4EQ1A

Crystal structure of the arnt pas-b homodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
109
Chain Sequence
GVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Regulating the ARNT/TACC3 Axis: Multiple Approaches to Manipulating Protein/Protein Interactions with Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 32
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eq1A01
2A24B 3PYPA 2VEAA 3UB6A 5HSQA 1T18A 1OJ5A 2L0WA 1OTEA 4NXBA 4L9FA 1DP6A 3F1PA 4HJ6A 1OTIA 1F98A 5F69A 4EXOA 4BBTA 2L1MA 4EW7A 3C8CA 2EA9A 3F1PB 1S1ZA 3H7WA 2PD7A 1XFNA 2L4RA 4HP4A 2KX6A 2VLGA 4XT2A 1TS8A 1KOUA 4R3AA 4GS9A 4WLAA 5HD3A 3P7NA 4I3AA 4XT2B 3RH8B 5HD5A 1S4RA 4GS9B 4BBUA 2V1BA 5TBMB 3HJIA 4I39A 5G4YA 4MN6A 2QHKA 2WKQA 3E4PA 3K3DA 5KIZA 4L9GA 4HP9A 4LRYC 4R38A 3NHQA 5DJUA 1P97A 2PYRA 3IS2A 3CAXA 1WA9A 1XJ2A 2ZBBA 5HDDA 3NOPC 4NXGA 3UB7A 4L9EA 4HI4A 5AVEA 3FC7A 3G6OA 3IS2B 1LSWA 2V0WA 4WF0A 4LRXC 3IBRA 1N9NA 2PR6A 1X0OA 2J80A 3ICYA 4HHDA 3KX0X 2ZOHA 2QJ7A 1S1YA 2PYPA 3PHYA 3LIAA 3T50A 1V9YA 2W27A 1JNUA 4WUJA 5HWTA 1LT0A 1UWNX 4GHIA 5F5YA 5J4EA 4HY8A 4LRZE 4DJ2A 4HJ3A 1XJ4A 4R70A 5DJTA 2P7JA 1D7EA 3ZQ5A 4F3LA 1MZUA 3CWFA 4HNBA 4GHIB 2VV7A 1LSXA 5G4ZA 3UMDA 5J7EA 3GDIA 4F3LB 1S4SA 4HJ4A 4PKYA 2W0NA 2WKRA 3HJKA 2JN7A 2YKFA 1TS0A 4NXEA 2K7SA 5AVFA 3H7WB 4JGOA 1XFQA 5DKLA 2V1AA 3UB8A 2QWSA 2PR5A 1ODVA 2D02A 1OTAA 3NOTC 4I3IA 4KUKA 3NJAA 2JHEA 3EEHA 2PDRA 3H82A 3H9WA 1N9LA 1OJGA 2OWHA 2PD8A 4HH3A 1T1BA 4EESA 2PHYA 1BYWA 1DP9A 5I5LA 3H82B 4I38A 3K3CA 3ULFA 5DKKA 3F1NA 5F68A 3GECA 5IU1A 2KDKA 3LIDA 1Y28A 2R78A 3BY9A 3C2WA 3B33A 2CMNA 3E4QA 3EWKA 3F1NB 4EEUA 1DRMA 2VV6A 1T1AA 3BWLA 1OTBA 4LLOB 1S67L 3UMEA 3LI8A 2GJ3A 2INWA 5HZHA 3NOUC 1T19A 4JGQA 4WN5A 4MN5A 2I9VA 4EEPA 2V0UA 4PKYG 2WKPA 2B02A 1VB6A 3OLOA 1F9IA 4NXFA 4KQDA 5HWVA 3MFXA 3VE3A 3UE6A 3LIFA 2QKPA 2QJ5A 3LICA 4WL9A 1LL8A 1TS6A 3LI9A 3CLOA 4I5SA 4EERA 4JGRA 1XJ6A 4DJ3A 1P0ZA 1OTDA 5HWWA 3UB9A 4HOIA 3D72A 5J3WA 3MR0A 2Z6DA 1N9OA 3LIEA 1UWPX 5EFWA 2VV8A 5HDSA 1XJ3A 3LYXA 2BASA 3BY8A 2Z6CA 2OWJA 4HIAA 2H28A 3MJQA 4E04A 2HV1A 1TS7A 3VE4A 1LSVA 1OT6A 1UGUA 3LIBA 4GCZA 5TBMA 1DP8A 1EW0A 1V9ZA 4HH2A 3A0SA 5IS1A 2YKHA 4KUOA 2V9AA 4B9OA 3LUQA 4K08A 4RQ9A 2D01A 3SW1A 3F1OA 2OOLA 4H6JA 4M4XA 2M1CA 4EQ1A 1T1CA 5HDCA 4JGPA 1GSWA 2ZOIA 3F1OB 3MQOA 3A0VA 4H6JB 4YWZA 5A8BA 1G28A 5F6AA 3VOLA 3MXQA 1OT9A 1GSVA 4LPZA 1S66L 4GW9A 2A24A 4BBVA 1D06A 4R6LA 3MQQA 4HQAA 3FG8A 4I3JA 3E4OA 1NWZA 3RTYA 4EETB 1GSXA 3A0RA
chains in the Genus database with same CATH superfamily
5HL6A 1BULA 1K57C 2HDUA 5FDHA 4BMWA 3W4QA 2VEAA 4XUXA 4G3KA 4PAUA 4Y2FA 1BSGA 1PZPA 1PFLA 2L0WA 1ESIA 1KGGA 4NXBA 4N92A 3F1PA 3MZDA 1P9RA 2E8IA 5HL1A 1ZC2A 2AVXA 4EXOA 4BBTA 1NY0A 3V5MA 4EW7A 3ITBA 2Y2NA 4R3JA 3N6IA 3MZFA 2VGLS 4Z1WA 4S2OA 1G68A 3TSGA 4DXCA 3OPRA 4OVDA 4GLQA 1N9BA 4DDYA 2VZWA 1A0KA 3W8KA 3IHBA 3VP3A 4ETXA 3G4PA 3G32A 5KSHA 1XPBA 1Q2PA 2PRFA 1KOUA 1J3WA 4GS9A 4IBRA 3DTKA 3GQZA 3A3IA 3LR4A 4E3LA 5FAQA 5HD3A 3P7NA 3K2NA 4P6ZS 5HD5A 2XFTA 2NUPC 1BZAA 3ZVTA 4GZBA 5EVIB 5G4YA 2QHKA 2WKQA 4EU0A 2DCFA 3E4PA 3EQVA 4L9GA 4LRYC 3HUNA 4ZDXA 1GA9A 4CPKA 1FIKA 4JF4A 1Q2QA 5FQQA 3FPVA 1P9WA 1VQQA 5FEFA 2V1ZA 1PI5A 3KSFA 1STZA 4HBUA 3CI6A 3G6OA 2LB9A 2H10A 1M40A 4Q0HA 1TF1A 4K0XA 3C7UA 3BFGA 2OLUA 2Y2QA 4IUKA 2PR6A 5FA7A 3IX8A 1MY8A 1X0OA 4UQIM 4CLCA 4A5RA 2JBFA 2A49A 2PYPA 3DWZA 3LCEA 1VM1A 3B47A 1MXOA 3R4KA 1HVBA 2RL3A 2J7VA 1IOUA 1XJ4A 3PTEA 1KE0A 4P85A 2VA0A 1SKOB 2C5WB 3Q7VA 5L10A 3QNBA 4R70A 4U0XA 5IT5A 4YNRA 4F3LA 3CWFA 4HNBA 4GHIB 5G4ZA 2HPBA 4BJPA 3GDIA 3PAEA 4Q8IA 5FL3A 2A2LA 3VOZA 4CLCD 1H8ZA 1L0DA 4OONA 3CJMA 4UA7A 5EM0A 1TVFA 3NI9A 4U3TA 3QNCA 4JGOA 1KGEA 1NYMA 2ZMFA 1XFQA 4RYEA 5CTNA 4Q0IA 4JLFA 2V1AA 3UB8A 5HAPA 1NJ4A 1KGFA 5AJGA 2QWSA 3T4JA 1ODVA 3BECA 3UDXA 2D02A 2JCHA 4X6TA 3FKVA 5IHVA 4R1GA 4OP8A 1PZOA 3IF5A 4MMNA 3JVUA 3UE1A 2E8JA 3CPTB 3H9WA 2PD8A 3VFFA 3QP1A 3T1XA 5I5LA 3JVVA 5EM1A 4X55A 3AGFA 5U47A 4ME4A 1H0MA 5F68A 1ERQA 1K0KA 4PM6A 3IH8A 2C6WB 3C2WA 2XH9A 3R7WA 3HVFA 5GLDA 3Q81A 1T1AA 3BW6A 3OPPA 4LLOB 1GHIA 2G2WA 1SHVA 2BTFP 4PM5A 2ZQCA 4MBFA 3EGDC 4E6WA 3HBRA 4Y15A 4FH4A 4JGQA 1AXBA 2W3EA 3NCKA 4WN5A 2V0UA 4PM9A 4PKYG 2WKPA 3MKEA 4GJ4A 3T1QB 1F9IA 1FR1A 1LLBA 3HUMA 5HWVA 3VE3A 1BLCA 1S0WA 4YOFA 3NECA 1LL8A 3BFCA 3LI9A 2JC7A 4KZ5A 4WZ5C 4S2LA 3KYZA 4JF5A 3HLWA 5CECA 3IF6A 4S2NA 2WGWB 5J3WA 4X25A 4N1XA 2VV8A 3T4TA 2J3TD 2BASA 1K54C 5E2EA 2Z6CA 2ZC7A 4X69A 4K91A 2G7UA 3NC8A 4HIAA 5CX7A 1GA0A 1KE4A 2HZ5A 4IVKA 1G6OA 3KSGA 2GDNA 1LI0A 3IXHA 1LL5A 3LIBA 2BLSA 5TBMA 3SH8A 4ESPA 1FCNA 4OOYA 3VMAA 3DBAA 3KSIA 4Y3IA 4LV1A 4DE2A 4FSFA 1VETB 4B9OA 1L0GA 2QMIA 1HZOA 2D01A 3FZCA 1SCWA 3HLBA 2DMWA 2M1CA 4EQ1A 3SS3A 4WBGA 1JTDA 4MBHA 3TW8A 5DFYA 4P87A 1N4OA 4G3WA 3A0VA 5M19A 4S2PA 1G28A 4F94A 1S66L 3NY4A 4GNUA 4D2OA 2A24A 4BBVA 5DF9A 3FG8A 2OLVA 2ZLYA 3RTYA 1NRFA 2XROA 3LR0A 1FSWA 5M18A 4IHQA 3M6HA 3SS5A 3OOVA 3P01A 4N9KA 3N8RA 1T18A 3VV4A 3MSHA 1JVJA 5GHYA 1BLHA 2XA7S 3O5YA 4II7A 4L9FA 1PRQA 1DP6A 3UPPA 3MQ0A 1H8MA 2K31A 1JTGA 1F98A 2CC1A 5KSCA 5AQ9A 3PBOA 5BOHA 2ZQDA 4LCMA 1VHMA 3C8CA 1DJAA 3M2JA 5AQ7A 3F1PB 2ZQ8A 3LEZA 2W3GA 3H7WA 4L0LA 2L4RA 2Y2PA 1I5QA 3VP0A 3QP5A 3MMHA 4OH0A 5M1AA 1L2SA 2VLGA 4XT2A 4Y0TA 2WAFA 4Q0JA 2J9PA 3V3SA 1GHPA 4E3OA 5EVIC 2Y55A 2JKTM 3RH8B 3HLCA 4PM8A 4GS9B 1YSQA 3ZDJA 1I2WA 1W7FA 3MXSA 4I39A 1HD8A 4MN6A 3GMWA 2B95A 4UA6A 3BFFA 5KIZA 3T4OA 4GB7A 3IHAA 3SOIA 1P97A 5CXWA 2VGLM 2IWBA 3IS2A 3WS1A 3PAGA 2EX9A 3MS6A 1XJ2A 4Y0OA 5HDDA 3LGOA 3NOPC 5FATA 3O86A 4Z9QA 5E2GA 4L9EA 5AVEA 1JWPA 1TDGA 3BLSA 1TD5A 4WF0A 1FOFA 3D3OA 1KVLA 5C5KA 4Y5FA 4HHDA 5TFQA 2QJ7A 1S1YA 3T50A 2M7UA 3VP2A 4P6ZM 1G5UA 1JNUA 2W27A 1E4DA 1FCOA 3DTIA 1LT0A 5GHZA 4KZ8A 3V67A 5FEGA 4LRZE 4BQMA 4HJ3A 4CLCB 3B42A 3IQAA 1LI9A 1H3QA 2IWDA 2EX6A 2GZAA 4D60A 1S6RA 3IXGA 2G2UA 3G2YA 1MZUA 3D4FA 3HUOA 4RX3A 2Y8HA 3UMDA 3VFHA 1ES2A 4O0PA 3Q7VB 2XQZA 3ZYTA 5A93A 1IELA 4F3LB 3P09A 5FQJA 4HJ4A 2ZM8A 4GD8A 1CK3A 2XD1A 3ZNYA 2YKFA 4NXEA 2K7SA 4MNRA 5CHUA 3OCLA 3Q1FA 1K56A 2PAVP 3EGXC 2MJ6A 4JBFA 3LY3A 1IEMA 3Q07A 4DE1A 3DTEA 1O7EA 4B93A 4C3QA 3NOTC 4KUKA 5EV0A 1W5DA 4GDBA 4GDNA 2V2FF 1E25A 2PDRA 1NZOA 1NYYA 2ZC4B 2HDQA 5E43A 5G18A 1T1BA 3KYEA 2KOIA 3ISGA 1DP9A 1JWVA 4OOLA 3PR6A 3K3CA 3KSHA 5CERA 2W3DA 2ZM0A 1K56D 3BY9A 1MKMA 4QY6A 4LV0A 3UY6A 4LGWA 4WYYA 3S1YA 5FQMA 5GLBA 1YLTA 3BWLA 3W2ZA 1Y4OA 1S67L 3UMEA 3R7WB 4FTXA 4EQIA 3LI8A 2P04A 3IH9A 1IYQA 5DTKA 4PHTA 4MDZA 2INWA 4LENA 4OOMA 3NOUC 2VGKA 3BJNA 4EEPA 5CGSA 3C5AA 4JXVA 3DW0A 5DVAA 1VB6A 3FWLA 3GV9A 4NXFA 1K55A 1CQAA 3C30A 3RXXA 4BL2A 3ZG5A 2V8CA 3BEBA 3B3XA 1YMSA 2IA2A 1TS6A 5A91A 3CLOA 2J3WA 4MEZA 4YINA 2W1TA 5HWWA 3E2KA 3T1RA 3E2LA 2EXAA 3UB9A 3BYDA 4E3MA 4KG6A 5HARA 4OPQA 3C7VA 4OLGA 1UWPX 3Q7ZA 4KG5A 5EECA 5L09A 5HDSA 3LYXA 1XJ3A 3IF6B 3G34A 4ZJ3A 4NG2A 1RGZA 4QHCA 5FQKA 2Y79A 3U2AA 1LL9A 1D1JA 1TS7A 2JE5A 1W8YA 5HPFA 2PU4A 4GCZA 4G3VA 1J9MA 2WYXA 4IBXA 1HTZA 1EW0A 2VX8A 3BFEA 3PBQA 3A0SA 1YLJA 3OBFA 5IS1A 4ZBEA 2P9VA 5FI6A 1YLWA 4R4SA 3BRMA 5F82A 4LFUA 3UB5P 4K08A 5HW3A 3BM6A 2HP9A 2UV0E 3T12B 1LHYA 1WYCA 2OOLA 4H6JA 5TR7A 5HDCA 1ZG6A 4GKUA 4O8GA 3P98A 4Y7PA 1IFQA 4K0WA 4X1LA 1VEUA 2J9OA 4JPMA 4Y17A 2EXBA 5F6AA 4JXSA 1PWGA 3V50A 2LB5A 4LPZA 1OT9A 1GSVA 2H5SA 4EUVA 1W63M 1MBLA 1MWUA 2O0YA 3IXBA 3E98A 4HQAA 3V39A 4I3JA 1NLZA 3HCYA 1NWZA 4CLCE 5CHMA 1EWZA 3A0RA 3CUEA 3ZG7B 4QWOA 4ID4A 2A24B 1K57A 3T1SA 3HL9A 1SKOA 2O9AA 3PBNA 2PBDP 1OJ5A 4ZJ1A 3RFBA 2QZ6A 2EWWA 1E3UA 3CMZA 4HESA 2L1MA 3NDGA 4WZ4A 4WELA 2EA9A 1MC0A 1YQSA 2ZMVA 3TOIA 2X71A 2QYBA 1S1ZA 5CHJA 1XFNA 3C4PA 3T4LA 2W1RA 3DWKA 4NEED 1G6AA 5D3OA 4BENA 4B4XA 3I7JA 3HLFA 3T4SA 4KQRA 2ZC5B 2OAP1 1TS8A 3A3JA 1DY6A 4R3AA 1F5MA 4MN7A 4OP5A 3PXPA 3CPTA 1E3UD 4WLAA 3D9YA 1K4EA 1PW1A 4FD8A 4XT2B 2WGIA 5J8XA 2XRNA 1S4RA 2XA7M 2V1BA 3RJUA 4KZ6A 4M3KA 2FFFB 5MC7A 3S7PA 4BLMA 1YT4A 2HDRA 5JYPA 4R38A 5A90A 3NHQA 5DJUA 4JXGA 1RCJA 1NRJA 1FCMA 1WA9A 1SZVA 2WADA 2ZM2A 2ZBBA 4X68A 3S7NA 4OPZA 3UB7A 4N9LA 4HI4A 3FC7A 4EBNA 2EFUA 3IS2B 2M7VA 1LSWA 4DDSA 3IBRA 1IKIA 1N9NA 3UPNA 1XA1A 2J80A 4PPRA 4CLCC 2Z2LB 3NIAA 1YLPA 3A3DA 3PHYA 1YLZA 1V9YA 4DRTA 4WUJA 1UWNX 1PNEA 4CJNA 5F5YA 5J4EA 4PM7A 1O07A 2JKRI 3MBZA 3G30A 1YM1A 1PW8A 2VV7A 1MKIA 1LSXA 5J7EA 3ZGAB 4HBTA 1S4SA 3HLEA 5FSRA 2P74A 4H8RA 2W0NA 2BG1A 2Y2LA 1RGYA 1FQGA 2JN7A 3HJKA 4EBLA 3RXWA 2XGNA 1U60A 3ZG9B 1Z09A 1YLYA 3ZG8B 4S2JA 1ES4A 3OPLA 4AFIA 4EUZA 1QMFA 1IYPA 3S7QA 2V8FA 5GL9A 3LFVA 2PR5A 2PT7A 4WMCA 4P6BA 1OTAA 1JWZA 4I3IA 2XLNA 3NJAA 3TE8A 3NULA 5KZHA 5L07A 1WE4A 3UN7A 1GCEA 1IYOA 3H82A 3CZDA 2ZQAA 4E3KA 1N9LA 1VETA 1TDLA 2OWHA 4BL3A 3N8LA 3IWQA 5EOEA 5TJJA 4KZ4A 3IWOA 1KE3A 3VP1A 3DTMA 3ULFA 1BT5A 2WZZA 1SDEA 2XDMA 3F1NA 2EFXA 4NETA 1ES5A 5CTMA 3BQ8A 3GECA 5HAIA 5IU1A 3UO9A 3WS0A 3LIDA 1Y28A 2R78A 1AWIA 1XP4A 1CI8A 3B33A 2CMNA 1Y54A 3E4QA 4NKPA 4UAAA 3IX3A 5HPIA 4WMCD 3UNWA 2WUQA 3QHYA 3G31A 3SZTA 2ZD8A 1W8QA 1K4FA 4DXBA 4ZAMA 3EQUA 4OQHA 5HZHA 4RVAA 4MN5A 3MKFA 2I9VA 2J3TC 4U0TA 2B02A 3AGEA 4QY5A 4BD1A 3UE0A 1ZKJA 3WS4A 3OZHA 1ESUA 3LEQA 4MLLA 4LV2A 1NXYA 3LIFA 4DN0A 1K6SA 2WZXA 1FR6A 1BLSA 2QJ5A 4WL9A 5F1FA 3TG9A 5FQ9A 3FPWA 4I5SA 2QPNA 2FZ0A 1WYBA 2H0YA 4EERA 4JGRA 4WZ5A 4QJGA 1P0ZA 3S22A 3IF6C 1PI4A 1Z6FA 2WKHA 4S2NC 2DNSA 2WAEA 1OPXA 3D72A 1CF0A 1YKDA 2WGVA 4OKPA 3MR0A 2KLIA 2Z6DA 1N9OA 5K5BA 4DE3A 1GHMA 3LIEA 5EFWA 5GHXA 2W1TB 5HAQA 4WM9A 3MFDA 2ZC3B 4B88A 1BTLA 3BY8A 4C6YA 4DF6A 2HF6A 1K54A 1I2SA 5EVEA 1EROA 2WKEA 5FASA 3HREA 3EEAA 1XXMA 5I94A 5GLCA 2HGVA 3ZCZA 2HV1A 1PWDA 3ZFZA 3VE4A 1FILA 2ZJ9A 4BD0A 5DFXA 3O88A 1ZG4A 5EPHA 2ZL1A 4QB8A 3WS2A 3S4XA 3G2ZA 4IUHA 5CEBA 4WEKA 2WKIA 2R9XA 4ARZA 1ES3A 3JPUA 3MXRA 3NDEA 2ACGA 1YMXA 3F1OA 2OSUA 1RP5A 3UDFA 4M4XA 2P9VB 3PBSA 4JGPA 3V3RA 1DJBA 4WEJA 3PBRA 4XXRA 4UHUA 5CGWA 4OQGA 4IJGA 4H6JB 4YWZA 5A8BA 2GNXA 3LR5A 3IT9A 4GW9A 1F2KA 3IBJA 2HJEA 4FH2A 3NBLA 1D06A 2HP6A 3EOIA 1VEUB 2XEPA 2XR0A 3KYQA 4EETB 2WK0A 1GSXA 5A92A 2Y2HA 3PYPA 4GD6A 1NZUA 2HJ9C 3UB6A 5HSQA 3GSGA 3VSLA 2XF3A 4BWIA 4KQOA 1OTEA 4DMZA 4HJ6A 1OTIA 2HDSA 2K2NA 5F69A 5FQIA 5EUAA 4OQIA 3SH7A 2JKGA 2GX5A 5L8MA 5KMWA 4IEDA 4X1MA 4FOFA 2OV5A 3CHWP 2W3HA 2W3FA 2PD7A 1H5XA 4HEFA 4ZJ2A 4KG2A 2Q9NA 1K38A 4P0MA 4HP4A 1HLUP 4KZAA 3O87A 2KX6A 5F1GA 1QMEA 2Y4AA 3HLDA 3C38A 1CEGA 1K6RA 4GOGA 2R9WA 4UQIS 4QPRA 3UE3A 3L7HA 3GVBA 4GN2A 2Y2KA 3M2KA 5EVIA 4I3AA 4E3JA 1KDSA 2EX8A 4BBUA 1L3LA 4QU3A 5TBMB 1SKFA 2VK3A 4FUWA 3HJIA 4ETZA 2O9BA 3K3DA 4HP9A 1EI5A 3BLMA 5EE8A 4S2IA 1CEFA 2XD5A 1L0EA 5CEDA 2PYRA 4O7DA 3ZHHA 3CAXA 4N1HA 2Y2JA 3A3FA 3ZNTA 5DF8A 3OC2A 4KZ9A 4NXGA 2FH5A 3Q82A 2XFSA 2V0WA 4LRXC 5EVID 5HFOA 3ICYA 2HP5A 3IX4A 1FSYA 2ZOHA 3KX0X 4X53A 4Y13A 3IXDA 4OPYA 3TJZC 3LIAA 4DE0A 3S7OA 3GR2A 3QP6A 5HWTA 1XX2A 5EVLA 4GHIA 3TRCA 3M6BA 4HY8A 1W63Q 4DJ2A 3DAVA 3GRJA 2Y2GA 2X02A 5DJTA 3MF0A 2P7JA 1D7EA 3ZQ5A 2IWCA 3E0YA 4O01A 3WRZA 4YFMA 1MPLA 1ONGA 2EWVA 2J8YA 4OPRA 4MCWA 1H8YA 2ZQ7A 3HLGA 1C3BA 5FI2A 2I72A 3CITA 4PKYA 4C75A 1L0FA 2WKRA 5CRFA 5FDSA 2XSSA 1TS0A 3OPHA 2Y2IA 4PMAA 4JKTA 5AVFA 5E2HA 2NUTC 4KQQA 4ZTKA 3H7WB 3JYIA 5FAOA 3KO6A 3LY4A 3T4KA 2PBYA 3W4OA 1XGJA 3PBTA 5DKLA 2B5RA 3VP4A 2X01A 1MWSA 5GLAA 4R23A 3FV7A 4X56A 1ERMA 2JHEA 3EEHA 4E6XA 4OQ0A 1IYSA 3ZG0A 4JF6A 2EX2A 4EWFA 1OJGA 5AQAA 4HH3A 4Y0UA 4EESA 2PHYA 4KZBA 1BYWA 5L2FA 1CI9A 3H82B 4I38A 1MWRA 4RA7A 5DKKA 2RCXA 3WWXA 4KZ3A 2JKFA 3ITAA 2KDKA 2FFYA 4KZ7A 4UEYA 2O9CA 4NK3A 3AGDA 1YPRA 5LBRA 1OMEA 3EWKA 3VSKA 3F1NB 4IVIA 1ZHHB 3N7WA 4EEUA 1DRMA 1XA7A 2JKTI 2VV6A 1ONHA 1OTBA 5HX9A 2Y59A 2DRWA 3O3VA 2GJ3A 1M6KA 3UDIA 3N4IA 1BLPA 4EV4A 1T19A 2ZQ9A 2ZMAA 3WRTA 3OLOA 2Y2OA 1K55C 1NLYA 3FKWA 2UWXA 4KQDA 3MFXA 1BUEA 3C4OA 3UE6A 1K25A 3SH9A 3L9KA 1XGIA 2QKPA 3LICA 2Q0OA 1CJFA 1KDWA 2WGWA 5JYOA 1MWTA 3LR3A 4KENB 4S2KA 1TEMA 2VJWA 1XJ6A 3QP4A 4DJ3A 1OTDA 5TGFA 3OCNA 4E3NA 4LV3A 2XK1A 2O99A 1PWCA 2A3UA 5FAPA 4HOIA 4ZRRA 4MBKA 2OAQ1 1YAXA 2VGJA 5E2FA 4R0QA 4E3IA 3UPOA 2OWJA 4S2MA 3A3EA 2H28A 4EBPA 3ZVWA 3MJQA 4E04A 3G35A 2Y91A 1DJCA 1LSVA 1OT6A 5DTSA 1UGUA 4R3BA 2P08A 1SDNA 1W79A 5F83A 1DP8A 1ACFA 4DKIA 1V9ZA 3IWIA 4HH2A 1PIOA 3QP2A 4XUZA 3BFDA 2YKHA 4KUOA 2V9AA 4LCLA 3LUQA 2ZC6B 1YSPA 1ALQA 4RQ9A 2ZL1B 3FYZA 3U4LP 3SW1A 4QD4A 3VOYA 3GTCA 5DTTA 4JXWA 1XKZA 1IKGA 5FI7A 3T4QA 1T1CA 4B4ZA 4ARZB 2H0TA 2B18A 3WS5A 2JKRM 4FCFA 1GSWA 2Q9MA 2ZOIA 4UA9A 3CG5A 5AQBA 3F1OB 3MQOA 1ZTUA 5EOOA 4R4RA 5DF7A 2VKSA 3VOLA 4RX2A 3MXQA 5CGXA 3MZEA 4OLDA 1PYYA 2PU2A 2Y2MA 3W4PA 4CQHA 4R6LA 2V20A 3MQQA 3BQAA 3N8SA 3QP8A 1KVMA 3CUEC 3E4OA 2Z2MB 3LO7A 3SS4A
chains in the Genus database with same CATH topology
5HL6A 2A24B 3LR0A 3PYPA 4BMWA 4IHQA 2HJ9C 2VEAA 3OOVA 3P01A 2O9AA 3PBNA 3UB6A 4G3KA 5HSQA 4PAUA 4Y2FA 1T18A 3VV4A 1OJ5A 2L0WA 4BWIA 3RFBA 4KQOA 1OTEA 2XA7S 4NXBA 3O5YA 4II7A 4L9FA 1DP6A 2EWWA 3MQ0A 1H8MA 3F1PA 4DMZA 2K31A 4HJ6A 1P9RA 1OTIA 1F98A 2K2NA 5F69A 4EXOA 4BBTA 3PBOA 2L1MA 1VHMA 4EW7A 2GX5A 5L8MA 3C8CA 4WELA 2EA9A 1MC0A 4Z1WA 2VGLS 3F1PB 2ZMVA 4FOFA 2W3HA 2W3GA 2W3FA 2QYBA 1S1ZA 3H7WA 2PD7A 4GLQA 1XFNA 4L0LA 2L4RA 2VZWA 3T4LA 2W1RA 4NEED 4HP4A 2KX6A 3MMHA 3T4SA 4ETXA 3C38A 2VLGA 4XT2A 2OAP1 4Q0JA 5KSHA 1TS8A 1KOUA 4R3AA 4GS9A 1F5MA 4MN7A 4UQIS 4QPRA 3PXPA 3UE3A 3LR4A 4WLAA 5HD3A 3P7NA 3K2NA 4P6ZS 4I3AA 4XT2B 2JKTM 3RH8B 2XRNA 5HD5A 1S4RA 4GS9B 1YSQA 4BBUA 2XA7M 2V1BA 5TBMB 2NUPC 3HJIA 4I39A 5G4YA 4MN6A 2QHKA 2WKQA 5MC7A 4ETZA 3S7PA 4EU0A 2O9BA 3E4PA 3K3DA 5KIZA 3EQVA 3T4OA 4L9GA 4HP9A 4LRYC 4R38A 3NHQA 5DJUA 1P97A 1NRJA 2VGLM 2PYRA 3IS2A 3CAXA 3FPVA 1WA9A 1XJ2A 2ZBBA 3S7NA 1P9WA 5HDDA 3NOPC 3OC2A 4NXGA 3UB7A 3KSFA 4HI4A 1STZA 4L9EA 5AVEA 3CI6A 3FC7A 3G6OA 2FH5A 2LB9A 4Q0HA 1TD5A 1TF1A 3IS2B 1LSWA 2M7VA 2V0WA 4WF0A 4LRXC 3IBRA 3D3OA 4IUKA 1N9NA 2PR6A 5C5KA 4Y5FA 1X0OA 2J80A 3ICYA 4HHDA 4UQIM 4CLCC 3KX0X 2ZOHA 4CLCA 2QJ7A 3TJZC 1S1YA 2PYPA 3PHYA 3LIAA 3T50A 2M7UA 1V9YA 3S7OA 4P6ZM 2W27A 1JNUA 4WUJA 3B47A 1LT0A 1UWNX 5HWTA 4GHIA 3R4KA 5F5YA 5J4EA 3TRCA 4HY8A 3V67A 1W63Q 4LRZE 4DJ2A 1IOUA 4HJ3A 1XJ4A 3B42A 4CLCB 2JKRI 1H3QA 2GZAA 2VA0A 4R70A 5DJTA 3MF0A 5IT5A 2P7JA 1D7EA 4YNRA 3ZQ5A 4F3LA 1MZUA 3CWFA 4HNBA 4GHIB 2VV7A 3E0YA 4O01A 1LSXA 2EWVA 2Y8HA 5G4ZA 3UMDA 5J7EA 4O0PA 4BJPA 4MCWA 3ZYTA 3GDIA 4F3LB 1S4SA 5FL3A 2A2LA 4HJ4A 3CITA 2W0NA 4PKYA 2WKRA 3HJKA 2JN7A 2XSSA 2YKFA 1TS0A 4NXEA 4CLCD 2K7SA 5AVFA 2NUTC 3OCLA 3H7WB 4JGOA 3EGXC 4AFIA 3KO6A 2MJ6A 3T4KA 2ZMFA 1XFQA 3PBTA 3S7QA 4Q0IA 5DKLA 2V1AA 3UB8A 5AJGA 2QWSA 3LFVA 3T4JA 2PR5A 4B93A 1ODVA 2PT7A 2D02A 1OTAA 3NOTC 4I3IA 4KUKA 3NJAA 3TE8A 2JHEA 3EEHA 4MMNA 3JVUA 2PDRA 3H82A 3H9WA 1N9LA 1OJGA 2OWHA 2PD8A 4HH3A 1T1BA 2KOIA 4EESA 2PHYA 1BYWA 1DP9A 5I5LA 5TJJA 4OOLA 3PR6A 3JVVA 3H82B 4I38A 3K3CA 3ULFA 3KSHA 5DKKA 2W3DA 4ME4A 3F1NA 5F68A 3BQ8A 3GECA 5IU1A 2KDKA 3LIDA 1Y28A 2R78A 3BY9A 1MKMA 4UEYA 2O9CA 3C2WA 3B33A 2CMNA 3E4QA 5LBRA 3R7WA 3EWKA 4NKPA 5HPIA 3F1NB 1ZHHB 4EEUA 1DRMA 2JKTI 2VV6A 1T1AA 3BWLA 1OTBA 3W2ZA 3BW6A 4LLOB 1S67L 3UMEA 3R7WB 3LI8A 2GJ3A 2P04A 3EQUA 4PHTA 3EGDC 4MDZA 2INWA 4OOMA 5HZHA 3NOUC 1T19A 4JGQA 2W3EA 4MN5A 4WN5A 2I9VA 3BJNA 2J3TC 4EEPA 2V0UA 4PKYG 2WKPA 2B02A 1VB6A 3OLOA 4GJ4A 1NLYA 1F9IA 4NXFA 4KQDA 5HWVA 3MFXA 3VE3A 3UE6A 3LIFA 4DN0A 3C30A 2QKPA 2QJ5A 3LICA 4WL9A 4YOFA 1LL8A 2IA2A 1TS6A 3LI9A 3FPWA 3LR3A 3CLOA 2J3WA 4I5SA 2FZ0A 4EERA 2VJWA 3KYZA 1XJ6A 4JGRA 4DJ3A 2W1TA 1P0ZA 1OTDA 5HWWA 3OCNA 3UB9A 2O99A 1OPXA 4HOIA 3D72A 1YKDA 4ZRRA 5J3WA 3MR0A 2KLIA 2OAQ1 2Z6DA 1N9OA 1YAXA 5K5BA 3LIEA 1UWPX 5EFWA 2W1TB 2VV8A 3T4TA 5HDSA 1XJ3A 2J3TD 3LYXA 2BASA 3BY8A 2Z6CA 2HF6A 2G7UA 2OWJA 4HIAA 5CX7A 2H28A 2Y79A 3MJQA 3U2AA 4E04A 1G6OA 3EEAA 2HGVA 3KSGA 2HV1A 1TS7A 3VE4A 1LSVA 1OT6A 5HPFA 1UGUA 3LIBA 4GCZA 5DFXA 5TBMA 2P08A 1DP8A 4G3VA 1EW0A 1V9ZA 2VX8A 3DBAA 4HH2A 3PBQA 4IUHA 3A0SA 3KSIA 3OBFA 5IS1A 4Y3IA 4FSFA 4WEKA 2YKHA 4ARZA 4KUOA 2V9AA 4B9OA 3LUQA 4K08A 1YSPA 4RQ9A 2D01A 3SW1A 3F1OA 2OOLA 4H6JA 4M4XA 2DMWA 2M1CA 4EQ1A 3PBSA 3T4QA 1T1CA 5HDCA 4JGPA 4ARZB 4O8GA 2B18A 2JKRM 1GSWA 4WEJA 3TW8A 3PBRA 1IFQA 5DFYA 2ZOIA 3F1OB 3MQOA 1ZTUA 4G3WA 3A0VA 4IJGA 4H6JB 4YWZA 5A8BA 2VKSA 1G28A 5F6AA 3VOLA 2GNXA 3LR5A 2LB5A 3MXQA 1OT9A 1GSVA 4LPZA 1S66L 4GW9A 4EUVA 1W63M 3IBJA 2HJEA 2A24A 2O0YA 4BBVA 3E98A 5DF9A 1D06A 4CQHA 4R6LA 3EOIA 3MQQA 4HQAA 3FG8A 3BQAA 3KYQA 1NLZA 3HCYA 4I3JA 3CUEC 3E4OA 1NWZA 3RTYA 4CLCE 4EETB 1GSXA 3A0RA 3CUEA 2XROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A24 B;  3PYP A;  2VEA A;  3UB6 A;  5HSQ A;  1T18 A;  1OJ5 A;  2L0W A;  1OTE A;  4NXB A;  4L9F A;  1DP6 A;  3F1P A;  4HJ6 A;  1OTI A;  1F98 A;  5F69 A;  4EXO A;  4BBT A;  2L1M A;  4EW7 A;  3C8C A;  2EA9 A;  3F1P B;  1S1Z A;  3H7W A;  2PD7 A;  1XFN A;  2L4R A;  4HP4 A;  2KX6 A;  2VLG A;  4XT2 A;  1TS8 A;  1KOU A;  4R3A A;  4GS9 A;  4WLA A;  5HD3 A;  3P7N A;  4I3A A;  4XT2 B;  3RH8 B;  5HD5 A;  1S4R A;  4GS9 B;  4BBU A;  2V1B A;  5TBM B;  3HJI A;  4I39 A;  5G4Y A;  4MN6 A;  2QHK A;  2WKQ A;  3E4P A;  3K3D A;  5KIZ A;  4L9G A;  4HP9 A;  4LRY C;  4R38 A;  3NHQ A;  5DJU A;  1P97 A;  2PYR A;  3IS2 A;  3CAX A;  1WA9 A;  1XJ2 A;  2ZBB A;  5HDD A;  3NOP C;  4NXG A;  3UB7 A;  4L9E A;  4HI4 A;  5AVE A;  3FC7 A;  3G6O A;  3IS2 B;  1LSW A;  2V0W A;  4WF0 A;  4LRX C;  3IBR A;  1N9N A;  2PR6 A;  1X0O A;  2J80 A;  3ICY A;  4HHD A;  3KX0 X;  2ZOH A;  2QJ7 A;  1S1Y A;  2PYP A;  3PHY A;  3LIA A;  3T50 A;  1V9Y A;  2W27 A;  1JNU A;  4WUJ A;  5HWT A;  1LT0 A;  1UWN X;  4GHI A;  5F5Y A;  5J4E A;  4HY8 A;  4LRZ E;  4DJ2 A;  4HJ3 A;  1XJ4 A;  4R70 A;  5DJT A;  2P7J A;  1D7E A;  3ZQ5 A;  4F3L A;  1MZU A;  3CWF A;  4HNB A;  4GHI B;  2VV7 A;  1LSX A;  5G4Z A;  3UMD A;  5J7E A;  3GDI A;  4F3L B;  1S4S A;  4HJ4 A;  4PKY A;  2W0N A;  2WKR A;  3HJK A;  2JN7 A;  2YKF A;  1TS0 A;  4NXE A;  2K7S A;  5AVF A;  3H7W B;  4JGO A;  1XFQ A;  5DKL A;  2V1A A;  3UB8 A;  2QWS A;  2PR5 A;  1ODV A;  2D02 A;  1OTA A;  3NOT C;  4I3I A;  4KUK A;  3NJA A;  2JHE A;  3EEH A;  2PDR A;  3H82 A;  3H9W A;  1N9L A;  1OJG A;  2OWH A;  2PD8 A;  4HH3 A;  1T1B A;  4EES A;  2PHY A;  1BYW A;  1DP9 A;  5I5L A;  3H82 B;  4I38 A;  3K3C A;  3ULF A;  5DKK A;  3F1N A;  5F68 A;  3GEC A;  5IU1 A;  2KDK A;  3LID A;  1Y28 A;  2R78 A;  3BY9 A;  3C2W A;  3B33 A;  2CMN A;  3E4Q A;  3EWK A;  3F1N B;  4EEU A;  1DRM A;  2VV6 A;  1T1A A;  3BWL A;  1OTB A;  4LLO B;  1S67 L;  3UME A;  3LI8 A;  2GJ3 A;  2INW A;  5HZH A;  3NOU C;  1T19 A;  4JGQ A;  4WN5 A;  4MN5 A;  2I9V A;  4EEP A;  2V0U A;  4PKY G;  2WKP A;  2B02 A;  1VB6 A;  3OLO A;  1F9I A;  4NXF A;  4KQD A;  5HWV A;  3MFX A;  3VE3 A;  3UE6 A;  3LIF A;  2QKP A;  2QJ5 A;  3LIC A;  4WL9 A;  1LL8 A;  1TS6 A;  3LI9 A;  3CLO A;  4I5S A;  4EER A;  4JGR A;  1XJ6 A;  4DJ3 A;  1P0Z A;  1OTD A;  5HWW A;  3UB9 A;  4HOI A;  3D72 A;  5J3W A;  3MR0 A;  2Z6D A;  1N9O A;  3LIE A;  1UWP X;  5EFW A;  2VV8 A;  5HDS A;  1XJ3 A;  3LYX A;  2BAS A;  3BY8 A;  2Z6C A;  2OWJ A;  4HIA A;  2H28 A;  3MJQ A;  4E04 A;  2HV1 A;  1TS7 A;  3VE4 A;  1LSV A;  1OT6 A;  1UGU A;  3LIB A;  4GCZ A;  5TBM A;  1DP8 A;  1EW0 A;  1V9Z A;  4HH2 A;  3A0S A;  5IS1 A;  2YKH A;  4KUO A;  2V9A A;  4B9O A;  3LUQ A;  4K08 A;  4RQ9 A;  2D01 A;  3SW1 A;  3F1O A;  2OOL A;  4H6J A;  4M4X A;  2M1C A;  4EQ1 A;  1T1C A;  5HDC A;  4JGP A;  1GSW A;  2ZOI A;  3F1O B;  3MQO A;  3A0V A;  4H6J B;  4YWZ A;  5A8B A;  1G28 A;  5F6A A;  3VOL A;  3MXQ A;  1OT9 A;  1GSV A;  4LPZ A;  1S66 L;  4GW9 A;  2A24 A;  4BBV A;  1D06 A;  4R6L A;  3MQQ A;  4HQA A;  3FG8 A;  4I3J A;  3E4O A;  1NWZ A;  3RTY A;  4EET B;  1GSX A;  3A0R A; 
#chains in the Genus database with same CATH topology
 5HL6 A;  1BUL A;  1K57 C;  2HDU A;  5FDH A;  4BMW A;  3W4Q A;  2VEA A;  4XUX A;  4G3K A;  4PAU A;  4Y2F A;  1BSG A;  1PZP A;  1PFL A;  2L0W A;  1ESI A;  1KGG A;  4NXB A;  4N92 A;  3F1P A;  3MZD A;  1P9R A;  2E8I A;  5HL1 A;  1ZC2 A;  2AVX A;  4EXO A;  4BBT A;  1NY0 A;  3V5M A;  4EW7 A;  3ITB A;  2Y2N A;  4R3J A;  3N6I A;  3MZF A;  2VGL S;  4Z1W A;  4S2O A;  1G68 A;  3TSG A;  4DXC A;  3OPR A;  4OVD A;  4GLQ A;  1N9B A;  4DDY A;  2VZW A;  1A0K A;  3W8K A;  3IHB A;  3VP3 A;  4ETX A;  3G4P A;  3G32 A;  5KSH A;  1XPB A;  1Q2P A;  2PRF A;  1KOU A;  1J3W A;  4GS9 A;  4IBR A;  3DTK A;  3GQZ A;  3A3I A;  3LR4 A;  4E3L A;  5FAQ A;  5HD3 A;  3P7N A;  3K2N A;  4P6Z S;  5HD5 A;  2XFT A;  2NUP C;  1BZA A;  3ZVT A;  4GZB A;  5EVI B;  5G4Y A;  2QHK A;  2WKQ A;  4EU0 A;  2DCF A;  3E4P A;  3EQV A;  4L9G A;  4LRY C;  3HUN A;  4ZDX A;  1GA9 A;  4CPK A;  1FIK A;  4JF4 A;  1Q2Q A;  5FQQ A;  3FPV A;  1P9W A;  1VQQ A;  5FEF A;  2V1Z A;  1PI5 A;  3KSF A;  1STZ A;  4HBU A;  3CI6 A;  3G6O A;  2LB9 A;  2H10 A;  1M40 A;  4Q0H A;  1TF1 A;  4K0X A;  3C7U A;  3BFG A;  2OLU A;  2Y2Q A;  4IUK A;  2PR6 A;  5FA7 A;  3IX8 A;  1MY8 A;  1X0O A;  4UQI M;  4CLC A;  4A5R A;  2JBF A;  2A49 A;  2PYP A;  3DWZ A;  3LCE A;  1VM1 A;  3B47 A;  1MXO A;  3R4K A;  1HVB A;  2RL3 A;  2J7V A;  1IOU A;  1XJ4 A;  3PTE A;  1KE0 A;  4P85 A;  2VA0 A;  1SKO B;  2C5W B;  3Q7V A;  5L10 A;  3QNB A;  4R70 A;  4U0X A;  5IT5 A;  4YNR A;  4F3L A;  3CWF A;  4HNB A;  4GHI B;  5G4Z A;  2HPB A;  4BJP A;  3GDI A;  3PAE A;  4Q8I A;  5FL3 A;  2A2L A;  3VOZ A;  4CLC D;  1H8Z A;  1L0D A;  4OON A;  3CJM A;  4UA7 A;  5EM0 A;  1TVF A;  3NI9 A;  4U3T A;  3QNC A;  4JGO A;  1KGE A;  1NYM A;  2ZMF A;  1XFQ A;  4RYE A;  5CTN A;  4Q0I A;  4JLF A;  2V1A A;  3UB8 A;  5HAP A;  1NJ4 A;  1KGF A;  5AJG A;  2QWS A;  3T4J A;  1ODV A;  3BEC A;  3UDX A;  2D02 A;  2JCH A;  4X6T A;  3FKV A;  5IHV A;  4R1G A;  4OP8 A;  1PZO A;  3IF5 A;  4MMN A;  3JVU A;  3UE1 A;  2E8J A;  3CPT B;  3H9W A;  2PD8 A;  3VFF A;  3QP1 A;  3T1X A;  5I5L A;  3JVV A;  5EM1 A;  4X55 A;  3AGF A;  5U47 A;  4ME4 A;  1H0M A;  5F68 A;  1ERQ A;  1K0K A;  4PM6 A;  3IH8 A;  2C6W B;  3C2W A;  2XH9 A;  3R7W A;  3HVF A;  5GLD A;  3Q81 A;  1T1A A;  3BW6 A;  3OPP A;  4LLO B;  1GHI A;  2G2W A;  1SHV A;  2BTF P;  4PM5 A;  2ZQC A;  4MBF A;  3EGD C;  4E6W A;  3HBR A;  4Y15 A;  4FH4 A;  4JGQ A;  1AXB A;  2W3E A;  3NCK A;  4WN5 A;  2V0U A;  4PM9 A;  4PKY G;  2WKP A;  3MKE A;  4GJ4 A;  3T1Q B;  1F9I A;  1FR1 A;  1LLB A;  3HUM A;  5HWV A;  3VE3 A;  1BLC A;  1S0W A;  4YOF A;  3NEC A;  1LL8 A;  3BFC A;  3LI9 A;  2JC7 A;  4KZ5 A;  4WZ5 C;  4S2L A;  3KYZ A;  4JF5 A;  3HLW A;  5CEC A;  3IF6 A;  4S2N A;  2WGW B;  5J3W A;  4X25 A;  4N1X A;  2VV8 A;  3T4T A;  2J3T D;  2BAS A;  1K54 C;  5E2E A;  2Z6C A;  2ZC7 A;  4X69 A;  4K91 A;  2G7U A;  3NC8 A;  4HIA A;  5CX7 A;  1GA0 A;  1KE4 A;  2HZ5 A;  4IVK A;  1G6O A;  3KSG A;  2GDN A;  1LI0 A;  3IXH A;  1LL5 A;  3LIB A;  2BLS A;  5TBM A;  3SH8 A;  4ESP A;  1FCN A;  4OOY A;  3VMA A;  3DBA A;  3KSI A;  4Y3I A;  4LV1 A;  4DE2 A;  4FSF A;  1VET B;  4B9O A;  1L0G A;  2QMI A;  1HZO A;  2D01 A;  3FZC A;  1SCW A;  3HLB A;  2DMW A;  2M1C A;  4EQ1 A;  3SS3 A;  4WBG A;  1JTD A;  4MBH A;  3TW8 A;  5DFY A;  4P87 A;  1N4O A;  4G3W A;  3A0V A;  5M19 A;  4S2P A;  1G28 A;  4F94 A;  1S66 L;  3NY4 A;  4GNU A;  4D2O A;  2A24 A;  4BBV A;  5DF9 A;  3FG8 A;  2OLV A;  2ZLY A;  3RTY A;  1NRF A;  2XRO A;  3LR0 A;  1FSW A;  5M18 A;  4IHQ A;  3M6H A;  3SS5 A;  3OOV A;  3P01 A;  4N9K A;  3N8R A;  1T18 A;  3VV4 A;  3MSH A;  1JVJ A;  5GHY A;  1BLH A;  2XA7 S;  3O5Y A;  4II7 A;  4L9F A;  1PRQ A;  1DP6 A;  3UPP A;  3MQ0 A;  1H8M A;  2K31 A;  1JTG A;  1F98 A;  2CC1 A;  5KSC A;  5AQ9 A;  3PBO A;  5BOH A;  2ZQD A;  4LCM A;  1VHM A;  3C8C A;  1DJA A;  3M2J A;  5AQ7 A;  3F1P B;  2ZQ8 A;  3LEZ A;  2W3G A;  3H7W A;  4L0L A;  2L4R A;  2Y2P A;  1I5Q A;  3VP0 A;  3QP5 A;  3MMH A;  4OH0 A;  5M1A A;  1L2S A;  2VLG A;  4XT2 A;  4Y0T A;  2WAF A;  4Q0J A;  2J9P A;  3V3S A;  1GHP A;  4E3O A;  5EVI C;  2Y55 A;  2JKT M;  3RH8 B;  3HLC A;  4PM8 A;  4GS9 B;  1YSQ A;  3ZDJ A;  1I2W A;  1W7F A;  3MXS A;  4I39 A;  1HD8 A;  4MN6 A;  3GMW A;  2B95 A;  4UA6 A;  3BFF A;  5KIZ A;  3T4O A;  4GB7 A;  3IHA A;  3SOI A;  1P97 A;  5CXW A;  2VGL M;  2IWB A;  3IS2 A;  3WS1 A;  3PAG A;  2EX9 A;  3MS6 A;  1XJ2 A;  4Y0O A;  5HDD A;  3LGO A;  3NOP C;  5FAT A;  3O86 A;  4Z9Q A;  5E2G A;  4L9E A;  5AVE A;  1JWP A;  1TDG A;  3BLS A;  1TD5 A;  4WF0 A;  1FOF A;  3D3O A;  1KVL A;  5C5K A;  4Y5F A;  4HHD A;  5TFQ A;  2QJ7 A;  1S1Y A;  3T50 A;  2M7U A;  3VP2 A;  4P6Z M;  1G5U A;  1JNU A;  2W27 A;  1E4D A;  1FCO A;  3DTI A;  1LT0 A;  5GHZ A;  4KZ8 A;  3V67 A;  5FEG A;  4LRZ E;  4BQM A;  4HJ3 A;  4CLC B;  3B42 A;  3IQA A;  1LI9 A;  1H3Q A;  2IWD A;  2EX6 A;  2GZA A;  4D60 A;  1S6R A;  3IXG A;  2G2U A;  3G2Y A;  1MZU A;  3D4F A;  3HUO A;  4RX3 A;  2Y8H A;  3UMD A;  3VFH A;  1ES2 A;  4O0P A;  3Q7V B;  2XQZ A;  3ZYT A;  5A93 A;  1IEL A;  4F3L B;  3P09 A;  5FQJ A;  4HJ4 A;  2ZM8 A;  4GD8 A;  1CK3 A;  2XD1 A;  3ZNY A;  2YKF A;  4NXE A;  2K7S A;  4MNR A;  5CHU A;  3OCL A;  3Q1F A;  1K56 A;  2PAV P;  3EGX C;  2MJ6 A;  4JBF A;  3LY3 A;  1IEM A;  3Q07 A;  4DE1 A;  3DTE A;  1O7E A;  4B93 A;  4C3Q A;  3NOT C;  4KUK A;  5EV0 A;  1W5D A;  4GDB A;  4GDN A;  2V2F F;  1E25 A;  2PDR A;  1NZO A;  1NYY A;  2ZC4 B;  2HDQ A;  5E43 A;  5G18 A;  1T1B A;  3KYE A;  2KOI A;  3ISG A;  1DP9 A;  1JWV A;  4OOL A;  3PR6 A;  3K3C A;  3KSH A;  5CER A;  2W3D A;  2ZM0 A;  1K56 D;  3BY9 A;  1MKM A;  4QY6 A;  4LV0 A;  3UY6 A;  4LGW A;  4WYY A;  3S1Y A;  5FQM A;  5GLB A;  1YLT A;  3BWL A;  3W2Z A;  1Y4O A;  1S67 L;  3UME A;  3R7W B;  4FTX A;  4EQI A;  3LI8 A;  2P04 A;  3IH9 A;  1IYQ A;  5DTK A;  4PHT A;  4MDZ A;  2INW A;  4LEN A;  4OOM A;  3NOU C;  2VGK A;  3BJN A;  4EEP A;  5CGS A;  3C5A A;  4JXV A;  3DW0 A;  5DVA A;  1VB6 A;  3FWL A;  3GV9 A;  4NXF A;  1K55 A;  1CQA A;  3C30 A;  3RXX A;  4BL2 A;  3ZG5 A;  2V8C A;  3BEB A;  3B3X A;  1YMS A;  2IA2 A;  1TS6 A;  5A91 A;  3CLO A;  2J3W A;  4MEZ A;  4YIN A;  2W1T A;  5HWW A;  3E2K A;  3T1R A;  3E2L A;  2EXA A;  3UB9 A;  3BYD A;  4E3M A;  4KG6 A;  5HAR A;  4OPQ A;  3C7V A;  4OLG A;  1UWP X;  3Q7Z A;  4KG5 A;  5EEC A;  5L09 A;  5HDS A;  3LYX A;  1XJ3 A;  3IF6 B;  3G34 A;  4ZJ3 A;  4NG2 A;  1RGZ A;  4QHC A;  5FQK A;  2Y79 A;  3U2A A;  1LL9 A;  1D1J A;  1TS7 A;  2JE5 A;  1W8Y A;  5HPF A;  2PU4 A;  4GCZ A;  4G3V A;  1J9M A;  2WYX A;  4IBX A;  1HTZ A;  1EW0 A;  2VX8 A;  3BFE A;  3PBQ A;  3A0S A;  1YLJ A;  3OBF A;  5IS1 A;  4ZBE A;  2P9V A;  5FI6 A;  1YLW A;  4R4S A;  3BRM A;  5F82 A;  4LFU A;  3UB5 P;  4K08 A;  5HW3 A;  3BM6 A;  2HP9 A;  2UV0 E;  3T12 B;  1LHY A;  1WYC A;  2OOL A;  4H6J A;  5TR7 A;  5HDC A;  1ZG6 A;  4GKU A;  4O8G A;  3P98 A;  4Y7P A;  1IFQ A;  4K0W A;  4X1L A;  1VEU A;  2J9O A;  4JPM A;  4Y17 A;  2EXB A;  5F6A A;  4JXS A;  1PWG A;  3V50 A;  2LB5 A;  4LPZ A;  1OT9 A;  1GSV A;  2H5S A;  4EUV A;  1W63 M;  1MBL A;  1MWU A;  2O0Y A;  3IXB A;  3E98 A;  4HQA A;  3V39 A;  4I3J A;  1NLZ A;  3HCY A;  1NWZ A;  4CLC E;  5CHM A;  1EWZ A;  3A0R A;  3CUE A;  3ZG7 B;  4QWO A;  4ID4 A;  2A24 B;  1K57 A;  3T1S A;  3HL9 A;  1SKO A;  2O9A A;  3PBN A;  2PBD P;  1OJ5 A;  4ZJ1 A;  3RFB A;  2QZ6 A;  2EWW A;  1E3U A;  3CMZ A;  4HES A;  2L1M A;  3NDG A;  4WZ4 A;  4WEL A;  2EA9 A;  1MC0 A;  1YQS A;  2ZMV A;  3TOI A;  2X71 A;  2QYB A;  1S1Z A;  5CHJ A;  1XFN A;  3C4P A;  3T4L A;  2W1R A;  3DWK A;  4NEE D;  1G6A A;  5D3O A;  4BEN A;  4B4X A;  3I7J A;  3HLF A;  3T4S A;  4KQR A;  2ZC5 B;  2OAP 1;  1TS8 A;  3A3J A;  1DY6 A;  4R3A A;  1F5M A;  4MN7 A;  4OP5 A;  3PXP A;  3CPT A;  1E3U D;  4WLA A;  3D9Y A;  1K4E A;  1PW1 A;  4FD8 A;  4XT2 B;  2WGI A;  5J8X A;  2XRN A;  1S4R A;  2XA7 M;  2V1B A;  3RJU A;  4KZ6 A;  4M3K A;  2FFF B;  5MC7 A;  3S7P A;  4BLM A;  1YT4 A;  2HDR A;  5JYP A;  4R38 A;  5A90 A;  3NHQ A;  5DJU A;  4JXG A;  1RCJ A;  1NRJ A;  1FCM A;  1WA9 A;  1SZV A;  2WAD A;  2ZM2 A;  2ZBB A;  4X68 A;  3S7N A;  4OPZ A;  3UB7 A;  4N9L A;  4HI4 A;  3FC7 A;  4EBN A;  2EFU A;  3IS2 B;  2M7V A;  1LSW A;  4DDS A;  3IBR A;  1IKI A;  1N9N A;  3UPN A;  1XA1 A;  2J80 A;  4PPR A;  4CLC C;  2Z2L B;  3NIA A;  1YLP A;  3A3D A;  3PHY A;  1YLZ A;  1V9Y A;  4DRT A;  4WUJ A;  1UWN X;  1PNE A;  4CJN A;  5F5Y A;  5J4E A;  4PM7 A;  1O07 A;  2JKR I;  3MBZ A;  3G30 A;  1YM1 A;  1PW8 A;  2VV7 A;  1MKI A;  1LSX A;  5J7E A;  3ZGA B;  4HBT A;  1S4S A;  3HLE A;  5FSR A;  2P74 A;  4H8R A;  2W0N A;  2BG1 A;  2Y2L A;  1RGY A;  1FQG A;  2JN7 A;  3HJK A;  4EBL A;  3RXW A;  2XGN A;  1U60 A;  3ZG9 B;  1Z09 A;  1YLY A;  3ZG8 B;  4S2J A;  1ES4 A;  3OPL A;  4AFI A;  4EUZ A;  1QMF A;  1IYP A;  3S7Q A;  2V8F A;  5GL9 A;  3LFV A;  2PR5 A;  2PT7 A;  4WMC A;  4P6B A;  1OTA A;  1JWZ A;  4I3I A;  2XLN A;  3NJA A;  3TE8 A;  3NUL A;  5KZH A;  5L07 A;  1WE4 A;  3UN7 A;  1GCE A;  1IYO A;  3H82 A;  3CZD A;  2ZQA A;  4E3K A;  1N9L A;  1VET A;  1TDL A;  2OWH A;  4BL3 A;  3N8L A;  3IWQ A;  5EOE A;  5TJJ A;  4KZ4 A;  3IWO A;  1KE3 A;  3VP1 A;  3DTM A;  3ULF A;  1BT5 A;  2WZZ A;  1SDE A;  2XDM A;  3F1N A;  2EFX A;  4NET A;  1ES5 A;  5CTM A;  3BQ8 A;  3GEC A;  5HAI A;  5IU1 A;  3UO9 A;  3WS0 A;  3LID A;  1Y28 A;  2R78 A;  1AWI A;  1XP4 A;  1CI8 A;  3B33 A;  2CMN A;  1Y54 A;  3E4Q A;  4NKP A;  4UAA A;  3IX3 A;  5HPI A;  4WMC D;  3UNW A;  2WUQ A;  3QHY A;  3G31 A;  3SZT A;  2ZD8 A;  1W8Q A;  1K4F A;  4DXB A;  4ZAM A;  3EQU A;  4OQH A;  5HZH A;  4RVA A;  4MN5 A;  3MKF A;  2I9V A;  2J3T C;  4U0T A;  2B02 A;  3AGE A;  4QY5 A;  4BD1 A;  3UE0 A;  1ZKJ A;  3WS4 A;  3OZH A;  1ESU A;  3LEQ A;  4MLL A;  4LV2 A;  1NXY A;  3LIF A;  4DN0 A;  1K6S A;  2WZX A;  1FR6 A;  1BLS A;  2QJ5 A;  4WL9 A;  5F1F A;  3TG9 A;  5FQ9 A;  3FPW A;  4I5S A;  2QPN A;  2FZ0 A;  1WYB A;  2H0Y A;  4EER A;  4JGR A;  4WZ5 A;  4QJG A;  1P0Z A;  3S22 A;  3IF6 C;  1PI4 A;  1Z6F A;  2WKH A;  4S2N C;  2DNS A;  2WAE A;  1OPX A;  3D72 A;  1CF0 A;  1YKD A;  2WGV A;  4OKP A;  3MR0 A;  2KLI A;  2Z6D A;  1N9O A;  5K5B A;  4DE3 A;  1GHM A;  3LIE A;  5EFW A;  5GHX A;  2W1T B;  5HAQ A;  4WM9 A;  3MFD A;  2ZC3 B;  4B88 A;  1BTL A;  3BY8 A;  4C6Y A;  4DF6 A;  2HF6 A;  1K54 A;  1I2S A;  5EVE A;  1ERO A;  2WKE A;  5FAS A;  3HRE A;  3EEA A;  1XXM A;  5I94 A;  5GLC A;  2HGV A;  3ZCZ A;  2HV1 A;  1PWD A;  3ZFZ A;  3VE4 A;  1FIL A;  2ZJ9 A;  4BD0 A;  5DFX A;  3O88 A;  1ZG4 A;  5EPH A;  2ZL1 A;  4QB8 A;  3WS2 A;  3S4X A;  3G2Z A;  4IUH A;  5CEB A;  4WEK A;  2WKI A;  2R9X A;  4ARZ A;  1ES3 A;  3JPU A;  3MXR A;  3NDE A;  2ACG A;  1YMX A;  3F1O A;  2OSU A;  1RP5 A;  3UDF A;  4M4X A;  2P9V B;  3PBS A;  4JGP A;  3V3R A;  1DJB A;  4WEJ A;  3PBR A;  4XXR A;  4UHU A;  5CGW A;  4OQG A;  4IJG A;  4H6J B;  4YWZ A;  5A8B A;  2GNX A;  3LR5 A;  3IT9 A;  4GW9 A;  1F2K A;  3IBJ A;  2HJE A;  4FH2 A;  3NBL A;  1D06 A;  2HP6 A;  3EOI A;  1VEU B;  2XEP A;  2XR0 A;  3KYQ A;  4EET B;  2WK0 A;  1GSX A;  5A92 A;  2Y2H A;  3PYP A;  4GD6 A;  1NZU A;  2HJ9 C;  3UB6 A;  5HSQ A;  3GSG A;  3VSL A;  2XF3 A;  4BWI A;  4KQO A;  1OTE A;  4DMZ A;  4HJ6 A;  1OTI A;  2HDS A;  2K2N A;  5F69 A;  5FQI A;  5EUA A;  4OQI A;  3SH7 A;  2JKG A;  2GX5 A;  5L8M A;  5KMW A;  4IED A;  4X1M A;  4FOF A;  2OV5 A;  3CHW P;  2W3H A;  2W3F A;  2PD7 A;  1H5X A;  4HEF A;  4ZJ2 A;  4KG2 A;  2Q9N A;  1K38 A;  4P0M A;  4HP4 A;  1HLU P;  4KZA A;  3O87 A;  2KX6 A;  5F1G A;  1QME A;  2Y4A A;  3HLD A;  3C38 A;  1CEG A;  1K6R A;  4GOG A;  2R9W A;  4UQI S;  4QPR A;  3UE3 A;  3L7H A;  3GVB A;  4GN2 A;  2Y2K A;  3M2K A;  5EVI A;  4I3A A;  4E3J A;  1KDS A;  2EX8 A;  4BBU A;  1L3L A;  4QU3 A;  5TBM B;  1SKF A;  2VK3 A;  4FUW A;  3HJI A;  4ETZ A;  2O9B A;  3K3D A;  4HP9 A;  1EI5 A;  3BLM A;  5EE8 A;  4S2I A;  1CEF A;  2XD5 A;  1L0E A;  5CED A;  2PYR A;  4O7D A;  3ZHH A;  3CAX A;  4N1H A;  2Y2J A;  3A3F A;  3ZNT A;  5DF8 A;  3OC2 A;  4KZ9 A;  4NXG A;  2FH5 A;  3Q82 A;  2XFS A;  2V0W A;  4LRX C;  5EVI D;  5HFO A;  3ICY A;  2HP5 A;  3IX4 A;  1FSY A;  2ZOH A;  3KX0 X;  4X53 A;  4Y13 A;  3IXD A;  4OPY A;  3TJZ C;  3LIA A;  4DE0 A;  3S7O A;  3GR2 A;  3QP6 A;  5HWT A;  1XX2 A;  5EVL A;  4GHI A;  3TRC A;  3M6B A;  4HY8 A;  1W63 Q;  4DJ2 A;  3DAV A;  3GRJ A;  2Y2G A;  2X02 A;  5DJT A;  3MF0 A;  2P7J A;  1D7E A;  3ZQ5 A;  2IWC A;  3E0Y A;  4O01 A;  3WRZ A;  4YFM A;  1MPL A;  1ONG A;  2EWV A;  2J8Y A;  4OPR A;  4MCW A;  1H8Y A;  2ZQ7 A;  3HLG A;  1C3B A;  5FI2 A;  2I72 A;  3CIT A;  4PKY A;  4C75 A;  1L0F A;  2WKR A;  5CRF A;  5FDS A;  2XSS A;  1TS0 A;  3OPH A;  2Y2I A;  4PMA A;  4JKT A;  5AVF A;  5E2H A;  2NUT C;  4KQQ A;  4ZTK A;  3H7W B;  3JYI A;  5FAO A;  3KO6 A;  3LY4 A;  3T4K A;  2PBY A;  3W4O A;  1XGJ A;  3PBT A;  5DKL A;  2B5R A;  3VP4 A;  2X01 A;  1MWS A;  5GLA A;  4R23 A;  3FV7 A;  4X56 A;  1ERM A;  2JHE A;  3EEH A;  4E6X A;  4OQ0 A;  1IYS A;  3ZG0 A;  4JF6 A;  2EX2 A;  4EWF A;  1OJG A;  5AQA A;  4HH3 A;  4Y0U A;  4EES A;  2PHY A;  4KZB A;  1BYW A;  5L2F A;  1CI9 A;  3H82 B;  4I38 A;  1MWR A;  4RA7 A;  5DKK A;  2RCX A;  3WWX A;  4KZ3 A;  2JKF A;  3ITA A;  2KDK A;  2FFY A;  4KZ7 A;  4UEY A;  2O9C A;  4NK3 A;  3AGD A;  1YPR A;  5LBR A;  1OME A;  3EWK A;  3VSK A;  3F1N B;  4IVI A;  1ZHH B;  3N7W A;  4EEU A;  1DRM A;  1XA7 A;  2JKT I;  2VV6 A;  1ONH A;  1OTB A;  5HX9 A;  2Y59 A;  2DRW A;  3O3V A;  2GJ3 A;  1M6K A;  3UDI A;  3N4I A;  1BLP A;  4EV4 A;  1T19 A;  2ZQ9 A;  2ZMA A;  3WRT A;  3OLO A;  2Y2O A;  1K55 C;  1NLY A;  3FKW A;  2UWX A;  4KQD A;  3MFX A;  1BUE A;  3C4O A;  3UE6 A;  1K25 A;  3SH9 A;  3L9K A;  1XGI A;  2QKP A;  3LIC A;  2Q0O A;  1CJF A;  1KDW A;  2WGW A;  5JYO A;  1MWT A;  3LR3 A;  4KEN B;  4S2K A;  1TEM A;  2VJW A;  1XJ6 A;  3QP4 A;  4DJ3 A;  1OTD A;  5TGF A;  3OCN A;  4E3N A;  4LV3 A;  2XK1 A;  2O99 A;  1PWC A;  2A3U A;  5FAP A;  4HOI A;  4ZRR A;  4MBK A;  2OAQ 1;  1YAX A;  2VGJ A;  5E2F A;  4R0Q A;  4E3I A;  3UPO A;  2OWJ A;  4S2M A;  3A3E A;  2H28 A;  4EBP A;  3ZVW A;  3MJQ A;  4E04 A;  3G35 A;  2Y91 A;  1DJC A;  1LSV A;  1OT6 A;  5DTS A;  1UGU A;  4R3B A;  2P08 A;  1SDN A;  1W79 A;  5F83 A;  1DP8 A;  1ACF A;  4DKI A;  1V9Z A;  3IWI A;  4HH2 A;  1PIO A;  3QP2 A;  4XUZ A;  3BFD A;  2YKH A;  4KUO A;  2V9A A;  4LCL A;  3LUQ A;  2ZC6 B;  1YSP A;  1ALQ A;  4RQ9 A;  2ZL1 B;  3FYZ A;  3U4L P;  3SW1 A;  4QD4 A;  3VOY A;  3GTC A;  5DTT A;  4JXW A;  1XKZ A;  1IKG A;  5FI7 A;  3T4Q A;  1T1C A;  4B4Z A;  4ARZ B;  2H0T A;  2B18 A;  3WS5 A;  2JKR M;  4FCF A;  1GSW A;  2Q9M A;  2ZOI A;  4UA9 A;  3CG5 A;  5AQB A;  3F1O B;  3MQO A;  1ZTU A;  5EOO A;  4R4R A;  5DF7 A;  2VKS A;  3VOL A;  4RX2 A;  3MXQ A;  5CGX A;  3MZE A;  4OLD A;  1PYY A;  2PU2 A;  2Y2M A;  3W4P A;  4CQH A;  4R6L A;  2V20 A;  3MQQ A;  3BQA A;  3N8S A;  3QP8 A;  1KVM A;  3CUE C;  3E4O A;  2Z2M B;  3LO7 A;  3SS4 A; 
#chains in the Genus database with same CATH homology
 5HL6 A;  2A24 B;  3LR0 A;  3PYP A;  4BMW A;  4IHQ A;  2HJ9 C;  2VEA A;  3OOV A;  3P01 A;  2O9A A;  3PBN A;  3UB6 A;  4G3K A;  5HSQ A;  4PAU A;  4Y2F A;  1T18 A;  3VV4 A;  1OJ5 A;  2L0W A;  4BWI A;  3RFB A;  4KQO A;  1OTE A;  2XA7 S;  4NXB A;  3O5Y A;  4II7 A;  4L9F A;  1DP6 A;  2EWW A;  3MQ0 A;  1H8M A;  3F1P A;  4DMZ A;  2K31 A;  4HJ6 A;  1P9R A;  1OTI A;  1F98 A;  2K2N A;  5F69 A;  4EXO A;  4BBT A;  3PBO A;  2L1M A;  1VHM A;  4EW7 A;  2GX5 A;  5L8M A;  3C8C A;  4WEL A;  2EA9 A;  1MC0 A;  4Z1W A;  2VGL S;  3F1P B;  2ZMV A;  4FOF A;  2W3H A;  2W3G A;  2W3F A;  2QYB A;  1S1Z A;  3H7W A;  2PD7 A;  4GLQ A;  1XFN A;  4L0L A;  2L4R A;  2VZW A;  3T4L A;  2W1R A;  4NEE D;  4HP4 A;  2KX6 A;  3MMH A;  3T4S A;  4ETX A;  3C38 A;  2VLG A;  4XT2 A;  2OAP 1;  4Q0J A;  5KSH A;  1TS8 A;  1KOU A;  4R3A A;  4GS9 A;  1F5M A;  4MN7 A;  4UQI S;  4QPR A;  3PXP A;  3UE3 A;  3LR4 A;  4WLA A;  5HD3 A;  3P7N A;  3K2N A;  4P6Z S;  4I3A A;  4XT2 B;  2JKT M;  3RH8 B;  2XRN A;  5HD5 A;  1S4R A;  4GS9 B;  1YSQ A;  4BBU A;  2XA7 M;  2V1B A;  5TBM B;  2NUP C;  3HJI A;  4I39 A;  5G4Y A;  4MN6 A;  2QHK A;  2WKQ A;  5MC7 A;  4ETZ A;  3S7P A;  4EU0 A;  2O9B A;  3E4P A;  3K3D A;  5KIZ A;  3EQV A;  3T4O A;  4L9G A;  4HP9 A;  4LRY C;  4R38 A;  3NHQ A;  5DJU A;  1P97 A;  1NRJ A;  2VGL M;  2PYR A;  3IS2 A;  3CAX A;  3FPV A;  1WA9 A;  1XJ2 A;  2ZBB A;  3S7N A;  1P9W A;  5HDD A;  3NOP C;  3OC2 A;  4NXG A;  3UB7 A;  3KSF A;  4HI4 A;  1STZ A;  4L9E A;  5AVE A;  3CI6 A;  3FC7 A;  3G6O A;  2FH5 A;  2LB9 A;  4Q0H A;  1TD5 A;  1TF1 A;  3IS2 B;  1LSW A;  2M7V A;  2V0W A;  4WF0 A;  4LRX C;  3IBR A;  3D3O A;  4IUK A;  1N9N A;  2PR6 A;  5C5K A;  4Y5F A;  1X0O A;  2J80 A;  3ICY A;  4HHD A;  4UQI M;  4CLC C;  3KX0 X;  2ZOH A;  4CLC A;  2QJ7 A;  3TJZ C;  1S1Y A;  2PYP A;  3PHY A;  3LIA A;  3T50 A;  2M7U A;  1V9Y A;  3S7O A;  4P6Z M;  2W27 A;  1JNU A;  4WUJ A;  3B47 A;  1LT0 A;  1UWN X;  5HWT A;  4GHI A;  3R4K A;  5F5Y A;  5J4E A;  3TRC A;  4HY8 A;  3V67 A;  1W63 Q;  4LRZ E;  4DJ2 A;  1IOU A;  4HJ3 A;  1XJ4 A;  3B42 A;  4CLC B;  2JKR I;  1H3Q A;  2GZA A;  2VA0 A;  4R70 A;  5DJT A;  3MF0 A;  5IT5 A;  2P7J A;  1D7E A;  4YNR A;  3ZQ5 A;  4F3L A;  1MZU A;  3CWF A;  4HNB A;  4GHI B;  2VV7 A;  3E0Y A;  4O01 A;  1LSX A;  2EWV A;  2Y8H A;  5G4Z A;  3UMD A;  5J7E A;  4O0P A;  4BJP A;  4MCW A;  3ZYT A;  3GDI A;  4F3L B;  1S4S A;  5FL3 A;  2A2L A;  4HJ4 A;  3CIT A;  2W0N A;  4PKY A;  2WKR A;  3HJK A;  2JN7 A;  2XSS A;  2YKF A;  1TS0 A;  4NXE A;  4CLC D;  2K7S A;  5AVF A;  2NUT C;  3OCL A;  3H7W B;  4JGO A;  3EGX C;  4AFI A;  3KO6 A;  2MJ6 A;  3T4K A;  2ZMF A;  1XFQ A;  3PBT A;  3S7Q A;  4Q0I A;  5DKL A;  2V1A A;  3UB8 A;  5AJG A;  2QWS A;  3LFV A;  3T4J A;  2PR5 A;  4B93 A;  1ODV A;  2PT7 A;  2D02 A;  1OTA A;  3NOT C;  4I3I A;  4KUK A;  3NJA A;  3TE8 A;  2JHE A;  3EEH A;  4MMN A;  3JVU A;  2PDR A;  3H82 A;  3H9W A;  1N9L A;  1OJG A;  2OWH A;  2PD8 A;  4HH3 A;  1T1B A;  2KOI A;  4EES A;  2PHY A;  1BYW A;  1DP9 A;  5I5L A;  5TJJ A;  4OOL A;  3PR6 A;  3JVV A;  3H82 B;  4I38 A;  3K3C A;  3ULF A;  3KSH A;  5DKK A;  2W3D A;  4ME4 A;  3F1N A;  5F68 A;  3BQ8 A;  3GEC A;  5IU1 A;  2KDK A;  3LID A;  1Y28 A;  2R78 A;  3BY9 A;  1MKM A;  4UEY A;  2O9C A;  3C2W A;  3B33 A;  2CMN A;  3E4Q A;  5LBR A;  3R7W A;  3EWK A;  4NKP A;  5HPI A;  3F1N B;  1ZHH B;  4EEU A;  1DRM A;  2JKT I;  2VV6 A;  1T1A A;  3BWL A;  1OTB A;  3W2Z A;  3BW6 A;  4LLO B;  1S67 L;  3UME A;  3R7W B;  3LI8 A;  2GJ3 A;  2P04 A;  3EQU A;  4PHT A;  3EGD C;  4MDZ A;  2INW A;  4OOM A;  5HZH A;  3NOU C;  1T19 A;  4JGQ A;  2W3E A;  4MN5 A;  4WN5 A;  2I9V A;  3BJN A;  2J3T C;  4EEP A;  2V0U A;  4PKY G;  2WKP A;  2B02 A;  1VB6 A;  3OLO A;  4GJ4 A;  1NLY A;  1F9I A;  4NXF A;  4KQD A;  5HWV A;  3MFX A;  3VE3 A;  3UE6 A;  3LIF A;  4DN0 A;  3C30 A;  2QKP A;  2QJ5 A;  3LIC A;  4WL9 A;  4YOF A;  1LL8 A;  2IA2 A;  1TS6 A;  3LI9 A;  3FPW A;  3LR3 A;  3CLO A;  2J3W A;  4I5S A;  2FZ0 A;  4EER A;  2VJW A;  3KYZ A;  1XJ6 A;  4JGR A;  4DJ3 A;  2W1T A;  1P0Z A;  1OTD A;  5HWW A;  3OCN A;  3UB9 A;  2O99 A;  1OPX A;  4HOI A;  3D72 A;  1YKD A;  4ZRR A;  5J3W A;  3MR0 A;  2KLI A;  2OAQ 1;  2Z6D A;  1N9O A;  1YAX A;  5K5B A;  3LIE A;  1UWP X;  5EFW A;  2W1T B;  2VV8 A;  3T4T A;  5HDS A;  1XJ3 A;  2J3T D;  3LYX A;  2BAS A;  3BY8 A;  2Z6C A;  2HF6 A;  2G7U A;  2OWJ A;  4HIA A;  5CX7 A;  2H28 A;  2Y79 A;  3MJQ A;  3U2A A;  4E04 A;  1G6O A;  3EEA A;  2HGV A;  3KSG A;  2HV1 A;  1TS7 A;  3VE4 A;  1LSV A;  1OT6 A;  5HPF A;  1UGU A;  3LIB A;  4GCZ A;  5DFX A;  5TBM A;  2P08 A;  1DP8 A;  4G3V A;  1EW0 A;  1V9Z A;  2VX8 A;  3DBA A;  4HH2 A;  3PBQ A;  4IUH A;  3A0S A;  3KSI A;  3OBF A;  5IS1 A;  4Y3I A;  4FSF A;  4WEK A;  2YKH A;  4ARZ A;  4KUO A;  2V9A A;  4B9O A;  3LUQ A;  4K08 A;  1YSP A;  4RQ9 A;  2D01 A;  3SW1 A;  3F1O A;  2OOL A;  4H6J A;  4M4X A;  2DMW A;  2M1C A;  4EQ1 A;  3PBS A;  3T4Q A;  1T1C A;  5HDC A;  4JGP A;  4ARZ B;  4O8G A;  2B18 A;  2JKR M;  1GSW A;  4WEJ A;  3TW8 A;  3PBR A;  1IFQ A;  5DFY A;  2ZOI A;  3F1O B;  3MQO A;  1ZTU A;  4G3W A;  3A0V A;  4IJG A;  4H6J B;  4YWZ A;  5A8B A;  2VKS A;  1G28 A;  5F6A A;  3VOL A;  2GNX A;  3LR5 A;  2LB5 A;  3MXQ A;  1OT9 A;  1GSV A;  4LPZ A;  1S66 L;  4GW9 A;  4EUV A;  1W63 M;  3IBJ A;  2HJE A;  2A24 A;  2O0Y A;  4BBV A;  3E98 A;  5DF9 A;  1D06 A;  4CQH A;  4R6L A;  3EOI A;  3MQQ A;  4HQA A;  3FG8 A;  3BQA A;  3KYQ A;  1NLZ A;  3HCY A;  4I3J A;  3CUE C;  3E4O A;  1NWZ A;  3RTY A;  4CLC E;  4EET B;  1GSX A;  3A0R A;  3CUE A;  2XRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...