4WBGA

Crystal structure of class c beta-lactamase mox-1 covalently complexed with aztorenam
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
353
structure length
347
Chain Sequence
DPLRPVVDASIQPLLKEHRIPGMAVAVLKDGKAHYFNYGVANRESGASVSEQTLFEIGSVSKTLTATLGAYAVVKGAMQLDDKASRHAPWLKGSVFDSITMGELATYSAGGLPLQFPEEVDSSEKMRAYYRQWAPVYSPGSHRQYSNPSIGLFGHLAASSLKQPFAQLMEQTLLPGLGMHHTYVNVPKQAMASYAYGYSKEDKPIRVGMLADEAYGIKTSSADLLAFVKANIGGVDDKALQQAISLTHKGHYSVGGMTQGLGWESYAYPVTEQTLLAGNSAKVILEANPTAAPRQVLFNKTGSSNGFGAYVAFVPARGIGIVMLANRNYPIPARVKAAHAILAQLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Conformational Change Observed in the Active Site of Class C beta-Lactamase MOX-1 upon Binding to Aztreonam
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 110
structure length 347
sequence length 353
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4wbgA00
4GD8A 4WM9A 4CJNA 4KZ4A 1WYBA 3TSGA 3V39A 4XUZA 3VOYA 4EBPA 1IELA 4LV2A 2X01A 1ONGA 2Y2PA 4O7DA 2Y2GA 4MNRA 2ZQ8A 3RXWA 3IF6B 3IXHA 4A5RA 1IYOA 3NIAA 3WS0A 4BQMA 4X53A 1L0GA 2JBFA 3CZDA 4RX3A 5KSHA 4E3JA 1Q2PA 3P09A 4KZ8A 3ZG9B 2UWXA 4ZBEA 3SOIA 5JYOA 5L2FA 2JC7A 1KGFA 1ERQA 2Y4AA 4JXSA 3UPNA 5G18A 3Q1FA 2QMIA 5GLDA 4BD0A 3Q82A 1CEGA 1YLYA 2XH9A 1BT5A 4MBHA 4X69A 1IYQA 1YM1A 1W79A 1GA9A 2H10A 2ZC3B 1TEMA 4HESA 1NXYA 1LHYA 1U60A 4JF6A 4EUZA 3G30A 4GDNA 1NYMA 5FAOA 4KZ7A 3RXXA 5FDHA 4UA9A 1PIOA 4L0LA 5CGXA 4IEDA 3ITBA 1G6AA 5GLBA 2HP6A 2BG1A 3LEZA 5FQIA 3IWQA 3UE1A 3M6BA 4JXVA 5CEDA 1MXOA 4OQIA 3A3EA 5FI7A 5E2EA 2HDQA 4MBKA 4DRTA 4WZ5C 4WEJA 1EI5A 4KZ3A 4DE2A 1CEFA 1TVFA 2R9XA 1YLTA 1H5XA 4PM7A 5FATA 3UO9A 2J9PA 3WS2A 3EQVA 2JCHA 1Y54A 4GKUA 1VM1A 3UY6A 4E3OA 1LL9A 3ISGA 1MBLA 3HLWA 1BLSA 3RJUA 4ZTKA 3V50A 3VMAA 2J9OA 2X71A 3Q7VB 4OKPA 4OPRA 1G68A 1TDLA 1MWUA 3HLGA 3VFFA 2ZQDA 3BFFA 4WBGA 3NDGA 3MZDA 3WWXA 1JVJA 1YLPA 2PBYA 2WGWB 5CRFA 3ZNYA 4OOYA 5A92A 4QD4A 1FR1A 5D3OA 1BTLA 3DW0A 5EOOA 2Y91A 5EE8A 4R0QA 1XKZA 4GDBA 3ZNTA 1MWSA 4S2JA 1SKFA 2GDNA 4X6TA 3VOZA 5U47A 3G35A 3W4PA 4MBFA 2WGIA 5FQJA 4LCMA 1L0DA 4Z9QA 1ES4A 1JWZA 4R23A 4F94A 2E8IA 3IF6C 3SS3A 4DXCA 3IH9A 1BULA 3IXGA 4GD6A 4MEZA 2VGJA 1ZG4A 4FCFA 5A90A 5HAQA 4FH2A 4QJGA 4OQ0A 5KZHA 4OPZA 2Y2NA 2Y2HA 4E3NA 4WELA 4ID4A 1GHMA 2WK0A 4R3JA 3VP1A 4PM8A 4JLFA 4BJPA 2ZJ9A 4WZ5A 4IBRA 5EECA 1YLWA 3BFCA 1GHIA 5FASA 5KSCA 2I72A 4PM6A 2H0TA 2Y2JA 2Q9MA 1K56D 4DKIA 4HEFA 1PI5A 1KE0A 1K57C 1O07A 4YFMA 3ZGAB 5FI6A 3OPPA 5CHMA 3ZG0A 1CI9A 1W5DA 1FSYA 4ZJ3A 4HBTA 5E43A 4BLMA 1RGZA 4WYYA 4JF5A 3FKWA 2JE5A 1I2WA 1NJ4A 5CERA 5M1AA 5FQQA 3PAGA 4RX2A 2WAEA 4WMCD 2Z2MB 5JYPA 2EFXA 3SS4A 3IQAA 3AGEA 1N9BA 4P85A 4BD1A 4PMAA 2WAFA 1K25A 1NYYA 1PWCA 5FSRA 3VP3A 1FCMA 1LI0A 1YMSA 2WZXA 1IYPA 5CGSA 1ESUA 4BENA 3OCNA 1ES3A 4JXWA 2OLUA 1PYYA 2WKIA 4M3KA 1W8YA 4NETA 3G32A 4K0XA 1RP5A 3IF6A 2Y2OA 4KG6A 5GL9A 4K0WA 3PBSA 3W4QA 2EX8A 1SDEA 3AGDA 4OPQA 2Y55A 1DY6A 1E3UA 4Q8IA 3IXDA 5EUAA 2XDMA 3HL9A 4N1XA 2ZQAA 4OOMA 3A3IA 3D4FA 4FD8A 1PW1A 4QY5A 2HDRA 2IWDA 5EVID 3NY4A 2C5WB 4JF4A 4EBNA 4EWFA 2ZD8A 3MBZA 1NZOA 4FH4A 1KGGA 1KVMA 3AGFA 3S1YA 1K57A 5E2FA 4KENB 4ZDXA 3S22A 5E2HA 3V3RA 1SCWA 2J7VA 1K38A 2ZC5B 1K4FA 3M2KA 3P98A 1GHPA 3EQUA 3LCEA 4QY6A 1IEMA 1FR6A 3IF5A 3N7WA 1VQQA 2HDSA 3HLEA 3UNWA 2Y2IA 1BLHA 1YQSA 1YMXA 2H5SA 5DF8A 4UHUA 4EQIA 3UDXA 2XD5A 3BFEA 4QU3A 2Q9NA 5HW3A 5HAIA 1M6KA 1PWGA 5CGWA 1YLZA 3S4XA 4P6BA 4R4SA 3N8LA 3BFGA 1BUEA 1H8ZA 3IHBA 3QHYA 3C4PA 2P74A 5FQMA 2ZM8A 4FSFA 4DE1A 3O3VA 4KZAA 2PU2A 2HP5A 4H8RA 3Q7VA 3WS1A 3ZCZA 4CPKA 3C7UA 4UA6A 3GQZA 1XA7A 1C3BA 4GZBA 1BLPA 4Y0TA 5HAPA 3V3SA 2Y2KA 3W4OA 1L0EA 5F82A 5A93A 2WGWA 2RL3A 3JYIA 4R4RA 2Z2LB 4JXGA 1OMEA 4UA7A 3CG5A 4LV3A 3MKEA 4DF6A 1ONHA 4OONA 1AXBA 4WEKA 2DNSA 3WRTA 5CEBA 3FV7A 4JBFA 3UE3A 3VSKA 4KQOA 4D2OA 3QNCA 4S2MA 2P9VB 3OCLA 4KQQA 3UDIA 5BOHA 1BLCA 1ZKJA 3UPPA 1ES2A 4PPRA 1PI4A 4N1HA 1IKIA 1XGIA 4GNUA 4RVAA 4WZ4A 5FI2A 1SHVA 3OPRA 2ZC4B 2WYXA 3CJMA 5FA7A 3FYZA 3GV9A 3GTCA 4OPYA 4Y7PA 2WKHA 1I5QA 3TG9A 3VP0A 4DDSA 3BEBA 3ZDJA 4B88A 2HPBA 3A3DA 3PTEA 5DF7A 4PM5A 2HDUA 3HLCA 1BSGA 5HL1A 1L2SA 3PBRA 4U0XA 2IWCA 3GR2A 3GMWA 4UAAA 4KZ5A 3I7JA 4LV1A 4E6WA 2R9WA 1ES5A 2V1ZA 2XFSA 1XPBA 1FSWA 3G31A 2A3UA 1DJAA 3G34A 5EVIB 5A91A 1S6RA 2RCXA 5M19A 2ZLYA 3PBTA 5FAQA 1XP4A 3CMZA 3MZFA 2CC1A 3O88A 4JPMA 1QMEA 1H8YA 2DCFA 3BLMA 3HLFA 1WYCA 5E2GA 4JKTA 3FWLA 4OP5A 5TGFA 3NC8A 2XLNA 2Y2LA 2ZM2A 5F1GA 2OV5A 1ZG6A 4KG5A 1ERMA 4ZJ1A 2VGKA 1K55A 4GB7A 3BYDA 1MWTA 3BFDA 4NK3A 1PZOA 1XX2A 1MY8A 3A3FA 1KE3A 5DTTA 4S2NC 2WKEA 1JWVA 4MLLA 4QB8A 1KDWA 2PU4A 3IHAA 3HUOA 4RA7A 1NY0A 5KMWA 1K54A 5HARA 4ZJ2A 2XQZA 3C7VA 1MPLA 3WS5A 4DE0A 1WE4A 5CTNA 5EOEA 4BL3A 4B4XA 4DDYA 4C6YA 3OC2A 5F83A 5TFQA 3SH9A 4B4ZA 2FFFB 1JTGA 4X56A 3ZG8B 5HFOA 3BRMA 1NRFA 4PM9A 1CK3A 1LL5A 4XXRA 1HZOA 5GHYA 2ZMAA 2HP9A 4KZ9A 2ZC7A 2A49A 3NCKA 4K91A 3ITAA 4R1GA 4S2IA 4KZ6A 3V5MA 1MKIA 3DWKA 1CI8A 4N92A 4S2KA 1K6SA 1XGJA 4OH0A 4OVDA 4ZAMA 3MKFA 1TDGA 3QNBA 3UDFA 3OPHA 1Z6FA 2OLVA 3PBQA 3ZVTA 3IH8A 1EROA 5M18A 3IT9A 2EX2A 1FCNA 2WADA 3UE0A 3IXBA 5FAPA 2X02A 1LI9A 5F1FA 3HLBA 3LO7A 3C5AA 4LENA 4OOLA 1M40A 1FCOA 1KE4A 1RCJA 1PWDA 4LCLA 5EPHA 3HVFA 4X55A 3GSGA 4DE3A 1XXMA 2G2WA 3MZEA 2QZ6A 3VFHA 3C4OA 4YINA 2OSUA 4KQRA 2ZQCA 2ZC6B 3LY4A 4P87A 1ALQA 1GA0A 1Q2QA 4S2NA 1RGYA 3GVBA 3OZHA 1GCEA 1KGEA 2Y2MA 4S2OA 3VP4A 2EXBA 2XGNA 5EVIC 4EBLA 1YLJA 2EXAA 1I2SA 3N8SA 2XEPA 2XK1A 1S0WA 3HUMA 4OQHA 4E3MA 1FOFA 1K56A 2DRWA 3N6IA 3E2KA 2H0YA 1W7FA 3BM6A 1K6RA 2ZQ7A 4U0TA 2EX9A 2XFTA 1DJCA 5GLCA 1K55C 2FFYA 2B5RA 3MXRA 3Q81A 2ZQ9A 1PZPA 3O86A 3ZVWA 1KDSA 3WS4A 5TR7A 4IBXA 2IWBA 5HX9A 4WMCA 1ESIA 1K54C 4N9KA 3N4IA 5AQAA 1SDNA 1E3UD 4OQGA 1ZC2A 2XF3A 5FQKA 3SS5A 4S2LA 3BLSA 3LY3A 3M6HA 4LV0A 2P9VA 1PW8A 5IHVA 2XR0A 1EWZA 1IYSA 5DTSA 1W8QA 3DTMA 4OP8A 2QPNA 3HBRA 5GHZA 5DTKA 3HLDA 2EX6A 3VP2A 2WUQA 3PAEA 5I94A 3G2YA 3HUNA 2BLSA 4U3TA 1JWPA 1DJBA 3N8RA 3SH7A 5CXWA 1K4EA 2G2UA 1HVBA 3PBNA 3ZHHA 4RYEA 4E3LA 3B3XA 1QMFA 5EVLA 4DXBA 4IVKA 4S2PA 3HREA 3M2JA 3W8KA 1KVLA 4Y0UA 3Q07A 2V20A 4OLDA 5DF9A 1JTDA 5EVIA 1BZAA 3O87A 2J8YA 3IWOA 4R3BA 4C3QA 5DVAA 3FZCA 3G2ZA 4KG2A 1FQGA 3ZG7B 1YT4A 3NI9A 1E25A 3NBLA 5CHUA 1MWRA 1HTZA 4N9LA 4GOGA 5GHXA 4IVIA 1HD8A 4X68A 4P0MA 3UN7A 3ZFZA 3GRJA 3PBOA 4E3KA 5AQ7A 3NDEA 2EFUA 2WGVA 4OLGA 4E3IA 3DWZA 3WRZA 4KZBA 3MFDA 1N4OA 4QHCA 3OPLA 4C75A 4Y0OA 4BL2A 1XA1A 1J9MA 5CHJA 2C6WB 5AQ9A 1O7EA 4E6XA 3BECA 3FKVA 2WZZA 1E4DA 3UPOA 5FQ9A 3E2LA 3A3JA 3G4PA 4XUXA 1L0FA 3ZG5A 1LLBA 3IWIA 2XD1A 5J8XA 2Y2QA 3MXSA 3SH8A 4EV4A 5CTMA 2Y59A 1NZUA 4HBUA 3VSLA 5GLAA 5AQBA 3TOIA 5CECA 3Q7ZA 1IKGA 2V2FF 2ZM0A 4GN2A
chains in the Genus database with same CATH superfamily
3BY9A 4KZ4A 3EWKA 2X01A 2Y2PA 4O7DA 5HL6A 3IXHA 1IYOA 3NIAA 4BQMA 3NOPC 5KSHA 1Q2PA 4I39A 2VZWA 4XT2A 1KGFA 3VV4A 3UPNA 1G6OA 4NXGA 2KX6A 5GLDA 1BT5A 1YM1A 2ZC3B 1T18A 1TEMA 4EUZA 1G5UA 5FAOA 2Y79A 1PIOA 2K31A 1W63M 5CGXA 3UB5P 3MSHA 1G6AA 5GLBA 5EFWA 2BG1A 1EW0A 3M6BA 3LICA 4DRTA 4HP9A 1H5XA 2VKSA 5FATA 3UO9A 4BBVA 2JCHA 1Y54A 4E3OA 5TBMA 5J7EA 2X71A 2L0WA 3Q7VB 4OPRA 1MWUA 3BFFA 4D60A 3NDGA 1JVJA 1PRQA 5C5KA 5EV0A 4QD4A 4G3VA 1BTLA 4R0QA 1SKFA 3ZYTA 3W4PA 2WGIA 4LCMA 1ES4A 3A0SA 5IU1A 3S7NA 3IH9A 3R4KA 2DMWA 4ARZA 4HNBA 2LB9A 5KZHA 4E3NA 2Y2HA 2WK0A 3VP1A 4JLFA 3L9KA 4IBRA 5EECA 4PM6A 3EOIA 2H0TA 2ZMVA 4RQ9A 4HEFA 2Y8HA 2M7VA 1KE0A 3DTKA 1FSYA 3MS6A 4HBTA 4BLMA 4WYYA 4JF5A 3FKWA 3C30A 4WMCD 2WAEA 1Y28A 4Y15A 4WUJA 4PMAA 1PWCA 2VGLS 4EXOA 1FCMA 4Y13A 1LI0A 2W3EA 3IS2A 1OTDA 4NEED 3T4TA 4M3KA 4EESA 3IF6A 2JN7A 5GL9A 3BJNA 3T1RA 2EX8A 1SDEA 4R3AA 5EUAA 2XDMA 3A3IA 2KLIA 4K08A 2HDRA 2Z6CA 4CLCD 3NOUC 1LSVA 1NZOA 1P9WA 4FH4A 3V67A 1TD5A 5E2FA 4KENB 3S22A 2KDKA 2J3WA 1K4FA 4FOFA 4UEYA 1GHPA 3LCEA 4QY6A 2JKTI 2Y2IA 1BLHA 1YQSA 2H5SA 1XJ3A 2QJ5A 5FDSA 2XD5A 3CUEC 3LIBA 5HAIA 4Z1WA 1T1AA 2OOLA 3S4XA 4DE1A 4KZAA 4H8RA 5AVFA 3WS1A 4UA6A 2ZMFA 1C3BA 3EGXC 4Y0TA 5HAPA 2OWHA 3W4OA 3PR6A 1L0EA 5F82A 2WGWA 5HDCA 5G4ZA 1AXBA 4JBFA 4KQOA 4S2MA 2W3DA 2P9VB 3E0YA 4KQQA 3UDIA 5BOHA 4KUOA 1PI4A 3VE3A 4YOFA 4WZ4A 1XGIA 3OPRA 2WYXA 3TG9A 2GX5A 3VP0A 3BWLA 3RTYA 3ZDJA 4QWOA 5DF7A 5J3WA 3KSFA 3PBRA 4U0XA 3GMWA 3HCYA 3LYXA 3I7JA 4LV1A 5CX7A 1Z09A 2K2NA 1XPBA 1FSWA 5A91A 2RCXA 3IBRA 2Q0OA 3NOTC 4JPMA 3BLMA 5L09A 1N9LA 4OP5A 2P7JA 2L4RA 4KG5A 4H6JA 2B95A 3S7OA 2GNXA 1T1BA 3QP8A 3BYDA 3BFDA 4NK3A 1KE3A 5DTTA 1KDWA 3IHAA 3HUOA 3E4PA 3TRCA 5HARA 3EEAA 2HJ9C 4JGRA 3KO6A 1WE4A 4ETZA 1HLUP 2XA7S 3RFBA 4B4XA 5TFQA 3SH9A 4B4ZA 2O99A 4EEUA 5HDSA 3BRMA 4PM9A 4XXRA 4S2IA 4R1GA 4KZ6A 4X25A 3DWKA 3L7HA 3QP5A 2OLVA 3ZVTA 4KUKA 3IH8A 1LSWA 1IFQA 2WADA 3B47A 5F1FA 4XT2B 4I3JA 2WKPA 4LCLA 1A0KA 5EPHA 2HZ5A 1TF1A 2QZ6A 3LUQA 4HH2A 1GA0A 4WF0A 1GCEA 2ZL1A 2XGNA 1YLJA 1I2SA 4CLCC 3QP2A 2XK1A 3CPTA 1S0WA 2H0YA 3BM6A 2ZQ7A 1Y4OA 2EX9A 2XFTA 3LEQA 3MXRA 2V8CA 1PZPA 2HJEA 3MR0A 3EEHA 5TR7A 1CQAA 4IBXA 1K54C 1E3UD 4OQGA 1NLYA 1ZC2A 1S4SA 3T1QB 3BLSA 3LY3A 3M6HA 4LV0A 3H82A 3A0VA 1PW8A 2B02A 4OP8A 3HBRA 5I94A 4BWIA 2XROA 1PFLA 2FH5A 2R78A 1JWPA 3HUNA 3N8RA 2J3TD 5HZHA 1HVBA 5EM0A 3ZHHA 4E3LA 3B3XA 1CJFA 1GSVA 1QMFA 2PBDP 2UV0E 4KQDA 3HREA 3B42A 2V20A 2QJ7A 4ARZB 5EVIA 3UB9A 1BZAA 3O87A 3IWOA 4R3BA 3FZCA 3SW1A 3G2ZA 3UMDA 1YSPA 4EQ1A 4GOGA 1HD8A 4X68A 4P0MA 3UN7A 3ZFZA 4E3IA 2QKPA 4KZBA 1N4OA 4QHCA 4BL2A 2PDRA 5CHJA 1J9MA 5AQ9A 3LIAA 2WZZA 2FZ0A 3UPOA 3U2AA 4JGOA 3IX8A 4XUXA 3DBAA 1LLBA 2XD1A 4ME4A 2Y2QA 1OT9A 3SH8A 2NUPC 2EWWA 4WL9A 4HBUA 3VSLA 5GLAA 3TOIA 2V2FF 4WM9A 4CJNA 3IS2B 3V39A 3DTEA 4EBPA 4LV2A 3KSHA 1PNEA 4CLCE 2ZQ8A 3IF6B 4G3KA 4A5RA 1L0GA 2UWXA 5JYOA 2JC7A 4PKYA 5G18A 4UQIS 2XH9A 4MBHA 4X69A 1U60A 5DFXA 3MMHA 2HP6A 5FQIA 4OQIA 4MBKA 1XFQA 1EI5A 1CEFA 2R9XA 1YLTA 1IOUA 4PM7A 3EQVA 3UY6A 1LL9A 3ISGA 3LFVA 2O9BA 3HLWA 1BLSA 1JNUA 3RJUA 4ZTKA 3VMAA 4EEPA 2ZQDA 4O0PA 4WBGA 2PBYA 2WGWB 3G6OA 1OJ5A 5A92A 5EOOA 1D1JA 5EE8A 1XKZA 4GDBA 2GDNA 4X6TA 1S4RA 3F1PA 3G35A 2VLGA 4F94A 3T4LA 4GD6A 1BULA 5I5LA 2I9VA 4MEZA 4FCFA 4QJGA 4WELA 2QWSA 2ZJ9A 4WZ5A 1GHIA 5FASA 2I72A 2Q9MA 1K56D 1K57C 3ZGAB 5FI6A 5CHMA 4JGQA 3U4LP 1ZTUA 2QHKA 1RGZA 4YNRA 1I2WA 1NJ4A 5CERA 3S7QA 3PAGA 4RX2A 4H6JB 2Z2MB 4EETB 2EFXA 1TS6A 2WAFA 1K25A 1NYYA 2A24A 5FSRA 2WZXA 5CGSA 4FUWA 4HQAA 1ES3A 2VV6A 4II7A 2VJWA 5IT5A 2WKIA 3KSGA 2K7SA 2M1CA 4GS9A 3AGDA 4OPQA 1DY6A 1H3QA 5HD5A 3HL9A 2ZQAA 1PW1A 4QY5A 2IWDA 2W3GA 3IX3A 2C5WB 3T4KA 4EBNA 2ZOHA 4GW9A 4PKYG 1J3WA 5DFYA 3AGFA 3S1YA 3UMEA 3V3RA 2ZC5B 3EQUA 4P6ZS 1FR6A 3IF5A 1VQQA 2Z6DA 4DMZA 5DF8A 4EQIA 4O8GA 2P04A 4GLQA 1T19A 1M6KA 1F9IA 2ZL1B 5CGWA 4R4SA 3N8LA 3CPTB 2P74A 2CMNA 5FQMA 4FSFA 4L9FA 2PU2A 2HP5A 3GQZA 4GZBA 1BLPA 3V3SA 2Y2KA 3BQAA 3FPWA 2RL3A 3JYIA 4EUVA 3CG5A 4O01A 1ONHA 3WRTA 2DNSA 1VEUA 1XFNA 4PAUA 3QNCA 3H82B 3UPPA 1BYWA 1IKIA 4GNUA 3E4OA 4LRXC 1SHVA 5FI2A 3GV9A 4Y7PA 1I5QA 2P08A 3BEBA 4B88A 2HPBA 2PR6A 2HDUA 5HL1A 1L2SA 2IWCA 1D7EA 1YPRA 4E6WA 5EVIB 2W3HA 1DJAA 2A3UA 5M19A 4HP4A 3MF0A 4NG2A 4HIAA 1QMEA 1H8YA 2ACGA 5DKKA 5TGFA 2XLNA 1NWZA 1ERMA 3CWFA 2VGKA 1PZOA 4MLLA 5KMWA 2PU4A 5L07A 1K54A 4BBUA 1NLZA 3WS5A 4DDYA 2JKGA 2PD8A 1CK3A 5GHYA 2ZMAA 2HP9A 5DJUA 2ZC7A 4K91A 3ITAA 2INWA 4E04A 4OH0A 4OVDA 1TDGA 3QNBA 2QYBA 4G3WA 2PD7A 2EX2A 3C8CA 3LR5A 3NECA 5DKLA 4M4XA 1YKDA 1LI9A 3LO7A 3C5AA 4LENA 4OOLA 1F2KA 3JVUA 2NUTC 2W1TA 3C4OA 4YINA 4KQRA 5HWWA 4S2NA 1RGYA 1KGEA 3QP6A 4S2OA 3ICYA 3VP4A 4EBLA 2EXAA 1XJ4A 3N8SA 4B9OA 2XEPA 3T1SA 2BTFP 4OQHA 4E3MA 1FOFA 1ODVA 2DRWA 2L1MA 3E2KA 4FTXA 5LBRA 4PHTA 3F1OA 5AQAA 2WKRA 4Q0IA 3SS5A 1OT6A 5IHVA 3RH8B 1IYSA 1W8QA 5GHZA 2WUQA 3G2YA 2VK3A 2G2UA 3F1PB 1G28A 3MQQA 5EVLA 4IVKA 4S2PA 3Q07A 2V0WA 3PHYA 2J8YA 1YT4A 3NI9A 5TJJA 1SZVA 3BQ8A 4OLGA 4F3LA 3DWZA 3MFDA 3OPLA 4C75A 1XA1A 4HI4A 3BECA 1FIKA 5FQ9A 5A8BA 4IUKA 1L0FA 3MXSA 4EV4A 2JKTM 2A24B 5CECA 3Q7ZA 2ZM0A 4GD8A 3TSGA 4ESPA 4MN7A 1IELA 1ONGA 1D06A 5AVEA 2Y2GA 4MNRA 4GS9B 3WS0A 2VX8A 4X53A 2HGVA 3T4JA 4HJ4A 4RX3A 2ZBBA 3MQ0A 5HD3A 4E3JA 3P09A 4KZ8A 3ZG9B 4ZBEA 1ERQA 4BD0A 1ACFA 1CEGA 1YLYA 1S66L 1IYQA 3KSIA 5K5BA 1W79A 3DAVA 1GA9A 1NXYA 1LHYA 4GDNA 1UGUA 3RXXA 4KZ7A 5FDHA 4L9EA 4UA9A 4L0LA 3TJZC 4WLAA 1DRMA 4JXVA 5CEDA 5FI7A 5E2EA 2HDQA 4KZ3A 1N9NA 3FC7A 1MKMA 3WS2A 5HPFA 4GJ4A 4GKUA 1VM1A 1P97A 1MBLA 3V50A 2J9OA 3LR0A 2HV1A 3VFFA 3HLGA 1LL8A 4NXEA 4Q0HA 2OWJA 1NRJA 3ZNYA 4OOYA 1FR1A 3LR3A 3DW0A 2Y91A 1VEUB 4S2JA 2VGLM 5U47A 5FQJA 1L0DA 4Z9QA 4YWZA 1JWZA 3IF6C 2H28A 3R7WA 1ZG4A 3LIFA 5A90A 3VE4A 3SZTA 2EWVA 3BY8A 4PM8A 4BJPA 4HH3A 3BFCA 4GHIA 1PI5A 4X1MA 4NXFA 1CI9A 1W5DA 5E43A 1K0KA 5M1AA 4ETXA 5FQQA 5JYPA 3K3DA 1T1CA 1N9BA 4P85A 4NXBA 4BD1A 4I5SA 1VETA 3T4SA 1IYPA 1ESUA 1UWPX 2OLUA 1PYYA 1W8YA 3G32A 3ULFA 1RP5A 2Y2OA 4KG6A 4QPRA 1VHMA 3W4QA 1V9ZA 2Y55A 3UE6A 4Q8IA 3IXDA 3IBJA 3OOVA 5HWVA 4N1XA 4OOMA 4FD8A 5EVID 3NY4A 4JF4A 3MBZA 1OPXA 1KGGA 1KVMA 3K2NA 2J7VA 1K38A 3MJQA 1UWNX 3M2KA 4IJGA 1IEMA 3N7WA 3UNWA 2W1TB 4UHUA 4LRZE 3UDXA 3T1XA 3BFEA 2Q9NA 5HW3A 3P7NA 1PWGA 1YLZA 4I3IA 3C2WA 3BFGA 1BUEA 1H8ZA 4DJ2A 3O3VA 4HY8A 3F1NA 3C7UA 1XA7A 1FILA 5A93A 4MN6A 3F1OB 4R4RA 3MKEA 2JKFA 4OONA 3UB8A 3FV7A 3UE3A 3QP1A 5EM1A 1BLCA 1ZKJA 2VA0A 4PPRA 4N1HA 4RVAA 2PHYA 3O5YA 3CJMA 3FYZA 3LI8A 2JKRM 1OTEA 2WKHA 2XA7M 3PTEA 3HLCA 3GR2A 3CUEA 3EGDC 4UAAA 3D3OA 1ES5A 2V1ZA 3G31A 4R6LA 1F98A 5HPIA 1S6RA 2ZLYA 3PBTA 2J3TC 1XP4A 3CMZA 1OTIA 2DCFA 3HJKA 3KYZA 3LR4A 5E2GA 3FWLA 2V1BA 2ZM2A 2OV5A 5DJTA 4F3LB 4Y2FA 4ZJ1A 4HJ6A 4GB7A 3A3FA 2PR5A 2V1AA 1JWVA 4DE3A 4RA7A 1NY0A 3OLOA 2XQZA 3C7VA 1MPLA 4DE0A 4WN5A 5CTNA 2E8JA 1DP9A 3OC2A 5F83A 2FFFB 4IHQA 1NRFA 3B33A 1HZOA 2PAVP 3NCKA 2A49A 1MKIA 3KYEA 1K6SA 3MKFA 3UDFA 3OPHA 1Z6FA 3PBQA 1DP6A 5M18A 3IXBA 3VOLA 4DJ3A 2X02A 4NKPA 3HLBA 1M40A 3T4QA 4AFIA 1PWDA 4X55A 3GSGA 3S7PA 3NJAA 3VFHA 1LSXA 1P9RA 3KYQA 2OSUA 1Q2QA 4I38A 3GVBA 2EXBA 3LI9A 5EVIC 1VB6A 3OBFA 1DJCA 5GLCA 1K55C 3Q81A 2B5RA 2ZQ9A 3O86A 3ZVWA 3WS4A 2IWBA 5HX9A 4WMCA 1ESIA 4N9KA 3N4IA 1SDNA 2XF3A 2IA2A 5FQKA 4S2LA 3T12B 1EWZA 5DTSA 2QPNA 5DTKA 2YKFA 3HLDA 3C38A 2EX6A 3K3CA 3PAEA 3VP2A 3SH7A 5CXWA 4RYEA 3BW6A 2XSSA 5G4YA 3M2JA 5L8MA 4MN5A 5DF9A 3R7WB 4C3QA 4CLCA 4KG2A 3ZG7B 5J4EA 5CHUA 1E25A 1MWRA 1HTZA 5GHXA 1STZA 4IVIA 1CF0A 4MDZA 3GRJA 3PBOA 4GHIB 5AQ7A 2EFUA 2WGVA 2O9CA 4UQIM 4Y0OA 1O7EA 3FKVA 1E4DA 5HSQA 3E2LA 3A3JA 3G4PA 3ZG5A 5J8XA 5CTMA 2Y59A 3MQOA 5AQBA 1VETB 4GN2A 3H7WA 1WYBA 4XUZA 3VOYA 2WKQA 3RXWA 2ZOIA 2D02A 2JBFA 3CZDA 2GZAA 4DN0A 2XRNA 3SOIA 5L2FA 4EW7A 2Y4AA 4JXSA 3Q1FA 2QMIA 3Q82A 4L9GA 5L10A 1S1ZA 2H10A 4HESA 4JF6A 3G30A 1NYMA 4LFUA 4IEDA 3ITBA 5F69A 4CQHA 3LEZA 3IWQA 3UE1A 1MXOA 1TS7A 3A3EA 3CAXA 4WZ5C 4WEJA 4DE2A 5EVEA 1TVFA 2J9PA 4Y17A 1XJ6A 1W63Q 2VV7A 5MC7A 3CLOA 1KOUA 3F1NB 4OKPA 1G68A 1TDLA 3GDIA 3MZDA 3WWXA 1S1YA 1YLPA 5CRFA 2LB5A 4BBTA 5D3OA 5HWTA 1MC0A 3ZNTA 1MWSA 3VOZA 4MBFA 1DP8A 4Y3IA 4R23A 4HHDA 1OTAA 2E8IA 3SS3A 1H0MA 4DXCA 3IXGA 2VGJA 5HAQA 5FEFA 4FH2A 4OQ0A 1V9YA 2Y2NA 4OPZA 4ID4A 1GHMA 4R3JA 2W27A 4Y5FA 1OTBA 1SKOA 1XJ2A 1YLWA 5KSCA 2Y2JA 4DKIA 3CHWP 1O07A 4YFMA 3OPPA 3ZG0A 3IX4A 4ZJ3A 2JHEA 2JE5A 2KOIA 4P6ZM 3W2ZA 3SS4A 2GJ3A 3IQAA 3AGEA 3VP3A 3NHQA 1YMSA 4BENA 3LGOA 3OCNA 4JXWA 1GSXA 3LIEA 4NETA 4K0XA 4K0WA 3PBSA 2W0NA 1E3UA 3D72A 4EERA 4R38A 3D4FA 5F68A 2PYPA 4EWFA 2G7UA 2ZD8A 3FG8A 1ZHHB 1K57A 4ZDXA 4X1LA 5E2HA 1SCWA 2M7UA 3P98A 2HDSA 3HLEA 1YMXA 4QU3A 1TS8A 4EU0A 1P0ZA 3CI6A 4P6BA 1GSWA 3IHBA 3QHYA 3C4PA 2BASA 2ZM8A 3QP4A 2J80A 3Q7VA 3ZCZA 3TW8A 4CPKA 4I3AA 2PRFA 3MXQA 3E4QA 1F5MA 2Z2LB 4JXGA 1OMEA 4UA7A 4LV3A 5CEBA 5TBMB 4WEKA 4DF6A 2PT7A 4Q0JA 3VSKA 5FL3A 1N9OA 4D2OA 3OCLA 2O0YA 1ES2A 3PXPA 4BMWA 3DTIA 2ZC4B 5FA7A 3GTCA 4OPYA 4DDSA 4LGWA 3A3DA 4PM5A 2OAP1 4GCZA 1BSGA 4LRYC 3GECA 3MFXA 4KZ5A 2R9WA 2XFSA 1OJGA 3G34A 4CLCB 5FAQA 3MZFA 2CC1A 2W1RA 3O88A 3HLFA 1WYCA 4LLOB 3HJIA 4JKTA 3T4OA 3NC8A 2Y2LA 5F1GA 2V8FA 1ZG6A 2B18A 2VEAA 3D9YA 5IS1A 3TE8A 1K55A 2D01A 1MWTA 1XX2A 1MY8A 2AVXA 4S2NC 2WKEA 4QB8A 3UB7A 2YKHA 3E98A 4ZJ2A 3FPVA 2JKRI 5EOEA 4BL3A 1MZUA 4C6YA 2V0UA 1JTGA 4X56A 3ZG8B 5HFOA 1LL5A 4KZ9A 3LIDA 3V5MA 3H7WB 1CI8A 4N92A 5F6AA 4S2KA 1L3LA 1XGJA 4ZAMA 5F5YA 2W3FA 2EA9A 1EROA 3IT9A 1FCNA 3UE0A 5FAPA 5KIZA 5FEGA 3H9WA 4HJ3A 1FCOA 1KE4A 1RCJA 2A2LA 3HVFA 1XXMA 2G2WA 3NULA 3MZEA 3KX0X 1YSQA 2ZQCA 2ZC6B 3LY4A 4P87A 1ALQA 3OZHA 2Y2MA 1TS0A 4R70A 4B93A 4ZRRA 3HUMA 4MMNA 3JPUA 2MJ6A 1K56A 3N6IA 1W7FA 1K6RA 4U0TA 3JVVA 2FFYA 4MCWA 4IUHA 1KDSA 2V9AA 3P01A 1WA9A 4JGPA 3ZQ5A 2P9VA 2XR0A 3DTMA 1X0OA 2BLSA 4U3TA 1YAXA 5HDDA 1DJBA 1K4EA 3PBNA 4DXBA 3W8KA 1KVLA 4Y0UA 2PYRA 1H8MA 1LT0A 4OLDA 1JTDA 4HOIA 2VV8A 2HF6A 5DVAA 3UB6A 1AWIA 1FQGA 3NBLA 4N9LA 3T50A 1SKOB 4E3KA 3NDEA 2O9AA 3WRZA 2C6WB 4E6XA 3PYPA 1S67L 3A0RA 3IWIA 2OAQ1 3CITA 5AJGA 4LPZA 1NZUA 1IKGA
chains in the Genus database with same CATH topology
4GD8A 4WM9A 4CJNA 4KZ4A 1WYBA 3TSGA 3V39A 4XUZA 3VOYA 4EBPA 1IELA 4LV2A 2X01A 1ONGA 2Y2PA 4O7DA 2Y2GA 4MNRA 2ZQ8A 3RXWA 3IF6B 3IXHA 4A5RA 1IYOA 3NIAA 3WS0A 4BQMA 4X53A 1L0GA 2JBFA 3CZDA 4RX3A 5KSHA 4E3JA 1Q2PA 3P09A 4KZ8A 3ZG9B 2UWXA 4ZBEA 3SOIA 5JYOA 5L2FA 2JC7A 1KGFA 1ERQA 2Y4AA 4JXSA 3UPNA 5G18A 3Q1FA 2QMIA 5GLDA 4BD0A 3Q82A 1CEGA 1YLYA 2XH9A 1BT5A 4MBHA 4X69A 1IYQA 1YM1A 1W79A 1GA9A 2H10A 2ZC3B 1TEMA 4HESA 1NXYA 1LHYA 1U60A 4JF6A 4EUZA 3G30A 4GDNA 1NYMA 5FAOA 4KZ7A 3RXXA 5FDHA 4UA9A 1PIOA 4L0LA 5CGXA 4IEDA 3ITBA 1G6AA 5GLBA 2HP6A 2BG1A 3LEZA 5FQIA 3IWQA 3UE1A 3M6BA 4JXVA 5CEDA 1MXOA 4OQIA 3A3EA 5FI7A 5E2EA 2HDQA 4MBKA 4DRTA 4WZ5C 4WEJA 1EI5A 4KZ3A 4DE2A 1CEFA 1TVFA 2R9XA 1YLTA 1H5XA 4PM7A 5FATA 3UO9A 2J9PA 3WS2A 3EQVA 2JCHA 1Y54A 4GKUA 1VM1A 3UY6A 4E3OA 1LL9A 3ISGA 1MBLA 3HLWA 1BLSA 3RJUA 4ZTKA 3V50A 3VMAA 2J9OA 2X71A 3Q7VB 4OKPA 4OPRA 1G68A 1TDLA 1MWUA 3HLGA 3VFFA 2ZQDA 3BFFA 4WBGA 3NDGA 3MZDA 3WWXA 1JVJA 1YLPA 2PBYA 2WGWB 5CRFA 3ZNYA 4OOYA 5A92A 4QD4A 1FR1A 5D3OA 1BTLA 3DW0A 5EOOA 2Y91A 5EE8A 4R0QA 1XKZA 4GDBA 3ZNTA 1MWSA 4S2JA 1SKFA 2GDNA 4X6TA 3VOZA 5U47A 3G35A 3W4PA 4MBFA 2WGIA 5FQJA 4LCMA 1L0DA 4Z9QA 1ES4A 1JWZA 4R23A 4F94A 2E8IA 3IF6C 3SS3A 4DXCA 3IH9A 1BULA 3IXGA 4GD6A 4MEZA 2VGJA 1ZG4A 4FCFA 5A90A 5HAQA 4FH2A 4QJGA 4OQ0A 5KZHA 4OPZA 2Y2NA 2Y2HA 4E3NA 4WELA 4ID4A 1GHMA 2WK0A 4R3JA 3VP1A 4PM8A 4JLFA 4BJPA 2ZJ9A 4WZ5A 4IBRA 5EECA 1YLWA 3BFCA 1GHIA 5FASA 5KSCA 2I72A 4PM6A 2H0TA 2Y2JA 2Q9MA 1K56D 4DKIA 4HEFA 1PI5A 1KE0A 1K57C 1O07A 4YFMA 3ZGAB 5FI6A 3OPPA 5CHMA 3ZG0A 1CI9A 1W5DA 1FSYA 4ZJ3A 4HBTA 5E43A 4BLMA 1RGZA 4WYYA 4JF5A 3FKWA 2JE5A 1I2WA 1NJ4A 5CERA 5M1AA 5FQQA 3PAGA 4RX2A 2WAEA 4WMCD 2Z2MB 5JYPA 2EFXA 3SS4A 3IQAA 3AGEA 1N9BA 4P85A 4BD1A 4PMAA 2WAFA 1K25A 1NYYA 1PWCA 5FSRA 3VP3A 1FCMA 1LI0A 1YMSA 2WZXA 1IYPA 5CGSA 1ESUA 4BENA 3OCNA 1ES3A 4JXWA 2OLUA 1PYYA 2WKIA 4M3KA 1W8YA 4NETA 3G32A 4K0XA 1RP5A 3IF6A 2Y2OA 4KG6A 5GL9A 4K0WA 3PBSA 3W4QA 2EX8A 1SDEA 3AGDA 4OPQA 2Y55A 1DY6A 1E3UA 4Q8IA 3IXDA 5EUAA 2XDMA 3HL9A 4N1XA 2ZQAA 4OOMA 3A3IA 3D4FA 4FD8A 1PW1A 4QY5A 2HDRA 2IWDA 5EVID 3NY4A 2C5WB 4JF4A 4EBNA 4EWFA 2ZD8A 3MBZA 1NZOA 4FH4A 1KGGA 1KVMA 3AGFA 3S1YA 1K57A 5E2FA 4KENB 4ZDXA 3S22A 5E2HA 3V3RA 1SCWA 2J7VA 1K38A 2ZC5B 1K4FA 3M2KA 3P98A 1GHPA 3EQUA 3LCEA 4QY6A 1IEMA 1FR6A 3IF5A 3N7WA 1VQQA 2HDSA 3HLEA 3UNWA 2Y2IA 1BLHA 1YQSA 1YMXA 2H5SA 5DF8A 4UHUA 4EQIA 3UDXA 2XD5A 3BFEA 4QU3A 2Q9NA 5HW3A 5HAIA 1M6KA 1PWGA 5CGWA 1YLZA 3S4XA 4P6BA 4R4SA 3N8LA 3BFGA 1BUEA 1H8ZA 3IHBA 3QHYA 3C4PA 2P74A 5FQMA 2ZM8A 4FSFA 4DE1A 3O3VA 4KZAA 2PU2A 2HP5A 4H8RA 3Q7VA 3WS1A 3ZCZA 4CPKA 3C7UA 4UA6A 3GQZA 1XA7A 1C3BA 4GZBA 1BLPA 4Y0TA 5HAPA 3V3SA 2Y2KA 3W4OA 1L0EA 5F82A 5A93A 2WGWA 2RL3A 3JYIA 4R4RA 2Z2LB 4JXGA 1OMEA 4UA7A 3CG5A 4LV3A 3MKEA 4DF6A 1ONHA 4OONA 1AXBA 4WEKA 2DNSA 3WRTA 5CEBA 3FV7A 4JBFA 3UE3A 3VSKA 4KQOA 4D2OA 3QNCA 4S2MA 2P9VB 3OCLA 4KQQA 3UDIA 5BOHA 1BLCA 1ZKJA 3UPPA 1ES2A 4PPRA 1PI4A 4N1HA 1IKIA 1XGIA 4GNUA 4RVAA 4WZ4A 5FI2A 1SHVA 3OPRA 2ZC4B 2WYXA 3CJMA 5FA7A 3FYZA 3GV9A 3GTCA 4OPYA 4Y7PA 2WKHA 1I5QA 3TG9A 3VP0A 4DDSA 3BEBA 3ZDJA 4B88A 2HPBA 3A3DA 3PTEA 5DF7A 4PM5A 2HDUA 3HLCA 1BSGA 5HL1A 1L2SA 3PBRA 4U0XA 2IWCA 3GR2A 3GMWA 4UAAA 4KZ5A 3I7JA 4LV1A 4E6WA 2R9WA 1ES5A 2V1ZA 2XFSA 1XPBA 1FSWA 3G31A 2A3UA 1DJAA 3G34A 5EVIB 5A91A 1S6RA 2RCXA 5M19A 2ZLYA 3PBTA 5FAQA 1XP4A 3CMZA 3MZFA 2CC1A 3O88A 4JPMA 1QMEA 1H8YA 2DCFA 3BLMA 3HLFA 1WYCA 5E2GA 4JKTA 3FWLA 4OP5A 5TGFA 3NC8A 2XLNA 2Y2LA 2ZM2A 5F1GA 2OV5A 1ZG6A 4KG5A 1ERMA 4ZJ1A 2VGKA 1K55A 4GB7A 3BYDA 1MWTA 3BFDA 4NK3A 1PZOA 1XX2A 1MY8A 3A3FA 1KE3A 5DTTA 4S2NC 2WKEA 1JWVA 4MLLA 4QB8A 1KDWA 2PU4A 3IHAA 3HUOA 4RA7A 1NY0A 5KMWA 1K54A 5HARA 4ZJ2A 2XQZA 3C7VA 1MPLA 3WS5A 4DE0A 1WE4A 5CTNA 5EOEA 4BL3A 4B4XA 4DDYA 4C6YA 3OC2A 5F83A 5TFQA 3SH9A 4B4ZA 2FFFB 1JTGA 4X56A 3ZG8B 5HFOA 3BRMA 1NRFA 4PM9A 1CK3A 1LL5A 4XXRA 1HZOA 5GHYA 2ZMAA 2HP9A 4KZ9A 2ZC7A 2A49A 3NCKA 4K91A 3ITAA 4R1GA 4S2IA 4KZ6A 3V5MA 1MKIA 3DWKA 1CI8A 4N92A 4S2KA 1K6SA 1XGJA 4OH0A 4OVDA 4ZAMA 3MKFA 1TDGA 3QNBA 3UDFA 3OPHA 1Z6FA 2OLVA 3PBQA 3ZVTA 3IH8A 1EROA 5M18A 3IT9A 2EX2A 1FCNA 2WADA 3UE0A 3IXBA 5FAPA 2X02A 1LI9A 5F1FA 3HLBA 3LO7A 3C5AA 4LENA 4OOLA 1M40A 1FCOA 1KE4A 1RCJA 1PWDA 4LCLA 5EPHA 3HVFA 4X55A 3GSGA 4DE3A 1XXMA 2G2WA 3MZEA 2QZ6A 3VFHA 3C4OA 4YINA 2OSUA 4KQRA 2ZQCA 2ZC6B 3LY4A 4P87A 1ALQA 1GA0A 1Q2QA 4S2NA 1RGYA 3GVBA 3OZHA 1GCEA 1KGEA 2Y2MA 4S2OA 3VP4A 2EXBA 2XGNA 5EVIC 4EBLA 1YLJA 2EXAA 1I2SA 3N8SA 2XEPA 2XK1A 1S0WA 3HUMA 4OQHA 4E3MA 1FOFA 1K56A 2DRWA 3N6IA 3E2KA 2H0YA 1W7FA 3BM6A 1K6RA 2ZQ7A 4U0TA 2EX9A 2XFTA 1DJCA 5GLCA 1K55C 2FFYA 2B5RA 3MXRA 3Q81A 2ZQ9A 1PZPA 3O86A 3ZVWA 1KDSA 3WS4A 5TR7A 4IBXA 2IWBA 5HX9A 4WMCA 1ESIA 1K54C 4N9KA 3N4IA 5AQAA 1SDNA 1E3UD 4OQGA 1ZC2A 2XF3A 5FQKA 3SS5A 4S2LA 3BLSA 3LY3A 3M6HA 4LV0A 2P9VA 1PW8A 5IHVA 2XR0A 1EWZA 1IYSA 5DTSA 1W8QA 3DTMA 4OP8A 2QPNA 3HBRA 5GHZA 5DTKA 3HLDA 2EX6A 3VP2A 2WUQA 3PAEA 5I94A 3G2YA 3HUNA 2BLSA 4U3TA 1JWPA 1DJBA 3N8RA 3SH7A 5CXWA 1K4EA 2G2UA 1HVBA 3PBNA 3ZHHA 4RYEA 4E3LA 3B3XA 1QMFA 5EVLA 4DXBA 4IVKA 4S2PA 3HREA 3M2JA 3W8KA 1KVLA 4Y0UA 3Q07A 2V20A 4OLDA 5DF9A 1JTDA 5EVIA 1BZAA 3O87A 2J8YA 3IWOA 4R3BA 4C3QA 5DVAA 3FZCA 3G2ZA 4KG2A 1FQGA 3ZG7B 1YT4A 3NI9A 1E25A 3NBLA 5CHUA 1MWRA 1HTZA 4N9LA 4GOGA 5GHXA 4IVIA 1HD8A 4X68A 4P0MA 3UN7A 3ZFZA 3GRJA 3PBOA 4E3KA 5AQ7A 3NDEA 2EFUA 2WGVA 4OLGA 4E3IA 3DWZA 3WRZA 4KZBA 3MFDA 1N4OA 4QHCA 3OPLA 4C75A 4Y0OA 4BL2A 1XA1A 1J9MA 5CHJA 2C6WB 5AQ9A 1O7EA 4E6XA 3BECA 3FKVA 2WZZA 1E4DA 3UPOA 5FQ9A 3E2LA 3A3JA 3G4PA 4XUXA 1L0FA 3ZG5A 1LLBA 3IWIA 2XD1A 5J8XA 2Y2QA 3MXSA 3SH8A 4EV4A 5CTMA 2Y59A 1NZUA 4HBUA 3VSLA 5GLAA 5AQBA 3TOIA 5CECA 3Q7ZA 1IKGA 2V2FF 2ZM0A 4GN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GD8 A;  4WM9 A;  4CJN A;  4KZ4 A;  1WYB A;  3TSG A;  3V39 A;  4XUZ A;  3VOY A;  4EBP A;  1IEL A;  4LV2 A;  2X01 A;  1ONG A;  2Y2P A;  4O7D A;  2Y2G A;  4MNR A;  2ZQ8 A;  3RXW A;  3IF6 B;  3IXH A;  4A5R A;  1IYO A;  3NIA A;  3WS0 A;  4BQM A;  4X53 A;  1L0G A;  2JBF A;  3CZD A;  4RX3 A;  5KSH A;  4E3J A;  1Q2P A;  3P09 A;  4KZ8 A;  3ZG9 B;  2UWX A;  4ZBE A;  3SOI A;  5JYO A;  5L2F A;  2JC7 A;  1KGF A;  1ERQ A;  2Y4A A;  4JXS A;  3UPN A;  5G18 A;  3Q1F A;  2QMI A;  5GLD A;  4BD0 A;  3Q82 A;  1CEG A;  1YLY A;  2XH9 A;  1BT5 A;  4MBH A;  4X69 A;  1IYQ A;  1YM1 A;  1W79 A;  1GA9 A;  2H10 A;  2ZC3 B;  1TEM A;  4HES A;  1NXY A;  1LHY A;  1U60 A;  4JF6 A;  4EUZ A;  3G30 A;  4GDN A;  1NYM A;  5FAO A;  4KZ7 A;  3RXX A;  5FDH A;  4UA9 A;  1PIO A;  4L0L A;  5CGX A;  4IED A;  3ITB A;  1G6A A;  5GLB A;  2HP6 A;  2BG1 A;  3LEZ A;  5FQI A;  3IWQ A;  3UE1 A;  3M6B A;  4JXV A;  5CED A;  1MXO A;  4OQI A;  3A3E A;  5FI7 A;  5E2E A;  2HDQ A;  4MBK A;  4DRT A;  4WZ5 C;  4WEJ A;  1EI5 A;  4KZ3 A;  4DE2 A;  1CEF A;  1TVF A;  2R9X A;  1YLT A;  1H5X A;  4PM7 A;  5FAT A;  3UO9 A;  2J9P A;  3WS2 A;  3EQV A;  2JCH A;  1Y54 A;  4GKU A;  1VM1 A;  3UY6 A;  4E3O A;  1LL9 A;  3ISG A;  1MBL A;  3HLW A;  1BLS A;  3RJU A;  4ZTK A;  3V50 A;  3VMA A;  2J9O A;  2X71 A;  3Q7V B;  4OKP A;  4OPR A;  1G68 A;  1TDL A;  1MWU A;  3HLG A;  3VFF A;  2ZQD A;  3BFF A;  4WBG A;  3NDG A;  3MZD A;  3WWX A;  1JVJ A;  1YLP A;  2PBY A;  2WGW B;  5CRF A;  3ZNY A;  4OOY A;  5A92 A;  4QD4 A;  1FR1 A;  5D3O A;  1BTL A;  3DW0 A;  5EOO A;  2Y91 A;  5EE8 A;  4R0Q A;  1XKZ A;  4GDB A;  3ZNT A;  1MWS A;  4S2J A;  1SKF A;  2GDN A;  4X6T A;  3VOZ A;  5U47 A;  3G35 A;  3W4P A;  4MBF A;  2WGI A;  5FQJ A;  4LCM A;  1L0D A;  4Z9Q A;  1ES4 A;  1JWZ A;  4R23 A;  4F94 A;  2E8I A;  3IF6 C;  3SS3 A;  4DXC A;  3IH9 A;  1BUL A;  3IXG A;  4GD6 A;  4MEZ A;  2VGJ A;  1ZG4 A;  4FCF A;  5A90 A;  5HAQ A;  4FH2 A;  4QJG A;  4OQ0 A;  5KZH A;  4OPZ A;  2Y2N A;  2Y2H A;  4E3N A;  4WEL A;  4ID4 A;  1GHM A;  2WK0 A;  4R3J A;  3VP1 A;  4PM8 A;  4JLF A;  4BJP A;  2ZJ9 A;  4WZ5 A;  4IBR A;  5EEC A;  1YLW A;  3BFC A;  1GHI A;  5FAS A;  5KSC A;  2I72 A;  4PM6 A;  2H0T A;  2Y2J A;  2Q9M A;  1K56 D;  4DKI A;  4HEF A;  1PI5 A;  1KE0 A;  1K57 C;  1O07 A;  4YFM A;  3ZGA B;  5FI6 A;  3OPP A;  5CHM A;  3ZG0 A;  1CI9 A;  1W5D A;  1FSY A;  4ZJ3 A;  4HBT A;  5E43 A;  4BLM A;  1RGZ A;  4WYY A;  4JF5 A;  3FKW A;  2JE5 A;  1I2W A;  1NJ4 A;  5CER A;  5M1A A;  5FQQ A;  3PAG A;  4RX2 A;  2WAE A;  4WMC D;  2Z2M B;  5JYP A;  2EFX A;  3SS4 A;  3IQA A;  3AGE A;  1N9B A;  4P85 A;  4BD1 A;  4PMA A;  2WAF A;  1K25 A;  1NYY A;  1PWC A;  5FSR A;  3VP3 A;  1FCM A;  1LI0 A;  1YMS A;  2WZX A;  1IYP A;  5CGS A;  1ESU A;  4BEN A;  3OCN A;  1ES3 A;  4JXW A;  2OLU A;  1PYY A;  2WKI A;  4M3K A;  1W8Y A;  4NET A;  3G32 A;  4K0X A;  1RP5 A;  3IF6 A;  2Y2O A;  4KG6 A;  5GL9 A;  4K0W A;  3PBS A;  3W4Q A;  2EX8 A;  1SDE A;  3AGD A;  4OPQ A;  2Y55 A;  1DY6 A;  1E3U A;  4Q8I A;  3IXD A;  5EUA A;  2XDM A;  3HL9 A;  4N1X A;  2ZQA A;  4OOM A;  3A3I A;  3D4F A;  4FD8 A;  1PW1 A;  4QY5 A;  2HDR A;  2IWD A;  5EVI D;  3NY4 A;  2C5W B;  4JF4 A;  4EBN A;  4EWF A;  2ZD8 A;  3MBZ A;  1NZO A;  4FH4 A;  1KGG A;  1KVM A;  3AGF A;  3S1Y A;  1K57 A;  5E2F A;  4KEN B;  4ZDX A;  3S22 A;  5E2H A;  3V3R A;  1SCW A;  2J7V A;  1K38 A;  2ZC5 B;  1K4F A;  3M2K A;  3P98 A;  1GHP A;  3EQU A;  3LCE A;  4QY6 A;  1IEM A;  1FR6 A;  3IF5 A;  3N7W A;  1VQQ A;  2HDS A;  3HLE A;  3UNW A;  2Y2I A;  1BLH A;  1YQS A;  1YMX A;  2H5S A;  5DF8 A;  4UHU A;  4EQI A;  3UDX A;  2XD5 A;  3BFE A;  4QU3 A;  2Q9N A;  5HW3 A;  5HAI A;  1M6K A;  1PWG A;  5CGW A;  1YLZ A;  3S4X A;  4P6B A;  4R4S A;  3N8L A;  3BFG A;  1BUE A;  1H8Z A;  3IHB A;  3QHY A;  3C4P A;  2P74 A;  5FQM A;  2ZM8 A;  4FSF A;  4DE1 A;  3O3V A;  4KZA A;  2PU2 A;  2HP5 A;  4H8R A;  3Q7V A;  3WS1 A;  3ZCZ A;  4CPK A;  3C7U A;  4UA6 A;  3GQZ A;  1XA7 A;  1C3B A;  4GZB A;  1BLP A;  4Y0T A;  5HAP A;  3V3S A;  2Y2K A;  3W4O A;  1L0E A;  5F82 A;  5A93 A;  2WGW A;  2RL3 A;  3JYI A;  4R4R A;  2Z2L B;  4JXG A;  1OME A;  4UA7 A;  3CG5 A;  4LV3 A;  3MKE A;  4DF6 A;  1ONH A;  4OON A;  1AXB A;  4WEK A;  2DNS A;  3WRT A;  5CEB A;  3FV7 A;  4JBF A;  3UE3 A;  3VSK A;  4KQO A;  4D2O A;  3QNC A;  4S2M A;  2P9V B;  3OCL A;  4KQQ A;  3UDI A;  5BOH A;  1BLC A;  1ZKJ A;  3UPP A;  1ES2 A;  4PPR A;  1PI4 A;  4N1H A;  1IKI A;  1XGI A;  4GNU A;  4RVA A;  4WZ4 A;  5FI2 A;  1SHV A;  3OPR A;  2ZC4 B;  2WYX A;  3CJM A;  5FA7 A;  3FYZ A;  3GV9 A;  3GTC A;  4OPY A;  4Y7P A;  2WKH A;  1I5Q A;  3TG9 A;  3VP0 A;  4DDS A;  3BEB A;  3ZDJ A;  4B88 A;  2HPB A;  3A3D A;  3PTE A;  5DF7 A;  4PM5 A;  2HDU A;  3HLC A;  1BSG A;  5HL1 A;  1L2S A;  3PBR A;  4U0X A;  2IWC A;  3GR2 A;  3GMW A;  4UAA A;  4KZ5 A;  3I7J A;  4LV1 A;  4E6W A;  2R9W A;  1ES5 A;  2V1Z A;  2XFS A;  1XPB A;  1FSW A;  3G31 A;  2A3U A;  1DJA A;  3G34 A;  5EVI B;  5A91 A;  1S6R A;  2RCX A;  5M19 A;  2ZLY A;  3PBT A;  5FAQ A;  1XP4 A;  3CMZ A;  3MZF A;  2CC1 A;  3O88 A;  4JPM A;  1QME A;  1H8Y A;  2DCF A;  3BLM A;  3HLF A;  1WYC A;  5E2G A;  4JKT A;  3FWL A;  4OP5 A;  5TGF A;  3NC8 A;  2XLN A;  2Y2L A;  2ZM2 A;  5F1G A;  2OV5 A;  1ZG6 A;  4KG5 A;  1ERM A;  4ZJ1 A;  2VGK A;  1K55 A;  4GB7 A;  3BYD A;  1MWT A;  3BFD A;  4NK3 A;  1PZO A;  1XX2 A;  1MY8 A;  3A3F A;  1KE3 A;  5DTT A;  4S2N C;  2WKE A;  1JWV A;  4MLL A;  4QB8 A;  1KDW A;  2PU4 A;  3IHA A;  3HUO A;  4RA7 A;  1NY0 A;  5KMW A;  1K54 A;  5HAR A;  4ZJ2 A;  2XQZ A;  3C7V A;  1MPL A;  3WS5 A;  4DE0 A;  1WE4 A;  5CTN A;  5EOE A;  4BL3 A;  4B4X A;  4DDY A;  4C6Y A;  3OC2 A;  5F83 A;  5TFQ A;  3SH9 A;  4B4Z A;  2FFF B;  1JTG A;  4X56 A;  3ZG8 B;  5HFO A;  3BRM A;  1NRF A;  4PM9 A;  1CK3 A;  1LL5 A;  4XXR A;  1HZO A;  5GHY A;  2ZMA A;  2HP9 A;  4KZ9 A;  2ZC7 A;  2A49 A;  3NCK A;  4K91 A;  3ITA A;  4R1G A;  4S2I A;  4KZ6 A;  3V5M A;  1MKI A;  3DWK A;  1CI8 A;  4N92 A;  4S2K A;  1K6S A;  1XGJ A;  4OH0 A;  4OVD A;  4ZAM A;  3MKF A;  1TDG A;  3QNB A;  3UDF A;  3OPH A;  1Z6F A;  2OLV A;  3PBQ A;  3ZVT A;  3IH8 A;  1ERO A;  5M18 A;  3IT9 A;  2EX2 A;  1FCN A;  2WAD A;  3UE0 A;  3IXB A;  5FAP A;  2X02 A;  1LI9 A;  5F1F A;  3HLB A;  3LO7 A;  3C5A A;  4LEN A;  4OOL A;  1M40 A;  1FCO A;  1KE4 A;  1RCJ A;  1PWD A;  4LCL A;  5EPH A;  3HVF A;  4X55 A;  3GSG A;  4DE3 A;  1XXM A;  2G2W A;  3MZE A;  2QZ6 A;  3VFH A;  3C4O A;  4YIN A;  2OSU A;  4KQR A;  2ZQC A;  2ZC6 B;  3LY4 A;  4P87 A;  1ALQ A;  1GA0 A;  1Q2Q A;  4S2N A;  1RGY A;  3GVB A;  3OZH A;  1GCE A;  1KGE A;  2Y2M A;  4S2O A;  3VP4 A;  2EXB A;  2XGN A;  5EVI C;  4EBL A;  1YLJ A;  2EXA A;  1I2S A;  3N8S A;  2XEP A;  2XK1 A;  1S0W A;  3HUM A;  4OQH A;  4E3M A;  1FOF A;  1K56 A;  2DRW A;  3N6I A;  3E2K A;  2H0Y A;  1W7F A;  3BM6 A;  1K6R A;  2ZQ7 A;  4U0T A;  2EX9 A;  2XFT A;  1DJC A;  5GLC A;  1K55 C;  2FFY A;  2B5R A;  3MXR A;  3Q81 A;  2ZQ9 A;  1PZP A;  3O86 A;  3ZVW A;  1KDS A;  3WS4 A;  5TR7 A;  4IBX A;  2IWB A;  5HX9 A;  4WMC A;  1ESI A;  1K54 C;  4N9K A;  3N4I A;  5AQA A;  1SDN A;  1E3U D;  4OQG A;  1ZC2 A;  2XF3 A;  5FQK A;  3SS5 A;  4S2L A;  3BLS A;  3LY3 A;  3M6H A;  4LV0 A;  2P9V A;  1PW8 A;  5IHV A;  2XR0 A;  1EWZ A;  1IYS A;  5DTS A;  1W8Q A;  3DTM A;  4OP8 A;  2QPN A;  3HBR A;  5GHZ A;  5DTK A;  3HLD A;  2EX6 A;  3VP2 A;  2WUQ A;  3PAE A;  5I94 A;  3G2Y A;  3HUN A;  2BLS A;  4U3T A;  1JWP A;  1DJB A;  3N8R A;  3SH7 A;  5CXW A;  1K4E A;  2G2U A;  1HVB A;  3PBN A;  3ZHH A;  4RYE A;  4E3L A;  3B3X A;  1QMF A;  5EVL A;  4DXB A;  4IVK A;  4S2P A;  3HRE A;  3M2J A;  3W8K A;  1KVL A;  4Y0U A;  3Q07 A;  2V20 A;  4OLD A;  5DF9 A;  1JTD A;  5EVI A;  1BZA A;  3O87 A;  2J8Y A;  3IWO A;  4R3B A;  4C3Q A;  5DVA A;  3FZC A;  3G2Z A;  4KG2 A;  1FQG A;  3ZG7 B;  1YT4 A;  3NI9 A;  1E25 A;  3NBL A;  5CHU A;  1MWR A;  1HTZ A;  4N9L A;  4GOG A;  5GHX A;  4IVI A;  1HD8 A;  4X68 A;  4P0M A;  3UN7 A;  3ZFZ A;  3GRJ A;  3PBO A;  4E3K A;  5AQ7 A;  3NDE A;  2EFU A;  2WGV A;  4OLG A;  4E3I A;  3DWZ A;  3WRZ A;  4KZB A;  3MFD A;  1N4O A;  4QHC A;  3OPL A;  4C75 A;  4Y0O A;  4BL2 A;  1XA1 A;  1J9M A;  5CHJ A;  2C6W B;  5AQ9 A;  1O7E A;  4E6X A;  3BEC A;  3FKV A;  2WZZ A;  1E4D A;  3UPO A;  5FQ9 A;  3E2L A;  3A3J A;  3G4P A;  4XUX A;  1L0F A;  3ZG5 A;  1LLB A;  3IWI A;  2XD1 A;  5J8X A;  2Y2Q A;  3MXS A;  3SH8 A;  4EV4 A;  5CTM A;  2Y59 A;  1NZU A;  4HBU A;  3VSL A;  5GLA A;  5AQB A;  3TOI A;  5CEC A;  3Q7Z A;  1IKG A;  2V2F F;  2ZM0 A;  4GN2 A; 
#chains in the Genus database with same CATH topology
 3BY9 A;  4KZ4 A;  3EWK A;  2X01 A;  2Y2P A;  4O7D A;  5HL6 A;  3IXH A;  1IYO A;  3NIA A;  4BQM A;  3NOP C;  5KSH A;  1Q2P A;  4I39 A;  2VZW A;  4XT2 A;  1KGF A;  3VV4 A;  3UPN A;  1G6O A;  4NXG A;  2KX6 A;  5GLD A;  1BT5 A;  1YM1 A;  2ZC3 B;  1T18 A;  1TEM A;  4EUZ A;  1G5U A;  5FAO A;  2Y79 A;  1PIO A;  2K31 A;  1W63 M;  5CGX A;  3UB5 P;  3MSH A;  1G6A A;  5GLB A;  5EFW A;  2BG1 A;  1EW0 A;  3M6B A;  3LIC A;  4DRT A;  4HP9 A;  1H5X A;  2VKS A;  5FAT A;  3UO9 A;  4BBV A;  2JCH A;  1Y54 A;  4E3O A;  5TBM A;  5J7E A;  2X71 A;  2L0W A;  3Q7V B;  4OPR A;  1MWU A;  3BFF A;  4D60 A;  3NDG A;  1JVJ A;  1PRQ A;  5C5K A;  5EV0 A;  4QD4 A;  4G3V A;  1BTL A;  4R0Q A;  1SKF A;  3ZYT A;  3W4P A;  2WGI A;  4LCM A;  1ES4 A;  3A0S A;  5IU1 A;  3S7N A;  3IH9 A;  3R4K A;  2DMW A;  4ARZ A;  4HNB A;  2LB9 A;  5KZH A;  4E3N A;  2Y2H A;  2WK0 A;  3VP1 A;  4JLF A;  3L9K A;  4IBR A;  5EEC A;  4PM6 A;  3EOI A;  2H0T A;  2ZMV A;  4RQ9 A;  4HEF A;  2Y8H A;  2M7V A;  1KE0 A;  3DTK A;  1FSY A;  3MS6 A;  4HBT A;  4BLM A;  4WYY A;  4JF5 A;  3FKW A;  3C30 A;  4WMC D;  2WAE A;  1Y28 A;  4Y15 A;  4WUJ A;  4PMA A;  1PWC A;  2VGL S;  4EXO A;  1FCM A;  4Y13 A;  1LI0 A;  2W3E A;  3IS2 A;  1OTD A;  4NEE D;  3T4T A;  4M3K A;  4EES A;  3IF6 A;  2JN7 A;  5GL9 A;  3BJN A;  3T1R A;  2EX8 A;  1SDE A;  4R3A A;  5EUA A;  2XDM A;  3A3I A;  2KLI A;  4K08 A;  2HDR A;  2Z6C A;  4CLC D;  3NOU C;  1LSV A;  1NZO A;  1P9W A;  4FH4 A;  3V67 A;  1TD5 A;  5E2F A;  4KEN B;  3S22 A;  2KDK A;  2J3W A;  1K4F A;  4FOF A;  4UEY A;  1GHP A;  3LCE A;  4QY6 A;  2JKT I;  2Y2I A;  1BLH A;  1YQS A;  2H5S A;  1XJ3 A;  2QJ5 A;  5FDS A;  2XD5 A;  3CUE C;  3LIB A;  5HAI A;  4Z1W A;  1T1A A;  2OOL A;  3S4X A;  4DE1 A;  4KZA A;  4H8R A;  5AVF A;  3WS1 A;  4UA6 A;  2ZMF A;  1C3B A;  3EGX C;  4Y0T A;  5HAP A;  2OWH A;  3W4O A;  3PR6 A;  1L0E A;  5F82 A;  2WGW A;  5HDC A;  5G4Z A;  1AXB A;  4JBF A;  4KQO A;  4S2M A;  2W3D A;  2P9V B;  3E0Y A;  4KQQ A;  3UDI A;  5BOH A;  4KUO A;  1PI4 A;  3VE3 A;  4YOF A;  4WZ4 A;  1XGI A;  3OPR A;  2WYX A;  3TG9 A;  2GX5 A;  3VP0 A;  3BWL A;  3RTY A;  3ZDJ A;  4QWO A;  5DF7 A;  5J3W A;  3KSF A;  3PBR A;  4U0X A;  3GMW A;  3HCY A;  3LYX A;  3I7J A;  4LV1 A;  5CX7 A;  1Z09 A;  2K2N A;  1XPB A;  1FSW A;  5A91 A;  2RCX A;  3IBR A;  2Q0O A;  3NOT C;  4JPM A;  3BLM A;  5L09 A;  1N9L A;  4OP5 A;  2P7J A;  2L4R A;  4KG5 A;  4H6J A;  2B95 A;  3S7O A;  2GNX A;  1T1B A;  3QP8 A;  3BYD A;  3BFD A;  4NK3 A;  1KE3 A;  5DTT A;  1KDW A;  3IHA A;  3HUO A;  3E4P A;  3TRC A;  5HAR A;  3EEA A;  2HJ9 C;  4JGR A;  3KO6 A;  1WE4 A;  4ETZ A;  1HLU P;  2XA7 S;  3RFB A;  4B4X A;  5TFQ A;  3SH9 A;  4B4Z A;  2O99 A;  4EEU A;  5HDS A;  3BRM A;  4PM9 A;  4XXR A;  4S2I A;  4R1G A;  4KZ6 A;  4X25 A;  3DWK A;  3L7H A;  3QP5 A;  2OLV A;  3ZVT A;  4KUK A;  3IH8 A;  1LSW A;  1IFQ A;  2WAD A;  3B47 A;  5F1F A;  4XT2 B;  4I3J A;  2WKP A;  4LCL A;  1A0K A;  5EPH A;  2HZ5 A;  1TF1 A;  2QZ6 A;  3LUQ A;  4HH2 A;  1GA0 A;  4WF0 A;  1GCE A;  2ZL1 A;  2XGN A;  1YLJ A;  1I2S A;  4CLC C;  3QP2 A;  2XK1 A;  3CPT A;  1S0W A;  2H0Y A;  3BM6 A;  2ZQ7 A;  1Y4O A;  2EX9 A;  2XFT A;  3LEQ A;  3MXR A;  2V8C A;  1PZP A;  2HJE A;  3MR0 A;  3EEH A;  5TR7 A;  1CQA A;  4IBX A;  1K54 C;  1E3U D;  4OQG A;  1NLY A;  1ZC2 A;  1S4S A;  3T1Q B;  3BLS A;  3LY3 A;  3M6H A;  4LV0 A;  3H82 A;  3A0V A;  1PW8 A;  2B02 A;  4OP8 A;  3HBR A;  5I94 A;  4BWI A;  2XRO A;  1PFL A;  2FH5 A;  2R78 A;  1JWP A;  3HUN A;  3N8R A;  2J3T D;  5HZH A;  1HVB A;  5EM0 A;  3ZHH A;  4E3L A;  3B3X A;  1CJF A;  1GSV A;  1QMF A;  2PBD P;  2UV0 E;  4KQD A;  3HRE A;  3B42 A;  2V20 A;  2QJ7 A;  4ARZ B;  5EVI A;  3UB9 A;  1BZA A;  3O87 A;  3IWO A;  4R3B A;  3FZC A;  3SW1 A;  3G2Z A;  3UMD A;  1YSP A;  4EQ1 A;  4GOG A;  1HD8 A;  4X68 A;  4P0M A;  3UN7 A;  3ZFZ A;  4E3I A;  2QKP A;  4KZB A;  1N4O A;  4QHC A;  4BL2 A;  2PDR A;  5CHJ A;  1J9M A;  5AQ9 A;  3LIA A;  2WZZ A;  2FZ0 A;  3UPO A;  3U2A A;  4JGO A;  3IX8 A;  4XUX A;  3DBA A;  1LLB A;  2XD1 A;  4ME4 A;  2Y2Q A;  1OT9 A;  3SH8 A;  2NUP C;  2EWW A;  4WL9 A;  4HBU A;  3VSL A;  5GLA A;  3TOI A;  2V2F F;  4WM9 A;  4CJN A;  3IS2 B;  3V39 A;  3DTE A;  4EBP A;  4LV2 A;  3KSH A;  1PNE A;  4CLC E;  2ZQ8 A;  3IF6 B;  4G3K A;  4A5R A;  1L0G A;  2UWX A;  5JYO A;  2JC7 A;  4PKY A;  5G18 A;  4UQI S;  2XH9 A;  4MBH A;  4X69 A;  1U60 A;  5DFX A;  3MMH A;  2HP6 A;  5FQI A;  4OQI A;  4MBK A;  1XFQ A;  1EI5 A;  1CEF A;  2R9X A;  1YLT A;  1IOU A;  4PM7 A;  3EQV A;  3UY6 A;  1LL9 A;  3ISG A;  3LFV A;  2O9B A;  3HLW A;  1BLS A;  1JNU A;  3RJU A;  4ZTK A;  3VMA A;  4EEP A;  2ZQD A;  4O0P A;  4WBG A;  2PBY A;  2WGW B;  3G6O A;  1OJ5 A;  5A92 A;  5EOO A;  1D1J A;  5EE8 A;  1XKZ A;  4GDB A;  2GDN A;  4X6T A;  1S4R A;  3F1P A;  3G35 A;  2VLG A;  4F94 A;  3T4L A;  4GD6 A;  1BUL A;  5I5L A;  2I9V A;  4MEZ A;  4FCF A;  4QJG A;  4WEL A;  2QWS A;  2ZJ9 A;  4WZ5 A;  1GHI A;  5FAS A;  2I72 A;  2Q9M A;  1K56 D;  1K57 C;  3ZGA B;  5FI6 A;  5CHM A;  4JGQ A;  3U4L P;  1ZTU A;  2QHK A;  1RGZ A;  4YNR A;  1I2W A;  1NJ4 A;  5CER A;  3S7Q A;  3PAG A;  4RX2 A;  4H6J B;  2Z2M B;  4EET B;  2EFX A;  1TS6 A;  2WAF A;  1K25 A;  1NYY A;  2A24 A;  5FSR A;  2WZX A;  5CGS A;  4FUW A;  4HQA A;  1ES3 A;  2VV6 A;  4II7 A;  2VJW A;  5IT5 A;  2WKI A;  3KSG A;  2K7S A;  2M1C A;  4GS9 A;  3AGD A;  4OPQ A;  1DY6 A;  1H3Q A;  5HD5 A;  3HL9 A;  2ZQA A;  1PW1 A;  4QY5 A;  2IWD A;  2W3G A;  3IX3 A;  2C5W B;  3T4K A;  4EBN A;  2ZOH A;  4GW9 A;  4PKY G;  1J3W A;  5DFY A;  3AGF A;  3S1Y A;  3UME A;  3V3R A;  2ZC5 B;  3EQU A;  4P6Z S;  1FR6 A;  3IF5 A;  1VQQ A;  2Z6D A;  4DMZ A;  5DF8 A;  4EQI A;  4O8G A;  2P04 A;  4GLQ A;  1T19 A;  1M6K A;  1F9I A;  2ZL1 B;  5CGW A;  4R4S A;  3N8L A;  3CPT B;  2P74 A;  2CMN A;  5FQM A;  4FSF A;  4L9F A;  2PU2 A;  2HP5 A;  3GQZ A;  4GZB A;  1BLP A;  3V3S A;  2Y2K A;  3BQA A;  3FPW A;  2RL3 A;  3JYI A;  4EUV A;  3CG5 A;  4O01 A;  1ONH A;  3WRT A;  2DNS A;  1VEU A;  1XFN A;  4PAU A;  3QNC A;  3H82 B;  3UPP A;  1BYW A;  1IKI A;  4GNU A;  3E4O A;  4LRX C;  1SHV A;  5FI2 A;  3GV9 A;  4Y7P A;  1I5Q A;  2P08 A;  3BEB A;  4B88 A;  2HPB A;  2PR6 A;  2HDU A;  5HL1 A;  1L2S A;  2IWC A;  1D7E A;  1YPR A;  4E6W A;  5EVI B;  2W3H A;  1DJA A;  2A3U A;  5M19 A;  4HP4 A;  3MF0 A;  4NG2 A;  4HIA A;  1QME A;  1H8Y A;  2ACG A;  5DKK A;  5TGF A;  2XLN A;  1NWZ A;  1ERM A;  3CWF A;  2VGK A;  1PZO A;  4MLL A;  5KMW A;  2PU4 A;  5L07 A;  1K54 A;  4BBU A;  1NLZ A;  3WS5 A;  4DDY A;  2JKG A;  2PD8 A;  1CK3 A;  5GHY A;  2ZMA A;  2HP9 A;  5DJU A;  2ZC7 A;  4K91 A;  3ITA A;  2INW A;  4E04 A;  4OH0 A;  4OVD A;  1TDG A;  3QNB A;  2QYB A;  4G3W A;  2PD7 A;  2EX2 A;  3C8C A;  3LR5 A;  3NEC A;  5DKL A;  4M4X A;  1YKD A;  1LI9 A;  3LO7 A;  3C5A A;  4LEN A;  4OOL A;  1F2K A;  3JVU A;  2NUT C;  2W1T A;  3C4O A;  4YIN A;  4KQR A;  5HWW A;  4S2N A;  1RGY A;  1KGE A;  3QP6 A;  4S2O A;  3ICY A;  3VP4 A;  4EBL A;  2EXA A;  1XJ4 A;  3N8S A;  4B9O A;  2XEP A;  3T1S A;  2BTF P;  4OQH A;  4E3M A;  1FOF A;  1ODV A;  2DRW A;  2L1M A;  3E2K A;  4FTX A;  5LBR A;  4PHT A;  3F1O A;  5AQA A;  2WKR A;  4Q0I A;  3SS5 A;  1OT6 A;  5IHV A;  3RH8 B;  1IYS A;  1W8Q A;  5GHZ A;  2WUQ A;  3G2Y A;  2VK3 A;  2G2U A;  3F1P B;  1G28 A;  3MQQ A;  5EVL A;  4IVK A;  4S2P A;  3Q07 A;  2V0W A;  3PHY A;  2J8Y A;  1YT4 A;  3NI9 A;  5TJJ A;  1SZV A;  3BQ8 A;  4OLG A;  4F3L A;  3DWZ A;  3MFD A;  3OPL A;  4C75 A;  1XA1 A;  4HI4 A;  3BEC A;  1FIK A;  5FQ9 A;  5A8B A;  4IUK A;  1L0F A;  3MXS A;  4EV4 A;  2JKT M;  2A24 B;  5CEC A;  3Q7Z A;  2ZM0 A;  4GD8 A;  3TSG A;  4ESP A;  4MN7 A;  1IEL A;  1ONG A;  1D06 A;  5AVE A;  2Y2G A;  4MNR A;  4GS9 B;  3WS0 A;  2VX8 A;  4X53 A;  2HGV A;  3T4J A;  4HJ4 A;  4RX3 A;  2ZBB A;  3MQ0 A;  5HD3 A;  4E3J A;  3P09 A;  4KZ8 A;  3ZG9 B;  4ZBE A;  1ERQ A;  4BD0 A;  1ACF A;  1CEG A;  1YLY A;  1S66 L;  1IYQ A;  3KSI A;  5K5B A;  1W79 A;  3DAV A;  1GA9 A;  1NXY A;  1LHY A;  4GDN A;  1UGU A;  3RXX A;  4KZ7 A;  5FDH A;  4L9E A;  4UA9 A;  4L0L A;  3TJZ C;  4WLA A;  1DRM A;  4JXV A;  5CED A;  5FI7 A;  5E2E A;  2HDQ A;  4KZ3 A;  1N9N A;  3FC7 A;  1MKM A;  3WS2 A;  5HPF A;  4GJ4 A;  4GKU A;  1VM1 A;  1P97 A;  1MBL A;  3V50 A;  2J9O A;  3LR0 A;  2HV1 A;  3VFF A;  3HLG A;  1LL8 A;  4NXE A;  4Q0H A;  2OWJ A;  1NRJ A;  3ZNY A;  4OOY A;  1FR1 A;  3LR3 A;  3DW0 A;  2Y91 A;  1VEU B;  4S2J A;  2VGL M;  5U47 A;  5FQJ A;  1L0D A;  4Z9Q A;  4YWZ A;  1JWZ A;  3IF6 C;  2H28 A;  3R7W A;  1ZG4 A;  3LIF A;  5A90 A;  3VE4 A;  3SZT A;  2EWV A;  3BY8 A;  4PM8 A;  4BJP A;  4HH3 A;  3BFC A;  4GHI A;  1PI5 A;  4X1M A;  4NXF A;  1CI9 A;  1W5D A;  5E43 A;  1K0K A;  5M1A A;  4ETX A;  5FQQ A;  5JYP A;  3K3D A;  1T1C A;  1N9B A;  4P85 A;  4NXB A;  4BD1 A;  4I5S A;  1VET A;  3T4S A;  1IYP A;  1ESU A;  1UWP X;  2OLU A;  1PYY A;  1W8Y A;  3G32 A;  3ULF A;  1RP5 A;  2Y2O A;  4KG6 A;  4QPR A;  1VHM A;  3W4Q A;  1V9Z A;  2Y55 A;  3UE6 A;  4Q8I A;  3IXD A;  3IBJ A;  3OOV A;  5HWV A;  4N1X A;  4OOM A;  4FD8 A;  5EVI D;  3NY4 A;  4JF4 A;  3MBZ A;  1OPX A;  1KGG A;  1KVM A;  3K2N A;  2J7V A;  1K38 A;  3MJQ A;  1UWN X;  3M2K A;  4IJG A;  1IEM A;  3N7W A;  3UNW A;  2W1T B;  4UHU A;  4LRZ E;  3UDX A;  3T1X A;  3BFE A;  2Q9N A;  5HW3 A;  3P7N A;  1PWG A;  1YLZ A;  4I3I A;  3C2W A;  3BFG A;  1BUE A;  1H8Z A;  4DJ2 A;  3O3V A;  4HY8 A;  3F1N A;  3C7U A;  1XA7 A;  1FIL A;  5A93 A;  4MN6 A;  3F1O B;  4R4R A;  3MKE A;  2JKF A;  4OON A;  3UB8 A;  3FV7 A;  3UE3 A;  3QP1 A;  5EM1 A;  1BLC A;  1ZKJ A;  2VA0 A;  4PPR A;  4N1H A;  4RVA A;  2PHY A;  3O5Y A;  3CJM A;  3FYZ A;  3LI8 A;  2JKR M;  1OTE A;  2WKH A;  2XA7 M;  3PTE A;  3HLC A;  3GR2 A;  3CUE A;  3EGD C;  4UAA A;  3D3O A;  1ES5 A;  2V1Z A;  3G31 A;  4R6L A;  1F98 A;  5HPI A;  1S6R A;  2ZLY A;  3PBT A;  2J3T C;  1XP4 A;  3CMZ A;  1OTI A;  2DCF A;  3HJK A;  3KYZ A;  3LR4 A;  5E2G A;  3FWL A;  2V1B A;  2ZM2 A;  2OV5 A;  5DJT A;  4F3L B;  4Y2F A;  4ZJ1 A;  4HJ6 A;  4GB7 A;  3A3F A;  2PR5 A;  2V1A A;  1JWV A;  4DE3 A;  4RA7 A;  1NY0 A;  3OLO A;  2XQZ A;  3C7V A;  1MPL A;  4DE0 A;  4WN5 A;  5CTN A;  2E8J A;  1DP9 A;  3OC2 A;  5F83 A;  2FFF B;  4IHQ A;  1NRF A;  3B33 A;  1HZO A;  2PAV P;  3NCK A;  2A49 A;  1MKI A;  3KYE A;  1K6S A;  3MKF A;  3UDF A;  3OPH A;  1Z6F A;  3PBQ A;  1DP6 A;  5M18 A;  3IXB A;  3VOL A;  4DJ3 A;  2X02 A;  4NKP A;  3HLB A;  1M40 A;  3T4Q A;  4AFI A;  1PWD A;  4X55 A;  3GSG A;  3S7P A;  3NJA A;  3VFH A;  1LSX A;  1P9R A;  3KYQ A;  2OSU A;  1Q2Q A;  4I38 A;  3GVB A;  2EXB A;  3LI9 A;  5EVI C;  1VB6 A;  3OBF A;  1DJC A;  5GLC A;  1K55 C;  3Q81 A;  2B5R A;  2ZQ9 A;  3O86 A;  3ZVW A;  3WS4 A;  2IWB A;  5HX9 A;  4WMC A;  1ESI A;  4N9K A;  3N4I A;  1SDN A;  2XF3 A;  2IA2 A;  5FQK A;  4S2L A;  3T12 B;  1EWZ A;  5DTS A;  2QPN A;  5DTK A;  2YKF A;  3HLD A;  3C38 A;  2EX6 A;  3K3C A;  3PAE A;  3VP2 A;  3SH7 A;  5CXW A;  4RYE A;  3BW6 A;  2XSS A;  5G4Y A;  3M2J A;  5L8M A;  4MN5 A;  5DF9 A;  3R7W B;  4C3Q A;  4CLC A;  4KG2 A;  3ZG7 B;  5J4E A;  5CHU A;  1E25 A;  1MWR A;  1HTZ A;  5GHX A;  1STZ A;  4IVI A;  1CF0 A;  4MDZ A;  3GRJ A;  3PBO A;  4GHI B;  5AQ7 A;  2EFU A;  2WGV A;  2O9C A;  4UQI M;  4Y0O A;  1O7E A;  3FKV A;  1E4D A;  5HSQ A;  3E2L A;  3A3J A;  3G4P A;  3ZG5 A;  5J8X A;  5CTM A;  2Y59 A;  3MQO A;  5AQB A;  1VET B;  4GN2 A;  3H7W A;  1WYB A;  4XUZ A;  3VOY A;  2WKQ A;  3RXW A;  2ZOI A;  2D02 A;  2JBF A;  3CZD A;  2GZA A;  4DN0 A;  2XRN A;  3SOI A;  5L2F A;  4EW7 A;  2Y4A A;  4JXS A;  3Q1F A;  2QMI A;  3Q82 A;  4L9G A;  5L10 A;  1S1Z A;  2H10 A;  4HES A;  4JF6 A;  3G30 A;  1NYM A;  4LFU A;  4IED A;  3ITB A;  5F69 A;  4CQH A;  3LEZ A;  3IWQ A;  3UE1 A;  1MXO A;  1TS7 A;  3A3E A;  3CAX A;  4WZ5 C;  4WEJ A;  4DE2 A;  5EVE A;  1TVF A;  2J9P A;  4Y17 A;  1XJ6 A;  1W63 Q;  2VV7 A;  5MC7 A;  3CLO A;  1KOU A;  3F1N B;  4OKP A;  1G68 A;  1TDL A;  3GDI A;  3MZD A;  3WWX A;  1S1Y A;  1YLP A;  5CRF A;  2LB5 A;  4BBT A;  5D3O A;  5HWT A;  1MC0 A;  3ZNT A;  1MWS A;  3VOZ A;  4MBF A;  1DP8 A;  4Y3I A;  4R23 A;  4HHD A;  1OTA A;  2E8I A;  3SS3 A;  1H0M A;  4DXC A;  3IXG A;  2VGJ A;  5HAQ A;  5FEF A;  4FH2 A;  4OQ0 A;  1V9Y A;  2Y2N A;  4OPZ A;  4ID4 A;  1GHM A;  4R3J A;  2W27 A;  4Y5F A;  1OTB A;  1SKO A;  1XJ2 A;  1YLW A;  5KSC A;  2Y2J A;  4DKI A;  3CHW P;  1O07 A;  4YFM A;  3OPP A;  3ZG0 A;  3IX4 A;  4ZJ3 A;  2JHE A;  2JE5 A;  2KOI A;  4P6Z M;  3W2Z A;  3SS4 A;  2GJ3 A;  3IQA A;  3AGE A;  3VP3 A;  3NHQ A;  1YMS A;  4BEN A;  3LGO A;  3OCN A;  4JXW A;  1GSX A;  3LIE A;  4NET A;  4K0X A;  4K0W A;  3PBS A;  2W0N A;  1E3U A;  3D72 A;  4EER A;  4R38 A;  3D4F A;  5F68 A;  2PYP A;  4EWF A;  2G7U A;  2ZD8 A;  3FG8 A;  1ZHH B;  1K57 A;  4ZDX A;  4X1L A;  5E2H A;  1SCW A;  2M7U A;  3P98 A;  2HDS A;  3HLE A;  1YMX A;  4QU3 A;  1TS8 A;  4EU0 A;  1P0Z A;  3CI6 A;  4P6B A;  1GSW A;  3IHB A;  3QHY A;  3C4P A;  2BAS A;  2ZM8 A;  3QP4 A;  2J80 A;  3Q7V A;  3ZCZ A;  3TW8 A;  4CPK A;  4I3A A;  2PRF A;  3MXQ A;  3E4Q A;  1F5M A;  2Z2L B;  4JXG A;  1OME A;  4UA7 A;  4LV3 A;  5CEB A;  5TBM B;  4WEK A;  4DF6 A;  2PT7 A;  4Q0J A;  3VSK A;  5FL3 A;  1N9O A;  4D2O A;  3OCL A;  2O0Y A;  1ES2 A;  3PXP A;  4BMW A;  3DTI A;  2ZC4 B;  5FA7 A;  3GTC A;  4OPY A;  4DDS A;  4LGW A;  3A3D A;  4PM5 A;  2OAP 1;  4GCZ A;  1BSG A;  4LRY C;  3GEC A;  3MFX A;  4KZ5 A;  2R9W A;  2XFS A;  1OJG A;  3G34 A;  4CLC B;  5FAQ A;  3MZF A;  2CC1 A;  2W1R A;  3O88 A;  3HLF A;  1WYC A;  4LLO B;  3HJI A;  4JKT A;  3T4O A;  3NC8 A;  2Y2L A;  5F1G A;  2V8F A;  1ZG6 A;  2B18 A;  2VEA A;  3D9Y A;  5IS1 A;  3TE8 A;  1K55 A;  2D01 A;  1MWT A;  1XX2 A;  1MY8 A;  2AVX A;  4S2N C;  2WKE A;  4QB8 A;  3UB7 A;  2YKH A;  3E98 A;  4ZJ2 A;  3FPV A;  2JKR I;  5EOE A;  4BL3 A;  1MZU A;  4C6Y A;  2V0U A;  1JTG A;  4X56 A;  3ZG8 B;  5HFO A;  1LL5 A;  4KZ9 A;  3LID A;  3V5M A;  3H7W B;  1CI8 A;  4N92 A;  5F6A A;  4S2K A;  1L3L A;  1XGJ A;  4ZAM A;  5F5Y A;  2W3F A;  2EA9 A;  1ERO A;  3IT9 A;  1FCN A;  3UE0 A;  5FAP A;  5KIZ A;  5FEG A;  3H9W A;  4HJ3 A;  1FCO A;  1KE4 A;  1RCJ A;  2A2L A;  3HVF A;  1XXM A;  2G2W A;  3NUL A;  3MZE A;  3KX0 X;  1YSQ A;  2ZQC A;  2ZC6 B;  3LY4 A;  4P87 A;  1ALQ A;  3OZH A;  2Y2M A;  1TS0 A;  4R70 A;  4B93 A;  4ZRR A;  3HUM A;  4MMN A;  3JPU A;  2MJ6 A;  1K56 A;  3N6I A;  1W7F A;  1K6R A;  4U0T A;  3JVV A;  2FFY A;  4MCW A;  4IUH A;  1KDS A;  2V9A A;  3P01 A;  1WA9 A;  4JGP A;  3ZQ5 A;  2P9V A;  2XR0 A;  3DTM A;  1X0O A;  2BLS A;  4U3T A;  1YAX A;  5HDD A;  1DJB A;  1K4E A;  3PBN A;  4DXB A;  3W8K A;  1KVL A;  4Y0U A;  2PYR A;  1H8M A;  1LT0 A;  4OLD A;  1JTD A;  4HOI A;  2VV8 A;  2HF6 A;  5DVA A;  3UB6 A;  1AWI A;  1FQG A;  3NBL A;  4N9L A;  3T50 A;  1SKO B;  4E3K A;  3NDE A;  2O9A A;  3WRZ A;  2C6W B;  4E6X A;  3PYP A;  1S67 L;  3A0R A;  3IWI A;  2OAQ 1;  3CIT A;  5AJG A;  4LPZ A;  1NZU A;  1IKG A; 
#chains in the Genus database with same CATH homology
 4GD8 A;  4WM9 A;  4CJN A;  4KZ4 A;  1WYB A;  3TSG A;  3V39 A;  4XUZ A;  3VOY A;  4EBP A;  1IEL A;  4LV2 A;  2X01 A;  1ONG A;  2Y2P A;  4O7D A;  2Y2G A;  4MNR A;  2ZQ8 A;  3RXW A;  3IF6 B;  3IXH A;  4A5R A;  1IYO A;  3NIA A;  3WS0 A;  4BQM A;  4X53 A;  1L0G A;  2JBF A;  3CZD A;  4RX3 A;  5KSH A;  4E3J A;  1Q2P A;  3P09 A;  4KZ8 A;  3ZG9 B;  2UWX A;  4ZBE A;  3SOI A;  5JYO A;  5L2F A;  2JC7 A;  1KGF A;  1ERQ A;  2Y4A A;  4JXS A;  3UPN A;  5G18 A;  3Q1F A;  2QMI A;  5GLD A;  4BD0 A;  3Q82 A;  1CEG A;  1YLY A;  2XH9 A;  1BT5 A;  4MBH A;  4X69 A;  1IYQ A;  1YM1 A;  1W79 A;  1GA9 A;  2H10 A;  2ZC3 B;  1TEM A;  4HES A;  1NXY A;  1LHY A;  1U60 A;  4JF6 A;  4EUZ A;  3G30 A;  4GDN A;  1NYM A;  5FAO A;  4KZ7 A;  3RXX A;  5FDH A;  4UA9 A;  1PIO A;  4L0L A;  5CGX A;  4IED A;  3ITB A;  1G6A A;  5GLB A;  2HP6 A;  2BG1 A;  3LEZ A;  5FQI A;  3IWQ A;  3UE1 A;  3M6B A;  4JXV A;  5CED A;  1MXO A;  4OQI A;  3A3E A;  5FI7 A;  5E2E A;  2HDQ A;  4MBK A;  4DRT A;  4WZ5 C;  4WEJ A;  1EI5 A;  4KZ3 A;  4DE2 A;  1CEF A;  1TVF A;  2R9X A;  1YLT A;  1H5X A;  4PM7 A;  5FAT A;  3UO9 A;  2J9P A;  3WS2 A;  3EQV A;  2JCH A;  1Y54 A;  4GKU A;  1VM1 A;  3UY6 A;  4E3O A;  1LL9 A;  3ISG A;  1MBL A;  3HLW A;  1BLS A;  3RJU A;  4ZTK A;  3V50 A;  3VMA A;  2J9O A;  2X71 A;  3Q7V B;  4OKP A;  4OPR A;  1G68 A;  1TDL A;  1MWU A;  3HLG A;  3VFF A;  2ZQD A;  3BFF A;  4WBG A;  3NDG A;  3MZD A;  3WWX A;  1JVJ A;  1YLP A;  2PBY A;  2WGW B;  5CRF A;  3ZNY A;  4OOY A;  5A92 A;  4QD4 A;  1FR1 A;  5D3O A;  1BTL A;  3DW0 A;  5EOO A;  2Y91 A;  5EE8 A;  4R0Q A;  1XKZ A;  4GDB A;  3ZNT A;  1MWS A;  4S2J A;  1SKF A;  2GDN A;  4X6T A;  3VOZ A;  5U47 A;  3G35 A;  3W4P A;  4MBF A;  2WGI A;  5FQJ A;  4LCM A;  1L0D A;  4Z9Q A;  1ES4 A;  1JWZ A;  4R23 A;  4F94 A;  2E8I A;  3IF6 C;  3SS3 A;  4DXC A;  3IH9 A;  1BUL A;  3IXG A;  4GD6 A;  4MEZ A;  2VGJ A;  1ZG4 A;  4FCF A;  5A90 A;  5HAQ A;  4FH2 A;  4QJG A;  4OQ0 A;  5KZH A;  4OPZ A;  2Y2N A;  2Y2H A;  4E3N A;  4WEL A;  4ID4 A;  1GHM A;  2WK0 A;  4R3J A;  3VP1 A;  4PM8 A;  4JLF A;  4BJP A;  2ZJ9 A;  4WZ5 A;  4IBR A;  5EEC A;  1YLW A;  3BFC A;  1GHI A;  5FAS A;  5KSC A;  2I72 A;  4PM6 A;  2H0T A;  2Y2J A;  2Q9M A;  1K56 D;  4DKI A;  4HEF A;  1PI5 A;  1KE0 A;  1K57 C;  1O07 A;  4YFM A;  3ZGA B;  5FI6 A;  3OPP A;  5CHM A;  3ZG0 A;  1CI9 A;  1W5D A;  1FSY A;  4ZJ3 A;  4HBT A;  5E43 A;  4BLM A;  1RGZ A;  4WYY A;  4JF5 A;  3FKW A;  2JE5 A;  1I2W A;  1NJ4 A;  5CER A;  5M1A A;  5FQQ A;  3PAG A;  4RX2 A;  2WAE A;  4WMC D;  2Z2M B;  5JYP A;  2EFX A;  3SS4 A;  3IQA A;  3AGE A;  1N9B A;  4P85 A;  4BD1 A;  4PMA A;  2WAF A;  1K25 A;  1NYY A;  1PWC A;  5FSR A;  3VP3 A;  1FCM A;  1LI0 A;  1YMS A;  2WZX A;  1IYP A;  5CGS A;  1ESU A;  4BEN A;  3OCN A;  1ES3 A;  4JXW A;  2OLU A;  1PYY A;  2WKI A;  4M3K A;  1W8Y A;  4NET A;  3G32 A;  4K0X A;  1RP5 A;  3IF6 A;  2Y2O A;  4KG6 A;  5GL9 A;  4K0W A;  3PBS A;  3W4Q A;  2EX8 A;  1SDE A;  3AGD A;  4OPQ A;  2Y55 A;  1DY6 A;  1E3U A;  4Q8I A;  3IXD A;  5EUA A;  2XDM A;  3HL9 A;  4N1X A;  2ZQA A;  4OOM A;  3A3I A;  3D4F A;  4FD8 A;  1PW1 A;  4QY5 A;  2HDR A;  2IWD A;  5EVI D;  3NY4 A;  2C5W B;  4JF4 A;  4EBN A;  4EWF A;  2ZD8 A;  3MBZ A;  1NZO A;  4FH4 A;  1KGG A;  1KVM A;  3AGF A;  3S1Y A;  1K57 A;  5E2F A;  4KEN B;  4ZDX A;  3S22 A;  5E2H A;  3V3R A;  1SCW A;  2J7V A;  1K38 A;  2ZC5 B;  1K4F A;  3M2K A;  3P98 A;  1GHP A;  3EQU A;  3LCE A;  4QY6 A;  1IEM A;  1FR6 A;  3IF5 A;  3N7W A;  1VQQ A;  2HDS A;  3HLE A;  3UNW A;  2Y2I A;  1BLH A;  1YQS A;  1YMX A;  2H5S A;  5DF8 A;  4UHU A;  4EQI A;  3UDX A;  2XD5 A;  3BFE A;  4QU3 A;  2Q9N A;  5HW3 A;  5HAI A;  1M6K A;  1PWG A;  5CGW A;  1YLZ A;  3S4X A;  4P6B A;  4R4S A;  3N8L A;  3BFG A;  1BUE A;  1H8Z A;  3IHB A;  3QHY A;  3C4P A;  2P74 A;  5FQM A;  2ZM8 A;  4FSF A;  4DE1 A;  3O3V A;  4KZA A;  2PU2 A;  2HP5 A;  4H8R A;  3Q7V A;  3WS1 A;  3ZCZ A;  4CPK A;  3C7U A;  4UA6 A;  3GQZ A;  1XA7 A;  1C3B A;  4GZB A;  1BLP A;  4Y0T A;  5HAP A;  3V3S A;  2Y2K A;  3W4O A;  1L0E A;  5F82 A;  5A93 A;  2WGW A;  2RL3 A;  3JYI A;  4R4R A;  2Z2L B;  4JXG A;  1OME A;  4UA7 A;  3CG5 A;  4LV3 A;  3MKE A;  4DF6 A;  1ONH A;  4OON A;  1AXB A;  4WEK A;  2DNS A;  3WRT A;  5CEB A;  3FV7 A;  4JBF A;  3UE3 A;  3VSK A;  4KQO A;  4D2O A;  3QNC A;  4S2M A;  2P9V B;  3OCL A;  4KQQ A;  3UDI A;  5BOH A;  1BLC A;  1ZKJ A;  3UPP A;  1ES2 A;  4PPR A;  1PI4 A;  4N1H A;  1IKI A;  1XGI A;  4GNU A;  4RVA A;  4WZ4 A;  5FI2 A;  1SHV A;  3OPR A;  2ZC4 B;  2WYX A;  3CJM A;  5FA7 A;  3FYZ A;  3GV9 A;  3GTC A;  4OPY A;  4Y7P A;  2WKH A;  1I5Q A;  3TG9 A;  3VP0 A;  4DDS A;  3BEB A;  3ZDJ A;  4B88 A;  2HPB A;  3A3D A;  3PTE A;  5DF7 A;  4PM5 A;  2HDU A;  3HLC A;  1BSG A;  5HL1 A;  1L2S A;  3PBR A;  4U0X A;  2IWC A;  3GR2 A;  3GMW A;  4UAA A;  4KZ5 A;  3I7J A;  4LV1 A;  4E6W A;  2R9W A;  1ES5 A;  2V1Z A;  2XFS A;  1XPB A;  1FSW A;  3G31 A;  2A3U A;  1DJA A;  3G34 A;  5EVI B;  5A91 A;  1S6R A;  2RCX A;  5M19 A;  2ZLY A;  3PBT A;  5FAQ A;  1XP4 A;  3CMZ A;  3MZF A;  2CC1 A;  3O88 A;  4JPM A;  1QME A;  1H8Y A;  2DCF A;  3BLM A;  3HLF A;  1WYC A;  5E2G A;  4JKT A;  3FWL A;  4OP5 A;  5TGF A;  3NC8 A;  2XLN A;  2Y2L A;  2ZM2 A;  5F1G A;  2OV5 A;  1ZG6 A;  4KG5 A;  1ERM A;  4ZJ1 A;  2VGK A;  1K55 A;  4GB7 A;  3BYD A;  1MWT A;  3BFD A;  4NK3 A;  1PZO A;  1XX2 A;  1MY8 A;  3A3F A;  1KE3 A;  5DTT A;  4S2N C;  2WKE A;  1JWV A;  4MLL A;  4QB8 A;  1KDW A;  2PU4 A;  3IHA A;  3HUO A;  4RA7 A;  1NY0 A;  5KMW A;  1K54 A;  5HAR A;  4ZJ2 A;  2XQZ A;  3C7V A;  1MPL A;  3WS5 A;  4DE0 A;  1WE4 A;  5CTN A;  5EOE A;  4BL3 A;  4B4X A;  4DDY A;  4C6Y A;  3OC2 A;  5F83 A;  5TFQ A;  3SH9 A;  4B4Z A;  2FFF B;  1JTG A;  4X56 A;  3ZG8 B;  5HFO A;  3BRM A;  1NRF A;  4PM9 A;  1CK3 A;  1LL5 A;  4XXR A;  1HZO A;  5GHY A;  2ZMA A;  2HP9 A;  4KZ9 A;  2ZC7 A;  2A49 A;  3NCK A;  4K91 A;  3ITA A;  4R1G A;  4S2I A;  4KZ6 A;  3V5M A;  1MKI A;  3DWK A;  1CI8 A;  4N92 A;  4S2K A;  1K6S A;  1XGJ A;  4OH0 A;  4OVD A;  4ZAM A;  3MKF A;  1TDG A;  3QNB A;  3UDF A;  3OPH A;  1Z6F A;  2OLV A;  3PBQ A;  3ZVT A;  3IH8 A;  1ERO A;  5M18 A;  3IT9 A;  2EX2 A;  1FCN A;  2WAD A;  3UE0 A;  3IXB A;  5FAP A;  2X02 A;  1LI9 A;  5F1F A;  3HLB A;  3LO7 A;  3C5A A;  4LEN A;  4OOL A;  1M40 A;  1FCO A;  1KE4 A;  1RCJ A;  1PWD A;  4LCL A;  5EPH A;  3HVF A;  4X55 A;  3GSG A;  4DE3 A;  1XXM A;  2G2W A;  3MZE A;  2QZ6 A;  3VFH A;  3C4O A;  4YIN A;  2OSU A;  4KQR A;  2ZQC A;  2ZC6 B;  3LY4 A;  4P87 A;  1ALQ A;  1GA0 A;  1Q2Q A;  4S2N A;  1RGY A;  3GVB A;  3OZH A;  1GCE A;  1KGE A;  2Y2M A;  4S2O A;  3VP4 A;  2EXB A;  2XGN A;  5EVI C;  4EBL A;  1YLJ A;  2EXA A;  1I2S A;  3N8S A;  2XEP A;  2XK1 A;  1S0W A;  3HUM A;  4OQH A;  4E3M A;  1FOF A;  1K56 A;  2DRW A;  3N6I A;  3E2K A;  2H0Y A;  1W7F A;  3BM6 A;  1K6R A;  2ZQ7 A;  4U0T A;  2EX9 A;  2XFT A;  1DJC A;  5GLC A;  1K55 C;  2FFY A;  2B5R A;  3MXR A;  3Q81 A;  2ZQ9 A;  1PZP A;  3O86 A;  3ZVW A;  1KDS A;  3WS4 A;  5TR7 A;  4IBX A;  2IWB A;  5HX9 A;  4WMC A;  1ESI A;  1K54 C;  4N9K A;  3N4I A;  5AQA A;  1SDN A;  1E3U D;  4OQG A;  1ZC2 A;  2XF3 A;  5FQK A;  3SS5 A;  4S2L A;  3BLS A;  3LY3 A;  3M6H A;  4LV0 A;  2P9V A;  1PW8 A;  5IHV A;  2XR0 A;  1EWZ A;  1IYS A;  5DTS A;  1W8Q A;  3DTM A;  4OP8 A;  2QPN A;  3HBR A;  5GHZ A;  5DTK A;  3HLD A;  2EX6 A;  3VP2 A;  2WUQ A;  3PAE A;  5I94 A;  3G2Y A;  3HUN A;  2BLS A;  4U3T A;  1JWP A;  1DJB A;  3N8R A;  3SH7 A;  5CXW A;  1K4E A;  2G2U A;  1HVB A;  3PBN A;  3ZHH A;  4RYE A;  4E3L A;  3B3X A;  1QMF A;  5EVL A;  4DXB A;  4IVK A;  4S2P A;  3HRE A;  3M2J A;  3W8K A;  1KVL A;  4Y0U A;  3Q07 A;  2V20 A;  4OLD A;  5DF9 A;  1JTD A;  5EVI A;  1BZA A;  3O87 A;  2J8Y A;  3IWO A;  4R3B A;  4C3Q A;  5DVA A;  3FZC A;  3G2Z A;  4KG2 A;  1FQG A;  3ZG7 B;  1YT4 A;  3NI9 A;  1E25 A;  3NBL A;  5CHU A;  1MWR A;  1HTZ A;  4N9L A;  4GOG A;  5GHX A;  4IVI A;  1HD8 A;  4X68 A;  4P0M A;  3UN7 A;  3ZFZ A;  3GRJ A;  3PBO A;  4E3K A;  5AQ7 A;  3NDE A;  2EFU A;  2WGV A;  4OLG A;  4E3I A;  3DWZ A;  3WRZ A;  4KZB A;  3MFD A;  1N4O A;  4QHC A;  3OPL A;  4C75 A;  4Y0O A;  4BL2 A;  1XA1 A;  1J9M A;  5CHJ A;  2C6W B;  5AQ9 A;  1O7E A;  4E6X A;  3BEC A;  3FKV A;  2WZZ A;  1E4D A;  3UPO A;  5FQ9 A;  3E2L A;  3A3J A;  3G4P A;  4XUX A;  1L0F A;  3ZG5 A;  1LLB A;  3IWI A;  2XD1 A;  5J8X A;  2Y2Q A;  3MXS A;  3SH8 A;  4EV4 A;  5CTM A;  2Y59 A;  1NZU A;  4HBU A;  3VSL A;  5GLA A;  5AQB A;  3TOI A;  5CEC A;  3Q7Z A;  1IKG A;  2V2F F;  2ZM0 A;  4GN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...