4WBGA

Crystal structure of class c beta-lactamase mox-1 covalently complexed with aztorenam
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
353
structure length
347
Chain Sequence
DPLRPVVDASIQPLLKEHRIPGMAVAVLKDGKAHYFNYGVANRESGASVSEQTLFEIGSVSKTLTATLGAYAVVKGAMQLDDKASRHAPWLKGSVFDSITMGELATYSAGGLPLQFPEEVDSSEKMRAYYRQWAPVYSPGSHRQYSNPSIGLFGHLAASSLKQPFAQLMEQTLLPGLGMHHTYVNVPKQAMASYAYGYSKEDKPIRVGMLADEAYGIKTSSADLLAFVKANIGGVDDKALQQAISLTHKGHYSVGGMTQGLGWESYAYPVTEQTLLAGNSAKVILEANPTAAPRQVLFNKTGSSNGFGAYVAFVPARGIGIVMLANRNYPIPARVKAAHAILAQLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Conformational Change Observed in the Active Site of Class C beta-Lactamase MOX-1 upon Binding to Aztreonam
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 110
structure length 347
sequence length 353
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4wbgA00
5EVIC 1YLPA 2XD5A 2ZC7A 3DWKA 3HVFA 1K55C 5FDHA 3IWIA 2J7VA 4LV3A 2C5WB 3MXRA 4BLMA 1ES5A 1PW8A 2ZC5B 2Y2LA 1I5QA 4LV2A 4WZ5C 1JWZA 3BFEA 1E4DA 2P9VB 4GZBA 1XA7A 5D3OA 3SH9A 4K0WA 3UPPA 4JF6A 2JE5A 5EOEA 3TOIA 1WE4A 3GRJA 1QMFA 3W4OA 4QHCA 4FD8A 1TVFA 1KE3A 3ZG0A 1ZC2A 3DTMA 3S22A 1VM1A 1Q2QA 2EX2A 3CMZA 4JF4A 4KG2A 4FSFA 3CJMA 3A3FA 1E25A 3EQVA 3OPHA 3ITAA 4YFMA 4S2NC 4KG6A 4Q8IA 1PW1A 2HDUA 2WYXA 3N4IA 4OONA 3CG5A 3NC8A 5EE8A 1ESIA 3C7UA 4P85A 4E3OA 2WAEA 1IKGA 1HZOA 4JPMA 1LHYA 3M6HA 3ZVWA 4XUZA 2HDSA 1G6AA 4Y0TA 4MBFA 2BG1A 3A3EA 5EECA 3BLSA 4R4SA 1RP5A 4OH0A 2ZD8A 3OC2A 2WADA 4ZTKA 2RCXA 1OMEA 4B4XA 3HUNA 1LLBA 1Q2PA 3V3RA 1Z6FA 2XF3A 5KZHA 5F1GA 4DRTA 3W8KA 2Y2NA 1BT5A 1FOFA 4WEJA 3UDIA 2Y59A 5EVID 3UDFA 3IXBA 4Y0UA 4CJNA 4DXBA 2OLUA 2WKEA 1BZAA 4HBUA 5CGXA 3NDGA 4R4RA 4C6YA 4E3IA 1ZG4A 1N9BA 1CEFA 2ZC4B 4WYYA 2EXBA 4GOGA 2XFTA 1NYYA 3O87A 3FV7A 4QJGA 1IYPA 4WELA 2WAFA 2XEPA 1BUEA 1VQQA 3G30A 5GLCA 3M6BA 4UA9A 3FKWA 4WMCD 2H5SA 4WZ4A 3UDXA 2XK1A 1K56D 4WZ5A 2A3UA 3Q07A 1IKIA 4PM8A 5DF9A 5EVIA 1E3UA 5F82A 3VSKA 1PWCA 3AGFA 1K55A 1MWRA 1MWUA 3UY6A 3VP0A 4LV1A 4GKUA 2ZMAA 1K54A 3QNBA 2PBYA 2CC1A 4WM9A 3BFFA 2WKHA 4P0MA 3ZGAB 1RGZA 1DY6A 4H8RA 4OP8A 5DTKA 5M18A 1BLPA 4IBRA 3HBRA 2I72A 4E3JA 2WUQA 4S2MA 4IEDA 3MFDA 4LV0A 1ERQA 4HEFA 4N92A 4RYEA 4EV4A 4KZ4A 2Y2IA 2EX8A 1K4FA 2HPBA 1K57C 3UE3A 5DTTA 4RVAA 1BSGA 4GNUA 3IT9A 3VFFA 4BQMA 2DRWA 4XXRA 5U47A 4U0TA 1K56A 1FR6A 2Q9NA 5FAPA 4E3NA 2H0TA 3SH7A 3UO9A 4CPKA 3FZCA 3RXXA 4WBGA 2Y2OA 4IBXA 2G2WA 1XXMA 4P87A 1K38A 1KE4A 3TG9A 1DJBA 5CEDA 1FSWA 1PZPA 4KQOA 5M19A 3IHBA 5FQQA 4FH2A 5CECA 4Y0OA 2Y2KA 3IWOA 1HD8A 5FI7A 5FI2A 3FWLA 4KZBA 4MEZA 1O7EA 3BM6A 1PWGA 1W8YA 3IH9A 4PPRA 1LI0A 1CI9A 1GA0A 1YLTA 1ONHA 2C6WB 2XLNA 1JWVA 3E2LA 3HLFA 1QMEA 3N8RA 4JBFA 4RX3A 2Y2PA 5GLDA 3NBLA 4OOYA 3VP1A 5FATA 3Q7VA 3LCEA 3FYZA 4OQGA 5M1AA 5AQ9A 3IXDA 3BLMA 4X55A 3BECA 1K54C 3E2KA 4OOLA 4X53A 5KMWA 4JXGA 2EX6A 3IF5A 4R1GA 2JCHA 1Y54A 3IQAA 4OVDA 2GDNA 1GA9A 1LI9A 2X02A 4C75A 4BJPA 2Y2QA 4S2OA 1ZKJA 5CTMA 1K4EA 5CXWA 4DXCA 4E6XA 1YMSA 4ZAMA 3N6IA 2VGKA 1NYMA 3ZHHA 1TDLA 4QB8A 5E2GA 4E3LA 1XGJA 4ID4A 2OSUA 5JYPA 4MLLA 2DNSA 5KSHA 4R3JA 2QPNA 2UWXA 1DJAA 5CHMA 3ZG5A 2BLSA 2HP9A 3GSGA 2Z2LB 5A93A 3Q1FA 1M6KA 1ALQA 1FR1A 1GHIA 2Y2JA 2ZQDA 4U0XA 3GTCA 3QHYA 1L0GA 5EOOA 1L2SA 5AQ7A 1K25A 2H10A 4DE1A 4X56A 5CTNA 3SS3A 4MNRA 4KQQA 1FQGA 1W79A 3SH8A 2B5RA 1XPBA 4OLGA 3WS4A 4DDSA 1GHMA 4BD0A 4YINA 4P6BA 2J9PA 4R0QA 4GDBA 3M2KA 3ZDJA 4S2IA 1PYYA 3VP3A 1E3UD 1K57A 3A3DA 5FQKA 1J9MA 3MZDA 3OCNA 4EQIA 5FQIA 1LL5A 3RJUA 4PM9A 4PM5A 1L0EA 2J9OA 4RA7A 3GMWA 4GDNA 1CI8A 1BLCA 1BLSA 1IYSA 2Y55A 3BFDA 3CZDA 3V39A 5DTSA 3V3SA 3GVBA 5G18A 4HESA 3P98A 4A5RA 1KDWA 1GCEA 3VMAA 3ZFZA 4N9LA 1MBLA 4OPRA 1JWPA 1WYCA 4LCLA 4GD6A 4BD1A 4EBNA 3NCKA 5EVIB 1NZUA 4OQHA 1ESUA 2V20A 1XKZA 2ZC3B 1ERMA 3HL9A 5FAQA 4BL3A 5GHYA 1L0DA 2JBFA 5A91A 3V5MA 5L2FA 3JYIA 5CEBA 3EQUA 5DF7A 2DCFA 3WS2A 3IXGA 2WGIA 1YLZA 3I7JA 2HDRA 3WRZA 1XP4A 5EVLA 1ES2A 5FSRA 3OPPA 4U3TA 1CEGA 3D4FA 4S2PA 4ZDXA 4ZBEA 2R9WA 4QY6A 1O07A 3IXHA 5HFOA 3NDEA 3PBQA 3A3IA 4QY5A 4F94A 4OP5A 3UE1A 4FCFA 2Z2MB 4DE3A 1KGFA 1S6RA 1IELA 3SS5A 2EX9A 5CERA 5A92A 2XR0A 4BL2A 2FFYA 2P74A 3G2ZA 4C3QA 5FAOA 4HBTA 3G31A 1YM1A 4S2KA 4N9KA 4QU3A 3HLGA 1MKIA 5F83A 2Y2MA 5JYOA 1WYBA 2V2FF 1KGEA 1G68A 3Q7ZA 3VSLA 3LY4A 1YLWA 3PBTA 4B4ZA 3GR2A 5HAIA 1ZG6A 2FFFB 4GN2A 2ZM8A 4O7DA 1PIOA 4ZJ2A 5FQ9A 4OQ0A 3ZG9B 4X69A 5E2HA 4LCMA 3Q7VB 3MBZA 3W4PA 4M3KA 3HLWA 2XD1A 1KDSA 2QZ6A 3IF6C 1H5XA 4NETA 5CHJA 4PMAA 3PAEA 2ZQCA 2Y4AA 2WK0A 2J8YA 4UA7A 4LENA 1LL9A 4B88A 2QMIA 2ZQ7A 3N7WA 4ZJ3A 1I2WA 1NJ4A 2G2UA 3P09A 2E8IA 5AQAA 4ZJ1A 2XQZA 3C7VA 3BRMA 2ZM2A 4XUXA 1RGYA 2XDMA 1RCJA 2IWCA 3AGEA 5HARA 4KZ9A 1C3BA 3OCLA 4RX2A 3MKEA 4JF5A 1YT4A 1MY8A 3W4QA 1EROA 4Y7PA 5F1FA 3NIAA 1K6RA 2JC7A 3LY3A 4IVKA 3IHAA 1PWDA 1PZOA 2R9XA 1NY0A 2WGWB 2ZJ9A 4MBKA 3UPOA 3MZFA 3HLBA 3Q82A 4GD8A 4JKTA 4KZAA 5FQMA 1SHVA 3G32A 3C4PA 1BLHA 4OPQA 4OLDA 4EWFA 1SDNA 3ZG8B 2WGWA 4OOMA 5CHUA 1ES3A 4DE2A 4S2LA 1N4OA 4X6TA 2HP5A 5FI6A 5CGSA 2P9VA 3DWZA 3HLDA 4X68A 2V1ZA 4JLFA 1ONGA 4KZ7A 4PM7A 3ZCZA 1EI5A 2ZLYA 3RXWA 3IWQA 4KZ5A 5EUAA 4KQRA 2XH9A 3WS1A 4GB7A 4EUZA 2EFXA 3NI9A 5E2FA 5FQJA 3ZG7B 1GHPA 1MWTA 4JXSA 3ZVTA 5KSCA 2IWBA 3PTEA 3PBNA 3HUOA 2OV5A 4DE0A 3TSGA 5GL9A 5J8XA 4Z9QA 4K0XA 3M2JA 2RL3A 3HUMA 2Y2HA 3FKVA 4N1HA 3LEZA 1KE0A 3Q81A 1IEMA 1FCMA 4MBHA 3SOIA 5FASA 3O3VA 4KG5A 5E2EA 2WKIA 3OPRA 1AXBA 1U60A 5IHVA 2EFUA 3ISGA 1NZOA 1YLYA 2XFSA 4R23A 1SKFA 4DF6A 1IYOA 1SCWA 3WS0A 3N8LA 1SDEA 3ZNYA 4EBLA 2PU2A 2WZZA 1H8YA 3WS5A 4OPYA 1XA1A 3C4OA 3WRTA 3VOYA 3BYDA 1L0FA 5EPHA 3PBOA 3IH8A 3HLCA 3IF6B 4R3BA 1ES4A 4IVIA 4WEKA 5BOHA 1JVJA 1PI4A 3O86A 3PBSA 3S1YA 1MPLA 4D2OA 5HAPA 3MKFA 4UHUA 1DJCA 1S0WA 3IF6A 4E3KA 2WZXA 4KENB 1IYQA 4QD4A 5TGFA 2H0YA 2X01A 3ZNTA 3QNCA 2ZC6B 1HVBA 1PI5A 4DKIA 4OQIA 1TDGA 3A3JA 5AQBA 4N1XA 4EBPA 5DF8A 3HREA 3PBRA 3BFGA 5E43A 5GHXA 1K6SA 4UAAA 2X71A 1JTDA 3VP4A 4NK3A 3VP2A 4OKPA 3G34A 5TR7A 4L0LA 1I2SA 3UE0A 2Q9MA 4JXVA 1NRFA 3N8SA 3DW0A 3MXSA 3MZEA 1FSYA 3UNWA 5GLAA 4S2JA 5GLBA 3PAGA 2OLVA 1FCOA 3HLEA 4E3MA 3GV9A 1M40A 4KZ3A 4KZ6A 1MWSA 3BFCA 3LO7A 3G4PA 3OZHA 3AGDA 4UA6A 4FH4A 1XGIA 3ITBA 4PM6A 5CGWA 2ZQ8A 1W8QA 1KVLA 3BEBA 2HP6A 5DVAA 1HTZA 5FA7A 3WWXA 1KGGA 3VOZA 3V50A 5HW3A 2HDQA 2ZQAA 2IWDA 5HX9A 3B3XA 1H8ZA 3VFHA 3G35A 3SS4A 3NY4A 4WMCA 4K91A 2ZM0A 3UPNA 4E6WA 5TFQA 2VGJA 2Y91A 2Y2GA 3C5AA 4OPZA 4S2NA 1XX2A 2EXAA 3OPLA 3O88A 1TEMA 1YQSA 1JTGA 3UN7A 1BTLA 2PU4A 2ZQ9A 5CRFA 1NXYA 1YLJA 2A49A 4BENA 1CK3A 1YMXA 5GHZA 3GQZA 1MXOA 1FCNA 1W5DA 2WGVA 4DDYA 4JXWA 1KVMA 5A90A 1BULA 5HAQA 2XGNA 5I94A 1EWZA 4KZ8A 1W7FA 3S4XA 3G2YA 5HL1A
chains in the Genus database with same CATH superfamily
1YLPA 2ZC7A 3OLOA 1T1CA 2HGVA 2VZWA 3MXRA 1PW8A 2O9AA 3B33A 2Y2LA 4HHDA 3PR6A 3BFEA 3MMHA 1YPRA 1D1JA 4JF6A 2JE5A 1TVFA 1VEUA 3ZG0A 1STZA 3S22A 1Q2QA 3BY9A 4JF4A 3EQVA 2HDUA 4OONA 4GS9A 1N9OA 5EE8A 2VX8A 4P85A 1LHYA 1H0MA 2PRFA 3M6HA 2B18A 3F1PB 1P97A 1G6AA 4MBFA 3QP2A 3A3EA 2DMWA 2KOIA 3BLSA 4Y17A 4BBTA 1RP5A 2ZD8A 1OMEA 3V3RA 3T4JA 5F1GA 4ME4A 1SZVA 4L9EA 2Y59A 1SKOA 1G28A 2AVXA 3O5YA 4HBUA 1S66L 3H82A 2PYRA 4EXOA 1ODVA 2JKTM 3SW1A 3O87A 4QJGA 1IYPA 1K0KA 1S67L 1BUEA 4HP4A 3G30A 3M6BA 4WMCD 3W2ZA 4WZ4A 2XK1A 2A3UA 3T4QA 3RFBA 3VSKA 3C2WA 1MWRA 4HJ4A 1CJFA 4GKUA 2ZMAA 3JVUA 4IUKA 2PBYA 2B95A 3BFFA 3R7WB 4E3JA 4HEFA 4NXBA 5DTTA 2VA0A 4GCZA 2JKFA 2GJ3A 4U0TA 2Q9NA 1FIKA 3DAVA 3F1NB 5A8BA 4CLCE 3TG9A 2YKHA 1PZPA 2YKFA 2Y2KA 4KZBA 3BM6A 3T4LA 4DMZA 4MNRA 3E2LA 1YLTA 5GLDA 2HJ9C 3VP1A 4GHIB 3FYZA 5M1AA 5AQ9A 4RQ9A 4X55A 4EETB 3E2KA 4X53A 5KMWA 2EX6A 2VK3A 4R1GA 2JCHA 4YNRA 4BJPA 2J3WA 1K4EA 2QJ7A 1YMSA 1XJ2A 3N6IA 2VGKA 1TDLA 1TS0A 4QB8A 4LGWA 2NUPC 3B47A 5KSHA 4I38A 4FOFA 1LSXA 3E4QA 5CHMA 2BLSA 3CITA 4NXFA 3EEHA 1FR1A 3NECA 4MN5A 1GHIA 2ZQDA 2W3HA 1K25A 2H10A 5F68A 5CTNA 4OLGA 1XPBA 4IUHA 3ZYTA 2J9PA 3QP6A 2W3GA 2JKTI 3MFXA 4S2IA 1PYYA 3DTKA 3FPWA 1J9MA 3RJUA 4PM5A 2J9OA 4RA7A 4GDNA 2Y55A 5L10A 4CLCB 3V3SA 3B42A 3GVBA 3ZFZA 5DJTA 1JWPA 4I3AA 1WYCA 4LCLA 2ZL1A 3UB5P 3NCKA 1ESUA 2V20A 3HL9A 1ERMA 5FAQA 3V5MA 2JBFA 3JYIA 3E98A 3WS2A 2WGIA 3I7JA 4U3TA 1CEGA 4S2PA 4H6JA 2K31A 5HFOA 3PBQA 4UQIM 4QY5A 2EWVA 1KGFA 1S6RA 2EX9A 4DN0A 3G2ZA 3G31A 1YM1A 1MKIA 1WYBA 1KGEA 1G68A 2HZ5A 3Q7ZA 3VSLA 3LY4A 4HH2A 4NXGA 3GR2A 1ZG6A 4O7DA 4ZJ2A 3LR5A 4LCMA 2M7UA 3Q7VB 2W1TB 2V8CA 3T1RA 3MBZA 3W4PA 4M3KA 2QZ6A 3IF6C 1H5XA 1VB6A 5CHJA 4PMAA 2ZQCA 4UA7A 2J8YA 4ZJ3A 2E8JA 1I2WA 2G2UA 2VV8A 1XJ6A 1P9WA 5AQAA 5IT5A 3BRMA 2ZM2A 2XDMA 1RCJA 1Z09A 5HARA 1EROA 4Y7PA 4AFIA 4IVKA 3IHAA 3QP5A 2ZJ9A 3HLBA 4GD8A 1P0ZA 4OPQA 5J3WA 1SDNA 2WGWA 4OOMA 1ES3A 1N4OA 4X6TA 5HDCA 1GSXA 4X68A 2V1ZA 1ONGA 4KZ7A 3ZCZA 1EI5A 3RXWA 3WS1A 2WKRA 3NI9A 1GHPA 1MWTA 1S1ZA 3PBNA 3HUOA 2OV5A 4K0XA 2VGLM 2Y2HA 3FKVA 4Y13A 1IEMA 4R38A 2WKIA 3F1PA 4Z1WA 2EFUA 1NZOA 1YLYA 1CF0A 2LB5A 4HOIA 4EBLA 2PU2A 4Y15A 5DFYA 3VE3A 1XA1A 4HY8A 1L0FA 5EPHA 4MN6A 1ES4A 4D2OA 1DJCA 3IF6A 4O8GA 4E3KA 5TGFA 2H0YA 1TDGA 4N1XA 5DF8A 3KYQA 5C5KA 2VEAA 2X71A 4NK3A 3E4OA 4OKPA 5TR7A 1I2SA 1NRFA 3N8SA 3DW0A 3T4SA 3MXSA 3UB9A 5HD3A 3UNWA 5GLAA 5GLBA 3PAGA 3GV9A 1M40A 4KZ6A 3BFCA 4UA6A 5CGWA 3T12B 1JNUA 2ZQ8A 1W8QA 1KGGA 5DJUA 5HW3A 2HDQA 2PR6A 5HX9A 3R7WA 3TJZC 1H8ZA 3SS4A 3NY4A 3UPNA 5TFQA 2VGJA 2Y2GA 3UB6A 2OWJA 3O88A 1TEMA 5L09A 3MQOA 3UN7A 2PU4A 1NXYA 1LT0A 2W27A 4JXWA 5HAQA 1EWZA 3E0YA 5HL1A 2OOLA 2PD7A 3OOVA 2XD5A 1TF1A 3HVFA 2L0WA 4BLMA 4LV3A 4MCWA 1ZTUA 1JWZA 5TJJA 2P9VB 1GSWA 3SH9A 2I9VA 5EFWA 5EOEA 3UPPA 3TOIA 5I5LA 1QMFA 3T1SA 4ARZB 3GECA 4FD8A 2P08A 1NLYA 1YAXA 1VM1A 2EX2A 1DP8A 1UWNX 4LPZA 3CJMA 1E25A 4YFMA 4S2NC 1PW1A 2WYXA 3N4IA 5J7EA 5G4ZA 3C7UA 2WAEA 1HZOA 3L9KA 3NULA 3BWLA 3OC2A 2WADA 3KSGA 1S4RA 4BBUA 1LLBA 1Q2PA 2XF3A 1ZHHB 4DRTA 4HP9A 2Y2NA 1FOFA 4WEJA 3UDIA 4DXBA 4JGOA 4NG2A 2M7VA 4C6YA 2ZC4B 4WYYA 2EXBA 3A0VA 2XFTA 1NYYA 4CLCA 4WELA 2XEPA 3PYPA 1VQQA 3BJNA 3T1QB 1K56D 1A0KA 3Q07A 1IKIA 4PM8A 4Y2FA 5F82A 1OTIA 1TD5A 1PWCA 5EM1A 5F6AA 5J4EA 4B9OA 1OT6A 3ZGAB 1RGZA 4OP8A 2KLIA 4IBRA 3GDIA 3MFDA 4LV0A 4N92A 4KZ4A 3LICA 1K4FA 1OTAA 3IT9A 1K56A 5FAPA 3T4KA 3SH7A 1OPXA 4WBGA 2G2WA 1XXMA 4NKPA 4P87A 3A0SA 3LR0A 5M19A 5FQQA 5CECA 5FI7A 3FG8A 3IH9A 4PPRA 3HLFA 3K3CA 1LI0A 2C6WB 4JBFA 3JPUA 2V0UA 3NBLA 2ACGA 3Q7VA 3LCEA 2W1TA 4OQGA 3BLMA 4XT2B 1WA9A 4OOLA 3IF5A 3IQAA 4OVDA 2GDNA 1LI9A 2X02A 3IX3A 4C75A 3VOLA 5CXWA 5JYPA 1F9IA 4ID4A 5L8MA 3S7PA 4G3VA 3CAXA 1CQAA 2KDKA 4U0XA 5IU1A 3GTCA 5HWVA 1IFQA 4DE1A 4KQQA 1FQGA 4BD0A 3LYXA 3M2KA 2WKPA 4Q0IA 4DJ3A 3MZDA 5EM0A 3GMWA 1BLCA 3CUEA 4YWZA 4HESA 2W1RA 1KDWA 1GCEA 3VMAA 2ZBBA 4QWOA 1UGUA 4EBNA 1S1YA 2PBDP 1NZUA 2GZAA 3HJKA 4HQAA 3ZQ5A 5GHYA 5A91A 5L2FA 2EWWA 5DF7A 2HDRA 3WRZA 5EVLA 2V9AA 5FSRA 1GSVA 3S7OA 3D4FA 4ZDXA 1N9LA 3U4LP 1PRQA 4QY6A 4B93A 3FPVA 3TE8A 4F94A 4OP5A 3UE1A 4FCFA 2UV0E 2Z2MB 4FTXA 4BL2A 2P74A 1DP6A 4HBTA 4N9KA 4QU3A 3HLGA 2VLGA 5JYOA 5HDSA 4X1MA 2VKSA 4WN5A 1OJ5A 2W0NA 3ICYA 5HAIA 2FFFB 5HWWA 1MC0A 3ZG9B 3LGOA 4YOFA 2FZ0A 3V67A 4LRYC 1KDSA 4NETA 2WK0A 3UMEA 4LENA 1NJ4A 3P09A 2E8IA 1RGYA 2W3DA 4RX2A 1YT4A 3KX0X 5F1FA 3NIAA 2R9XA 2Z6CA 4MBKA 3RTYA 4JKTA 4LRXC 4KZAA 5FL3A 3ZG8B 4DE2A 3LI9A 2HP5A 2W3FA 1PFLA 2P9VA 4PM7A 4KZ5A 5EUAA 4R3AA 4ARZA 3ZG7B 3ZVTA 2VV7A 4DE0A 5GL9A 5J8XA 3M2JA 3IS2B 4X1LA 3FC7A 1KE0A 2VJWA 3SOIA 5FASA 3O3VA 3LUQA 5E2EA 1U60A 3EGXC 1TS8A 1IYOA 3KSHA 1SDEA 2WZZA 1LSVA 3C4OA 4KUKA 3VOYA 3HLCA 2D02A 4IVIA 1PI4A 3PBSA 3MKFA 4EEPA 2WZXA 3QNCA 1PI5A 4OQIA 1VETB 3A3JA 4ETXA 3EWKA 3PBRA 3BFGA 1D7EA 3VP2A 4LFUA 4I3IA 4Y5FA 4JXVA 4LRZE 1TS7A 1S4SA 3E4PA 2M1CA 1MWSA 3OZHA 3NOUC 2HP6A 2OAP1 3WWXA 3S7QA 3V50A 1F98A 2A24B 5FDSA 1FILA 3VFHA 2PYPA 2Y91A 3OPLA 1YQSA 3VV4A 1BTLA 2ZQ9A 4BENA 1YMXA 5GHZA 4D60A 3CWFA 1XJ3A 4PKYA 1FCNA 4DDYA 1BULA 2XGNA 5FEGA 4X56A 2W3EA 2O9CA 3DWKA 5FDHA 2C5WB 1PNEA 4KUOA 5IS1A 2ZC5B 3L7HA 4WLAA 4GZBA 1XA7A 4K0WA 2P04A 4XT2A 3GRJA 3BQAA 3W4OA 5DKLA 1ZC2A 3DTMA 3T4TA 3CMZA 4FSFA 3D3OA 3ITAA 3UMDA 1ACFA 1ESIA 4E3OA 2CMNA 1IKGA 3ZVWA 2HDSA 4Y0TA 2BG1A 1H8MA 4G3KA 4EEUA 4R4SA 3A0RA 2RCXA 3HUNA 3MXQA 1V9YA 4JGPA 5L07A 1BYWA 3W8KA 1OT9A 5K5BA 2V8FA 3UDFA 3IXBA 4Y0UA 4HJ6A 3H82B 4IHQA 2WKEA 3NDGA 4R4RA 4E3IA 1ZG4A 4G3WA 1N9BA 5HL6A 2QHKA 4GOGA 1G6OA 2V1BA 3FKWA 3UDXA 4WZ5A 1P9RA 3IX8A 1E3UA 3AGFA 3UY6A 4LV1A 2L4RA 1K54A 3H7WB 2KX6A 4H8RA 1BLPA 3HBRA 2I72A 4S2MA 4IEDA 2ZMFA 4KQDA 1ERQA 2Y2IA 1TS6A 3UE3A 4GNUA 4BQMA 1FR6A 4E3NA 2H0TA 5DKKA 2QJ5A 3UO9A 4CPKA 3FZCA 3RXXA 3D72A 4IBXA 1KE4A 1DJBA 3F1NA 1YKDA 3VE4A 4CLCC 5F69A 4FH2A 3IWOA 4P6ZS 1HD8A 2D01A 5FI2A 4MEZA 1W8YA 1CI9A 1GA0A 3N8RA 1ONHA 3F1OB 1QMEA 4RX3A 1G5UA 2Y2PA 4OOYA 5FATA 4WL9A 5AVEA 4HH3A 3BECA 4GHIA 1Y54A 3T1XA 1GA9A 3IX4A 2Y2QA 4S2OA 1ZKJA 4HIAA 4DXCA 4E6XA 4ZAMA 1NYMA 4CQHA 2OSUA 4WF0A 4MLLA 2DNSA 2QPNA 2UWXA 3ZG5A 2HP9A 4F3LB 2Z2LB 5A93A 3Q1FA 1ALQA 3MS6A 3QHYA 1L0GA 5EOOA 3KO6A 3PHYA 4CLCD 1T1BA 1W79A 3SH8A 2B5RA 3WS4A 4YINA 4R0QA 3C38A 5FQKA 3OCNA 5FQIA 1LL5A 4PM9A 1L0EA 1CI8A 3IS2A 5DTSA 5G18A 2ZL1B 3P98A 1MBLA 4OPRA 4EESA 4GD6A 4BD1A 1AWIA 2QWSA 5EVIB 3ULFA 4OQHA 4K08A 1XKZA 1DRMA 5HPFA 5CEBA 1YSPA 2DCFA 3IXGA 4EUVA 1ES2A 3S7NA 5TBMB 1MZUA 3NDEA 3A3IA 3LEQA 4DE3A 1IELA 3SS5A 2EA9A 5CERA 5A92A 2XR0A 4BWIA 2FH5A 4S2KA 5F83A 4HJ3A 2O99A 3CUEC 2V2FF 2PR5A 1YLWA 5HSQA 4MDZA 3PBTA 4B4ZA 3MQQA 2ZM8A 1PIOA 1F2KA 3OBFA 4X69A 4UQIS 4ESPA 4FUWA 1V9ZA 5LBRA 2INWA 3UE6A 3CPTB 3HLWA 2XD1A 3LIDA 3HJIA 5CX7A 1Y4OA 1LL9A 4B88A 2ZQ7A 2J3TC 3MR0A 3DBAA 3RH8B 3C7VA 2IWCA 3AGEA 3EGDC 4KZ9A 1C3BA 3OCLA 3MKEA 3W4QA 1MY8A 1MKMA 3LY3A 2JC7A 2NUTC 2GNXA 4JGRA 1NY0A 2WGWB 4O0PA 3MZFA 3T50A 3Q82A 2O9BA 2XA7S 4EWFA 5CHUA 4S2LA 3D9YA 5CGSA 3HLDA 3DWZA 4JLFA 4QPRA 3CI6A 3IWQA 3QP4A 2XH9A 5KSCA 1KOUA 3HCYA 1W63M 3DTIA 4EW7A 3TSGA 2PD8A 3HUMA 4N1HA 2ZOIA 3LEZA 4NXEA 4MBHA 2OAQ1 2J3TD 3BY8A 3ISGA 2XFSA 4R23A 1SKFA 4DF6A 3WS0A 1H8YA 3WRTA 3BYDA 3PBOA 1OJGA 3IF6B 4II7A 4R3BA 1JVJA 3S1YA 2VGLS 4UHUA 1H3QA 2PDRA 4KENB 1IYQA 4QD4A 2X01A 3ZNTA 2ZC6B 4DKIA 4JGQA 3MSHA 5HDDA 3HREA 1K6SA 1OTDA 2B02A 3VP4A 3G34A 1OTBA 2Q9MA 2JKGA 3HLEA 4E3MA 4KZ3A 4FH4A 4P6ZM 1KVLA 1HTZA 4ZRRA 1NRJA 5G4YA 2IWDA 3H7WA 5DFXA 3G35A 4WMCA 1Y28A 4K91A 2ZM0A 4OPZA 3C5AA 1XX2A 4R70A 2EXAA 4ETZA 2PHYA 1JTGA 5CRFA 2K2NA 2A49A 5F5YA 4E04A 1W5DA 2WGVA 5EV0A 4Q0JA 5I94A 2JKRM 4KZ8A 1W7FA 5KIZA 3G2YA 2H28A 5AVFA 5EVIC 1K55C 3F1OA 2J7VA 3IWIA 5HD5A 1ES5A 2HV1A 3P7NA 4LV2A 1I5QA 1E4DA 5D3OA 1WE4A 4QHCA 3UB7A 1KE3A 1XJ4A 4KG2A 4Q0HA 3A3FA 2Y79A 3OPHA 4KG6A 4Q8IA 3G6OA 3CG5A 3NC8A 4MMNA 4JPMA 4XUZA 3PXPA 5EECA 4OH0A 4ZTKA 4F3LA 4B4XA 2L1MA 2IA2A 4PAUA 2LB9A 1Z6FA 4NEED 1T19A 5KZHA 2MJ6A 1BT5A 5EVID 5EVEA 4CJNA 2OLUA 1BZAA 2K7SA 4L9GA 2Q0OA 1CEFA 3JVVA 1NLZA 3KYZA 3FV7A 4UEYA 3LIBA 2XRNA 2WAFA 5GLCA 4PKYG 4UA9A 2H5SA 3MF0A 2G7UA 1EW0A 5DF9A 1DP9A 1VHMA 5EVIA 4LLOB 1OTEA 1K55A 4EQ1A 1MWUA 3VP0A 3QNBA 2CC1A 4WM9A 2V1AA 2WKHA 4P0MA 3K2NA 1DY6A 5DTKA 5M18A 5TBMA 3QP8A 2WUQA 4X25A 4EV4A 4RYEA 2EX8A 2HPBA 1K57C 4RVAA 1BSGA 3VFFA 2DRWA 4XXRA 5U47A 3LIEA 2A2LA 2JKRI 2Y2OA 1K38A 5CEDA 1FSWA 4KQOA 4R6LA 3IHBA 1X0OA 4Y0OA 3FWLA 1O7EA 1PWGA 5CGXA 2XLNA 4WZ5C 3LIAA 3IBRA 1JWVA 2XA7M 3SZTA 2GX5A 3IXDA 4O01A 3CHWP 3CPTA 1K54C 4JXGA 1VEUB 2V0WA 2P7JA 2Y8HA 5CTMA 4GLQA 4GS9B 3ZHHA 3BQ8A 4L9FA 2Z6DA 5E2GA 2WKQA 4E3LA 1XGJA 4R3JA 3TRCA 1DJAA 5HPIA 3GSGA 1M6KA 1XFNA 2Y2JA 2R78A 1L2SA 3DTEA 5AQ7A 3SS3A 3LR3A 1SKOB 5HZHA 4DDSA 1GHMA 4P6BA 3C30A 3CLOA 1UWPX 4GDBA 3ZDJA 3VP3A 1E3UD 1K57A 3A3DA 4EQIA 4GJ4A 4HNBA 1N9NA 1BLSA 1IYSA 3BFDA 3CZDA 3V39A 2J80A 1T18A 4A5RA 3UB8A 4N9LA 1J3WA 3P01A 2ZC3B 2XSSA 4BL3A 3LIFA 4I39A 1L0DA 2HF6A 3EQUA 1YLZA 1XP4A 1IOUA 4GW9A 3OPPA 4ZBEA 2R9WA 1O07A 3IXHA 1L3LA 2ZMVA 2BTFP 2FFYA 4C3QA 5FAOA 5MC7A 2Y2MA 4MN7A 3NOPC 4GN2A 4I3JA 5FQ9A 4M4XA 4OQ0A 5E2HA 2PT7A 3KSFA 2ZOHA 1HLUP 3U2AA 3PAEA 2Y4AA 3LR4A 2QMIA 3N7WA 3NHQA 3K3DA 3R4KA 3TW8A 4ZJ1A 2XQZA 4IJGA 4XUXA 4JF5A 4BBVA 4WUJA 1K6RA 1PWDA 1PZOA 4Y3IA 3UPOA 1LL8A 3IBJA 2O0YA 5HWTA 5FQMA 1SHVA 2JHEA 3G32A 5AJGA 3C4PA 1BLHA 1NWZA 4OLDA 3C8CA 5FI6A 1YSQA 2ZLYA 3NJAA 4KQRA 3MQ0A 2QYBA 4GB7A 2PAVP 4EUZA 2EFXA 5E2FA 4BMWA 5FQJA 4JXSA 2IWBA 3PTEA 3H9WA 2HJEA 4Z9QA 1XFQA 2RL3A 3Q81A 1FCMA 4KG5A 2JN7A 3OPRA 1AXBA 5IHVA 2QKPA 2VV6A 3NOTC 1SCWA 1F5MA 3KSIA 3N8LA 3ZNYA 4HI4A 3WS5A 4OPYA 1LSWA 3T4OA 3IH8A 5BOHA 3LI8A 4WEKA 3MJQA 3O86A 5HAPA 1MPLA 4H6JB 1S0WA 3LFVA 1HVBA 5AQBA 3BW6A 4EBPA 5E43A 4PHTA 5GHXA 2XROA 4UAAA 1JTDA 1VETA 3EEAA 4L0LA 3UE0A 1T1AA 5FEFA 3MZEA 1FSYA 1W63Q 4S2JA 2OWHA 1D06A 2OLVA 1FCOA 3KYEA 3LO7A 3G4PA 3AGDA 1XGIA 3ITBA 4PM6A 5FA7A 3BEBA 5DVAA 3VOZA 4I5SA 2ZQAA 3B3XA 3EOIA 2A24A 2BASA 4E6WA 4EU0A 4DJ2A 4S2NA 4EERA 1YLJA 1CK3A 3GQZA 1MXOA 1KVMA 5A90A 3QP1A 3S4XA
chains in the Genus database with same CATH topology
5EVIC 1YLPA 2XD5A 2ZC7A 3DWKA 3HVFA 1K55C 5FDHA 3IWIA 2J7VA 4LV3A 2C5WB 3MXRA 4BLMA 1ES5A 1PW8A 2ZC5B 2Y2LA 1I5QA 4LV2A 4WZ5C 1JWZA 3BFEA 1E4DA 2P9VB 4GZBA 1XA7A 5D3OA 3SH9A 4K0WA 3UPPA 4JF6A 2JE5A 5EOEA 3TOIA 1WE4A 3GRJA 1QMFA 3W4OA 4QHCA 4FD8A 1TVFA 1KE3A 3ZG0A 1ZC2A 3DTMA 3S22A 1VM1A 1Q2QA 2EX2A 3CMZA 4JF4A 4KG2A 4FSFA 3CJMA 3A3FA 1E25A 3EQVA 3OPHA 3ITAA 4YFMA 4S2NC 4KG6A 4Q8IA 1PW1A 2HDUA 2WYXA 3N4IA 4OONA 3CG5A 3NC8A 5EE8A 1ESIA 3C7UA 4P85A 4E3OA 2WAEA 1IKGA 1HZOA 4JPMA 1LHYA 3M6HA 3ZVWA 4XUZA 2HDSA 1G6AA 4Y0TA 4MBFA 2BG1A 3A3EA 5EECA 3BLSA 4R4SA 1RP5A 4OH0A 2ZD8A 3OC2A 2WADA 4ZTKA 2RCXA 1OMEA 4B4XA 3HUNA 1LLBA 1Q2PA 3V3RA 1Z6FA 2XF3A 5KZHA 5F1GA 4DRTA 3W8KA 2Y2NA 1BT5A 1FOFA 4WEJA 3UDIA 2Y59A 5EVID 3UDFA 3IXBA 4Y0UA 4CJNA 4DXBA 2OLUA 2WKEA 1BZAA 4HBUA 5CGXA 3NDGA 4R4RA 4C6YA 4E3IA 1ZG4A 1N9BA 1CEFA 2ZC4B 4WYYA 2EXBA 4GOGA 2XFTA 1NYYA 3O87A 3FV7A 4QJGA 1IYPA 4WELA 2WAFA 2XEPA 1BUEA 1VQQA 3G30A 5GLCA 3M6BA 4UA9A 3FKWA 4WMCD 2H5SA 4WZ4A 3UDXA 2XK1A 1K56D 4WZ5A 2A3UA 3Q07A 1IKIA 4PM8A 5DF9A 5EVIA 1E3UA 5F82A 3VSKA 1PWCA 3AGFA 1K55A 1MWRA 1MWUA 3UY6A 3VP0A 4LV1A 4GKUA 2ZMAA 1K54A 3QNBA 2PBYA 2CC1A 4WM9A 3BFFA 2WKHA 4P0MA 3ZGAB 1RGZA 1DY6A 4H8RA 4OP8A 5DTKA 5M18A 1BLPA 4IBRA 3HBRA 2I72A 4E3JA 2WUQA 4S2MA 4IEDA 3MFDA 4LV0A 1ERQA 4HEFA 4N92A 4RYEA 4EV4A 4KZ4A 2Y2IA 2EX8A 1K4FA 2HPBA 1K57C 3UE3A 5DTTA 4RVAA 1BSGA 4GNUA 3IT9A 3VFFA 4BQMA 2DRWA 4XXRA 5U47A 4U0TA 1K56A 1FR6A 2Q9NA 5FAPA 4E3NA 2H0TA 3SH7A 3UO9A 4CPKA 3FZCA 3RXXA 4WBGA 2Y2OA 4IBXA 2G2WA 1XXMA 4P87A 1K38A 1KE4A 3TG9A 1DJBA 5CEDA 1FSWA 1PZPA 4KQOA 5M19A 3IHBA 5FQQA 4FH2A 5CECA 4Y0OA 2Y2KA 3IWOA 1HD8A 5FI7A 5FI2A 3FWLA 4KZBA 4MEZA 1O7EA 3BM6A 1PWGA 1W8YA 3IH9A 4PPRA 1LI0A 1CI9A 1GA0A 1YLTA 1ONHA 2C6WB 2XLNA 1JWVA 3E2LA 3HLFA 1QMEA 3N8RA 4JBFA 4RX3A 2Y2PA 5GLDA 3NBLA 4OOYA 3VP1A 5FATA 3Q7VA 3LCEA 3FYZA 4OQGA 5M1AA 5AQ9A 3IXDA 3BLMA 4X55A 3BECA 1K54C 3E2KA 4OOLA 4X53A 5KMWA 4JXGA 2EX6A 3IF5A 4R1GA 2JCHA 1Y54A 3IQAA 4OVDA 2GDNA 1GA9A 1LI9A 2X02A 4C75A 4BJPA 2Y2QA 4S2OA 1ZKJA 5CTMA 1K4EA 5CXWA 4DXCA 4E6XA 1YMSA 4ZAMA 3N6IA 2VGKA 1NYMA 3ZHHA 1TDLA 4QB8A 5E2GA 4E3LA 1XGJA 4ID4A 2OSUA 5JYPA 4MLLA 2DNSA 5KSHA 4R3JA 2QPNA 2UWXA 1DJAA 5CHMA 3ZG5A 2BLSA 2HP9A 3GSGA 2Z2LB 5A93A 3Q1FA 1M6KA 1ALQA 1FR1A 1GHIA 2Y2JA 2ZQDA 4U0XA 3GTCA 3QHYA 1L0GA 5EOOA 1L2SA 5AQ7A 1K25A 2H10A 4DE1A 4X56A 5CTNA 3SS3A 4MNRA 4KQQA 1FQGA 1W79A 3SH8A 2B5RA 1XPBA 4OLGA 3WS4A 4DDSA 1GHMA 4BD0A 4YINA 4P6BA 2J9PA 4R0QA 4GDBA 3M2KA 3ZDJA 4S2IA 1PYYA 3VP3A 1E3UD 1K57A 3A3DA 5FQKA 1J9MA 3MZDA 3OCNA 4EQIA 5FQIA 1LL5A 3RJUA 4PM9A 4PM5A 1L0EA 2J9OA 4RA7A 3GMWA 4GDNA 1CI8A 1BLCA 1BLSA 1IYSA 2Y55A 3BFDA 3CZDA 3V39A 5DTSA 3V3SA 3GVBA 5G18A 4HESA 3P98A 4A5RA 1KDWA 1GCEA 3VMAA 3ZFZA 4N9LA 1MBLA 4OPRA 1JWPA 1WYCA 4LCLA 4GD6A 4BD1A 4EBNA 3NCKA 5EVIB 1NZUA 4OQHA 1ESUA 2V20A 1XKZA 2ZC3B 1ERMA 3HL9A 5FAQA 4BL3A 5GHYA 1L0DA 2JBFA 5A91A 3V5MA 5L2FA 3JYIA 5CEBA 3EQUA 5DF7A 2DCFA 3WS2A 3IXGA 2WGIA 1YLZA 3I7JA 2HDRA 3WRZA 1XP4A 5EVLA 1ES2A 5FSRA 3OPPA 4U3TA 1CEGA 3D4FA 4S2PA 4ZDXA 4ZBEA 2R9WA 4QY6A 1O07A 3IXHA 5HFOA 3NDEA 3PBQA 3A3IA 4QY5A 4F94A 4OP5A 3UE1A 4FCFA 2Z2MB 4DE3A 1KGFA 1S6RA 1IELA 3SS5A 2EX9A 5CERA 5A92A 2XR0A 4BL2A 2FFYA 2P74A 3G2ZA 4C3QA 5FAOA 4HBTA 3G31A 1YM1A 4S2KA 4N9KA 4QU3A 3HLGA 1MKIA 5F83A 2Y2MA 5JYOA 1WYBA 2V2FF 1KGEA 1G68A 3Q7ZA 3VSLA 3LY4A 1YLWA 3PBTA 4B4ZA 3GR2A 5HAIA 1ZG6A 2FFFB 4GN2A 2ZM8A 4O7DA 1PIOA 4ZJ2A 5FQ9A 4OQ0A 3ZG9B 4X69A 5E2HA 4LCMA 3Q7VB 3MBZA 3W4PA 4M3KA 3HLWA 2XD1A 1KDSA 2QZ6A 3IF6C 1H5XA 4NETA 5CHJA 4PMAA 3PAEA 2ZQCA 2Y4AA 2WK0A 2J8YA 4UA7A 4LENA 1LL9A 4B88A 2QMIA 2ZQ7A 3N7WA 4ZJ3A 1I2WA 1NJ4A 2G2UA 3P09A 2E8IA 5AQAA 4ZJ1A 2XQZA 3C7VA 3BRMA 2ZM2A 4XUXA 1RGYA 2XDMA 1RCJA 2IWCA 3AGEA 5HARA 4KZ9A 1C3BA 3OCLA 4RX2A 3MKEA 4JF5A 1YT4A 1MY8A 3W4QA 1EROA 4Y7PA 5F1FA 3NIAA 1K6RA 2JC7A 3LY3A 4IVKA 3IHAA 1PWDA 1PZOA 2R9XA 1NY0A 2WGWB 2ZJ9A 4MBKA 3UPOA 3MZFA 3HLBA 3Q82A 4GD8A 4JKTA 4KZAA 5FQMA 1SHVA 3G32A 3C4PA 1BLHA 4OPQA 4OLDA 4EWFA 1SDNA 3ZG8B 2WGWA 4OOMA 5CHUA 1ES3A 4DE2A 4S2LA 1N4OA 4X6TA 2HP5A 5FI6A 5CGSA 2P9VA 3DWZA 3HLDA 4X68A 2V1ZA 4JLFA 1ONGA 4KZ7A 4PM7A 3ZCZA 1EI5A 2ZLYA 3RXWA 3IWQA 4KZ5A 5EUAA 4KQRA 2XH9A 3WS1A 4GB7A 4EUZA 2EFXA 3NI9A 5E2FA 5FQJA 3ZG7B 1GHPA 1MWTA 4JXSA 3ZVTA 5KSCA 2IWBA 3PTEA 3PBNA 3HUOA 2OV5A 4DE0A 3TSGA 5GL9A 5J8XA 4Z9QA 4K0XA 3M2JA 2RL3A 3HUMA 2Y2HA 3FKVA 4N1HA 3LEZA 1KE0A 3Q81A 1IEMA 1FCMA 4MBHA 3SOIA 5FASA 3O3VA 4KG5A 5E2EA 2WKIA 3OPRA 1AXBA 1U60A 5IHVA 2EFUA 3ISGA 1NZOA 1YLYA 2XFSA 4R23A 1SKFA 4DF6A 1IYOA 1SCWA 3WS0A 3N8LA 1SDEA 3ZNYA 4EBLA 2PU2A 2WZZA 1H8YA 3WS5A 4OPYA 1XA1A 3C4OA 3WRTA 3VOYA 3BYDA 1L0FA 5EPHA 3PBOA 3IH8A 3HLCA 3IF6B 4R3BA 1ES4A 4IVIA 4WEKA 5BOHA 1JVJA 1PI4A 3O86A 3PBSA 3S1YA 1MPLA 4D2OA 5HAPA 3MKFA 4UHUA 1DJCA 1S0WA 3IF6A 4E3KA 2WZXA 4KENB 1IYQA 4QD4A 5TGFA 2H0YA 2X01A 3ZNTA 3QNCA 2ZC6B 1HVBA 1PI5A 4DKIA 4OQIA 1TDGA 3A3JA 5AQBA 4N1XA 4EBPA 5DF8A 3HREA 3PBRA 3BFGA 5E43A 5GHXA 1K6SA 4UAAA 2X71A 1JTDA 3VP4A 4NK3A 3VP2A 4OKPA 3G34A 5TR7A 4L0LA 1I2SA 3UE0A 2Q9MA 4JXVA 1NRFA 3N8SA 3DW0A 3MXSA 3MZEA 1FSYA 3UNWA 5GLAA 4S2JA 5GLBA 3PAGA 2OLVA 1FCOA 3HLEA 4E3MA 3GV9A 1M40A 4KZ3A 4KZ6A 1MWSA 3BFCA 3LO7A 3G4PA 3OZHA 3AGDA 4UA6A 4FH4A 1XGIA 3ITBA 4PM6A 5CGWA 2ZQ8A 1W8QA 1KVLA 3BEBA 2HP6A 5DVAA 1HTZA 5FA7A 3WWXA 1KGGA 3VOZA 3V50A 5HW3A 2HDQA 2ZQAA 2IWDA 5HX9A 3B3XA 1H8ZA 3VFHA 3G35A 3SS4A 3NY4A 4WMCA 4K91A 2ZM0A 3UPNA 4E6WA 5TFQA 2VGJA 2Y91A 2Y2GA 3C5AA 4OPZA 4S2NA 1XX2A 2EXAA 3OPLA 3O88A 1TEMA 1YQSA 1JTGA 3UN7A 1BTLA 2PU4A 2ZQ9A 5CRFA 1NXYA 1YLJA 2A49A 4BENA 1CK3A 1YMXA 5GHZA 3GQZA 1MXOA 1FCNA 1W5DA 2WGVA 4DDYA 4JXWA 1KVMA 5A90A 1BULA 5HAQA 2XGNA 5I94A 1EWZA 4KZ8A 1W7FA 3S4XA 3G2YA 5HL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVI C;  1YLP A;  2XD5 A;  2ZC7 A;  3DWK A;  3HVF A;  1K55 C;  5FDH A;  3IWI A;  2J7V A;  4LV3 A;  2C5W B;  3MXR A;  4BLM A;  1ES5 A;  1PW8 A;  2ZC5 B;  2Y2L A;  1I5Q A;  4LV2 A;  4WZ5 C;  1JWZ A;  3BFE A;  1E4D A;  2P9V B;  4GZB A;  1XA7 A;  5D3O A;  3SH9 A;  4K0W A;  3UPP A;  4JF6 A;  2JE5 A;  5EOE A;  3TOI A;  1WE4 A;  3GRJ A;  1QMF A;  3W4O A;  4QHC A;  4FD8 A;  1TVF A;  1KE3 A;  3ZG0 A;  1ZC2 A;  3DTM A;  3S22 A;  1VM1 A;  1Q2Q A;  2EX2 A;  3CMZ A;  4JF4 A;  4KG2 A;  4FSF A;  3CJM A;  3A3F A;  1E25 A;  3EQV A;  3OPH A;  3ITA A;  4YFM A;  4S2N C;  4KG6 A;  4Q8I A;  1PW1 A;  2HDU A;  2WYX A;  3N4I A;  4OON A;  3CG5 A;  3NC8 A;  5EE8 A;  1ESI A;  3C7U A;  4P85 A;  4E3O A;  2WAE A;  1IKG A;  1HZO A;  4JPM A;  1LHY A;  3M6H A;  3ZVW A;  4XUZ A;  2HDS A;  1G6A A;  4Y0T A;  4MBF A;  2BG1 A;  3A3E A;  5EEC A;  3BLS A;  4R4S A;  1RP5 A;  4OH0 A;  2ZD8 A;  3OC2 A;  2WAD A;  4ZTK A;  2RCX A;  1OME A;  4B4X A;  3HUN A;  1LLB A;  1Q2P A;  3V3R A;  1Z6F A;  2XF3 A;  5KZH A;  5F1G A;  4DRT A;  3W8K A;  2Y2N A;  1BT5 A;  1FOF A;  4WEJ A;  3UDI A;  2Y59 A;  5EVI D;  3UDF A;  3IXB A;  4Y0U A;  4CJN A;  4DXB A;  2OLU A;  2WKE A;  1BZA A;  4HBU A;  5CGX A;  3NDG A;  4R4R A;  4C6Y A;  4E3I A;  1ZG4 A;  1N9B A;  1CEF A;  2ZC4 B;  4WYY A;  2EXB A;  4GOG A;  2XFT A;  1NYY A;  3O87 A;  3FV7 A;  4QJG A;  1IYP A;  4WEL A;  2WAF A;  2XEP A;  1BUE A;  1VQQ A;  3G30 A;  5GLC A;  3M6B A;  4UA9 A;  3FKW A;  4WMC D;  2H5S A;  4WZ4 A;  3UDX A;  2XK1 A;  1K56 D;  4WZ5 A;  2A3U A;  3Q07 A;  1IKI A;  4PM8 A;  5DF9 A;  5EVI A;  1E3U A;  5F82 A;  3VSK A;  1PWC A;  3AGF A;  1K55 A;  1MWR A;  1MWU A;  3UY6 A;  3VP0 A;  4LV1 A;  4GKU A;  2ZMA A;  1K54 A;  3QNB A;  2PBY A;  2CC1 A;  4WM9 A;  3BFF A;  2WKH A;  4P0M A;  3ZGA B;  1RGZ A;  1DY6 A;  4H8R A;  4OP8 A;  5DTK A;  5M18 A;  1BLP A;  4IBR A;  3HBR A;  2I72 A;  4E3J A;  2WUQ A;  4S2M A;  4IED A;  3MFD A;  4LV0 A;  1ERQ A;  4HEF A;  4N92 A;  4RYE A;  4EV4 A;  4KZ4 A;  2Y2I A;  2EX8 A;  1K4F A;  2HPB A;  1K57 C;  3UE3 A;  5DTT A;  4RVA A;  1BSG A;  4GNU A;  3IT9 A;  3VFF A;  4BQM A;  2DRW A;  4XXR A;  5U47 A;  4U0T A;  1K56 A;  1FR6 A;  2Q9N A;  5FAP A;  4E3N A;  2H0T A;  3SH7 A;  3UO9 A;  4CPK A;  3FZC A;  3RXX A;  4WBG A;  2Y2O A;  4IBX A;  2G2W A;  1XXM A;  4P87 A;  1K38 A;  1KE4 A;  3TG9 A;  1DJB A;  5CED A;  1FSW A;  1PZP A;  4KQO A;  5M19 A;  3IHB A;  5FQQ A;  4FH2 A;  5CEC A;  4Y0O A;  2Y2K A;  3IWO A;  1HD8 A;  5FI7 A;  5FI2 A;  3FWL A;  4KZB A;  4MEZ A;  1O7E A;  3BM6 A;  1PWG A;  1W8Y A;  3IH9 A;  4PPR A;  1LI0 A;  1CI9 A;  1GA0 A;  1YLT A;  1ONH A;  2C6W B;  2XLN A;  1JWV A;  3E2L A;  3HLF A;  1QME A;  3N8R A;  4JBF A;  4RX3 A;  2Y2P A;  5GLD A;  3NBL A;  4OOY A;  3VP1 A;  5FAT A;  3Q7V A;  3LCE A;  3FYZ A;  4OQG A;  5M1A A;  5AQ9 A;  3IXD A;  3BLM A;  4X55 A;  3BEC A;  1K54 C;  3E2K A;  4OOL A;  4X53 A;  5KMW A;  4JXG A;  2EX6 A;  3IF5 A;  4R1G A;  2JCH A;  1Y54 A;  3IQA A;  4OVD A;  2GDN A;  1GA9 A;  1LI9 A;  2X02 A;  4C75 A;  4BJP A;  2Y2Q A;  4S2O A;  1ZKJ A;  5CTM A;  1K4E A;  5CXW A;  4DXC A;  4E6X A;  1YMS A;  4ZAM A;  3N6I A;  2VGK A;  1NYM A;  3ZHH A;  1TDL A;  4QB8 A;  5E2G A;  4E3L A;  1XGJ A;  4ID4 A;  2OSU A;  5JYP A;  4MLL A;  2DNS A;  5KSH A;  4R3J A;  2QPN A;  2UWX A;  1DJA A;  5CHM A;  3ZG5 A;  2BLS A;  2HP9 A;  3GSG A;  2Z2L B;  5A93 A;  3Q1F A;  1M6K A;  1ALQ A;  1FR1 A;  1GHI A;  2Y2J A;  2ZQD A;  4U0X A;  3GTC A;  3QHY A;  1L0G A;  5EOO A;  1L2S A;  5AQ7 A;  1K25 A;  2H10 A;  4DE1 A;  4X56 A;  5CTN A;  3SS3 A;  4MNR A;  4KQQ A;  1FQG A;  1W79 A;  3SH8 A;  2B5R A;  1XPB A;  4OLG A;  3WS4 A;  4DDS A;  1GHM A;  4BD0 A;  4YIN A;  4P6B A;  2J9P A;  4R0Q A;  4GDB A;  3M2K A;  3ZDJ A;  4S2I A;  1PYY A;  3VP3 A;  1E3U D;  1K57 A;  3A3D A;  5FQK A;  1J9M A;  3MZD A;  3OCN A;  4EQI A;  5FQI A;  1LL5 A;  3RJU A;  4PM9 A;  4PM5 A;  1L0E A;  2J9O A;  4RA7 A;  3GMW A;  4GDN A;  1CI8 A;  1BLC A;  1BLS A;  1IYS A;  2Y55 A;  3BFD A;  3CZD A;  3V39 A;  5DTS A;  3V3S A;  3GVB A;  5G18 A;  4HES A;  3P98 A;  4A5R A;  1KDW A;  1GCE A;  3VMA A;  3ZFZ A;  4N9L A;  1MBL A;  4OPR A;  1JWP A;  1WYC A;  4LCL A;  4GD6 A;  4BD1 A;  4EBN A;  3NCK A;  5EVI B;  1NZU A;  4OQH A;  1ESU A;  2V20 A;  1XKZ A;  2ZC3 B;  1ERM A;  3HL9 A;  5FAQ A;  4BL3 A;  5GHY A;  1L0D A;  2JBF A;  5A91 A;  3V5M A;  5L2F A;  3JYI A;  5CEB A;  3EQU A;  5DF7 A;  2DCF A;  3WS2 A;  3IXG A;  2WGI A;  1YLZ A;  3I7J A;  2HDR A;  3WRZ A;  1XP4 A;  5EVL A;  1ES2 A;  5FSR A;  3OPP A;  4U3T A;  1CEG A;  3D4F A;  4S2P A;  4ZDX A;  4ZBE A;  2R9W A;  4QY6 A;  1O07 A;  3IXH A;  5HFO A;  3NDE A;  3PBQ A;  3A3I A;  4QY5 A;  4F94 A;  4OP5 A;  3UE1 A;  4FCF A;  2Z2M B;  4DE3 A;  1KGF A;  1S6R A;  1IEL A;  3SS5 A;  2EX9 A;  5CER A;  5A92 A;  2XR0 A;  4BL2 A;  2FFY A;  2P74 A;  3G2Z A;  4C3Q A;  5FAO A;  4HBT A;  3G31 A;  1YM1 A;  4S2K A;  4N9K A;  4QU3 A;  3HLG A;  1MKI A;  5F83 A;  2Y2M A;  5JYO A;  1WYB A;  2V2F F;  1KGE A;  1G68 A;  3Q7Z A;  3VSL A;  3LY4 A;  1YLW A;  3PBT A;  4B4Z A;  3GR2 A;  5HAI A;  1ZG6 A;  2FFF B;  4GN2 A;  2ZM8 A;  4O7D A;  1PIO A;  4ZJ2 A;  5FQ9 A;  4OQ0 A;  3ZG9 B;  4X69 A;  5E2H A;  4LCM A;  3Q7V B;  3MBZ A;  3W4P A;  4M3K A;  3HLW A;  2XD1 A;  1KDS A;  2QZ6 A;  3IF6 C;  1H5X A;  4NET A;  5CHJ A;  4PMA A;  3PAE A;  2ZQC A;  2Y4A A;  2WK0 A;  2J8Y A;  4UA7 A;  4LEN A;  1LL9 A;  4B88 A;  2QMI A;  2ZQ7 A;  3N7W A;  4ZJ3 A;  1I2W A;  1NJ4 A;  2G2U A;  3P09 A;  2E8I A;  5AQA A;  4ZJ1 A;  2XQZ A;  3C7V A;  3BRM A;  2ZM2 A;  4XUX A;  1RGY A;  2XDM A;  1RCJ A;  2IWC A;  3AGE A;  5HAR A;  4KZ9 A;  1C3B A;  3OCL A;  4RX2 A;  3MKE A;  4JF5 A;  1YT4 A;  1MY8 A;  3W4Q A;  1ERO A;  4Y7P A;  5F1F A;  3NIA A;  1K6R A;  2JC7 A;  3LY3 A;  4IVK A;  3IHA A;  1PWD A;  1PZO A;  2R9X A;  1NY0 A;  2WGW B;  2ZJ9 A;  4MBK A;  3UPO A;  3MZF A;  3HLB A;  3Q82 A;  4GD8 A;  4JKT A;  4KZA A;  5FQM A;  1SHV A;  3G32 A;  3C4P A;  1BLH A;  4OPQ A;  4OLD A;  4EWF A;  1SDN A;  3ZG8 B;  2WGW A;  4OOM A;  5CHU A;  1ES3 A;  4DE2 A;  4S2L A;  1N4O A;  4X6T A;  2HP5 A;  5FI6 A;  5CGS A;  2P9V A;  3DWZ A;  3HLD A;  4X68 A;  2V1Z A;  4JLF A;  1ONG A;  4KZ7 A;  4PM7 A;  3ZCZ A;  1EI5 A;  2ZLY A;  3RXW A;  3IWQ A;  4KZ5 A;  5EUA A;  4KQR A;  2XH9 A;  3WS1 A;  4GB7 A;  4EUZ A;  2EFX A;  3NI9 A;  5E2F A;  5FQJ A;  3ZG7 B;  1GHP A;  1MWT A;  4JXS A;  3ZVT A;  5KSC A;  2IWB A;  3PTE A;  3PBN A;  3HUO A;  2OV5 A;  4DE0 A;  3TSG A;  5GL9 A;  5J8X A;  4Z9Q A;  4K0X A;  3M2J A;  2RL3 A;  3HUM A;  2Y2H A;  3FKV A;  4N1H A;  3LEZ A;  1KE0 A;  3Q81 A;  1IEM A;  1FCM A;  4MBH A;  3SOI A;  5FAS A;  3O3V A;  4KG5 A;  5E2E A;  2WKI A;  3OPR A;  1AXB A;  1U60 A;  5IHV A;  2EFU A;  3ISG A;  1NZO A;  1YLY A;  2XFS A;  4R23 A;  1SKF A;  4DF6 A;  1IYO A;  1SCW A;  3WS0 A;  3N8L A;  1SDE A;  3ZNY A;  4EBL A;  2PU2 A;  2WZZ A;  1H8Y A;  3WS5 A;  4OPY A;  1XA1 A;  3C4O A;  3WRT A;  3VOY A;  3BYD A;  1L0F A;  5EPH A;  3PBO A;  3IH8 A;  3HLC A;  3IF6 B;  4R3B A;  1ES4 A;  4IVI A;  4WEK A;  5BOH A;  1JVJ A;  1PI4 A;  3O86 A;  3PBS A;  3S1Y A;  1MPL A;  4D2O A;  5HAP A;  3MKF A;  4UHU A;  1DJC A;  1S0W A;  3IF6 A;  4E3K A;  2WZX A;  4KEN B;  1IYQ A;  4QD4 A;  5TGF A;  2H0Y A;  2X01 A;  3ZNT A;  3QNC A;  2ZC6 B;  1HVB A;  1PI5 A;  4DKI A;  4OQI A;  1TDG A;  3A3J A;  5AQB A;  4N1X A;  4EBP A;  5DF8 A;  3HRE A;  3PBR A;  3BFG A;  5E43 A;  5GHX A;  1K6S A;  4UAA A;  2X71 A;  1JTD A;  3VP4 A;  4NK3 A;  3VP2 A;  4OKP A;  3G34 A;  5TR7 A;  4L0L A;  1I2S A;  3UE0 A;  2Q9M A;  4JXV A;  1NRF A;  3N8S A;  3DW0 A;  3MXS A;  3MZE A;  1FSY A;  3UNW A;  5GLA A;  4S2J A;  5GLB A;  3PAG A;  2OLV A;  1FCO A;  3HLE A;  4E3M A;  3GV9 A;  1M40 A;  4KZ3 A;  4KZ6 A;  1MWS A;  3BFC A;  3LO7 A;  3G4P A;  3OZH A;  3AGD A;  4UA6 A;  4FH4 A;  1XGI A;  3ITB A;  4PM6 A;  5CGW A;  2ZQ8 A;  1W8Q A;  1KVL A;  3BEB A;  2HP6 A;  5DVA A;  1HTZ A;  5FA7 A;  3WWX A;  1KGG A;  3VOZ A;  3V50 A;  5HW3 A;  2HDQ A;  2ZQA A;  2IWD A;  5HX9 A;  3B3X A;  1H8Z A;  3VFH A;  3G35 A;  3SS4 A;  3NY4 A;  4WMC A;  4K91 A;  2ZM0 A;  3UPN A;  4E6W A;  5TFQ A;  2VGJ A;  2Y91 A;  2Y2G A;  3C5A A;  4OPZ A;  4S2N A;  1XX2 A;  2EXA A;  3OPL A;  3O88 A;  1TEM A;  1YQS A;  1JTG A;  3UN7 A;  1BTL A;  2PU4 A;  2ZQ9 A;  5CRF A;  1NXY A;  1YLJ A;  2A49 A;  4BEN A;  1CK3 A;  1YMX A;  5GHZ A;  3GQZ A;  1MXO A;  1FCN A;  1W5D A;  2WGV A;  4DDY A;  4JXW A;  1KVM A;  5A90 A;  1BUL A;  5HAQ A;  2XGN A;  5I94 A;  1EWZ A;  4KZ8 A;  1W7F A;  3S4X A;  3G2Y A;  5HL1 A; 
#chains in the Genus database with same CATH topology
 1YLP A;  2ZC7 A;  3OLO A;  1T1C A;  2HGV A;  2VZW A;  3MXR A;  1PW8 A;  2O9A A;  3B33 A;  2Y2L A;  4HHD A;  3PR6 A;  3BFE A;  3MMH A;  1YPR A;  1D1J A;  4JF6 A;  2JE5 A;  1TVF A;  1VEU A;  3ZG0 A;  1STZ A;  3S22 A;  1Q2Q A;  3BY9 A;  4JF4 A;  3EQV A;  2HDU A;  4OON A;  4GS9 A;  1N9O A;  5EE8 A;  2VX8 A;  4P85 A;  1LHY A;  1H0M A;  2PRF A;  3M6H A;  2B18 A;  3F1P B;  1P97 A;  1G6A A;  4MBF A;  3QP2 A;  3A3E A;  2DMW A;  2KOI A;  3BLS A;  4Y17 A;  4BBT A;  1RP5 A;  2ZD8 A;  1OME A;  3V3R A;  3T4J A;  5F1G A;  4ME4 A;  1SZV A;  4L9E A;  2Y59 A;  1SKO A;  1G28 A;  2AVX A;  3O5Y A;  4HBU A;  1S66 L;  3H82 A;  2PYR A;  4EXO A;  1ODV A;  2JKT M;  3SW1 A;  3O87 A;  4QJG A;  1IYP A;  1K0K A;  1S67 L;  1BUE A;  4HP4 A;  3G30 A;  3M6B A;  4WMC D;  3W2Z A;  4WZ4 A;  2XK1 A;  2A3U A;  3T4Q A;  3RFB A;  3VSK A;  3C2W A;  1MWR A;  4HJ4 A;  1CJF A;  4GKU A;  2ZMA A;  3JVU A;  4IUK A;  2PBY A;  2B95 A;  3BFF A;  3R7W B;  4E3J A;  4HEF A;  4NXB A;  5DTT A;  2VA0 A;  4GCZ A;  2JKF A;  2GJ3 A;  4U0T A;  2Q9N A;  1FIK A;  3DAV A;  3F1N B;  5A8B A;  4CLC E;  3TG9 A;  2YKH A;  1PZP A;  2YKF A;  2Y2K A;  4KZB A;  3BM6 A;  3T4L A;  4DMZ A;  4MNR A;  3E2L A;  1YLT A;  5GLD A;  2HJ9 C;  3VP1 A;  4GHI B;  3FYZ A;  5M1A A;  5AQ9 A;  4RQ9 A;  4X55 A;  4EET B;  3E2K A;  4X53 A;  5KMW A;  2EX6 A;  2VK3 A;  4R1G A;  2JCH A;  4YNR A;  4BJP A;  2J3W A;  1K4E A;  2QJ7 A;  1YMS A;  1XJ2 A;  3N6I A;  2VGK A;  1TDL A;  1TS0 A;  4QB8 A;  4LGW A;  2NUP C;  3B47 A;  5KSH A;  4I38 A;  4FOF A;  1LSX A;  3E4Q A;  5CHM A;  2BLS A;  3CIT A;  4NXF A;  3EEH A;  1FR1 A;  3NEC A;  4MN5 A;  1GHI A;  2ZQD A;  2W3H A;  1K25 A;  2H10 A;  5F68 A;  5CTN A;  4OLG A;  1XPB A;  4IUH A;  3ZYT A;  2J9P A;  3QP6 A;  2W3G A;  2JKT I;  3MFX A;  4S2I A;  1PYY A;  3DTK A;  3FPW A;  1J9M A;  3RJU A;  4PM5 A;  2J9O A;  4RA7 A;  4GDN A;  2Y55 A;  5L10 A;  4CLC B;  3V3S A;  3B42 A;  3GVB A;  3ZFZ A;  5DJT A;  1JWP A;  4I3A A;  1WYC A;  4LCL A;  2ZL1 A;  3UB5 P;  3NCK A;  1ESU A;  2V20 A;  3HL9 A;  1ERM A;  5FAQ A;  3V5M A;  2JBF A;  3JYI A;  3E98 A;  3WS2 A;  2WGI A;  3I7J A;  4U3T A;  1CEG A;  4S2P A;  4H6J A;  2K31 A;  5HFO A;  3PBQ A;  4UQI M;  4QY5 A;  2EWV A;  1KGF A;  1S6R A;  2EX9 A;  4DN0 A;  3G2Z A;  3G31 A;  1YM1 A;  1MKI A;  1WYB A;  1KGE A;  1G68 A;  2HZ5 A;  3Q7Z A;  3VSL A;  3LY4 A;  4HH2 A;  4NXG A;  3GR2 A;  1ZG6 A;  4O7D A;  4ZJ2 A;  3LR5 A;  4LCM A;  2M7U A;  3Q7V B;  2W1T B;  2V8C A;  3T1R A;  3MBZ A;  3W4P A;  4M3K A;  2QZ6 A;  3IF6 C;  1H5X A;  1VB6 A;  5CHJ A;  4PMA A;  2ZQC A;  4UA7 A;  2J8Y A;  4ZJ3 A;  2E8J A;  1I2W A;  2G2U A;  2VV8 A;  1XJ6 A;  1P9W A;  5AQA A;  5IT5 A;  3BRM A;  2ZM2 A;  2XDM A;  1RCJ A;  1Z09 A;  5HAR A;  1ERO A;  4Y7P A;  4AFI A;  4IVK A;  3IHA A;  3QP5 A;  2ZJ9 A;  3HLB A;  4GD8 A;  1P0Z A;  4OPQ A;  5J3W A;  1SDN A;  2WGW A;  4OOM A;  1ES3 A;  1N4O A;  4X6T A;  5HDC A;  1GSX A;  4X68 A;  2V1Z A;  1ONG A;  4KZ7 A;  3ZCZ A;  1EI5 A;  3RXW A;  3WS1 A;  2WKR A;  3NI9 A;  1GHP A;  1MWT A;  1S1Z A;  3PBN A;  3HUO A;  2OV5 A;  4K0X A;  2VGL M;  2Y2H A;  3FKV A;  4Y13 A;  1IEM A;  4R38 A;  2WKI A;  3F1P A;  4Z1W A;  2EFU A;  1NZO A;  1YLY A;  1CF0 A;  2LB5 A;  4HOI A;  4EBL A;  2PU2 A;  4Y15 A;  5DFY A;  3VE3 A;  1XA1 A;  4HY8 A;  1L0F A;  5EPH A;  4MN6 A;  1ES4 A;  4D2O A;  1DJC A;  3IF6 A;  4O8G A;  4E3K A;  5TGF A;  2H0Y A;  1TDG A;  4N1X A;  5DF8 A;  3KYQ A;  5C5K A;  2VEA A;  2X71 A;  4NK3 A;  3E4O A;  4OKP A;  5TR7 A;  1I2S A;  1NRF A;  3N8S A;  3DW0 A;  3T4S A;  3MXS A;  3UB9 A;  5HD3 A;  3UNW A;  5GLA A;  5GLB A;  3PAG A;  3GV9 A;  1M40 A;  4KZ6 A;  3BFC A;  4UA6 A;  5CGW A;  3T12 B;  1JNU A;  2ZQ8 A;  1W8Q A;  1KGG A;  5DJU A;  5HW3 A;  2HDQ A;  2PR6 A;  5HX9 A;  3R7W A;  3TJZ C;  1H8Z A;  3SS4 A;  3NY4 A;  3UPN A;  5TFQ A;  2VGJ A;  2Y2G A;  3UB6 A;  2OWJ A;  3O88 A;  1TEM A;  5L09 A;  3MQO A;  3UN7 A;  2PU4 A;  1NXY A;  1LT0 A;  2W27 A;  4JXW A;  5HAQ A;  1EWZ A;  3E0Y A;  5HL1 A;  2OOL A;  2PD7 A;  3OOV A;  2XD5 A;  1TF1 A;  3HVF A;  2L0W A;  4BLM A;  4LV3 A;  4MCW A;  1ZTU A;  1JWZ A;  5TJJ A;  2P9V B;  1GSW A;  3SH9 A;  2I9V A;  5EFW A;  5EOE A;  3UPP A;  3TOI A;  5I5L A;  1QMF A;  3T1S A;  4ARZ B;  3GEC A;  4FD8 A;  2P08 A;  1NLY A;  1YAX A;  1VM1 A;  2EX2 A;  1DP8 A;  1UWN X;  4LPZ A;  3CJM A;  1E25 A;  4YFM A;  4S2N C;  1PW1 A;  2WYX A;  3N4I A;  5J7E A;  5G4Z A;  3C7U A;  2WAE A;  1HZO A;  3L9K A;  3NUL A;  3BWL A;  3OC2 A;  2WAD A;  3KSG A;  1S4R A;  4BBU A;  1LLB A;  1Q2P A;  2XF3 A;  1ZHH B;  4DRT A;  4HP9 A;  2Y2N A;  1FOF A;  4WEJ A;  3UDI A;  4DXB A;  4JGO A;  4NG2 A;  2M7V A;  4C6Y A;  2ZC4 B;  4WYY A;  2EXB A;  3A0V A;  2XFT A;  1NYY A;  4CLC A;  4WEL A;  2XEP A;  3PYP A;  1VQQ A;  3BJN A;  3T1Q B;  1K56 D;  1A0K A;  3Q07 A;  1IKI A;  4PM8 A;  4Y2F A;  5F82 A;  1OTI A;  1TD5 A;  1PWC A;  5EM1 A;  5F6A A;  5J4E A;  4B9O A;  1OT6 A;  3ZGA B;  1RGZ A;  4OP8 A;  2KLI A;  4IBR A;  3GDI A;  3MFD A;  4LV0 A;  4N92 A;  4KZ4 A;  3LIC A;  1K4F A;  1OTA A;  3IT9 A;  1K56 A;  5FAP A;  3T4K A;  3SH7 A;  1OPX A;  4WBG A;  2G2W A;  1XXM A;  4NKP A;  4P87 A;  3A0S A;  3LR0 A;  5M19 A;  5FQQ A;  5CEC A;  5FI7 A;  3FG8 A;  3IH9 A;  4PPR A;  3HLF A;  3K3C A;  1LI0 A;  2C6W B;  4JBF A;  3JPU A;  2V0U A;  3NBL A;  2ACG A;  3Q7V A;  3LCE A;  2W1T A;  4OQG A;  3BLM A;  4XT2 B;  1WA9 A;  4OOL A;  3IF5 A;  3IQA A;  4OVD A;  2GDN A;  1LI9 A;  2X02 A;  3IX3 A;  4C75 A;  3VOL A;  5CXW A;  5JYP A;  1F9I A;  4ID4 A;  5L8M A;  3S7P A;  4G3V A;  3CAX A;  1CQA A;  2KDK A;  4U0X A;  5IU1 A;  3GTC A;  5HWV A;  1IFQ A;  4DE1 A;  4KQQ A;  1FQG A;  4BD0 A;  3LYX A;  3M2K A;  2WKP A;  4Q0I A;  4DJ3 A;  3MZD A;  5EM0 A;  3GMW A;  1BLC A;  3CUE A;  4YWZ A;  4HES A;  2W1R A;  1KDW A;  1GCE A;  3VMA A;  2ZBB A;  4QWO A;  1UGU A;  4EBN A;  1S1Y A;  2PBD P;  1NZU A;  2GZA A;  3HJK A;  4HQA A;  3ZQ5 A;  5GHY A;  5A91 A;  5L2F A;  2EWW A;  5DF7 A;  2HDR A;  3WRZ A;  5EVL A;  2V9A A;  5FSR A;  1GSV A;  3S7O A;  3D4F A;  4ZDX A;  1N9L A;  3U4L P;  1PRQ A;  4QY6 A;  4B93 A;  3FPV A;  3TE8 A;  4F94 A;  4OP5 A;  3UE1 A;  4FCF A;  2UV0 E;  2Z2M B;  4FTX A;  4BL2 A;  2P74 A;  1DP6 A;  4HBT A;  4N9K A;  4QU3 A;  3HLG A;  2VLG A;  5JYO A;  5HDS A;  4X1M A;  2VKS A;  4WN5 A;  1OJ5 A;  2W0N A;  3ICY A;  5HAI A;  2FFF B;  5HWW A;  1MC0 A;  3ZG9 B;  3LGO A;  4YOF A;  2FZ0 A;  3V67 A;  4LRY C;  1KDS A;  4NET A;  2WK0 A;  3UME A;  4LEN A;  1NJ4 A;  3P09 A;  2E8I A;  1RGY A;  2W3D A;  4RX2 A;  1YT4 A;  3KX0 X;  5F1F A;  3NIA A;  2R9X A;  2Z6C A;  4MBK A;  3RTY A;  4JKT A;  4LRX C;  4KZA A;  5FL3 A;  3ZG8 B;  4DE2 A;  3LI9 A;  2HP5 A;  2W3F A;  1PFL A;  2P9V A;  4PM7 A;  4KZ5 A;  5EUA A;  4R3A A;  4ARZ A;  3ZG7 B;  3ZVT A;  2VV7 A;  4DE0 A;  5GL9 A;  5J8X A;  3M2J A;  3IS2 B;  4X1L A;  3FC7 A;  1KE0 A;  2VJW A;  3SOI A;  5FAS A;  3O3V A;  3LUQ A;  5E2E A;  1U60 A;  3EGX C;  1TS8 A;  1IYO A;  3KSH A;  1SDE A;  2WZZ A;  1LSV A;  3C4O A;  4KUK A;  3VOY A;  3HLC A;  2D02 A;  4IVI A;  1PI4 A;  3PBS A;  3MKF A;  4EEP A;  2WZX A;  3QNC A;  1PI5 A;  4OQI A;  1VET B;  3A3J A;  4ETX A;  3EWK A;  3PBR A;  3BFG A;  1D7E A;  3VP2 A;  4LFU A;  4I3I A;  4Y5F A;  4JXV A;  4LRZ E;  1TS7 A;  1S4S A;  3E4P A;  2M1C A;  1MWS A;  3OZH A;  3NOU C;  2HP6 A;  2OAP 1;  3WWX A;  3S7Q A;  3V50 A;  1F98 A;  2A24 B;  5FDS A;  1FIL A;  3VFH A;  2PYP A;  2Y91 A;  3OPL A;  1YQS A;  3VV4 A;  1BTL A;  2ZQ9 A;  4BEN A;  1YMX A;  5GHZ A;  4D60 A;  3CWF A;  1XJ3 A;  4PKY A;  1FCN A;  4DDY A;  1BUL A;  2XGN A;  5FEG A;  4X56 A;  2W3E A;  2O9C A;  3DWK A;  5FDH A;  2C5W B;  1PNE A;  4KUO A;  5IS1 A;  2ZC5 B;  3L7H A;  4WLA A;  4GZB A;  1XA7 A;  4K0W A;  2P04 A;  4XT2 A;  3GRJ A;  3BQA A;  3W4O A;  5DKL A;  1ZC2 A;  3DTM A;  3T4T A;  3CMZ A;  4FSF A;  3D3O A;  3ITA A;  3UMD A;  1ACF A;  1ESI A;  4E3O A;  2CMN A;  1IKG A;  3ZVW A;  2HDS A;  4Y0T A;  2BG1 A;  1H8M A;  4G3K A;  4EEU A;  4R4S A;  3A0R A;  2RCX A;  3HUN A;  3MXQ A;  1V9Y A;  4JGP A;  5L07 A;  1BYW A;  3W8K A;  1OT9 A;  5K5B A;  2V8F A;  3UDF A;  3IXB A;  4Y0U A;  4HJ6 A;  3H82 B;  4IHQ A;  2WKE A;  3NDG A;  4R4R A;  4E3I A;  1ZG4 A;  4G3W A;  1N9B A;  5HL6 A;  2QHK A;  4GOG A;  1G6O A;  2V1B A;  3FKW A;  3UDX A;  4WZ5 A;  1P9R A;  3IX8 A;  1E3U A;  3AGF A;  3UY6 A;  4LV1 A;  2L4R A;  1K54 A;  3H7W B;  2KX6 A;  4H8R A;  1BLP A;  3HBR A;  2I72 A;  4S2M A;  4IED A;  2ZMF A;  4KQD A;  1ERQ A;  2Y2I A;  1TS6 A;  3UE3 A;  4GNU A;  4BQM A;  1FR6 A;  4E3N A;  2H0T A;  5DKK A;  2QJ5 A;  3UO9 A;  4CPK A;  3FZC A;  3RXX A;  3D72 A;  4IBX A;  1KE4 A;  1DJB A;  3F1N A;  1YKD A;  3VE4 A;  4CLC C;  5F69 A;  4FH2 A;  3IWO A;  4P6Z S;  1HD8 A;  2D01 A;  5FI2 A;  4MEZ A;  1W8Y A;  1CI9 A;  1GA0 A;  3N8R A;  1ONH A;  3F1O B;  1QME A;  4RX3 A;  1G5U A;  2Y2P A;  4OOY A;  5FAT A;  4WL9 A;  5AVE A;  4HH3 A;  3BEC A;  4GHI A;  1Y54 A;  3T1X A;  1GA9 A;  3IX4 A;  2Y2Q A;  4S2O A;  1ZKJ A;  4HIA A;  4DXC A;  4E6X A;  4ZAM A;  1NYM A;  4CQH A;  2OSU A;  4WF0 A;  4MLL A;  2DNS A;  2QPN A;  2UWX A;  3ZG5 A;  2HP9 A;  4F3L B;  2Z2L B;  5A93 A;  3Q1F A;  1ALQ A;  3MS6 A;  3QHY A;  1L0G A;  5EOO A;  3KO6 A;  3PHY A;  4CLC D;  1T1B A;  1W79 A;  3SH8 A;  2B5R A;  3WS4 A;  4YIN A;  4R0Q A;  3C38 A;  5FQK A;  3OCN A;  5FQI A;  1LL5 A;  4PM9 A;  1L0E A;  1CI8 A;  3IS2 A;  5DTS A;  5G18 A;  2ZL1 B;  3P98 A;  1MBL A;  4OPR A;  4EES A;  4GD6 A;  4BD1 A;  1AWI A;  2QWS A;  5EVI B;  3ULF A;  4OQH A;  4K08 A;  1XKZ A;  1DRM A;  5HPF A;  5CEB A;  1YSP A;  2DCF A;  3IXG A;  4EUV A;  1ES2 A;  3S7N A;  5TBM B;  1MZU A;  3NDE A;  3A3I A;  3LEQ A;  4DE3 A;  1IEL A;  3SS5 A;  2EA9 A;  5CER A;  5A92 A;  2XR0 A;  4BWI A;  2FH5 A;  4S2K A;  5F83 A;  4HJ3 A;  2O99 A;  3CUE C;  2V2F F;  2PR5 A;  1YLW A;  5HSQ A;  4MDZ A;  3PBT A;  4B4Z A;  3MQQ A;  2ZM8 A;  1PIO A;  1F2K A;  3OBF A;  4X69 A;  4UQI S;  4ESP A;  4FUW A;  1V9Z A;  5LBR A;  2INW A;  3UE6 A;  3CPT B;  3HLW A;  2XD1 A;  3LID A;  3HJI A;  5CX7 A;  1Y4O A;  1LL9 A;  4B88 A;  2ZQ7 A;  2J3T C;  3MR0 A;  3DBA A;  3RH8 B;  3C7V A;  2IWC A;  3AGE A;  3EGD C;  4KZ9 A;  1C3B A;  3OCL A;  3MKE A;  3W4Q A;  1MY8 A;  1MKM A;  3LY3 A;  2JC7 A;  2NUT C;  2GNX A;  4JGR A;  1NY0 A;  2WGW B;  4O0P A;  3MZF A;  3T50 A;  3Q82 A;  2O9B A;  2XA7 S;  4EWF A;  5CHU A;  4S2L A;  3D9Y A;  5CGS A;  3HLD A;  3DWZ A;  4JLF A;  4QPR A;  3CI6 A;  3IWQ A;  3QP4 A;  2XH9 A;  5KSC A;  1KOU A;  3HCY A;  1W63 M;  3DTI A;  4EW7 A;  3TSG A;  2PD8 A;  3HUM A;  4N1H A;  2ZOI A;  3LEZ A;  4NXE A;  4MBH A;  2OAQ 1;  2J3T D;  3BY8 A;  3ISG A;  2XFS A;  4R23 A;  1SKF A;  4DF6 A;  3WS0 A;  1H8Y A;  3WRT A;  3BYD A;  3PBO A;  1OJG A;  3IF6 B;  4II7 A;  4R3B A;  1JVJ A;  3S1Y A;  2VGL S;  4UHU A;  1H3Q A;  2PDR A;  4KEN B;  1IYQ A;  4QD4 A;  2X01 A;  3ZNT A;  2ZC6 B;  4DKI A;  4JGQ A;  3MSH A;  5HDD A;  3HRE A;  1K6S A;  1OTD A;  2B02 A;  3VP4 A;  3G34 A;  1OTB A;  2Q9M A;  2JKG A;  3HLE A;  4E3M A;  4KZ3 A;  4FH4 A;  4P6Z M;  1KVL A;  1HTZ A;  4ZRR A;  1NRJ A;  5G4Y A;  2IWD A;  3H7W A;  5DFX A;  3G35 A;  4WMC A;  1Y28 A;  4K91 A;  2ZM0 A;  4OPZ A;  3C5A A;  1XX2 A;  4R70 A;  2EXA A;  4ETZ A;  2PHY A;  1JTG A;  5CRF A;  2K2N A;  2A49 A;  5F5Y A;  4E04 A;  1W5D A;  2WGV A;  5EV0 A;  4Q0J A;  5I94 A;  2JKR M;  4KZ8 A;  1W7F A;  5KIZ A;  3G2Y A;  2H28 A;  5AVF A;  5EVI C;  1K55 C;  3F1O A;  2J7V A;  3IWI A;  5HD5 A;  1ES5 A;  2HV1 A;  3P7N A;  4LV2 A;  1I5Q A;  1E4D A;  5D3O A;  1WE4 A;  4QHC A;  3UB7 A;  1KE3 A;  1XJ4 A;  4KG2 A;  4Q0H A;  3A3F A;  2Y79 A;  3OPH A;  4KG6 A;  4Q8I A;  3G6O A;  3CG5 A;  3NC8 A;  4MMN A;  4JPM A;  4XUZ A;  3PXP A;  5EEC A;  4OH0 A;  4ZTK A;  4F3L A;  4B4X A;  2L1M A;  2IA2 A;  4PAU A;  2LB9 A;  1Z6F A;  4NEE D;  1T19 A;  5KZH A;  2MJ6 A;  1BT5 A;  5EVI D;  5EVE A;  4CJN A;  2OLU A;  1BZA A;  2K7S A;  4L9G A;  2Q0O A;  1CEF A;  3JVV A;  1NLZ A;  3KYZ A;  3FV7 A;  4UEY A;  3LIB A;  2XRN A;  2WAF A;  5GLC A;  4PKY G;  4UA9 A;  2H5S A;  3MF0 A;  2G7U A;  1EW0 A;  5DF9 A;  1DP9 A;  1VHM A;  5EVI A;  4LLO B;  1OTE A;  1K55 A;  4EQ1 A;  1MWU A;  3VP0 A;  3QNB A;  2CC1 A;  4WM9 A;  2V1A A;  2WKH A;  4P0M A;  3K2N A;  1DY6 A;  5DTK A;  5M18 A;  5TBM A;  3QP8 A;  2WUQ A;  4X25 A;  4EV4 A;  4RYE A;  2EX8 A;  2HPB A;  1K57 C;  4RVA A;  1BSG A;  3VFF A;  2DRW A;  4XXR A;  5U47 A;  3LIE A;  2A2L A;  2JKR I;  2Y2O A;  1K38 A;  5CED A;  1FSW A;  4KQO A;  4R6L A;  3IHB A;  1X0O A;  4Y0O A;  3FWL A;  1O7E A;  1PWG A;  5CGX A;  2XLN A;  4WZ5 C;  3LIA A;  3IBR A;  1JWV A;  2XA7 M;  3SZT A;  2GX5 A;  3IXD A;  4O01 A;  3CHW P;  3CPT A;  1K54 C;  4JXG A;  1VEU B;  2V0W A;  2P7J A;  2Y8H A;  5CTM A;  4GLQ A;  4GS9 B;  3ZHH A;  3BQ8 A;  4L9F A;  2Z6D A;  5E2G A;  2WKQ A;  4E3L A;  1XGJ A;  4R3J A;  3TRC A;  1DJA A;  5HPI A;  3GSG A;  1M6K A;  1XFN A;  2Y2J A;  2R78 A;  1L2S A;  3DTE A;  5AQ7 A;  3SS3 A;  3LR3 A;  1SKO B;  5HZH A;  4DDS A;  1GHM A;  4P6B A;  3C30 A;  3CLO A;  1UWP X;  4GDB A;  3ZDJ A;  3VP3 A;  1E3U D;  1K57 A;  3A3D A;  4EQI A;  4GJ4 A;  4HNB A;  1N9N A;  1BLS A;  1IYS A;  3BFD A;  3CZD A;  3V39 A;  2J80 A;  1T18 A;  4A5R A;  3UB8 A;  4N9L A;  1J3W A;  3P01 A;  2ZC3 B;  2XSS A;  4BL3 A;  3LIF A;  4I39 A;  1L0D A;  2HF6 A;  3EQU A;  1YLZ A;  1XP4 A;  1IOU A;  4GW9 A;  3OPP A;  4ZBE A;  2R9W A;  1O07 A;  3IXH A;  1L3L A;  2ZMV A;  2BTF P;  2FFY A;  4C3Q A;  5FAO A;  5MC7 A;  2Y2M A;  4MN7 A;  3NOP C;  4GN2 A;  4I3J A;  5FQ9 A;  4M4X A;  4OQ0 A;  5E2H A;  2PT7 A;  3KSF A;  2ZOH A;  1HLU P;  3U2A A;  3PAE A;  2Y4A A;  3LR4 A;  2QMI A;  3N7W A;  3NHQ A;  3K3D A;  3R4K A;  3TW8 A;  4ZJ1 A;  2XQZ A;  4IJG A;  4XUX A;  4JF5 A;  4BBV A;  4WUJ A;  1K6R A;  1PWD A;  1PZO A;  4Y3I A;  3UPO A;  1LL8 A;  3IBJ A;  2O0Y A;  5HWT A;  5FQM A;  1SHV A;  2JHE A;  3G32 A;  5AJG A;  3C4P A;  1BLH A;  1NWZ A;  4OLD A;  3C8C A;  5FI6 A;  1YSQ A;  2ZLY A;  3NJA A;  4KQR A;  3MQ0 A;  2QYB A;  4GB7 A;  2PAV P;  4EUZ A;  2EFX A;  5E2F A;  4BMW A;  5FQJ A;  4JXS A;  2IWB A;  3PTE A;  3H9W A;  2HJE A;  4Z9Q A;  1XFQ A;  2RL3 A;  3Q81 A;  1FCM A;  4KG5 A;  2JN7 A;  3OPR A;  1AXB A;  5IHV A;  2QKP A;  2VV6 A;  3NOT C;  1SCW A;  1F5M A;  3KSI A;  3N8L A;  3ZNY A;  4HI4 A;  3WS5 A;  4OPY A;  1LSW A;  3T4O A;  3IH8 A;  5BOH A;  3LI8 A;  4WEK A;  3MJQ A;  3O86 A;  5HAP A;  1MPL A;  4H6J B;  1S0W A;  3LFV A;  1HVB A;  5AQB A;  3BW6 A;  4EBP A;  5E43 A;  4PHT A;  5GHX A;  2XRO A;  4UAA A;  1JTD A;  1VET A;  3EEA A;  4L0L A;  3UE0 A;  1T1A A;  5FEF A;  3MZE A;  1FSY A;  1W63 Q;  4S2J A;  2OWH A;  1D06 A;  2OLV A;  1FCO A;  3KYE A;  3LO7 A;  3G4P A;  3AGD A;  1XGI A;  3ITB A;  4PM6 A;  5FA7 A;  3BEB A;  5DVA A;  3VOZ A;  4I5S A;  2ZQA A;  3B3X A;  3EOI A;  2A24 A;  2BAS A;  4E6W A;  4EU0 A;  4DJ2 A;  4S2N A;  4EER A;  1YLJ A;  1CK3 A;  3GQZ A;  1MXO A;  1KVM A;  5A90 A;  3QP1 A;  3S4X A; 
#chains in the Genus database with same CATH homology
 5EVI C;  1YLP A;  2XD5 A;  2ZC7 A;  3DWK A;  3HVF A;  1K55 C;  5FDH A;  3IWI A;  2J7V A;  4LV3 A;  2C5W B;  3MXR A;  4BLM A;  1ES5 A;  1PW8 A;  2ZC5 B;  2Y2L A;  1I5Q A;  4LV2 A;  4WZ5 C;  1JWZ A;  3BFE A;  1E4D A;  2P9V B;  4GZB A;  1XA7 A;  5D3O A;  3SH9 A;  4K0W A;  3UPP A;  4JF6 A;  2JE5 A;  5EOE A;  3TOI A;  1WE4 A;  3GRJ A;  1QMF A;  3W4O A;  4QHC A;  4FD8 A;  1TVF A;  1KE3 A;  3ZG0 A;  1ZC2 A;  3DTM A;  3S22 A;  1VM1 A;  1Q2Q A;  2EX2 A;  3CMZ A;  4JF4 A;  4KG2 A;  4FSF A;  3CJM A;  3A3F A;  1E25 A;  3EQV A;  3OPH A;  3ITA A;  4YFM A;  4S2N C;  4KG6 A;  4Q8I A;  1PW1 A;  2HDU A;  2WYX A;  3N4I A;  4OON A;  3CG5 A;  3NC8 A;  5EE8 A;  1ESI A;  3C7U A;  4P85 A;  4E3O A;  2WAE A;  1IKG A;  1HZO A;  4JPM A;  1LHY A;  3M6H A;  3ZVW A;  4XUZ A;  2HDS A;  1G6A A;  4Y0T A;  4MBF A;  2BG1 A;  3A3E A;  5EEC A;  3BLS A;  4R4S A;  1RP5 A;  4OH0 A;  2ZD8 A;  3OC2 A;  2WAD A;  4ZTK A;  2RCX A;  1OME A;  4B4X A;  3HUN A;  1LLB A;  1Q2P A;  3V3R A;  1Z6F A;  2XF3 A;  5KZH A;  5F1G A;  4DRT A;  3W8K A;  2Y2N A;  1BT5 A;  1FOF A;  4WEJ A;  3UDI A;  2Y59 A;  5EVI D;  3UDF A;  3IXB A;  4Y0U A;  4CJN A;  4DXB A;  2OLU A;  2WKE A;  1BZA A;  4HBU A;  5CGX A;  3NDG A;  4R4R A;  4C6Y A;  4E3I A;  1ZG4 A;  1N9B A;  1CEF A;  2ZC4 B;  4WYY A;  2EXB A;  4GOG A;  2XFT A;  1NYY A;  3O87 A;  3FV7 A;  4QJG A;  1IYP A;  4WEL A;  2WAF A;  2XEP A;  1BUE A;  1VQQ A;  3G30 A;  5GLC A;  3M6B A;  4UA9 A;  3FKW A;  4WMC D;  2H5S A;  4WZ4 A;  3UDX A;  2XK1 A;  1K56 D;  4WZ5 A;  2A3U A;  3Q07 A;  1IKI A;  4PM8 A;  5DF9 A;  5EVI A;  1E3U A;  5F82 A;  3VSK A;  1PWC A;  3AGF A;  1K55 A;  1MWR A;  1MWU A;  3UY6 A;  3VP0 A;  4LV1 A;  4GKU A;  2ZMA A;  1K54 A;  3QNB A;  2PBY A;  2CC1 A;  4WM9 A;  3BFF A;  2WKH A;  4P0M A;  3ZGA B;  1RGZ A;  1DY6 A;  4H8R A;  4OP8 A;  5DTK A;  5M18 A;  1BLP A;  4IBR A;  3HBR A;  2I72 A;  4E3J A;  2WUQ A;  4S2M A;  4IED A;  3MFD A;  4LV0 A;  1ERQ A;  4HEF A;  4N92 A;  4RYE A;  4EV4 A;  4KZ4 A;  2Y2I A;  2EX8 A;  1K4F A;  2HPB A;  1K57 C;  3UE3 A;  5DTT A;  4RVA A;  1BSG A;  4GNU A;  3IT9 A;  3VFF A;  4BQM A;  2DRW A;  4XXR A;  5U47 A;  4U0T A;  1K56 A;  1FR6 A;  2Q9N A;  5FAP A;  4E3N A;  2H0T A;  3SH7 A;  3UO9 A;  4CPK A;  3FZC A;  3RXX A;  4WBG A;  2Y2O A;  4IBX A;  2G2W A;  1XXM A;  4P87 A;  1K38 A;  1KE4 A;  3TG9 A;  1DJB A;  5CED A;  1FSW A;  1PZP A;  4KQO A;  5M19 A;  3IHB A;  5FQQ A;  4FH2 A;  5CEC A;  4Y0O A;  2Y2K A;  3IWO A;  1HD8 A;  5FI7 A;  5FI2 A;  3FWL A;  4KZB A;  4MEZ A;  1O7E A;  3BM6 A;  1PWG A;  1W8Y A;  3IH9 A;  4PPR A;  1LI0 A;  1CI9 A;  1GA0 A;  1YLT A;  1ONH A;  2C6W B;  2XLN A;  1JWV A;  3E2L A;  3HLF A;  1QME A;  3N8R A;  4JBF A;  4RX3 A;  2Y2P A;  5GLD A;  3NBL A;  4OOY A;  3VP1 A;  5FAT A;  3Q7V A;  3LCE A;  3FYZ A;  4OQG A;  5M1A A;  5AQ9 A;  3IXD A;  3BLM A;  4X55 A;  3BEC A;  1K54 C;  3E2K A;  4OOL A;  4X53 A;  5KMW A;  4JXG A;  2EX6 A;  3IF5 A;  4R1G A;  2JCH A;  1Y54 A;  3IQA A;  4OVD A;  2GDN A;  1GA9 A;  1LI9 A;  2X02 A;  4C75 A;  4BJP A;  2Y2Q A;  4S2O A;  1ZKJ A;  5CTM A;  1K4E A;  5CXW A;  4DXC A;  4E6X A;  1YMS A;  4ZAM A;  3N6I A;  2VGK A;  1NYM A;  3ZHH A;  1TDL A;  4QB8 A;  5E2G A;  4E3L A;  1XGJ A;  4ID4 A;  2OSU A;  5JYP A;  4MLL A;  2DNS A;  5KSH A;  4R3J A;  2QPN A;  2UWX A;  1DJA A;  5CHM A;  3ZG5 A;  2BLS A;  2HP9 A;  3GSG A;  2Z2L B;  5A93 A;  3Q1F A;  1M6K A;  1ALQ A;  1FR1 A;  1GHI A;  2Y2J A;  2ZQD A;  4U0X A;  3GTC A;  3QHY A;  1L0G A;  5EOO A;  1L2S A;  5AQ7 A;  1K25 A;  2H10 A;  4DE1 A;  4X56 A;  5CTN A;  3SS3 A;  4MNR A;  4KQQ A;  1FQG A;  1W79 A;  3SH8 A;  2B5R A;  1XPB A;  4OLG A;  3WS4 A;  4DDS A;  1GHM A;  4BD0 A;  4YIN A;  4P6B A;  2J9P A;  4R0Q A;  4GDB A;  3M2K A;  3ZDJ A;  4S2I A;  1PYY A;  3VP3 A;  1E3U D;  1K57 A;  3A3D A;  5FQK A;  1J9M A;  3MZD A;  3OCN A;  4EQI A;  5FQI A;  1LL5 A;  3RJU A;  4PM9 A;  4PM5 A;  1L0E A;  2J9O A;  4RA7 A;  3GMW A;  4GDN A;  1CI8 A;  1BLC A;  1BLS A;  1IYS A;  2Y55 A;  3BFD A;  3CZD A;  3V39 A;  5DTS A;  3V3S A;  3GVB A;  5G18 A;  4HES A;  3P98 A;  4A5R A;  1KDW A;  1GCE A;  3VMA A;  3ZFZ A;  4N9L A;  1MBL A;  4OPR A;  1JWP A;  1WYC A;  4LCL A;  4GD6 A;  4BD1 A;  4EBN A;  3NCK A;  5EVI B;  1NZU A;  4OQH A;  1ESU A;  2V20 A;  1XKZ A;  2ZC3 B;  1ERM A;  3HL9 A;  5FAQ A;  4BL3 A;  5GHY A;  1L0D A;  2JBF A;  5A91 A;  3V5M A;  5L2F A;  3JYI A;  5CEB A;  3EQU A;  5DF7 A;  2DCF A;  3WS2 A;  3IXG A;  2WGI A;  1YLZ A;  3I7J A;  2HDR A;  3WRZ A;  1XP4 A;  5EVL A;  1ES2 A;  5FSR A;  3OPP A;  4U3T A;  1CEG A;  3D4F A;  4S2P A;  4ZDX A;  4ZBE A;  2R9W A;  4QY6 A;  1O07 A;  3IXH A;  5HFO A;  3NDE A;  3PBQ A;  3A3I A;  4QY5 A;  4F94 A;  4OP5 A;  3UE1 A;  4FCF A;  2Z2M B;  4DE3 A;  1KGF A;  1S6R A;  1IEL A;  3SS5 A;  2EX9 A;  5CER A;  5A92 A;  2XR0 A;  4BL2 A;  2FFY A;  2P74 A;  3G2Z A;  4C3Q A;  5FAO A;  4HBT A;  3G31 A;  1YM1 A;  4S2K A;  4N9K A;  4QU3 A;  3HLG A;  1MKI A;  5F83 A;  2Y2M A;  5JYO A;  1WYB A;  2V2F F;  1KGE A;  1G68 A;  3Q7Z A;  3VSL A;  3LY4 A;  1YLW A;  3PBT A;  4B4Z A;  3GR2 A;  5HAI A;  1ZG6 A;  2FFF B;  4GN2 A;  2ZM8 A;  4O7D A;  1PIO A;  4ZJ2 A;  5FQ9 A;  4OQ0 A;  3ZG9 B;  4X69 A;  5E2H A;  4LCM A;  3Q7V B;  3MBZ A;  3W4P A;  4M3K A;  3HLW A;  2XD1 A;  1KDS A;  2QZ6 A;  3IF6 C;  1H5X A;  4NET A;  5CHJ A;  4PMA A;  3PAE A;  2ZQC A;  2Y4A A;  2WK0 A;  2J8Y A;  4UA7 A;  4LEN A;  1LL9 A;  4B88 A;  2QMI A;  2ZQ7 A;  3N7W A;  4ZJ3 A;  1I2W A;  1NJ4 A;  2G2U A;  3P09 A;  2E8I A;  5AQA A;  4ZJ1 A;  2XQZ A;  3C7V A;  3BRM A;  2ZM2 A;  4XUX A;  1RGY A;  2XDM A;  1RCJ A;  2IWC A;  3AGE A;  5HAR A;  4KZ9 A;  1C3B A;  3OCL A;  4RX2 A;  3MKE A;  4JF5 A;  1YT4 A;  1MY8 A;  3W4Q A;  1ERO A;  4Y7P A;  5F1F A;  3NIA A;  1K6R A;  2JC7 A;  3LY3 A;  4IVK A;  3IHA A;  1PWD A;  1PZO A;  2R9X A;  1NY0 A;  2WGW B;  2ZJ9 A;  4MBK A;  3UPO A;  3MZF A;  3HLB A;  3Q82 A;  4GD8 A;  4JKT A;  4KZA A;  5FQM A;  1SHV A;  3G32 A;  3C4P A;  1BLH A;  4OPQ A;  4OLD A;  4EWF A;  1SDN A;  3ZG8 B;  2WGW A;  4OOM A;  5CHU A;  1ES3 A;  4DE2 A;  4S2L A;  1N4O A;  4X6T A;  2HP5 A;  5FI6 A;  5CGS A;  2P9V A;  3DWZ A;  3HLD A;  4X68 A;  2V1Z A;  4JLF A;  1ONG A;  4KZ7 A;  4PM7 A;  3ZCZ A;  1EI5 A;  2ZLY A;  3RXW A;  3IWQ A;  4KZ5 A;  5EUA A;  4KQR A;  2XH9 A;  3WS1 A;  4GB7 A;  4EUZ A;  2EFX A;  3NI9 A;  5E2F A;  5FQJ A;  3ZG7 B;  1GHP A;  1MWT A;  4JXS A;  3ZVT A;  5KSC A;  2IWB A;  3PTE A;  3PBN A;  3HUO A;  2OV5 A;  4DE0 A;  3TSG A;  5GL9 A;  5J8X A;  4Z9Q A;  4K0X A;  3M2J A;  2RL3 A;  3HUM A;  2Y2H A;  3FKV A;  4N1H A;  3LEZ A;  1KE0 A;  3Q81 A;  1IEM A;  1FCM A;  4MBH A;  3SOI A;  5FAS A;  3O3V A;  4KG5 A;  5E2E A;  2WKI A;  3OPR A;  1AXB A;  1U60 A;  5IHV A;  2EFU A;  3ISG A;  1NZO A;  1YLY A;  2XFS A;  4R23 A;  1SKF A;  4DF6 A;  1IYO A;  1SCW A;  3WS0 A;  3N8L A;  1SDE A;  3ZNY A;  4EBL A;  2PU2 A;  2WZZ A;  1H8Y A;  3WS5 A;  4OPY A;  1XA1 A;  3C4O A;  3WRT A;  3VOY A;  3BYD A;  1L0F A;  5EPH A;  3PBO A;  3IH8 A;  3HLC A;  3IF6 B;  4R3B A;  1ES4 A;  4IVI A;  4WEK A;  5BOH A;  1JVJ A;  1PI4 A;  3O86 A;  3PBS A;  3S1Y A;  1MPL A;  4D2O A;  5HAP A;  3MKF A;  4UHU A;  1DJC A;  1S0W A;  3IF6 A;  4E3K A;  2WZX A;  4KEN B;  1IYQ A;  4QD4 A;  5TGF A;  2H0Y A;  2X01 A;  3ZNT A;  3QNC A;  2ZC6 B;  1HVB A;  1PI5 A;  4DKI A;  4OQI A;  1TDG A;  3A3J A;  5AQB A;  4N1X A;  4EBP A;  5DF8 A;  3HRE A;  3PBR A;  3BFG A;  5E43 A;  5GHX A;  1K6S A;  4UAA A;  2X71 A;  1JTD A;  3VP4 A;  4NK3 A;  3VP2 A;  4OKP A;  3G34 A;  5TR7 A;  4L0L A;  1I2S A;  3UE0 A;  2Q9M A;  4JXV A;  1NRF A;  3N8S A;  3DW0 A;  3MXS A;  3MZE A;  1FSY A;  3UNW A;  5GLA A;  4S2J A;  5GLB A;  3PAG A;  2OLV A;  1FCO A;  3HLE A;  4E3M A;  3GV9 A;  1M40 A;  4KZ3 A;  4KZ6 A;  1MWS A;  3BFC A;  3LO7 A;  3G4P A;  3OZH A;  3AGD A;  4UA6 A;  4FH4 A;  1XGI A;  3ITB A;  4PM6 A;  5CGW A;  2ZQ8 A;  1W8Q A;  1KVL A;  3BEB A;  2HP6 A;  5DVA A;  1HTZ A;  5FA7 A;  3WWX A;  1KGG A;  3VOZ A;  3V50 A;  5HW3 A;  2HDQ A;  2ZQA A;  2IWD A;  5HX9 A;  3B3X A;  1H8Z A;  3VFH A;  3G35 A;  3SS4 A;  3NY4 A;  4WMC A;  4K91 A;  2ZM0 A;  3UPN A;  4E6W A;  5TFQ A;  2VGJ A;  2Y91 A;  2Y2G A;  3C5A A;  4OPZ A;  4S2N A;  1XX2 A;  2EXA A;  3OPL A;  3O88 A;  1TEM A;  1YQS A;  1JTG A;  3UN7 A;  1BTL A;  2PU4 A;  2ZQ9 A;  5CRF A;  1NXY A;  1YLJ A;  2A49 A;  4BEN A;  1CK3 A;  1YMX A;  5GHZ A;  3GQZ A;  1MXO A;  1FCN A;  1W5D A;  2WGV A;  4DDY A;  4JXW A;  1KVM A;  5A90 A;  1BUL A;  5HAQ A;  2XGN A;  5I94 A;  1EWZ A;  4KZ8 A;  1W7F A;  3S4X A;  3G2Y A;  5HL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...