4EQ1A

Crystal structure of the arnt pas-b homodimer
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
109
structure length
109
Chain Sequence
GVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aryl hydrocarbon receptor nuclear translocator
publication title Regulating the ARNT/TACC3 Axis: Multiple Approaches to Manipulating Protein/Protein Interactions with Small Molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 32
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4eq1A01
5G4YA 1NWZA 3F1OB 3LICA 4HP9A 2PYRA 4L9EA 3MFXA 4GHIA 4R6LA 1DP6A 2D02A 2OWJA 5HDCA 1DP8A 5AVEA 5I5LA 3GECA 4HOIA 1P97A 1V9YA 5DKLA 4GW9A 2W27A 3C8CA 2VLGA 3K3DA 3HJKA 4I3AA 3UB9A 1X0OA 2L1MA 4HY8A 1GSXA 5F68A 2YKFA 5HWWA 3RTYA 3KX0X 1EW0A 3BY8A 2PHYA 3LI8A 1S1YA 4XT2A 3UB6A 1DRMA 4DJ3A 1T1AA 4HQAA 1ODVA 2A24B 3G6OA 1OJGA 4R70A 1T1BA 2H28A 3ICYA 1D7EA 3E4OA 4YWZA 2ZOHA 2P7JA 3F1NB 4HH2A 4GS9A 2I9VA 2QWSA 4HHDA 3A0SA 3FG8A 1TS0A 3CWFA 1TS6A 2W0NA 4NXBA 4KQDA 4JGOA 1XFQA 4R38A 1GSWA 3A0RA 4HJ3A 5HDSA 4JGRA 4WLAA 3EEHA 3F1PB 5TBMB 1OT9A 3SW1A 2QJ7A 3IS2A 5J3WA 1LSVA 4NXFA 1S66L 2V0UA 3CAXA 2L0WA 1OTAA 5F5YA 2EA9A 1TS8A 4F3LB 2QKPA 2VV8A 4B9OA 2PD8A 1S1ZA 2QHKA 5HZHA 4DJ2A 3H82B 2JN7A 4JGPA 4PKYA 4BBTA 4L9GA 4H6JB 3MXQA 5HWTA 2K7SA 1XFNA 4WL9A 5F69A 2V1BA 3MQQA 4I38A 2L4RA 1OTDA 2VEAA 4NXGA 1OTIA 5A8BA 4BBUA 3NJAA 1S4SA 4WUJA 5DJUA 1XJ3A 1KOUA 3FC7A 4HI4A 3PYPA 3PHYA 2QJ5A 4NXEA 1XJ2A 3LUQA 4I3JA 2WKRA 3H7WA 4HH3A 4EQ1A 1N9NA 4I5SA 2INWA 3UE6A 3NOUC 3UMDA 2ZOIA 4BBVA 4JGQA 3B33A 2KX6A 5HD5A 3A0VA 4EW7A 4HP4A 4M4XA 1T1CA 4WF0A 1LT0A 3H9WA 3T50A 3NOTC 3BWLA 3UMEA 3LIEA 5HD3A 2HV1A 4EERA 4KUOA 3F1PA 4PKYG 1S67L 5DKKA 3C2WA 4I39A 3LI9A 3F1OA 2Z6DA 4HIAA 4MN5A 2V9AA 3MR0A 1MZUA 3E4PA 1LSXA 3UB8A 4EEUA 3ULFA 2KDKA 1S4RA 4GS9B 2D01A 4HJ6A 3H82A 2M1CA 3EWKA 1G28A 2PR5A 5DJTA 1F9IA 4LRXC 3OLOA 4LRYC 2YKHA 2B02A 5AVFA 1UGUA 5IS1A 1OJ5A 1LSWA 2J80A 3LIFA 3MQOA 1N9OA 2JHEA 3IS2B 1F98A 4I3IA 4EXOA 2Z6CA 1Y28A 5G4ZA 3NOPC 5J7EA 3UB7A 3ZQ5A 5F6AA 2PYPA 4LPZA 4WN5A 2ZBBA 4L9FA 4GHIB 3MJQA 1T18A 2CMNA 3LIAA 1XJ4A 2A24A 3K3CA 1V9ZA 5HSQA 2PDRA 5HDDA 3P7NA 3RH8B 4HNBA 1VB6A 4GCZA 4RQ9A 2OWHA 3LIDA 4KUKA 5EFWA 3F1NA 4EESA 4E04A 2OOLA 3LYXA 5HWVA 4EETB 1LL8A 4R3AA 3LIBA 5KIZA 4MN6A 2PD7A 2VV7A 2V0WA 4XT2B 3CLOA 1N9LA 3VE3A 5J4EA 2R78A 1DP9A 1T19A 3H7WB 4HJ4A 1OTEA 5IU1A 5TBMA 1TS7A 3BY9A 3IBRA 1UWPX 2GJ3A 1JNUA 4LLOB 1BYWA 2WKPA 4K08A 4F3LA 1UWNX 3GDIA 1OTBA 1WA9A 4EEPA 3VE4A 1XJ6A 1OT6A 3HJIA 3E4QA 2V1AA 1D06A 2VV6A 2BASA 3NHQA 4H6JA 2PR6A 3VOLA 1GSVA 3D72A 4LRZE 2WKQA 1P0ZA
chains in the Genus database with same CATH superfamily
1NWZA 2Y2GA 2XK1A 2ZL1B 4Y0TA 4WELA 4FH4A 4L9EA 1ESIA 4YFMA 1H0MA 2D02A 5AVEA 3QP6A 2EXAA 1S6RA 3ITBA 5I5LA 2I72A 4AFIA 2PU4A 4KQRA 3WS1A 1MWUA 1K54C 3PAEA 4GD8A 1KGGA 1V9YA 2LB5A 3Q7VA 1I5QA 4Y3IA 5CEDA 3C8CA 4JXSA 3K3DA 5E2GA 3UB9A 2L1MA 4PMAA 3G2YA 1GSXA 4QWOA 2NUTC 1NZOA 1H8ZA 3Q82A 2P9VA 2JCHA 1CI8A 4P6BA 2PHYA 3LI8A 4XT2A 4DDSA 3PBRA 5M1AA 4HQAA 1ODVA 2V8FA 2W1RA 2Y55A 1G5UA 1ZG6A 4PHTA 5FA7A 4S2PA 4PM8A 5CEBA 3V3RA 3KO6A 4BQMA 5J8XA 5FDHA 1J3WA 3HLCA 5A92A 3LGOA 1PW1A 1YLWA 2WAEA 3V3SA 1XXMA 4QPRA 2O99A 3ZYTA 2ZC7A 3ZVTA 2W0NA 4NXBA 2X01A 2Y59A 3OC2A 4OH0A 1SDNA 4Z9QA 3ZVWA 1OMEA 3SH9A 1XFQA 5CGWA 1K56A 3A0RA 2Y2KA 4FUWA 3MF0A 3V39A 4JXWA 4MNRA 2W3EA 3CAXA 4OP8A 3C4OA 1OTAA 2QKPA 3G31A 5CRFA 3WS2A 3OOVA 2PD8A 2QHKA 3P01A 1E3UD 4OVDA 1JVJA 3VOZA 5L09A 3E2LA 2Y2HA 1W5DA 3HL9A 4OOYA 4BBTA 5AQBA 4LGWA 4H6JB 2CC1A 2J3TD 3R7WA 3MZFA 4IBXA 3C7UA 3BFCA 2V1ZA 4PM5A 5A8BA 5CGSA 4RA7A 1IKGA 2UWXA 2X71A 4CLCC 5FI6A 1K55A 2FZ0A 3UE0A 3JVUA 3G35A 1KOUA 3FC7A 2Y4AA 3C7VA 1H3QA 5DF7A 4HI4A 3PYPA 2PRFA 1XKZA 2W3GA 4P87A 1MWSA 1XA7A 5LBRA 2ZQAA 1N9NA 3WS0A 2INWA 5AQ7A 3UMDA 5GHZA 1ZHHB 3A0VA 1J9MA 4S2OA 2EX2A 5TJJA 3UE1A 4WF0A 2DCFA 2JKGA 3NOTC 1ES4A 3UNWA 3MS6A 3VP0A 2JKRI 2OAQ1 1NJ4A 3NY4A 3B42A 1XX2A 2P08A 3IF6A 2X02A 4RX3A 2HV1A 1XP4A 4KG6A 4R23A 3F1PA 5M18A 4EQIA 2Q9NA 3OPPA 2XROA 1PI4A 3LI9A 1K0KA 4HIAA 2VJWA 4MBHA 2BTFP 1BZAA 4PM7A 1MKIA 3HBRA 5DFYA 4XUZA 2KDKA 4GS9B 4KZ5A 4MLLA 4B88A 4JF5A 4K0WA 3SH7A 1JTDA 2M1CA 4Y0OA 3LR5A 1LL5A 5U47A 4OP5A 1G28A 1KDSA 5DJTA 4GKUA 2GDNA 1ZC2A 3IF6C 2WK0A 2XFTA 4IBRA 1KDWA 2V20A 4GDNA 4Y15A 2YKHA 4FH2A 4PM6A 2AVXA 2DRWA 2BG1A 3MMHA 4IUHA 1N9OA 2O9AA 4E6XA 1P9RA 4I3IA 4KZ9A 3Q7ZA 2HF6A 1Y28A 4OPQA 4X25A 3W4OA 4GJ4A 1KVLA 3HUNA 1SKOA 1TF1A 2PYPA 4S2NA 3SZTA 2ZBBA 3IXDA 4JF4A 1IOUA 2FH5A 2ZM0A 2CMNA 3HCYA 3LIAA 1XJ4A 2ZMFA 1AXBA 5HSQA 2PDRA 3GQZA 3JYIA 4O8GA 5EPHA 4HNBA 4X1LA 1VB6A 1L0GA 3ZG7B 3EGDC 4DE2A 4RQ9A 5HPFA 1LHYA 3F1NA 5GHYA 4LV0A 4O7DA 4IVKA 3CPTB 3T4JA 2VGLS 4WBGA 5AQAA 5KIZA 2PD7A 2VGLM 3O88A 2WKIA 2O9BA 2M7VA 4S2NC 2VV7A 2V0WA 4Y7PA 5L8MA 3V67A 3IWQA 3RXXA 3VE3A 5J4EA 3T12B 2WYXA 1DP9A 4H8RA 2LB9A 3N8LA 5FQMA 5EVIC 5TBMA 4KQOA 2HP9A 2EXBA 3HREA 5HFOA 2JBFA 3IXBA 1RGYA 2GJ3A 1JNUA 1HD8A 1XGJA 3KSFA 1E25A 5F83A 3VP1A 4E3NA 4B93A 2J8YA 3P98A 5FQKA 3UO9A 1UWNX 2WAFA 1OTBA 1QMEA 4OQHA 1D1JA 4DMZA 4EEPA 2HZ5A 4KG2A 1XJ6A 3FZCA 5KZHA 2WGIA 2ZM8A 3HJIA 1YSPA 4X53A 2KLIA 1D06A 3VFFA 4R0QA 4LV3A 5E2HA 2VV6A 2BASA 3BJNA 3VOLA 3GVBA 4IHQA 5GL9A 3MKEA 4GDBA 2W1TB 1S0WA 5EOEA 2J7VA 3T4LA 3A3JA 3A3FA 3UPOA 2PYRA 2Y2OA 4GHIA 2PT7A 1L0DA 3BQAA 1DP8A 5TGFA 4HBUA 1XA1A 3N8RA 3GECA 2C6WB 4KZ7A 1BT5A 1P97A 4XXRA 5DKLA 2W27A 3UPNA 1PIOA 1RGZA 3MKFA 3HJKA 2OLVA 3ZNTA 4PAUA 4XUXA 4BENA 2A49A 5F68A 3V50A 3EQVA 4QB8A 2H10A 4O01A 1EW0A 1W7FA 4N92A 3BY8A 3BRMA 1BUEA 3R4KA 1GHPA 1S1YA 3Q81A 3JPUA 3T4TA 2Y2JA 3W4PA 4KZBA 4K0XA 1LI9A 2Y2IA 4LV1A 5JYOA 1NXYA 4KZ4A 1IEMA 3UDFA 3VP2A 2OLUA 3BEBA 3UDXA 3ICYA 1VEUB 1FCNA 3E4OA 3LR3A 2H0YA 2ZOHA 4D60A 3VV4A 1MY8A 5GLAA 4F94A 3A0SA 3IHAA 1TS0A 3FG8A 3CWFA 3HUMA 1JWPA 5EM0A 4Q0IA 5K5BA 1HTZA 2HPBA 2XD5A 3UPPA 3ISGA 4LCMA 2W3HA 1GSWA 4HJ3A 4WLAA 3EEHA 3ZCZA 2A3UA 2BLSA 1LSVA 1NY0A 1YM1A 4OOMA 3K2NA 4CQHA 2QPNA 4JXVA 3ZG9B 2V0UA 1DJCA 2L0WA 5HL6A 1TS8A 3CMZA 4F3LB 3T4SA 4Z1WA 3CHWP 5HZHA 4OPRA 4KZ8A 3LY4A 1VQQA 2EX6A 4JF6A 3IH9A 1C3BA 3MXQA 4ZDXA 1XFNA 1GCEA 5F69A 3PBNA 1IYPA 2Q9MA 5DF9A 2L4RA 1OTDA 2VEAA 3LCEA 3NJAA 1S4SA 4WUJA 4NK3A 2K31A 2Z2LB 4Y17A 4KQQA 2JKTM 1LLBA 4NXEA 3GRJA 3VFHA 2QYBA 3HLGA 3UE3A 3KYQA 2Y91A 3Q7VB 2EWVA 4YNRA 3DWZA 4ARZB 4P0MA 3IXGA 2KX6A 4EV4A 3S4XA 5HD5A 4ZJ1A 3EOIA 4EW7A 5F1GA 1F5MA 3CG5A 3OCLA 3LR4A 3AGEA 4EBNA 1H8YA 3H9WA 3QP8A 3T50A 4GZBA 2WGWA 1PZOA 4ZRRA 3BWLA 3UMEA 4DF6A 4GOGA 3N8SA 3VMAA 4Y13A 1HZOA 3WRZA 4EERA 2ZC5B 4KUOA 3O5YA 4LCLA 5DTSA 2O9CA 4B4ZA 1QMFA 1YQSA 2VA0A 3F1OA 4P6ZS 2HJ9C 1LI0A 4CLCE 2XLNA 4S2KA 4ID4A 1L0FA 3IX8A 3E4PA 1BLCA 4OLGA 5A91A 5HAQA 2J9PA 3ULFA 4CLCA 3CI6A 3NECA 5FL3A 1KVMA 1CI9A 4RYEA 1MXOA 2ZM2A 3AGDA 2VGKA 1F9IA 4GN2A 2ZQ8A 5L2FA 3BLSA 3O87A 4RX2A 3PBQA 1ZTUA 2JKFA 2NUPC 1UGUA 1ALQA 3OCNA 5IS1A 5FEGA 3MQOA 2JHEA 2IWBA 4E3OA 1F98A 4WMCA 4Q0HA 4EXOA 4QU3A 5E43A 2HP5A 5FDSA 2ZD8A 3TG9A 1N4OA 3NDEA 1K6RA 1GA0A 2XA7S 2A24A 1V9ZA 4X1MA 5EV0A 1KE4A 2XA7M 3P7NA 1K56D 5F82A 5CX7A 2OWHA 3R7WB 5EFWA 1Y4OA 3DTMA 5HL1A 3CUEA 5KSCA 2VGJA 3KSHA 4DDYA 2OOLA 4CLCD 4EETB 4OOLA 4R3AA 1BSGA 1FR6A 3MZDA 3FYZA 2XF3A 3C5AA 3IBJA 1PZPA 3W4QA 3G30A 5HX9A 2UV0E 1IYQA 3BY9A 5EUAA 1ES3A 1NLYA 5HW3A 3GR2A 3C38A 2O0YA 3W2ZA 1Y54A 1W79A 3CUEC 2QZ6A 1Q2PA 2FFFB 1WA9A 1GHIA 1YPRA 3VE4A 1MPLA 3OPHA 1OT6A 3CZDA 3E4QA 2V1AA 1CEFA 2P04A 1SZVA 1K25A 3MSHA 4S2LA 5MC7A 3NHQA 1PYYA 1GSVA 5G18A 3D72A 3SS5A 4LRZE 2WKQA 1STZA 4NETA 2IA2A 1GHMA 5G4YA 2ZC6B 3HLDA 4E3KA 4GB7A 1TD5A 1TVFA 1YLJA 3NC8A 3BW6A 4HP9A 3BECA 2WUQA 1IYOA 1KGEA 1G6OA 3MFXA 3IHBA 4U0TA 2HDRA 1DP6A 2OWJA 5HDCA 5FI2A 3ZDJA 4WYYA 3EEAA 1IYSA 3CITA 2VK3A 2VKSA 4L0LA 1K4FA 3G2ZA 1ACFA 2WKEA 4BLMA 2WGVA 4M3KA 2XQZA 4QY5A 1MWRA 3ZG5A 1H8MA 5TFQA 4OKPA 4EWFA 4R3BA 4I3AA 5EVIA 3HLEA 3CPTA 2YKFA 4DRTA 3KX0X 4MBFA 2OSUA 3FV7A 2Y2NA 5M19A 2ZC3B 3KSGA 4OLDA 3SOIA 2PBYA 2HJEA 3O86A 5KMWA 4S2MA 4DJ3A 3ZNYA 1ERQA 4UA7A 3L9KA 4FD8A 4WEJA 3BLMA 4U0XA 1OJGA 2EFUA 2H28A 4MN7A 5FAPA 2ZQ7A 4FCFA 4CPKA 3F1NB 3T1RA 1FCOA 4OONA 3D3OA 2WZXA 2QWSA 4HHDA 4G3KA 1IFQA 4HBTA 4WZ4A 3RXWA 1H5XA 1TS6A 4KQDA 1K38A 4JGOA 2W1TA 3BM6A 3BYDA 3VP4A 2B18A 5FI7A 4JGRA 5CHMA 5EVID 1SDEA 2EWWA 4DE3A 5TBMB 3QP2A 3SW1A 2QJ7A 4C6YA 3IS2A 2ZQ9A 3DTIA 4X68A 1S66L 1WYBA 3TW8A 2EA9A 5CHJA 1HVBA 3NDGA 1PWDA 1E4DA 1EI5A 1JTGA 1TDGA 5FQQA 3H82B 4UEYA 2XDMA 4BD1A 4ZJ3A 2JN7A 3Q07A 4PKYA 1MC0A 4FSFA 4L9GA 5CTNA 2K7SA 1AWIA 4N9KA 4WL9A 1VETB 4N9LA 3MQQA 5FQIA 2XH9A 1OTIA 4YINA 2WZZA 3MXSA 1MBLA 1XJ3A 2GNXA 3GV9A 4OQGA 5KSHA 3DW0A 3VP3A 4B4XA 2OAP1 4EBLA 4I3JA 2WKRA 3IX4A 3H7WA 4HH3A 3PBTA 4EQ1A 1VHMA 5C5KA 3UE6A 3NOUC 2ZOIA 4BBVA 1FOFA 3UN7A 3B33A 4IUKA 3S1YA 2W3FA 3T1XA 4HP4A 3B47A 4DKIA 5F1FA 4M4XA 4FOFA 4MCWA 3BQ8A 1FCMA 5EVLA 4MEZA 1W63M 2PAVP 5DTKA 4EUVA 5GLDA 2VZWA 4FTXA 4II7A 4R4SA 4KZ3A 3DWKA 3LIEA 4C75A 3HVFA 1VM1A 3BFEA 1FR1A 5EE8A 3QNCA 1BLPA 1ES5A 1N9BA 1S67L 3P09A 3FPVA 5DKKA 5HARA 3PAGA 4I39A 3TOIA 3T1SA 1U60A 3WS5A 3S7QA 4BWIA 2ZL1A 2Z6DA 1IKIA 4MN5A 5GHXA 2V9AA 3OZHA 3DBAA 1MZUA 1YLYA 3FKVA 1L3LA 3L7HA 4S2IA 2J9OA 4X6TA 3O3VA 1LSXA 3UB8A 4EEUA 1FIKA 3HLBA 3NULA 3FPWA 4N1XA 5D3OA 1A0KA 2EX8A 3SS3A 3PR6A 4NKPA 4UAAA 5CECA 1JWVA 2ZQDA 1YLTA 4QHCA 4LRXC 3KSIA 5DVAA 4C3QA 4WZ5A 1ONHA 5FQ9A 1BLSA 5AVFA 1BLHA 3CJMA 2Q0OA 1OJ5A 3S7NA 2J80A 1XPBA 3NBLA 3C4PA 3LO7A 3MQ0A 3ZHHA 1OPXA 2Z6CA 1M40A 1RCJA 1W63Q 4NEED 3W8KA 5J7EA 3G34A 3UB7A 2EX9A 5F6AA 4KENB 4LPZA 2XR0A 2M7UA 2EFXA 3MJQA 3E0YA 2HP6A 4ARZA 2R9WA 1PWGA 1K4EA 4JLFA 3TRCA 4OPYA 4DE0A 3NIAA 1ONGA 3UY6A 1W8QA 4D2OA 2G2WA 3LEQA 4BL2A 3LFVA 4K91A 4UA6A 4KUKA 2JKTI 4WZ5C 2Y2MA 3IT9A 4IJGA 1RP5A 1EWZA 3LIBA 2P74A 4MN6A 1E3UA 2P9VB 5IT5A 4G3WA 3S22A 4XT2B 4ME4A 3G4PA 2PBDP 3T4KA 2XD1A 4HJ4A 4YOFA 5IU1A 1G68A 2ZMVA 1TS7A 4UA9A 1PWCA 3M2KA 2J3WA 5FAOA 2JC7A 1YSQA 2WKPA 4P6ZM 3UB5P 4ETXA 3BFFA 2WGWB 4EUZA 3A3EA 3QP1A 2RL3A 2QMIA 4LV2A 1ZKJA 3UDIA 1K6SA 4WEKA 5EVEA 5EOOA 4H6JA 3WS4A 3PTEA 5CERA 1CK3A 2HDSA 3HUOA 2J3TC 3TJZC 4DE1A 3F1OB 4GLQA 3LICA 4BMWA 2H0TA 3EGXC 2VX8A 4G3VA 4A5RA 1PFLA 2XRNA 5AQ9A 3FKWA 1Z6FA 4ZJ2A 1L2SA 4R6LA 4HEFA 1SCWA 1W8YA 4CLCB 4QY6A 3U4LP 3FWLA 4HOIA 3T1QB 1KE3A 3QHYA 1NRFA 4IVIA 4Q0JA 4ZAMA 1YAXA 2HDUA 5DFXA 4GW9A 4OQIA 2VLGA 1NLZA 1X0OA 3U2AA 4HY8A 3C30A 5CHUA 3A3IA 3LR0A 4BJPA 3QP5A 1HLUP 5HWWA 3RTYA 4LFUA 3S7PA 4RVAA 3PBOA 4E3LA 2B5RA 3UB6A 3HLWA 3WRTA 4Q8IA 1MKMA 4Y0UA 1DRMA 5L07A 1T1AA 2RCXA 2A24B 4EBPA 2A2LA 3G6OA 2JKRM 3LY3A 4IEDA 3E98A 4R70A 1T1BA 2E8IA 4E3MA 3IXHA 5L10A 4MMNA 1EROA 4S2JA 1D7EA 3B3XA 4YWZA 3IH8A 3EQUA 1DJAA 2XGNA 2P7JA 4HH2A 4GS9A 4WMCD 2I9VA 2K2NA 1K55C 2HDQA 3IQAA 1K57A 1BULA 2ZJ9A 1ESUA 5DF8A 1PNEA 2XFSA 5FATA 1SKFA 5EM1A 4E3JA 1ZG4A 2W3DA 4R38A 1Q2QA 3IF6B 3GMWA 2IWDA 3MZEA 5HDSA 1GA9A 3F1PB 4JKTA 5GLBA 5FSRA 3TSGA 1OT9A 5J3WA 1FSWA 3M6BA 4NXFA 4KZ6A 5F5YA 5FAQA 1L0EA 2VV8A 4B9OA 5A90A 2GX5A 4QJGA 1K57C 1S1ZA 5FQJA 4DJ2A 3JVVA 1KGFA 1PI5A 4JGPA 2Y2LA 2Y8HA 3SH8A 5HWTA 1P9WA 4U3TA 2DNSA 1JWZA 2Y79A 2V1BA 5IHVA 4I38A 4NXGA 3I7JA 1O7EA 3BFGA 4BBUA 3DTEA 1YLPA 2Y2QA 5DJUA 3VOYA 5E2EA 4MDZA 2G7UA 1CF0A 3Q1FA 1WE4A 5FEFA 3N6IA 4GNUA 4P85A 3PHYA 1SKOB 2QJ5A 1XJ2A 2ZMAA 3LUQA 2R9XA 3IX3A 4PPRA 4I5SA 4KZAA 1KE0A 5GLCA 4ETZA 5I94A 4R1GA 4X56A 4JGQA 4DXCA 5A93A 5EVIB 1YKDA 3GTCA 4JXGA 3MXRA 5CXWA 1DY6A 4PM9A 3NCKA 2ACGA 4ZBEA 5E2FA 1T1CA 1LT0A 3PXPA 2H5SA 2ZC4B 1M6KA 3IWIA 4ZTKA 4DXBA 5HD3A 4CJNA 2DMWA 1YT4A 3GSGA 3IWOA 2Y2PA 1O07A 4PKYG 2XEPA 3C2WA 3VSKA 4JPMA 3SS4A 1Z09A 3ZGAB 3MR0A 4NG2A 2PU2A 3OPLA 3TE8A 1S4RA 5AJGA 2D01A 3NI9A 4HJ6A 3DAVA 3H82A 2HGVA 4GD6A 1PRQA 4EU0A 3EWKA 1DJBA 2PR5A 4UQIS 2ZQCA 4R4RA 3S7OA 2KOIA 5CGXA 2WADA 1NYYA 1YLZA 4UHUA 3OLOA 4UQIM 1MWTA 1YMXA 2MJ6A 1NRJA 4LRYC 1VETA 4OPZA 5FASA 3ITAA 1FSYA 2B02A 1I2SA 1TDLA 3PBSA 1LSWA 3LIFA 4ESPA 1LL9A 3IS2B 2OV5A 4QD4A 3AGFA 3A3DA 5DTTA 5G4ZA 3LEZA 3NOPC 5JYPA 5HAIA 3ZQ5A 4WN5A 1SHVA 4L9FA 4GHIB 1T18A 3T4QA 1IELA 4X69A 2E8JA 3N4IA 3BFDA 3KYEA 3K3CA 4DN0A 1XGIA 1NZUA 5HDDA 2B95A 3RH8B 3G32A 4O0PA 2V2FF 4WM9A 2G2UA 1VEUA 2C5WB 4E3IA 2IWCA 1ERMA 4GCZA 3LIDA 1G6AA 3ZG0A 2Z2MB 2XSSA 4EESA 4E04A 1PW8A 3LYXA 4R3JA 4X55A 5HWVA 3MBZA 1LL8A 1FILA 3MFDA 2WKHA 5CTMA 2V8CA 4OQ0A 4N1HA 3WWXA 4Y5FA 3D9YA 3RJUA 3CLOA 1N9LA 3DTKA 3QP4A 4Y2FA 2R78A 1T19A 3H7WB 5HAPA 1CEGA 1OTEA 2GZAA 5BOHA 1CQAA 4KG5A 3M6HA 4LENA 3D4FA 3M2JA 4BL3A 3IBRA 3E2KA 1ES2A 3N7WA 1UWPX 3V5MA 3QNBA 4LLOB 2FFYA 3HLFA 1BYWA 1YMSA 3ZG8B 4K08A 4F3LA 4HESA 5TR7A 3GDIA 1CJFA 1K54A 1WYCA 3IF5A 3OPRA 4BD0A 3RFBA 2JE5A 3OBFA 5EECA 1I2WA 3T4OA 4E6WA 1NYMA 1TEMA 4MBKA 1FQGA 3KYZA 4JBFA 3ZFZA 1F2KA 2PR6A 5HPIA 2ZLYA 1BTLA 3VSLA 1P0ZA
chains in the Genus database with same CATH topology
5G4YA 1NWZA 3F1OB 4GLQA 3LICA 4BMWA 1TD5A 3EGXC 3T4LA 2VX8A 4WELA 3BW6A 4HP9A 4G3VA 2PYRA 2XRNA 4L9EA 1G6OA 3MFXA 4GHIA 2PT7A 4R6LA 1DP6A 2D02A 2OWJA 5HDCA 3BQAA 1DP8A 5AVEA 4CLCB 5I5LA 3EEAA 3CITA 4AFIA 3GECA 2VKSA 4L0LA 4HOIA 1P97A 1V9YA 2LB5A 4Q0JA 1YAXA 5DKLA 5DFXA 4GW9A 2W27A 4Y3IA 1H8MA 3C8CA 2VLGA 3K3DA 3HJKA 1NLZA 4I3AA 3UB9A 1X0OA 2L1MA 3U2AA 4HY8A 3C30A 4PAUA 1GSXA 2NUTC 5F68A 3LR0A 2YKFA 4BJPA 5HWWA 3RTYA 3EQVA 3KX0X 4O01A 3S7PA 1EW0A 3PBOA 3BY8A 3R4KA 2PHYA 3LI8A 1S1YA 4XT2A 3UB6A 3KSGA 3T4TA 1MKMA 3PBRA 2HJEA 1DRMA 4DJ3A 1T1AA 4HQAA 1ODVA 2W1RA 2A24B 4WEJA 4PHTA 2A2LA 3G6OA 2JKRM 1OJGA 3E98A 4R70A 1T1BA 2H28A 3ICYA 4MN7A 4MMNA 3KO6A 1D7EA 3E4OA 4YWZA 3EQUA 3LR3A 2ZOHA 2P7JA 3F1NB 4HH2A 3VV4A 4GS9A 2I9VA 2K2NA 4QPRA 2O99A 3D3OA 3ZYTA 2QWSA 4HHDA 3A0SA 3FG8A 1TS0A 4G3KA 1IFQA 3CWFA 1TS6A 2W0NA 4NXBA 4Q0IA 3OC2A 4KQDA 5K5BA 4JGOA 2W3DA 2W1TA 1XFQA 4R38A 2W3HA 1GSWA 2B18A 3A0RA 4HJ3A 5HDSA 4JGRA 4WLAA 3EEHA 3MF0A 3F1PB 2EWWA 5TBMB 1OT9A 3SW1A 2QJ7A 3IS2A 5J3WA 1LSVA 4OOMA 3K2NA 4CQHA 4NXFA 1S66L 2W3EA 2V0UA 3CAXA 2L0WA 3TW8A 1OTAA 5HL6A 5F5YA 2EA9A 1TS8A 4F3LB 2QKPA 2VV8A 4B9OA 3T4SA 2GX5A 3OOVA 4Z1WA 2PD8A 1S1ZA 2QHKA 3P01A 5HZHA 4DJ2A 3JVVA 3H82B 4UEYA 2JN7A 4JGPA 4PKYA 1MC0A 4FSFA 2Y8HA 4BBTA 4L9GA 4H6JB 3MXQA 5HWTA 1P9WA 2J3TD 2K7SA 1XFNA 4WL9A 3R7WA 5F69A 3PBNA 5DF9A 2Y79A 2V1BA 3MQQA 4I38A 2L4RA 1OTDA 2VEAA 4NXGA 1OTIA 5A8BA 4BBUA 3NJAA 1S4SA 4WUJA 5DJUA 1XJ3A 2GNXA 4CLCC 2K31A 4MDZA 2FZ0A 2G7UA 3JVUA 5KSHA 1KOUA 3FC7A 2JKTM 1H3QA 2OAP1 4HI4A 3PYPA 3PHYA 2QJ5A 4NXEA 1XJ2A 2W3GA 3LUQA 2QYBA 4I3JA 2WKRA 3H7WA 5LBRA 4HH3A 3PBTA 4EQ1A 3UE3A 3KYQA 1N9NA 4I5SA 2INWA 1VHMA 5C5KA 4ETZA 3UE6A 2EWVA 4YNRA 3NOUC 4ARZB 3UMDA 2ZOIA 4BBVA 4JGQA 3B33A 1ZHHB 2KX6A 4IUKA 2W3FA 5HD5A 3EOIA 1YKDA 3A0VA 4EW7A 4HP4A 3B47A 1F5MA 4M4XA 3OCLA 1T1CA 4FOFA 4MCWA 5TJJA 3LR4A 4WF0A 3BQ8A 1LT0A 3PXPA 3H9WA 3T50A 3NOTC 1W63M 4ZRRA 3BWLA 3UMEA 4EUVA 2JKRI 2OAQ1 2VZWA 3B42A 4II7A 2P08A 3LIEA 5HD3A 2HV1A 2DMWA 4EERA 4KUOA 3F1PA 4PKYG 1S67L 3O5YA 3FPVA 5DKKA 3C2WA 2XROA 4I39A 2O9CA 3LI9A 2VA0A 3F1OA 3S7QA 4P6ZS 2HJ9C 4BWIA 2Z6DA 4HIAA 4MN5A 4CLCE 2VJWA 2V9AA 3DBAA 3MR0A 1MZUA 3E4PA 3TE8A 1LSXA 3UB8A 5DFYA 4EEUA 3ULFA 2KDKA 1S4RA 4GS9B 5AJGA 4CLCA 3CI6A 2D01A 5FL3A 4HJ6A 3H82A 2HGVA 3FPWA 2M1CA 3LR5A 4EU0A 3EWKA 1G28A 2PR5A 3PR6A 4NKPA 4UQIS 5DJTA 1F9IA 3S7OA 2KOIA 4LRXC 3OLOA 4UQIM 2MJ6A 4LRYC 1NRJA 3KSIA 3PBQA 1ZTUA 2YKHA 2NUPC 2B02A 5AVFA 3PBSA 1UGUA 3OCNA 5IS1A 1OJ5A 3S7NA 3MMHA 1LSWA 2J80A 3LIFA 3MQOA 4IUHA 1N9OA 2JHEA 2O9AA 3IS2B 1F98A 1P9RA 3MQ0A 4I3IA 4Q0HA 4EXOA 2HF6A 1OPXA 1Y28A 2Z6CA 4GJ4A 5G4ZA 1W63Q 4NEED 3NOPC 5J7EA 1TF1A 3UB7A 5F6AA 3ZQ5A 2PYPA 4LPZA 4WN5A 2ZBBA 2M7UA 4L9FA 4GHIB 1IOUA 3MJQA 2FH5A 1T18A 2CMNA 3E0YA 3T4QA 3HCYA 3LIAA 4ARZA 2XA7S 1XJ4A 2A24A 3TRCA 2ZMFA 3K3CA 1V9ZA 4DN0A 5HSQA 2PDRA 2XA7M 5HDDA 3P7NA 4O8GA 3RH8B 4HNBA 4O0PA 3LFVA 1VB6A 5CX7A 3EGDC 4GCZA 4RQ9A 2OWHA 3LIDA 3R7WB 4KUKA 2JKTI 5HPFA 5EFWA 3F1NA 2XSSA 3CUEA 4EESA 4E04A 3KSHA 2OOLA 3LYXA 3T4JA 2VGLS 4CLCD 4EETB 1LL8A 4OOLA 5HWVA 4R3AA 4IJGA 3LIBA 5KIZA 4MN6A 2PD7A 2VGLM 2O9BA 5IT5A 2M7VA 4G3WA 4Y5FA 2VV7A 2V0WA 5L8MA 4XT2B 3V67A 3CLOA 1N9LA 4ME4A 3VE3A 5J4EA 3T4KA 4Y2FA 2R78A 1DP9A 1T19A 3H7WB 4HJ4A 3IBJA 4YOFA 1OTEA 2GZAA 5IU1A 2LB9A 5TBMA 2ZMVA 1TS7A 4KQOA 3BY9A 3IBRA 1UWPX 1NLYA 2GJ3A 1JNUA 2J3WA 4LLOB 3C38A 3KSFA 1BYWA 2O0YA 3W2ZA 1YSQA 2WKPA 4P6ZM 4ETXA 4B93A 3CUEC 4K08A 4F3LA 1UWNX 3GDIA 1OTBA 1WA9A 4DMZA 4EEPA 3VE4A 1XJ6A 1OT6A 3RFBA 3HJIA 1YSPA 3E4QA 2V1AA 2KLIA 1D06A 3OBFA 2P04A 3T4OA 5MC7A 4WEKA 2VV6A 3KYZA 2BASA 3NHQA 4H6JA 3BJNA 2PR6A 3VOLA 1GSVA 3D72A 4LRZE 5HPIA 4IHQA 2WKQA 1STZA 3TJZC 2J3TC 2W1TB 2IA2A 1P0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G4Y A;  1NWZ A;  3F1O B;  3LIC A;  4HP9 A;  2PYR A;  4L9E A;  3MFX A;  4GHI A;  4R6L A;  1DP6 A;  2D02 A;  2OWJ A;  5HDC A;  1DP8 A;  5AVE A;  5I5L A;  3GEC A;  4HOI A;  1P97 A;  1V9Y A;  5DKL A;  4GW9 A;  2W27 A;  3C8C A;  2VLG A;  3K3D A;  3HJK A;  4I3A A;  3UB9 A;  1X0O A;  2L1M A;  4HY8 A;  1GSX A;  5F68 A;  2YKF A;  5HWW A;  3RTY A;  3KX0 X;  1EW0 A;  3BY8 A;  2PHY A;  3LI8 A;  1S1Y A;  4XT2 A;  3UB6 A;  1DRM A;  4DJ3 A;  1T1A A;  4HQA A;  1ODV A;  2A24 B;  3G6O A;  1OJG A;  4R70 A;  1T1B A;  2H28 A;  3ICY A;  1D7E A;  3E4O A;  4YWZ A;  2ZOH A;  2P7J A;  3F1N B;  4HH2 A;  4GS9 A;  2I9V A;  2QWS A;  4HHD A;  3A0S A;  3FG8 A;  1TS0 A;  3CWF A;  1TS6 A;  2W0N A;  4NXB A;  4KQD A;  4JGO A;  1XFQ A;  4R38 A;  1GSW A;  3A0R A;  4HJ3 A;  5HDS A;  4JGR A;  4WLA A;  3EEH A;  3F1P B;  5TBM B;  1OT9 A;  3SW1 A;  2QJ7 A;  3IS2 A;  5J3W A;  1LSV A;  4NXF A;  1S66 L;  2V0U A;  3CAX A;  2L0W A;  1OTA A;  5F5Y A;  2EA9 A;  1TS8 A;  4F3L B;  2QKP A;  2VV8 A;  4B9O A;  2PD8 A;  1S1Z A;  2QHK A;  5HZH A;  4DJ2 A;  3H82 B;  2JN7 A;  4JGP A;  4PKY A;  4BBT A;  4L9G A;  4H6J B;  3MXQ A;  5HWT A;  2K7S A;  1XFN A;  4WL9 A;  5F69 A;  2V1B A;  3MQQ A;  4I38 A;  2L4R A;  1OTD A;  2VEA A;  4NXG A;  1OTI A;  5A8B A;  4BBU A;  3NJA A;  1S4S A;  4WUJ A;  5DJU A;  1XJ3 A;  1KOU A;  3FC7 A;  4HI4 A;  3PYP A;  3PHY A;  2QJ5 A;  4NXE A;  1XJ2 A;  3LUQ A;  4I3J A;  2WKR A;  3H7W A;  4HH3 A;  4EQ1 A;  1N9N A;  4I5S A;  2INW A;  3UE6 A;  3NOU C;  3UMD A;  2ZOI A;  4BBV A;  4JGQ A;  3B33 A;  2KX6 A;  5HD5 A;  3A0V A;  4EW7 A;  4HP4 A;  4M4X A;  1T1C A;  4WF0 A;  1LT0 A;  3H9W A;  3T50 A;  3NOT C;  3BWL A;  3UME A;  3LIE A;  5HD3 A;  2HV1 A;  4EER A;  4KUO A;  3F1P A;  4PKY G;  1S67 L;  5DKK A;  3C2W A;  4I39 A;  3LI9 A;  3F1O A;  2Z6D A;  4HIA A;  4MN5 A;  2V9A A;  3MR0 A;  1MZU A;  3E4P A;  1LSX A;  3UB8 A;  4EEU A;  3ULF A;  2KDK A;  1S4R A;  4GS9 B;  2D01 A;  4HJ6 A;  3H82 A;  2M1C A;  3EWK A;  1G28 A;  2PR5 A;  5DJT A;  1F9I A;  4LRX C;  3OLO A;  4LRY C;  2YKH A;  2B02 A;  5AVF A;  1UGU A;  5IS1 A;  1OJ5 A;  1LSW A;  2J80 A;  3LIF A;  3MQO A;  1N9O A;  2JHE A;  3IS2 B;  1F98 A;  4I3I A;  4EXO A;  2Z6C A;  1Y28 A;  5G4Z A;  3NOP C;  5J7E A;  3UB7 A;  3ZQ5 A;  5F6A A;  2PYP A;  4LPZ A;  4WN5 A;  2ZBB A;  4L9F A;  4GHI B;  3MJQ A;  1T18 A;  2CMN A;  3LIA A;  1XJ4 A;  2A24 A;  3K3C A;  1V9Z A;  5HSQ A;  2PDR A;  5HDD A;  3P7N A;  3RH8 B;  4HNB A;  1VB6 A;  4GCZ A;  4RQ9 A;  2OWH A;  3LID A;  4KUK A;  5EFW A;  3F1N A;  4EES A;  4E04 A;  2OOL A;  3LYX A;  5HWV A;  4EET B;  1LL8 A;  4R3A A;  3LIB A;  5KIZ A;  4MN6 A;  2PD7 A;  2VV7 A;  2V0W A;  4XT2 B;  3CLO A;  1N9L A;  3VE3 A;  5J4E A;  2R78 A;  1DP9 A;  1T19 A;  3H7W B;  4HJ4 A;  1OTE A;  5IU1 A;  5TBM A;  1TS7 A;  3BY9 A;  3IBR A;  1UWP X;  2GJ3 A;  1JNU A;  4LLO B;  1BYW A;  2WKP A;  4K08 A;  4F3L A;  1UWN X;  3GDI A;  1OTB A;  1WA9 A;  4EEP A;  3VE4 A;  1XJ6 A;  1OT6 A;  3HJI A;  3E4Q A;  2V1A A;  1D06 A;  2VV6 A;  2BAS A;  3NHQ A;  4H6J A;  2PR6 A;  3VOL A;  1GSV A;  3D72 A;  4LRZ E;  2WKQ A;  1P0Z A; 
#chains in the Genus database with same CATH topology
 1NWZ A;  2Y2G A;  2XK1 A;  2ZL1 B;  4Y0T A;  4WEL A;  4FH4 A;  4L9E A;  1ESI A;  4YFM A;  1H0M A;  2D02 A;  5AVE A;  3QP6 A;  2EXA A;  1S6R A;  3ITB A;  5I5L A;  2I72 A;  4AFI A;  2PU4 A;  4KQR A;  3WS1 A;  1MWU A;  1K54 C;  3PAE A;  4GD8 A;  1KGG A;  1V9Y A;  2LB5 A;  3Q7V A;  1I5Q A;  4Y3I A;  5CED A;  3C8C A;  4JXS A;  3K3D A;  5E2G A;  3UB9 A;  2L1M A;  4PMA A;  3G2Y A;  1GSX A;  4QWO A;  2NUT C;  1NZO A;  1H8Z A;  3Q82 A;  2P9V A;  2JCH A;  1CI8 A;  4P6B A;  2PHY A;  3LI8 A;  4XT2 A;  4DDS A;  3PBR A;  5M1A A;  4HQA A;  1ODV A;  2V8F A;  2W1R A;  2Y55 A;  1G5U A;  1ZG6 A;  4PHT A;  5FA7 A;  4S2P A;  4PM8 A;  5CEB A;  3V3R A;  3KO6 A;  4BQM A;  5J8X A;  5FDH A;  1J3W A;  3HLC A;  5A92 A;  3LGO A;  1PW1 A;  1YLW A;  2WAE A;  3V3S A;  1XXM A;  4QPR A;  2O99 A;  3ZYT A;  2ZC7 A;  3ZVT A;  2W0N A;  4NXB A;  2X01 A;  2Y59 A;  3OC2 A;  4OH0 A;  1SDN A;  4Z9Q A;  3ZVW A;  1OME A;  3SH9 A;  1XFQ A;  5CGW A;  1K56 A;  3A0R A;  2Y2K A;  4FUW A;  3MF0 A;  3V39 A;  4JXW A;  4MNR A;  2W3E A;  3CAX A;  4OP8 A;  3C4O A;  1OTA A;  2QKP A;  3G31 A;  5CRF A;  3WS2 A;  3OOV A;  2PD8 A;  2QHK A;  3P01 A;  1E3U D;  4OVD A;  1JVJ A;  3VOZ A;  5L09 A;  3E2L A;  2Y2H A;  1W5D A;  3HL9 A;  4OOY A;  4BBT A;  5AQB A;  4LGW A;  4H6J B;  2CC1 A;  2J3T D;  3R7W A;  3MZF A;  4IBX A;  3C7U A;  3BFC A;  2V1Z A;  4PM5 A;  5A8B A;  5CGS A;  4RA7 A;  1IKG A;  2UWX A;  2X71 A;  4CLC C;  5FI6 A;  1K55 A;  2FZ0 A;  3UE0 A;  3JVU A;  3G35 A;  1KOU A;  3FC7 A;  2Y4A A;  3C7V A;  1H3Q A;  5DF7 A;  4HI4 A;  3PYP A;  2PRF A;  1XKZ A;  2W3G A;  4P87 A;  1MWS A;  1XA7 A;  5LBR A;  2ZQA A;  1N9N A;  3WS0 A;  2INW A;  5AQ7 A;  3UMD A;  5GHZ A;  1ZHH B;  3A0V A;  1J9M A;  4S2O A;  2EX2 A;  5TJJ A;  3UE1 A;  4WF0 A;  2DCF A;  2JKG A;  3NOT C;  1ES4 A;  3UNW A;  3MS6 A;  3VP0 A;  2JKR I;  2OAQ 1;  1NJ4 A;  3NY4 A;  3B42 A;  1XX2 A;  2P08 A;  3IF6 A;  2X02 A;  4RX3 A;  2HV1 A;  1XP4 A;  4KG6 A;  4R23 A;  3F1P A;  5M18 A;  4EQI A;  2Q9N A;  3OPP A;  2XRO A;  1PI4 A;  3LI9 A;  1K0K A;  4HIA A;  2VJW A;  4MBH A;  2BTF P;  1BZA A;  4PM7 A;  1MKI A;  3HBR A;  5DFY A;  4XUZ A;  2KDK A;  4GS9 B;  4KZ5 A;  4MLL A;  4B88 A;  4JF5 A;  4K0W A;  3SH7 A;  1JTD A;  2M1C A;  4Y0O A;  3LR5 A;  1LL5 A;  5U47 A;  4OP5 A;  1G28 A;  1KDS A;  5DJT A;  4GKU A;  2GDN A;  1ZC2 A;  3IF6 C;  2WK0 A;  2XFT A;  4IBR A;  1KDW A;  2V20 A;  4GDN A;  4Y15 A;  2YKH A;  4FH2 A;  4PM6 A;  2AVX A;  2DRW A;  2BG1 A;  3MMH A;  4IUH A;  1N9O A;  2O9A A;  4E6X A;  1P9R A;  4I3I A;  4KZ9 A;  3Q7Z A;  2HF6 A;  1Y28 A;  4OPQ A;  4X25 A;  3W4O A;  4GJ4 A;  1KVL A;  3HUN A;  1SKO A;  1TF1 A;  2PYP A;  4S2N A;  3SZT A;  2ZBB A;  3IXD A;  4JF4 A;  1IOU A;  2FH5 A;  2ZM0 A;  2CMN A;  3HCY A;  3LIA A;  1XJ4 A;  2ZMF A;  1AXB A;  5HSQ A;  2PDR A;  3GQZ A;  3JYI A;  4O8G A;  5EPH A;  4HNB A;  4X1L A;  1VB6 A;  1L0G A;  3ZG7 B;  3EGD C;  4DE2 A;  4RQ9 A;  5HPF A;  1LHY A;  3F1N A;  5GHY A;  4LV0 A;  4O7D A;  4IVK A;  3CPT B;  3T4J A;  2VGL S;  4WBG A;  5AQA A;  5KIZ A;  2PD7 A;  2VGL M;  3O88 A;  2WKI A;  2O9B A;  2M7V A;  4S2N C;  2VV7 A;  2V0W A;  4Y7P A;  5L8M A;  3V67 A;  3IWQ A;  3RXX A;  3VE3 A;  5J4E A;  3T12 B;  2WYX A;  1DP9 A;  4H8R A;  2LB9 A;  3N8L A;  5FQM A;  5EVI C;  5TBM A;  4KQO A;  2HP9 A;  2EXB A;  3HRE A;  5HFO A;  2JBF A;  3IXB A;  1RGY A;  2GJ3 A;  1JNU A;  1HD8 A;  1XGJ A;  3KSF A;  1E25 A;  5F83 A;  3VP1 A;  4E3N A;  4B93 A;  2J8Y A;  3P98 A;  5FQK A;  3UO9 A;  1UWN X;  2WAF A;  1OTB A;  1QME A;  4OQH A;  1D1J A;  4DMZ A;  4EEP A;  2HZ5 A;  4KG2 A;  1XJ6 A;  3FZC A;  5KZH A;  2WGI A;  2ZM8 A;  3HJI A;  1YSP A;  4X53 A;  2KLI A;  1D06 A;  3VFF A;  4R0Q A;  4LV3 A;  5E2H A;  2VV6 A;  2BAS A;  3BJN A;  3VOL A;  3GVB A;  4IHQ A;  5GL9 A;  3MKE A;  4GDB A;  2W1T B;  1S0W A;  5EOE A;  2J7V A;  3T4L A;  3A3J A;  3A3F A;  3UPO A;  2PYR A;  2Y2O A;  4GHI A;  2PT7 A;  1L0D A;  3BQA A;  1DP8 A;  5TGF A;  4HBU A;  1XA1 A;  3N8R A;  3GEC A;  2C6W B;  4KZ7 A;  1BT5 A;  1P97 A;  4XXR A;  5DKL A;  2W27 A;  3UPN A;  1PIO A;  1RGZ A;  3MKF A;  3HJK A;  2OLV A;  3ZNT A;  4PAU A;  4XUX A;  4BEN A;  2A49 A;  5F68 A;  3V50 A;  3EQV A;  4QB8 A;  2H10 A;  4O01 A;  1EW0 A;  1W7F A;  4N92 A;  3BY8 A;  3BRM A;  1BUE A;  3R4K A;  1GHP A;  1S1Y A;  3Q81 A;  3JPU A;  3T4T A;  2Y2J A;  3W4P A;  4KZB A;  4K0X A;  1LI9 A;  2Y2I A;  4LV1 A;  5JYO A;  1NXY A;  4KZ4 A;  1IEM A;  3UDF A;  3VP2 A;  2OLU A;  3BEB A;  3UDX A;  3ICY A;  1VEU B;  1FCN A;  3E4O A;  3LR3 A;  2H0Y A;  2ZOH A;  4D60 A;  3VV4 A;  1MY8 A;  5GLA A;  4F94 A;  3A0S A;  3IHA A;  1TS0 A;  3FG8 A;  3CWF A;  3HUM A;  1JWP A;  5EM0 A;  4Q0I A;  5K5B A;  1HTZ A;  2HPB A;  2XD5 A;  3UPP A;  3ISG A;  4LCM A;  2W3H A;  1GSW A;  4HJ3 A;  4WLA A;  3EEH A;  3ZCZ A;  2A3U A;  2BLS A;  1LSV A;  1NY0 A;  1YM1 A;  4OOM A;  3K2N A;  4CQH A;  2QPN A;  4JXV A;  3ZG9 B;  2V0U A;  1DJC A;  2L0W A;  5HL6 A;  1TS8 A;  3CMZ A;  4F3L B;  3T4S A;  4Z1W A;  3CHW P;  5HZH A;  4OPR A;  4KZ8 A;  3LY4 A;  1VQQ A;  2EX6 A;  4JF6 A;  3IH9 A;  1C3B A;  3MXQ A;  4ZDX A;  1XFN A;  1GCE A;  5F69 A;  3PBN A;  1IYP A;  2Q9M A;  5DF9 A;  2L4R A;  1OTD A;  2VEA A;  3LCE A;  3NJA A;  1S4S A;  4WUJ A;  4NK3 A;  2K31 A;  2Z2L B;  4Y17 A;  4KQQ A;  2JKT M;  1LLB A;  4NXE A;  3GRJ A;  3VFH A;  2QYB A;  3HLG A;  3UE3 A;  3KYQ A;  2Y91 A;  3Q7V B;  2EWV A;  4YNR A;  3DWZ A;  4ARZ B;  4P0M A;  3IXG A;  2KX6 A;  4EV4 A;  3S4X A;  5HD5 A;  4ZJ1 A;  3EOI A;  4EW7 A;  5F1G A;  1F5M A;  3CG5 A;  3OCL A;  3LR4 A;  3AGE A;  4EBN A;  1H8Y A;  3H9W A;  3QP8 A;  3T50 A;  4GZB A;  2WGW A;  1PZO A;  4ZRR A;  3BWL A;  3UME A;  4DF6 A;  4GOG A;  3N8S A;  3VMA A;  4Y13 A;  1HZO A;  3WRZ A;  4EER A;  2ZC5 B;  4KUO A;  3O5Y A;  4LCL A;  5DTS A;  2O9C A;  4B4Z A;  1QMF A;  1YQS A;  2VA0 A;  3F1O A;  4P6Z S;  2HJ9 C;  1LI0 A;  4CLC E;  2XLN A;  4S2K A;  4ID4 A;  1L0F A;  3IX8 A;  3E4P A;  1BLC A;  4OLG A;  5A91 A;  5HAQ A;  2J9P A;  3ULF A;  4CLC A;  3CI6 A;  3NEC A;  5FL3 A;  1KVM A;  1CI9 A;  4RYE A;  1MXO A;  2ZM2 A;  3AGD A;  2VGK A;  1F9I A;  4GN2 A;  2ZQ8 A;  5L2F A;  3BLS A;  3O87 A;  4RX2 A;  3PBQ A;  1ZTU A;  2JKF A;  2NUP C;  1UGU A;  1ALQ A;  3OCN A;  5IS1 A;  5FEG A;  3MQO A;  2JHE A;  2IWB A;  4E3O A;  1F98 A;  4WMC A;  4Q0H A;  4EXO A;  4QU3 A;  5E43 A;  2HP5 A;  5FDS A;  2ZD8 A;  3TG9 A;  1N4O A;  3NDE A;  1K6R A;  1GA0 A;  2XA7 S;  2A24 A;  1V9Z A;  4X1M A;  5EV0 A;  1KE4 A;  2XA7 M;  3P7N A;  1K56 D;  5F82 A;  5CX7 A;  2OWH A;  3R7W B;  5EFW A;  1Y4O A;  3DTM A;  5HL1 A;  3CUE A;  5KSC A;  2VGJ A;  3KSH A;  4DDY A;  2OOL A;  4CLC D;  4EET B;  4OOL A;  4R3A A;  1BSG A;  1FR6 A;  3MZD A;  3FYZ A;  2XF3 A;  3C5A A;  3IBJ A;  1PZP A;  3W4Q A;  3G30 A;  5HX9 A;  2UV0 E;  1IYQ A;  3BY9 A;  5EUA A;  1ES3 A;  1NLY A;  5HW3 A;  3GR2 A;  3C38 A;  2O0Y A;  3W2Z A;  1Y54 A;  1W79 A;  3CUE C;  2QZ6 A;  1Q2P A;  2FFF B;  1WA9 A;  1GHI A;  1YPR A;  3VE4 A;  1MPL A;  3OPH A;  1OT6 A;  3CZD A;  3E4Q A;  2V1A A;  1CEF A;  2P04 A;  1SZV A;  1K25 A;  3MSH A;  4S2L A;  5MC7 A;  3NHQ A;  1PYY A;  1GSV A;  5G18 A;  3D72 A;  3SS5 A;  4LRZ E;  2WKQ A;  1STZ A;  4NET A;  2IA2 A;  1GHM A;  5G4Y A;  2ZC6 B;  3HLD A;  4E3K A;  4GB7 A;  1TD5 A;  1TVF A;  1YLJ A;  3NC8 A;  3BW6 A;  4HP9 A;  3BEC A;  2WUQ A;  1IYO A;  1KGE A;  1G6O A;  3MFX A;  3IHB A;  4U0T A;  2HDR A;  1DP6 A;  2OWJ A;  5HDC A;  5FI2 A;  3ZDJ A;  4WYY A;  3EEA A;  1IYS A;  3CIT A;  2VK3 A;  2VKS A;  4L0L A;  1K4F A;  3G2Z A;  1ACF A;  2WKE A;  4BLM A;  2WGV A;  4M3K A;  2XQZ A;  4QY5 A;  1MWR A;  3ZG5 A;  1H8M A;  5TFQ A;  4OKP A;  4EWF A;  4R3B A;  4I3A A;  5EVI A;  3HLE A;  3CPT A;  2YKF A;  4DRT A;  3KX0 X;  4MBF A;  2OSU A;  3FV7 A;  2Y2N A;  5M19 A;  2ZC3 B;  3KSG A;  4OLD A;  3SOI A;  2PBY A;  2HJE A;  3O86 A;  5KMW A;  4S2M A;  4DJ3 A;  3ZNY A;  1ERQ A;  4UA7 A;  3L9K A;  4FD8 A;  4WEJ A;  3BLM A;  4U0X A;  1OJG A;  2EFU A;  2H28 A;  4MN7 A;  5FAP A;  2ZQ7 A;  4FCF A;  4CPK A;  3F1N B;  3T1R A;  1FCO A;  4OON A;  3D3O A;  2WZX A;  2QWS A;  4HHD A;  4G3K A;  1IFQ A;  4HBT A;  4WZ4 A;  3RXW A;  1H5X A;  1TS6 A;  4KQD A;  1K38 A;  4JGO A;  2W1T A;  3BM6 A;  3BYD A;  3VP4 A;  2B18 A;  5FI7 A;  4JGR A;  5CHM A;  5EVI D;  1SDE A;  2EWW A;  4DE3 A;  5TBM B;  3QP2 A;  3SW1 A;  2QJ7 A;  4C6Y A;  3IS2 A;  2ZQ9 A;  3DTI A;  4X68 A;  1S66 L;  1WYB A;  3TW8 A;  2EA9 A;  5CHJ A;  1HVB A;  3NDG A;  1PWD A;  1E4D A;  1EI5 A;  1JTG A;  1TDG A;  5FQQ A;  3H82 B;  4UEY A;  2XDM A;  4BD1 A;  4ZJ3 A;  2JN7 A;  3Q07 A;  4PKY A;  1MC0 A;  4FSF A;  4L9G A;  5CTN A;  2K7S A;  1AWI A;  4N9K A;  4WL9 A;  1VET B;  4N9L A;  3MQQ A;  5FQI A;  2XH9 A;  1OTI A;  4YIN A;  2WZZ A;  3MXS A;  1MBL A;  1XJ3 A;  2GNX A;  3GV9 A;  4OQG A;  5KSH A;  3DW0 A;  3VP3 A;  4B4X A;  2OAP 1;  4EBL A;  4I3J A;  2WKR A;  3IX4 A;  3H7W A;  4HH3 A;  3PBT A;  4EQ1 A;  1VHM A;  5C5K A;  3UE6 A;  3NOU C;  2ZOI A;  4BBV A;  1FOF A;  3UN7 A;  3B33 A;  4IUK A;  3S1Y A;  2W3F A;  3T1X A;  4HP4 A;  3B47 A;  4DKI A;  5F1F A;  4M4X A;  4FOF A;  4MCW A;  3BQ8 A;  1FCM A;  5EVL A;  4MEZ A;  1W63 M;  2PAV P;  5DTK A;  4EUV A;  5GLD A;  2VZW A;  4FTX A;  4II7 A;  4R4S A;  4KZ3 A;  3DWK A;  3LIE A;  4C75 A;  3HVF A;  1VM1 A;  3BFE A;  1FR1 A;  5EE8 A;  3QNC A;  1BLP A;  1ES5 A;  1N9B A;  1S67 L;  3P09 A;  3FPV A;  5DKK A;  5HAR A;  3PAG A;  4I39 A;  3TOI A;  3T1S A;  1U60 A;  3WS5 A;  3S7Q A;  4BWI A;  2ZL1 A;  2Z6D A;  1IKI A;  4MN5 A;  5GHX A;  2V9A A;  3OZH A;  3DBA A;  1MZU A;  1YLY A;  3FKV A;  1L3L A;  3L7H A;  4S2I A;  2J9O A;  4X6T A;  3O3V A;  1LSX A;  3UB8 A;  4EEU A;  1FIK A;  3HLB A;  3NUL A;  3FPW A;  4N1X A;  5D3O A;  1A0K A;  2EX8 A;  3SS3 A;  3PR6 A;  4NKP A;  4UAA A;  5CEC A;  1JWV A;  2ZQD A;  1YLT A;  4QHC A;  4LRX C;  3KSI A;  5DVA A;  4C3Q A;  4WZ5 A;  1ONH A;  5FQ9 A;  1BLS A;  5AVF A;  1BLH A;  3CJM A;  2Q0O A;  1OJ5 A;  3S7N A;  2J80 A;  1XPB A;  3NBL A;  3C4P A;  3LO7 A;  3MQ0 A;  3ZHH A;  1OPX A;  2Z6C A;  1M40 A;  1RCJ A;  1W63 Q;  4NEE D;  3W8K A;  5J7E A;  3G34 A;  3UB7 A;  2EX9 A;  5F6A A;  4KEN B;  4LPZ A;  2XR0 A;  2M7U A;  2EFX A;  3MJQ A;  3E0Y A;  2HP6 A;  4ARZ A;  2R9W A;  1PWG A;  1K4E A;  4JLF A;  3TRC A;  4OPY A;  4DE0 A;  3NIA A;  1ONG A;  3UY6 A;  1W8Q A;  4D2O A;  2G2W A;  3LEQ A;  4BL2 A;  3LFV A;  4K91 A;  4UA6 A;  4KUK A;  2JKT I;  4WZ5 C;  2Y2M A;  3IT9 A;  4IJG A;  1RP5 A;  1EWZ A;  3LIB A;  2P74 A;  4MN6 A;  1E3U A;  2P9V B;  5IT5 A;  4G3W A;  3S22 A;  4XT2 B;  4ME4 A;  3G4P A;  2PBD P;  3T4K A;  2XD1 A;  4HJ4 A;  4YOF A;  5IU1 A;  1G68 A;  2ZMV A;  1TS7 A;  4UA9 A;  1PWC A;  3M2K A;  2J3W A;  5FAO A;  2JC7 A;  1YSQ A;  2WKP A;  4P6Z M;  3UB5 P;  4ETX A;  3BFF A;  2WGW B;  4EUZ A;  3A3E A;  3QP1 A;  2RL3 A;  2QMI A;  4LV2 A;  1ZKJ A;  3UDI A;  1K6S A;  4WEK A;  5EVE A;  5EOO A;  4H6J A;  3WS4 A;  3PTE A;  5CER A;  1CK3 A;  2HDS A;  3HUO A;  2J3T C;  3TJZ C;  4DE1 A;  3F1O B;  4GLQ A;  3LIC A;  4BMW A;  2H0T A;  3EGX C;  2VX8 A;  4G3V A;  4A5R A;  1PFL A;  2XRN A;  5AQ9 A;  3FKW A;  1Z6F A;  4ZJ2 A;  1L2S A;  4R6L A;  4HEF A;  1SCW A;  1W8Y A;  4CLC B;  4QY6 A;  3U4L P;  3FWL A;  4HOI A;  3T1Q B;  1KE3 A;  3QHY A;  1NRF A;  4IVI A;  4Q0J A;  4ZAM A;  1YAX A;  2HDU A;  5DFX A;  4GW9 A;  4OQI A;  2VLG A;  1NLZ A;  1X0O A;  3U2A A;  4HY8 A;  3C30 A;  5CHU A;  3A3I A;  3LR0 A;  4BJP A;  3QP5 A;  1HLU P;  5HWW A;  3RTY A;  4LFU A;  3S7P A;  4RVA A;  3PBO A;  4E3L A;  2B5R A;  3UB6 A;  3HLW A;  3WRT A;  4Q8I A;  1MKM A;  4Y0U A;  1DRM A;  5L07 A;  1T1A A;  2RCX A;  2A24 B;  4EBP A;  2A2L A;  3G6O A;  2JKR M;  3LY3 A;  4IED A;  3E98 A;  4R70 A;  1T1B A;  2E8I A;  4E3M A;  3IXH A;  5L10 A;  4MMN A;  1ERO A;  4S2J A;  1D7E A;  3B3X A;  4YWZ A;  3IH8 A;  3EQU A;  1DJA A;  2XGN A;  2P7J A;  4HH2 A;  4GS9 A;  4WMC D;  2I9V A;  2K2N A;  1K55 C;  2HDQ A;  3IQA A;  1K57 A;  1BUL A;  2ZJ9 A;  1ESU A;  5DF8 A;  1PNE A;  2XFS A;  5FAT A;  1SKF A;  5EM1 A;  4E3J A;  1ZG4 A;  2W3D A;  4R38 A;  1Q2Q A;  3IF6 B;  3GMW A;  2IWD A;  3MZE A;  5HDS A;  1GA9 A;  3F1P B;  4JKT A;  5GLB A;  5FSR A;  3TSG A;  1OT9 A;  5J3W A;  1FSW A;  3M6B A;  4NXF A;  4KZ6 A;  5F5Y A;  5FAQ A;  1L0E A;  2VV8 A;  4B9O A;  5A90 A;  2GX5 A;  4QJG A;  1K57 C;  1S1Z A;  5FQJ A;  4DJ2 A;  3JVV A;  1KGF A;  1PI5 A;  4JGP A;  2Y2L A;  2Y8H A;  3SH8 A;  5HWT A;  1P9W A;  4U3T A;  2DNS A;  1JWZ A;  2Y79 A;  2V1B A;  5IHV A;  4I38 A;  4NXG A;  3I7J A;  1O7E A;  3BFG A;  4BBU A;  3DTE A;  1YLP A;  2Y2Q A;  5DJU A;  3VOY A;  5E2E A;  4MDZ A;  2G7U A;  1CF0 A;  3Q1F A;  1WE4 A;  5FEF A;  3N6I A;  4GNU A;  4P85 A;  3PHY A;  1SKO B;  2QJ5 A;  1XJ2 A;  2ZMA A;  3LUQ A;  2R9X A;  3IX3 A;  4PPR A;  4I5S A;  4KZA A;  1KE0 A;  5GLC A;  4ETZ A;  5I94 A;  4R1G A;  4X56 A;  4JGQ A;  4DXC A;  5A93 A;  5EVI B;  1YKD A;  3GTC A;  4JXG A;  3MXR A;  5CXW A;  1DY6 A;  4PM9 A;  3NCK A;  2ACG A;  4ZBE A;  5E2F A;  1T1C A;  1LT0 A;  3PXP A;  2H5S A;  2ZC4 B;  1M6K A;  3IWI A;  4ZTK A;  4DXB A;  5HD3 A;  4CJN A;  2DMW A;  1YT4 A;  3GSG A;  3IWO A;  2Y2P A;  1O07 A;  4PKY G;  2XEP A;  3C2W A;  3VSK A;  4JPM A;  3SS4 A;  1Z09 A;  3ZGA B;  3MR0 A;  4NG2 A;  2PU2 A;  3OPL A;  3TE8 A;  1S4R A;  5AJG A;  2D01 A;  3NI9 A;  4HJ6 A;  3DAV A;  3H82 A;  2HGV A;  4GD6 A;  1PRQ A;  4EU0 A;  3EWK A;  1DJB A;  2PR5 A;  4UQI S;  2ZQC A;  4R4R A;  3S7O A;  2KOI A;  5CGX A;  2WAD A;  1NYY A;  1YLZ A;  4UHU A;  3OLO A;  4UQI M;  1MWT A;  1YMX A;  2MJ6 A;  1NRJ A;  4LRY C;  1VET A;  4OPZ A;  5FAS A;  3ITA A;  1FSY A;  2B02 A;  1I2S A;  1TDL A;  3PBS A;  1LSW A;  3LIF A;  4ESP A;  1LL9 A;  3IS2 B;  2OV5 A;  4QD4 A;  3AGF A;  3A3D A;  5DTT A;  5G4Z A;  3LEZ A;  3NOP C;  5JYP A;  5HAI A;  3ZQ5 A;  4WN5 A;  1SHV A;  4L9F A;  4GHI B;  1T18 A;  3T4Q A;  1IEL A;  4X69 A;  2E8J A;  3N4I A;  3BFD A;  3KYE A;  3K3C A;  4DN0 A;  1XGI A;  1NZU A;  5HDD A;  2B95 A;  3RH8 B;  3G32 A;  4O0P A;  2V2F F;  4WM9 A;  2G2U A;  1VEU A;  2C5W B;  4E3I A;  2IWC A;  1ERM A;  4GCZ A;  3LID A;  1G6A A;  3ZG0 A;  2Z2M B;  2XSS A;  4EES A;  4E04 A;  1PW8 A;  3LYX A;  4R3J A;  4X55 A;  5HWV A;  3MBZ A;  1LL8 A;  1FIL A;  3MFD A;  2WKH A;  5CTM A;  2V8C A;  4OQ0 A;  4N1H A;  3WWX A;  4Y5F A;  3D9Y A;  3RJU A;  3CLO A;  1N9L A;  3DTK A;  3QP4 A;  4Y2F A;  2R78 A;  1T19 A;  3H7W B;  5HAP A;  1CEG A;  1OTE A;  2GZA A;  5BOH A;  1CQA A;  4KG5 A;  3M6H A;  4LEN A;  3D4F A;  3M2J A;  4BL3 A;  3IBR A;  3E2K A;  1ES2 A;  3N7W A;  1UWP X;  3V5M A;  3QNB A;  4LLO B;  2FFY A;  3HLF A;  1BYW A;  1YMS A;  3ZG8 B;  4K08 A;  4F3L A;  4HES A;  5TR7 A;  3GDI A;  1CJF A;  1K54 A;  1WYC A;  3IF5 A;  3OPR A;  4BD0 A;  3RFB A;  2JE5 A;  3OBF A;  5EEC A;  1I2W A;  3T4O A;  4E6W A;  1NYM A;  1TEM A;  4MBK A;  1FQG A;  3KYZ A;  4JBF A;  3ZFZ A;  1F2K A;  2PR6 A;  5HPI A;  2ZLY A;  1BTL A;  3VSL A;  1P0Z A; 
#chains in the Genus database with same CATH homology
 5G4Y A;  1NWZ A;  3F1O B;  4GLQ A;  3LIC A;  4BMW A;  1TD5 A;  3EGX C;  3T4L A;  2VX8 A;  4WEL A;  3BW6 A;  4HP9 A;  4G3V A;  2PYR A;  2XRN A;  4L9E A;  1G6O A;  3MFX A;  4GHI A;  2PT7 A;  4R6L A;  1DP6 A;  2D02 A;  2OWJ A;  5HDC A;  3BQA A;  1DP8 A;  5AVE A;  4CLC B;  5I5L A;  3EEA A;  3CIT A;  4AFI A;  3GEC A;  2VKS A;  4L0L A;  4HOI A;  1P97 A;  1V9Y A;  2LB5 A;  4Q0J A;  1YAX A;  5DKL A;  5DFX A;  4GW9 A;  2W27 A;  4Y3I A;  1H8M A;  3C8C A;  2VLG A;  3K3D A;  3HJK A;  1NLZ A;  4I3A A;  3UB9 A;  1X0O A;  2L1M A;  3U2A A;  4HY8 A;  3C30 A;  4PAU A;  1GSX A;  2NUT C;  5F68 A;  3LR0 A;  2YKF A;  4BJP A;  5HWW A;  3RTY A;  3EQV A;  3KX0 X;  4O01 A;  3S7P A;  1EW0 A;  3PBO A;  3BY8 A;  3R4K A;  2PHY A;  3LI8 A;  1S1Y A;  4XT2 A;  3UB6 A;  3KSG A;  3T4T A;  1MKM A;  3PBR A;  2HJE A;  1DRM A;  4DJ3 A;  1T1A A;  4HQA A;  1ODV A;  2W1R A;  2A24 B;  4WEJ A;  4PHT A;  2A2L A;  3G6O A;  2JKR M;  1OJG A;  3E98 A;  4R70 A;  1T1B A;  2H28 A;  3ICY A;  4MN7 A;  4MMN A;  3KO6 A;  1D7E A;  3E4O A;  4YWZ A;  3EQU A;  3LR3 A;  2ZOH A;  2P7J A;  3F1N B;  4HH2 A;  3VV4 A;  4GS9 A;  2I9V A;  2K2N A;  4QPR A;  2O99 A;  3D3O A;  3ZYT A;  2QWS A;  4HHD A;  3A0S A;  3FG8 A;  1TS0 A;  4G3K A;  1IFQ A;  3CWF A;  1TS6 A;  2W0N A;  4NXB A;  4Q0I A;  3OC2 A;  4KQD A;  5K5B A;  4JGO A;  2W3D A;  2W1T A;  1XFQ A;  4R38 A;  2W3H A;  1GSW A;  2B18 A;  3A0R A;  4HJ3 A;  5HDS A;  4JGR A;  4WLA A;  3EEH A;  3MF0 A;  3F1P B;  2EWW A;  5TBM B;  1OT9 A;  3SW1 A;  2QJ7 A;  3IS2 A;  5J3W A;  1LSV A;  4OOM A;  3K2N A;  4CQH A;  4NXF A;  1S66 L;  2W3E A;  2V0U A;  3CAX A;  2L0W A;  3TW8 A;  1OTA A;  5HL6 A;  5F5Y A;  2EA9 A;  1TS8 A;  4F3L B;  2QKP A;  2VV8 A;  4B9O A;  3T4S A;  2GX5 A;  3OOV A;  4Z1W A;  2PD8 A;  1S1Z A;  2QHK A;  3P01 A;  5HZH A;  4DJ2 A;  3JVV A;  3H82 B;  4UEY A;  2JN7 A;  4JGP A;  4PKY A;  1MC0 A;  4FSF A;  2Y8H A;  4BBT A;  4L9G A;  4H6J B;  3MXQ A;  5HWT A;  1P9W A;  2J3T D;  2K7S A;  1XFN A;  4WL9 A;  3R7W A;  5F69 A;  3PBN A;  5DF9 A;  2Y79 A;  2V1B A;  3MQQ A;  4I38 A;  2L4R A;  1OTD A;  2VEA A;  4NXG A;  1OTI A;  5A8B A;  4BBU A;  3NJA A;  1S4S A;  4WUJ A;  5DJU A;  1XJ3 A;  2GNX A;  4CLC C;  2K31 A;  4MDZ A;  2FZ0 A;  2G7U A;  3JVU A;  5KSH A;  1KOU A;  3FC7 A;  2JKT M;  1H3Q A;  2OAP 1;  4HI4 A;  3PYP A;  3PHY A;  2QJ5 A;  4NXE A;  1XJ2 A;  2W3G A;  3LUQ A;  2QYB A;  4I3J A;  2WKR A;  3H7W A;  5LBR A;  4HH3 A;  3PBT A;  4EQ1 A;  3UE3 A;  3KYQ A;  1N9N A;  4I5S A;  2INW A;  1VHM A;  5C5K A;  4ETZ A;  3UE6 A;  2EWV A;  4YNR A;  3NOU C;  4ARZ B;  3UMD A;  2ZOI A;  4BBV A;  4JGQ A;  3B33 A;  1ZHH B;  2KX6 A;  4IUK A;  2W3F A;  5HD5 A;  3EOI A;  1YKD A;  3A0V A;  4EW7 A;  4HP4 A;  3B47 A;  1F5M A;  4M4X A;  3OCL A;  1T1C A;  4FOF A;  4MCW A;  5TJJ A;  3LR4 A;  4WF0 A;  3BQ8 A;  1LT0 A;  3PXP A;  3H9W A;  3T50 A;  3NOT C;  1W63 M;  4ZRR A;  3BWL A;  3UME A;  4EUV A;  2JKR I;  2OAQ 1;  2VZW A;  3B42 A;  4II7 A;  2P08 A;  3LIE A;  5HD3 A;  2HV1 A;  2DMW A;  4EER A;  4KUO A;  3F1P A;  4PKY G;  1S67 L;  3O5Y A;  3FPV A;  5DKK A;  3C2W A;  2XRO A;  4I39 A;  2O9C A;  3LI9 A;  2VA0 A;  3F1O A;  3S7Q A;  4P6Z S;  2HJ9 C;  4BWI A;  2Z6D A;  4HIA A;  4MN5 A;  4CLC E;  2VJW A;  2V9A A;  3DBA A;  3MR0 A;  1MZU A;  3E4P A;  3TE8 A;  1LSX A;  3UB8 A;  5DFY A;  4EEU A;  3ULF A;  2KDK A;  1S4R A;  4GS9 B;  5AJG A;  4CLC A;  3CI6 A;  2D01 A;  5FL3 A;  4HJ6 A;  3H82 A;  2HGV A;  3FPW A;  2M1C A;  3LR5 A;  4EU0 A;  3EWK A;  1G28 A;  2PR5 A;  3PR6 A;  4NKP A;  4UQI S;  5DJT A;  1F9I A;  3S7O A;  2KOI A;  4LRX C;  3OLO A;  4UQI M;  2MJ6 A;  4LRY C;  1NRJ A;  3KSI A;  3PBQ A;  1ZTU A;  2YKH A;  2NUP C;  2B02 A;  5AVF A;  3PBS A;  1UGU A;  3OCN A;  5IS1 A;  1OJ5 A;  3S7N A;  3MMH A;  1LSW A;  2J80 A;  3LIF A;  3MQO A;  4IUH A;  1N9O A;  2JHE A;  2O9A A;  3IS2 B;  1F98 A;  1P9R A;  3MQ0 A;  4I3I A;  4Q0H A;  4EXO A;  2HF6 A;  1OPX A;  1Y28 A;  2Z6C A;  4GJ4 A;  5G4Z A;  1W63 Q;  4NEE D;  3NOP C;  5J7E A;  1TF1 A;  3UB7 A;  5F6A A;  3ZQ5 A;  2PYP A;  4LPZ A;  4WN5 A;  2ZBB A;  2M7U A;  4L9F A;  4GHI B;  1IOU A;  3MJQ A;  2FH5 A;  1T18 A;  2CMN A;  3E0Y A;  3T4Q A;  3HCY A;  3LIA A;  4ARZ A;  2XA7 S;  1XJ4 A;  2A24 A;  3TRC A;  2ZMF A;  3K3C A;  1V9Z A;  4DN0 A;  5HSQ A;  2PDR A;  2XA7 M;  5HDD A;  3P7N A;  4O8G A;  3RH8 B;  4HNB A;  4O0P A;  3LFV A;  1VB6 A;  5CX7 A;  3EGD C;  4GCZ A;  4RQ9 A;  2OWH A;  3LID A;  3R7W B;  4KUK A;  2JKT I;  5HPF A;  5EFW A;  3F1N A;  2XSS A;  3CUE A;  4EES A;  4E04 A;  3KSH A;  2OOL A;  3LYX A;  3T4J A;  2VGL S;  4CLC D;  4EET B;  1LL8 A;  4OOL A;  5HWV A;  4R3A A;  4IJG A;  3LIB A;  5KIZ A;  4MN6 A;  2PD7 A;  2VGL M;  2O9B A;  5IT5 A;  2M7V A;  4G3W A;  4Y5F A;  2VV7 A;  2V0W A;  5L8M A;  4XT2 B;  3V67 A;  3CLO A;  1N9L A;  4ME4 A;  3VE3 A;  5J4E A;  3T4K A;  4Y2F A;  2R78 A;  1DP9 A;  1T19 A;  3H7W B;  4HJ4 A;  3IBJ A;  4YOF A;  1OTE A;  2GZA A;  5IU1 A;  2LB9 A;  5TBM A;  2ZMV A;  1TS7 A;  4KQO A;  3BY9 A;  3IBR A;  1UWP X;  1NLY A;  2GJ3 A;  1JNU A;  2J3W A;  4LLO B;  3C38 A;  3KSF A;  1BYW A;  2O0Y A;  3W2Z A;  1YSQ A;  2WKP A;  4P6Z M;  4ETX A;  4B93 A;  3CUE C;  4K08 A;  4F3L A;  1UWN X;  3GDI A;  1OTB A;  1WA9 A;  4DMZ A;  4EEP A;  3VE4 A;  1XJ6 A;  1OT6 A;  3RFB A;  3HJI A;  1YSP A;  3E4Q A;  2V1A A;  2KLI A;  1D06 A;  3OBF A;  2P04 A;  3T4O A;  5MC7 A;  4WEK A;  2VV6 A;  3KYZ A;  2BAS A;  3NHQ A;  4H6J A;  3BJN A;  2PR6 A;  3VOL A;  1GSV A;  3D72 A;  4LRZ E;  5HPI A;  4IHQ A;  2WKQ A;  1STZ A;  3TJZ C;  2J3T C;  2W1T B;  2IA2 A;  1P0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...