1VETA

Crystal structure of p14/mp1 at 1.9 a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
122
structure length
122
Chain Sequence
ADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVVEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/protein binding
molecule keywords Mitogen-activated protein kinase kinase 1 interacting protei
publication title Crystal structure of the p14/MP1 scaffolding complex: How a twin couple attaches mitogen- activated protein kinase signaling to late endosomes
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 2004-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08923 MAPKK1_Int Mitogen-activated protein kinase kinase 1 interacting
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 1vetA00
4D60A 1Y4OA 1SKOB 4ESPA 3T1SA 5FEFA 3T1RA 5EVEA 1F2KA 3CPTA 3LEQA 2V8FA 1D1JA 5FDSA 3KYEA 1PNEA 1Z09A 4X1MA 3CHWP 5EM1A 3CPTB 3T1XA 2VK3A 2HZ5A 1VEUA 3MS6A 1VEUB 1YPRA 1CQAA 1HLUP 4FTXA 2PRFA 4X1LA 3NECA 1A0KA 1PFLA 1CJFA 3UB5P 3L7HA 1VETA 3T12B 1ACFA 1CF0A 1FILA 1SZVA 3T1QB 1J3WA 2E8JA 1VETB 3D9YA 2PBDP 2ZL1A 3NULA 1G5UA 4QWOA 1AWIA 2B95A 2ZL1B 3U4LP 3LGOA 3DAVA 3L9KA 2JKFA 4X25A 5EM0A 2JKGA 1K0KA 5EV0A 2PAVP 3MSHA 4FUWA 1FIKA 2ACGA 1PRQA 2BTFP 2V8CA 1SKOA 5FEGA
chains in the Genus database with same CATH superfamily
2O99A 4YNRA 3CJMA 1IKIA 1EW0A 1UGUA 2C5WB 2Z6CA 5J7EA 4OPZA 2BG1A 3O5YA 4P6ZM 2AVXA 4B93A 3CAXA 1Z09A 4ZTKA 1HTZA 3F1PB 3ISGA 1XA1A 2Y2HA 3SS3A 2VK3A 3P98A 2K31A 4MEZA 4IBXA 5FQMA 5EVIC 1Z6FA 2HPBA 3E2KA 3RXWA 1VEUB 3C2WA 1BLCA 2VZWA 3ZVTA 3GECA 5HW3A 3O87A 4KZAA 3LY4A 3H9WA 1XJ2A 4NEED 2OAQ1 4G3WA 3JPUA 2ZM8A 3MJQA 4GNUA 3D3OA 1MY8A 4LV2A 2ZQCA 1RGZA 3HUMA 1OTBA 4LFUA 3S22A 5EVIA 1ZG6A 3Q7ZA 1YAXA 5FA7A 2XA7M 4OP5A 4Y13A 2XROA 3QP1A 2J3WA 4U0XA 1SCWA 5BOHA 2Y55A 5I94A 4IVKA 1NLYA 1ESIA 2WGVA 1PZOA 2WK0A 5E2EA 4B9OA 2JKGA 1OT6A 2YKFA 3MSHA 2X01A 3VP0A 1OTAA 3OPRA 4II7A 1MWTA 3PBTA 1PRQA 3LUQA 4ZJ1A 4MN7A 4HH3A 3W4OA 1Y4OA 2J80A 4EU0A 4ZAMA 5FI6A 1EWZA 2PU2A 4R38A 3BFEA 3T1SA 4LPZA 2W1TA 1N9BA 5EVEA 2XF3A 2OWJA 2Y2GA 5CRFA 4DE3A 2JKTM 1IYSA 3C5AA 3C8CA 4KG5A 2V2FF 4O8GA 3P01A 5EM1A 3UPOA 4HJ6A 5GHXA 1PZPA 4L9EA 4BQMA 1T1AA 3HLFA 4MLLA 5FQKA 4KG6A 3FC7A 4WZ5A 2K7SA 2GNXA 2KOIA 1FQGA 4EQIA 3F1OB 4YWZA 2X02A 1S0WA 4RQ9A 5EOEA 5HL6A 5U47A 2B5RA 1QMFA 5IU1A 4X68A 3HVFA 3K3DA 3SH9A 4R6LA 3LIBA 4NKPA 3FPVA 5FSRA 2OLUA 1XP4A 1K6SA 1DP9A 2ZLYA 5E2HA 2VV6A 1MXOA 4IJGA 2C6WB 2B95A 3V39A 3IXBA 4OQGA 3U4LP 1VB6A 3T4TA 3DW0A 4Y0OA 3KSGA 2HP6A 2V1ZA 3Q1FA 4Q0HA 2WKPA 3N4IA 2PAVP 2EFUA 3HLDA 4DE1A 1FIKA 4QPRA 4CLCA 3T4OA 4WEJA 1SKOA 5GLDA 3BY8A 4Y0TA 2PYPA 4MNRA 3PBSA 3FG8A 1LL9A 4Q8IA 3SH7A 3BQAA 4OQHA 1H8ZA 3N8RA 4PM5A 5D3OA 3NOTC 5JYOA 4R3JA 1BUEA 1XA7A 3PAGA 5A93A 1NRFA 4OH0A 3MMHA 1L0EA 1Y28A 2HP9A 2J3TC 5FDHA 1UWPX 2V20A 4KZ4A 3HUNA 5G18A 4H6JB 4O01A 2VGJA 2PBYA 5G4ZA 2EWVA 4QB8A 2Y2MA 3UMDA 2V0WA 1RGYA 1YLJA 3ULFA 5HWTA 2JKRI 3KSFA 4WF0A 4S2JA 1K55A 2Y59A 2WKRA 1ESUA 2QHKA 2WYXA 1CJFA 1U60A 3VP2A 3IWQA 3TRCA 2L0WA 4X6TA 3T12B 2Q9MA 2ZC3B 3H82A 2EX2A 5TBMB 3IF6B 4GS9A 3KSIA 3IHAA 3OZHA 4IUKA 5M1AA 1BYWA 5AVEA 2ZL1B 1DP6A 1W8YA 2HF6A 1S6RA 4FH4A 2WGWB 2Y79A 1ALQA 4UEYA 4HNBA 5CX7A 4QHCA 1WA9A 2Y2OA 4U3TA 4I5SA 3WRZA 3ZCZA 4R0QA 1GHMA 2G2UA 3OPHA 1HD8A 4ZRRA 4Y3IA 1PW8A 1JWZA 4D60A 4I38A 1YM1A 4ID4A 4M4XA 3PYPA 4DMZA 4EXOA 4P85A 1CEFA 3OOVA 4KENB 2OOLA 1E25A 1XX2A 4GJ4A 4I3JA 3GSGA 2XH9A 3SS5A 1S66L 3IS2B 5CGSA 3V3SA 2ZOIA 1PI4A 2XDMA 2EX6A 2W3HA 1YLYA 4ETXA 3IXDA 3O3VA 2RL3A 4AFIA 1KDWA 4ZJ3A 2ZQAA 2XK1A 2J9OA 2WGIA 3MQOA 4GW9A 1L2SA 3MKFA 4IEDA 1K38A 2VEAA 3ZHHA 4BMWA 1FILA 3FYZA 3VFHA 1K57C 2M7VA 1YLTA 3D9YA 4HQAA 1GSVA 2HJ9C 4B88A 4HH2A 3M6BA 1SHVA 1YMSA 4KZ8A 1GSXA 3WS0A 1F5MA 5J8XA 1JNUA 3BQ8A 5CEDA 4P6ZS 1KE0A 1K0KA 1RP5A 1FR1A 5F1FA 1TF1A 3GVBA 3OCLA 2ZOHA 2BTFP 2VV8A 4KZ7A 4XT2B 3MXSA 2KLIA 1FSYA 1EI5A 5A90A 1Q2PA 1OT9A 4X53A 2VV7A 3MZEA 2QJ5A 3VSLA 4BJPA 3IWIA 3FKWA 2JKTI 1IOUA 2P9VB 2L1MA 1IEMA 2XSSA 1ES3A 2EX8A 2PRFA 2XA7S 4DJ2A 3ZYTA 1ES2A 4MBFA 2XLNA 4N92A 3R7WB 3BLMA 2P74A 5CTMA 4I3AA 5C5KA 5FQIA 2JKRM 5DJTA 4S2MA 1NZUA 3CZDA 3DTIA 4PHTA 2WKQA 4BD0A 3MBZA 3IT9A 3NULA 3Q82A 1N4OA 4FCFA 3GDIA 4OONA 4QD4A 3DWZA 2EWWA 3LGOA 4WN5A 3CWFA 4Y5FA 3UPNA 1ODVA 4G3KA 3L9KA 5EM0A 3DWKA 3ZG0A 1VHMA 4JPMA 3SZTA 2W0NA 3CUEC 3LYXA 3C4PA 3IWOA 5F69A 3TSGA 2VGLS 4GDBA 1KE4A 4BD1A 5DJUA 4EEPA 3G34A 2MJ6A 1NZOA 2PHYA 2J8YA 2O9AA 3EQVA 2VGKA 3C7UA 3H7WB 4YINA 3IF5A 3S7PA 1VM1A 1S67L 3TOIA 1H3QA 1YQSA 4GCZA 4K08A 3B47A 1TS0A 3UMEA 2A24A 3T4QA 3TE8A 2BLSA 5CXWA 5I5LA 4JGOA 5FQQA 1BLHA 1TVFA 1KOUA 2Q0OA 1NRJA 5HDSA 3LI9A 3CUEA 3N8SA 3T1XA 1MWRA 2HZ5A 2VLGA 4P0MA 3BW6A 3G32A 1TS8A 3V67A 4XXRA 3GV9A 5GL9A 3E98A 1KGFA 1LT0A 4KZBA 2QJ7A 4X1LA 1L0DA 1SDEA 4F3LA 4RA7A 1PYYA 4C3QA 1XXMA 4NXFA 4NG2A 5HD3A 4OOYA 4WMCA 1VQQA 3UB5P 4HIAA 4OPYA 1HVBA 5L8MA 3A3IA 3MQQA 4ZJ2A 5HPFA 3GRJA 4WM9A 3LR0A 3IQAA 5DTTA 3ZG7B 5AQBA 4R4SA 5AQAA 4FD8A 3KO6A 2OWHA 2Y2PA 4CJNA 3P09A 2INWA 5EVIB 4C6YA 5F5YA 1JWVA 4OP8A 5HWVA 1IYOA 4X25A 1IYQA 1YLWA 4EBPA 5EPHA 4JKTA 4B4XA 1JWPA 3TW8A 3S7OA 3NCKA 4E3KA 5FEGA 3UO9A 4ARZA 2KDKA 3JVVA 4C75A 3KYQA 3ZFZA 1BULA 3FZCA 4OQ0A 1TDLA 2WUQA 5CHUA 2VKSA 1N9LA 1W79A 2W1TB 1W8QA 3CPTA 4BBVA 4E3MA 4HBTA 3N7WA 2WKHA 4XUXA 2ZQ7A 3CHWP 4QY5A 2HDUA 4KZ9A 2W1RA 3EGDC 2IA2A 5F1GA 1LL8A 1KVMA 1CQAA 2D02A 3MFXA 4S2OA 5DF9A 2VJWA 5L10A 1L0FA 2ZJ9A 2JBFA 3IH8A 1FCMA 3NECA 3V3RA 4M3KA 3VOZA 3C38A 3UDFA 3A3JA 2VGLM 4QY6A 2EFXA 2CC1A 1PW1A 1XJ4A 4KQOA 4F94A 4B4ZA 3LR5A 1CK3A 2UWXA 2I9VA 4BL2A 3HCYA 1BLSA 2A3UA 4CLCE 2FH5A 5HARA 1RCJA 2R9XA 3PR6A 1FR6A 1OPXA 2ZMAA 5DF8A 2JKFA 3GTCA 1T18A 5HAIA 3SOIA 2M1CA 4JLFA 4IVIA 4CLCD 3NIAA 4GD6A 5EFWA 2ZQ9A 2B02A 4CLCB 1MC0A 3LEZA 5JYPA 3C7VA 2X71A 3BWLA 1SKOB 5M19A 2WAFA 1D7EA 1NJ4A 1G28A 1J9MA 4NXEA 3TG9A 5FASA 3BYDA 1ZG4A 4N9KA 3LEQA 1D1JA 1MWSA 3KYEA 5DFXA 3NC8A 3AGEA 1BZAA 2OAP1 2Y91A 4BENA 3VV4A 2PR5A 4O0PA 3UE1A 4GD8A 1NY0A 3A0VA 4EWFA 4S2NC 2GZAA 3MS6A 2ZQDA 1TD5A 2DNSA 2HDSA 2EA9A 3OLOA 3CMZA 4Z1WA 1W63Q 1K6RA 4QJGA 1LI9A 5CERA 3HREA 1P97A 1Y54A 2W3DA 2IWCA 2VA0A 5HL1A 1GA0A 2ZC4B 1VETA 4P6BA 1M6KA 1MKMA 2FFFB 2R9WA 4LV1A 3A0RA 3T1QB 1BLPA 4K91A 1K25A 4OOLA 4DXCA 4S2PA 5FATA 1NYMA 4S2NA 2Y2KA 3H82B 3M2KA 2VX8A 4GS9B 5E43A 1S1YA 1ZTUA 1OTDA 4I39A 4OKPA 3RJUA 1K56D 5TGFA 1K54C 2EX9A 2ZM2A 3LI8A 2ZC6B 4PM7A 2Z2MB 3KSHA 3UDXA 2O9BA 2W3FA 3MFDA 4MCWA 3TJZC 1I2WA 3MF0A 3HLWA 3NBLA 5F6AA 4BWIA 1E3UD 1LLBA 1ONHA 3PXPA 3LFVA 4X56A 3HJKA 5HDDA 3BECA 3A3FA 2PR6A 2Z6DA 1MKIA 3WRTA 1XFNA 1K54A 3QNCA 5EOOA 2DRWA 4RX2A 3ZG8B 1ZHHB 3WS1A 3FV7A 2D01A 4DKIA 3KYZA 4PM6A 1KGGA 4JGPA 1O7EA 4GHIA 1GSWA 3E4OA 3S1YA 1I5QA 4OVDA 3QP6A 4LLOB 2H10A 3WS2A 4LV3A 5GHYA 1T1BA 4WLAA 1FCNA 3QP4A 3SW1A 3RFBA 1ZKJA 1QMEA 2V0UA 3UB6A 2Y4AA 2XRNA 4KUOA 4QWOA 3FPWA 3NJAA 4WZ4A 2QKPA 4IBRA 3IX3A 4MN5A 1FOFA 3DAVA 5DF7A 5G4YA 5CHJA 2L4RA 5CHMA 5CGWA 1T1CA 4JXGA 3UB8A 2DCFA 4DF6A 2H0TA 1FCOA 1V9ZA 3CLOA 4FSFA 3NI9A 5CEBA 3BRMA 3GQZA 4YOFA 3HUOA 1TDGA 2H28A 4DDSA 1XGIA 1W5DA 3MXQA 4L0LA 4KQRA 4UAAA 5LBRA 1O07A 2J7VA 1LSVA 3G31A 3HLEA 5HAPA 3T4LA 2KX6A 3MZDA 1YLZA 4FOFA 4LCMA 5IT5A 3BLSA 5A91A 2A49A 3R4KA 1K57A 3O88A 3OC2A 1OMEA 1HLUP 3T4JA 3MZFA 3RTYA 4ZBEA 1T19A 5HAQA 5L09A 1NLZA 1XPBA 4S2LA 3UPPA 2Y2JA 1DJBA 3UE3A 1IFQA 2Y2IA 3ZG5A 1NWZA 5KSCA 4R70A 3O86A 4NXBA 1P0ZA 5IS1A 1NXYA 5FL3A 3U2AA 2E8JA 4LRXC 3IXHA 1KVLA 5DTSA 4I3IA 5DVAA 3ZNTA 4R1GA 2ZQ8A 3CITA 1K4EA 3VP4A 2E8IA 3QNBA 3WS5A 4EW7A 3ZDJA 1OTEA 3OCNA 1OJGA 4XUZA 1XJ6A 1TS6A 4H8RA 4HP9A 1IELA 3BFGA 4HBUA 3LO7A 1STZA 4JF5A 2V8CA 3C30A 4DRTA 3K3CA 2XEPA 1ERMA 1YLPA 3T4KA 5FAQA 4LGWA 2R78A 4KZ3A 4K0XA 3QP2A 3B33A 4PKYA 3VP1A 5AQ7A 3C4OA 4R3AA 3F1NA 3Q81A 2W27A 3CG5A 2GX5A 4DN0A 1H8YA 4R3BA 5CECA 3Q7VA 2A24B 2JN7A 4Y17A 5AVFA 4E3JA 2EXAA 2EXBA 3UE6A 1XGJA 2OLVA 5J4EA 1F9IA 4PM9A 5TR7A 4RVAA 4MBHA 2J9PA 4FTXA 4JF6A 1BSGA 1IKGA 3E4QA 4OOMA 3N8LA 3G4PA 3LR4A 3A0SA 4JXSA 2ZC5B 3E4PA 4X69A 4ETZA 4Q0IA 5TJJA 4F3LB 3HJIA 3L7HA 2DMWA 3BEBA 4KG2A 3NDEA 1PWDA 4GLQA 2PYRA 5FAPA 4E6XA 1P9RA 3QHYA 2W3GA 4UHUA 3G30A 4JGRA 2ZC7A 4JGQA 3EWKA 4PM8A 3PTEA 3DBAA 3UDIA 1JTGA 1N9NA 3PBNA 5HPIA 2HDQA 3NDGA 1JTDA 5FI7A 4OLGA 2YKHA 3EEHA 3G2ZA 3PHYA 4HI4A 2IWDA 3IX4A 3MQ0A 4PPRA 3IXGA 4LV0A 5GLBA 2ZD8A 2Q9NA 4NETA 5EVID 4EEUA 2JE5A 3UB7A 3AGFA 3IBRA 2P04A 1CEGA 4EV4A 4E3LA 5A92A 1MPLA 4ARZB 3NY4A 4E04A 3W2ZA 4MMNA 4YFMA 3LIFA 2V8FA 5FDSA 3F1PA 1OTIA 4ZDXA 3CPTB 1PWGA 3CI6A 3I7JA 3A3DA 3QP5A 1SKFA 1VEUA 4EBLA 1GCEA 2RCXA 3DTMA 2QYBA 1YPRA 2PU4A 4Y15A 4JXWA 2O0YA 2WZXA 1GHPA 3IH9A 1XKZA 5HWWA 1LI0A 3HLGA 3IHBA 2ZM0A 3ZNYA 3UN7A 4FH2A 2HV1A 2WKEA 2WAEA 3RH8B 3SS4A 1H0MA 4JXVA 2WADA 4UA9A 3UNWA 3BFFA 3T4SA 3BY9A 4Y2FA 2I72A 4GOGA 3ZVWA 5FQ9A 3S7NA 2PBDP 5EVLA 4UA7A 4BL3A 4WZ5C 3B3XA 3ITAA 3LY3A 4DDYA 3EOIA 5HSQA 1UWNX 3WWXA 1L3LA 1KGEA 2WZZA 3W4QA 4EERA 1G6AA 1G68A 2PD8A 3OPPA 3ZGAB 2G2WA 2JHEA 4MDZA 5AQ9A 1H8MA 3T50A 2PDRA 4KQQA 5KZHA 3OPLA 3WS4A 1ES4A 3G35A 4GN2A 4WL9A 1GHIA 3AGDA 5DKLA 4ESPA 3GMWA 3S7QA 2WKIA 4CPKA 2OSUA 2B18A 4DXBA 2V1AA 3VP3A 4OLDA 3MXRA 4DE0A 3E2LA 4MBKA 1BTLA 4IUHA 3HBRA 4EQ1A 2PT7A 3F1OA 4GKUA 4PAUA 5KIZA 3QP8A 4CLCC 4CQHA 3DTKA 4EETB 1WYBA 1WYCA 2A2LA 1XJ3A 2XFSA 5L2FA 1DP8A 3JVUA 3UB9A 1DJAA 4EUVA 3DTEA 1A0KA 1KDSA 1OJ5A 5KMWA 1CI8A 2Z2LB 5HDCA 3HLCA 1W63M 1F98A 1CF0A 4IHQA 1FSWA 1J3WA 4N9LA 1VETB 5DKKA 4E3IA 5EECA 1L0GA 5GLCA 3LCEA 5AJGA 2ZBBA 1C3BA 2UV0E 3P7NA 3LIAA 3VOYA 4JF4A 1K55C 4GDNA 1MBLA 5EV0A 5M18A 2H5SA 5HD5A 1ONGA 4DE2A 1ERQA 2J3TD 4LCLA 2QPNA 1EROA 3VSKA 3VE4A 3ITBA 4KUKA 4UQIS 1MZUA 1GA9A 1P9WA 2K2NA 5A8BA 3FKVA 5FI2A 3BFDA 4D2OA 3NHQA 3B42A 2XD5A 1PNEA 4R23A 5HZHA 1X0OA 1M40A 3IF6C 4H6JA 2IWBA 1PIOA 4EESA 4PMAA 4Y7PA 2G7UA 3MR0A 3IBJA 4GB7A 5L07A 3LIEA 4HESA 2Y8HA 1Q2QA 4WELA 5DTKA 1KE3A 3S4XA 4S2KA 1DJCA 4HHDA 1PFLA 3ZQ5A 4E3NA 2P7JA 2ZMVA 3A3EA 4GHIB 4LRYC 4NK3A 2QMIA 2XFTA 3BJNA 1YKDA 3K2NA 3LIDA 5TBMA 1ACFA 1HZOA 1K56A 4NXGA 3IF6A 3D72A 1SZVA 2HJEA 4JBFA 3SH8A 4N1XA 5F68A 3ZG9B 2ZL1A 5CGXA 3G6OA 1AWIA 3Q07A 2WGWA 5F83A 3ICYA 1S1ZA 2ZMFA 4K0WA 2P08A 4ME4A 4DJ3A 3W8KA 2JCHA 5GHZA 1ZC2A 1E3UA 3PAEA 5J3WA 2FZ0A 3E0YA 5F82A 4X55A 4FUWA 2ACGA 2QZ6A 2OV5A 1TS7A 4Q0JA 2JC7A 2GJ3A 4L9GA 4S2IA 1ES5A 1PI5A 4HEFA 5TFQA 4OQIA 5MC7A 3IS2A 3MKEA 4BLMA 4Y0UA 1LSXA 3UY6A 4HJ3A 2Y2LA 4HY8A 4X1MA 2Y2QA 1YSQA 3RXXA 3UE0A 3JYIA 5IHVA 3G2YA 3BFCA 1LHYA 4G3VA 2PD7A 4LENA 2QWSA 2XD1A 4QU3A 3M6HA 3EEAA 4RX3A 5FQJA 5DFYA 3FWLA 2LB9A 2NUTC 1YSPA 2H0YA 5HFOA 5EUAA 1D06A 1DY6A 3NOUC 2NUPC 2V9AA 4KZ6A 4UQIM 2LB5A 4E3OA 4BBTA 1G5UA 4O7DA 2XGNA 5GLAA 1WE4A 1K4FA 4KQDA 4A5RA 1IYPA 1W7FA 5CTNA 5FAOA 2BASA 3VFFA 1AXBA 1MWUA 3VE3A 2XR0A 2HDRA 2HGVA 4RYEA 4XT2A 3EGXC 3N6IA 3OBFA 4R4RA 3VOLA 4EBNA 4OPQA 3V50A 3LR3A 1NYYA 2HP5A 4WYYA 5FEFA 2FFYA 3T1RA 3PBOA 5K5BA 1F2KA 2XQZA 3HLBA 5EE8A 1G6OA 4WUJA 3F1NB 3EQUA 2O9CA 1XFQA 2P9VA 1YT4A 3Q7VB 1H5XA 1LL5A 3PBQA 4L9FA 5KSHA 5E2GA 2GDNA 1V9YA 4HOIA 4N1HA 1BT5A 1SDNA 4Z9QA 3R7WA 1S4RA 4OPRA 1S4SA 2V1BA 4E6WA 3HL9A 4LRZE 3IX8A 4BBUA 4WEKA 3LICA 4U0TA 3BM6A 3M2JA 3V5MA 3VMAA 3GR2A 4HJ4A 4MN6A 2Y2NA 4UA6A 4HP4A 1I2SA 4GZBA 2W3EA 2CMNA 1PWCA 4PKYG 4KZ5A 1N9OA 1JVJA 4WMCD 5HX9A 1E4DA 5E2FA 1DRMA 3D4FA 2M7UA 4EUZA 3PBRA 3KX0X 4P87A 3W4PA 1CI9A 1LSWA 1TEMA 3H7WA 3NOPC 4WBGA 1YMXA
chains in the Genus database with same CATH topology
4D60A 1Y4OA 1SKOB 4ESPA 3T1SA 5FEFA 3T1RA 5EVEA 1F2KA 3CPTA 3LEQA 2V8FA 1D1JA 5FDSA 3KYEA 1PNEA 1Z09A 4X1MA 3CHWP 5EM1A 3CPTB 3T1XA 2VK3A 2HZ5A 1VEUA 3MS6A 1VEUB 1YPRA 1CQAA 1HLUP 4FTXA 2PRFA 4X1LA 3NECA 1A0KA 1PFLA 1CJFA 3UB5P 3L7HA 1VETA 3T12B 1ACFA 1CF0A 1FILA 1SZVA 3T1QB 1J3WA 2E8JA 1VETB 3D9YA 2PBDP 2ZL1A 3NULA 1G5UA 4QWOA 1AWIA 2B95A 2ZL1B 3U4LP 3LGOA 3DAVA 3L9KA 2JKFA 4X25A 5EM0A 2JKGA 1K0KA 5EV0A 2PAVP 3MSHA 4FUWA 1FIKA 2ACGA 1PRQA 2BTFP 2V8CA 1SKOA 5FEGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D60 A;  1Y4O A;  1SKO B;  4ESP A;  3T1S A;  5FEF A;  3T1R A;  5EVE A;  1F2K A;  3CPT A;  3LEQ A;  2V8F A;  1D1J A;  5FDS A;  3KYE A;  1PNE A;  1Z09 A;  4X1M A;  3CHW P;  5EM1 A;  3CPT B;  3T1X A;  2VK3 A;  2HZ5 A;  1VEU A;  3MS6 A;  1VEU B;  1YPR A;  1CQA A;  1HLU P;  4FTX A;  2PRF A;  4X1L A;  3NEC A;  1A0K A;  1PFL A;  1CJF A;  3UB5 P;  3L7H A;  1VET A;  3T12 B;  1ACF A;  1CF0 A;  1FIL A;  1SZV A;  3T1Q B;  1J3W A;  2E8J A;  1VET B;  3D9Y A;  2PBD P;  2ZL1 A;  3NUL A;  1G5U A;  4QWO A;  1AWI A;  2B95 A;  2ZL1 B;  3U4L P;  3LGO A;  3DAV A;  3L9K A;  2JKF A;  4X25 A;  5EM0 A;  2JKG A;  1K0K A;  5EV0 A;  2PAV P;  3MSH A;  4FUW A;  1FIK A;  2ACG A;  1PRQ A;  2BTF P;  2V8C A;  1SKO A;  5FEG A; 
#chains in the Genus database with same CATH topology
 2O99 A;  4YNR A;  3CJM A;  1IKI A;  1EW0 A;  1UGU A;  2C5W B;  2Z6C A;  5J7E A;  4OPZ A;  2BG1 A;  3O5Y A;  4P6Z M;  2AVX A;  4B93 A;  3CAX A;  1Z09 A;  4ZTK A;  1HTZ A;  3F1P B;  3ISG A;  1XA1 A;  2Y2H A;  3SS3 A;  2VK3 A;  3P98 A;  2K31 A;  4MEZ A;  4IBX A;  5FQM A;  5EVI C;  1Z6F A;  2HPB A;  3E2K A;  3RXW A;  1VEU B;  3C2W A;  1BLC A;  2VZW A;  3ZVT A;  3GEC A;  5HW3 A;  3O87 A;  4KZA A;  3LY4 A;  3H9W A;  1XJ2 A;  4NEE D;  2OAQ 1;  4G3W A;  3JPU A;  2ZM8 A;  3MJQ A;  4GNU A;  3D3O A;  1MY8 A;  4LV2 A;  2ZQC A;  1RGZ A;  3HUM A;  1OTB A;  4LFU A;  3S22 A;  5EVI A;  1ZG6 A;  3Q7Z A;  1YAX A;  5FA7 A;  2XA7 M;  4OP5 A;  4Y13 A;  2XRO A;  3QP1 A;  2J3W A;  4U0X A;  1SCW A;  5BOH A;  2Y55 A;  5I94 A;  4IVK A;  1NLY A;  1ESI A;  2WGV A;  1PZO A;  2WK0 A;  5E2E A;  4B9O A;  2JKG A;  1OT6 A;  2YKF A;  3MSH A;  2X01 A;  3VP0 A;  1OTA A;  3OPR A;  4II7 A;  1MWT A;  3PBT A;  1PRQ A;  3LUQ A;  4ZJ1 A;  4MN7 A;  4HH3 A;  3W4O A;  1Y4O A;  2J80 A;  4EU0 A;  4ZAM A;  5FI6 A;  1EWZ A;  2PU2 A;  4R38 A;  3BFE A;  3T1S A;  4LPZ A;  2W1T A;  1N9B A;  5EVE A;  2XF3 A;  2OWJ A;  2Y2G A;  5CRF A;  4DE3 A;  2JKT M;  1IYS A;  3C5A A;  3C8C A;  4KG5 A;  2V2F F;  4O8G A;  3P01 A;  5EM1 A;  3UPO A;  4HJ6 A;  5GHX A;  1PZP A;  4L9E A;  4BQM A;  1T1A A;  3HLF A;  4MLL A;  5FQK A;  4KG6 A;  3FC7 A;  4WZ5 A;  2K7S A;  2GNX A;  2KOI A;  1FQG A;  4EQI A;  3F1O B;  4YWZ A;  2X02 A;  1S0W A;  4RQ9 A;  5EOE A;  5HL6 A;  5U47 A;  2B5R A;  1QMF A;  5IU1 A;  4X68 A;  3HVF A;  3K3D A;  3SH9 A;  4R6L A;  3LIB A;  4NKP A;  3FPV A;  5FSR A;  2OLU A;  1XP4 A;  1K6S A;  1DP9 A;  2ZLY A;  5E2H A;  2VV6 A;  1MXO A;  4IJG A;  2C6W B;  2B95 A;  3V39 A;  3IXB A;  4OQG A;  3U4L P;  1VB6 A;  3T4T A;  3DW0 A;  4Y0O A;  3KSG A;  2HP6 A;  2V1Z A;  3Q1F A;  4Q0H A;  2WKP A;  3N4I A;  2PAV P;  2EFU A;  3HLD A;  4DE1 A;  1FIK A;  4QPR A;  4CLC A;  3T4O A;  4WEJ A;  1SKO A;  5GLD A;  3BY8 A;  4Y0T A;  2PYP A;  4MNR A;  3PBS A;  3FG8 A;  1LL9 A;  4Q8I A;  3SH7 A;  3BQA A;  4OQH A;  1H8Z A;  3N8R A;  4PM5 A;  5D3O A;  3NOT C;  5JYO A;  4R3J A;  1BUE A;  1XA7 A;  3PAG A;  5A93 A;  1NRF A;  4OH0 A;  3MMH A;  1L0E A;  1Y28 A;  2HP9 A;  2J3T C;  5FDH A;  1UWP X;  2V20 A;  4KZ4 A;  3HUN A;  5G18 A;  4H6J B;  4O01 A;  2VGJ A;  2PBY A;  5G4Z A;  2EWV A;  4QB8 A;  2Y2M A;  3UMD A;  2V0W A;  1RGY A;  1YLJ A;  3ULF A;  5HWT A;  2JKR I;  3KSF A;  4WF0 A;  4S2J A;  1K55 A;  2Y59 A;  2WKR A;  1ESU A;  2QHK A;  2WYX A;  1CJF A;  1U60 A;  3VP2 A;  3IWQ A;  3TRC A;  2L0W A;  4X6T A;  3T12 B;  2Q9M A;  2ZC3 B;  3H82 A;  2EX2 A;  5TBM B;  3IF6 B;  4GS9 A;  3KSI A;  3IHA A;  3OZH A;  4IUK A;  5M1A A;  1BYW A;  5AVE A;  2ZL1 B;  1DP6 A;  1W8Y A;  2HF6 A;  1S6R A;  4FH4 A;  2WGW B;  2Y79 A;  1ALQ A;  4UEY A;  4HNB A;  5CX7 A;  4QHC A;  1WA9 A;  2Y2O A;  4U3T A;  4I5S A;  3WRZ A;  3ZCZ A;  4R0Q A;  1GHM A;  2G2U A;  3OPH A;  1HD8 A;  4ZRR A;  4Y3I A;  1PW8 A;  1JWZ A;  4D60 A;  4I38 A;  1YM1 A;  4ID4 A;  4M4X A;  3PYP A;  4DMZ A;  4EXO A;  4P85 A;  1CEF A;  3OOV A;  4KEN B;  2OOL A;  1E25 A;  1XX2 A;  4GJ4 A;  4I3J A;  3GSG A;  2XH9 A;  3SS5 A;  1S66 L;  3IS2 B;  5CGS A;  3V3S A;  2ZOI A;  1PI4 A;  2XDM A;  2EX6 A;  2W3H A;  1YLY A;  4ETX A;  3IXD A;  3O3V A;  2RL3 A;  4AFI A;  1KDW A;  4ZJ3 A;  2ZQA A;  2XK1 A;  2J9O A;  2WGI A;  3MQO A;  4GW9 A;  1L2S A;  3MKF A;  4IED A;  1K38 A;  2VEA A;  3ZHH A;  4BMW A;  1FIL A;  3FYZ A;  3VFH A;  1K57 C;  2M7V A;  1YLT A;  3D9Y A;  4HQA A;  1GSV A;  2HJ9 C;  4B88 A;  4HH2 A;  3M6B A;  1SHV A;  1YMS A;  4KZ8 A;  1GSX A;  3WS0 A;  1F5M A;  5J8X A;  1JNU A;  3BQ8 A;  5CED A;  4P6Z S;  1KE0 A;  1K0K A;  1RP5 A;  1FR1 A;  5F1F A;  1TF1 A;  3GVB A;  3OCL A;  2ZOH A;  2BTF P;  2VV8 A;  4KZ7 A;  4XT2 B;  3MXS A;  2KLI A;  1FSY A;  1EI5 A;  5A90 A;  1Q2P A;  1OT9 A;  4X53 A;  2VV7 A;  3MZE A;  2QJ5 A;  3VSL A;  4BJP A;  3IWI A;  3FKW A;  2JKT I;  1IOU A;  2P9V B;  2L1M A;  1IEM A;  2XSS A;  1ES3 A;  2EX8 A;  2PRF A;  2XA7 S;  4DJ2 A;  3ZYT A;  1ES2 A;  4MBF A;  2XLN A;  4N92 A;  3R7W B;  3BLM A;  2P74 A;  5CTM A;  4I3A A;  5C5K A;  5FQI A;  2JKR M;  5DJT A;  4S2M A;  1NZU A;  3CZD A;  3DTI A;  4PHT A;  2WKQ A;  4BD0 A;  3MBZ A;  3IT9 A;  3NUL A;  3Q82 A;  1N4O A;  4FCF A;  3GDI A;  4OON A;  4QD4 A;  3DWZ A;  2EWW A;  3LGO A;  4WN5 A;  3CWF A;  4Y5F A;  3UPN A;  1ODV A;  4G3K A;  3L9K A;  5EM0 A;  3DWK A;  3ZG0 A;  1VHM A;  4JPM A;  3SZT A;  2W0N A;  3CUE C;  3LYX A;  3C4P A;  3IWO A;  5F69 A;  3TSG A;  2VGL S;  4GDB A;  1KE4 A;  4BD1 A;  5DJU A;  4EEP A;  3G34 A;  2MJ6 A;  1NZO A;  2PHY A;  2J8Y A;  2O9A A;  3EQV A;  2VGK A;  3C7U A;  3H7W B;  4YIN A;  3IF5 A;  3S7P A;  1VM1 A;  1S67 L;  3TOI A;  1H3Q A;  1YQS A;  4GCZ A;  4K08 A;  3B47 A;  1TS0 A;  3UME A;  2A24 A;  3T4Q A;  3TE8 A;  2BLS A;  5CXW A;  5I5L A;  4JGO A;  5FQQ A;  1BLH A;  1TVF A;  1KOU A;  2Q0O A;  1NRJ A;  5HDS A;  3LI9 A;  3CUE A;  3N8S A;  3T1X A;  1MWR A;  2HZ5 A;  2VLG A;  4P0M A;  3BW6 A;  3G32 A;  1TS8 A;  3V67 A;  4XXR A;  3GV9 A;  5GL9 A;  3E98 A;  1KGF A;  1LT0 A;  4KZB A;  2QJ7 A;  4X1L A;  1L0D A;  1SDE A;  4F3L A;  4RA7 A;  1PYY A;  4C3Q A;  1XXM A;  4NXF A;  4NG2 A;  5HD3 A;  4OOY A;  4WMC A;  1VQQ A;  3UB5 P;  4HIA A;  4OPY A;  1HVB A;  5L8M A;  3A3I A;  3MQQ A;  4ZJ2 A;  5HPF A;  3GRJ A;  4WM9 A;  3LR0 A;  3IQA A;  5DTT A;  3ZG7 B;  5AQB A;  4R4S A;  5AQA A;  4FD8 A;  3KO6 A;  2OWH A;  2Y2P A;  4CJN A;  3P09 A;  2INW A;  5EVI B;  4C6Y A;  5F5Y A;  1JWV A;  4OP8 A;  5HWV A;  1IYO A;  4X25 A;  1IYQ A;  1YLW A;  4EBP A;  5EPH A;  4JKT A;  4B4X A;  1JWP A;  3TW8 A;  3S7O A;  3NCK A;  4E3K A;  5FEG A;  3UO9 A;  4ARZ A;  2KDK A;  3JVV A;  4C75 A;  3KYQ A;  3ZFZ A;  1BUL A;  3FZC A;  4OQ0 A;  1TDL A;  2WUQ A;  5CHU A;  2VKS A;  1N9L A;  1W79 A;  2W1T B;  1W8Q A;  3CPT A;  4BBV A;  4E3M A;  4HBT A;  3N7W A;  2WKH A;  4XUX A;  2ZQ7 A;  3CHW P;  4QY5 A;  2HDU A;  4KZ9 A;  2W1R A;  3EGD C;  2IA2 A;  5F1G A;  1LL8 A;  1KVM A;  1CQA A;  2D02 A;  3MFX A;  4S2O A;  5DF9 A;  2VJW A;  5L10 A;  1L0F A;  2ZJ9 A;  2JBF A;  3IH8 A;  1FCM A;  3NEC A;  3V3R A;  4M3K A;  3VOZ A;  3C38 A;  3UDF A;  3A3J A;  2VGL M;  4QY6 A;  2EFX A;  2CC1 A;  1PW1 A;  1XJ4 A;  4KQO A;  4F94 A;  4B4Z A;  3LR5 A;  1CK3 A;  2UWX A;  2I9V A;  4BL2 A;  3HCY A;  1BLS A;  2A3U A;  4CLC E;  2FH5 A;  5HAR A;  1RCJ A;  2R9X A;  3PR6 A;  1FR6 A;  1OPX A;  2ZMA A;  5DF8 A;  2JKF A;  3GTC A;  1T18 A;  5HAI A;  3SOI A;  2M1C A;  4JLF A;  4IVI A;  4CLC D;  3NIA A;  4GD6 A;  5EFW A;  2ZQ9 A;  2B02 A;  4CLC B;  1MC0 A;  3LEZ A;  5JYP A;  3C7V A;  2X71 A;  3BWL A;  1SKO B;  5M19 A;  2WAF A;  1D7E A;  1NJ4 A;  1G28 A;  1J9M A;  4NXE A;  3TG9 A;  5FAS A;  3BYD A;  1ZG4 A;  4N9K A;  3LEQ A;  1D1J A;  1MWS A;  3KYE A;  5DFX A;  3NC8 A;  3AGE A;  1BZA A;  2OAP 1;  2Y91 A;  4BEN A;  3VV4 A;  2PR5 A;  4O0P A;  3UE1 A;  4GD8 A;  1NY0 A;  3A0V A;  4EWF A;  4S2N C;  2GZA A;  3MS6 A;  2ZQD A;  1TD5 A;  2DNS A;  2HDS A;  2EA9 A;  3OLO A;  3CMZ A;  4Z1W A;  1W63 Q;  1K6R A;  4QJG A;  1LI9 A;  5CER A;  3HRE A;  1P97 A;  1Y54 A;  2W3D A;  2IWC A;  2VA0 A;  5HL1 A;  1GA0 A;  2ZC4 B;  1VET A;  4P6B A;  1M6K A;  1MKM A;  2FFF B;  2R9W A;  4LV1 A;  3A0R A;  3T1Q B;  1BLP A;  4K91 A;  1K25 A;  4OOL A;  4DXC A;  4S2P A;  5FAT A;  1NYM A;  4S2N A;  2Y2K A;  3H82 B;  3M2K A;  2VX8 A;  4GS9 B;  5E43 A;  1S1Y A;  1ZTU A;  1OTD A;  4I39 A;  4OKP A;  3RJU A;  1K56 D;  5TGF A;  1K54 C;  2EX9 A;  2ZM2 A;  3LI8 A;  2ZC6 B;  4PM7 A;  2Z2M B;  3KSH A;  3UDX A;  2O9B A;  2W3F A;  3MFD A;  4MCW A;  3TJZ C;  1I2W A;  3MF0 A;  3HLW A;  3NBL A;  5F6A A;  4BWI A;  1E3U D;  1LLB A;  1ONH A;  3PXP A;  3LFV A;  4X56 A;  3HJK A;  5HDD A;  3BEC A;  3A3F A;  2PR6 A;  2Z6D A;  1MKI A;  3WRT A;  1XFN A;  1K54 A;  3QNC A;  5EOO A;  2DRW A;  4RX2 A;  3ZG8 B;  1ZHH B;  3WS1 A;  3FV7 A;  2D01 A;  4DKI A;  3KYZ A;  4PM6 A;  1KGG A;  4JGP A;  1O7E A;  4GHI A;  1GSW A;  3E4O A;  3S1Y A;  1I5Q A;  4OVD A;  3QP6 A;  4LLO B;  2H10 A;  3WS2 A;  4LV3 A;  5GHY A;  1T1B A;  4WLA A;  1FCN A;  3QP4 A;  3SW1 A;  3RFB A;  1ZKJ A;  1QME A;  2V0U A;  3UB6 A;  2Y4A A;  2XRN A;  4KUO A;  4QWO A;  3FPW A;  3NJA A;  4WZ4 A;  2QKP A;  4IBR A;  3IX3 A;  4MN5 A;  1FOF A;  3DAV A;  5DF7 A;  5G4Y A;  5CHJ A;  2L4R A;  5CHM A;  5CGW A;  1T1C A;  4JXG A;  3UB8 A;  2DCF A;  4DF6 A;  2H0T A;  1FCO A;  1V9Z A;  3CLO A;  4FSF A;  3NI9 A;  5CEB A;  3BRM A;  3GQZ A;  4YOF A;  3HUO A;  1TDG A;  2H28 A;  4DDS A;  1XGI A;  1W5D A;  3MXQ A;  4L0L A;  4KQR A;  4UAA A;  5LBR A;  1O07 A;  2J7V A;  1LSV A;  3G31 A;  3HLE A;  5HAP A;  3T4L A;  2KX6 A;  3MZD A;  1YLZ A;  4FOF A;  4LCM A;  5IT5 A;  3BLS A;  5A91 A;  2A49 A;  3R4K A;  1K57 A;  3O88 A;  3OC2 A;  1OME A;  1HLU P;  3T4J A;  3MZF A;  3RTY A;  4ZBE A;  1T19 A;  5HAQ A;  5L09 A;  1NLZ A;  1XPB A;  4S2L A;  3UPP A;  2Y2J A;  1DJB A;  3UE3 A;  1IFQ A;  2Y2I A;  3ZG5 A;  1NWZ A;  5KSC A;  4R70 A;  3O86 A;  4NXB A;  1P0Z A;  5IS1 A;  1NXY A;  5FL3 A;  3U2A A;  2E8J A;  4LRX C;  3IXH A;  1KVL A;  5DTS A;  4I3I A;  5DVA A;  3ZNT A;  4R1G A;  2ZQ8 A;  3CIT A;  1K4E A;  3VP4 A;  2E8I A;  3QNB A;  3WS5 A;  4EW7 A;  3ZDJ A;  1OTE A;  3OCN A;  1OJG A;  4XUZ A;  1XJ6 A;  1TS6 A;  4H8R A;  4HP9 A;  1IEL A;  3BFG A;  4HBU A;  3LO7 A;  1STZ A;  4JF5 A;  2V8C A;  3C30 A;  4DRT A;  3K3C A;  2XEP A;  1ERM A;  1YLP A;  3T4K A;  5FAQ A;  4LGW A;  2R78 A;  4KZ3 A;  4K0X A;  3QP2 A;  3B33 A;  4PKY A;  3VP1 A;  5AQ7 A;  3C4O A;  4R3A A;  3F1N A;  3Q81 A;  2W27 A;  3CG5 A;  2GX5 A;  4DN0 A;  1H8Y A;  4R3B A;  5CEC A;  3Q7V A;  2A24 B;  2JN7 A;  4Y17 A;  5AVF A;  4E3J A;  2EXA A;  2EXB A;  3UE6 A;  1XGJ A;  2OLV A;  5J4E A;  1F9I A;  4PM9 A;  5TR7 A;  4RVA A;  4MBH A;  2J9P A;  4FTX A;  4JF6 A;  1BSG A;  1IKG A;  3E4Q A;  4OOM A;  3N8L A;  3G4P A;  3LR4 A;  3A0S A;  4JXS A;  2ZC5 B;  3E4P A;  4X69 A;  4ETZ A;  4Q0I A;  5TJJ A;  4F3L B;  3HJI A;  3L7H A;  2DMW A;  3BEB A;  4KG2 A;  3NDE A;  1PWD A;  4GLQ A;  2PYR A;  5FAP A;  4E6X A;  1P9R A;  3QHY A;  2W3G A;  4UHU A;  3G30 A;  4JGR A;  2ZC7 A;  4JGQ A;  3EWK A;  4PM8 A;  3PTE A;  3DBA A;  3UDI A;  1JTG A;  1N9N A;  3PBN A;  5HPI A;  2HDQ A;  3NDG A;  1JTD A;  5FI7 A;  4OLG A;  2YKH A;  3EEH A;  3G2Z A;  3PHY A;  4HI4 A;  2IWD A;  3IX4 A;  3MQ0 A;  4PPR A;  3IXG A;  4LV0 A;  5GLB A;  2ZD8 A;  2Q9N A;  4NET A;  5EVI D;  4EEU A;  2JE5 A;  3UB7 A;  3AGF A;  3IBR A;  2P04 A;  1CEG A;  4EV4 A;  4E3L A;  5A92 A;  1MPL A;  4ARZ B;  3NY4 A;  4E04 A;  3W2Z A;  4MMN A;  4YFM A;  3LIF A;  2V8F A;  5FDS A;  3F1P A;  1OTI A;  4ZDX A;  3CPT B;  1PWG A;  3CI6 A;  3I7J A;  3A3D A;  3QP5 A;  1SKF A;  1VEU A;  4EBL A;  1GCE A;  2RCX A;  3DTM A;  2QYB A;  1YPR A;  2PU4 A;  4Y15 A;  4JXW A;  2O0Y A;  2WZX A;  1GHP A;  3IH9 A;  1XKZ A;  5HWW A;  1LI0 A;  3HLG A;  3IHB A;  2ZM0 A;  3ZNY A;  3UN7 A;  4FH2 A;  2HV1 A;  2WKE A;  2WAE A;  3RH8 B;  3SS4 A;  1H0M A;  4JXV A;  2WAD A;  4UA9 A;  3UNW A;  3BFF A;  3T4S A;  3BY9 A;  4Y2F A;  2I72 A;  4GOG A;  3ZVW A;  5FQ9 A;  3S7N A;  2PBD P;  5EVL A;  4UA7 A;  4BL3 A;  4WZ5 C;  3B3X A;  3ITA A;  3LY3 A;  4DDY A;  3EOI A;  5HSQ A;  1UWN X;  3WWX A;  1L3L A;  1KGE A;  2WZZ A;  3W4Q A;  4EER A;  1G6A A;  1G68 A;  2PD8 A;  3OPP A;  3ZGA B;  2G2W A;  2JHE A;  4MDZ A;  5AQ9 A;  1H8M A;  3T50 A;  2PDR A;  4KQQ A;  5KZH A;  3OPL A;  3WS4 A;  1ES4 A;  3G35 A;  4GN2 A;  4WL9 A;  1GHI A;  3AGD A;  5DKL A;  4ESP A;  3GMW A;  3S7Q A;  2WKI A;  4CPK A;  2OSU A;  2B18 A;  4DXB A;  2V1A A;  3VP3 A;  4OLD A;  3MXR A;  4DE0 A;  3E2L A;  4MBK A;  1BTL A;  4IUH A;  3HBR A;  4EQ1 A;  2PT7 A;  3F1O A;  4GKU A;  4PAU A;  5KIZ A;  3QP8 A;  4CLC C;  4CQH A;  3DTK A;  4EET B;  1WYB A;  1WYC A;  2A2L A;  1XJ3 A;  2XFS A;  5L2F A;  1DP8 A;  3JVU A;  3UB9 A;  1DJA A;  4EUV A;  3DTE A;  1A0K A;  1KDS A;  1OJ5 A;  5KMW A;  1CI8 A;  2Z2L B;  5HDC A;  3HLC A;  1W63 M;  1F98 A;  1CF0 A;  4IHQ A;  1FSW A;  1J3W A;  4N9L A;  1VET B;  5DKK A;  4E3I A;  5EEC A;  1L0G A;  5GLC A;  3LCE A;  5AJG A;  2ZBB A;  1C3B A;  2UV0 E;  3P7N A;  3LIA A;  3VOY A;  4JF4 A;  1K55 C;  4GDN A;  1MBL A;  5EV0 A;  5M18 A;  2H5S A;  5HD5 A;  1ONG A;  4DE2 A;  1ERQ A;  2J3T D;  4LCL A;  2QPN A;  1ERO A;  3VSK A;  3VE4 A;  3ITB A;  4KUK A;  4UQI S;  1MZU A;  1GA9 A;  1P9W A;  2K2N A;  5A8B A;  3FKV A;  5FI2 A;  3BFD A;  4D2O A;  3NHQ A;  3B42 A;  2XD5 A;  1PNE A;  4R23 A;  5HZH A;  1X0O A;  1M40 A;  3IF6 C;  4H6J A;  2IWB A;  1PIO A;  4EES A;  4PMA A;  4Y7P A;  2G7U A;  3MR0 A;  3IBJ A;  4GB7 A;  5L07 A;  3LIE A;  4HES A;  2Y8H A;  1Q2Q A;  4WEL A;  5DTK A;  1KE3 A;  3S4X A;  4S2K A;  1DJC A;  4HHD A;  1PFL A;  3ZQ5 A;  4E3N A;  2P7J A;  2ZMV A;  3A3E A;  4GHI B;  4LRY C;  4NK3 A;  2QMI A;  2XFT A;  3BJN A;  1YKD A;  3K2N A;  3LID A;  5TBM A;  1ACF A;  1HZO A;  1K56 A;  4NXG A;  3IF6 A;  3D72 A;  1SZV A;  2HJE A;  4JBF A;  3SH8 A;  4N1X A;  5F68 A;  3ZG9 B;  2ZL1 A;  5CGX A;  3G6O A;  1AWI A;  3Q07 A;  2WGW A;  5F83 A;  3ICY A;  1S1Z A;  2ZMF A;  4K0W A;  2P08 A;  4ME4 A;  4DJ3 A;  3W8K A;  2JCH A;  5GHZ A;  1ZC2 A;  1E3U A;  3PAE A;  5J3W A;  2FZ0 A;  3E0Y A;  5F82 A;  4X55 A;  4FUW A;  2ACG A;  2QZ6 A;  2OV5 A;  1TS7 A;  4Q0J A;  2JC7 A;  2GJ3 A;  4L9G A;  4S2I A;  1ES5 A;  1PI5 A;  4HEF A;  5TFQ A;  4OQI A;  5MC7 A;  3IS2 A;  3MKE A;  4BLM A;  4Y0U A;  1LSX A;  3UY6 A;  4HJ3 A;  2Y2L A;  4HY8 A;  4X1M A;  2Y2Q A;  1YSQ A;  3RXX A;  3UE0 A;  3JYI A;  5IHV A;  3G2Y A;  3BFC A;  1LHY A;  4G3V A;  2PD7 A;  4LEN A;  2QWS A;  2XD1 A;  4QU3 A;  3M6H A;  3EEA A;  4RX3 A;  5FQJ A;  5DFY A;  3FWL A;  2LB9 A;  2NUT C;  1YSP A;  2H0Y A;  5HFO A;  5EUA A;  1D06 A;  1DY6 A;  3NOU C;  2NUP C;  2V9A A;  4KZ6 A;  4UQI M;  2LB5 A;  4E3O A;  4BBT A;  1G5U A;  4O7D A;  2XGN A;  5GLA A;  1WE4 A;  1K4F A;  4KQD A;  4A5R A;  1IYP A;  1W7F A;  5CTN A;  5FAO A;  2BAS A;  3VFF A;  1AXB A;  1MWU A;  3VE3 A;  2XR0 A;  2HDR A;  2HGV A;  4RYE A;  4XT2 A;  3EGX C;  3N6I A;  3OBF A;  4R4R A;  3VOL A;  4EBN A;  4OPQ A;  3V50 A;  3LR3 A;  1NYY A;  2HP5 A;  4WYY A;  5FEF A;  2FFY A;  3T1R A;  3PBO A;  5K5B A;  1F2K A;  2XQZ A;  3HLB A;  5EE8 A;  1G6O A;  4WUJ A;  3F1N B;  3EQU A;  2O9C A;  1XFQ A;  2P9V A;  1YT4 A;  3Q7V B;  1H5X A;  1LL5 A;  3PBQ A;  4L9F A;  5KSH A;  5E2G A;  2GDN A;  1V9Y A;  4HOI A;  4N1H A;  1BT5 A;  1SDN A;  4Z9Q A;  3R7W A;  1S4R A;  4OPR A;  1S4S A;  2V1B A;  4E6W A;  3HL9 A;  4LRZ E;  3IX8 A;  4BBU A;  4WEK A;  3LIC A;  4U0T A;  3BM6 A;  3M2J A;  3V5M A;  3VMA A;  3GR2 A;  4HJ4 A;  4MN6 A;  2Y2N A;  4UA6 A;  4HP4 A;  1I2S A;  4GZB A;  2W3E A;  2CMN A;  1PWC A;  4PKY G;  4KZ5 A;  1N9O A;  1JVJ A;  4WMC D;  5HX9 A;  1E4D A;  5E2F A;  1DRM A;  3D4F A;  2M7U A;  4EUZ A;  3PBR A;  3KX0 X;  4P87 A;  3W4P A;  1CI9 A;  1LSW A;  1TEM A;  3H7W A;  3NOP C;  4WBG A;  1YMX A; 
#chains in the Genus database with same CATH homology
 4D60 A;  1Y4O A;  1SKO B;  4ESP A;  3T1S A;  5FEF A;  3T1R A;  5EVE A;  1F2K A;  3CPT A;  3LEQ A;  2V8F A;  1D1J A;  5FDS A;  3KYE A;  1PNE A;  1Z09 A;  4X1M A;  3CHW P;  5EM1 A;  3CPT B;  3T1X A;  2VK3 A;  2HZ5 A;  1VEU A;  3MS6 A;  1VEU B;  1YPR A;  1CQA A;  1HLU P;  4FTX A;  2PRF A;  4X1L A;  3NEC A;  1A0K A;  1PFL A;  1CJF A;  3UB5 P;  3L7H A;  1VET A;  3T12 B;  1ACF A;  1CF0 A;  1FIL A;  1SZV A;  3T1Q B;  1J3W A;  2E8J A;  1VET B;  3D9Y A;  2PBD P;  2ZL1 A;  3NUL A;  1G5U A;  4QWO A;  1AWI A;  2B95 A;  2ZL1 B;  3U4L P;  3LGO A;  3DAV A;  3L9K A;  2JKF A;  4X25 A;  5EM0 A;  2JKG A;  1K0K A;  5EV0 A;  2PAV P;  3MSH A;  4FUW A;  1FIK A;  2ACG A;  1PRQ A;  2BTF P;  2V8C A;  1SKO A;  5FEG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...