3GDIA

Mammalian clock protein mper2 - crystal structure of a pas domain fragment
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
306
structure length
269
Chain Sequence
GSSYSMEQVEGITSENADMFAVAVSLVSGKILYISNQVASIFSDAKFVEFLAPHDVSVFHSYTTPYKLPPWSEKSFFCRVSVGKEIRYQPFRMTPYLVKVQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAPPCPEEKTPHPSVQELTEQIHRLLMQPVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Period circadian protein homolog 2
publication title Structural and functional analyses of PAS domain interactions of the clock proteins Drosophila PERIOD and mouse PERIOD2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 58
structure length 269
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3gdiA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3gdiA02
4H6JA 3VE4A 4EXOA 3F1NB 1S4RA 4R38A 1LT0A 3G6OA 1TS7A 3T50A 5A8BA 1LSVA 3UB9A 4KQDA 1S1YA 2PDRA 2QHKA 4DJ2A 3UMEA 4BBVA 3H9WA 5IS1A 2W0NA 4HI4A 3NOTC 1S67L 4XT2A 4E04A 4NXFA 3A0VA 1LSWA 1UWNX 1XJ4A 2PD8A 5HSQA 1N9OA 5HD5A 2M1CA 1V9YA 4LRZE 1OJGA 4GHIB 4JGPA 4KUOA 4HQAA 4WUJA 3LIAA 1XJ6A 4JGOA 4NXGA 2L1MA 2H28A 3KX0X 5KIZA 2EA9A 5G4ZA 3ICYA 1G28A 4HH3A 3NOUC 1OT9A 3MXQA 1N9NA 4EEPA 5HDCA 4B9OA 2V0UA 5HD3A 3H7WA 4EQ1A 4PKYG 4WF0A 4EEUA 3IS2B 4LRYC 4I38A 2VV7A 3GECA 3HJKA 3LIEA 2INWA 4H6JB 3FG8A 1JNUA 3LYXA 2A24A 2P7JA 2Z6DA 1T1CA 3UE6A 1OTEA 2HV1A 3F1PA 1DP8A 4KUKA 3MFXA 5HDDA 1GSWA 3CWFA 2WKQA 3K3CA 2OWJA 2QJ5A 2VV6A 5J7EA 2PR5A 3UB6A 4MN6A 4R6LA 4XT2B 2V0WA 2WKPA 3MQQA 1LL8A 3VOLA 2KDKA 3LUQA 2WKRA 1KOUA 1P97A 2R78A 1F9IA 3P7NA 3MR0A 4GS9A 3E4OA 1Y28A 1ODVA 1OTDA 3F1OA 3LIDA 3FC7A 4YWZA 1GSXA 4F3LA 1T1BA 5DKLA 5TBMA 5DKKA 4NXBA 2QWSA 3A0SA 3VE3A 1S1ZA 3LIFA 2KX6A 3H7WB 1TS0A 1NWZA 2J80A 2BASA 1DRMA 3BWLA 4LPZA 4R70A 4I3AA 3EEHA 1VB6A 2PHYA 2B02A 3BY8A 5F68A 1WA9A 4I3IA 1UWPX 2CMNA 2V1AA 3LIBA 1LSXA 3RTYA 1F98A 4WN5A 1TS8A 2VLGA 1MZUA 4WL9A 3CLOA 4GHIA 2A24B 1OTBA 4I5SA 3F1PB 4K08A 3H82A 1S4SA 3IBRA 2Z6CA 2JHEA 4L9GA 1V9ZA 3OLOA 5DJUA 3UB8A 5I5LA 1D06A 4GW9A 2I9VA 5DJTA 4HOIA 2ZOIA 4EW7A 3ULFA 4EERA 2D02A 2PYRA 2V1BA 2PD7A 3GDIA 3NOPC 2YKHA 4JGRA 2GJ3A 5HWTA 3MQOA 4MN5A 5HDSA 4GS9B 3LICA 3F1OB 2QKPA 4I3JA 1D7EA 4NXEA 4EESA 4F3LB 5HWWA 4L9EA 3C8CA 4HJ6A 3PHYA 5TBMB 1OTAA 3MJQA 4DJ3A 2OOLA 3B33A 4HP4A 4HP9A 1GSVA 3E4PA 1X0OA 2QJ7A 3C2WA 1OTIA 3F1NA 3UB7A 3NJAA 4M4XA 3UMDA 3ZQ5A 1EW0A 4HH2A 5J3WA 4GCZA 4HJ4A 1T19A 3HJIA 3NHQA 3RH8B 2D01A 1DP6A 4LRXC 2ZOHA 2JN7A 3K3DA 4I39A 1XJ2A 5IU1A 5J4EA 3H82B 1XFQA 5HZHA 4JGQA 4HHDA 3BY9A 1XFNA 4HIAA 4RQ9A 4EETB 4BBTA 5EFWA 2VEAA 4L9FA 3SW1A 4BBUA 1T18A 2L0WA 1N9LA 5F69A 1OJ5A 1UGUA 4LLOB 2VV8A 1OT6A 3E4QA 4R3AA 1P0ZA 1T1AA 2PYPA 3D72A 5F6AA 3CAXA 1BYWA 5G4YA 2K7SA 2L4RA 4PKYA 2ZBBA 4HY8A 2OWHA 5HWVA 4HJ3A 1DP9A 3LI8A 5F5YA 1S66L 3A0RA 2PR6A 2V9AA 3IS2A 1XJ3A 2YKFA 5AVEA 1TS6A 2W27A 5AVFA 3EWKA 4WLAA 3PYPA 3LI9A 4HNBA
chains in the Genus database with same CATH superfamily
1VEUB 2J8YA 1NRJA 3VE4A 3AGEA 2VKSA 1TDGA 3PR6A 4CLCD 4EU0A 3ZG5A 5L8MA 1JTGA 4PPRA 1LSVA 2E8IA 1KGFA 5DVAA 4X53A 2PDRA 4X56A 3EOIA 4LGWA 4ZJ3A 4HI4A 3CI6A 2H5SA 1CQAA 5CX7A 4LV3A 4EWFA 1HTZA 4E3MA 2OV5A 2G2UA 3UE3A 1UWNX 4UQIM 2EX2A 4R3BA 5EVIB 1NYYA 1Q2PA 4PHTA 2ZQCA 3QNCA 3HLEA 4GN2A 1W8YA 5CHUA 4JGOA 3E2KA 3MXSA 3AGDA 1K6SA 4E3IA 1D1JA 5KIZA 2EA9A 3ICYA 1KGGA 4X68A 1W8QA 3BFEA 4BMWA 1RP5A 5EPHA 3VP3A 4B4ZA 1CJFA 5TJJA 4EEPA 3KSHA 5HD3A 3GVBA 3MF0A 4DE1A 4EQ1A 3BECA 1G6OA 3ZNTA 1E3UD 5FL3A 4BENA 1LLBA 4EEUA 3MBZA 1BT5A 5FI7A 2JBFA 4B88A 2Y91A 1M6KA 2Y55A 3LY4A 3UE0A 5GHZA 3OCNA 4S2JA 1Z6FA 1GHIA 2WKIA 3A3JA 4PM6A 5CHMA 2C5WB 3BEBA 3Q7VA 3D4FA 4K91A 2A2LA 3HL9A 3RXXA 2AVXA 3HUOA 4Z1WA 2A24A 3FWLA 3BFDA 3B47A 3FV7A 3F1PA 1DP8A 2DMWA 3BLMA 4KUKA 3R7WA 4QB8A 4OQIA 3UPNA 5HDDA 2OLVA 2QJ5A 2QYBA 3MS6A 3BYDA 5J7EA 3FPWA 1MBLA 4MN6A 4AFIA 4KZBA 1BZAA 4XT2B 5CXWA 3MQQA 1XA1A 2PBYA 2KDKA 3LUQA 3CITA 5DF8A 3QP2A 4MCWA 1MKMA 2ZQ8A 1F9IA 4NETA 2WKEA 4GKUA 3V67A 2XA7S 4OONA 4OQ0A 3FC7A 2WGWB 4YWZA 1K6RA 1GSXA 1ZC2A 1CEFA 3UDFA 1VM1A 3C38A 4S2IA 4JF4A 1E4DA 5FQ9A 2VA0A 4ZTKA 1MWUA 2FZ0A 1KDSA 4NXBA 5EVLA 1BLPA 3H7WB 1TS0A 2HP6A 4KG6A 1GCEA 2BLSA 1SHVA 3PBNA 3N8SA 3L7HA 3U2AA 4RX2A 3MZDA 4P85A 3EEHA 3RFBA 4QY6A 1ONGA 1NLYA 2B02A 2X01A 4QPRA 2WYXA 3L9KA 2CMNA 2V1AA 3GV9A 4ZAMA 4IEDA 1LSXA 1YSPA 2H0YA 2VLGA 3GQZA 2JE5A 4MBHA 5A91A 1NLZA 3UPPA 3H82A 4OVDA 4IUKA 4ME4A 4HEFA 2VGJA 4GW9A 4OPYA 4HOIA 5DJTA 2IWCA 2XH9A 3ULFA 2PYRA 4EBPA 3N8RA 1KE0A 2PD7A 3ZGAB 2WZZA 3QP4A 3E0YA 3Q1FA 5F1GA 4B4XA 5JYPA 2HDUA 3F1OB 2QKPA 4R3JA 4EESA 4C75A 4F3LB 4L9EA 2Y2QA 1W79A 3W2ZA 1PWDA 3IXBA 2WKHA 2XD5A 5FQIA 3KYEA 1G6AA 4ETXA 1AXBA 4DJ3A 3IH8A 2XFSA 1FOFA 1W63Q 2W3GA 4O8GA 5G18A 3G35A 4EUZA 4S2LA 4HP4A 3SOIA 3ITBA 1H5XA 1IYOA 2KOIA 2ZL1B 2Y2LA 5I94A 1HD8A 1VEUA 4Y3IA 1X0OA 5E2GA 3A3DA 4P6ZS 4OQHA 3UB7A 2HDQA 2KLIA 2A3UA 3ZQ5A 4IJGA 4LCLA 4LFUA 3O87A 5F83A 5HFOA 1P9WA 3NHQA 2ZC6B 2K2NA 3PBOA 2ZOHA 3K3DA 4I39A 1L2SA 5LBRA 5IU1A 5IHVA 3M2KA 3SS4A 4NKPA 5HZHA 2WGVA 5DTSA 2LB9A 3VSKA 2Y8HA 1L0EA 3T4TA 1SDEA 2BG1A 5EV0A 1ES3A 5EVIA 5CTMA 2JC7A 4O7DA 1LHYA 3W4OA 1T18A 3V50A 1N9LA 5F69A 1OJ5A 3C30A 4JXGA 4KZ5A 4LLOB 4UQIS 4G3VA 1TDLA 1L0FA 3GRJA 2ZM2A 1W63M 3WWXA 1CEGA 2XGNA 2XROA 5HPIA 3D72A 3JVVA 4O01A 3RJUA 5EVEA 1BYWA 3OPRA 1VQQA 4GLQA 1HLUP 2L4RA 2ZC5B 1YQSA 4PKYA 4MLLA 3DW0A 4NK3A 2ZD8A 2PRFA 4CJNA 1PZPA 4E3NA 2PR6A 3HUMA 4IVIA 3UE1A 2W27A 2J7VA 2O0YA 3W4QA 3EWKA 3IX8A 4DF6A 1SDNA 2EXAA 4G3WA 4R23A 3HBRA 3ZCZA 1IKIA 4E3LA 5L10A 3CJMA 4EXOA 3GTCA 1S4RA 1LT0A 1TS7A 1I5QA 4UHUA 3ZVWA 3UB5P 3NCKA 4JXWA 4Y0OA 3H9WA 4YNRA 5IS1A 4MN7A 2W0NA 4FTXA 2P04A 4OPZA 3U4LP 2P9VB 2Y2IA 2OAP1 3NOTC 4XT2A 1MPLA 2DCFA 4E04A 2JKRM 1XJ4A 3OPHA 2O9AA 1O07A 2ZMFA 4R4RA 1ZTUA 3QHYA 2EFUA 4S2KA 1L0GA 3V3SA 1BLHA 5A93A 3T1XA 3CZDA 3LO7A 4KUOA 2FH5A 2EX9A 1PIOA 2WGWA 4WUJA 3LIAA 1YT4A 3VP1A 3T4SA 2H28A 3KX0X 5C5KA 4PM8A 5G4ZA 4MEZA 3WS2A 1ESIA 1EROA 3MXQA 2RL3A 1YLJA 4U0TA 5EVIC 5L07A 5E2EA 4L0LA 3H7WA 3DAVA 4LCMA 4X69A 3N4IA 3IX4A 2P74A 5FAQA 3IS2B 4LRYC 5GHYA 3HLGA 4I38A 4X25A 2HP9A 4O0PA 5U47A 4X6TA 1K57A 3IXDA 2EX6A 1A0KA 1H8MA 1JWPA 2WK0A 3TOIA 1N4OA 3LIEA 3UO9A 4H6JB 5GLAA 3UDIA 1STZA 1JNUA 2Z6DA 1T1CA 3UE6A 2HV1A 4OOMA 1TF1A 3GMWA 5M18A 2WKQA 2ZC7A 3K3CA 3TSGA 4JBFA 2FFYA 1IYQA 4MNRA 3LGOA 5E43A 3P01A 2V0WA 2WKPA 1L0DA 3VOLA 2HZ5A 3M2JA 3IWIA 1Y4OA 5FAPA 4Q0JA 3P7NA 1K4EA 3V3RA 1WE4A 5BOHA 3E4OA 1Y28A 3AGFA 3F1OA 4UA9A 1NZOA 5FI6A 4F3LA 2GNXA 2V2FF 1XGJA 1P9RA 3PAEA 5GLDA 4OQGA 5DKKA 3PBSA 4KZ7A 4K0WA 3HUNA 3B42A 1M40A 3T1QB 3LIFA 3FKWA 1DRMA 2ZL1A 4ZDXA 1WYCA 1BLSA 2XDMA 1TVFA 3N8LA 4LV1A 3A3EA 1UWPX 4DXBA 1YLWA 2XK1A 3LIBA 4WN5A 4CPKA 1IELA 1TS8A 3QP1A 2I72A 3T4OA 1MZUA 4WL9A 4GHIA 1OTBA 4I5SA 5HW3A 4OH0A 3VV4A 2A49A 2MJ6A 3G2YA 4EBLA 1H3QA 4K0XA 3ZG9B 2ZQAA 2JHEA 3LFVA 1XX2A 3HLWA 3OLOA 3K2NA 3UB8A 3ZVTA 1K57C 4N9KA 5I5LA 1D06A 1PI5A 1FIKA 2JKFA 1BLCA 2D02A 2GX5A 2PT7A 2V1BA 3MZFA 2K31A 2ZJ9A 2PU2A 4IBRA 3GDIA 3NOPC 2YKHA 3T12B 1SKOB 1KE3A 3CMZA 2GJ3A 5HWTA 4MN5A 2XF3A 4WBGA 2W3FA 1N9BA 1BTLA 4KENB 1ZG4A 4IVKA 4OPQA 2Q9MA 1KGEA 3C8CA 2O9CA 5FDHA 3PHYA 4KG2A 4UEYA 1YSQA 1YMSA 3NECA 2QMIA 3MJQA 5HAIA 3B33A 3DWKA 3BRMA 2PAVP 2VGLM 4HP9A 4WZ4A 4ESPA 1CK3A 3W8KA 1BULA 3C2WA 1ERQA 5EVID 5HX9A 1ALQA 3G31A 4HBUA 2IWDA 4E6WA 3UNWA 4PMAA 4N92A 3DWZA 2ZLYA 2NUTC 4M3KA 3D3OA 1G68A 1U60A 5HPFA 1FILA 1MY8A 4ID4A 1DP6A 2J3TC 2P9VA 3IX3A 1XFQA 3ITAA 1FCMA 2Q9NA 4S2PA 3BY9A 4KZ6A 1XFNA 4HIAA 3UY6A 5JYOA 4EETB 1ES5A 4L9FA 5DTTA 2HDRA 4BLMA 3SW1A 4BBUA 1J9MA 2IA2A 2VGKA 1UGUA 4GDBA 3LEZA 1KDWA 4Q0IA 4WELA 1OT6A 3OBFA 4R3AA 2PYPA 1S0WA 5FATA 2B5RA 4Q0HA 1K38A 3ZG0A 3NULA 4X55A 2HP5A 5TGFA 3LI8A 4KZAA 1S66L 1H0MA 2B18A 3IS2A 5AVEA 1EI5A 5EOEA 4MDZA 4KZ9A 5AVFA 3BW6A 3HLDA 3TG9A 2M7UA 4XUXA 4KG5A 4Y13A 3A3FA 4H6JA 2Z2LB 4FD8A 4EQIA 5DTKA 2NUPC 3F1NB 2OSUA 3ZNYA 4F94A 1DJAA 3NIAA 4QD4A 4FH4A 4FCFA 5A8BA 2ZQ9A 4BD0A 3PBTA 2W3HA 4KQDA 3MKEA 3C4OA 1MKIA 2Y2PA 3TE8A 1JTDA 2QHKA 1ZKJA 4XXRA 3UMEA 4DJ2A 3UN7A 4D2OA 4EV4A 5CGXA 4OKPA 1RGYA 3FKVA 4Y15A 4YOFA 3KSGA 2PBDP 3G34A 3S1YA 3A0VA 1LSWA 4JXSA 3ZDJA 3LY3A 4X1MA 4BL3A 1K54C 5HSQA 1FR6A 4WEJA 5HD5A 2M1CA 4GHIB 3WS1A 4Y5FA 4HQAA 3BJNA 4WEKA 4CLCC 2H10A 2HJEA 1IOUA 1FCNA 4JF6A 5KSHA 2G2WA 1XGIA 1G28A 2FFFB 4HH3A 1K56A 3NOUC 3DTIA 2EWWA 4WMCA 5FQKA 1N9NA 2V8FA 4E6XA 4QWOA 1BUEA 4DKIA 5FASA 3LCEA 4X1LA 1KVMA 5KZHA 4G3KA 1S6RA 2ZQ7A 3ISGA 2VZWA 3BM6A 2JKTM 4KZ4A 5DFXA 1IYPA 1PNEA 4R4SA 4OOYA 2Y2GA 1PWCA 2VV7A 3O88A 1YPRA 1QMFA 3HCYA 2EX8A 1WYBA 5EM1A 2H0TA 5HL6A 3HJKA 1Q2QA 1YLTA 2Y4AA 4GD8A 1CF0A 3DBAA 3HLBA 2C6WB 2XFTA 1ACFA 1QMEA 3T4LA 3FG8A 3LYXA 3G2ZA 2OLUA 1H8ZA 5J8XA 3ZFZA 4B93A 1GHPA 1GSWA 1FSWA 1DJBA 3EGXC 4EUVA 5EUAA 2UV0E 5CEBA 4YFMA 4Y7PA 5DF9A 4N9LA 5CTNA 1MWSA 2PR5A 5EECA 2HF6A 4R6LA 1GHMA 1NYMA 1LL8A 3I7JA 2DRWA 3T1RA 2JKGA 1SKOA 1KOUA 2WKRA 5HARA 1ES4A 1CI8A 2R78A 5GLBA 3C5AA 4CLCB 1GA9A 3R4KA 1PW1A 1ODVA 1OTDA 3E98A 2Y2JA 2V8CA 3PTEA 3QNBA 3KYQA 3NBLA 5F82A 1FCOA 3DTKA 1T1BA 3NC8A 5L2FA 3EEAA 1ESUA 1K55A 5DKLA 1JWZA 3CPTB 3O5YA 2Y79A 4Y0TA 1FSYA 1IFQA 2WAEA 1EWZA 4Y17A 3TRCA 1DY6A 3A0SA 5DFYA 1YMXA 1NWZA 2J80A 4LENA 3PAGA 1YKDA 3IF5A 4LPZA 4RA7A 4GNUA 2Y2KA 3KSFA 4R1GA 4NG2A 4R70A 4BL2A 5CEDA 4QHCA 4DDYA 2PHYA 4JF5A 1F5MA 1C3BA 1YM1A 3BY8A 4H8RA 1WA9A 3N6IA 4I3IA 4U0XA 3NI9A 4PAUA 5FDSA 3RTYA 5KSCA 3T4JA 4C6YA 3SS3A 3VFHA 2LB5A 4K08A 4XUZA 2HJ9C 4PM9A 3IBRA 4II7A 2EWVA 3MQ0A 3G32A 1V9ZA 5DJUA 1GA0A 4LV0A 3W4PA 2DNSA 3MKFA 3TJZC 4D60A 4N1HA 4EW7A 1PYYA 2WGIA 4EERA 3VOYA 4Y2FA 4JGRA 3CHWP 3SZTA 3PBRA 5HDSA 4GS9B 3DTEA 2RCXA 4FSFA 4P6ZM 3CUEA 1ZG6A 3KYZA 4KQRA 3LEQA 4Y0UA 3Q07A 2Z2MB 4NXEA 3QP6A 1NJ4A 1YLZA 4HJ6A 1Y54A 3NDEA 5TFQA 2J9PA 3ZHHA 5TBMB 4GOGA 1MXOA 4GD6A 1LL5A 2VJWA 4OLDA 4GB7A 4RX3A 5EE8A 3P98A 1PW8A 2CC1A 4OP5A 1I2SA 2WZXA 4U3TA 1ES2A 3F1NA 4P0MA 5AJGA 5CECA 2JKRI 1XP4A 1LI0A 1K55C 4ARZB 3IF6B 4DE2A 3BFGA 4HH2A 3VOZA 5J3WA 4GCZA 5FEFA 1T19A 2XR0A 1VHMA 3Q7ZA 4JLFA 4IUHA 2D01A 2EXBA 1G5UA 4QY5A 4LRXC 3V5MA 2R9WA 2JN7A 3IWQA 3OPLA 5J4EA 5A92A 1FR1A 1YLYA 3VSLA 5E2HA 1KVLA 4S2NA 4HHDA 4KZ8A 3LR4A 2V20A 2OAQ1 3WS4A 1LL9A 2Y59A 1ERMA 1YLPA 3VP4A 3JYIA 3M6HA 4UAAA 4RQ9A 3S7NA 1O7EA 1SCWA 3VP2A 5HAQA 2PU4A 1CI9A 2X71A 2VK3A 5A90A 3UPOA 5FAOA 1L3LA 1VETB 1OPXA 4BQMA 1T1AA 4MBFA 2V1ZA 3HREA 1Z09A 5F6AA 2K7SA 3UDXA 3ZG8B 3LR3A 5L09A 3BQ8A 4NEED 3T4KA 2P08A 2ZQDA 1K4FA 1W7FA 5F5YA 3MZEA 3DTMA 3WRTA 1TS6A 4BJPA 3E2LA 5K5BA 3IXGA 3Q82A 1DJCA 3IH9A 2ZMVA 4GDNA 4JPMA 4RYEA 1F2KA 2QPNA 1IKGA 3CUEC 1FQGA 3NDGA 4ZBEA 3LI9A 4HNBA 4BD1A 1MWRA 3G4PA 1SZVA 2R9XA 4CQHA 4R38A 3ZYTA 2BTFP 3O3VA 3G6OA 5AQ7A 2J3WA 1NRFA 5CHJA 3T50A 4PM5A 2WUQA 4DXCA 3UB9A 1S1YA 1JWVA 2Y2NA 3FZCA 3S7QA 3O86A 4BBVA 3QP8A 4EBNA 2EFXA 2W3EA 1PWGA 1K56D 4OOLA 1K54A 4Q8IA 4WMCD 1S67L 5M1AA 4NXFA 3BQAA 2PD8A 3OC2A 1N9OA 3SH8A 1PRQA 4CLCA 1V9YA 4ZJ2A 4LRZE 1OJGA 2W1TB 4JGPA 3MFDA 5FA7A 4OLGA 1XJ6A 4NXGA 2GZAA 2L1MA 1PI4A 4P87A 2B95A 4WZ5A 1NXYA 1RCJA 1E25A 4S2OA 5AQ9A 3OPPA 5FI2A 1OT9A 4S2NC 2HPBA 3CPTA 2ZM8A 3C4PA 3EGDC 2XSSA 5HDCA 1AWIA 4B9OA 1IYSA 4DE3A 2V0UA 3BFCA 3C7VA 3TW8A 3P09A 3QP5A 4PKYG 3IHAA 3M6BA 3SH7A 4WF0A 3Q81A 4JKTA 2GDNA 3VFFA 5CRFA 1HZOA 3A3IA 4N1XA 5FSRA 4KZ3A 3GECA 2Y2HA 1HVBA 2INWA 3LR0A 2ZC3B 2Q0OA 3OZHA 3WRZA 3B3XA 2P7JA 3IWOA 5D3OA 3FPVA 5IT5A 3MXRA 1OTEA 3MFXA 4GZBA 1E3UA 1SKFA 3CWFA 2ZM0A 2OWJA 2VV6A 3SS5A 3G30A 3UB6A 2XRNA 5F1FA 1TEMA 4OPRA 1W5DA 5AQBA 3PBQA 1H8YA 1P97A 3OOVA 3HVFA 3MR0A 2ZC4B 4GS9A 1RGZA 4QU3A 4DMZA 3GR2A 4LV2A 4RVAA 5FQMA 3LIDA 1BSGA 1PFLA 1J3WA 4WM9A 2ACGA 2IWBA 5TBMA 5HL1A 2JCHA 4DE0A 3HLCA 2QWSA 3VE3A 1S1ZA 2KX6A 2BASA 4E3KA 3BWLA 3CG5A 5MC7A 5HAPA 2XQZA 4I3AA 5M19A 1VB6A 2HDSA 1KE4A 4WZ5C 4ARZA 5F68A 3S7OA 3IF6A 3D9YA 4E3OA 3Q7VB 1F98A 1XPBA 3V39A 1XXMA 2J9OA 3CLOA 3MMHA 2A24B 5TR7A 3F1PB 4JXVA 4P6BA 2O9BA 3R7WB 1S4SA 2WADA 2Z6CA 5FQJA 5CERA 3LR5A 4L9GA 1K25A 3IQAA 2I9VA 4KQOA 2ZOIA 2XA7M 1XKZA 5GHXA 4HESA 4DDSA 3T1SA 3S22A 3IXHA 1YAXA 4FOFA 1VETA 1K0KA 1MC0A 4C3QA 3MQOA 3JVUA 2HGVA 3LICA 4QJGA 1LI9A 4I3JA 1D7EA 1ZHHB 5HWWA 4ETZA 4KQQA 3ZG7B 2J3TD 5CGSA 3EQVA 3KO6A 5FEGA 3JPUA 1OTAA 3IHBA 5AQAA 3HLFA 1TD5A 2OOLA 3BLSA 1JVJA 4ZJ1A 1GSVA 3E4PA 3T4QA 2E8JA 4Z9QA 2QJ7A 1OTIA 2Y2MA 3NJAA 4M4XA 1I2WA 3UMDA 4R0QA 1EW0A 3RXWA 3N7WA 5E2FA 4HJ4A 4OP8A 1MWTA 3BFFA 3HJIA 3IBJA 2W1RA 4HBTA 3RH8B 1NY0A 4IBXA 4PM7A 3OCLA 1XJ2A 4MMNA 3H82B 5GLCA 4JGQA 2UWXA 3EQUA 2VGLS 5FQQA 3NY4A 4ZRRA 4DRTA 2XD1A 3S4XA 4BBTA 3IF6C 5EFWA 2XEPA 2VEAA 4WYYA 3S7PA 4CLCE 2W1TA 3SH9A 4DN0A 2O99A 1OMEA 2L0WA 5CGWA 4UA6A 3VMAA 2JKTI 2X02A 4S2MA 4YINA 3WS0A 2G7UA 2VV8A 4MBKA 2ZMAA 3E4QA 3IT9A 1P0ZA 5EOOA 3CAXA 4A5RA 1XA7A 5G4YA 4BWIA 3GSGA 1ONHA 2W3DA 3FYZA 3KSIA 4E3JA 2ZBBA 4HY8A 3C7UA 3WS5A 2OWHA 5HWVA 4HJ3A 4FH2A 1DP9A 1IEMA 3PXPA 3A0RA 2QZ6A 2V9AA 4FUWA 3MSHA 1XJ3A 2XLNA 2YKFA 1PZOA 4UA7A 2Y2OA 5DF7A 3VP0A 5EM0A 4IHQA 4GJ4A 4WLAA 2M7VA 1NZUA 2VX8A 5KMWA 5GL9A 3PYPA 2WAFA
chains in the Genus database with same CATH topology
1NRJA 4H6JA 3VE4A 4EXOA 2NUPC 2VKSA 4CQHA 3F1NB 1S4RA 4R38A 3ZYTA 1LT0A 3G6OA 3PR6A 4CLCD 2J3WA 1TS7A 4EU0A 5L8MA 3T50A 5A8BA 1LSVA 3UB9A 3PBTA 2W3HA 4KQDA 1S1YA 2PDRA 3TE8A 2QHKA 4DJ2A 3UMEA 3S7QA 3EOIA 4BBVA 3H9WA 4YNRA 5IS1A 4MN7A 2W0NA 4HI4A 2P04A 2W3EA 3CI6A 4OOLA 2OAP1 4YOFA 5CX7A 3NOTC 1S67L 3KSGA 4XT2A 4E04A 4NXFA 3A0VA 2JKRM 3BQAA 3UE3A 1LSWA 1UWNX 1XJ4A 2PD8A 4UQIM 3OC2A 5HSQA 1N9OA 2O9AA 4WEJA 5HD5A 4PHTA 2ZMFA 4CLCA 1ZTUA 2M1CA 1V9YA 4LRZE 1OJGA 2W1TB 4GHIB 4JGPA 4KUOA 2FH5A 4Y5FA 4HQAA 3BJNA 4WUJA 4WEKA 3LIAA 4CLCC 1XJ6A 2HJEA 4JGOA 4NXGA 1IOUA 2GZAA 2L1MA 3T4SA 2H28A 3KX0X 5C5KA 5KIZA 5KSHA 2EA9A 5G4ZA 3ICYA 1G28A 4HH3A 4BMWA 3NOUC 1OT9A 2EWWA 3MXQA 1N9NA 5TJJA 3EGDC 2XSSA 5HDCA 4EEPA 3KSHA 4B9OA 4G3KA 2V0UA 4L0LA 5HD3A 3H7WA 3MF0A 4EQ1A 3TW8A 2VZWA 1G6OA 2JKTM 5DFXA 4PKYG 5FL3A 4WF0A 4EEUA 3IS2B 4LRYC 4I38A 2VV7A 4O0PA 3OCNA 3HCYA 3GECA 1H8MA 5HL6A 3HJKA 3LIEA 2INWA 3LR0A 3DBAA 4H6JB 2A2LA 3T4LA 1STZA 3FG8A 4Z1WA 1JNUA 3LYXA 2A24A 2P7JA 3FPVA 2Z6DA 5IT5A 3B47A 1T1CA 3UE6A 1OTEA 2HV1A 3F1PA 4OOMA 1DP8A 2DMWA 4KUKA 3MFXA 3R7WA 4B93A 1TF1A 5HDDA 1GSWA 3CWFA 2WKQA 3EGXC 3K3CA 4EUVA 2OWJA 2QJ5A 2QYBA 5DF9A 2VV6A 5J7EA 2PR5A 3FPWA 3UB6A 4MN6A 4AFIA 2HF6A 4R6LA 4XT2B 2XRNA 3P01A 2V0WA 2WKPA 3MQQA 1LL8A 3VOLA 3PBQA 2KDKA 3LUQA 3CITA 2WKRA 1KOUA 1P97A 3OOVA 4MCWA 1MKMA 2R78A 1F9IA 4Q0JA 3P7NA 3MR0A 4CLCB 3R4KA 3V67A 4GS9A 2XA7S 3E4OA 1Y28A 4DMZA 1ODVA 1OTDA 3F1OA 3E98A 3LIDA 3FC7A 4YWZA 3KYQA 1GSXA 4F3LA 1T1BA 3C38A 2GNXA 3EEAA 2VA0A 1P9RA 5DKLA 5TBMA 5DKKA 3PBSA 3O5YA 2FZ0A 2Y79A 1IFQA 4NXBA 3B42A 2QWSA 3TRCA 3A0SA 3VE3A 1S1ZA 5DFYA 3LIFA 2KX6A 3H7WB 1TS0A 1NWZA 2J80A 1YKDA 2BASA 1DRMA 3BWLA 4LPZA 3PBNA 3KSFA 5MC7A 4R70A 3U2AA 4I3AA 3EEHA 3RFBA 1VB6A 2PHYA 1NLYA 1F5MA 2B02A 4QPRA 3BY8A 4ARZA 5F68A 1WA9A 3S7OA 4I3IA 1UWPX 2CMNA 2V1AA 4PAUA 3LIBA 1LSXA 3RTYA 1F98A 4WN5A 1TS8A 1YSPA 2VLGA 3T4OA 1MZUA 4WL9A 3T4JA 3CLOA 3MMHA 4GHIA 2A24B 2LB5A 1OTBA 4I5SA 3VV4A 3F1PB 4K08A 1NLZA 2MJ6A 2O9BA 3R7WB 2HJ9C 3H82A 1S4SA 3IBRA 4II7A 1H3QA 2Z6CA 2EWVA 2JHEA 3LFVA 3MQ0A 4IUKA 3LR5A 1V9ZA 4L9GA 4ME4A 3OLOA 3K2NA 5DJUA 3UB8A 5I5LA 1D06A 4GW9A 3TJZC 2I9VA 5DJTA 4HOIA 4KQOA 2ZOIA 2XA7M 4EW7A 3ULFA 4EERA 2D02A 2GX5A 2PT7A 2PYRA 2V1BA 2K31A 1YAXA 4Y2FA 2PD7A 3GDIA 3NOPC 2YKHA 4FOFA 4JGRA 1MC0A 2GJ3A 5HWTA 3MQOA 3PBRA 3JVUA 4MN5A 3E0YA 5HDSA 2W3FA 2HGVA 4GS9B 4FSFA 3LICA 4P6ZM 3CUEA 3KYZA 3F1OB 2QKPA 4I3JA 1D7EA 1ZHHB 4NXEA 4EESA 4F3LB 5HWWA 4L9EA 3C8CA 2O9CA 3W2ZA 4HJ6A 4ETZA 3PHYA 2J3TD 4UEYA 3EQVA 3KO6A 1YSQA 5TBMB 1OTAA 4ETXA 3MJQA 4DJ3A 1TD5A 1W63Q 2OOLA 2W3GA 2VJWA 4O8GA 3B33A 4HP4A 2VGLM 4HP9A 1GSVA 2KOIA 3E4PA 3T4QA 4Y3IA 1X0OA 2QJ7A 3C2WA 1OTIA 3F1NA 4P6ZS 3UB7A 3NJAA 4M4XA 5AJGA 2JKRI 2KLIA 3UMDA 3ZQ5A 4IJGA 1EW0A 4ARZB 4HH2A 5J3WA 4GCZA 4HJ4A 1T19A 1VHMA 2NUTC 3D3OA 3HJIA 3IBJA 1P9WA 3NHQA 2W1RA 4IUHA 5HPFA 3RH8B 2K2NA 2D01A 1DP6A 2J3TC 3OCLA 2ZOHA 3PBOA 4LRXC 2JN7A 3K3DA 4I39A 1XJ2A 5LBRA 4MMNA 5IU1A 5J4EA 3H82B 1XFQA 5HZHA 4JGQA 4NKPA 3EQUA 2VGLS 4HHDA 2LB9A 3LR4A 2Y8HA 2OAQ1 3BY9A 1XFNA 4HIAA 3T4TA 4ZRRA 4RQ9A 4EETB 4BBTA 3S7NA 5EFWA 2VEAA 4L9FA 3SW1A 3S7PA 4CLCE 4BBUA 1T18A 2W1TA 4DN0A 2O99A 2IA2A 2L0WA 1N9LA 5F69A 1OJ5A 2JKTI 1UGUA 3C30A 4Q0IA 4LLOB 4UQIS 2G7UA 1OT6A 2VV8A 4WELA 4G3VA 1OPXA 3E4QA 1W63M 3OBFA 4R3AA 1P0ZA 1T1AA 2PYPA 2XROA 5HPIA 3D72A 3JVVA 4O01A 5F6AA 3CAXA 1BYWA 5G4YA 4BWIA 4GLQA 2K7SA 4Q0HA 2L4RA 2W3DA 3KSIA 3LR3A 4PKYA 2ZBBA 4HY8A 3BQ8A 4NEED 3T4KA 2OWHA 5HWVA 2P08A 4HJ3A 1DP9A 3LI8A 5F5YA 1S66L 3PXPA 3A0RA 2PR6A 2B18A 2V9AA 3IS2A 1XJ3A 2YKFA 5AVEA 1TS6A 2W27A 4BJPA 5K5BA 2O0YA 4MDZA 5AVFA 3BW6A 3EWKA 2M7UA 2ZMVA 4IHQA 4GJ4A 4G3WA 4WLAA 2M7VA 2VX8A 3PYPA 3CUEC 3LI9A 4HNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6J A;  3VE4 A;  4EXO A;  3F1N B;  1S4R A;  4R38 A;  1LT0 A;  3G6O A;  1TS7 A;  3T50 A;  5A8B A;  1LSV A;  3UB9 A;  4KQD A;  1S1Y A;  2PDR A;  2QHK A;  4DJ2 A;  3UME A;  4BBV A;  3H9W A;  5IS1 A;  2W0N A;  4HI4 A;  3NOT C;  1S67 L;  4XT2 A;  4E04 A;  4NXF A;  3A0V A;  1LSW A;  1UWN X;  1XJ4 A;  2PD8 A;  5HSQ A;  1N9O A;  5HD5 A;  2M1C A;  1V9Y A;  4LRZ E;  1OJG A;  4GHI B;  4JGP A;  4KUO A;  4HQA A;  4WUJ A;  3LIA A;  1XJ6 A;  4JGO A;  4NXG A;  2L1M A;  2H28 A;  3KX0 X;  5KIZ A;  2EA9 A;  5G4Z A;  3ICY A;  1G28 A;  4HH3 A;  3NOU C;  1OT9 A;  3MXQ A;  1N9N A;  4EEP A;  5HDC A;  4B9O A;  2V0U A;  5HD3 A;  3H7W A;  4EQ1 A;  4PKY G;  4WF0 A;  4EEU A;  3IS2 B;  4LRY C;  4I38 A;  2VV7 A;  3GEC A;  3HJK A;  3LIE A;  2INW A;  4H6J B;  3FG8 A;  1JNU A;  3LYX A;  2A24 A;  2P7J A;  2Z6D A;  1T1C A;  3UE6 A;  1OTE A;  2HV1 A;  3F1P A;  1DP8 A;  4KUK A;  3MFX A;  5HDD A;  1GSW A;  3CWF A;  2WKQ A;  3K3C A;  2OWJ A;  2QJ5 A;  2VV6 A;  5J7E A;  2PR5 A;  3UB6 A;  4MN6 A;  4R6L A;  4XT2 B;  2V0W A;  2WKP A;  3MQQ A;  1LL8 A;  3VOL A;  2KDK A;  3LUQ A;  2WKR A;  1KOU A;  1P97 A;  2R78 A;  1F9I A;  3P7N A;  3MR0 A;  4GS9 A;  3E4O A;  1Y28 A;  1ODV A;  1OTD A;  3F1O A;  3LID A;  3FC7 A;  4YWZ A;  1GSX A;  4F3L A;  1T1B A;  5DKL A;  5TBM A;  5DKK A;  4NXB A;  2QWS A;  3A0S A;  3VE3 A;  1S1Z A;  3LIF A;  2KX6 A;  3H7W B;  1TS0 A;  1NWZ A;  2J80 A;  2BAS A;  1DRM A;  3BWL A;  4LPZ A;  4R70 A;  4I3A A;  3EEH A;  1VB6 A;  2PHY A;  2B02 A;  3BY8 A;  5F68 A;  1WA9 A;  4I3I A;  1UWP X;  2CMN A;  2V1A A;  3LIB A;  1LSX A;  3RTY A;  1F98 A;  4WN5 A;  1TS8 A;  2VLG A;  1MZU A;  4WL9 A;  3CLO A;  4GHI A;  2A24 B;  1OTB A;  4I5S A;  3F1P B;  4K08 A;  3H82 A;  1S4S A;  3IBR A;  2Z6C A;  2JHE A;  4L9G A;  1V9Z A;  3OLO A;  5DJU A;  3UB8 A;  5I5L A;  1D06 A;  4GW9 A;  2I9V A;  5DJT A;  4HOI A;  2ZOI A;  4EW7 A;  3ULF A;  4EER A;  2D02 A;  2PYR A;  2V1B A;  2PD7 A;  3GDI A;  3NOP C;  2YKH A;  4JGR A;  2GJ3 A;  5HWT A;  3MQO A;  4MN5 A;  5HDS A;  4GS9 B;  3LIC A;  3F1O B;  2QKP A;  4I3J A;  1D7E A;  4NXE A;  4EES A;  4F3L B;  5HWW A;  4L9E A;  3C8C A;  4HJ6 A;  3PHY A;  5TBM B;  1OTA A;  3MJQ A;  4DJ3 A;  2OOL A;  3B33 A;  4HP4 A;  4HP9 A;  1GSV A;  3E4P A;  1X0O A;  2QJ7 A;  3C2W A;  1OTI A;  3F1N A;  3UB7 A;  3NJA A;  4M4X A;  3UMD A;  3ZQ5 A;  1EW0 A;  4HH2 A;  5J3W A;  4GCZ A;  4HJ4 A;  1T19 A;  3HJI A;  3NHQ A;  3RH8 B;  2D01 A;  1DP6 A;  4LRX C;  2ZOH A;  2JN7 A;  3K3D A;  4I39 A;  1XJ2 A;  5IU1 A;  5J4E A;  3H82 B;  1XFQ A;  5HZH A;  4JGQ A;  4HHD A;  3BY9 A;  1XFN A;  4HIA A;  4RQ9 A;  4EET B;  4BBT A;  5EFW A;  2VEA A;  4L9F A;  3SW1 A;  4BBU A;  1T18 A;  2L0W A;  1N9L A;  5F69 A;  1OJ5 A;  1UGU A;  4LLO B;  2VV8 A;  1OT6 A;  3E4Q A;  4R3A A;  1P0Z A;  1T1A A;  2PYP A;  3D72 A;  5F6A A;  3CAX A;  1BYW A;  5G4Y A;  2K7S A;  2L4R A;  4PKY A;  2ZBB A;  4HY8 A;  2OWH A;  5HWV A;  4HJ3 A;  1DP9 A;  3LI8 A;  5F5Y A;  1S66 L;  3A0R A;  2PR6 A;  2V9A A;  3IS2 A;  1XJ3 A;  2YKF A;  5AVE A;  1TS6 A;  2W27 A;  5AVF A;  3EWK A;  4WLA A;  3PYP A;  3LI9 A;  4HNB A; 
#chains in the Genus database with same CATH topology
 1VEU B;  2J8Y A;  1NRJ A;  3VE4 A;  3AGE A;  2VKS A;  1TDG A;  3PR6 A;  4CLC D;  4EU0 A;  3ZG5 A;  5L8M A;  1JTG A;  4PPR A;  1LSV A;  2E8I A;  1KGF A;  5DVA A;  4X53 A;  2PDR A;  4X56 A;  3EOI A;  4LGW A;  4ZJ3 A;  4HI4 A;  3CI6 A;  2H5S A;  1CQA A;  5CX7 A;  4LV3 A;  4EWF A;  1HTZ A;  4E3M A;  2OV5 A;  2G2U A;  3UE3 A;  1UWN X;  4UQI M;  2EX2 A;  4R3B A;  5EVI B;  1NYY A;  1Q2P A;  4PHT A;  2ZQC A;  3QNC A;  3HLE A;  4GN2 A;  1W8Y A;  5CHU A;  4JGO A;  3E2K A;  3MXS A;  3AGD A;  1K6S A;  4E3I A;  1D1J A;  5KIZ A;  2EA9 A;  3ICY A;  1KGG A;  4X68 A;  1W8Q A;  3BFE A;  4BMW A;  1RP5 A;  5EPH A;  3VP3 A;  4B4Z A;  1CJF A;  5TJJ A;  4EEP A;  3KSH A;  5HD3 A;  3GVB A;  3MF0 A;  4DE1 A;  4EQ1 A;  3BEC A;  1G6O A;  3ZNT A;  1E3U D;  5FL3 A;  4BEN A;  1LLB A;  4EEU A;  3MBZ A;  1BT5 A;  5FI7 A;  2JBF A;  4B88 A;  2Y91 A;  1M6K A;  2Y55 A;  3LY4 A;  3UE0 A;  5GHZ A;  3OCN A;  4S2J A;  1Z6F A;  1GHI A;  2WKI A;  3A3J A;  4PM6 A;  5CHM A;  2C5W B;  3BEB A;  3Q7V A;  3D4F A;  4K91 A;  2A2L A;  3HL9 A;  3RXX A;  2AVX A;  3HUO A;  4Z1W A;  2A24 A;  3FWL A;  3BFD A;  3B47 A;  3FV7 A;  3F1P A;  1DP8 A;  2DMW A;  3BLM A;  4KUK A;  3R7W A;  4QB8 A;  4OQI A;  3UPN A;  5HDD A;  2OLV A;  2QJ5 A;  2QYB A;  3MS6 A;  3BYD A;  5J7E A;  3FPW A;  1MBL A;  4MN6 A;  4AFI A;  4KZB A;  1BZA A;  4XT2 B;  5CXW A;  3MQQ A;  1XA1 A;  2PBY A;  2KDK A;  3LUQ A;  3CIT A;  5DF8 A;  3QP2 A;  4MCW A;  1MKM A;  2ZQ8 A;  1F9I A;  4NET A;  2WKE A;  4GKU A;  3V67 A;  2XA7 S;  4OON A;  4OQ0 A;  3FC7 A;  2WGW B;  4YWZ A;  1K6R A;  1GSX A;  1ZC2 A;  1CEF A;  3UDF A;  1VM1 A;  3C38 A;  4S2I A;  4JF4 A;  1E4D A;  5FQ9 A;  2VA0 A;  4ZTK A;  1MWU A;  2FZ0 A;  1KDS A;  4NXB A;  5EVL A;  1BLP A;  3H7W B;  1TS0 A;  2HP6 A;  4KG6 A;  1GCE A;  2BLS A;  1SHV A;  3PBN A;  3N8S A;  3L7H A;  3U2A A;  4RX2 A;  3MZD A;  4P85 A;  3EEH A;  3RFB A;  4QY6 A;  1ONG A;  1NLY A;  2B02 A;  2X01 A;  4QPR A;  2WYX A;  3L9K A;  2CMN A;  2V1A A;  3GV9 A;  4ZAM A;  4IED A;  1LSX A;  1YSP A;  2H0Y A;  2VLG A;  3GQZ A;  2JE5 A;  4MBH A;  5A91 A;  1NLZ A;  3UPP A;  3H82 A;  4OVD A;  4IUK A;  4ME4 A;  4HEF A;  2VGJ A;  4GW9 A;  4OPY A;  4HOI A;  5DJT A;  2IWC A;  2XH9 A;  3ULF A;  2PYR A;  4EBP A;  3N8R A;  1KE0 A;  2PD7 A;  3ZGA B;  2WZZ A;  3QP4 A;  3E0Y A;  3Q1F A;  5F1G A;  4B4X A;  5JYP A;  2HDU A;  3F1O B;  2QKP A;  4R3J A;  4EES A;  4C75 A;  4F3L B;  4L9E A;  2Y2Q A;  1W79 A;  3W2Z A;  1PWD A;  3IXB A;  2WKH A;  2XD5 A;  5FQI A;  3KYE A;  1G6A A;  4ETX A;  1AXB A;  4DJ3 A;  3IH8 A;  2XFS A;  1FOF A;  1W63 Q;  2W3G A;  4O8G A;  5G18 A;  3G35 A;  4EUZ A;  4S2L A;  4HP4 A;  3SOI A;  3ITB A;  1H5X A;  1IYO A;  2KOI A;  2ZL1 B;  2Y2L A;  5I94 A;  1HD8 A;  1VEU A;  4Y3I A;  1X0O A;  5E2G A;  3A3D A;  4P6Z S;  4OQH A;  3UB7 A;  2HDQ A;  2KLI A;  2A3U A;  3ZQ5 A;  4IJG A;  4LCL A;  4LFU A;  3O87 A;  5F83 A;  5HFO A;  1P9W A;  3NHQ A;  2ZC6 B;  2K2N A;  3PBO A;  2ZOH A;  3K3D A;  4I39 A;  1L2S A;  5LBR A;  5IU1 A;  5IHV A;  3M2K A;  3SS4 A;  4NKP A;  5HZH A;  2WGV A;  5DTS A;  2LB9 A;  3VSK A;  2Y8H A;  1L0E A;  3T4T A;  1SDE A;  2BG1 A;  5EV0 A;  1ES3 A;  5EVI A;  5CTM A;  2JC7 A;  4O7D A;  1LHY A;  3W4O A;  1T18 A;  3V50 A;  1N9L A;  5F69 A;  1OJ5 A;  3C30 A;  4JXG A;  4KZ5 A;  4LLO B;  4UQI S;  4G3V A;  1TDL A;  1L0F A;  3GRJ A;  2ZM2 A;  1W63 M;  3WWX A;  1CEG A;  2XGN A;  2XRO A;  5HPI A;  3D72 A;  3JVV A;  4O01 A;  3RJU A;  5EVE A;  1BYW A;  3OPR A;  1VQQ A;  4GLQ A;  1HLU P;  2L4R A;  2ZC5 B;  1YQS A;  4PKY A;  4MLL A;  3DW0 A;  4NK3 A;  2ZD8 A;  2PRF A;  4CJN A;  1PZP A;  4E3N A;  2PR6 A;  3HUM A;  4IVI A;  3UE1 A;  2W27 A;  2J7V A;  2O0Y A;  3W4Q A;  3EWK A;  3IX8 A;  4DF6 A;  1SDN A;  2EXA A;  4G3W A;  4R23 A;  3HBR A;  3ZCZ A;  1IKI A;  4E3L A;  5L10 A;  3CJM A;  4EXO A;  3GTC A;  1S4R A;  1LT0 A;  1TS7 A;  1I5Q A;  4UHU A;  3ZVW A;  3UB5 P;  3NCK A;  4JXW A;  4Y0O A;  3H9W A;  4YNR A;  5IS1 A;  4MN7 A;  2W0N A;  4FTX A;  2P04 A;  4OPZ A;  3U4L P;  2P9V B;  2Y2I A;  2OAP 1;  3NOT C;  4XT2 A;  1MPL A;  2DCF A;  4E04 A;  2JKR M;  1XJ4 A;  3OPH A;  2O9A A;  1O07 A;  2ZMF A;  4R4R A;  1ZTU A;  3QHY A;  2EFU A;  4S2K A;  1L0G A;  3V3S A;  1BLH A;  5A93 A;  3T1X A;  3CZD A;  3LO7 A;  4KUO A;  2FH5 A;  2EX9 A;  1PIO A;  2WGW A;  4WUJ A;  3LIA A;  1YT4 A;  3VP1 A;  3T4S A;  2H28 A;  3KX0 X;  5C5K A;  4PM8 A;  5G4Z A;  4MEZ A;  3WS2 A;  1ESI A;  1ERO A;  3MXQ A;  2RL3 A;  1YLJ A;  4U0T A;  5EVI C;  5L07 A;  5E2E A;  4L0L A;  3H7W A;  3DAV A;  4LCM A;  4X69 A;  3N4I A;  3IX4 A;  2P74 A;  5FAQ A;  3IS2 B;  4LRY C;  5GHY A;  3HLG A;  4I38 A;  4X25 A;  2HP9 A;  4O0P A;  5U47 A;  4X6T A;  1K57 A;  3IXD A;  2EX6 A;  1A0K A;  1H8M A;  1JWP A;  2WK0 A;  3TOI A;  1N4O A;  3LIE A;  3UO9 A;  4H6J B;  5GLA A;  3UDI A;  1STZ A;  1JNU A;  2Z6D A;  1T1C A;  3UE6 A;  2HV1 A;  4OOM A;  1TF1 A;  3GMW A;  5M18 A;  2WKQ A;  2ZC7 A;  3K3C A;  3TSG A;  4JBF A;  2FFY A;  1IYQ A;  4MNR A;  3LGO A;  5E43 A;  3P01 A;  2V0W A;  2WKP A;  1L0D A;  3VOL A;  2HZ5 A;  3M2J A;  3IWI A;  1Y4O A;  5FAP A;  4Q0J A;  3P7N A;  1K4E A;  3V3R A;  1WE4 A;  5BOH A;  3E4O A;  1Y28 A;  3AGF A;  3F1O A;  4UA9 A;  1NZO A;  5FI6 A;  4F3L A;  2GNX A;  2V2F F;  1XGJ A;  1P9R A;  3PAE A;  5GLD A;  4OQG A;  5DKK A;  3PBS A;  4KZ7 A;  4K0W A;  3HUN A;  3B42 A;  1M40 A;  3T1Q B;  3LIF A;  3FKW A;  1DRM A;  2ZL1 A;  4ZDX A;  1WYC A;  1BLS A;  2XDM A;  1TVF A;  3N8L A;  4LV1 A;  3A3E A;  1UWP X;  4DXB A;  1YLW A;  2XK1 A;  3LIB A;  4WN5 A;  4CPK A;  1IEL A;  1TS8 A;  3QP1 A;  2I72 A;  3T4O A;  1MZU A;  4WL9 A;  4GHI A;  1OTB A;  4I5S A;  5HW3 A;  4OH0 A;  3VV4 A;  2A49 A;  2MJ6 A;  3G2Y A;  4EBL A;  1H3Q A;  4K0X A;  3ZG9 B;  2ZQA A;  2JHE A;  3LFV A;  1XX2 A;  3HLW A;  3OLO A;  3K2N A;  3UB8 A;  3ZVT A;  1K57 C;  4N9K A;  5I5L A;  1D06 A;  1PI5 A;  1FIK A;  2JKF A;  1BLC A;  2D02 A;  2GX5 A;  2PT7 A;  2V1B A;  3MZF A;  2K31 A;  2ZJ9 A;  2PU2 A;  4IBR A;  3GDI A;  3NOP C;  2YKH A;  3T12 B;  1SKO B;  1KE3 A;  3CMZ A;  2GJ3 A;  5HWT A;  4MN5 A;  2XF3 A;  4WBG A;  2W3F A;  1N9B A;  1BTL A;  4KEN B;  1ZG4 A;  4IVK A;  4OPQ A;  2Q9M A;  1KGE A;  3C8C A;  2O9C A;  5FDH A;  3PHY A;  4KG2 A;  4UEY A;  1YSQ A;  1YMS A;  3NEC A;  2QMI A;  3MJQ A;  5HAI A;  3B33 A;  3DWK A;  3BRM A;  2PAV P;  2VGL M;  4HP9 A;  4WZ4 A;  4ESP A;  1CK3 A;  3W8K A;  1BUL A;  3C2W A;  1ERQ A;  5EVI D;  5HX9 A;  1ALQ A;  3G31 A;  4HBU A;  2IWD A;  4E6W A;  3UNW A;  4PMA A;  4N92 A;  3DWZ A;  2ZLY A;  2NUT C;  4M3K A;  3D3O A;  1G68 A;  1U60 A;  5HPF A;  1FIL A;  1MY8 A;  4ID4 A;  1DP6 A;  2J3T C;  2P9V A;  3IX3 A;  1XFQ A;  3ITA A;  1FCM A;  2Q9N A;  4S2P A;  3BY9 A;  4KZ6 A;  1XFN A;  4HIA A;  3UY6 A;  5JYO A;  4EET B;  1ES5 A;  4L9F A;  5DTT A;  2HDR A;  4BLM A;  3SW1 A;  4BBU A;  1J9M A;  2IA2 A;  2VGK A;  1UGU A;  4GDB A;  3LEZ A;  1KDW A;  4Q0I A;  4WEL A;  1OT6 A;  3OBF A;  4R3A A;  2PYP A;  1S0W A;  5FAT A;  2B5R A;  4Q0H A;  1K38 A;  3ZG0 A;  3NUL A;  4X55 A;  2HP5 A;  5TGF A;  3LI8 A;  4KZA A;  1S66 L;  1H0M A;  2B18 A;  3IS2 A;  5AVE A;  1EI5 A;  5EOE A;  4MDZ A;  4KZ9 A;  5AVF A;  3BW6 A;  3HLD A;  3TG9 A;  2M7U A;  4XUX A;  4KG5 A;  4Y13 A;  3A3F A;  4H6J A;  2Z2L B;  4FD8 A;  4EQI A;  5DTK A;  2NUP C;  3F1N B;  2OSU A;  3ZNY A;  4F94 A;  1DJA A;  3NIA A;  4QD4 A;  4FH4 A;  4FCF A;  5A8B A;  2ZQ9 A;  4BD0 A;  3PBT A;  2W3H A;  4KQD A;  3MKE A;  3C4O A;  1MKI A;  2Y2P A;  3TE8 A;  1JTD A;  2QHK A;  1ZKJ A;  4XXR A;  3UME A;  4DJ2 A;  3UN7 A;  4D2O A;  4EV4 A;  5CGX A;  4OKP A;  1RGY A;  3FKV A;  4Y15 A;  4YOF A;  3KSG A;  2PBD P;  3G34 A;  3S1Y A;  3A0V A;  1LSW A;  4JXS A;  3ZDJ A;  3LY3 A;  4X1M A;  4BL3 A;  1K54 C;  5HSQ A;  1FR6 A;  4WEJ A;  5HD5 A;  2M1C A;  4GHI B;  3WS1 A;  4Y5F A;  4HQA A;  3BJN A;  4WEK A;  4CLC C;  2H10 A;  2HJE A;  1IOU A;  1FCN A;  4JF6 A;  5KSH A;  2G2W A;  1XGI A;  1G28 A;  2FFF B;  4HH3 A;  1K56 A;  3NOU C;  3DTI A;  2EWW A;  4WMC A;  5FQK A;  1N9N A;  2V8F A;  4E6X A;  4QWO A;  1BUE A;  4DKI A;  5FAS A;  3LCE A;  4X1L A;  1KVM A;  5KZH A;  4G3K A;  1S6R A;  2ZQ7 A;  3ISG A;  2VZW A;  3BM6 A;  2JKT M;  4KZ4 A;  5DFX A;  1IYP A;  1PNE A;  4R4S A;  4OOY A;  2Y2G A;  1PWC A;  2VV7 A;  3O88 A;  1YPR A;  1QMF A;  3HCY A;  2EX8 A;  1WYB A;  5EM1 A;  2H0T A;  5HL6 A;  3HJK A;  1Q2Q A;  1YLT A;  2Y4A A;  4GD8 A;  1CF0 A;  3DBA A;  3HLB A;  2C6W B;  2XFT A;  1ACF A;  1QME A;  3T4L A;  3FG8 A;  3LYX A;  3G2Z A;  2OLU A;  1H8Z A;  5J8X A;  3ZFZ A;  4B93 A;  1GHP A;  1GSW A;  1FSW A;  1DJB A;  3EGX C;  4EUV A;  5EUA A;  2UV0 E;  5CEB A;  4YFM A;  4Y7P A;  5DF9 A;  4N9L A;  5CTN A;  1MWS A;  2PR5 A;  5EEC A;  2HF6 A;  4R6L A;  1GHM A;  1NYM A;  1LL8 A;  3I7J A;  2DRW A;  3T1R A;  2JKG A;  1SKO A;  1KOU A;  2WKR A;  5HAR A;  1ES4 A;  1CI8 A;  2R78 A;  5GLB A;  3C5A A;  4CLC B;  1GA9 A;  3R4K A;  1PW1 A;  1ODV A;  1OTD A;  3E98 A;  2Y2J A;  2V8C A;  3PTE A;  3QNB A;  3KYQ A;  3NBL A;  5F82 A;  1FCO A;  3DTK A;  1T1B A;  3NC8 A;  5L2F A;  3EEA A;  1ESU A;  1K55 A;  5DKL A;  1JWZ A;  3CPT B;  3O5Y A;  2Y79 A;  4Y0T A;  1FSY A;  1IFQ A;  2WAE A;  1EWZ A;  4Y17 A;  3TRC A;  1DY6 A;  3A0S A;  5DFY A;  1YMX A;  1NWZ A;  2J80 A;  4LEN A;  3PAG A;  1YKD A;  3IF5 A;  4LPZ A;  4RA7 A;  4GNU A;  2Y2K A;  3KSF A;  4R1G A;  4NG2 A;  4R70 A;  4BL2 A;  5CED A;  4QHC A;  4DDY A;  2PHY A;  4JF5 A;  1F5M A;  1C3B A;  1YM1 A;  3BY8 A;  4H8R A;  1WA9 A;  3N6I A;  4I3I A;  4U0X A;  3NI9 A;  4PAU A;  5FDS A;  3RTY A;  5KSC A;  3T4J A;  4C6Y A;  3SS3 A;  3VFH A;  2LB5 A;  4K08 A;  4XUZ A;  2HJ9 C;  4PM9 A;  3IBR A;  4II7 A;  2EWV A;  3MQ0 A;  3G32 A;  1V9Z A;  5DJU A;  1GA0 A;  4LV0 A;  3W4P A;  2DNS A;  3MKF A;  3TJZ C;  4D60 A;  4N1H A;  4EW7 A;  1PYY A;  2WGI A;  4EER A;  3VOY A;  4Y2F A;  4JGR A;  3CHW P;  3SZT A;  3PBR A;  5HDS A;  4GS9 B;  3DTE A;  2RCX A;  4FSF A;  4P6Z M;  3CUE A;  1ZG6 A;  3KYZ A;  4KQR A;  3LEQ A;  4Y0U A;  3Q07 A;  2Z2M B;  4NXE A;  3QP6 A;  1NJ4 A;  1YLZ A;  4HJ6 A;  1Y54 A;  3NDE A;  5TFQ A;  2J9P A;  3ZHH A;  5TBM B;  4GOG A;  1MXO A;  4GD6 A;  1LL5 A;  2VJW A;  4OLD A;  4GB7 A;  4RX3 A;  5EE8 A;  3P98 A;  1PW8 A;  2CC1 A;  4OP5 A;  1I2S A;  2WZX A;  4U3T A;  1ES2 A;  3F1N A;  4P0M A;  5AJG A;  5CEC A;  2JKR I;  1XP4 A;  1LI0 A;  1K55 C;  4ARZ B;  3IF6 B;  4DE2 A;  3BFG A;  4HH2 A;  3VOZ A;  5J3W A;  4GCZ A;  5FEF A;  1T19 A;  2XR0 A;  1VHM A;  3Q7Z A;  4JLF A;  4IUH A;  2D01 A;  2EXB A;  1G5U A;  4QY5 A;  4LRX C;  3V5M A;  2R9W A;  2JN7 A;  3IWQ A;  3OPL A;  5J4E A;  5A92 A;  1FR1 A;  1YLY A;  3VSL A;  5E2H A;  1KVL A;  4S2N A;  4HHD A;  4KZ8 A;  3LR4 A;  2V20 A;  2OAQ 1;  3WS4 A;  1LL9 A;  2Y59 A;  1ERM A;  1YLP A;  3VP4 A;  3JYI A;  3M6H A;  4UAA A;  4RQ9 A;  3S7N A;  1O7E A;  1SCW A;  3VP2 A;  5HAQ A;  2PU4 A;  1CI9 A;  2X71 A;  2VK3 A;  5A90 A;  3UPO A;  5FAO A;  1L3L A;  1VET B;  1OPX A;  4BQM A;  1T1A A;  4MBF A;  2V1Z A;  3HRE A;  1Z09 A;  5F6A A;  2K7S A;  3UDX A;  3ZG8 B;  3LR3 A;  5L09 A;  3BQ8 A;  4NEE D;  3T4K A;  2P08 A;  2ZQD A;  1K4F A;  1W7F A;  5F5Y A;  3MZE A;  3DTM A;  3WRT A;  1TS6 A;  4BJP A;  3E2L A;  5K5B A;  3IXG A;  3Q82 A;  1DJC A;  3IH9 A;  2ZMV A;  4GDN A;  4JPM A;  4RYE A;  1F2K A;  2QPN A;  1IKG A;  3CUE C;  1FQG A;  3NDG A;  4ZBE A;  3LI9 A;  4HNB A;  4BD1 A;  1MWR A;  3G4P A;  1SZV A;  2R9X A;  4CQH A;  4R38 A;  3ZYT A;  2BTF P;  3O3V A;  3G6O A;  5AQ7 A;  2J3W A;  1NRF A;  5CHJ A;  3T50 A;  4PM5 A;  2WUQ A;  4DXC A;  3UB9 A;  1S1Y A;  1JWV A;  2Y2N A;  3FZC A;  3S7Q A;  3O86 A;  4BBV A;  3QP8 A;  4EBN A;  2EFX A;  2W3E A;  1PWG A;  1K56 D;  4OOL A;  1K54 A;  4Q8I A;  4WMC D;  1S67 L;  5M1A A;  4NXF A;  3BQA A;  2PD8 A;  3OC2 A;  1N9O A;  3SH8 A;  1PRQ A;  4CLC A;  1V9Y A;  4ZJ2 A;  4LRZ E;  1OJG A;  2W1T B;  4JGP A;  3MFD A;  5FA7 A;  4OLG A;  1XJ6 A;  4NXG A;  2GZA A;  2L1M A;  1PI4 A;  4P87 A;  2B95 A;  4WZ5 A;  1NXY A;  1RCJ A;  1E25 A;  4S2O A;  5AQ9 A;  3OPP A;  5FI2 A;  1OT9 A;  4S2N C;  2HPB A;  3CPT A;  2ZM8 A;  3C4P A;  3EGD C;  2XSS A;  5HDC A;  1AWI A;  4B9O A;  1IYS A;  4DE3 A;  2V0U A;  3BFC A;  3C7V A;  3TW8 A;  3P09 A;  3QP5 A;  4PKY G;  3IHA A;  3M6B A;  3SH7 A;  4WF0 A;  3Q81 A;  4JKT A;  2GDN A;  3VFF A;  5CRF A;  1HZO A;  3A3I A;  4N1X A;  5FSR A;  4KZ3 A;  3GEC A;  2Y2H A;  1HVB A;  2INW A;  3LR0 A;  2ZC3 B;  2Q0O A;  3OZH A;  3WRZ A;  3B3X A;  2P7J A;  3IWO A;  5D3O A;  3FPV A;  5IT5 A;  3MXR A;  1OTE A;  3MFX A;  4GZB A;  1E3U A;  1SKF A;  3CWF A;  2ZM0 A;  2OWJ A;  2VV6 A;  3SS5 A;  3G30 A;  3UB6 A;  2XRN A;  5F1F A;  1TEM A;  4OPR A;  1W5D A;  5AQB A;  3PBQ A;  1H8Y A;  1P97 A;  3OOV A;  3HVF A;  3MR0 A;  2ZC4 B;  4GS9 A;  1RGZ A;  4QU3 A;  4DMZ A;  3GR2 A;  4LV2 A;  4RVA A;  5FQM A;  3LID A;  1BSG A;  1PFL A;  1J3W A;  4WM9 A;  2ACG A;  2IWB A;  5TBM A;  5HL1 A;  2JCH A;  4DE0 A;  3HLC A;  2QWS A;  3VE3 A;  1S1Z A;  2KX6 A;  2BAS A;  4E3K A;  3BWL A;  3CG5 A;  5MC7 A;  5HAP A;  2XQZ A;  4I3A A;  5M19 A;  1VB6 A;  2HDS A;  1KE4 A;  4WZ5 C;  4ARZ A;  5F68 A;  3S7O A;  3IF6 A;  3D9Y A;  4E3O A;  3Q7V B;  1F98 A;  1XPB A;  3V39 A;  1XXM A;  2J9O A;  3CLO A;  3MMH A;  2A24 B;  5TR7 A;  3F1P B;  4JXV A;  4P6B A;  2O9B A;  3R7W B;  1S4S A;  2WAD A;  2Z6C A;  5FQJ A;  5CER A;  3LR5 A;  4L9G A;  1K25 A;  3IQA A;  2I9V A;  4KQO A;  2ZOI A;  2XA7 M;  1XKZ A;  5GHX A;  4HES A;  4DDS A;  3T1S A;  3S22 A;  3IXH A;  1YAX A;  4FOF A;  1VET A;  1K0K A;  1MC0 A;  4C3Q A;  3MQO A;  3JVU A;  2HGV A;  3LIC A;  4QJG A;  1LI9 A;  4I3J A;  1D7E A;  1ZHH B;  5HWW A;  4ETZ A;  4KQQ A;  3ZG7 B;  2J3T D;  5CGS A;  3EQV A;  3KO6 A;  5FEG A;  3JPU A;  1OTA A;  3IHB A;  5AQA A;  3HLF A;  1TD5 A;  2OOL A;  3BLS A;  1JVJ A;  4ZJ1 A;  1GSV A;  3E4P A;  3T4Q A;  2E8J A;  4Z9Q A;  2QJ7 A;  1OTI A;  2Y2M A;  3NJA A;  4M4X A;  1I2W A;  3UMD A;  4R0Q A;  1EW0 A;  3RXW A;  3N7W A;  5E2F A;  4HJ4 A;  4OP8 A;  1MWT A;  3BFF A;  3HJI A;  3IBJ A;  2W1R A;  4HBT A;  3RH8 B;  1NY0 A;  4IBX A;  4PM7 A;  3OCL A;  1XJ2 A;  4MMN A;  3H82 B;  5GLC A;  4JGQ A;  2UWX A;  3EQU A;  2VGL S;  5FQQ A;  3NY4 A;  4ZRR A;  4DRT A;  2XD1 A;  3S4X A;  4BBT A;  3IF6 C;  5EFW A;  2XEP A;  2VEA A;  4WYY A;  3S7P A;  4CLC E;  2W1T A;  3SH9 A;  4DN0 A;  2O99 A;  1OME A;  2L0W A;  5CGW A;  4UA6 A;  3VMA A;  2JKT I;  2X02 A;  4S2M A;  4YIN A;  3WS0 A;  2G7U A;  2VV8 A;  4MBK A;  2ZMA A;  3E4Q A;  3IT9 A;  1P0Z A;  5EOO A;  3CAX A;  4A5R A;  1XA7 A;  5G4Y A;  4BWI A;  3GSG A;  1ONH A;  2W3D A;  3FYZ A;  3KSI A;  4E3J A;  2ZBB A;  4HY8 A;  3C7U A;  3WS5 A;  2OWH A;  5HWV A;  4HJ3 A;  4FH2 A;  1DP9 A;  1IEM A;  3PXP A;  3A0R A;  2QZ6 A;  2V9A A;  4FUW A;  3MSH A;  1XJ3 A;  2XLN A;  2YKF A;  1PZO A;  4UA7 A;  2Y2O A;  5DF7 A;  3VP0 A;  5EM0 A;  4IHQ A;  4GJ4 A;  4WLA A;  2M7V A;  1NZU A;  2VX8 A;  5KMW A;  5GL9 A;  3PYP A;  2WAF A; 
#chains in the Genus database with same CATH homology
 1NRJ A;  4H6J A;  3VE4 A;  4EXO A;  2NUP C;  2VKS A;  4CQH A;  3F1N B;  1S4R A;  4R38 A;  3ZYT A;  1LT0 A;  3G6O A;  3PR6 A;  4CLC D;  2J3W A;  1TS7 A;  4EU0 A;  5L8M A;  3T50 A;  5A8B A;  1LSV A;  3UB9 A;  3PBT A;  2W3H A;  4KQD A;  1S1Y A;  2PDR A;  3TE8 A;  2QHK A;  4DJ2 A;  3UME A;  3S7Q A;  3EOI A;  4BBV A;  3H9W A;  4YNR A;  5IS1 A;  4MN7 A;  2W0N A;  4HI4 A;  2P04 A;  2W3E A;  3CI6 A;  4OOL A;  2OAP 1;  4YOF A;  5CX7 A;  3NOT C;  1S67 L;  3KSG A;  4XT2 A;  4E04 A;  4NXF A;  3A0V A;  2JKR M;  3BQA A;  3UE3 A;  1LSW A;  1UWN X;  1XJ4 A;  2PD8 A;  4UQI M;  3OC2 A;  5HSQ A;  1N9O A;  2O9A A;  4WEJ A;  5HD5 A;  4PHT A;  2ZMF A;  4CLC A;  1ZTU A;  2M1C A;  1V9Y A;  4LRZ E;  1OJG A;  2W1T B;  4GHI B;  4JGP A;  4KUO A;  2FH5 A;  4Y5F A;  4HQA A;  3BJN A;  4WUJ A;  4WEK A;  3LIA A;  4CLC C;  1XJ6 A;  2HJE A;  4JGO A;  4NXG A;  1IOU A;  2GZA A;  2L1M A;  3T4S A;  2H28 A;  3KX0 X;  5C5K A;  5KIZ A;  5KSH A;  2EA9 A;  5G4Z A;  3ICY A;  1G28 A;  4HH3 A;  4BMW A;  3NOU C;  1OT9 A;  2EWW A;  3MXQ A;  1N9N A;  5TJJ A;  3EGD C;  2XSS A;  5HDC A;  4EEP A;  3KSH A;  4B9O A;  4G3K A;  2V0U A;  4L0L A;  5HD3 A;  3H7W A;  3MF0 A;  4EQ1 A;  3TW8 A;  2VZW A;  1G6O A;  2JKT M;  5DFX A;  4PKY G;  5FL3 A;  4WF0 A;  4EEU A;  3IS2 B;  4LRY C;  4I38 A;  2VV7 A;  4O0P A;  3OCN A;  3HCY A;  3GEC A;  1H8M A;  5HL6 A;  3HJK A;  3LIE A;  2INW A;  3LR0 A;  3DBA A;  4H6J B;  2A2L A;  3T4L A;  1STZ A;  3FG8 A;  4Z1W A;  1JNU A;  3LYX A;  2A24 A;  2P7J A;  3FPV A;  2Z6D A;  5IT5 A;  3B47 A;  1T1C A;  3UE6 A;  1OTE A;  2HV1 A;  3F1P A;  4OOM A;  1DP8 A;  2DMW A;  4KUK A;  3MFX A;  3R7W A;  4B93 A;  1TF1 A;  5HDD A;  1GSW A;  3CWF A;  2WKQ A;  3EGX C;  3K3C A;  4EUV A;  2OWJ A;  2QJ5 A;  2QYB A;  5DF9 A;  2VV6 A;  5J7E A;  2PR5 A;  3FPW A;  3UB6 A;  4MN6 A;  4AFI A;  2HF6 A;  4R6L A;  4XT2 B;  2XRN A;  3P01 A;  2V0W A;  2WKP A;  3MQQ A;  1LL8 A;  3VOL A;  3PBQ A;  2KDK A;  3LUQ A;  3CIT A;  2WKR A;  1KOU A;  1P97 A;  3OOV A;  4MCW A;  1MKM A;  2R78 A;  1F9I A;  4Q0J A;  3P7N A;  3MR0 A;  4CLC B;  3R4K A;  3V67 A;  4GS9 A;  2XA7 S;  3E4O A;  1Y28 A;  4DMZ A;  1ODV A;  1OTD A;  3F1O A;  3E98 A;  3LID A;  3FC7 A;  4YWZ A;  3KYQ A;  1GSX A;  4F3L A;  1T1B A;  3C38 A;  2GNX A;  3EEA A;  2VA0 A;  1P9R A;  5DKL A;  5TBM A;  5DKK A;  3PBS A;  3O5Y A;  2FZ0 A;  2Y79 A;  1IFQ A;  4NXB A;  3B42 A;  2QWS A;  3TRC A;  3A0S A;  3VE3 A;  1S1Z A;  5DFY A;  3LIF A;  2KX6 A;  3H7W B;  1TS0 A;  1NWZ A;  2J80 A;  1YKD A;  2BAS A;  1DRM A;  3BWL A;  4LPZ A;  3PBN A;  3KSF A;  5MC7 A;  4R70 A;  3U2A A;  4I3A A;  3EEH A;  3RFB A;  1VB6 A;  2PHY A;  1NLY A;  1F5M A;  2B02 A;  4QPR A;  3BY8 A;  4ARZ A;  5F68 A;  1WA9 A;  3S7O A;  4I3I A;  1UWP X;  2CMN A;  2V1A A;  4PAU A;  3LIB A;  1LSX A;  3RTY A;  1F98 A;  4WN5 A;  1TS8 A;  1YSP A;  2VLG A;  3T4O A;  1MZU A;  4WL9 A;  3T4J A;  3CLO A;  3MMH A;  4GHI A;  2A24 B;  2LB5 A;  1OTB A;  4I5S A;  3VV4 A;  3F1P B;  4K08 A;  1NLZ A;  2MJ6 A;  2O9B A;  3R7W B;  2HJ9 C;  3H82 A;  1S4S A;  3IBR A;  4II7 A;  1H3Q A;  2Z6C A;  2EWV A;  2JHE A;  3LFV A;  3MQ0 A;  4IUK A;  3LR5 A;  1V9Z A;  4L9G A;  4ME4 A;  3OLO A;  3K2N A;  5DJU A;  3UB8 A;  5I5L A;  1D06 A;  4GW9 A;  3TJZ C;  2I9V A;  5DJT A;  4HOI A;  4KQO A;  2ZOI A;  2XA7 M;  4EW7 A;  3ULF A;  4EER A;  2D02 A;  2GX5 A;  2PT7 A;  2PYR A;  2V1B A;  2K31 A;  1YAX A;  4Y2F A;  2PD7 A;  3GDI A;  3NOP C;  2YKH A;  4FOF A;  4JGR A;  1MC0 A;  2GJ3 A;  5HWT A;  3MQO A;  3PBR A;  3JVU A;  4MN5 A;  3E0Y A;  5HDS A;  2W3F A;  2HGV A;  4GS9 B;  4FSF A;  3LIC A;  4P6Z M;  3CUE A;  3KYZ A;  3F1O B;  2QKP A;  4I3J A;  1D7E A;  1ZHH B;  4NXE A;  4EES A;  4F3L B;  5HWW A;  4L9E A;  3C8C A;  2O9C A;  3W2Z A;  4HJ6 A;  4ETZ A;  3PHY A;  2J3T D;  4UEY A;  3EQV A;  3KO6 A;  1YSQ A;  5TBM B;  1OTA A;  4ETX A;  3MJQ A;  4DJ3 A;  1TD5 A;  1W63 Q;  2OOL A;  2W3G A;  2VJW A;  4O8G A;  3B33 A;  4HP4 A;  2VGL M;  4HP9 A;  1GSV A;  2KOI A;  3E4P A;  3T4Q A;  4Y3I A;  1X0O A;  2QJ7 A;  3C2W A;  1OTI A;  3F1N A;  4P6Z S;  3UB7 A;  3NJA A;  4M4X A;  5AJG A;  2JKR I;  2KLI A;  3UMD A;  3ZQ5 A;  4IJG A;  1EW0 A;  4ARZ B;  4HH2 A;  5J3W A;  4GCZ A;  4HJ4 A;  1T19 A;  1VHM A;  2NUT C;  3D3O A;  3HJI A;  3IBJ A;  1P9W A;  3NHQ A;  2W1R A;  4IUH A;  5HPF A;  3RH8 B;  2K2N A;  2D01 A;  1DP6 A;  2J3T C;  3OCL A;  2ZOH A;  3PBO A;  4LRX C;  2JN7 A;  3K3D A;  4I39 A;  1XJ2 A;  5LBR A;  4MMN A;  5IU1 A;  5J4E A;  3H82 B;  1XFQ A;  5HZH A;  4JGQ A;  4NKP A;  3EQU A;  2VGL S;  4HHD A;  2LB9 A;  3LR4 A;  2Y8H A;  2OAQ 1;  3BY9 A;  1XFN A;  4HIA A;  3T4T A;  4ZRR A;  4RQ9 A;  4EET B;  4BBT A;  3S7N A;  5EFW A;  2VEA A;  4L9F A;  3SW1 A;  3S7P A;  4CLC E;  4BBU A;  1T18 A;  2W1T A;  4DN0 A;  2O99 A;  2IA2 A;  2L0W A;  1N9L A;  5F69 A;  1OJ5 A;  2JKT I;  1UGU A;  3C30 A;  4Q0I A;  4LLO B;  4UQI S;  2G7U A;  1OT6 A;  2VV8 A;  4WEL A;  4G3V A;  1OPX A;  3E4Q A;  1W63 M;  3OBF A;  4R3A A;  1P0Z A;  1T1A A;  2PYP A;  2XRO A;  5HPI A;  3D72 A;  3JVV A;  4O01 A;  5F6A A;  3CAX A;  1BYW A;  5G4Y A;  4BWI A;  4GLQ A;  2K7S A;  4Q0H A;  2L4R A;  2W3D A;  3KSI A;  3LR3 A;  4PKY A;  2ZBB A;  4HY8 A;  3BQ8 A;  4NEE D;  3T4K A;  2OWH A;  5HWV A;  2P08 A;  4HJ3 A;  1DP9 A;  3LI8 A;  5F5Y A;  1S66 L;  3PXP A;  3A0R A;  2PR6 A;  2B18 A;  2V9A A;  3IS2 A;  1XJ3 A;  2YKF A;  5AVE A;  1TS6 A;  2W27 A;  4BJP A;  5K5B A;  2O0Y A;  4MDZ A;  5AVF A;  3BW6 A;  3EWK A;  2M7U A;  2ZMV A;  4IHQ A;  4GJ4 A;  4G3W A;  4WLA A;  2M7V A;  2VX8 A;  3PYP A;  3CUE C;  3LI9 A;  4HNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...