4EQ1A

Crystal structure of the arnt pas-b homodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
109
Chain Sequence
GVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Regulating the ARNT/TACC3 Axis: Multiple Approaches to Manipulating Protein/Protein Interactions with Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eq1A01
3RH8B 3P7NA 3ICYA 2B02A 4I3IA 2WKPA 4DJ2A 4PKYA 1VB6A 2PD7A 3LIAA 2Z6DA 2WKQA 3B33A 3EEHA 4NXEA 2VEAA 1LSWA 3NHQA 4HOIA 3LIFA 4F3LB 4HJ6A 3C2WA 4L9EA 1DP6A 3BY8A 4HQAA 1JNUA 1TS7A 1GSXA 4I3JA 2QHKA 2PYRA 4HJ4A 4HNBA 3F1NA 1XFNA 2W27A 1OTAA 4R70A 1OTDA 4R38A 4E04A 1NWZA 3LIEA 3OLOA 2OWJA 5AVEA 2PR6A 2I9VA 1S4SA 1TS0A 1F9IA 2PHYA 2KX6A 1N9OA 2ZOIA 4EXOA 2BASA 2QJ7A 2A24A 2HV1A 3T50A 1ODVA 3H7WB 3UB7A 1BYWA 4GW9A 4KQDA 4BBVA 2QJ5A 2ZBBA 2A24B 3E4PA 1XJ4A 2INWA 2WKRA 3CAXA 3NJAA 3D72A 1EW0A 3GDIA 4M4XA 3LIBA 5J3WA 1S1ZA 1LL8A 3LIDA 4PKYG 4I38A 4LRYC 3SW1A 2OOLA 1G28A 2V1BA 2VV8A 1XJ3A 2D02A 5F68A 4HY8A 1DP8A 1S4RA 2QKPA 4JGPA 3MXQA 2L4RA 4HHDA 4WN5A 4DJ3A 4B9OA 1OTEA 5HD5A 1LSVA 2W0NA 4LPZA 3KX0X 1UWNX 1XFQA 4HP4A 3A0VA 3IS2A 4RQ9A 1OT9A 4EERA 1OTBA 4EQ1A 3CWFA 3FG8A 3PHYA 5J7EA 1V9YA 4HH3A 1S66L 4H6JA 4KUOA 4WF0A 2D01A 3VOLA 3UMDA 4NXGA 5HWTA 2P7JA 1MZUA 5AVFA 4GS9A 5HDSA 1XJ6A 4WL9A 3F1NB 5F69A 4L9FA 1N9LA 3FC7A 3UB8A 3IBRA 3LI9A 4GCZA 5A8BA 3MR0A 3UE6A 1D7EA 2K7SA 3K3CA 5DJTA 3HJIA 4GHIA 5I5LA 1UGUA 4KUKA 2V1AA 3F1OA 1T1BA 2Z6CA 2YKFA 3ULFA 3G6OA 5HDCA 2VV6A 3E4QA 3C8CA 3H9WA 1OJGA 2VLGA 1TS8A 1DRMA 1LSXA 2V0WA 4LRZE 5HD3A 2VV7A 4I39A 3VE3A 4L9GA 5HZHA 2CMNA 1UWPX 5EFWA 1LT0A 4JGQA 3BY9A 4I3AA 2YKHA 5J4EA 3A0SA 4R6LA 3NOTC 5HWVA 4HJ3A 4BBUA 1F98A 1T19A 4YWZA 1T18A 4K08A 3EWKA 5DKKA 1GSWA 3RTYA 4BBTA 4I5SA 5TBMA 2V0UA 5DKLA 5G4YA 4LRXC 4HH2A 3VE4A 2PDRA 5TBMB 2OWHA 1P97A 5IS1A 1OJ5A 1Y28A 2JHEA 1GSVA 2V9AA 4F3LA 3E4OA 5IU1A 3A0RA 2QWSA 3IS2B 4EESA 2KDKA 3LUQA 4NXBA 4XT2A 2R78A 4H6JB 5HDDA 1DP9A 4MN5A 3ZQ5A 2L0WA 4WUJA 2L1MA 1S1YA 4JGOA 4GS9B 4XT2B 5G4ZA 3NOUC 1N9NA 4JGRA 3LYXA 5HWWA 4EEPA 3BWLA 3UB9A 4HI4A 1OT6A 3MQOA 2M1CA 1TS6A 4HIAA 1V9ZA 3CLOA 2PD8A 2ZOHA 4GHIB 2PYPA 4MN6A 1WA9A 3H7WA 2GJ3A 3F1OB 3LI8A 3PYPA 1KOUA 3HJKA 2PR5A 2JN7A 4LLOB 1T1AA 5KIZA 2J80A 4NXFA 5DJUA 3MJQA 1S67L 3F1PA 4EEUA 5HSQA 1D06A 1XJ2A 2H28A 4EW7A 3K3DA 3MFXA 5F6AA 4R3AA 1OTIA 3UMEA 3GECA 3F1PB 1P0ZA 3NOPC 3H82A 5F5YA 3UB6A 4HP9A 3LICA 4WLAA 2EA9A 3MQQA 1X0OA 3H82B 1T1CA 4EETB
chains in the Genus database with same CATH superfamily
3RH8B 5HAQA 2CC1A 3ICYA 2QZ6A 3S4XA 4OLDA 1VETB 4DJ2A 4LGWA 3LCEA 1NZUA 1VB6A 2PD7A 3UDXA 2Z6DA 4Y3IA 2ACGA 4IEDA 2VEAA 5CGSA 4DRTA 1LSWA 3UN7A 5FQ9A 1PWGA 3KYZA 3JYIA 2C6WB 1JNUA 3TRCA 2EX2A 4I3JA 4CLCD 1PRQA 3UE3A 3ZNTA 4KZ5A 3PBTA 1YLTA 2UV0E 2W27A 2O9AA 1OTAA 4BD0A 1FR6A 2XF3A 4S2MA 5CECA 2VK3A 4ME4A 5L2FA 5FDSA 4OPQA 1YSPA 4ZJ2A 1BZAA 2WZZA 2OWJA 2PT7A 5EV0A 4X1LA 3SH9A 2GZAA 4QJGA 3S7PA 2HDUA 3E2LA 4YNRA 3CZDA 1O07A 1BSGA 1TF1A 3T1SA 4YINA 2A24A 2HV1A 3T50A 1ODVA 1PYYA 4IUHA 3H7WB 3UB7A 3DTEA 3NY4A 4N9LA 2QJ5A 1LI0A 2HJEA 4CLCE 3L9KA 3QP6A 1QMEA 3UY6A 1M6KA 3KYQA 1XJ4A 3EQVA 4R1GA 3WS5A 2V8FA 1BLCA 5FEGA 2XH9A 5BOHA 1EW0A 1ES2A 3CPTA 4CQHA 5J3WA 1GA0A 2HGVA 1IYOA 2ZL1A 4FOFA 5CRFA 2V8CA 4S2KA 4LRYC 3W4OA 4E3IA 4OOLA 5FDHA 2QPNA 3SOIA 4UQIS 1JTGA 1VQQA 2VV8A 4DDYA 3QP4A 3BJNA 2Y59A 4P6ZS 3T4QA 2RCXA 1KGGA 3TE8A 2P9VB 1DP8A 1ZC2A 5DFYA 2ZMFA 3C7UA 2Y55A 1NZOA 4WN5A 3BFCA 1YLWA 4KQRA 4B9OA 3HBRA 3UDIA 4OP5A 1OTEA 4B88A 1YLJA 3PR6A 1J3WA 3KX0X 1VHMA 1UWNX 3OCLA 3U2AA 1WYCA 3V50A 3W8KA 2M7VA 1SDNA 1SKFA 3A0VA 1DY6A 3WRTA 1E3UD 3UE0A 4EERA 3OOVA 3V39A 3LR4A 5AQ9A 3CWFA 4FTXA 2J3TD 1N4OA 5DF7A 3TG9A 3IX3A 4H6JA 4KUOA 1I2WA 2ZM2A 4WF0A 1FOFA 2D01A 2K2NA 5HWTA 3ZHHA 2XGNA 4UQIM 4Q8IA 1MZUA 4P6ZM 2XRNA 5CTNA 4Y5FA 3O87A 1XJ6A 5EM1A 4PM5A 3T4LA 3MS6A 2XR0A 5FQQA 1N9LA 4S2OA 3D3OA 1MXOA 1DJAA 4GCZA 3IF5A 1D7EA 4GD8A 5EVIB 2BG1A 1MKMA 5DJTA 3U4LP 2JKTM 1CI8A 1FIKA 1SCWA 3NBLA 1ES4A 2W1TA 1JWVA 4NG2A 4X53A 1T1BA 3MMHA 4O8GA 4JF5A 3PTEA 3G6OA 4MBHA 5HDCA 4N9KA 5FAQA 1GHIA 4U3TA 3FV7A 4ETZA 3VSLA 3E4QA 3C8CA 1ZG6A 4IBXA 3E2KA 4RX3A 1DRMA 1LSXA 3Q7VB 2ZQ7A 4LRZE 3CHWP 2HZ5A 2O0YA 1LL9A 2VV7A 4M3KA 1WE4A 3FKWA 5GLAA 4L9GA 3VP3A 5AQBA 5MC7A 4G3KA 1PW8A 1UWPX 5GHXA 4LV1A 2H10A 1L3LA 3HLDA 4HBTA 5J4EA 2W3FA 3BEBA 4G3WA 4KZ9A 2OLVA 3NOTC 4ZJ3A 4HJ3A 3CJMA 3DWZA 5U47A 3BLMA 4EQIA 2WKEA 3G2YA 4KG6A 4E3MA 5DKKA 4G3VA 2FFYA 1GSWA 4LV0A 3VP2A 2Z2LB 3DTKA 3W2ZA 4OONA 4B93A 1K4FA 1VETA 1K4EA 4O7DA 2JKGA 2GX5A 2PU2A 1NRJA 4Q0IA 1L0EA 4JLFA 2Y2GA 4B4ZA 3QP5A 2PDRA 4WMCD 1LI9A 3IBJA 2XEPA 4R3BA 3DW0A 2WYXA 3VOYA 4FCFA 3UB5P 4AFIA 2Q0OA 5FQMA 3A0RA 2VA0A 3N8SA 4EESA 1XA7A 1JWZA 3LUQA 3BW6A 4FSFA 1O7EA 1MWRA 3PBQA 3ZCZA 1XA1A 4OOMA 1CEGA 1PI5A 4MN5A 1K55C 3ZQ5A 3EGXC 2L0WA 3RXWA 5CXWA 3OPPA 4JGOA 4XT2B 5G4ZA 2B95A 4BL3A 5L07A 3HVFA 2VGJA 3UB9A 3OPLA 1KGFA 4OQGA 4D2OA 4QPRA 4Z9QA 2J9PA 2E8IA 4E3KA 1H3QA 1K55A 2ZOHA 4GHIB 2PYPA 3H7WA 1YLYA 3F1OB 3LI8A 4Q0JA 5HW3A 4GD6A 3HJKA 4DKIA 4R0QA 2J80A 4KZAA 4LFUA 4UA6A 1S67L 3SS4A 3F1PA 4EEUA 3N8LA 3R7WB 1W7FA 3MFXA 3CITA 4CLCB 1MWTA 3IHBA 3P98A 4LCLA 1C3BA 3GECA 1ZTUA 2R9XA 4JPMA 3FKVA 4ZJ1A 4HP9A 2W3EA 4N1XA 4KQOA 3MZEA 1CQAA 3ZGAB 1X0OA 4LV3A 1N9BA 4OKPA 5JYOA 4DE3A 2O99A 4EETB 3TW8A 4ZAMA 2QMIA 4YOFA 5HPFA 1CF0A 3LEQA 3T1QB 1PNEA 5GHZA 1RGZA 5CTMA 1IOUA 2HF6A 1E25A 4NXEA 3MFDA 3ZVTA 2EWVA 2Y4AA 4OVDA 3VOZA 3VMAA 1K54C 4HOIA 5EVIC 3M2JA 2W3GA 4WEJA 2ZQAA 1STZA 1GHMA 2PYRA 2WGIA 4HJ4A 3MF0A 3ZYTA 4Z1WA 1IEMA 1NWZA 5FASA 3P09A 5GL9A 5KSCA 1K54A 1U60A 5EVIA 2NUPC 4RX2A 4JXSA 1TS0A 4ESPA 1I2SA 1OMEA 2PHYA 4OP8A 5AJGA 2KX6A 2P04A 4QB8A 1W79A 4K0WA 5IHVA 3FWLA 1BUEA 1IKGA 2HPBA 1HD8A 2JC7A 1K38A 4GKUA 5EUAA 1BYWA 2IWCA 2O9CA 2ZBBA 2IWBA 3V5MA 3ZG8B 2INWA 3A3EA 3CAXA 3NC8A 1KDWA 1MBLA 1PWDA 3GDIA 3LIBA 1S1ZA 4PAUA 3GMWA 2XSSA 1FQGA 2VGKA 3DAVA 2JKRI 1K25A 4NKPA 3EQUA 2V1BA 4Y0OA 3C4PA 1H8YA 2PBDP 4E3NA 2ZQCA 2D02A 3W4QA 5F68A 3PBNA 3LY3A 3IWIA 2QKPA 2BTFP 4QHCA 1D1JA 3HUNA 4FD8A 4DJ3A 3QNBA 5L8MA 3M6BA 1NYYA 1LSVA 5CHUA 5A90A 5E2FA 1VEUB 4HP4A 1BULA 5E2EA 2WZXA 3N4IA 1TEMA 4DF6A 3PHYA 4MCWA 4X68A 4QY6A 5EVLA 4KZBA 2XROA 1I5QA 2FFFB 2JCHA 1HLUP 1ZHHB 1EROA 2K31A 3IT9A 5HL6A 5C5KA 1W8YA 2JBFA 2HP6A 4WL9A 3MBZA 2KOIA 2ZC7A 5E2HA 3KYEA 2ZC6B 3FC7A 3UB8A 1FCNA 3LI9A 3MZFA 4DXBA 4OH0A 5A8BA 3O5YA 3G32A 3SH8A 1W5DA 3C30A 4EWFA 3HJIA 4GHIA 4C6YA 2HDRA 1IYQA 3JVVA 4KUKA 3N7WA 2OAQ1 3F1OA 2R9WA 5FA7A 4GZBA 3IHAA 3ZG7B 2XFSA 1OJGA 3PBOA 4Y13A 3R7WA 5DTSA 1Z6FA 5A91A 1GCEA 4DE2A 3ITAA 3Q82A 3VSKA 2GDNA 4XUZA 5HZHA 1L0DA 2ZLYA 1ESUA 1YQSA 3BLSA 3MSHA 2H0TA 2Z2MB 4S2LA 4OPZA 3MQ0A 3BFFA 2X01A 3A0SA 4R6LA 5HWVA 4BBUA 1T19A 1E4DA 4YWZA 1HZOA 4OLGA 2DMWA 4HEFA 1LHYA 1BLPA 4S2JA 2HDSA 2WKIA 2W1RA 5DFXA 1TD5A 5TBMA 2V0UA 5DKLA 1MKIA 4HH2A 3AGFA 3VE4A 2ZC5B 3LR5A 1QMFA 2J9OA 2V20A 2OWHA 5FSRA 4CPKA 5CEDA 1OJ5A 2VGLS 1GSVA 4PM6A 3SS3A 3PBSA 4JXGA 3E4OA 1PFLA 4NETA 1TVFA 3G31A 1RCJA 3IS2B 2WAFA 4U0XA 4ZRRA 3NULA 3AGEA 1K6RA 1ES3A 2KLIA 3R4KA 2B5RA 4S2IA 3T4JA 3Q7ZA 2LB9A 1DP9A 3G34A 4GS9B 3KSIA 1N9NA 3ZG0A 2XA7S 5I94A 3NECA 1FCMA 4EEPA 5DTKA 3BWLA 4HI4A 3MQOA 3OZHA 2A49A 1F2KA 4DMZA 1G5UA 3LR3A 4HIAA 2Y2MA 2PD8A 3DTMA 2VGLM 3WS4A 2EWWA 4NK3A 3IXGA 1WA9A 2OAP1 3O3VA 4X1MA 3GQZA 3IXHA 1KOUA 2PR5A 4NXFA 4WM9A 3RJUA 5DJUA 2J3WA 3MJQA 4E6XA 3LEZA 4OPRA 5HSQA 4ARZA 2H28A 2OV5A 3SH7A 4R3AA 3RXXA 4IBRA 1P0ZA 4DN0A 4EBNA 3HLGA 2XA7M 2FH5A 2WK0A 4MNRA 4LV2A 4IVKA 3CI6A 2W3DA 5HARA 3H82B 4OQ0A 2HP5A 3T1RA 4MBKA 4BLMA 4EU0A 4GN2A 2WUQA 3P7NA 4S2NC 2B02A 4I3IA 4XUXA 4EUVA 1KE4A 1A0KA 2EXBA 4E3LA 3QP2A 2ZC4B 2VZWA 2DNSA 4KZ8A 1DJCA 1VM1A 3WS2A 4D60A 1FSWA 2P74A 4O0PA 1NLYA 4PM7A 3AGDA 4KZ7A 1ZG4A 4S2NA 1XP4A 3NHQA 3O88A 3KSGA 4HJ6A 1H0MA 4WZ5C 1DP6A 3BY8A 4HQAA 3TJZC 2QHKA 2A2LA 2ZMAA 3C7VA 2OLUA 4GOGA 4R70A 4R38A 5AQ7A 2XD1A 3IQAA 1IYPA 3LIEA 4KZ3A 3OLOA 4GDBA 3KSHA 1J9MA 3T4OA 2PR6A 5IT5A 4WZ5A 4UEYA 1ERMA 4X55A 2XDMA 2PAVP 4YFMA 5CX7A 3EOIA 3JVUA 3OPHA 4Y2FA 3OPRA 1N9OA 3VP4A 2BASA 1WYBA 2QJ7A 5EOOA 3IXBA 5HAIA 4MEZA 4KQDA 4BBVA 5FI6A 5JYPA 4IJGA 2A24B 3IWOA 1G6OA 3E4PA 3T4KA 3E0YA 3A3JA 1EI5A 2WKRA 4M4XA 4LENA 4P85A 2ZD8A 3K2NA 3LIDA 5EM0A 1H8ZA 4I38A 4MN7A 2P9VA 3SW1A 1NXYA 4UAAA 2NUTC 1XJ3A 3A3IA 1MY8A 4OPYA 4HY8A 1CK3A 1MWSA 3S22A 4II7A 5CHJA 4ZTKA 4EBPA 5TGFA 2H0YA 2ZM8A 4JGPA 1MPLA 4X6TA 4PHTA 5EVID 3KSFA 2W0NA 2X02A 3HLWA 2WAEA 4WZ4A 5EOEA 1XFQA 3IS2A 4RQ9A 1OTBA 4EQ1A 2Y2PA 1PI4A 3VV4A 4HH3A 1V9YA 4ID4A 1KE3A 2Y2JA 2ZJ9A 3MZDA 1PZPA 2Y2NA 5FAOA 5AQAA 4XXRA 3VOLA 1F5MA 3OC2A 4Q0HA 4GS9A 4ZBEA 3ZDJA 2EFXA 5A93A 3N8RA 5FI7A 3F1NB 2JKTI 3T4SA 2Q9NA 2Y8HA 2IWDA 2EFUA 3IBRA 2A3UA 3NI9A 2C5WB 5FQKA 2ZM0A 5F83A 3MR0A 4JF6A 5HL1A 2K7SA 3T4TA 1Q2QA 3HUMA 4KG5A 3M2KA 3N6IA 3NDEA 2E8JA 5DF8A 1YLPA 5I5LA 5D3OA 2V1AA 3V3RA 2YKFA 1K56A 1Y54A 4NEED 4RYEA 2WGWB 5FI2A 3O86A 3Q7VA 3ULFA 3VFHA 2VV6A 1IFQA 1TS8A 5HD3A 4S2PA 1IKIA 3UO9A 5M19A 3A3DA 1YM1A 4DDSA 5FEFA 2PRFA 5EFWA 2J7VA 3DTIA 4JGQA 3MXSA 3HUOA 4X56A 3T1XA 2YKHA 4BJPA 3DWKA 5HFOA 3TOIA 4UA9A 1T18A 2WADA 3EWKA 3FPVA 3G30A 2AVXA 1FR1A 5FL3A 3RTYA 4PM9A 4BBTA 5FATA 1PZOA 4KZ4A 5F82A 4I5SA 2PBYA 4JF4A 2PU4A 3JPUA 5G4YA 4QY5A 3OBFA 1Z09A 2G2WA 3NIAA 4OQIA 3LO7A 5CHMA 1P97A 4HESA 1Y28A 3WS0A 2V9AA 1KDSA 3S1YA 3C38A 4K0XA 1BLSA 2QWSA 4MDZA 4QU3A 1NJ4A 2ZMVA 3BFGA 3V67A 3UDFA 3HLEA 3LFVA 2KDKA 4P0MA 3QP1A 4XT2A 3UNWA 1IYSA 4RA7A 5HDDA 2XK1A 1W8QA 1S1YA 4JGRA 2VX8A 3LYXA 4CLCC 3QP8A 1SDEA 1OT6A 3FZCA 3PXPA 1XXMA 3BRMA 1TS6A 3HLCA 5GLCA 2IA2A 3UE1A 4EV4A 1V9ZA 3NDGA 3CUEC 3CLOA 4BWIA 3MXRA 4UA7A 1YLZA 5L10A 2Y2LA 2FZ0A 4WELA 3PYPA 4CLCA 4RVAA 1T1AA 3NCKA 5M18A 1M40A 1XJ2A 3CUEA 5F6AA 3GSGA 2XLNA 1OTIA 1PIOA 1TDGA 3F1PB 3NOPC 3G4PA 1SZVA 5F5YA 3D9YA 1KVLA 2I72A 3HLFA 5E2GA 3DBAA 3LICA 4KENB 2EA9A 3IXDA 2Y2QA 2Y2IA 3MQQA 1JVJA 3ZVWA 1L0FA 1YMXA 2BLSA 1YT4A 3ZG5A 4P87A 3BQ8A 3LR0A 3IH9A 1ONGA 2WKPA 4PKYA 5GLDA 1FILA 3LIAA 2JE5A 1YPRA 3IX8A 2WKQA 3WWXA 3B33A 1W63M 3EEHA 3IF6B 4WBGA 2JKFA 2DCFA 3LIFA 4KZ6A 4F3LB 3C2WA 1TDLA 4L9EA 2UWXA 1TS7A 1GSXA 3Q81A 4HNBA 2ZC3B 3F1NA 3FYZA 1XFNA 5KMWA 4IVIA 4X25A 1OTDA 4PMAA 4E04A 4HBUA 2GNXA 5M1AA 2J3TC 5CERA 1L0GA 3W4PA 1BT5A 1ACFA 4BQMA 4GJ4A 3G35A 5AVEA 1SKOB 1YSQA 2I9VA 1S4SA 1SHVA 4E6WA 3VP0A 1F9IA 1E3UA 3ZFZA 5HPIA 2WGWA 2XFTA 2ZOIA 4JBFA 4BENA 3C5AA 4EXOA 3UPPA 1H8MA 2EXAA 3M6HA 3T12B 3BM6A 3E98A 4LCMA 1NLZA 4ETXA 4GW9A 1GA9A 5CGWA 4UHUA 4O01A 3NJAA 4Y7PA 3D72A 2LB5A 3SS5A 1RGYA 4MMNA 2V2FF 1LL8A 4Y0TA 4R4RA 4PKYG 1IELA 5DVAA 2OOLA 1G28A 3GVBA 4JXVA 3S7QA 1ERQA 3LY4A 4IHQA 3HLBA 5CGXA 1S4RA 1XX2A 1P9WA 4Y0UA 3WS1A 4X69A 4DE1A 1YKDA 2JKRM 3MXQA 2HP9A 2L4RA 4HHDA 4R3JA 1VEUA 1ALQA 1H5XA 1Y4OA 4B4XA 3I7JA 5HD5A 1ES5A 1S6RA 1XGIA 4H8RA 3BFDA 4MBFA 1LLBA 1GHPA 3IH8A 4LPZA 4E3JA 1CJFA 1G68A 1K57C 3A3FA 4IUKA 3TSGA 1OT9A 2VKSA 3IX4A 1MC0A 4KQQA 5G18A 3FG8A 3CG5A 3B42A 1XGJA 3SZTA 5J8XA 5J7EA 4PPRA 1K6SA 1S66L 1NRFA 1PW1A 2XQZA 5TFQA 3PAGA 2V1ZA 1AXBA 2Y2HA 3GRJA 3UMDA 4NXGA 1BTLA 2P7JA 5AVFA 2OSUA 5HDSA 1K57A 2B18A 5FQJA 4JKTA 5F69A 4L9FA 5KZHA 3S7OA 5HX9A 4WMCA 1K0KA 3CMZA 2W3HA 3UE6A 4FH4A 3K3CA 1FCOA 1JWPA 4U0TA 2EX8A 1UGUA 4A5RA 2G2UA 3BQAA 2Z6CA 4N1HA 1Q2PA 2O9BA 3ITBA 4L0LA 3MKFA 5GLBA 3H9WA 2VLGA 3ZNYA 3EEAA 2V0WA 1EWZA 3PBRA 4I39A 3VE3A 1RP5A 1YAXA 4GDNA 1DJBA 5LBRA 1KE0A 2CMNA 1XPBA 4GLQA 3BYDA 1AWIA 3OCNA 4Y17A 3LGOA 1LT0A 3CPTB 3BY9A 4I3AA 4JXWA 5DF9A 2X71A 4KG2A 2ZL1B 3UPOA 4N92A 4Y15A 5E43A 3IF6C 1F98A 2DRWA 5GHYA 2M7UA 1W63Q 4K08A 3V3SA 4GNUA 5DTTA 4QWOA 3Q1FA 5EPHA 4MLLA 1YMSA 1NY0A 2EX9A 1NYMA 3HREA 4EBLA 2RL3A 4P6BA 3QHYA 4LRXC 3P01A 3BECA 3L7HA 4DE0A 1CI9A 4BL2A 4BD1A 3IF6A 3WRZA 4ZDXA 3IWQA 4K91A 5TBMB 2Y2KA 5IS1A 4R23A 4WEKA 1JTDA 2JHEA 4OQHA 3VFFA 1P9RA 4F3LA 2ZQDA 5EECA 5IU1A 3GV9A 5TJJA 3RFBA 1K56D 2ZQ9A 4F94A 3HCYA 5L09A 1OPXA 2J8YA 2QYBA 4NXBA 5KSHA 2R78A 4H6JB 2G7UA 3FPWA 1MWUA 2WKHA 5CEBA 4WUJA 2L1MA 4BMWA 2WGVA 3NOUC 4QD4A 1PWCA 1SKOA 3ISGA 1LL5A 3UPNA 1L2SA 2H5SA 3HL9A 3B47A 4CJNA 5EVEA 3S7NA 5HWWA 1HTZA 2EX6A 1ONHA 2M1CA 5F1GA 3KO6A 2MJ6A 1CEFA 3ZG9B 4R4SA 4WYYA 4C3QA 5FAPA 4PM8A 2XD5A 4EUZA 4MN6A 1BLHA 3B3XA 2GJ3A 2W1TB 4OOYA 2Y2OA 3EGDC 3PAEA 3VP1A 4FUWA 5A92A 4C75A 2JN7A 4LLOB 2Y91A 4FH2A 5TR7A 5KIZA 5EE8A 3Q07A 2P08A 1D06A 1S0WA 1ZKJA 5K5BA 4EW7A 1FSYA 3K3DA 5FQIA 5F1FA 2ZQ8A 3UMEA 3MKEA 1G6AA 4ARZB 3D4FA 3H82A 2VJWA 3UB6A 1XKZA 3GR2A 1KGEA 5HAPA 4E3OA 3G2ZA 4WLAA 2Y79A 4DXCA 3QNCA 1KVMA 4GB7A 2Q9MA 1ESIA 2HJ9C 1T1CA 2HDQA 3BFEA 3C4OA 1HVBA 3GTCA
chains in the Genus database with same CATH topology
3BQ8A 3RH8B 3P7NA 4YOFA 5HPFA 3ICYA 2B02A 3LR0A 4I3IA 4EUVA 2WKPA 4DJ2A 4PKYA 1IOUA 1VB6A 2HF6A 2PD7A 3LIAA 2Z6DA 2VZWA 4Y3IA 2WKQA 3B33A 1W63M 3EEHA 4NXEA 4O0PA 1NLYA 2EWVA 2VEAA 1LSWA 3NHQA 3KYZA 4HOIA 3LIFA 4F3LB 3KSGA 4HJ6A 3C2WA 2W3GA 4L9EA 1DP6A 3BY8A 4HQAA 1JNUA 3TJZC 3TRCA 1TS7A 4WEJA 1GSXA 4I3JA 2QHKA 1STZA 2A2LA 4CLCD 2PYRA 3UE3A 4HJ4A 4HNBA 3MF0A 3ZYTA 3PBTA 3F1NA 4Z1WA 1XFNA 2W27A 2O9AA 1OTAA 4R70A 1OTDA 4R38A 4E04A 1NWZA 2GNXA 2J3TC 4ME4A 3LIEA 3OLOA 1YSPA 3KSHA 4GJ4A 2OWJA 5AVEA 2PT7A 2NUPC 3T4OA 2PR6A 5IT5A 1YSQA 2I9VA 4UEYA 1S4SA 5CX7A 3EOIA 3JVUA 1TS0A 2GZAA 1F9IA 3S7PA 5HPIA 2PHYA 5AJGA 2KX6A 2P04A 1N9OA 4Y2FA 4YNRA 2ZOIA 4EXOA 1TF1A 1H8MA 2BASA 2QJ7A 2A24A 2HV1A 3T50A 1ODVA 3E98A 4IUHA 3H7WB 3UB7A 1NLZA 1BYWA 4GW9A 4ETXA 4KQDA 4BBVA 2QJ5A 2ZBBA 2HJEA 2O9CA 4IJGA 4CLCE 2A24B 1G6OA 3E4PA 1XJ4A 2INWA 3EQVA 3KYQA 4O01A 3T4KA 3E0YA 2WKRA 3CAXA 3NJAA 3D72A 1EW0A 2LB5A 3GDIA 4M4XA 4MMNA 4CQHA 3LIBA 5J3WA 1S1ZA 1LL8A 2HGVA 4PAUA 3K2NA 3LIDA 4FOFA 4PKYG 2XSSA 4I38A 4MN7A 4LRYC 3SW1A 4OOLA 2OOLA 2JKRI 1G28A 4NKPA 3EQUA 2NUTC 2V1BA 4UQIS 2VV8A 3BJNA 4P6ZS 3S7QA 1XJ3A 3T4QA 2D02A 5F68A 3PBNA 3TE8A 4IHQA 4HY8A 1DP8A 1S4RA 2QKPA 1P9WA 4II7A 5DFYA 2ZMFA 4JGPA 1YKDA 2JKRM 3MXQA 2L4RA 4HHDA 4WN5A 4PHTA 4DJ3A 5L8MA 4B9OA 1OTEA 5HD5A 3KSFA 1LSVA 2W0NA 3PR6A 4LPZA 3KX0X 1VHMA 1UWNX 1XFQA 3OCLA 3U2AA 4IUKA 4HP4A 2M7VA 3A0VA 3IS2A 4RQ9A 1OT9A 4EERA 3OOVA 1OTBA 4EQ1A 3LR4A 3CWFA 2VKSA 1MC0A 3FG8A 2J3TD 3PHYA 4MCWA 3VV4A 3B42A 5J7EA 1V9YA 4HH3A 1S66L 2XROA 4H6JA 4KUOA 4WF0A 2D01A 3VOLA 1F5MA 3OC2A 2K2NA 4NXGA 5HWTA 1ZHHB 3UMDA 2P7JA 4UQIM 1MZUA 2K31A 4P6ZM 5HL6A 5C5KA 2XRNA 4Q0HA 4GS9A 5AVFA 5HDSA 4Y5FA 2B18A 1XJ6A 4WL9A 3F1NB 2JKTI 3T4LA 2KOIA 5F69A 4L9FA 3T4SA 1N9LA 2Y8HA 3FC7A 3D3OA 3S7OA 3UB8A 3IBRA 3LI9A 4GCZA 5A8BA 3O5YA 2W3HA 3MR0A 3UE6A 1D7EA 2K7SA 3C30A 3T4TA 3K3CA 1MKMA 5DJTA 2JKTM 3HJIA 4GHIA 2W1TA 5I5LA 1UGUA 3JVVA 4KUKA 2V1AA 2OAQ1 3F1OA 1T1BA 2Z6CA 3BQAA 3MMHA 4O8GA 2YKFA 4NEED 2O9BA 3ULFA 4L0LA 3G6OA 5HDCA 2VV6A 4ETZA 3E4QA 3C8CA 3H9WA 1IFQA 1OJGA 3PBOA 2VLGA 3R7WA 3EEAA 1TS8A 1DRMA 1LSXA 2V0WA 4LRZE 3PBRA 5HD3A 2O0YA 2VV7A 4I39A 3VE3A 1YAXA 4L9GA 5LBRA 5HZHA 2CMNA 5MC7A 4G3KA 4GLQA 1UWPX 3OCNA 5EFWA 1LT0A 4JGQA 3BY9A 4I3AA 3MQ0A 5DF9A 2YKHA 4BJPA 5J4EA 3A0SA 4R6LA 2W3FA 4G3WA 3NOTC 5HWVA 4HJ3A 4BBUA 1F98A 1T19A 4YWZA 2M7UA 1W63Q 1T18A 4K08A 3EWKA 5DKKA 4G3VA 3FPVA 1GSWA 2DMWA 5FL3A 3RTYA 4BBTA 3W2ZA 4B93A 2W1RA 5DFXA 4I5SA 1TD5A 2GX5A 5TBMA 1NRJA 2V0UA 4Q0IA 5DKLA 5G4YA 4LRXC 3P01A 4HH2A 3VE4A 3OBFA 3LR5A 2PDRA 3IBJA 5TBMB 2OWHA 1P97A 5IS1A 1OJ5A 1Y28A 2VGLS 4WEKA 2JHEA 1GSVA 2V9AA 4AFIA 1P9RA 4F3LA 3PBSA 3C38A 3E4OA 5IU1A 3A0RA 2QWSA 4MDZA 2VA0A 2ZMVA 5TJJA 3V67A 3IS2B 4ZRRA 3RFBA 4EESA 3LFVA 2KDKA 3HCYA 2KLIA 3R4KA 3LUQA 3BW6A 1OPXA 2QYBA 4FSFA 4NXBA 3PBQA 4XT2A 2R78A 5KSHA 3T4JA 4OOMA 4H6JB 2G7UA 2LB9A 1DP9A 3FPWA 5HDDA 4MN5A 3ZQ5A 3EGXC 2L0WA 4WUJA 2L1MA 1S1YA 4JGOA 4GS9B 4XT2B 4BMWA 5G4ZA 3NOUC 3KSIA 1N9NA 2XA7S 4JGRA 3B47A 2VX8A 3LYXA 3S7NA 5HWWA 4EEPA 4CLCC 3BWLA 3UB9A 4HI4A 1OT6A 3MQOA 3PXPA 2M1CA 1TS6A 4QPRA 4DMZA 2IA2A 3KO6A 3LR3A 2MJ6A 1H3QA 4HIAA 1V9ZA 3CUEC 3CLOA 4BWIA 2PD8A 2VGLM 2ZOHA 2EWWA 4GHIB 2PYPA 4MN6A 1WA9A 2OAP1 3H7WA 2GJ3A 2W1TB 2FZ0A 4WELA 3EGDC 3F1OB 3LI8A 3PYPA 4Q0JA 1KOUA 4CLCA 3HJKA 2PR5A 2JN7A 4LLOB 1T1AA 5KIZA 2J80A 4NXFA 5DJUA 2J3WA 1S67L 3MJQA 3F1PA 4EEUA 2P08A 4ARZA 1D06A 1XJ2A 5HSQA 2H28A 5K5BA 3R7WB 4EW7A 3K3DA 3CUEA 4CLCB 3MFXA 3CITA 5F6AA 4R3AA 1OTIA 3UMEA 3GECA 1ZTUA 3F1PB 1P0ZA 4DN0A 3NOPC 4ARZB 2XA7M 2FH5A 3H82A 5F5YA 2VJWA 3UB6A 4HP9A 2W3EA 3DBAA 3LICA 4KQOA 4WLAA 2Y79A 3CI6A 2EA9A 2W3DA 3MQQA 1X0OA 2HJ9C 3H82B 1T1CA 2O99A 4EU0A 4EETB 3TW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RH8 B;  3P7N A;  3ICY A;  2B02 A;  4I3I A;  2WKP A;  4DJ2 A;  4PKY A;  1VB6 A;  2PD7 A;  3LIA A;  2Z6D A;  2WKQ A;  3B33 A;  3EEH A;  4NXE A;  2VEA A;  1LSW A;  3NHQ A;  4HOI A;  3LIF A;  4F3L B;  4HJ6 A;  3C2W A;  4L9E A;  1DP6 A;  3BY8 A;  4HQA A;  1JNU A;  1TS7 A;  1GSX A;  4I3J A;  2QHK A;  2PYR A;  4HJ4 A;  4HNB A;  3F1N A;  1XFN A;  2W27 A;  1OTA A;  4R70 A;  1OTD A;  4R38 A;  4E04 A;  1NWZ A;  3LIE A;  3OLO A;  2OWJ A;  5AVE A;  2PR6 A;  2I9V A;  1S4S A;  1TS0 A;  1F9I A;  2PHY A;  2KX6 A;  1N9O A;  2ZOI A;  4EXO A;  2BAS A;  2QJ7 A;  2A24 A;  2HV1 A;  3T50 A;  1ODV A;  3H7W B;  3UB7 A;  1BYW A;  4GW9 A;  4KQD A;  4BBV A;  2QJ5 A;  2ZBB A;  2A24 B;  3E4P A;  1XJ4 A;  2INW A;  2WKR A;  3CAX A;  3NJA A;  3D72 A;  1EW0 A;  3GDI A;  4M4X A;  3LIB A;  5J3W A;  1S1Z A;  1LL8 A;  3LID A;  4PKY G;  4I38 A;  4LRY C;  3SW1 A;  2OOL A;  1G28 A;  2V1B A;  2VV8 A;  1XJ3 A;  2D02 A;  5F68 A;  4HY8 A;  1DP8 A;  1S4R A;  2QKP A;  4JGP A;  3MXQ A;  2L4R A;  4HHD A;  4WN5 A;  4DJ3 A;  4B9O A;  1OTE A;  5HD5 A;  1LSV A;  2W0N A;  4LPZ A;  3KX0 X;  1UWN X;  1XFQ A;  4HP4 A;  3A0V A;  3IS2 A;  4RQ9 A;  1OT9 A;  4EER A;  1OTB A;  4EQ1 A;  3CWF A;  3FG8 A;  3PHY A;  5J7E A;  1V9Y A;  4HH3 A;  1S66 L;  4H6J A;  4KUO A;  4WF0 A;  2D01 A;  3VOL A;  3UMD A;  4NXG A;  5HWT A;  2P7J A;  1MZU A;  5AVF A;  4GS9 A;  5HDS A;  1XJ6 A;  4WL9 A;  3F1N B;  5F69 A;  4L9F A;  1N9L A;  3FC7 A;  3UB8 A;  3IBR A;  3LI9 A;  4GCZ A;  5A8B A;  3MR0 A;  3UE6 A;  1D7E A;  2K7S A;  3K3C A;  5DJT A;  3HJI A;  4GHI A;  5I5L A;  1UGU A;  4KUK A;  2V1A A;  3F1O A;  1T1B A;  2Z6C A;  2YKF A;  3ULF A;  3G6O A;  5HDC A;  2VV6 A;  3E4Q A;  3C8C A;  3H9W A;  1OJG A;  2VLG A;  1TS8 A;  1DRM A;  1LSX A;  2V0W A;  4LRZ E;  5HD3 A;  2VV7 A;  4I39 A;  3VE3 A;  4L9G A;  5HZH A;  2CMN A;  1UWP X;  5EFW A;  1LT0 A;  4JGQ A;  3BY9 A;  4I3A A;  2YKH A;  5J4E A;  3A0S A;  4R6L A;  3NOT C;  5HWV A;  4HJ3 A;  4BBU A;  1F98 A;  1T19 A;  4YWZ A;  1T18 A;  4K08 A;  3EWK A;  5DKK A;  1GSW A;  3RTY A;  4BBT A;  4I5S A;  5TBM A;  2V0U A;  5DKL A;  5G4Y A;  4LRX C;  4HH2 A;  3VE4 A;  2PDR A;  5TBM B;  2OWH A;  1P97 A;  5IS1 A;  1OJ5 A;  1Y28 A;  2JHE A;  1GSV A;  2V9A A;  4F3L A;  3E4O A;  5IU1 A;  3A0R A;  2QWS A;  3IS2 B;  4EES A;  2KDK A;  3LUQ A;  4NXB A;  4XT2 A;  2R78 A;  4H6J B;  5HDD A;  1DP9 A;  4MN5 A;  3ZQ5 A;  2L0W A;  4WUJ A;  2L1M A;  1S1Y A;  4JGO A;  4GS9 B;  4XT2 B;  5G4Z A;  3NOU C;  1N9N A;  4JGR A;  3LYX A;  5HWW A;  4EEP A;  3BWL A;  3UB9 A;  4HI4 A;  1OT6 A;  3MQO A;  2M1C A;  1TS6 A;  4HIA A;  1V9Z A;  3CLO A;  2PD8 A;  2ZOH A;  4GHI B;  2PYP A;  4MN6 A;  1WA9 A;  3H7W A;  2GJ3 A;  3F1O B;  3LI8 A;  3PYP A;  1KOU A;  3HJK A;  2PR5 A;  2JN7 A;  4LLO B;  1T1A A;  5KIZ A;  2J80 A;  4NXF A;  5DJU A;  3MJQ A;  1S67 L;  3F1P A;  4EEU A;  5HSQ A;  1D06 A;  1XJ2 A;  2H28 A;  4EW7 A;  3K3D A;  3MFX A;  5F6A A;  4R3A A;  1OTI A;  3UME A;  3GEC A;  3F1P B;  1P0Z A;  3NOP C;  3H82 A;  5F5Y A;  3UB6 A;  4HP9 A;  3LIC A;  4WLA A;  2EA9 A;  3MQQ A;  1X0O A;  3H82 B;  1T1C A;  4EET B; 
#chains in the Genus database with same CATH topology
 3RH8 B;  5HAQ A;  2CC1 A;  3ICY A;  2QZ6 A;  3S4X A;  4OLD A;  1VET B;  4DJ2 A;  4LGW A;  3LCE A;  1NZU A;  1VB6 A;  2PD7 A;  3UDX A;  2Z6D A;  4Y3I A;  2ACG A;  4IED A;  2VEA A;  5CGS A;  4DRT A;  1LSW A;  3UN7 A;  5FQ9 A;  1PWG A;  3KYZ A;  3JYI A;  2C6W B;  1JNU A;  3TRC A;  2EX2 A;  4I3J A;  4CLC D;  1PRQ A;  3UE3 A;  3ZNT A;  4KZ5 A;  3PBT A;  1YLT A;  2UV0 E;  2W27 A;  2O9A A;  1OTA A;  4BD0 A;  1FR6 A;  2XF3 A;  4S2M A;  5CEC A;  2VK3 A;  4ME4 A;  5L2F A;  5FDS A;  4OPQ A;  1YSP A;  4ZJ2 A;  1BZA A;  2WZZ A;  2OWJ A;  2PT7 A;  5EV0 A;  4X1L A;  3SH9 A;  2GZA A;  4QJG A;  3S7P A;  2HDU A;  3E2L A;  4YNR A;  3CZD A;  1O07 A;  1BSG A;  1TF1 A;  3T1S A;  4YIN A;  2A24 A;  2HV1 A;  3T50 A;  1ODV A;  1PYY A;  4IUH A;  3H7W B;  3UB7 A;  3DTE A;  3NY4 A;  4N9L A;  2QJ5 A;  1LI0 A;  2HJE A;  4CLC E;  3L9K A;  3QP6 A;  1QME A;  3UY6 A;  1M6K A;  3KYQ A;  1XJ4 A;  3EQV A;  4R1G A;  3WS5 A;  2V8F A;  1BLC A;  5FEG A;  2XH9 A;  5BOH A;  1EW0 A;  1ES2 A;  3CPT A;  4CQH A;  5J3W A;  1GA0 A;  2HGV A;  1IYO A;  2ZL1 A;  4FOF A;  5CRF A;  2V8C A;  4S2K A;  4LRY C;  3W4O A;  4E3I A;  4OOL A;  5FDH A;  2QPN A;  3SOI A;  4UQI S;  1JTG A;  1VQQ A;  2VV8 A;  4DDY A;  3QP4 A;  3BJN A;  2Y59 A;  4P6Z S;  3T4Q A;  2RCX A;  1KGG A;  3TE8 A;  2P9V B;  1DP8 A;  1ZC2 A;  5DFY A;  2ZMF A;  3C7U A;  2Y55 A;  1NZO A;  4WN5 A;  3BFC A;  1YLW A;  4KQR A;  4B9O A;  3HBR A;  3UDI A;  4OP5 A;  1OTE A;  4B88 A;  1YLJ A;  3PR6 A;  1J3W A;  3KX0 X;  1VHM A;  1UWN X;  3OCL A;  3U2A A;  1WYC A;  3V50 A;  3W8K A;  2M7V A;  1SDN A;  1SKF A;  3A0V A;  1DY6 A;  3WRT A;  1E3U D;  3UE0 A;  4EER A;  3OOV A;  3V39 A;  3LR4 A;  5AQ9 A;  3CWF A;  4FTX A;  2J3T D;  1N4O A;  5DF7 A;  3TG9 A;  3IX3 A;  4H6J A;  4KUO A;  1I2W A;  2ZM2 A;  4WF0 A;  1FOF A;  2D01 A;  2K2N A;  5HWT A;  3ZHH A;  2XGN A;  4UQI M;  4Q8I A;  1MZU A;  4P6Z M;  2XRN A;  5CTN A;  4Y5F A;  3O87 A;  1XJ6 A;  5EM1 A;  4PM5 A;  3T4L A;  3MS6 A;  2XR0 A;  5FQQ A;  1N9L A;  4S2O A;  3D3O A;  1MXO A;  1DJA A;  4GCZ A;  3IF5 A;  1D7E A;  4GD8 A;  5EVI B;  2BG1 A;  1MKM A;  5DJT A;  3U4L P;  2JKT M;  1CI8 A;  1FIK A;  1SCW A;  3NBL A;  1ES4 A;  2W1T A;  1JWV A;  4NG2 A;  4X53 A;  1T1B A;  3MMH A;  4O8G A;  4JF5 A;  3PTE A;  3G6O A;  4MBH A;  5HDC A;  4N9K A;  5FAQ A;  1GHI A;  4U3T A;  3FV7 A;  4ETZ A;  3VSL A;  3E4Q A;  3C8C A;  1ZG6 A;  4IBX A;  3E2K A;  4RX3 A;  1DRM A;  1LSX A;  3Q7V B;  2ZQ7 A;  4LRZ E;  3CHW P;  2HZ5 A;  2O0Y A;  1LL9 A;  2VV7 A;  4M3K A;  1WE4 A;  3FKW A;  5GLA A;  4L9G A;  3VP3 A;  5AQB A;  5MC7 A;  4G3K A;  1PW8 A;  1UWP X;  5GHX A;  4LV1 A;  2H10 A;  1L3L A;  3HLD A;  4HBT A;  5J4E A;  2W3F A;  3BEB A;  4G3W A;  4KZ9 A;  2OLV A;  3NOT C;  4ZJ3 A;  4HJ3 A;  3CJM A;  3DWZ A;  5U47 A;  3BLM A;  4EQI A;  2WKE A;  3G2Y A;  4KG6 A;  4E3M A;  5DKK A;  4G3V A;  2FFY A;  1GSW A;  4LV0 A;  3VP2 A;  2Z2L B;  3DTK A;  3W2Z A;  4OON A;  4B93 A;  1K4F A;  1VET A;  1K4E A;  4O7D A;  2JKG A;  2GX5 A;  2PU2 A;  1NRJ A;  4Q0I A;  1L0E A;  4JLF A;  2Y2G A;  4B4Z A;  3QP5 A;  2PDR A;  4WMC D;  1LI9 A;  3IBJ A;  2XEP A;  4R3B A;  3DW0 A;  2WYX A;  3VOY A;  4FCF A;  3UB5 P;  4AFI A;  2Q0O A;  5FQM A;  3A0R A;  2VA0 A;  3N8S A;  4EES A;  1XA7 A;  1JWZ A;  3LUQ A;  3BW6 A;  4FSF A;  1O7E A;  1MWR A;  3PBQ A;  3ZCZ A;  1XA1 A;  4OOM A;  1CEG A;  1PI5 A;  4MN5 A;  1K55 C;  3ZQ5 A;  3EGX C;  2L0W A;  3RXW A;  5CXW A;  3OPP A;  4JGO A;  4XT2 B;  5G4Z A;  2B95 A;  4BL3 A;  5L07 A;  3HVF A;  2VGJ A;  3UB9 A;  3OPL A;  1KGF A;  4OQG A;  4D2O A;  4QPR A;  4Z9Q A;  2J9P A;  2E8I A;  4E3K A;  1H3Q A;  1K55 A;  2ZOH A;  4GHI B;  2PYP A;  3H7W A;  1YLY A;  3F1O B;  3LI8 A;  4Q0J A;  5HW3 A;  4GD6 A;  3HJK A;  4DKI A;  4R0Q A;  2J80 A;  4KZA A;  4LFU A;  4UA6 A;  1S67 L;  3SS4 A;  3F1P A;  4EEU A;  3N8L A;  3R7W B;  1W7F A;  3MFX A;  3CIT A;  4CLC B;  1MWT A;  3IHB A;  3P98 A;  4LCL A;  1C3B A;  3GEC A;  1ZTU A;  2R9X A;  4JPM A;  3FKV A;  4ZJ1 A;  4HP9 A;  2W3E A;  4N1X A;  4KQO A;  3MZE A;  1CQA A;  3ZGA B;  1X0O A;  4LV3 A;  1N9B A;  4OKP A;  5JYO A;  4DE3 A;  2O99 A;  4EET B;  3TW8 A;  4ZAM A;  2QMI A;  4YOF A;  5HPF A;  1CF0 A;  3LEQ A;  3T1Q B;  1PNE A;  5GHZ A;  1RGZ A;  5CTM A;  1IOU A;  2HF6 A;  1E25 A;  4NXE A;  3MFD A;  3ZVT A;  2EWV A;  2Y4A A;  4OVD A;  3VOZ A;  3VMA A;  1K54 C;  4HOI A;  5EVI C;  3M2J A;  2W3G A;  4WEJ A;  2ZQA A;  1STZ A;  1GHM A;  2PYR A;  2WGI A;  4HJ4 A;  3MF0 A;  3ZYT A;  4Z1W A;  1IEM A;  1NWZ A;  5FAS A;  3P09 A;  5GL9 A;  5KSC A;  1K54 A;  1U60 A;  5EVI A;  2NUP C;  4RX2 A;  4JXS A;  1TS0 A;  4ESP A;  1I2S A;  1OME A;  2PHY A;  4OP8 A;  5AJG A;  2KX6 A;  2P04 A;  4QB8 A;  1W79 A;  4K0W A;  5IHV A;  3FWL A;  1BUE A;  1IKG A;  2HPB A;  1HD8 A;  2JC7 A;  1K38 A;  4GKU A;  5EUA A;  1BYW A;  2IWC A;  2O9C A;  2ZBB A;  2IWB A;  3V5M A;  3ZG8 B;  2INW A;  3A3E A;  3CAX A;  3NC8 A;  1KDW A;  1MBL A;  1PWD A;  3GDI A;  3LIB A;  1S1Z A;  4PAU A;  3GMW A;  2XSS A;  1FQG A;  2VGK A;  3DAV A;  2JKR I;  1K25 A;  4NKP A;  3EQU A;  2V1B A;  4Y0O A;  3C4P A;  1H8Y A;  2PBD P;  4E3N A;  2ZQC A;  2D02 A;  3W4Q A;  5F68 A;  3PBN A;  3LY3 A;  3IWI A;  2QKP A;  2BTF P;  4QHC A;  1D1J A;  3HUN A;  4FD8 A;  4DJ3 A;  3QNB A;  5L8M A;  3M6B A;  1NYY A;  1LSV A;  5CHU A;  5A90 A;  5E2F A;  1VEU B;  4HP4 A;  1BUL A;  5E2E A;  2WZX A;  3N4I A;  1TEM A;  4DF6 A;  3PHY A;  4MCW A;  4X68 A;  4QY6 A;  5EVL A;  4KZB A;  2XRO A;  1I5Q A;  2FFF B;  2JCH A;  1HLU P;  1ZHH B;  1ERO A;  2K31 A;  3IT9 A;  5HL6 A;  5C5K A;  1W8Y A;  2JBF A;  2HP6 A;  4WL9 A;  3MBZ A;  2KOI A;  2ZC7 A;  5E2H A;  3KYE A;  2ZC6 B;  3FC7 A;  3UB8 A;  1FCN A;  3LI9 A;  3MZF A;  4DXB A;  4OH0 A;  5A8B A;  3O5Y A;  3G32 A;  3SH8 A;  1W5D A;  3C30 A;  4EWF A;  3HJI A;  4GHI A;  4C6Y A;  2HDR A;  1IYQ A;  3JVV A;  4KUK A;  3N7W A;  2OAQ 1;  3F1O A;  2R9W A;  5FA7 A;  4GZB A;  3IHA A;  3ZG7 B;  2XFS A;  1OJG A;  3PBO A;  4Y13 A;  3R7W A;  5DTS A;  1Z6F A;  5A91 A;  1GCE A;  4DE2 A;  3ITA A;  3Q82 A;  3VSK A;  2GDN A;  4XUZ A;  5HZH A;  1L0D A;  2ZLY A;  1ESU A;  1YQS A;  3BLS A;  3MSH A;  2H0T A;  2Z2M B;  4S2L A;  4OPZ A;  3MQ0 A;  3BFF A;  2X01 A;  3A0S A;  4R6L A;  5HWV A;  4BBU A;  1T19 A;  1E4D A;  4YWZ A;  1HZO A;  4OLG A;  2DMW A;  4HEF A;  1LHY A;  1BLP A;  4S2J A;  2HDS A;  2WKI A;  2W1R A;  5DFX A;  1TD5 A;  5TBM A;  2V0U A;  5DKL A;  1MKI A;  4HH2 A;  3AGF A;  3VE4 A;  2ZC5 B;  3LR5 A;  1QMF A;  2J9O A;  2V20 A;  2OWH A;  5FSR A;  4CPK A;  5CED A;  1OJ5 A;  2VGL S;  1GSV A;  4PM6 A;  3SS3 A;  3PBS A;  4JXG A;  3E4O A;  1PFL A;  4NET A;  1TVF A;  3G31 A;  1RCJ A;  3IS2 B;  2WAF A;  4U0X A;  4ZRR A;  3NUL A;  3AGE A;  1K6R A;  1ES3 A;  2KLI A;  3R4K A;  2B5R A;  4S2I A;  3T4J A;  3Q7Z A;  2LB9 A;  1DP9 A;  3G34 A;  4GS9 B;  3KSI A;  1N9N A;  3ZG0 A;  2XA7 S;  5I94 A;  3NEC A;  1FCM A;  4EEP A;  5DTK A;  3BWL A;  4HI4 A;  3MQO A;  3OZH A;  2A49 A;  1F2K A;  4DMZ A;  1G5U A;  3LR3 A;  4HIA A;  2Y2M A;  2PD8 A;  3DTM A;  2VGL M;  3WS4 A;  2EWW A;  4NK3 A;  3IXG A;  1WA9 A;  2OAP 1;  3O3V A;  4X1M A;  3GQZ A;  3IXH A;  1KOU A;  2PR5 A;  4NXF A;  4WM9 A;  3RJU A;  5DJU A;  2J3W A;  3MJQ A;  4E6X A;  3LEZ A;  4OPR A;  5HSQ A;  4ARZ A;  2H28 A;  2OV5 A;  3SH7 A;  4R3A A;  3RXX A;  4IBR A;  1P0Z A;  4DN0 A;  4EBN A;  3HLG A;  2XA7 M;  2FH5 A;  2WK0 A;  4MNR A;  4LV2 A;  4IVK A;  3CI6 A;  2W3D A;  5HAR A;  3H82 B;  4OQ0 A;  2HP5 A;  3T1R A;  4MBK A;  4BLM A;  4EU0 A;  4GN2 A;  2WUQ A;  3P7N A;  4S2N C;  2B02 A;  4I3I A;  4XUX A;  4EUV A;  1KE4 A;  1A0K A;  2EXB A;  4E3L A;  3QP2 A;  2ZC4 B;  2VZW A;  2DNS A;  4KZ8 A;  1DJC A;  1VM1 A;  3WS2 A;  4D60 A;  1FSW A;  2P74 A;  4O0P A;  1NLY A;  4PM7 A;  3AGD A;  4KZ7 A;  1ZG4 A;  4S2N A;  1XP4 A;  3NHQ A;  3O88 A;  3KSG A;  4HJ6 A;  1H0M A;  4WZ5 C;  1DP6 A;  3BY8 A;  4HQA A;  3TJZ C;  2QHK A;  2A2L A;  2ZMA A;  3C7V A;  2OLU A;  4GOG A;  4R70 A;  4R38 A;  5AQ7 A;  2XD1 A;  3IQA A;  1IYP A;  3LIE A;  4KZ3 A;  3OLO A;  4GDB A;  3KSH A;  1J9M A;  3T4O A;  2PR6 A;  5IT5 A;  4WZ5 A;  4UEY A;  1ERM A;  4X55 A;  2XDM A;  2PAV P;  4YFM A;  5CX7 A;  3EOI A;  3JVU A;  3OPH A;  4Y2F A;  3OPR A;  1N9O A;  3VP4 A;  2BAS A;  1WYB A;  2QJ7 A;  5EOO A;  3IXB A;  5HAI A;  4MEZ A;  4KQD A;  4BBV A;  5FI6 A;  5JYP A;  4IJG A;  2A24 B;  3IWO A;  1G6O A;  3E4P A;  3T4K A;  3E0Y A;  3A3J A;  1EI5 A;  2WKR A;  4M4X A;  4LEN A;  4P85 A;  2ZD8 A;  3K2N A;  3LID A;  5EM0 A;  1H8Z A;  4I38 A;  4MN7 A;  2P9V A;  3SW1 A;  1NXY A;  4UAA A;  2NUT C;  1XJ3 A;  3A3I A;  1MY8 A;  4OPY A;  4HY8 A;  1CK3 A;  1MWS A;  3S22 A;  4II7 A;  5CHJ A;  4ZTK A;  4EBP A;  5TGF A;  2H0Y A;  2ZM8 A;  4JGP A;  1MPL A;  4X6T A;  4PHT A;  5EVI D;  3KSF A;  2W0N A;  2X02 A;  3HLW A;  2WAE A;  4WZ4 A;  5EOE A;  1XFQ A;  3IS2 A;  4RQ9 A;  1OTB A;  4EQ1 A;  2Y2P A;  1PI4 A;  3VV4 A;  4HH3 A;  1V9Y A;  4ID4 A;  1KE3 A;  2Y2J A;  2ZJ9 A;  3MZD A;  1PZP A;  2Y2N A;  5FAO A;  5AQA A;  4XXR A;  3VOL A;  1F5M A;  3OC2 A;  4Q0H A;  4GS9 A;  4ZBE A;  3ZDJ A;  2EFX A;  5A93 A;  3N8R A;  5FI7 A;  3F1N B;  2JKT I;  3T4S A;  2Q9N A;  2Y8H A;  2IWD A;  2EFU A;  3IBR A;  2A3U A;  3NI9 A;  2C5W B;  5FQK A;  2ZM0 A;  5F83 A;  3MR0 A;  4JF6 A;  5HL1 A;  2K7S A;  3T4T A;  1Q2Q A;  3HUM A;  4KG5 A;  3M2K A;  3N6I A;  3NDE A;  2E8J A;  5DF8 A;  1YLP A;  5I5L A;  5D3O A;  2V1A A;  3V3R A;  2YKF A;  1K56 A;  1Y54 A;  4NEE D;  4RYE A;  2WGW B;  5FI2 A;  3O86 A;  3Q7V A;  3ULF A;  3VFH A;  2VV6 A;  1IFQ A;  1TS8 A;  5HD3 A;  4S2P A;  1IKI A;  3UO9 A;  5M19 A;  3A3D A;  1YM1 A;  4DDS A;  5FEF A;  2PRF A;  5EFW A;  2J7V A;  3DTI A;  4JGQ A;  3MXS A;  3HUO A;  4X56 A;  3T1X A;  2YKH A;  4BJP A;  3DWK A;  5HFO A;  3TOI A;  4UA9 A;  1T18 A;  2WAD A;  3EWK A;  3FPV A;  3G30 A;  2AVX A;  1FR1 A;  5FL3 A;  3RTY A;  4PM9 A;  4BBT A;  5FAT A;  1PZO A;  4KZ4 A;  5F82 A;  4I5S A;  2PBY A;  4JF4 A;  2PU4 A;  3JPU A;  5G4Y A;  4QY5 A;  3OBF A;  1Z09 A;  2G2W A;  3NIA A;  4OQI A;  3LO7 A;  5CHM A;  1P97 A;  4HES A;  1Y28 A;  3WS0 A;  2V9A A;  1KDS A;  3S1Y A;  3C38 A;  4K0X A;  1BLS A;  2QWS A;  4MDZ A;  4QU3 A;  1NJ4 A;  2ZMV A;  3BFG A;  3V67 A;  3UDF A;  3HLE A;  3LFV A;  2KDK A;  4P0M A;  3QP1 A;  4XT2 A;  3UNW A;  1IYS A;  4RA7 A;  5HDD A;  2XK1 A;  1W8Q A;  1S1Y A;  4JGR A;  2VX8 A;  3LYX A;  4CLC C;  3QP8 A;  1SDE A;  1OT6 A;  3FZC A;  3PXP A;  1XXM A;  3BRM A;  1TS6 A;  3HLC A;  5GLC A;  2IA2 A;  3UE1 A;  4EV4 A;  1V9Z A;  3NDG A;  3CUE C;  3CLO A;  4BWI A;  3MXR A;  4UA7 A;  1YLZ A;  5L10 A;  2Y2L A;  2FZ0 A;  4WEL A;  3PYP A;  4CLC A;  4RVA A;  1T1A A;  3NCK A;  5M18 A;  1M40 A;  1XJ2 A;  3CUE A;  5F6A A;  3GSG A;  2XLN A;  1OTI A;  1PIO A;  1TDG A;  3F1P B;  3NOP C;  3G4P A;  1SZV A;  5F5Y A;  3D9Y A;  1KVL A;  2I72 A;  3HLF A;  5E2G A;  3DBA A;  3LIC A;  4KEN B;  2EA9 A;  3IXD A;  2Y2Q A;  2Y2I A;  3MQQ A;  1JVJ A;  3ZVW A;  1L0F A;  1YMX A;  2BLS A;  1YT4 A;  3ZG5 A;  4P87 A;  3BQ8 A;  3LR0 A;  3IH9 A;  1ONG A;  2WKP A;  4PKY A;  5GLD A;  1FIL A;  3LIA A;  2JE5 A;  1YPR A;  3IX8 A;  2WKQ A;  3WWX A;  3B33 A;  1W63 M;  3EEH A;  3IF6 B;  4WBG A;  2JKF A;  2DCF A;  3LIF A;  4KZ6 A;  4F3L B;  3C2W A;  1TDL A;  4L9E A;  2UWX A;  1TS7 A;  1GSX A;  3Q81 A;  4HNB A;  2ZC3 B;  3F1N A;  3FYZ A;  1XFN A;  5KMW A;  4IVI A;  4X25 A;  1OTD A;  4PMA A;  4E04 A;  4HBU A;  2GNX A;  5M1A A;  2J3T C;  5CER A;  1L0G A;  3W4P A;  1BT5 A;  1ACF A;  4BQM A;  4GJ4 A;  3G35 A;  5AVE A;  1SKO B;  1YSQ A;  2I9V A;  1S4S A;  1SHV A;  4E6W A;  3VP0 A;  1F9I A;  1E3U A;  3ZFZ A;  5HPI A;  2WGW A;  2XFT A;  2ZOI A;  4JBF A;  4BEN A;  3C5A A;  4EXO A;  3UPP A;  1H8M A;  2EXA A;  3M6H A;  3T12 B;  3BM6 A;  3E98 A;  4LCM A;  1NLZ A;  4ETX A;  4GW9 A;  1GA9 A;  5CGW A;  4UHU A;  4O01 A;  3NJA A;  4Y7P A;  3D72 A;  2LB5 A;  3SS5 A;  1RGY A;  4MMN A;  2V2F F;  1LL8 A;  4Y0T A;  4R4R A;  4PKY G;  1IEL A;  5DVA A;  2OOL A;  1G28 A;  3GVB A;  4JXV A;  3S7Q A;  1ERQ A;  3LY4 A;  4IHQ A;  3HLB A;  5CGX A;  1S4R A;  1XX2 A;  1P9W A;  4Y0U A;  3WS1 A;  4X69 A;  4DE1 A;  1YKD A;  2JKR M;  3MXQ A;  2HP9 A;  2L4R A;  4HHD A;  4R3J A;  1VEU A;  1ALQ A;  1H5X A;  1Y4O A;  4B4X A;  3I7J A;  5HD5 A;  1ES5 A;  1S6R A;  1XGI A;  4H8R A;  3BFD A;  4MBF A;  1LLB A;  1GHP A;  3IH8 A;  4LPZ A;  4E3J A;  1CJF A;  1G68 A;  1K57 C;  3A3F A;  4IUK A;  3TSG A;  1OT9 A;  2VKS A;  3IX4 A;  1MC0 A;  4KQQ A;  5G18 A;  3FG8 A;  3CG5 A;  3B42 A;  1XGJ A;  3SZT A;  5J8X A;  5J7E A;  4PPR A;  1K6S A;  1S66 L;  1NRF A;  1PW1 A;  2XQZ A;  5TFQ A;  3PAG A;  2V1Z A;  1AXB A;  2Y2H A;  3GRJ A;  3UMD A;  4NXG A;  1BTL A;  2P7J A;  5AVF A;  2OSU A;  5HDS A;  1K57 A;  2B18 A;  5FQJ A;  4JKT A;  5F69 A;  4L9F A;  5KZH A;  3S7O A;  5HX9 A;  4WMC A;  1K0K A;  3CMZ A;  2W3H A;  3UE6 A;  4FH4 A;  3K3C A;  1FCO A;  1JWP A;  4U0T A;  2EX8 A;  1UGU A;  4A5R A;  2G2U A;  3BQA A;  2Z6C A;  4N1H A;  1Q2P A;  2O9B A;  3ITB A;  4L0L A;  3MKF A;  5GLB A;  3H9W A;  2VLG A;  3ZNY A;  3EEA A;  2V0W A;  1EWZ A;  3PBR A;  4I39 A;  3VE3 A;  1RP5 A;  1YAX A;  4GDN A;  1DJB A;  5LBR A;  1KE0 A;  2CMN A;  1XPB A;  4GLQ A;  3BYD A;  1AWI A;  3OCN A;  4Y17 A;  3LGO A;  1LT0 A;  3CPT B;  3BY9 A;  4I3A A;  4JXW A;  5DF9 A;  2X71 A;  4KG2 A;  2ZL1 B;  3UPO A;  4N92 A;  4Y15 A;  5E43 A;  3IF6 C;  1F98 A;  2DRW A;  5GHY A;  2M7U A;  1W63 Q;  4K08 A;  3V3S A;  4GNU A;  5DTT A;  4QWO A;  3Q1F A;  5EPH A;  4MLL A;  1YMS A;  1NY0 A;  2EX9 A;  1NYM A;  3HRE A;  4EBL A;  2RL3 A;  4P6B A;  3QHY A;  4LRX C;  3P01 A;  3BEC A;  3L7H A;  4DE0 A;  1CI9 A;  4BL2 A;  4BD1 A;  3IF6 A;  3WRZ A;  4ZDX A;  3IWQ A;  4K91 A;  5TBM B;  2Y2K A;  5IS1 A;  4R23 A;  4WEK A;  1JTD A;  2JHE A;  4OQH A;  3VFF A;  1P9R A;  4F3L A;  2ZQD A;  5EEC A;  5IU1 A;  3GV9 A;  5TJJ A;  3RFB A;  1K56 D;  2ZQ9 A;  4F94 A;  3HCY A;  5L09 A;  1OPX A;  2J8Y A;  2QYB A;  4NXB A;  5KSH A;  2R78 A;  4H6J B;  2G7U A;  3FPW A;  1MWU A;  2WKH A;  5CEB A;  4WUJ A;  2L1M A;  4BMW A;  2WGV A;  3NOU C;  4QD4 A;  1PWC A;  1SKO A;  3ISG A;  1LL5 A;  3UPN A;  1L2S A;  2H5S A;  3HL9 A;  3B47 A;  4CJN A;  5EVE A;  3S7N A;  5HWW A;  1HTZ A;  2EX6 A;  1ONH A;  2M1C A;  5F1G A;  3KO6 A;  2MJ6 A;  1CEF A;  3ZG9 B;  4R4S A;  4WYY A;  4C3Q A;  5FAP A;  4PM8 A;  2XD5 A;  4EUZ A;  4MN6 A;  1BLH A;  3B3X A;  2GJ3 A;  2W1T B;  4OOY A;  2Y2O A;  3EGD C;  3PAE A;  3VP1 A;  4FUW A;  5A92 A;  4C75 A;  2JN7 A;  4LLO B;  2Y91 A;  4FH2 A;  5TR7 A;  5KIZ A;  5EE8 A;  3Q07 A;  2P08 A;  1D06 A;  1S0W A;  1ZKJ A;  5K5B A;  4EW7 A;  1FSY A;  3K3D A;  5FQI A;  5F1F A;  2ZQ8 A;  3UME A;  3MKE A;  1G6A A;  4ARZ B;  3D4F A;  3H82 A;  2VJW A;  3UB6 A;  1XKZ A;  3GR2 A;  1KGE A;  5HAP A;  4E3O A;  3G2Z A;  4WLA A;  2Y79 A;  4DXC A;  3QNC A;  1KVM A;  4GB7 A;  2Q9M A;  1ESI A;  2HJ9 C;  1T1C A;  2HDQ A;  3BFE A;  3C4O A;  1HVB A;  3GTC A; 
#chains in the Genus database with same CATH homology
 3BQ8 A;  3RH8 B;  3P7N A;  4YOF A;  5HPF A;  3ICY A;  2B02 A;  3LR0 A;  4I3I A;  4EUV A;  2WKP A;  4DJ2 A;  4PKY A;  1IOU A;  1VB6 A;  2HF6 A;  2PD7 A;  3LIA A;  2Z6D A;  2VZW A;  4Y3I A;  2WKQ A;  3B33 A;  1W63 M;  3EEH A;  4NXE A;  4O0P A;  1NLY A;  2EWV A;  2VEA A;  1LSW A;  3NHQ A;  3KYZ A;  4HOI A;  3LIF A;  4F3L B;  3KSG A;  4HJ6 A;  3C2W A;  2W3G A;  4L9E A;  1DP6 A;  3BY8 A;  4HQA A;  1JNU A;  3TJZ C;  3TRC A;  1TS7 A;  4WEJ A;  1GSX A;  4I3J A;  2QHK A;  1STZ A;  2A2L A;  4CLC D;  2PYR A;  3UE3 A;  4HJ4 A;  4HNB A;  3MF0 A;  3ZYT A;  3PBT A;  3F1N A;  4Z1W A;  1XFN A;  2W27 A;  2O9A A;  1OTA A;  4R70 A;  1OTD A;  4R38 A;  4E04 A;  1NWZ A;  2GNX A;  2J3T C;  4ME4 A;  3LIE A;  3OLO A;  1YSP A;  3KSH A;  4GJ4 A;  2OWJ A;  5AVE A;  2PT7 A;  2NUP C;  3T4O A;  2PR6 A;  5IT5 A;  1YSQ A;  2I9V A;  4UEY A;  1S4S A;  5CX7 A;  3EOI A;  3JVU A;  1TS0 A;  2GZA A;  1F9I A;  3S7P A;  5HPI A;  2PHY A;  5AJG A;  2KX6 A;  2P04 A;  1N9O A;  4Y2F A;  4YNR A;  2ZOI A;  4EXO A;  1TF1 A;  1H8M A;  2BAS A;  2QJ7 A;  2A24 A;  2HV1 A;  3T50 A;  1ODV A;  3E98 A;  4IUH A;  3H7W B;  3UB7 A;  1NLZ A;  1BYW A;  4GW9 A;  4ETX A;  4KQD A;  4BBV A;  2QJ5 A;  2ZBB A;  2HJE A;  2O9C A;  4IJG A;  4CLC E;  2A24 B;  1G6O A;  3E4P A;  1XJ4 A;  2INW A;  3EQV A;  3KYQ A;  4O01 A;  3T4K A;  3E0Y A;  2WKR A;  3CAX A;  3NJA A;  3D72 A;  1EW0 A;  2LB5 A;  3GDI A;  4M4X A;  4MMN A;  4CQH A;  3LIB A;  5J3W A;  1S1Z A;  1LL8 A;  2HGV A;  4PAU A;  3K2N A;  3LID A;  4FOF A;  4PKY G;  2XSS A;  4I38 A;  4MN7 A;  4LRY C;  3SW1 A;  4OOL A;  2OOL A;  2JKR I;  1G28 A;  4NKP A;  3EQU A;  2NUT C;  2V1B A;  4UQI S;  2VV8 A;  3BJN A;  4P6Z S;  3S7Q A;  1XJ3 A;  3T4Q A;  2D02 A;  5F68 A;  3PBN A;  3TE8 A;  4IHQ A;  4HY8 A;  1DP8 A;  1S4R A;  2QKP A;  1P9W A;  4II7 A;  5DFY A;  2ZMF A;  4JGP A;  1YKD A;  2JKR M;  3MXQ A;  2L4R A;  4HHD A;  4WN5 A;  4PHT A;  4DJ3 A;  5L8M A;  4B9O A;  1OTE A;  5HD5 A;  3KSF A;  1LSV A;  2W0N A;  3PR6 A;  4LPZ A;  3KX0 X;  1VHM A;  1UWN X;  1XFQ A;  3OCL A;  3U2A A;  4IUK A;  4HP4 A;  2M7V A;  3A0V A;  3IS2 A;  4RQ9 A;  1OT9 A;  4EER A;  3OOV A;  1OTB A;  4EQ1 A;  3LR4 A;  3CWF A;  2VKS A;  1MC0 A;  3FG8 A;  2J3T D;  3PHY A;  4MCW A;  3VV4 A;  3B42 A;  5J7E A;  1V9Y A;  4HH3 A;  1S66 L;  2XRO A;  4H6J A;  4KUO A;  4WF0 A;  2D01 A;  3VOL A;  1F5M A;  3OC2 A;  2K2N A;  4NXG A;  5HWT A;  1ZHH B;  3UMD A;  2P7J A;  4UQI M;  1MZU A;  2K31 A;  4P6Z M;  5HL6 A;  5C5K A;  2XRN A;  4Q0H A;  4GS9 A;  5AVF A;  5HDS A;  4Y5F A;  2B18 A;  1XJ6 A;  4WL9 A;  3F1N B;  2JKT I;  3T4L A;  2KOI A;  5F69 A;  4L9F A;  3T4S A;  1N9L A;  2Y8H A;  3FC7 A;  3D3O A;  3S7O A;  3UB8 A;  3IBR A;  3LI9 A;  4GCZ A;  5A8B A;  3O5Y A;  2W3H A;  3MR0 A;  3UE6 A;  1D7E A;  2K7S A;  3C30 A;  3T4T A;  3K3C A;  1MKM A;  5DJT A;  2JKT M;  3HJI A;  4GHI A;  2W1T A;  5I5L A;  1UGU A;  3JVV A;  4KUK A;  2V1A A;  2OAQ 1;  3F1O A;  1T1B A;  2Z6C A;  3BQA A;  3MMH A;  4O8G A;  2YKF A;  4NEE D;  2O9B A;  3ULF A;  4L0L A;  3G6O A;  5HDC A;  2VV6 A;  4ETZ A;  3E4Q A;  3C8C A;  3H9W A;  1IFQ A;  1OJG A;  3PBO A;  2VLG A;  3R7W A;  3EEA A;  1TS8 A;  1DRM A;  1LSX A;  2V0W A;  4LRZ E;  3PBR A;  5HD3 A;  2O0Y A;  2VV7 A;  4I39 A;  3VE3 A;  1YAX A;  4L9G A;  5LBR A;  5HZH A;  2CMN A;  5MC7 A;  4G3K A;  4GLQ A;  1UWP X;  3OCN A;  5EFW A;  1LT0 A;  4JGQ A;  3BY9 A;  4I3A A;  3MQ0 A;  5DF9 A;  2YKH A;  4BJP A;  5J4E A;  3A0S A;  4R6L A;  2W3F A;  4G3W A;  3NOT C;  5HWV A;  4HJ3 A;  4BBU A;  1F98 A;  1T19 A;  4YWZ A;  2M7U A;  1W63 Q;  1T18 A;  4K08 A;  3EWK A;  5DKK A;  4G3V A;  3FPV A;  1GSW A;  2DMW A;  5FL3 A;  3RTY A;  4BBT A;  3W2Z A;  4B93 A;  2W1R A;  5DFX A;  4I5S A;  1TD5 A;  2GX5 A;  5TBM A;  1NRJ A;  2V0U A;  4Q0I A;  5DKL A;  5G4Y A;  4LRX C;  3P01 A;  4HH2 A;  3VE4 A;  3OBF A;  3LR5 A;  2PDR A;  3IBJ A;  5TBM B;  2OWH A;  1P97 A;  5IS1 A;  1OJ5 A;  1Y28 A;  2VGL S;  4WEK A;  2JHE A;  1GSV A;  2V9A A;  4AFI A;  1P9R A;  4F3L A;  3PBS A;  3C38 A;  3E4O A;  5IU1 A;  3A0R A;  2QWS A;  4MDZ A;  2VA0 A;  2ZMV A;  5TJJ A;  3V67 A;  3IS2 B;  4ZRR A;  3RFB A;  4EES A;  3LFV A;  2KDK A;  3HCY A;  2KLI A;  3R4K A;  3LUQ A;  3BW6 A;  1OPX A;  2QYB A;  4FSF A;  4NXB A;  3PBQ A;  4XT2 A;  2R78 A;  5KSH A;  3T4J A;  4OOM A;  4H6J B;  2G7U A;  2LB9 A;  1DP9 A;  3FPW A;  5HDD A;  4MN5 A;  3ZQ5 A;  3EGX C;  2L0W A;  4WUJ A;  2L1M A;  1S1Y A;  4JGO A;  4GS9 B;  4XT2 B;  4BMW A;  5G4Z A;  3NOU C;  3KSI A;  1N9N A;  2XA7 S;  4JGR A;  3B47 A;  2VX8 A;  3LYX A;  3S7N A;  5HWW A;  4EEP A;  4CLC C;  3BWL A;  3UB9 A;  4HI4 A;  1OT6 A;  3MQO A;  3PXP A;  2M1C A;  1TS6 A;  4QPR A;  4DMZ A;  2IA2 A;  3KO6 A;  3LR3 A;  2MJ6 A;  1H3Q A;  4HIA A;  1V9Z A;  3CUE C;  3CLO A;  4BWI A;  2PD8 A;  2VGL M;  2ZOH A;  2EWW A;  4GHI B;  2PYP A;  4MN6 A;  1WA9 A;  2OAP 1;  3H7W A;  2GJ3 A;  2W1T B;  2FZ0 A;  4WEL A;  3EGD C;  3F1O B;  3LI8 A;  3PYP A;  4Q0J A;  1KOU A;  4CLC A;  3HJK A;  2PR5 A;  2JN7 A;  4LLO B;  1T1A A;  5KIZ A;  2J80 A;  4NXF A;  5DJU A;  2J3W A;  1S67 L;  3MJQ A;  3F1P A;  4EEU A;  2P08 A;  4ARZ A;  1D06 A;  1XJ2 A;  5HSQ A;  2H28 A;  5K5B A;  3R7W B;  4EW7 A;  3K3D A;  3CUE A;  4CLC B;  3MFX A;  3CIT A;  5F6A A;  4R3A A;  1OTI A;  3UME A;  3GEC A;  1ZTU A;  3F1P B;  1P0Z A;  4DN0 A;  3NOP C;  4ARZ B;  2XA7 M;  2FH5 A;  3H82 A;  5F5Y A;  2VJW A;  3UB6 A;  4HP9 A;  2W3E A;  3DBA A;  3LIC A;  4KQO A;  4WLA A;  2Y79 A;  3CI6 A;  2EA9 A;  2W3D A;  3MQQ A;  1X0O A;  2HJ9 C;  3H82 B;  1T1C A;  2O99 A;  4EU0 A;  4EET B;  3TW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...