1W8QA 1Q2QA 4R4RA 4IEDA 1M40A 1SKFA 3DWKA 3GRJA 1HVBA 1PW1A 3HBRA 1VQQA 1I2SA 1MWUA 3QNBA 2PU4A 5CTNA 5FASA 1DJBA 1K4FA 1IYOA 5EVLA 3JYIA 1DJAA 2UWXA 3HL9A 3PBOA 3C4PA 3HLBA 1ES4A 2Y2LA 3NY4A 2DCFA 1CEFA 2ZC3B 1KE0A 4CJNA 1ESUA 1YMSA 4BENA 3A3EA 1BSGA 5FQ9A 4ZJ1A 3FKVA 4OLGA 1KDSA 1L0DA 2QPNA 4WMCA 1NZOA 4WEKA 1K55C 3BM6A 5EVIC 5HFOA 5E2FA 5DTTA 4OQHA 4OPZA 3IXBA 4R23A 1MWRA 3MXRA 4A5RA 1TVFA 2FFFB 4ID4A 4N1XA 3MFDA 1MKIA 4OKPA 1ES2A 1J9MA 1K57C 1NJ4A 2XK1A 3M6BA 2ZJ9A 2XFSA 3MZFA 1NYYA 3GV9A 2QMIA 3I7JA 1IYQA 2J9OA 1I2WA 2P74A 1E3UA 2H0YA 5BOHA 4X6TA 2OLUA 2BG1A 5F1FA 1W7FA 4GKUA 5FQQA 2ZC7A 5FI7A 1H8ZA 3OCLA 1RGYA 1I5QA 4S2JA 5EPHA 1BLHA 4JF6A 1FOFA 1BULA 5DTKA 3SS5A 1K38A 4B88A 2ZQDA 2ZM0A 3FZCA 4RA7A 4KG6A 4IBRA 3VSLA 3TOIA 1FCMA 3HLDA 3OPLA 3NCKA 4MBHA 2H5SA 4UA6A 4P6BA 1KVMA 2EFUA 5G18A 3VOYA 4U0TA 4OH0A 1MXOA 3SH7A 1O07A 4R3JA 1YLYA 4WZ5C 2ZQCA 1LI0A 2H10A 3LCEA 4BQMA 1TEMA 4MLLA 3UNWA 5GHYA 2J8YA 1KDWA 4YFMA 5D3OA 1ZG4A 1MBLA 4R1GA 3WS4A 2WUQA 2XFTA 2WGWA 4EBLA 5GL9A 3RXXA 1PW8A 2Y55A 1U60A 3VP3A 5E43A 1YLJA 3IF5A 3ZCZA 1XGJA 2OSUA 3G32A 3GSGA 3NI9A 4X56A 5GHZA 3ZNTA 3ZG8B 5L2FA 2HP9A 1PWCA 3BFEA 4KENB 3IF6A 3N8SA 4QY6A 4S2NC 2XH9A 3A3DA 5FAPA 3Q81A 4KG2A 4QJGA 2WAFA 1M6KA 4NK3A 4X53A 1L0FA 2J9PA 4O7DA 1PZOA 1HZOA 4QHCA 3OCNA 4KZ5A 5DF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S2O A;  3BFD A;  2G2W A;  1NYM A;  2VGK A;  3IWQ A;  3MZE A;  4B4X A;  2QZ6 A;  2RL3 A;  1S6R A;  2WK0 A;  1GA9 A;  1ERO A;  3NC8 A;  1ERQ A;  3ZNY A;  4OPQ A;  4JXW A;  3PBS A;  3UE0 A;  5CHU A;  4BL2 A;  3SOI A;  3B3X A;  3O86 A;  4OON A;  3HUM A;  2EX9 A;  4GB7 A;  4GD8 A;  1EI5 A;  3HLW A;  3FKW A;  2X02 A;  5CGW A;  4DRT A;  3P98 A;  2BLS A;  1FCN A;  1K54 A;  3IH8 A;  3G35 A;  2WZX A;  3D4F A;  4WZ4 A;  3G4P A;  4E3J A;  4OQ0 A;  5FSR A;  2V2F F;  2E8I A;  2ZM8 A;  1DJC A;  4Y0O A;  4ZDX A;  3VP4 A;  2EXA A;  2XGN A;  1SDN A;  3A3I A;  3N6I A;  3WS5 A;  4E3O A;  5FQJ A;  4Y0T A;  1SCW A;  4IBX A;  3N8R A;  3PBR A;  1Z6F A;  4EBP A;  4EQI A;  4DXC A;  4Y0U A;  4FD8 A;  4WMC D;  4KZ3 A;  3UDX A;  1NXY A;  4ZJ2 A;  4R3B A;  4X69 A;  1CEG A;  3ISG A;  2IWC A;  3QNC A;  4U3T A;  2X01 A;  3ZFZ A;  1TDL A;  1ONG A;  4NET A;  3IWI A;  3Q7Z A;  4JF5 A;  1MWT A;  4M3K A;  3VOZ A;  2ZQ9 A;  4QD4 A;  4KZ9 A;  4MBF A;  1XP4 A;  4EWF A;  4RYE A;  3LY4 A;  5AQ9 A;  3UPO A;  2Y2N A;  1SHV A;  1LLB A;  3O87 A;  4UHU A;  4ZBE A;  1LHY A;  1EWZ A;  2OV5 A;  2DNS A;  2G2U A;  5KZH A;  1W79 A;  5GLA A;  4MEZ A;  1JWP A;  1NRF A;  5KMW A;  3S1Y A;  4OQI A;  3WWX A;  5EEC A;  4ZJ3 A;  3M2J A;  1VM1 A;  3OPR A;  4MNR A;  4OOM A;  2HDQ A;  1K56 A;  2Y2P A;  1L0E A;  3V5M A;  1KE3 A;  1NZU A;  4R0Q A;  5A91 A;  3V50 A;  1MY8 A;  4KZA A;  5E2H A;  2Y4A A;  1YLT A;  3E2L A;  4B4Z A;  2WKI A;  1XX2 A;  1RCJ A;  4PM5 A;  1PZP A;  4E6X A;  4DE2 A;  2ZC6 B;  5I94 A;  1QME A;  1MPL A;  2R9X A;  1W8Y A;  5CHJ A;  1KE4 A;  1BLC A;  2C6W B;  1IYP A;  1RGZ A;  2ZLY A;  3IHB A;  4PM7 A;  3ZVT A;  2WYX A;  3HLG A;  3C4O A;  2Y2J A;  4CPK A;  4DDS A;  1AXB A;  4E3M A;  1E4D A;  1CK3 A;  1G6A A;  1MWS A;  5CER A;  5CGX A;  2HDS A;  4JXV A;  1CI9 A;  3Q07 A;  2Y2K A;  5GLB A;  3IXG A;  4E3N A;  1KGF A;  4GDB A;  4L0L A;  4OOL A;  5EOO A;  3V3S A;  4KG5 A;  1S0W A;  4XUX A;  2HDR A;  1JWV A;  2VGJ A;  5E2G A;  5F83 A;  4GD6 A;  2ZMA A;  4PM9 A;  2RCX A;  5EVI D;  5FAO A;  1GHI A;  4GN2 A;  3W4O A;  5M1A A;  4WEL A;  5EUA A;  1H5X A;  1XA1 A;  5DVA A;  4UA9 A;  3BFC A;  3WS0 A;  1YQS A;  2Q9M A;  3M2K A;  2Y2G A;  3WS2 A;  4EUZ A;  1IEL A;  1K4E A;  3VP0 A;  2ZC5 B;  3IH9 A;  4WBG A;  2JCH A;  1BLP A;  4OP5 A;  4WZ5 A;  1YM1 A;  4XXR A;  2DRW A;  1K6R A;  1FQG A;  3V3R A;  5A92 A;  5FQI A;  3G30 A;  3C7V A;  1PI5 A;  3ITA A;  5TR7 A;  4Y7P A;  2H0T A;  1XA7 A;  1WE4 A;  3UE3 A;  4Q8I A;  1PWD A;  4JXS A;  3IXH A;  5AQ7 A;  1FR6 A;  3G34 A;  5GLD A;  3PAG A;  5A93 A;  5HX9 A;  5DF9 A;  3Q7V A;  4X55 A;  3GVB A;  1XGI A;  3NIA A;  4LV2 A;  1IKG A;  3EQV A;  5IHV A;  3GTC A;  3MKF A;  2Y2M A;  1N9B A;  2GDN A;  2WGW B;  3OZH A;  1ESI A;  2X71 A;  2ZQ8 A;  4KZ8 A;  5U47 A;  3IF6 C;  3UPP A;  3SH8 A;  4GZB A;  4C6Y A;  3UO9 A;  1YMX A;  3TG9 A;  4KZ7 A;  3RJU A;  5FA7 A;  5FQK A;  4U0X A;  1XKZ A;  1K55 A;  2P9V B;  3G2Y A;  1ES5 A;  3IHA A;  3N8L A;  3OPH A;  3LEZ A;  3VFH A;  1FCO A;  1K56 D;  3UE1 A;  4DE0 A;  1XXM A;  4H8R A;  4MBK A;  3N4I A;  4DE1 A;  4F94 A;  5TGF A;  3HLC A;  2PU2 A;  4P87 A;  3SH9 A;  4E3K A;  4DKI A;  2XF3 A;  4EV4 A;  3S22 A;  2EX6 A;  3NDG A;  1BLS A;  2EXB A;  2XLN A;  4ZTK A;  1YLP A;  2EX8 A;  4PM8 A;  1RP5 A;  3BEC A;  3Q82 A;  3V39 A;  2A3U A;  1E3U D;  4KZ4 A;  4KZB A;  4OLD A;  3FYZ A;  2HPB A;  2Y91 A;  4S2N A;  3UPN A;  4N9K A;  2IWD A;  2A49 A;  1YT4 A;  2J7V A;  2ZC4 B;  4K0W A;  1OME A;  5M18 A;  5JYP A;  5CHM A;  4GDN A;  3G31 A;  2ZD8 A;  4QY5 A;  4OVD A;  4S2L A;  1WYC A;  4RX3 A;  5KSC A;  4JLF A;  5HL1 A;  1ZC2 A;  3HLE A;  4C3Q A;  3FV7 A;  1HD8 A;  4P85 A;  5HAI A;  1K57 A;  3PBQ A;  1DY6 A;  1W5D A;  4BLM A;  3UN7 A;  3SS3 A;  4D2O A;  3MKE A;  1E25 A;  4UA7 A;  4BD1 A;  3VSK A;  5FAQ A;  4OQG A;  3A3F A;  4FH2 A;  2JE5 A;  4XUZ A;  4JPM A;  3IF6 B;  3LY3 A;  4GOG A;  4HBU A;  3CMZ A;  3VMA A;  1BTL A;  2Y59 A;  1IKI A;  4LV3 A;  1FSW A;  2WAD A;  5EOE A;  3VFF A;  2Z2L B;  3C7U A;  2WZZ A;  4LEN A;  5M19 A;  2JBF A;  2P9V A;  3BFF A;  2IWB A;  1LI9 A;  3GQZ A;  3Q1F A;  4KQQ A;  4Z9Q A;  2V20 A;  3PBT A;  4EBN A;  4X68 A;  3ITB A;  2OLV A;  3CG5 A;  2Z2M B;  2V1Z A;  3AGD A;  3W8K A;  3IWO A;  3NBL A;  1N4O A;  1NY0 A;  5CTM A;  4E3L A;  3HVF A;  4WEJ A;  3UDI A;  1ERM A;  3Q7V B;  1SDE A;  4PMA A;  4RVA A;  4HEF A;  4KQO A;  3ZHH A;  4WYY A;  4QU3 A;  3VP2 A;  2HP6 A;  2EX2 A;  1CI8 A;  3BRM A;  4N1H A;  4DDY A;  3QHY A;  1IYS A;  1WYB A;  5KSH A;  3W4Q A;  3E2K A;  5FAT A;  5HW3 A;  2WKH A;  1LL9 A;  3BLS A;  4LCM A;  3WRT A;  1PWG A;  2Y2O A;  3PBN A;  1YLW A;  1H8Y A;  3DWZ A;  3HUO A;  5EVI B;  1YLZ A;  3O3V A;  2HP5 A;  3C5A A;  4FSF A;  2CC1 A;  3A3J A;  1FR1 A;  1IEM A;  3DW0 A;  3ZG9 B;  1ZG6 A;  4YIN A;  4BJP A;  2C5W B;  3MZD A;  4JXG A;  3MXS A;  5F1G A;  4PM6 A;  1GA0 A;  3AGE A;  2XDM A;  2I72 A;  5HAP A;  3M6H A;  5TFQ A;  1FSY A;  2HDU A;  1PIO A;  3HUN A;  5HAR A;  3W4P A;  3BYD A;  1Q2P A;  4DF6 A;  3OPP A;  5F82 A;  1K25 A;  4JKT A;  1GHP A;  3DTM A;  4JBF A;  2FFY A;  1G68 A;  2R9W A;  5CEC A;  3S4X A;  4UAA A;  3FWL A;  1TDG A;  3ZG5 A;  4LV1 A;  4KZ6 A;  4BD0 A;  4C75 A;  3BFG A;  3EQU A;  4S2K A;  5JYO A;  3HRE A;  5AQB A;  4E3I A;  4DE3 A;  2ZM2 A;  2PBY A;  3UDF A;  3ZG7 B;  2ZQ7 A;  5E2E A;  2Y2I A;  3ZVW A;  1K6S A;  2XD1 A;  2Y2Q A;  5FI2 A;  1JTD A;  4DXB A;  5CEB A;  2ZQA A;  5A90 A;  1GCE A;  1JTG A;  3IXD A;  4N9L A;  3AGF A;  1HTZ A;  2WGV A;  4S2I A;  4IVI A;  2XR0 A;  3BLM A;  3OC2 A;  3ZDJ A;  3HLF A;  3GMW A;  3PTE A;  3BEB A;  4HES A;  3ZG0 A;  1KGE A;  1ES3 A;  1L0G A;  3PAE A;  4PPR A;  1C3B A;  1XPB A;  4S2P A;  3N7W A;  1JVJ A;  3P09 A;  4KQR A;  3SS4 A;  3WRZ A;  2Q9N A;  4WM9 A;  2Y2H A;  5CRF A;  3GR2 A;  2XQZ A;  1JWZ A;  4LV0 A;  1GHM A;  1ONH A;  4BL3 A;  1KGG A;  1Y54 A;  5CGS A;  2B5R A;  4LCL A;  1K54 C;  4P0M A;  4N92 A;  4K0X A;  3IT9 A;  5GHX A;  3RXW A;  5FQM A;  1O7E A;  4R4S A;  5DF8 A;  3ZGA B;  3O88 A;  5DTS A;  3LO7 A;  3TSG A;  2WKE A;  2XEP A;  2WAE A;  3UY6 A;  4FH4 A;  4K91 A;  4S2M A;  5EVI A;  5FDH A;  3G2Z A;  4FCF A;  5CED A;  4GNU A;  1ZKJ A;  3IQA A;  4RX2 A;  1KVL A;  4E6W A;  5FI6 A;  3CJM A;  3NDE A;  5J8X A;  1QMF A;  4QB8 A;  4IVK A;  5EE8 A;  1L2S A;  4HBT A;  4OPR A;  3WS1 A;  1PI4 A;  2EFX A;  3VP1 A;  4JF4 A;  5AQA A;  4ZAM A;  1BT5 A;  3MBZ A;  4OOY A;  1BUE A;  5CXW A;  5GLC A;  1LL5 A;  1ALQ A;  2JC7 A;  2XD5 A;  1PYY A;  4OP8 A;  1BZA A;  3CZD A;  4OPY A;  5HAQ A;  2WGI A;  1W8Q A;  1Q2Q A;  4R4R A;  4IED A;  1M40 A;  1SKF A;  3DWK A;  3GRJ A;  1HVB A;  1PW1 A;  3HBR A;  1VQQ A;  1I2S A;  1MWU A;  3QNB A;  2PU4 A;  5CTN A;  5FAS A;  1DJB A;  1K4F A;  1IYO A;  5EVL A;  3JYI A;  1DJA A;  2UWX A;  3HL9 A;  3PBO A;  3C4P A;  3HLB A;  1ES4 A;  2Y2L A;  3NY4 A;  2DCF A;  1CEF A;  2ZC3 B;  1KE0 A;  4CJN A;  1ESU A;  1YMS A;  4BEN A;  3A3E A;  1BSG A;  5FQ9 A;  4ZJ1 A;  3FKV A;  4OLG A;  1KDS A;  1L0D A;  2QPN A;  4WMC A;  1NZO A;  4WEK A;  1K55 C;  3BM6 A;  5EVI C;  5HFO A;  5E2F A;  5DTT A;  4OQH A;  4OPZ A;  3IXB A;  4R23 A;  1MWR A;  3MXR A;  4A5R A;  1TVF A;  2FFF B;  4ID4 A;  4N1X A;  3MFD A;  1MKI A;  4OKP A;  1ES2 A;  1J9M A;  1K57 C;  1NJ4 A;  2XK1 A;  3M6B A;  2ZJ9 A;  2XFS A;  3MZF A;  1NYY A;  3GV9 A;  2QMI A;  3I7J A;  1IYQ A;  2J9O A;  1I2W A;  2P74 A;  1E3U A;  2H0Y A;  5BOH A;  4X6T A;  2OLU A;  2BG1 A;  5F1F A;  1W7F A;  4GKU A;  5FQQ A;  2ZC7 A;  5FI7 A;  1H8Z A;  3OCL A;  1RGY A;  1I5Q A;  4S2J A;  5EPH A;  1BLH A;  4JF6 A;  1FOF A;  1BUL A;  5DTK A;  3SS5 A;  1K38 A;  4B88 A;  2ZQD A;  2ZM0 A;  3FZC A;  4RA7 A;  4KG6 A;  4IBR A;  3VSL A;  3TOI A;  1FCM A;  3HLD A;  3OPL A;  3NCK A;  4MBH A;  2H5S A;  4UA6 A;  4P6B A;  1KVM A;  2EFU A;  5G18 A;  3VOY A;  4U0T A;  4OH0 A;  1MXO A;  3SH7 A;  1O07 A;  4R3J A;  1YLY A;  4WZ5 C;  2ZQC A;  1LI0 A;  2H10 A;  3LCE A;  4BQM A;  1TEM A;  4MLL A;  3UNW A;  5GHY A;  2J8Y A;  1KDW A;  4YFM A;  5D3O A;  1ZG4 A;  1MBL A;  4R1G A;  3WS4 A;  2WUQ A;  2XFT A;  2WGW A;  4EBL A;  5GL9 A;  3RXX A;  1PW8 A;  2Y55 A;  1U60 A;  3VP3 A;  5E43 A;  1YLJ A;  3IF5 A;  3ZCZ A;  1XGJ A;  2OSU A;  3G32 A;  3GSG A;  3NI9 A;  4X56 A;  5GHZ A;  3ZNT A;  3ZG8 B;  5L2F A;  2HP9 A;  1PWC A;  3BFE A;  4KEN B;  3IF6 A;  3N8S A;  4QY6 A;  4S2N C;  2XH9 A;  3A3D A;  5FAP A;  3Q81 A;  4KG2 A;  4QJG A;  2WAF A;  1M6K A;  4NK3 A;  4X53 A;  1L0F A;  2J9P A;  4O7D A;  1PZO A;  1HZO A;  4QHC A;  3OCN A;  4KZ5 A;  5DF7 A; 
#chains in the Genus database with same CATH topology
 2JKT M;  1YAX A;  1YKD A;  4S2O A;  3TE8 A;  3BFD A;  2VGK A;  1NYM A;  2RL3 A;  2WK0 A;  5TBM A;  1ERO A;  2ACG A;  1P97 A;  3ZNY A;  4OPQ A;  3PBS A;  2W27 A;  5CHU A;  3O86 A;  3PYP A;  3EEA A;  2K7S A;  4GD8 A;  4DRT A;  3KO6 A;  1K54 A;  4GS9 A;  4OQ0 A;  2K2N A;  2E8I A;  1S1Z A;  2M7U A;  3A3I A;  5EM0 A;  4BBT A;  2V8C A;  2GX5 A;  1SCW A;  4GCZ A;  2G7U A;  3H82 A;  3OOV A;  2J3T D;  2JKG A;  4GW9 A;  4BMW A;  3QNC A;  4U3T A;  3ZFZ A;  2V9A A;  4NET A;  3Q7Z A;  3VOZ A;  4QD4 A;  5AQ9 A;  2Y2N A;  1SHV A;  3MQO A;  1LHY A;  3CIT A;  1NRF A;  3F1O B;  4ZJ3 A;  4OOM A;  2HV1 A;  2PBD P;  3KSF A;  1L0E A;  4R0Q A;  4BWI A;  1PZP A;  4NEE D;  4E6X A;  5I94 A;  2VV6 A;  4I3J A;  2R9X A;  2C6W B;  1Y4O A;  4CPK A;  3U4L P;  4DDS A;  5FDS A;  4HIA A;  3Q07 A;  2Y2K A;  3IXG A;  1KGF A;  4CLC C;  4GDB A;  4XUX A;  2HDR A;  1JWV A;  2OWJ A;  5TJJ A;  4PM9 A;  1XJ4 A;  3UB7 A;  5EUA A;  4X1L A;  1H5X A;  1XA1 A;  4UA9 A;  5DFX A;  3M2K A;  2Y2G A;  4EUZ A;  2ZC5 B;  4WBG A;  2JCH A;  1BLP A;  2DRW A;  1DP6 A;  1DP9 A;  5TR7 A;  2H0T A;  4RQ9 A;  1WE4 A;  1P9W A;  2OOL A;  4JXS A;  1LT0 A;  5GLD A;  5HX9 A;  1YPR A;  5DF9 A;  3R4K A;  1XGI A;  2V0W A;  5IHV A;  2PT7 A;  2Y2M A;  2X71 A;  2ZQ8 A;  2JKT I;  3IF6 C;  3UPP A;  4GZB A;  4C6Y A;  3L9K A;  4UQI M;  4HJ4 A;  5FQK A;  3RJU A;  4Q0J A;  1ES5 A;  3OPH A;  1XJ2 A;  4DE0 A;  3N4I A;  4UQI S;  5TGF A;  5AVF A;  3T50 A;  3EEH A;  4DKI A;  3JPU A;  2EX6 A;  2Q0O A;  1RP5 A;  4KZ4 A;  4KZB A;  2Y91 A;  4IUK A;  3T4O A;  2J7V A;  2ZC4 B;  5HL1 A;  1WA9 A;  1ZC2 A;  3FV7 A;  1DY6 A;  3MKE A;  1E25 A;  4HBU A;  3VMA A;  3D3O A;  1IKI A;  4LV3 A;  1FSW A;  2WAD A;  3CAX A;  3C7U A;  4LEN A;  2O9A A;  5EVE A;  4MN6 A;  5M19 A;  2IWB A;  1LI9 A;  3LIB A;  1OJG A;  4X68 A;  2OLV A;  3B42 A;  2Y8H A;  3CG5 A;  2PDR A;  3BY8 A;  3NBL A;  1N4O A;  1N9O A;  2PR6 A;  3UDI A;  4RVA A;  3ZHH A;  4KQO A;  4ETZ A;  4WYY A;  4QU3 A;  1SZV A;  2EX2 A;  1CI8 A;  5KSH A;  5HW3 A;  1MC0 A;  1LL9 A;  4LCM A;  4HHD A;  1PWG A;  2Y2O A;  3HUO A;  1YLZ A;  3LR4 A;  2HP5 A;  4BBU A;  3A3J A;  4H6J B;  4LPZ A;  4YIN A;  2C5W B;  5F1G A;  4DJ2 A;  4WN5 A;  2YKH A;  3M6H A;  5TFQ A;  3BJN A;  2HZ5 A;  1Q2P A;  3OPP A;  5F82 A;  1GHP A;  2FFY A;  1EW0 A;  3O5Y A;  4UAA A;  1S66 L;  3FWL A;  1TDG A;  3ZG5 A;  4BD0 A;  4C75 A;  2HGV A;  4LRZ E;  5AQB A;  3ZG7 B;  5A90 A;  1GCE A;  3C8C A;  2OAQ 1;  1HTZ A;  4S2I A;  1VET B;  3QP4 A;  3IBR A;  2XR0 A;  3OC2 A;  3BEB A;  2BTF P;  3MXQ A;  1ES3 A;  1TD5 A;  1C3B A;  2KLI A;  3WRZ A;  2Y2H A;  3GR2 A;  1KGG A;  4P0M A;  3IT9 A;  5FQM A;  1O7E A;  3TW8 A;  2HJ9 C;  3BY9 A;  2W3E A;  5DTS A;  3LO7 A;  3TSG A;  5F6A A;  1PFL A;  4ARZ B;  4MCW A;  5K5B A;  4S2M A;  5FDH A;  4FCF A;  3TRC A;  2L4R A;  5HPI A;  4RX2 A;  4E6W A;  1L2S A;  3WS1 A;  3CHW P;  1BUE A;  4OP8 A;  1BZA A;  2QJ7 A;  2WGI A;  1W8Q A;  4R4R A;  1SKF A;  3LFV A;  4G3W A;  3CWF A;  3QNB A;  2PU4 A;  5CTN A;  1K4F A;  1DJA A;  4XT2 A;  3PBO A;  1YSP A;  3HLB A;  1ES4 A;  4CJN A;  4OLG A;  1L0D A;  1KOU A;  1LSV A;  3BM6 A;  3LR0 A;  1XFQ A;  2QKP A;  4CLC D;  5HFO A;  5E2F A;  3MXR A;  1TVF A;  3MFD A;  2XFS A;  3MZF A;  2QMI A;  2PYP A;  5DKK A;  5CX7 A;  5J7E A;  4HOI A;  3OCL A;  1I5Q A;  1ACF A;  5EPH A;  5HWT A;  1BUL A;  3SS5 A;  2QWS A;  2YKF A;  4RA7 A;  4B88 A;  3VSL A;  1G5U A;  3OPL A;  2H5S A;  4UA6 A;  4QPR A;  3R7W A;  2EFU A;  3VOY A;  4U0T A;  1MXO A;  3SH7 A;  5MC7 A;  4WZ5 C;  2ZQC A;  3LCE A;  5GHY A;  3MSH A;  2J8Y A;  4X25 A;  4YFM A;  1S4R A;  1MBL A;  2XA7 M;  2JHE A;  2WUQ A;  2Z6D A;  2Y55 A;  1U60 A;  3VP3 A;  4NXB A;  3IF5 A;  3ZCZ A;  2OSU A;  3GSG A;  4QY6 A;  4KEN B;  4S2N C;  3LR5 A;  1PZO A;  1DRM A;  5DF7 A;  1W63 M;  3F1N A;  2G2W A;  4B4X A;  2H28 A;  1TF1 A;  4K08 A;  4JXW A;  2VLG A;  4OON A;  1UWP X;  4GB7 A;  4JGQ A;  1EI5 A;  1SKO B;  3OLO A;  2X02 A;  2BLS A;  3NOU C;  3IH8 A;  4EU0 A;  5FSR A;  2J3W A;  4AFI A;  1DJC A;  4ZDX A;  2EXA A;  2XGN A;  1SDN A;  2WKQ A;  3DTE A;  3N6I A;  3WS5 A;  4Y0T A;  3F1P B;  2PAV P;  4EQI A;  4DXC A;  4KUO A;  4WMC D;  1CQA A;  4ZJ2 A;  4EEU A;  2W3F A;  4I38 A;  3ISG A;  2IWC A;  1ONG A;  4JF5 A;  2ZBB A;  3MQ0 A;  4MBF A;  3QP6 A;  4EWF A;  3ICY A;  5GLA A;  4MEZ A;  1L3L A;  5KMW A;  3WWX A;  3OPR A;  4MNR A;  2Y2P A;  3V5M A;  1KE3 A;  1MY8 A;  1YLT A;  2WKI A;  4PM5 A;  3QP1 A;  4DE2 A;  1QME A;  1MPL A;  4YWZ A;  3RH8 B;  1IYP A;  1RGZ A;  2VGL M;  3OBF A;  3IHB A;  5HD3 A;  3ZVT A;  3MJQ A;  5DJU A;  1E4D A;  1G6A A;  1MWS A;  1F5M A;  4L0L A;  2I9V A;  5E2G A;  4GD6 A;  5FAO A;  2W1R A;  2DMW A;  5M1A A;  5DVA A;  3BFC A;  1YQS A;  1OTD A;  3WS2 A;  3S7N A;  4HH2 A;  3A0S A;  3VP0 A;  3IH9 A;  3KSH A;  4OP5 A;  4XXR A;  5A92 A;  5FQI A;  1PI5 A;  3ITA A;  2INW A;  3QP8 A;  4Q8I A;  5IS1 A;  4ME4 A;  1PWD A;  3PAG A;  5A93 A;  1VEU A;  3B47 A;  5G4Z A;  3F1O A;  3NIA A;  2ZOI A;  1IKG A;  3EQV A;  5L09 A;  3QP5 A;  3GTC A;  3OZH A;  2WGW B;  1ESI A;  4KZ8 A;  2MJ6 A;  4H6J A;  3SH8 A;  3CPT B;  4KZ7 A;  5FA7 A;  3EGD C;  3IHA A;  1LL8 A;  1FCO A;  4IUH A;  4LRX C;  4H8R A;  4MBK A;  5I5L A;  1A0K A;  2W3G A;  3HLC A;  3SH9 A;  1UGU A;  4EV4 A;  3S22 A;  1BLS A;  4ZTK A;  1YLP A;  4PM8 A;  3Q82 A;  3V39 A;  2A3U A;  1OT6 A;  4B9O A;  5KIZ A;  2WKR A;  1OME A;  2R78 A;  2VA0 A;  4GDN A;  3G31 A;  2ZD8 A;  4RX3 A;  4OVD A;  5KSC A;  3IX4 A;  2VGL S;  2NUP C;  1K57 A;  2OWH A;  3U2A A;  3UN7 A;  1D06 A;  3VSK A;  1Y28 A;  3NHQ A;  4FH2 A;  5HSQ A;  3LY3 A;  3KX0 X;  4GOG A;  1BTL A;  1TS7 A;  5EOE A;  3VFF A;  2Z2L B;  2WZZ A;  2JBF A;  2P9V A;  3BFF A;  4Z9Q A;  3PBT A;  4EBN A;  3ITB A;  3CI6 A;  2FH5 A;  3AGD A;  5IT5 A;  4EER A;  5CTM A;  4ESP A;  4CQH A;  3C38 A;  4DDY A;  3QHY A;  4Q0H A;  3KSI A;  3E2K A;  2O0Y A;  2WKH A;  2XRN A;  5HPF A;  1XJ6 A;  2LB5 A;  4FSF A;  3DW0 A;  3NUL A;  5HWW A;  4P6Z S;  4BJP A;  4JXG A;  4LRY C;  2I72 A;  2L1M A;  1N9L A;  1PIO A;  3HUN A;  4R38 A;  5HAR A;  4DF6 A;  1D7E A;  4JKT A;  4JBF A;  1G68 A;  2R9W A;  2PD8 A;  4KZ6 A;  4E3I A;  2ZM2 A;  5E2E A;  2Y2I A;  2XD1 A;  1VET A;  1JTD A;  4L9E A;  2ZQA A;  4N9L A;  3SW1 A;  3AGF A;  4PKY G;  4M4X A;  4IVI A;  3BLM A;  3ZDJ A;  4HES A;  4F3L B;  1L0G A;  5F5Y A;  2V1A A;  4WM9 A;  4Y13 A;  1ONH A;  5CGS A;  4R4S A;  3IX8 A;  3O88 A;  4HP9 A;  2WKE A;  2XEP A;  3KYE A;  3MQQ A;  2W1T A;  3UME A;  4K91 A;  3NOT C;  3KYZ A;  4BBV A;  1ZKJ A;  3T1S A;  3IQA A;  5FI6 A;  5J8X A;  4QB8 A;  1PI4 A;  4OOY A;  3MBZ A;  4HJ6 A;  1F9I A;  5CXW A;  1LL5 A;  3PXP A;  3CZD A;  3P01 A;  1VQQ A;  1MWU A;  4GHI A;  2UWX A;  4UEY A;  2DCF A;  4G3V A;  4BEN A;  4ZJ1 A;  3ZYT A;  1DP8 A;  4WMC A;  1NZO A;  2PYR A;  3KYQ A;  4EXO A;  4FOF A;  3VE4 A;  4EUV A;  3G6O A;  1VHM A;  4GS9 B;  1MWR A;  2KX6 A;  4ID4 A;  4OKP A;  1K57 C;  2XK1 A;  3GV9 A;  3I7J A;  1IYQ A;  3FPV A;  1JNU A;  3LEQ A;  5F1F A;  5FI7 A;  3H7W B;  4MN7 A;  1RGY A;  1H3Q A;  4P6Z M;  2ZQD A;  3FZC A;  3MF0 A;  4IBR A;  4KG6 A;  1FCM A;  3K3C A;  3NCK A;  1KVM A;  5G18 A;  4OH0 A;  1O07 A;  4R3J A;  4Y2F A;  4MLL A;  3UNW A;  3T4Q A;  1YSQ A;  2XFT A;  4EBL A;  4WUJ A;  2M1C A;  3T12 B;  1YLJ A;  3R7W B;  3ZNT A;  1PWC A;  3IF6 A;  3A3D A;  3PR6 A;  4DN0 A;  4KG2 A;  4NXG A;  1L0F A;  2J9P A;  1HZO A;  3L7H A;  3OCN A;  4KZ5 A;  1P0Z A;  3NEC A;  3UB6 A;  3IWQ A;  3MZE A;  2QZ6 A;  1GA9 A;  3NC8 A;  3UE0 A;  3B3X A;  3HUM A;  2HJE A;  3HLW A;  3FKW A;  4JGP A;  3G35 A;  3D4F A;  4WZ4 A;  2V2F F;  3F1N B;  3NJA A;  2ZM8 A;  4Y0O A;  4E3O A;  1S4S A;  5FQJ A;  4IBX A;  3N8R A;  3PBR A;  4FD8 A;  5L10 A;  4KZ3 A;  3UDX A;  1NXY A;  4X69 A;  4EET B;  4O0P A;  1CEG A;  1TDL A;  3T1X A;  1PNE A;  1X0O A;  2EA9 A;  1MWT A;  3UMD A;  2O9C A;  3LY4 A;  3VOL A;  5J4E A;  3UPO A;  1LLB A;  3O87 A;  4UHU A;  1EWZ A;  3MFX A;  3IS2 B;  2DNS A;  3JVV A;  1JWP A;  4OQI A;  5EEC A;  1VM1 A;  2HDQ A;  3K2N A;  3V50 A;  5A91 A;  4KZA A;  2Y4A A;  4B4Z A;  1RCJ A;  2W1T B;  2ZC6 B;  4GLQ A;  4JGO A;  1OTA A;  5CHJ A;  1KE4 A;  2ZLY A;  4PM7 A;  2A24 A;  1OTE A;  2Z6C A;  5CER A;  2VKS A;  2M7V A;  2K31 A;  1CI9 A;  3E4O A;  5EOO A;  3V3S A;  2VV7 A;  1S0W A;  4KUK A;  2VGJ A;  5F83 A;  2L0W A;  2BAS A;  4GN2 A;  2CMN A;  3W4O A;  3WS0 A;  3ULF A;  4EEP A;  1IEL A;  4Z1W A;  4WZ5 A;  1YM1 A;  3VV4 A;  2VJW A;  2VV8 A;  2ZL1 A;  3UE3 A;  2VEA A;  3IXH A;  5AQ7 A;  1FR6 A;  3Q7V A;  4X55 A;  1N9B A;  2GDN A;  3IBJ A;  5U47 A;  3IX3 A;  3UO9 A;  1YMX A;  3TG9 A;  1K55 A;  3N8L A;  3LEZ A;  1MKM A;  4IHQ A;  1K56 D;  1OT9 A;  3UE1 A;  4JGR A;  3TJZ C;  4DE1 A;  3BQ8 A;  4P87 A;  4E3K A;  1IFQ A;  2XF3 A;  3NDG A;  2EXB A;  2XLN A;  4EES A;  3BEC A;  1T1C A;  2V0U A;  5L8M A;  4OLD A;  2HPB A;  5FEF A;  3UPN A;  4N9K A;  2A49 A;  5M18 A;  5JYP A;  4HI4 A;  5CHM A;  4QY5 A;  4S2L A;  4E04 A;  1FIL A;  5G4Y A;  1HD8 A;  5HAI A;  3F1P A;  3PBQ A;  3LIC A;  1W5D A;  4BLM A;  4D2O A;  3MS6 A;  4UA7 A;  4BD1 A;  4OQG A;  3A3F A;  2JE5 A;  4XUZ A;  3IF6 B;  3CMZ A;  2Y59 A;  4Y3I A;  2B95 A;  3RFB A;  2ZMV A;  3GQZ A;  2KDK A;  3Q1F A;  3S7Q A;  1MZU A;  2V1Z A;  3ZQ5 A;  3HVF A;  3P7N A;  4PMA A;  3Q7V B;  1SDE A;  2HP6 A;  5C5K A;  4N1H A;  3C2W A;  5LBR A;  1IYS A;  1WYB A;  2PD7 A;  2WKP A;  3W4Q A;  3K3D A;  1YLW A;  1H8Y A;  3DWZ A;  3O3V A;  3C5A A;  4HH3 A;  1FR1 A;  1IEM A;  4KQD A;  3MZD A;  4PM6 A;  1GA0 A;  2XDM A;  3W4P A;  1K25 A;  4PHT A;  1VEU B;  1CF0 A;  5CEC A;  3JVU A;  3S4X A;  4Q0I A;  4LV1 A;  2W0N A;  5HDD A;  4DE3 A;  3UDF A;  3ZVW A;  4DXB A;  5CEB A;  1JTG A;  3IXD A;  1GSV A;  4ETX A;  3GMW A;  3PTE A;  1KGE A;  3BW6 A;  5FEG A;  3PAE A;  4PPR A;  1XPB A;  3PHY A;  3HCY A;  1OPX A;  3D9Y A;  3N7W A;  3P09 A;  3SS4 A;  4LV0 A;  1H0M A;  1Y54 A;  4N92 A;  4K0X A;  5GHX A;  3LGO A;  3ZGA B;  4CLC B;  4I3A A;  1D1J A;  2D02 A;  1STZ A;  4MMN A;  2IA2 A;  5CED A;  4GNU A;  5EM1 A;  1XJ3 A;  3NDE A;  2J80 A;  4HBT A;  4OPR A;  1BYW A;  1S1Y A;  2EFX A;  3VP1 A;  5AQA A;  4R70 A;  1ALQ A;  2XD5 A;  1PYY A;  2PR5 A;  3IS2 A;  4OPY A;  1S67 L;  3H9W A;  4IED A;  1M40 A;  3GRJ A;  1HVB A;  1PW1 A;  3HBR A;  1F2K A;  5FAS A;  1DJB A;  3MMH A;  2GJ3 A;  4ARZ A;  1IYO A;  3JYI A;  2Y79 A;  2D01 A;  1TS6 A;  4CLC E;  5F68 A;  3HL9 A;  2ZC3 B;  1KE0 A;  1ESU A;  1Z09 A;  1YMS A;  1BSG A;  1ZTU A;  5FQ9 A;  3FKV A;  2JKF A;  4WEK A;  4B93 A;  1K55 C;  4MN5 A;  5DTT A;  4OQH A;  4OPZ A;  3IXB A;  2A2L A;  3LI9 A;  4N1X A;  4WEJ A;  1J9M A;  3M6B A;  2ZJ9 A;  1NYY A;  1N9N A;  2ZOH A;  2KOI A;  5BOH A;  1LSX A;  4HJ3 A;  4X6T A;  2OLU A;  2BG1 A;  1W7F A;  4DJ3 A;  4GKU A;  5FQQ A;  1H8Z A;  3GDI A;  4S2J A;  1BLH A;  4HP4 A;  4JF6 A;  1FOF A;  2GNX A;  4FTX A;  2JKR M;  3UE6 A;  1K38 A;  2ZM0 A;  3TOI A;  3HLD A;  4MBH A;  3LIF A;  4P6B A;  2P08 A;  3VE3 A;  2H10 A;  1TEM A;  3LIA A;  2W3D A;  3WS4 A;  4R1G A;  2JN7 A;  2WGW A;  3RXX A;  3A0R A;  4LFU A;  5E43 A;  2EWW A;  1XGJ A;  1V9Y A;  3G32 A;  4HY8 A;  3NI9 A;  5L2F A;  3BFE A;  3N8S A;  2GZA A;  3Q81 A;  1M6K A;  4NK3 A;  4X53 A;  4O7D A;  1IOU A;  2OAP 1;  4YNR A;  1S6R A;  1ERQ A;  4BL2 A;  1VB6 A;  3SOI A;  5FL3 A;  3DTK A;  2EX9 A;  1OTB A;  1GSW A;  1P9R A;  5CGW A;  2XRO A;  3P98 A;  1FCN A;  2WZX A;  4E3J A;  3G4P A;  4Y15 A;  5L07 A;  5HZH A;  3VP4 A;  3EOI A;  3RTY A;  3D72 A;  3SZT A;  1Z6F A;  1XFN A;  4EBP A;  1ODV A;  4Y0U A;  4R3B A;  4LLO B;  1NRJ A;  2X01 A;  3UB5 P;  3IWI A;  4M3K A;  2QHK A;  2ZQ9 A;  4KZ9 A;  1XP4 A;  4RYE A;  3T1Q B;  3B33 A;  1AWI A;  4ZBE A;  2OV5 A;  2G2U A;  5KZH A;  1W79 A;  2VX8 A;  2V8F A;  3S1Y A;  4EQ1 A;  3GEC A;  3LR3 A;  3M2J A;  1K56 A;  1NZU A;  5E2H A;  3E2L A;  3MR0 A;  1T1B A;  1XX2 A;  2ZL1 B;  1CJF A;  5HL6 A;  1W8Y A;  4CLC A;  1BLC A;  2O99 A;  2WYX A;  3HLG A;  3C4O A;  2Y2J A;  1AXB A;  4E3M A;  1CK3 A;  5CGX A;  2HDS A;  4JXV A;  3S7O A;  5GLB A;  5A8B A;  3DTI A;  4E3N A;  2J3T C;  4OOL A;  3QP2 A;  4KG5 A;  4I3I A;  2PHY A;  4I39 A;  3CUE A;  2ZMA A;  4X1M A;  2RCX A;  5EVI D;  1GHI A;  1V9Z A;  4WEL A;  5AVE A;  2Q9M A;  2E8J A;  5IU1 A;  1UWN X;  3KSG A;  1K4E A;  1J3W A;  4DMZ A;  4QWO A;  1K6R A;  1K0K A;  1FQG A;  3V3R A;  3G30 A;  3C7V A;  1FIK A;  4Y7P A;  1XA7 A;  4NG2 A;  3LID A;  3G34 A;  4HNB A;  4WF0 A;  4NKP A;  4L9G A;  3GVB A;  4LV2 A;  1H8M A;  3MKF A;  3E4P A;  4U0X A;  1XKZ A;  2P9V B;  3G2Y A;  4I5S A;  3VFH A;  4WLA A;  1XXM A;  4F94 A;  2PU2 A;  1NWZ A;  2XA7 S;  2P7J A;  2JKR I;  5J3W A;  2EX8 A;  3W2Z A;  5EFW A;  2HF6 A;  1E3U D;  1SKO A;  3FYZ A;  4S2N A;  3LYX A;  2IWD A;  4PAU A;  1YT4 A;  4G3K A;  4K0W A;  4R6L A;  1WYC A;  4JLF A;  4NXF A;  3HLE A;  4C3Q A;  2XSS A;  4P85 A;  2O9B A;  5F69 A;  3SS3 A;  2VK3 A;  5FAQ A;  4IJG A;  4JPM A;  3E0Y A;  1GSX A;  4XT2 B;  5HD5 A;  4KQQ A;  2V20 A;  5HDS A;  2Z2M B;  3FC7 A;  2UV0 E;  3W8K A;  3IWO A;  3V67 A;  1NY0 A;  1G28 A;  4E3L A;  2B18 A;  1ERM A;  4HEF A;  3VP2 A;  3BRM A;  3BQA A;  3CLO A;  4GJ4 A;  2QJ5 A;  5FAT A;  3BLS A;  3WRT A;  3PBN A;  5EVI B;  3UB9 A;  2CC1 A;  2EWV A;  1LSW A;  3ZG9 B;  1ZG6 A;  2LB9 A;  3MXS A;  3E98 A;  4MDZ A;  3AGE A;  5HAP A;  1FSY A;  2HDU A;  1F98 A;  3BYD A;  3DTM A;  3E4Q A;  1OTI A;  3S7P A;  1G6O A;  5HWV A;  5JYO A;  3BFG A;  3EQU A;  4S2K A;  3HRE A;  4FUW A;  3H7W A;  2PBY A;  2VZW A;  2ZQ7 A;  1K6S A;  4L9F A;  2Y2Q A;  4R3A A;  5FI2 A;  4NXE A;  2AVX A;  3T4J A;  1T1A A;  4HQA A;  2WGV A;  1NLZ A;  4GHI B;  3HLF A;  3ZG0 A;  1ZHH B;  3HJI A;  5AJG A;  3FPW A;  4S2P A;  2P04 A;  2V1B A;  1JVJ A;  4KQR A;  2Q9N A;  5CRF A;  2PRF A;  3BWL A;  2ZMF A;  1JWZ A;  2XQZ A;  1GHM A;  4BL3 A;  2B5R A;  4LCL A;  1K54 C;  3RXW A;  5DF8 A;  3FG8 A;  3UY6 A;  2WAE A;  1TS0 A;  4FH4 A;  5EVI A;  3G2Z A;  4EW7 A;  1PRQ A;  1KVL A;  1W63 Q;  3CJM A;  1QMF A;  4IVK A;  4II7 A;  5EE8 A;  3T4K A;  3NOP C;  4JF4 A;  4ZAM A;  4PKY A;  1BT5 A;  3EWK A;  5GLC A;  1T19 A;  2B02 A;  4Y17 A;  2JC7 A;  5HAQ A;  4F3L A;  1Q2Q A;  3LI8 A;  3DWK A;  5HDC A;  4LGW A;  1I2S A;  5EVL A;  4YOF A;  3A0V A;  3C4P A;  2W3H A;  4O01 A;  1TS8 A;  2Y2L A;  3LUQ A;  3NY4 A;  1CEF A;  3H82 B;  3A3E A;  1KDS A;  2QPN A;  5DJT A;  5EV0 A;  3HJK A;  5EVI C;  3T4T A;  4Y5F A;  4R23 A;  4WL9 A;  4A5R A;  2FFF B;  1MKI A;  1ES2 A;  1NJ4 A;  2A24 B;  2J9O A;  1I2W A;  2P74 A;  1E3U A;  2H0Y A;  5TBM B;  1T18 A;  2ZC7 A;  3LIE A;  1OJ5 A;  5DTK A;  3T4S A;  3T1R A;  2FZ0 A;  2QYB A;  3UB8 A;  1HLU P;  1YLY A;  2NUT C;  1LI0 A;  4BQM A;  3CPT A;  1KDW A;  5D3O A;  1ZG4 A;  3C30 A;  5DFY A;  5GL9 A;  4ZRR A;  1PW8 A;  5DKL A;  3CUE C;  1NLY A;  4O8G A;  4X56 A;  5GHZ A;  3ZG8 B;  2HP9 A;  3DAV A;  3DBA A;  4D60 A;  2XH9 A;  5FAP A;  3EGX C;  4QJG A;  2WAF A;  4QHC A;  3T4L A; 
#chains in the Genus database with same CATH homology
 4S2O A;  3BFD A;  2G2W A;  1NYM A;  2VGK A;  3IWQ A;  3MZE A;  4B4X A;  2QZ6 A;  2RL3 A;  1S6R A;  2WK0 A;  1GA9 A;  1ERO A;  3NC8 A;  1ERQ A;  3ZNY A;  4OPQ A;  4JXW A;  3PBS A;  3UE0 A;  5CHU A;  4BL2 A;  3SOI A;  3B3X A;  3O86 A;  4OON A;  3HUM A;  2EX9 A;  4GB7 A;  4GD8 A;  1EI5 A;  3HLW A;  3FKW A;  2X02 A;  5CGW A;  4DRT A;  3P98 A;  2BLS A;  1FCN A;  1K54 A;  3IH8 A;  3G35 A;  2WZX A;  3D4F A;  4WZ4 A;  3G4P A;  4E3J A;  4OQ0 A;  5FSR A;  2V2F F;  2E8I A;  2ZM8 A;  1DJC A;  4Y0O A;  4ZDX A;  3VP4 A;  2EXA A;  2XGN A;  1SDN A;  3A3I A;  3N6I A;  3WS5 A;  4E3O A;  5FQJ A;  4Y0T A;  1SCW A;  4IBX A;  3N8R A;  3PBR A;  1Z6F A;  4EBP A;  4EQI A;  4DXC A;  4Y0U A;  4FD8 A;  4WMC D;  4KZ3 A;  3UDX A;  1NXY A;  4ZJ2 A;  4R3B A;  4X69 A;  1CEG A;  3ISG A;  2IWC A;  3QNC A;  4U3T A;  2X01 A;  3ZFZ A;  1TDL A;  1ONG A;  4NET A;  3IWI A;  3Q7Z A;  4JF5 A;  1MWT A;  4M3K A;  3VOZ A;  2ZQ9 A;  4QD4 A;  4KZ9 A;  4MBF A;  1XP4 A;  4EWF A;  4RYE A;  3LY4 A;  5AQ9 A;  3UPO A;  2Y2N A;  1SHV A;  1LLB A;  3O87 A;  4UHU A;  4ZBE A;  1LHY A;  1EWZ A;  2OV5 A;  2DNS A;  2G2U A;  5KZH A;  1W79 A;  5GLA A;  4MEZ A;  1JWP A;  1NRF A;  5KMW A;  3S1Y A;  4OQI A;  3WWX A;  5EEC A;  4ZJ3 A;  3M2J A;  1VM1 A;  3OPR A;  4MNR A;  4OOM A;  2HDQ A;  1K56 A;  2Y2P A;  1L0E A;  3V5M A;  1KE3 A;  1NZU A;  4R0Q A;  5A91 A;  3V50 A;  1MY8 A;  4KZA A;  5E2H A;  2Y4A A;  1YLT A;  3E2L A;  4B4Z A;  2WKI A;  1XX2 A;  1RCJ A;  4PM5 A;  1PZP A;  4E6X A;  4DE2 A;  2ZC6 B;  5I94 A;  1QME A;  1MPL A;  2R9X A;  1W8Y A;  5CHJ A;  1KE4 A;  1BLC A;  2C6W B;  1IYP A;  1RGZ A;  2ZLY A;  3IHB A;  4PM7 A;  3ZVT A;  2WYX A;  3HLG A;  3C4O A;  2Y2J A;  4CPK A;  4DDS A;  1AXB A;  4E3M A;  1E4D A;  1CK3 A;  1G6A A;  1MWS A;  5CER A;  5CGX A;  2HDS A;  4JXV A;  1CI9 A;  3Q07 A;  2Y2K A;  5GLB A;  3IXG A;  4E3N A;  1KGF A;  4GDB A;  4L0L A;  4OOL A;  5EOO A;  3V3S A;  4KG5 A;  1S0W A;  4XUX A;  2HDR A;  1JWV A;  2VGJ A;  5E2G A;  5F83 A;  4GD6 A;  2ZMA A;  4PM9 A;  2RCX A;  5EVI D;  5FAO A;  1GHI A;  4GN2 A;  3W4O A;  5M1A A;  4WEL A;  5EUA A;  1H5X A;  1XA1 A;  5DVA A;  4UA9 A;  3BFC A;  3WS0 A;  1YQS A;  2Q9M A;  3M2K A;  2Y2G A;  3WS2 A;  4EUZ A;  1IEL A;  1K4E A;  3VP0 A;  2ZC5 B;  3IH9 A;  4WBG A;  2JCH A;  1BLP A;  4OP5 A;  4WZ5 A;  1YM1 A;  4XXR A;  2DRW A;  1K6R A;  1FQG A;  3V3R A;  5A92 A;  5FQI A;  3G30 A;  3C7V A;  1PI5 A;  3ITA A;  5TR7 A;  4Y7P A;  2H0T A;  1XA7 A;  1WE4 A;  3UE3 A;  4Q8I A;  1PWD A;  4JXS A;  3IXH A;  5AQ7 A;  1FR6 A;  3G34 A;  5GLD A;  3PAG A;  5A93 A;  5HX9 A;  5DF9 A;  3Q7V A;  4X55 A;  3GVB A;  1XGI A;  3NIA A;  4LV2 A;  1IKG A;  3EQV A;  5IHV A;  3GTC A;  3MKF A;  2Y2M A;  1N9B A;  2GDN A;  2WGW B;  3OZH A;  1ESI A;  2X71 A;  2ZQ8 A;  4KZ8 A;  5U47 A;  3IF6 C;  3UPP A;  3SH8 A;  4GZB A;  4C6Y A;  3UO9 A;  1YMX A;  3TG9 A;  4KZ7 A;  3RJU A;  5FA7 A;  5FQK A;  4U0X A;  1XKZ A;  1K55 A;  2P9V B;  3G2Y A;  1ES5 A;  3IHA A;  3N8L A;  3OPH A;  3LEZ A;  3VFH A;  1FCO A;  1K56 D;  3UE1 A;  4DE0 A;  1XXM A;  4H8R A;  4MBK A;  3N4I A;  4DE1 A;  4F94 A;  5TGF A;  3HLC A;  2PU2 A;  4P87 A;  3SH9 A;  4E3K A;  4DKI A;  2XF3 A;  4EV4 A;  3S22 A;  2EX6 A;  3NDG A;  1BLS A;  2EXB A;  2XLN A;  4ZTK A;  1YLP A;  2EX8 A;  4PM8 A;  1RP5 A;  3BEC A;  3Q82 A;  3V39 A;  2A3U A;  1E3U D;  4KZ4 A;  4KZB A;  4OLD A;  3FYZ A;  2HPB A;  2Y91 A;  4S2N A;  3UPN A;  4N9K A;  2IWD A;  2A49 A;  1YT4 A;  2J7V A;  2ZC4 B;  4K0W A;  1OME A;  5M18 A;  5JYP A;  5CHM A;  4GDN A;  3G31 A;  2ZD8 A;  4QY5 A;  4OVD A;  4S2L A;  1WYC A;  4RX3 A;  5KSC A;  4JLF A;  5HL1 A;  1ZC2 A;  3HLE A;  4C3Q A;  3FV7 A;  1HD8 A;  4P85 A;  5HAI A;  1K57 A;  3PBQ A;  1DY6 A;  1W5D A;  4BLM A;  3UN7 A;  3SS3 A;  4D2O A;  3MKE A;  1E25 A;  4UA7 A;  4BD1 A;  3VSK A;  5FAQ A;  4OQG A;  3A3F A;  4FH2 A;  2JE5 A;  4XUZ A;  4JPM A;  3IF6 B;  3LY3 A;  4GOG A;  4HBU A;  3CMZ A;  3VMA A;  1BTL A;  2Y59 A;  1IKI A;  4LV3 A;  1FSW A;  2WAD A;  5EOE A;  3VFF A;  2Z2L B;  3C7U A;  2WZZ A;  4LEN A;  5M19 A;  2JBF A;  2P9V A;  3BFF A;  2IWB A;  1LI9 A;  3GQZ A;  3Q1F A;  4KQQ A;  4Z9Q A;  2V20 A;  3PBT A;  4EBN A;  4X68 A;  3ITB A;  2OLV A;  3CG5 A;  2Z2M B;  2V1Z A;  3AGD A;  3W8K A;  3IWO A;  3NBL A;  1N4O A;  1NY0 A;  5CTM A;  4E3L A;  3HVF A;  4WEJ A;  3UDI A;  1ERM A;  3Q7V B;  1SDE A;  4PMA A;  4RVA A;  4HEF A;  4KQO A;  3ZHH A;  4WYY A;  4QU3 A;  3VP2 A;  2HP6 A;  2EX2 A;  1CI8 A;  3BRM A;  4N1H A;  4DDY A;  3QHY A;  1IYS A;  1WYB A;  5KSH A;  3W4Q A;  3E2K A;  5FAT A;  5HW3 A;  2WKH A;  1LL9 A;  3BLS A;  4LCM A;  3WRT A;  1PWG A;  2Y2O A;  3PBN A;  1YLW A;  1H8Y A;  3DWZ A;  3HUO A;  5EVI B;  1YLZ A;  3O3V A;  2HP5 A;  3C5A A;  4FSF A;  2CC1 A;  3A3J A;  1FR1 A;  1IEM A;  3DW0 A;  3ZG9 B;  1ZG6 A;  4YIN A;  4BJP A;  2C5W B;  3MZD A;  4JXG A;  3MXS A;  5F1G A;  4PM6 A;  1GA0 A;  3AGE A;  2XDM A;  2I72 A;  5HAP A;  3M6H A;  5TFQ A;  1FSY A;  2HDU A;  1PIO A;  3HUN A;  5HAR A;  3W4P A;  3BYD A;  1Q2P A;  4DF6 A;  3OPP A;  5F82 A;  1K25 A;  4JKT A;  1GHP A;  3DTM A;  4JBF A;  2FFY A;  1G68 A;  2R9W A;  5CEC A;  3S4X A;  4UAA A;  3FWL A;  1TDG A;  3ZG5 A;  4LV1 A;  4KZ6 A;  4BD0 A;  4C75 A;  3BFG A;  3EQU A;  4S2K A;  5JYO A;  3HRE A;  5AQB A;  4E3I A;  4DE3 A;  2ZM2 A;  2PBY A;  3UDF A;  3ZG7 B;  2ZQ7 A;  5E2E A;  2Y2I A;  3ZVW A;  1K6S A;  2XD1 A;  2Y2Q A;  5FI2 A;  1JTD A;  4DXB A;  5CEB A;  2ZQA A;  5A90 A;  1GCE A;  1JTG A;  3IXD A;  4N9L A;  3AGF A;  1HTZ A;  2WGV A;  4S2I A;  4IVI A;  2XR0 A;  3BLM A;  3OC2 A;  3ZDJ A;  3HLF A;  3GMW A;  3PTE A;  3BEB A;  4HES A;  3ZG0 A;  1KGE A;  1ES3 A;  1L0G A;  3PAE A;  4PPR A;  1C3B A;  1XPB A;  4S2P A;  3N7W A;  1JVJ A;  3P09 A;  4KQR A;  3SS4 A;  3WRZ A;  2Q9N A;  4WM9 A;  2Y2H A;  5CRF A;  3GR2 A;  2XQZ A;  1JWZ A;  4LV0 A;  1GHM A;  1ONH A;  4BL3 A;  1KGG A;  1Y54 A;  5CGS A;  2B5R A;  4LCL A;  1K54 C;  4P0M A;  4N92 A;  4K0X A;  3IT9 A;  5GHX A;  3RXW A;  5FQM A;  1O7E A;  4R4S A;  5DF8 A;  3ZGA B;  3O88 A;  5DTS A;  3LO7 A;  3TSG A;  2WKE A;  2XEP A;  2WAE A;  3UY6 A;  4FH4 A;  4K91 A;  4S2M A;  5EVI A;  5FDH A;  3G2Z A;  4FCF A;  5CED A;  4GNU A;  1ZKJ A;  3IQA A;  4RX2 A;  1KVL A;  4E6W A;  5FI6 A;  3CJM A;  3NDE A;  5J8X A;  1QMF A;  4QB8 A;  4IVK A;  5EE8 A;  1L2S A;  4HBT A;  4OPR A;  3WS1 A;  1PI4 A;  2EFX A;  3VP1 A;  4JF4 A;  5AQA A;  4ZAM A;  1BT5 A;  3MBZ A;  4OOY A;  1BUE A;  5CXW A;  5GLC A;  1LL5 A;  1ALQ A;  2JC7 A;  2XD5 A;  1PYY A;  4OP8 A;  1BZA A;  3CZD A;  4OPY A;  5HAQ A;  2WGI A;  1W8Q A;  1Q2Q A;  4R4R A;  4IED A;  1M40 A;  1SKF A;  3DWK A;  3GRJ A;  1HVB A;  1PW1 A;  3HBR A;  1VQQ A;  1I2S A;  1MWU A;  3QNB A;  2PU4 A;  5CTN A;  5FAS A;  1DJB A;  1K4F A;  1IYO A;  5EVL A;  3JYI A;  1DJA A;  2UWX A;  3HL9 A;  3PBO A;  3C4P A;  3HLB A;  1ES4 A;  2Y2L A;  3NY4 A;  2DCF A;  1CEF A;  2ZC3 B;  1KE0 A;  4CJN A;  1ESU A;  1YMS A;  4BEN A;  3A3E A;  1BSG A;  5FQ9 A;  4ZJ1 A;  3FKV A;  4OLG A;  1KDS A;  1L0D A;  2QPN A;  4WMC A;  1NZO A;  4WEK A;  1K55 C;  3BM6 A;  5EVI C;  5HFO A;  5E2F A;  5DTT A;  4OQH A;  4OPZ A;  3IXB A;  4R23 A;  1MWR A;  3MXR A;  4A5R A;  1TVF A;  2FFF B;  4ID4 A;  4N1X A;  3MFD A;  1MKI A;  4OKP A;  1ES2 A;  1J9M A;  1K57 C;  1NJ4 A;  2XK1 A;  3M6B A;  2ZJ9 A;  2XFS A;  3MZF A;  1NYY A;  3GV9 A;  2QMI A;  3I7J A;  1IYQ A;  2J9O A;  1I2W A;  2P74 A;  1E3U A;  2H0Y A;  5BOH A;  4X6T A;  2OLU A;  2BG1 A;  5F1F A;  1W7F A;  4GKU A;  5FQQ A;  2ZC7 A;  5FI7 A;  1H8Z A;  3OCL A;  1RGY A;  1I5Q A;  4S2J A;  5EPH A;  1BLH A;  4JF6 A;  1FOF A;  1BUL A;  5DTK A;  3SS5 A;  1K38 A;  4B88 A;  2ZQD A;  2ZM0 A;  3FZC A;  4RA7 A;  4KG6 A;  4IBR A;  3VSL A;  3TOI A;  1FCM A;  3HLD A;  3OPL A;  3NCK A;  4MBH A;  2H5S A;  4UA6 A;  4P6B A;  1KVM A;  2EFU A;  5G18 A;  3VOY A;  4U0T A;  4OH0 A;  1MXO A;  3SH7 A;  1O07 A;  4R3J A;  1YLY A;  4WZ5 C;  2ZQC A;  1LI0 A;  2H10 A;  3LCE A;  4BQM A;  1TEM A;  4MLL A;  3UNW A;  5GHY A;  2J8Y A;  1KDW A;  4YFM A;  5D3O A;  1ZG4 A;  1MBL A;  4R1G A;  3WS4 A;  2WUQ A;  2XFT A;  2WGW A;  4EBL A;  5GL9 A;  3RXX A;  1PW8 A;  2Y55 A;  1U60 A;  3VP3 A;  5E43 A;  1YLJ A;  3IF5 A;  3ZCZ A;  1XGJ A;  2OSU A;  3G32 A;  3GSG A;  3NI9 A;  4X56 A;  5GHZ A;  3ZNT A;  3ZG8 B;  5L2F A;  2HP9 A;  1PWC A;  3BFE A;  4KEN B;  3IF6 A;  3N8S A;  4QY6 A;  4S2N C;  2XH9 A;  3A3D A;  5FAP A;  3Q81 A;  4KG2 A;  4QJG A;  2WAF A;  1M6K A;  4NK3 A;  4X53 A;  1L0F A;  2J9P A;  4O7D A;  1PZO A;  1HZO A;  4QHC A;  3OCN A;  4KZ5 A;  5DF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...