3GDIA

Mammalian clock protein mper2 - crystal structure of a pas domain fragment
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
306
structure length
269
Chain Sequence
b'GSSYSMEQVEGITSENADMFAVAVSLVSGKILYISNQVASIFSDAKFVEFLAPHDVSVFHSYTTPYKLPPWSEKSFFCRVSVGKEIRYQPFRMTPYLVKVQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAPPCPEEKTPHPSVQELTEQIHRLLMQPVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Period circadian protein homolog 2
molecule tags Transcription
source organism Mus musculus
publication title Structural and functional analyses of PAS domain interactions of the clock proteins Drosophila PERIOD and mouse PERIOD2.
pubmed doi rcsb
total genus 58
structure length 269
sequence length 306
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3gdiA01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3gdiA02
4KQDA 2V9AA 4GS9B 1WA9A 4HOIA 3UE6A 5HWWA 5I5LA 1DP9A 2VV8A 3EWKA 1EW0A 2Z6DA 3MR0A 5HWVA 1XJ3A 4H6JA 4HH3A 5HZHA 4HJ6A 3A0SA 1N9OA 1LT0A 3LICA 2P7JA 1F9IA 2QJ7A 3K3DA 4EQ1A 3T50A 1V9ZA 4R3AA 4R38A 4NXBA 3ZQ5A 1TS7A 1NWZA 3UB8A 2HV1A 1T19A 1ODVA 2PYRA 2V1BA 3GECA 1UWNX 2PHYA 4L9EA 3EEHA 4LPZA 4NXEA 1T1AA 2OWHA 1JNUA 1OTIA 4HJ4A 5EFWA 2V1AA 5J3WA 4WLAA 4RQ9A 3LIDA 3NOTC 4JGOA 5HDDA 2WKQA 1UWPX 5DKLA 5AVEA 1TS8A 3UB9A 4YWZA 4MN6A 3MFXA 2CMNA 5F6AA 1Y28A 3LIBA 1T1CA 2VEAA 3E4QA 5G4YA 3RTYA 5HD3A 2L1MA 1OTBA 4M4XA 2PD8A 3PYPA 3VE3A 2YKFA 5HDCA 3MQOA 3LIAA 4I38A 4L9GA 2PD7A 3IS2B 2A24B 3NOUC 4HQAA 4PKYG 3GDIA 3BY9A 1GSXA 1P97A 1F98A 1D06A 2KX6A 3CWFA 3K3CA 4R70A 5HD5A 3SW1A 3LI9A 4HJ3A 4L9FA 5KIZA 2PDRA 4H6JB 1T18A 3HJIA 5G4ZA 2Z6CA 1LSWA 1OTAA 2V0WA 3CAXA 3G6OA 3LYXA 4NXFA 3UB6A 4LRZE 2J80A 2QJ5A 1BYWA 1VB6A 2QWSA 4HY8A 2R78A 4F3LA 4WL9A 1X0OA 4EESA 2ZBBA 2OWJA 5DKKA 4EXOA 2KDKA 5HSQA 1OT6A 5A8BA 4HIAA 4PKYA 3A0RA 3OLOA 2VV6A 3MXQA 2BASA 4I3IA 2I9VA 3CLOA 5F5YA 1OT9A 3VOLA 1DP8A 1TS6A 3UMDA 1XJ4A 2D02A 3C2WA 4K08A 4DJ3A 4E04A 2V0UA 1G28A 1XJ6A 3A0VA 5TBMB 1MZUA 3PHYA 3UB7A 4BBVA 2QKPA 1D7EA 2W0NA 3F1NA 4F3LB 1T1BA 3F1PB 4R6LA 2ZOHA 1XJ2A 2H28A 4JGPA 3MJQA 5AVFA 5F69A 4EEPA 5DJTA 3FG8A 4GCZA 2W27A 4WF0A 4EEUA 3ULFA 4HP4A 4EERA 2YKHA 2PR6A 1KOUA 4WUJA 3E4PA 4WN5A 3IBRA 4BBTA 4I3AA 3LIEA 3H9WA 3ICYA 1S4SA 3IS2A 4MN5A 1GSVA 1S66L 2INWA 1UGUA 2VLGA 4I5SA 3BWLA 3H82A 4GW9A 1S4RA 1TS0A 4HP9A 4I3JA 4BBUA 5J4EA 5IS1A 1DRMA 2K7SA 2PR5A 3H7WA 3LUQA 1LL8A 2WKRA 4HH2A 4LRXC 3HJKA 5DJUA 1XFQA 2A24A 5HDSA 2GJ3A 1XFNA 3NJAA 3VE4A 3RH8B 4HNBA 2VV7A 3MQQA 1S67L 1N9NA 2M1CA 3F1NB 4GS9A 2QHKA 5IU1A 4DJ2A 4EW7A 1OTDA 3B33A 3D72A 3NHQA 5TBMA 5F68A 2PYPA 3P7NA 4GHIB 3C8CA 4LRYC 3KX0X 4XT2B 4EETB 1V9YA 4LLOB 2JHEA 1LSVA 3FC7A 1OJGA 2EA9A 3F1PA 3H7WB 3BY8A 1S1ZA 3NOPC 4I39A 4KUKA 4B9OA 2WKPA 3LI8A 3H82B 3F1OB 1P0ZA 3F1OA 4HI4A 2L0WA 1S1YA 2B02A 1GSWA 2OOLA 3LIFA 3UMEA 2D01A 1N9LA 4JGRA 5HWTA 5J7EA 3E4OA 1DP6A 4KUOA 2ZOIA 4GHIA 2L4RA 4XT2A 1OJ5A 4JGQA 1LSXA 4HHDA 4NXGA 1OTEA 2JN7A
chains in the Genus database with same CATH superfamily
1VHMA 1ONGA 3PBSA 2JKRM 5CEDA 3ZG9B 1TEMA 3N7WA 3ZQ5A 3FZCA 4P0MA 1YAXA 1JNUA 4MMNA 2Y2PA 2ZC5B 4KG2A 2RCXA 4X53A 4KZ3A 3I7JA 4KQOA 1SHVA 1L0DA 3CPTA 1ZG4A 4G3VA 3L7HA 1H8ZA 3OC2A 2ACGA 5AJGA 4PM6A 5CX7A 3DTMA 3HBRA 4KZ4A 5EVIC 2P04A 5HPFA 4YINA 3TSGA 1KE4A 3S22A 3O3VA 3IHBA 3F1NA 2HDQA 3F1PB 1H8MA 1W63Q 3E2KA 2W27A 3ULFA 1G5UA 4KZ6A 3KYQA 3LIEA 1HD8A 3C7UA 2G7UA 4E3LA 3RXXA 1LL8A 3UE1A 2W3FA 2O9BA 2PT7A 5TBMA 3BLSA 3KX0X 2UWXA 4B9OA 3UB5P 1S1ZA 4QU3A 2B02A 4ZJ1A 4R3JA 3MZFA 3E4OA 4KUOA 2L4RA 4HHDA 5EVIB 3EQUA 4IVKA 1DJBA 1VM1A 2JKRI 4H6JA 1ERQA 1N9OA 3LICA 2DRWA 3EEAA 1EI5A 4NXBA 3O88A 5U47A 4E6XA 2VJWA 1YSPA 1LHYA 1CI8A 4YWZA 4Y2FA 3B3XA 4KZ7A 4WELA 4P85A 4Y7PA 1TD5A 3VSLA 3NOUC 5GL9A 2Y79A 3FV7A 3BFDA 2EXBA 1ACFA 1CQAA 4DXBA 3LYXA 2EXAA 3ISGA 4EXOA 4PKYA 3CMZA 3VOLA 2WGIA 2V0UA 2VGLM 3GVBA 2DNSA 2QKPA 3SS3A 1XJ2A 1SDNA 3VMAA 3IBJA 3FYZA 1PI5A 2EX9A 4WF0A 1W5DA 4ZBEA 4XUXA 1QMFA 4G3KA 4LV0A 2X02A 2Y55A 3NJAA 3HLWA 1XXMA 5F68A 1K4EA 2HPBA 3GTCA 3V3SA 1GHIA 1STZA 1RGYA 5KSCA 2A3UA 4C75A 3U2AA 2HP5A 3LO7A 2PU2A 3TG9A 1N9LA 3GQZA 1U60A 3EOIA 2JN7A 4GS9B 4R3BA 1DP9A 1C3BA 3IXGA 2P9VB 4IEDA 4S2JA 3MZEA 2H0TA 3GECA 2K2NA 1MWRA 5FQ9A 4WEJA 2ZM2A 3A3FA 3SH8A 2NUTC 2CMNA 2V8CA 3LIBA 5G4YA 1TDLA 1GSXA 5DF7A 1YMXA 3CPTB 4DE1A 2JKFA 1W8YA 4S2MA 1K54A 5CXWA 1LSWA 3M2KA 4LRZE 1YKDA 5FDSA 4DRTA 4A5RA 4WYYA 1L0FA 4R23A 3P01A 4JBFA 3D9YA 4Q0HA 3N8RA 4Y0TA 4JXVA 2GNXA 5M18A 2W1TA 3T1SA 1OPXA 3MJQA 1MWTA 3BFCA 3NECA 4PM7A 5HW3A 5F1GA 3HL9A 4JLFA 2ZL1B 2P74A 2R9XA 1Q2QA 3U4LP 4X68A 3SH9A 1PIOA 2Y2QA 3MQQA 2XDMA 3ZCZA 2M1CA 3ZNYA 1SCWA 3P98A 3B33A 4KZBA 3Q82A 4LRYC 3V67A 4EETB 3ZDJA 4FH2A 3ZYTA 1K38A 2XRNA 3WS1A 1PI4A 3BLMA 3PBOA 2ZQAA 2XA7S 2WKEA 1IFQA 2PAVP 4JGQA 1LSXA 4NK3A 2V9AA 1H5XA 5A91A 4UAAA 4P6ZS 1P9RA 2EX8A 1GHPA 5IT5A 2I72A 5HZHA 3MSHA 3DBAA 1VETB 4HJ6A 1YM1A 3T50A 1PYYA 2HV1A 1DJAA 2PYRA 1W79A 3V50A 1RP5A 3LFVA 2BLSA 2WKQA 5DKLA 1E4DA 3CI6A 1FR6A 3BJNA 2VEAA 2VX8A 2WKIA 3T12B 4KZ5A 4I38A 3QP8A 2H10A 3K3CA 3S4XA 2QPNA 2HGVA 1XA1A 2PDRA 1T18A 5A92A 3OZHA 1ESUA 2R78A 2KDKA 5K5BA 3OLOA 5FI7A 2BASA 1OT9A 1XJ4A 2VGKA 3A0VA 1AXBA 1G68A 2ZOHA 2H28A 4CLCB 4DE2A 1BUEA 1K56D 3ZG5A 3H82A 4GDBA 5J4EA 4C6YA 1G6OA 3HJKA 2P08A 3CHWP 1N4OA 5CTMA 4CLCC 2B95A 1FIKA 3BY8A 1FCOA 1E25A 1M6KA 3H82B 2L0WA 1CEFA 2VK3A 2XFSA 2D01A 2EWWA 2W1RA 3KYZA 2FFFB 2ZOIA 4DKIA 2XR0A 4NXGA 3BQ8A 1OTEA 4Y5FA 3HUOA 3WS0A 2Y59A 3VP3A 4OPRA 1H8YA 4DF6A 4EQ1A 1K57A 2FFYA 2EX2A 2Y91A 5E43A 3TW8A 5CERA 1JVJA 4HBTA 4Y15A 1FILA 2WKHA 4JGOA 3KO6A 1Y4OA 5FAPA 2ZQ8A 2V20A 4GZBA 4DDYA 1T1CA 4R4SA 4UA9A 2L1MA 3G34A 1YQSA 4FOFA 2EWVA 2PD7A 4CLCD 3V5MA 2XROA 3CWFA 1NXYA 3UB6A 2J80A 4WL9A 3Q7VB 1K55C 3TE8A 3IQAA 1MWUA 2DCFA 3T4JA 1PZPA 4X55A 2ZLYA 2Y2OA 5GLAA 4M3KA 4EERA 2UV0E 4ZRRA 1BLCA 4N1XA 1XP4A 2WZZA 4OQ0A 1IYQA 1PZOA 2PR5A 2K7SA 3EQVA 3VE4A 1S6RA 4E3MA 4OQGA 3RH8B 4BJPA 1XX2A 4DJ2A 3WS2A 2XF3A 4N1HA 4AFIA 1CI9A 1NLZA 2JKGA 3O86A 2VZWA 2XFTA 5DF8A 3QNCA 4FSFA 5HWTA 3G2YA 1DP6A 1EWZA 4XT2A 1TVFA 3BQAA 1XPBA 4OP5A 1QMEA 3A3IA 3EWKA 2HZ5A 5KZHA 2XA7M 5HWVA 1LT0A 4QB8A 2WADA 3UDFA 1ODVA 4EBNA 5EVEA 4O7DA 4KQQA 1CF0A 3TRCA 2EX6A 1WE4A 2VGJA 2HDRA 3VE3A 3MQOA 3LIAA 4HQAA 2KX6A 4BMWA 2Y2IA 4L9FA 4NKPA 3G6OA 4Y0OA 4EESA 1MXOA 3LR5A 1GA9A 4HESA 3LY4A 1O07A 2WGWA 5F5YA 3T1QB 4RYEA 3KYEA 1PRQA 1S0WA 5CHUA 1NZOA 5DTTA 4X1MA 5TBMB 4GD6A 3PR6A 3HLGA 5C5KA 4IVIA 4GCZA 4WZ5A 4K0XA 3W4PA 4I3AA 3H9WA 2Y2HA 1S4SA 5AQBA 3NY4A 3UO9A 2B5RA 3GV9A 4BBUA 4RVAA 4HBUA 3DWZA 2A24A 5L09A 2H0YA 3JVUA 1KE3A 3UDXA 4R0QA 5EVID 2J9PA 4LLOB 3QNBA 4X69A 3F1OB 4JXGA 1Z6FA 2ZQDA 3S7OA 4NEED 3UMEA 3O5YA 4FTXA 2XQZA 2LB9A 3BFEA 1OJ5A 2GDNA 4IJGA 4BD1A 2VV8A 3V3RA 3AGEA 3SH7A 1XJ3A 1MBLA 1LI0A 4IBXA 1F2KA 4R4RA 4OPQA 3Q7ZA 4L9EA 3DW0A 2BTFP 2Y4AA 4MN7A 4HJ4A 5EOOA 5G18A 3IXHA 5FL3A 5DTKA 4MN6A 3WWXA 5F6AA 2ZM8A 2R9WA 5CHJA 3FKVA 2ZC4B 5D3OA 3HJIA 5G4ZA 2Z6CA 4YNRA 1SKFA 1YLZA 5F1FA 4HIAA 3IWQA 4YOFA 3IWOA 3C4OA 1IKIA 3IF6A 5JYOA 1TS6A 1XGIA 4E04A 2NUPC 3BEBA 3LR0A 3QP1A 2W0NA 1SDEA 3GRJA 1T1BA 3RXWA 4OPYA 4Q8IA 4P6BA 1BULA 3Q07A 3VFHA 3PXPA 4WUJA 2J3TC 2V1ZA 4D60A 3ICYA 4OOLA 2INWA 1MKIA 1D1JA 4I3JA 2Y2GA 2PU4A 5HDSA 3HLDA 4N92A 4ETXA 3JYIA 4EW7A 4BWIA 2KOIA 3T4KA 1NZUA 2J3WA 4GHIB 5GLDA 2XEPA 4QD4A 1XA7A 4E3NA 4OLGA 1Y54A 1FOFA 1IOUA 1IKGA 2ZD8A 3PBNA 4GHIA 3G35A 5BOHA 5FQMA 4LV3A 1LL5A 4B4XA 4CLCE 4GB7A 4N9KA 2ZQCA 1JTGA 3K3DA 1FSYA 4LV1A 1BLSA 1NWZA 1ALQA 4O8GA 3EEHA 2ZM0A 1T1AA 4NG2A 1DJCA 4QY5A 3E0YA 3MQ0A 2WGWB 4KG6A 3JVVA 4O01A 1OTBA 3LR4A 3ITAA 4OOMA 5HD5A 1K57C 1OTAA 1IELA 1BYWA 1ES4A 4NETA 5A8BA 2Q9NA 3L9KA 1JTDA 2GZAA 4OP8A 1OMEA 3QP4A 3NULA 1L0GA 1G28A 1XJ6A 3T4OA 5CEBA 3IF5A 3VSKA 3NCKA 3TJZC 4EEPA 3WS4A 5DJTA 4MNRA 5HAQA 3W8KA 3EGXC 3MBZA 4PPRA 5FQIA 3E98A 1Z09A 3A3JA 1FQGA 4II7A 2WYXA 2JC7A 2IWCA 4BENA 3H7WA 5TJJA 5DJUA 4LGWA 3MZDA 2GJ3A 1FSWA 3W4OA 5HPIA 4MDZA 4HNBA 5GLBA 4X1LA 2PYPA 4MBFA 5HL1A 2XGNA 3RFBA 4DN0A 4OLDA 5FAQA 3LI8A 3F1OA 1S1YA 2WZXA 1KGGA 3C4PA 2RL3A 4OH0A 4B88A 1KVMA 2HP9A 5E2GA 1H3QA 2O0YA 5GHXA 3A0SA 4ZDXA 2WGVA 2CC1A 5GHZA 3CUEC 1ES2A 4WMCD 1BLPA 2XD5A 1UWNX 3HREA 5J3WA 4S2IA 4JF4A 4MBHA 3DAVA 2Y8HA 3PYPA 2HF6A 2YKFA 3T1RA 4ZJ3A 4GJ4A 3GDIA 3S7QA 1ES3A 5KIZA 5FQKA 4NXFA 4B4ZA 5EM1A 3FWLA 3VP2A 4ZAMA 2XD1A 4I3IA 5DFXA 3CLOA 5FI2A 2B18A 2OLVA 2H5SA 5AQ9A 4BD0A 2ZQ7A 1GHMA 3B47A 1W8QA 3IX3A 3AGDA 1MZUA 3Q81A 4QY6A 3KSHA 4F3LB 2E8IA 3HCYA 5F69A 4JF6A 3FG8A 4HP4A 1NJ4A 1SKOA 2W3HA 4ID4A 4S2LA 2E8JA 4S2NA 1XFNA 4CPKA 2G2UA 1S67L 2X01A 4XT2B 3C8CA 1NRJA 1XKZA 3IXBA 2W1TB 3OOVA 4BLMA 2J9OA 3HUNA 4IHQA 3LCEA 5LBRA 2ZC3B 2M7UA 1O7EA 3PTEA 1FCMA 1WA9A 5I5LA 3T1XA 5FAOA 1LLBA 3A3DA 3R7WB 2VKSA 1V9ZA 4R3AA 4BL2A 5TGFA 3GSGA 3UDIA 4EWFA 5AVEA 2JE5A 1KVLA 3LY3A 1Y28A 5EUAA 1TF1A 4KZAA 4GN2A 4O0PA 2A24B 1E3UA 3LGOA 4OONA 2JBFA 2JKTI 5I94A 4ARZA 3NDEA 1VEUA 1AWIA 3SS4A 1X0OA 2W3EA 2XSSA 2IWBA 4N9LA 2VV6A 3MXQA 2I9VA 4G3WA 4K08A 5TR7A 4Y0UA 4BBVA 3C5AA 3R7WA 5FI6A 3QHYA 4EEUA 1A0KA 1KOUA 3IX4A 1GSVA 3OBFA 2LB5A 1G6AA 1TS0A 4LRXC 3IX8A 2ZMFA 3IF6C 5L07A 1N9NA 4Y13A 4R1GA 3BYDA 3D72A 3NHQA 3B42A 1YLTA 3LR3A 1F5MA 3CZDA 1IYOA 4Y17A 1BT5A 4U0TA 4KUKA 3PAEA 4RX3A 3WRZA 3Q1FA 4B93A 4EUZA 1GCEA 3HLEA 3AGFA 4CJNA 4DXCA 2EFXA 4OKPA 5DFYA 2PRFA 3V39A 5KMWA 1NY0A 3G30A 1J9MA 2V2FF 4PHTA 1SZVA 1PW8A 4X56A 2FH5A 1LL9A 3OCLA 3SS5A 5CRFA 3RTYA 3ZG0A 4P87A 2XH9A 3MFDA 4L9GA 3C38A 5E2FA 2MJ6A 4PKYG 4WZ5C 1MC0A 4MEZA 4H6JB 4EUVA 1HVBA 4EBLA 2JCHA 2QWSA 1RCJA 2HJEA 4LFUA 1CEGA 1IYSA 1PWDA 2WAFA 3DTIA 3C7VA 5AQAA 1HZOA 4KG5A 1MY8A 5L10A 3WRTA 1D7EA 2HDSA 5FQQA 3W2ZA 4R6LA 4K0WA 2BG1A 4E6WA 5AVFA 2P9VA 2K31A 3HLFA 4WN5A 2M7VA 3JPUA 5HAPA 3LUQA 2PBDP 3D3OA 1JWVA 1JWPA 5IU1A 5DTSA 4ETZA 5FEFA 2XLNA 4K91A 5MC7A 3A3EA 3R4KA 1YT4A 3FC7A 3F1PA 1I2WA 3LEQA 1I2SA 5CGXA 3G32A 3LIFA 1KGFA 2ZC6B 3M6HA 3QP6A 3VOYA 2FZ0A 3OCNA 4WM9A 4EQIA 4R38A 2V1BA 2HJ9C 3QP5A 2OWHA 2AVXA 2V1AA 3T4SA 3LIDA 3NOTC 5EPHA 5HDDA 5HFOA 3IH8A 5F83A 1TS8A 3MFXA 5EOEA 3HLBA 4MBKA 1BLHA 1ZG6A 1YMSA 3OPPA 1ERMA 4M4XA 3NI9A 5HDCA 1ES5A 1SKOB 3NBLA 4H8RA 5EM0A 3BY9A 1P97A 1M40A 3LI9A 3CUEA 1HLUP 3MMHA 3IXDA 2V0WA 4S2OA 4Z1WA 1PFLA 3CITA 4F3LA 2ZBBA 2OWJA 3PBTA 3IHAA 4KZ9A 3ZG7B 2DMWA 5HL6A 3UMDA 2D02A 4S2KA 4DJ3A 3IH9A 2IA2A 4ESPA 5F82A 1CK3A 4JGPA 4Z9QA 1W7FA 1K0KA 2PBYA 2WK0A 3N6IA 3E4PA 2JKTM 1VEUB 3IBRA 3IS2A 2QYBA 3DTEA 4GNUA 3ZG8B 1S66L 3BWLA 4GW9A 5EVIA 5EVLA 4OPZA 5HSQA 4UHUA 4GS9A 2QHKA 1OTDA 2X71A 4LV2A 3UPNA 1KDWA 2EA9A 1EROA 2J7VA 1VQQA 4MLLA 3Q7VA 5J7EA 4RX2A 5EECA 4KQDA 2WAEA 3ZNTA 5DVAA 1EW0A 1L3LA 3SZTA 2QJ7A 2OSUA 5GHYA 4QHCA 1BZAA 4PAUA 5CGSA 2PHYA 3EGDC 3GMWA 2GX5A 4KQRA 4IUKA 4RQ9A 2W3GA 4Y3IA 3GR2A 1YLJA 3IF6B 2VA0A 3N4IA 4QPRA 2PD8A 3S1YA 3MXSA 5A90A 1F98A 3SW1A 3S7PA 3ZVTA 1ONHA 1KGEA 4FCFA 1K6SA 3VV4A 4WMCA 1OT6A 1DY6A 1JWZA 2VGLS 3D4FA 2IWDA 1DP8A 2XK1A 4WZ4A 3C2WA 2Q9MA 3PHYA 4ZJ2A 1LI9A 1KDSA 3PAGA 1PWGA 3QP2A 3FPVA 3T4TA 1ZTUA 2YKHA 2PR6A 2Y2KA 4MN5A 4I5SA 2WKRA 5FA7A 5DF9A 1XFQA 1K4FA 5TFQA 1FCNA 4S2PA 4UQIS 1V9YA 4Q0IA 3PBQA 1GA0A 1YSQA 3BECA 3LEZA 5EFWA 5M1AA 2WUQA 2WKPA 1NRFA 2A49A 3KSGA 1H0MA 1KE0A 2Y2NA 3M2JA 1GSWA 5HX9A 4JGRA 3G2ZA 4R70A 3UNWA 5M19A 2ZMVA 5HWWA 2Z6DA 5L8MA 4HH3A 1F9IA 5CHMA 3W4QA 1T19A 4X25A 3ZGAB 1RGZA 4PMAA 3TOIA 4BQMA 4JXWA 2Y2LA 3G4PA 4WBGA 3E4QA 1K6RA 3BW6A 1P9WA 1J3WA 3UE0A 2C5WB 4FH4A 4QWOA 2QJ5A 4DE0A 4HY8A 1ZHHB 5DKKA 1MPLA 3VP4A 3ZHHA 4S2NC 1ZKJA 1WYBA 3OPLA 4C3QA 3UPOA 5JYPA 1I5QA 3BM6A 2QZ6A 3FPWA 1TDGA 4FD8A 2J3TD 3NDGA 2ZL1A 5FSRA 2VLGA 1S4RA 4HP9A 5IS1A 4QJGA 4GOGA 4WEKA 3S7NA 2G2WA 3N8SA 4PM9A 3KSFA 4U3TA 3VOZA 4JPMA 4RA7A 4ZTKA 1LSVA 1OJGA 4OOYA 5FASA 4LCMA 4KZ8A 2ZJ9A 3DWKA 5IHVA 4IUHA 4DMZA 2O99A 5GLCA 2ZMAA 2OOLA 1L2SA 4YFMA 1YLWA 3VP0A 2QMIA 5EV0A 4EU0A 4UA7A 2Z2LB 5HAIA 2P7JA 5CTNA 1MWSA 3VFFA 1HTZA 1TS7A 1ESIA 3G31A 4BL3A 4LPZA 4NXEA 3MXRA 4WLAA 4E3OA 4ARZB 1UWPX 2V8FA 3UB9A 3N8LA 3PBRA 3ZVWA 3CJMA 5HD3A 4GDNA 2Y2JA 4UQIM 3IS2B 3M6BA 4MCWA 2ZC7A 5FDHA 3BFGA 3OPRA 4JXSA 5E2EA 1VB6A 4CQHA 2ZQ9A 4GD8A 4L0LA 4DE3A 3A0RA 3KSIA 4ME4A 4LENA 4P6ZM 2W3DA 3O87A 5CECA 4HEFA 1PW1A 2OLUA 4OQIA 4E3JA 3HVFA 5EE8A 4D2OA 2Q0OA 4OQHA 4LCLA 4PM5A 3BRMA 4OVDA 4JKTA 5AQ7A 1NYYA 3HUMA 2OV5A 1PNEA 1DRMA 4HH2A 3SOIA 3MKEA 1YPRA 5FEGA 1K25A 5CGWA 4EV4A 3BFFA 1NLYA 4XUZA 2JHEA 3NIAA 4I39A 3K2NA 1E3UD 3ITBA 4HI4A 3T4QA 3C30A 4DDSA 3UN7A 4HOIA 1MKMA 1YLPA 3UE6A 3T4LA 3FKWA 4GLQA 3MR0A 4UEYA 4CLCA 5FATA 3DTKA 4EBPA 3MKFA 3MS6A 1K54C 3UB8A 5J8XA 2HP6A 4E3KA 3MF0A 3WS5A 1OTIA 3UY6A 4E3IA 4UA6A 3P09A 4XXRA 3OPHA 2Z2MB 4KENB 4PM8A 3VP1A 1N9BA 5KSHA 5L2FA 4Q0JA 1D06A 1L0EA 5A93A 4HJ3A 2Y2MA 3ZFZA 2OAP1 3CAXA 3NC8A 5E2HA 2A2LA 4FUWA 3E2LA 4GKUA 1IEMA 4U0XA 3RJUA 3UB7A 3IT9A 1NYMA 1W63M 2HDUA 1VETA 1BTLA 4IBRA 2O9AA 1ZC2A 4BBTA 1UGUA 1XGJA 1K55A 4JF5A 3UPPA 2EFUA 2OAQ1 1CJFA 1BSGA 1PWCA 2J8YA 2VV7A 3CG5A 3F1NB 1WYCA 4F94A 4X6TA 3P7NA 2O9CA 5HARA 2C6WB 3H7WB 3NOPC 2KLIA 1P0ZA 1YLYA 3HLCA 3UE3A 1Q2PA 5FQJA 1FR1A 1K56A 3IWIA 1IYPA
chains in the Genus database with same CATH topology
1VHMA 4KQDA 4Y5FA 1EW0A 3PBSA 1H3QA 2O0YA 2JKRM 3A0SA 2QJ7A 1OTEA 4EQ1A 3ZQ5A 3CUEC 3TW8A 4PAUA 1UWNX 2PHYA 3EGDC 1YAXA 1JNUA 2GX5A 4MMNA 5J3WA 4IUKA 4RQ9A 2W3GA 4JGOA 4Y3IA 3KO6A 2VA0A 1T1CA 2L1MA 4QPRA 2Y8HA 2PD8A 3PYPA 2HF6A 2YKFA 4FOFA 2EWVA 2PD7A 4CLCD 4GJ4A 3GDIA 3S7QA 2XROA 1F98A 3CWFA 4KQOA 3SW1A 3S7PA 4G3VA 5KIZA 3OC2A 4NXFA 3VV4A 3UB6A 2J80A 5AJGA 4WL9A 5CX7A 1OT6A 3TE8A 2VGLS 2P04A 4I3IA 5HPFA 5DFXA 3CLOA 2B18A 3T4JA 1DP8A 3C2WA 3B47A 1MZUA 3PHYA 4F3LB 3KSHA 3F1NA 3F1PB 3HCYA 1H8MA 1W63Q 5F69A 3FPVA 3T4TA 3FG8A 1ZTUA 2W27A 3ULFA 4HP4A 4EERA 2YKHA 4ZRRA 2PR6A 3KYQA 3LIEA 2W3HA 4MN5A 4I5SA 2G7UA 2PR5A 2K7SA 3EQVA 1LL8A 2WKRA 3VE4A 5DF9A 1XFQA 1XFNA 2W3FA 3RH8B 1S67L 4BJPA 2O9BA 2PT7A 4DJ2A 5TBMA 4XT2B 3C8CA 1NRJA 3KX0X 4UQIS 4AFIA 1NLZA 1V9YA 4Q0IA 3PBQA 1YSQA 5EFWA 4B9OA 2W1TB 1S1ZA 2WKPA 2VZWA 3OOVA 3KSGA 2B02A 4IHQA 1GSWA 4FSFA 5LBRA 4JGRA 5HWTA 3E4OA 2M7UA 1DP6A 4KUOA 4XT2A 2L4RA 4HHDA 3BQAA 4R70A 3EQUA 2ZMVA 1WA9A 5HWWA 5I5LA 3EWKA 2XA7M 2Z6DA 5L8MA 2JKRI 5HWVA 4H6JA 4HH3A 1N9OA 1LT0A 3LICA 1F9IA 3R7WB 2VKSA 3EEAA 1V9ZA 4R3AA 4NXBA 1T19A 1ODVA 2VJWA 1YSPA 5AVEA 3TRCA 4YWZA 4Y2FA 1Y28A 3E4QA 4WELA 3BW6A 3VE3A 1P9WA 1TD5A 3MQOA 1TF1A 3LIAA 4O0PA 2A24B 3NOUC 4HQAA 2KX6A 2Y79A 4BMWA 4L9FA 2JKTI 4NKPA 4ARZA 3G6OA 3LYXA 2QJ5A 4HY8A 4EESA 1X0OA 1ZHHB 3LR5A 4EXOA 2W3EA 5DKKA 2XSSA 4PKYA 2VV6A 3MXQA 2I9VA 5F5YA 3VOLA 4G3WA 4K08A 2V0UA 2VGLM 5TBMB 4BBVA 2QKPA 3FPWA 1XJ2A 3PR6A 3R7WA 3IBJA 2J3TD 5C5KA 4GCZA 4WF0A 4EEUA 1KOUA 4I3AA 3H9WA 1S4SA 4G3KA 1GSVA 3OBFA 2VLGA 2LB5A 4BBUA 1S4RA 1TS0A 4HP9A 5IS1A 4LRXC 2ZMFA 2A24A 3NJAA 4WEKA 3S7NA 3JVUA 1N9NA 3D72A 3NHQA 3B42A 3LR3A 3KSFA 5F68A 1F5MA 4LLOB 1LSVA 1OJGA 4KUKA 1STZA 3F1OB 4IUHA 3S7OA 3U2AA 4DMZA 2O99A 4B93A 4NEED 2OOLA 3UMEA 3O5YA 1N9LA 2LB9A 5DFYA 1OJ5A 3EOIA 2JN7A 4IJGA 4GS9B 4EU0A 1DP9A 2VV8A 1XJ3A 2P7JA 4PHTA 1TS7A 4L9EA 4LPZA 3GECA 2K2NA 4NXEA 4MN7A 4HJ4A 4WLAA 4ARZB 1UWPX 4WEJA 2FH5A 5FL3A 3UB9A 2NUTC 4MN6A 3OCLA 2CMNA 3PBRA 5F6AA 3LIBA 5G4YA 3RTYA 5HD3A 4UQIM 4L9GA 3IS2B 3C38A 2MJ6A 4PKYG 1GSXA 4MCWA 1MC0A 4H6JB 4EUVA 3HJIA 5G4ZA 2Z6CA 1LSWA 4LRZE 1YKDA 1VB6A 2QWSA 4YNRA 4CQHA 2HJEA 4L0LA 4HIAA 3A0RA 3KSIA 4ME4A 4YOFA 4P6ZM 1TS6A 4E04A 2W3DA 3P01A 4Q0HA 3LR0A 2NUPC 1D7EA 2GNXA 2W0NA 2W1TA 1T1BA 3W2ZA 4R6LA 1OPXA 3MJQA 5AVFA 2K31A 3PXPA 4WUJA 4WN5A 2J3TC 2M7VA 3ICYA 4OOLA 2INWA 4I3JA 3LUQA 1DRMA 4HH2A 5HDSA 3D3OA 4ETXA 3MQQA 2M1CA 5IU1A 4ETZA 4EW7A 4BWIA 2KOIA 3B33A 3T4KA 5MC7A 4LRYC 2J3WA 4GHIB 3V67A 1NLYA 4EETB 3R4KA 2JHEA 3ZYTA 3FC7A 4I39A 3F1PA 2XRNA 3K2NA 4HI4A 3T4QA 3PBOA 3C30A 1IOUA 3LIFA 2XA7S 1IFQA 3PBNA 4GHIA 4JGQA 1LSXA 2V9AA 4CLCE 4HOIA 1MKMA 1P9RA 4P6ZS 3UE6A 5IT5A 3T4LA 2FZ0A 4GLQA 3MR0A 5HZHA 3OCNA 3DBAA 4HJ6A 4UEYA 3K3DA 4CLCA 3T50A 4R38A 1NWZA 3UB8A 2HV1A 2PYRA 2V1BA 2HJ9C 3EEHA 4O8GA 1T1AA 3MF0A 2OWHA 1OTIA 2V1AA 3LFVA 3T4SA 3LIDA 3NOTC 5HDDA 2WKQA 5DKLA 1TS8A 3E0YA 3MFXA 3CI6A 3BJNA 3MQ0A 2VEAA 4O01A 3JVVA 1OTBA 2VX8A 4M4XA 5HDCA 4I38A 5KSHA 4Q0JA 3LR4A 3K3CA 3BY9A 1P97A 4OOMA 1D06A 5HD5A 2HGVA 3LI9A 4HJ3A 2PDRA 3CUEA 1T18A 2OAP1 3MMHA 1OTAA 2V0WA 3CAXA 4Z1WA 3CITA 1BYWA 2R78A 4F3LA 2ZBBA 2OWJA 2KDKA 3PBTA 5A8BA 5K5BA 3OLOA 2GZAA 2A2LA 2BASA 1OT9A 2DMWA 5HL6A 3UMDA 1XJ4A 2D02A 4DJ3A 1G28A 1XJ6A 3A0VA 3UB7A 2IA2A 3T4OA 1W63M 2ZOHA 4JGPA 2H28A 4CLCB 3TJZC 4EEPA 5DJTA 2O9AA 3E4PA 3EGXC 2JKTM 3IBRA 4BBTA 3E98A 3IS2A 2QYBA 1S66L 4II7A 1UGUA 3BWLA 3H82A 4GW9A 5J4EA 3H7WA 5HSQA 5TJJA 2OAQ1 5DJUA 1G6OA 3HJKA 2GJ3A 5HPIA 4MDZA 4HNBA 2VV7A 2P08A 4GS9A 3F1NB 2QHKA 1OTDA 2PYPA 3P7NA 2O9CA 4CLCC 3RFBA 4DN0A 2EA9A 3H7WB 3BY8A 3NOPC 3LI8A 3H82B 2KLIA 1P0ZA 3F1OA 2L0WA 1S1YA 3UE3A 2D01A 2EWWA 2W1RA 3KYZA 5J7EA 2ZOIA 4NXGA 3BQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KQD A;  2V9A A;  4GS9 B;  1WA9 A;  4HOI A;  3UE6 A;  5HWW A;  5I5L A;  1DP9 A;  2VV8 A;  3EWK A;  1EW0 A;  2Z6D A;  3MR0 A;  5HWV A;  1XJ3 A;  4H6J A;  4HH3 A;  5HZH A;  4HJ6 A;  3A0S A;  1N9O A;  1LT0 A;  3LIC A;  2P7J A;  1F9I A;  2QJ7 A;  3K3D A;  4EQ1 A;  3T50 A;  1V9Z A;  4R3A A;  4R38 A;  4NXB A;  3ZQ5 A;  1TS7 A;  1NWZ A;  3UB8 A;  2HV1 A;  1T19 A;  1ODV A;  2PYR A;  2V1B A;  3GEC A;  1UWN X;  2PHY A;  4L9E A;  3EEH A;  4LPZ A;  4NXE A;  1T1A A;  2OWH A;  1JNU A;  1OTI A;  4HJ4 A;  5EFW A;  2V1A A;  5J3W A;  4WLA A;  4RQ9 A;  3LID A;  3NOT C;  4JGO A;  5HDD A;  2WKQ A;  1UWP X;  5DKL A;  5AVE A;  1TS8 A;  3UB9 A;  4YWZ A;  4MN6 A;  3MFX A;  2CMN A;  5F6A A;  1Y28 A;  3LIB A;  1T1C A;  2VEA A;  3E4Q A;  5G4Y A;  3RTY A;  5HD3 A;  2L1M A;  1OTB A;  4M4X A;  2PD8 A;  3PYP A;  3VE3 A;  2YKF A;  5HDC A;  3MQO A;  3LIA A;  4I38 A;  4L9G A;  2PD7 A;  3IS2 B;  2A24 B;  3NOU C;  4HQA A;  4PKY G;  3GDI A;  3BY9 A;  1GSX A;  1P97 A;  1F98 A;  1D06 A;  2KX6 A;  3CWF A;  3K3C A;  4R70 A;  5HD5 A;  3SW1 A;  3LI9 A;  4HJ3 A;  4L9F A;  5KIZ A;  2PDR A;  4H6J B;  1T18 A;  3HJI A;  5G4Z A;  2Z6C A;  1LSW A;  1OTA A;  2V0W A;  3CAX A;  3G6O A;  3LYX A;  4NXF A;  3UB6 A;  4LRZ E;  2J80 A;  2QJ5 A;  1BYW A;  1VB6 A;  2QWS A;  4HY8 A;  2R78 A;  4F3L A;  4WL9 A;  1X0O A;  4EES A;  2ZBB A;  2OWJ A;  5DKK A;  4EXO A;  2KDK A;  5HSQ A;  1OT6 A;  5A8B A;  4HIA A;  4PKY A;  3A0R A;  3OLO A;  2VV6 A;  3MXQ A;  2BAS A;  4I3I A;  2I9V A;  3CLO A;  5F5Y A;  1OT9 A;  3VOL A;  1DP8 A;  1TS6 A;  3UMD A;  1XJ4 A;  2D02 A;  3C2W A;  4K08 A;  4DJ3 A;  4E04 A;  2V0U A;  1G28 A;  1XJ6 A;  3A0V A;  5TBM B;  1MZU A;  3PHY A;  3UB7 A;  4BBV A;  2QKP A;  1D7E A;  2W0N A;  3F1N A;  4F3L B;  1T1B A;  3F1P B;  4R6L A;  2ZOH A;  1XJ2 A;  2H28 A;  4JGP A;  3MJQ A;  5AVF A;  5F69 A;  4EEP A;  5DJT A;  3FG8 A;  4GCZ A;  2W27 A;  4WF0 A;  4EEU A;  3ULF A;  4HP4 A;  4EER A;  2YKH A;  2PR6 A;  1KOU A;  4WUJ A;  3E4P A;  4WN5 A;  3IBR A;  4BBT A;  4I3A A;  3LIE A;  3H9W A;  3ICY A;  1S4S A;  3IS2 A;  4MN5 A;  1GSV A;  1S66 L;  2INW A;  1UGU A;  2VLG A;  4I5S A;  3BWL A;  3H82 A;  4GW9 A;  1S4R A;  1TS0 A;  4HP9 A;  4I3J A;  4BBU A;  5J4E A;  5IS1 A;  1DRM A;  2K7S A;  2PR5 A;  3H7W A;  3LUQ A;  1LL8 A;  2WKR A;  4HH2 A;  4LRX C;  3HJK A;  5DJU A;  1XFQ A;  2A24 A;  5HDS A;  2GJ3 A;  1XFN A;  3NJA A;  3VE4 A;  3RH8 B;  4HNB A;  2VV7 A;  3MQQ A;  1S67 L;  1N9N A;  2M1C A;  3F1N B;  4GS9 A;  2QHK A;  5IU1 A;  4DJ2 A;  4EW7 A;  1OTD A;  3B33 A;  3D72 A;  3NHQ A;  5TBM A;  5F68 A;  2PYP A;  3P7N A;  4GHI B;  3C8C A;  4LRY C;  3KX0 X;  4XT2 B;  4EET B;  1V9Y A;  4LLO B;  2JHE A;  1LSV A;  3FC7 A;  1OJG A;  2EA9 A;  3F1P A;  3H7W B;  3BY8 A;  1S1Z A;  3NOP C;  4I39 A;  4KUK A;  4B9O A;  2WKP A;  3LI8 A;  3H82 B;  3F1O B;  1P0Z A;  3F1O A;  4HI4 A;  2L0W A;  1S1Y A;  2B02 A;  1GSW A;  2OOL A;  3LIF A;  3UME A;  2D01 A;  1N9L A;  4JGR A;  5HWT A;  5J7E A;  3E4O A;  1DP6 A;  4KUO A;  2ZOI A;  4GHI A;  2L4R A;  4XT2 A;  1OJ5 A;  4JGQ A;  1LSX A;  4HHD A;  4NXG A;  1OTE A;  2JN7 A; 
#chains in the Genus database with same CATH topology
 1VHM A;  1ONG A;  3PBS A;  2JKR M;  5CED A;  3ZG9 B;  1TEM A;  3N7W A;  3ZQ5 A;  3FZC A;  4P0M A;  1YAX A;  1JNU A;  4MMN A;  2Y2P A;  2ZC5 B;  4KG2 A;  2RCX A;  4X53 A;  4KZ3 A;  3I7J A;  4KQO A;  1SHV A;  1L0D A;  3CPT A;  1ZG4 A;  4G3V A;  3L7H A;  1H8Z A;  3OC2 A;  2ACG A;  5AJG A;  4PM6 A;  5CX7 A;  3DTM A;  3HBR A;  4KZ4 A;  5EVI C;  2P04 A;  5HPF A;  4YIN A;  3TSG A;  1KE4 A;  3S22 A;  3O3V A;  3IHB A;  3F1N A;  2HDQ A;  3F1P B;  1H8M A;  1W63 Q;  3E2K A;  2W27 A;  3ULF A;  1G5U A;  4KZ6 A;  3KYQ A;  3LIE A;  1HD8 A;  3C7U A;  2G7U A;  4E3L A;  3RXX A;  1LL8 A;  3UE1 A;  2W3F A;  2O9B A;  2PT7 A;  5TBM A;  3BLS A;  3KX0 X;  2UWX A;  4B9O A;  3UB5 P;  1S1Z A;  4QU3 A;  2B02 A;  4ZJ1 A;  4R3J A;  3MZF A;  3E4O A;  4KUO A;  2L4R A;  4HHD A;  5EVI B;  3EQU A;  4IVK A;  1DJB A;  1VM1 A;  2JKR I;  4H6J A;  1ERQ A;  1N9O A;  3LIC A;  2DRW A;  3EEA A;  1EI5 A;  4NXB A;  3O88 A;  5U47 A;  4E6X A;  2VJW A;  1YSP A;  1LHY A;  1CI8 A;  4YWZ A;  4Y2F A;  3B3X A;  4KZ7 A;  4WEL A;  4P85 A;  4Y7P A;  1TD5 A;  3VSL A;  3NOU C;  5GL9 A;  2Y79 A;  3FV7 A;  3BFD A;  2EXB A;  1ACF A;  1CQA A;  4DXB A;  3LYX A;  2EXA A;  3ISG A;  4EXO A;  4PKY A;  3CMZ A;  3VOL A;  2WGI A;  2V0U A;  2VGL M;  3GVB A;  2DNS A;  2QKP A;  3SS3 A;  1XJ2 A;  1SDN A;  3VMA A;  3IBJ A;  3FYZ A;  1PI5 A;  2EX9 A;  4WF0 A;  1W5D A;  4ZBE A;  4XUX A;  1QMF A;  4G3K A;  4LV0 A;  2X02 A;  2Y55 A;  3NJA A;  3HLW A;  1XXM A;  5F68 A;  1K4E A;  2HPB A;  3GTC A;  3V3S A;  1GHI A;  1STZ A;  1RGY A;  5KSC A;  2A3U A;  4C75 A;  3U2A A;  2HP5 A;  3LO7 A;  2PU2 A;  3TG9 A;  1N9L A;  3GQZ A;  1U60 A;  3EOI A;  2JN7 A;  4GS9 B;  4R3B A;  1DP9 A;  1C3B A;  3IXG A;  2P9V B;  4IED A;  4S2J A;  3MZE A;  2H0T A;  3GEC A;  2K2N A;  1MWR A;  5FQ9 A;  4WEJ A;  2ZM2 A;  3A3F A;  3SH8 A;  2NUT C;  2CMN A;  2V8C A;  3LIB A;  5G4Y A;  1TDL A;  1GSX A;  5DF7 A;  1YMX A;  3CPT B;  4DE1 A;  2JKF A;  1W8Y A;  4S2M A;  1K54 A;  5CXW A;  1LSW A;  3M2K A;  4LRZ E;  1YKD A;  5FDS A;  4DRT A;  4A5R A;  4WYY A;  1L0F A;  4R23 A;  3P01 A;  4JBF A;  3D9Y A;  4Q0H A;  3N8R A;  4Y0T A;  4JXV A;  2GNX A;  5M18 A;  2W1T A;  3T1S A;  1OPX A;  3MJQ A;  1MWT A;  3BFC A;  3NEC A;  4PM7 A;  5HW3 A;  5F1G A;  3HL9 A;  4JLF A;  2ZL1 B;  2P74 A;  2R9X A;  1Q2Q A;  3U4L P;  4X68 A;  3SH9 A;  1PIO A;  2Y2Q A;  3MQQ A;  2XDM A;  3ZCZ A;  2M1C A;  3ZNY A;  1SCW A;  3P98 A;  3B33 A;  4KZB A;  3Q82 A;  4LRY C;  3V67 A;  4EET B;  3ZDJ A;  4FH2 A;  3ZYT A;  1K38 A;  2XRN A;  3WS1 A;  1PI4 A;  3BLM A;  3PBO A;  2ZQA A;  2XA7 S;  2WKE A;  1IFQ A;  2PAV P;  4JGQ A;  1LSX A;  4NK3 A;  2V9A A;  1H5X A;  5A91 A;  4UAA A;  4P6Z S;  1P9R A;  2EX8 A;  1GHP A;  5IT5 A;  2I72 A;  5HZH A;  3MSH A;  3DBA A;  1VET B;  4HJ6 A;  1YM1 A;  3T50 A;  1PYY A;  2HV1 A;  1DJA A;  2PYR A;  1W79 A;  3V50 A;  1RP5 A;  3LFV A;  2BLS A;  2WKQ A;  5DKL A;  1E4D A;  3CI6 A;  1FR6 A;  3BJN A;  2VEA A;  2VX8 A;  2WKI A;  3T12 B;  4KZ5 A;  4I38 A;  3QP8 A;  2H10 A;  3K3C A;  3S4X A;  2QPN A;  2HGV A;  1XA1 A;  2PDR A;  1T18 A;  5A92 A;  3OZH A;  1ESU A;  2R78 A;  2KDK A;  5K5B A;  3OLO A;  5FI7 A;  2BAS A;  1OT9 A;  1XJ4 A;  2VGK A;  3A0V A;  1AXB A;  1G68 A;  2ZOH A;  2H28 A;  4CLC B;  4DE2 A;  1BUE A;  1K56 D;  3ZG5 A;  3H82 A;  4GDB A;  5J4E A;  4C6Y A;  1G6O A;  3HJK A;  2P08 A;  3CHW P;  1N4O A;  5CTM A;  4CLC C;  2B95 A;  1FIK A;  3BY8 A;  1FCO A;  1E25 A;  1M6K A;  3H82 B;  2L0W A;  1CEF A;  2VK3 A;  2XFS A;  2D01 A;  2EWW A;  2W1R A;  3KYZ A;  2FFF B;  2ZOI A;  4DKI A;  2XR0 A;  4NXG A;  3BQ8 A;  1OTE A;  4Y5F A;  3HUO A;  3WS0 A;  2Y59 A;  3VP3 A;  4OPR A;  1H8Y A;  4DF6 A;  4EQ1 A;  1K57 A;  2FFY A;  2EX2 A;  2Y91 A;  5E43 A;  3TW8 A;  5CER A;  1JVJ A;  4HBT A;  4Y15 A;  1FIL A;  2WKH A;  4JGO A;  3KO6 A;  1Y4O A;  5FAP A;  2ZQ8 A;  2V20 A;  4GZB A;  4DDY A;  1T1C A;  4R4S A;  4UA9 A;  2L1M A;  3G34 A;  1YQS A;  4FOF A;  2EWV A;  2PD7 A;  4CLC D;  3V5M A;  2XRO A;  3CWF A;  1NXY A;  3UB6 A;  2J80 A;  4WL9 A;  3Q7V B;  1K55 C;  3TE8 A;  3IQA A;  1MWU A;  2DCF A;  3T4J A;  1PZP A;  4X55 A;  2ZLY A;  2Y2O A;  5GLA A;  4M3K A;  4EER A;  2UV0 E;  4ZRR A;  1BLC A;  4N1X A;  1XP4 A;  2WZZ A;  4OQ0 A;  1IYQ A;  1PZO A;  2PR5 A;  2K7S A;  3EQV A;  3VE4 A;  1S6R A;  4E3M A;  4OQG A;  3RH8 B;  4BJP A;  1XX2 A;  4DJ2 A;  3WS2 A;  2XF3 A;  4N1H A;  4AFI A;  1CI9 A;  1NLZ A;  2JKG A;  3O86 A;  2VZW A;  2XFT A;  5DF8 A;  3QNC A;  4FSF A;  5HWT A;  3G2Y A;  1DP6 A;  1EWZ A;  4XT2 A;  1TVF A;  3BQA A;  1XPB A;  4OP5 A;  1QME A;  3A3I A;  3EWK A;  2HZ5 A;  5KZH A;  2XA7 M;  5HWV A;  1LT0 A;  4QB8 A;  2WAD A;  3UDF A;  1ODV A;  4EBN A;  5EVE A;  4O7D A;  4KQQ A;  1CF0 A;  3TRC A;  2EX6 A;  1WE4 A;  2VGJ A;  2HDR A;  3VE3 A;  3MQO A;  3LIA A;  4HQA A;  2KX6 A;  4BMW A;  2Y2I A;  4L9F A;  4NKP A;  3G6O A;  4Y0O A;  4EES A;  1MXO A;  3LR5 A;  1GA9 A;  4HES A;  3LY4 A;  1O07 A;  2WGW A;  5F5Y A;  3T1Q B;  4RYE A;  3KYE A;  1PRQ A;  1S0W A;  5CHU A;  1NZO A;  5DTT A;  4X1M A;  5TBM B;  4GD6 A;  3PR6 A;  3HLG A;  5C5K A;  4IVI A;  4GCZ A;  4WZ5 A;  4K0X A;  3W4P A;  4I3A A;  3H9W A;  2Y2H A;  1S4S A;  5AQB A;  3NY4 A;  3UO9 A;  2B5R A;  3GV9 A;  4BBU A;  4RVA A;  4HBU A;  3DWZ A;  2A24 A;  5L09 A;  2H0Y A;  3JVU A;  1KE3 A;  3UDX A;  4R0Q A;  5EVI D;  2J9P A;  4LLO B;  3QNB A;  4X69 A;  3F1O B;  4JXG A;  1Z6F A;  2ZQD A;  3S7O A;  4NEE D;  3UME A;  3O5Y A;  4FTX A;  2XQZ A;  2LB9 A;  3BFE A;  1OJ5 A;  2GDN A;  4IJG A;  4BD1 A;  2VV8 A;  3V3R A;  3AGE A;  3SH7 A;  1XJ3 A;  1MBL A;  1LI0 A;  4IBX A;  1F2K A;  4R4R A;  4OPQ A;  3Q7Z A;  4L9E A;  3DW0 A;  2BTF P;  2Y4A A;  4MN7 A;  4HJ4 A;  5EOO A;  5G18 A;  3IXH A;  5FL3 A;  5DTK A;  4MN6 A;  3WWX A;  5F6A A;  2ZM8 A;  2R9W A;  5CHJ A;  3FKV A;  2ZC4 B;  5D3O A;  3HJI A;  5G4Z A;  2Z6C A;  4YNR A;  1SKF A;  1YLZ A;  5F1F A;  4HIA A;  3IWQ A;  4YOF A;  3IWO A;  3C4O A;  1IKI A;  3IF6 A;  5JYO A;  1TS6 A;  1XGI A;  4E04 A;  2NUP C;  3BEB A;  3LR0 A;  3QP1 A;  2W0N A;  1SDE A;  3GRJ A;  1T1B A;  3RXW A;  4OPY A;  4Q8I A;  4P6B A;  1BUL A;  3Q07 A;  3VFH A;  3PXP A;  4WUJ A;  2J3T C;  2V1Z A;  4D60 A;  3ICY A;  4OOL A;  2INW A;  1MKI A;  1D1J A;  4I3J A;  2Y2G A;  2PU4 A;  5HDS A;  3HLD A;  4N92 A;  4ETX A;  3JYI A;  4EW7 A;  4BWI A;  2KOI A;  3T4K A;  1NZU A;  2J3W A;  4GHI B;  5GLD A;  2XEP A;  4QD4 A;  1XA7 A;  4E3N A;  4OLG A;  1Y54 A;  1FOF A;  1IOU A;  1IKG A;  2ZD8 A;  3PBN A;  4GHI A;  3G35 A;  5BOH A;  5FQM A;  4LV3 A;  1LL5 A;  4B4X A;  4CLC E;  4GB7 A;  4N9K A;  2ZQC A;  1JTG A;  3K3D A;  1FSY A;  4LV1 A;  1BLS A;  1NWZ A;  1ALQ A;  4O8G A;  3EEH A;  2ZM0 A;  1T1A A;  4NG2 A;  1DJC A;  4QY5 A;  3E0Y A;  3MQ0 A;  2WGW B;  4KG6 A;  3JVV A;  4O01 A;  1OTB A;  3LR4 A;  3ITA A;  4OOM A;  5HD5 A;  1K57 C;  1OTA A;  1IEL A;  1BYW A;  1ES4 A;  4NET A;  5A8B A;  2Q9N A;  3L9K A;  1JTD A;  2GZA A;  4OP8 A;  1OME A;  3QP4 A;  3NUL A;  1L0G A;  1G28 A;  1XJ6 A;  3T4O A;  5CEB A;  3IF5 A;  3VSK A;  3NCK A;  3TJZ C;  4EEP A;  3WS4 A;  5DJT A;  4MNR A;  5HAQ A;  3W8K A;  3EGX C;  3MBZ A;  4PPR A;  5FQI A;  3E98 A;  1Z09 A;  3A3J A;  1FQG A;  4II7 A;  2WYX A;  2JC7 A;  2IWC A;  4BEN A;  3H7W A;  5TJJ A;  5DJU A;  4LGW A;  3MZD A;  2GJ3 A;  1FSW A;  3W4O A;  5HPI A;  4MDZ A;  4HNB A;  5GLB A;  4X1L A;  2PYP A;  4MBF A;  5HL1 A;  2XGN A;  3RFB A;  4DN0 A;  4OLD A;  5FAQ A;  3LI8 A;  3F1O A;  1S1Y A;  2WZX A;  1KGG A;  3C4P A;  2RL3 A;  4OH0 A;  4B88 A;  1KVM A;  2HP9 A;  5E2G A;  1H3Q A;  2O0Y A;  5GHX A;  3A0S A;  4ZDX A;  2WGV A;  2CC1 A;  5GHZ A;  3CUE C;  1ES2 A;  4WMC D;  1BLP A;  2XD5 A;  1UWN X;  3HRE A;  5J3W A;  4S2I A;  4JF4 A;  4MBH A;  3DAV A;  2Y8H A;  3PYP A;  2HF6 A;  2YKF A;  3T1R A;  4ZJ3 A;  4GJ4 A;  3GDI A;  3S7Q A;  1ES3 A;  5KIZ A;  5FQK A;  4NXF A;  4B4Z A;  5EM1 A;  3FWL A;  3VP2 A;  4ZAM A;  2XD1 A;  4I3I A;  5DFX A;  3CLO A;  5FI2 A;  2B18 A;  2OLV A;  2H5S A;  5AQ9 A;  4BD0 A;  2ZQ7 A;  1GHM A;  3B47 A;  1W8Q A;  3IX3 A;  3AGD A;  1MZU A;  3Q81 A;  4QY6 A;  3KSH A;  4F3L B;  2E8I A;  3HCY A;  5F69 A;  4JF6 A;  3FG8 A;  4HP4 A;  1NJ4 A;  1SKO A;  2W3H A;  4ID4 A;  4S2L A;  2E8J A;  4S2N A;  1XFN A;  4CPK A;  2G2U A;  1S67 L;  2X01 A;  4XT2 B;  3C8C A;  1NRJ A;  1XKZ A;  3IXB A;  2W1T B;  3OOV A;  4BLM A;  2J9O A;  3HUN A;  4IHQ A;  3LCE A;  5LBR A;  2ZC3 B;  2M7U A;  1O7E A;  3PTE A;  1FCM A;  1WA9 A;  5I5L A;  3T1X A;  5FAO A;  1LLB A;  3A3D A;  3R7W B;  2VKS A;  1V9Z A;  4R3A A;  4BL2 A;  5TGF A;  3GSG A;  3UDI A;  4EWF A;  5AVE A;  2JE5 A;  1KVL A;  3LY3 A;  1Y28 A;  5EUA A;  1TF1 A;  4KZA A;  4GN2 A;  4O0P A;  2A24 B;  1E3U A;  3LGO A;  4OON A;  2JBF A;  2JKT I;  5I94 A;  4ARZ A;  3NDE A;  1VEU A;  1AWI A;  3SS4 A;  1X0O A;  2W3E A;  2XSS A;  2IWB A;  4N9L A;  2VV6 A;  3MXQ A;  2I9V A;  4G3W A;  4K08 A;  5TR7 A;  4Y0U A;  4BBV A;  3C5A A;  3R7W A;  5FI6 A;  3QHY A;  4EEU A;  1A0K A;  1KOU A;  3IX4 A;  1GSV A;  3OBF A;  2LB5 A;  1G6A A;  1TS0 A;  4LRX C;  3IX8 A;  2ZMF A;  3IF6 C;  5L07 A;  1N9N A;  4Y13 A;  4R1G A;  3BYD A;  3D72 A;  3NHQ A;  3B42 A;  1YLT A;  3LR3 A;  1F5M A;  3CZD A;  1IYO A;  4Y17 A;  1BT5 A;  4U0T A;  4KUK A;  3PAE A;  4RX3 A;  3WRZ A;  3Q1F A;  4B93 A;  4EUZ A;  1GCE A;  3HLE A;  3AGF A;  4CJN A;  4DXC A;  2EFX A;  4OKP A;  5DFY A;  2PRF A;  3V39 A;  5KMW A;  1NY0 A;  3G30 A;  1J9M A;  2V2F F;  4PHT A;  1SZV A;  1PW8 A;  4X56 A;  2FH5 A;  1LL9 A;  3OCL A;  3SS5 A;  5CRF A;  3RTY A;  3ZG0 A;  4P87 A;  2XH9 A;  3MFD A;  4L9G A;  3C38 A;  5E2F A;  2MJ6 A;  4PKY G;  4WZ5 C;  1MC0 A;  4MEZ A;  4H6J B;  4EUV A;  1HVB A;  4EBL A;  2JCH A;  2QWS A;  1RCJ A;  2HJE A;  4LFU A;  1CEG A;  1IYS A;  1PWD A;  2WAF A;  3DTI A;  3C7V A;  5AQA A;  1HZO A;  4KG5 A;  1MY8 A;  5L10 A;  3WRT A;  1D7E A;  2HDS A;  5FQQ A;  3W2Z A;  4R6L A;  4K0W A;  2BG1 A;  4E6W A;  5AVF A;  2P9V A;  2K31 A;  3HLF A;  4WN5 A;  2M7V A;  3JPU A;  5HAP A;  3LUQ A;  2PBD P;  3D3O A;  1JWV A;  1JWP A;  5IU1 A;  5DTS A;  4ETZ A;  5FEF A;  2XLN A;  4K91 A;  5MC7 A;  3A3E A;  3R4K A;  1YT4 A;  3FC7 A;  3F1P A;  1I2W A;  3LEQ A;  1I2S A;  5CGX A;  3G32 A;  3LIF A;  1KGF A;  2ZC6 B;  3M6H A;  3QP6 A;  3VOY A;  2FZ0 A;  3OCN A;  4WM9 A;  4EQI A;  4R38 A;  2V1B A;  2HJ9 C;  3QP5 A;  2OWH A;  2AVX A;  2V1A A;  3T4S A;  3LID A;  3NOT C;  5EPH A;  5HDD A;  5HFO A;  3IH8 A;  5F83 A;  1TS8 A;  3MFX A;  5EOE A;  3HLB A;  4MBK A;  1BLH A;  1ZG6 A;  1YMS A;  3OPP A;  1ERM A;  4M4X A;  3NI9 A;  5HDC A;  1ES5 A;  1SKO B;  3NBL A;  4H8R A;  5EM0 A;  3BY9 A;  1P97 A;  1M40 A;  3LI9 A;  3CUE A;  1HLU P;  3MMH A;  3IXD A;  2V0W A;  4S2O A;  4Z1W A;  1PFL A;  3CIT A;  4F3L A;  2ZBB A;  2OWJ A;  3PBT A;  3IHA A;  4KZ9 A;  3ZG7 B;  2DMW A;  5HL6 A;  3UMD A;  2D02 A;  4S2K A;  4DJ3 A;  3IH9 A;  2IA2 A;  4ESP A;  5F82 A;  1CK3 A;  4JGP A;  4Z9Q A;  1W7F A;  1K0K A;  2PBY A;  2WK0 A;  3N6I A;  3E4P A;  2JKT M;  1VEU B;  3IBR A;  3IS2 A;  2QYB A;  3DTE A;  4GNU A;  3ZG8 B;  1S66 L;  3BWL A;  4GW9 A;  5EVI A;  5EVL A;  4OPZ A;  5HSQ A;  4UHU A;  4GS9 A;  2QHK A;  1OTD A;  2X71 A;  4LV2 A;  3UPN A;  1KDW A;  2EA9 A;  1ERO A;  2J7V A;  1VQQ A;  4MLL A;  3Q7V A;  5J7E A;  4RX2 A;  5EEC A;  4KQD A;  2WAE A;  3ZNT A;  5DVA A;  1EW0 A;  1L3L A;  3SZT A;  2QJ7 A;  2OSU A;  5GHY A;  4QHC A;  1BZA A;  4PAU A;  5CGS A;  2PHY A;  3EGD C;  3GMW A;  2GX5 A;  4KQR A;  4IUK A;  4RQ9 A;  2W3G A;  4Y3I A;  3GR2 A;  1YLJ A;  3IF6 B;  2VA0 A;  3N4I A;  4QPR A;  2PD8 A;  3S1Y A;  3MXS A;  5A90 A;  1F98 A;  3SW1 A;  3S7P A;  3ZVT A;  1ONH A;  1KGE A;  4FCF A;  1K6S A;  3VV4 A;  4WMC A;  1OT6 A;  1DY6 A;  1JWZ A;  2VGL S;  3D4F A;  2IWD A;  1DP8 A;  2XK1 A;  4WZ4 A;  3C2W A;  2Q9M A;  3PHY A;  4ZJ2 A;  1LI9 A;  1KDS A;  3PAG A;  1PWG A;  3QP2 A;  3FPV A;  3T4T A;  1ZTU A;  2YKH A;  2PR6 A;  2Y2K A;  4MN5 A;  4I5S A;  2WKR A;  5FA7 A;  5DF9 A;  1XFQ A;  1K4F A;  5TFQ A;  1FCN A;  4S2P A;  4UQI S;  1V9Y A;  4Q0I A;  3PBQ A;  1GA0 A;  1YSQ A;  3BEC A;  3LEZ A;  5EFW A;  5M1A A;  2WUQ A;  2WKP A;  1NRF A;  2A49 A;  3KSG A;  1H0M A;  1KE0 A;  2Y2N A;  3M2J A;  1GSW A;  5HX9 A;  4JGR A;  3G2Z A;  4R70 A;  3UNW A;  5M19 A;  2ZMV A;  5HWW A;  2Z6D A;  5L8M A;  4HH3 A;  1F9I A;  5CHM A;  3W4Q A;  1T19 A;  4X25 A;  3ZGA B;  1RGZ A;  4PMA A;  3TOI A;  4BQM A;  4JXW A;  2Y2L A;  3G4P A;  4WBG A;  3E4Q A;  1K6R A;  3BW6 A;  1P9W A;  1J3W A;  3UE0 A;  2C5W B;  4FH4 A;  4QWO A;  2QJ5 A;  4DE0 A;  4HY8 A;  1ZHH B;  5DKK A;  1MPL A;  3VP4 A;  3ZHH A;  4S2N C;  1ZKJ A;  1WYB A;  3OPL A;  4C3Q A;  3UPO A;  5JYP A;  1I5Q A;  3BM6 A;  2QZ6 A;  3FPW A;  1TDG A;  4FD8 A;  2J3T D;  3NDG A;  2ZL1 A;  5FSR A;  2VLG A;  1S4R A;  4HP9 A;  5IS1 A;  4QJG A;  4GOG A;  4WEK A;  3S7N A;  2G2W A;  3N8S A;  4PM9 A;  3KSF A;  4U3T A;  3VOZ A;  4JPM A;  4RA7 A;  4ZTK A;  1LSV A;  1OJG A;  4OOY A;  5FAS A;  4LCM A;  4KZ8 A;  2ZJ9 A;  3DWK A;  5IHV A;  4IUH A;  4DMZ A;  2O99 A;  5GLC A;  2ZMA A;  2OOL A;  1L2S A;  4YFM A;  1YLW A;  3VP0 A;  2QMI A;  5EV0 A;  4EU0 A;  4UA7 A;  2Z2L B;  5HAI A;  2P7J A;  5CTN A;  1MWS A;  3VFF A;  1HTZ A;  1TS7 A;  1ESI A;  3G31 A;  4BL3 A;  4LPZ A;  4NXE A;  3MXR A;  4WLA A;  4E3O A;  4ARZ B;  1UWP X;  2V8F A;  3UB9 A;  3N8L A;  3PBR A;  3ZVW A;  3CJM A;  5HD3 A;  4GDN A;  2Y2J A;  4UQI M;  3IS2 B;  3M6B A;  4MCW A;  2ZC7 A;  5FDH A;  3BFG A;  3OPR A;  4JXS A;  5E2E A;  1VB6 A;  4CQH A;  2ZQ9 A;  4GD8 A;  4L0L A;  4DE3 A;  3A0R A;  3KSI A;  4ME4 A;  4LEN A;  4P6Z M;  2W3D A;  3O87 A;  5CEC A;  4HEF A;  1PW1 A;  2OLU A;  4OQI A;  4E3J A;  3HVF A;  5EE8 A;  4D2O A;  2Q0O A;  4OQH A;  4LCL A;  4PM5 A;  3BRM A;  4OVD A;  4JKT A;  5AQ7 A;  1NYY A;  3HUM A;  2OV5 A;  1PNE A;  1DRM A;  4HH2 A;  3SOI A;  3MKE A;  1YPR A;  5FEG A;  1K25 A;  5CGW A;  4EV4 A;  3BFF A;  1NLY A;  4XUZ A;  2JHE A;  3NIA A;  4I39 A;  3K2N A;  1E3U D;  3ITB A;  4HI4 A;  3T4Q A;  3C30 A;  4DDS A;  3UN7 A;  4HOI A;  1MKM A;  1YLP A;  3UE6 A;  3T4L A;  3FKW A;  4GLQ A;  3MR0 A;  4UEY A;  4CLC A;  5FAT A;  3DTK A;  4EBP A;  3MKF A;  3MS6 A;  1K54 C;  3UB8 A;  5J8X A;  2HP6 A;  4E3K A;  3MF0 A;  3WS5 A;  1OTI A;  3UY6 A;  4E3I A;  4UA6 A;  3P09 A;  4XXR A;  3OPH A;  2Z2M B;  4KEN B;  4PM8 A;  3VP1 A;  1N9B A;  5KSH A;  5L2F A;  4Q0J A;  1D06 A;  1L0E A;  5A93 A;  4HJ3 A;  2Y2M A;  3ZFZ A;  2OAP 1;  3CAX A;  3NC8 A;  5E2H A;  2A2L A;  4FUW A;  3E2L A;  4GKU A;  1IEM A;  4U0X A;  3RJU A;  3UB7 A;  3IT9 A;  1NYM A;  1W63 M;  2HDU A;  1VET A;  1BTL A;  4IBR A;  2O9A A;  1ZC2 A;  4BBT A;  1UGU A;  1XGJ A;  1K55 A;  4JF5 A;  3UPP A;  2EFU A;  2OAQ 1;  1CJF A;  1BSG A;  1PWC A;  2J8Y A;  2VV7 A;  3CG5 A;  3F1N B;  1WYC A;  4F94 A;  4X6T A;  3P7N A;  2O9C A;  5HAR A;  2C6W B;  3H7W B;  3NOP C;  2KLI A;  1P0Z A;  1YLY A;  3HLC A;  3UE3 A;  1Q2P A;  5FQJ A;  1FR1 A;  1K56 A;  3IWI A;  1IYP A; 
#chains in the Genus database with same CATH homology
 1VHM A;  4KQD A;  4Y5F A;  1EW0 A;  3PBS A;  1H3Q A;  2O0Y A;  2JKR M;  3A0S A;  2QJ7 A;  1OTE A;  4EQ1 A;  3ZQ5 A;  3CUE C;  3TW8 A;  4PAU A;  1UWN X;  2PHY A;  3EGD C;  1YAX A;  1JNU A;  2GX5 A;  4MMN A;  5J3W A;  4IUK A;  4RQ9 A;  2W3G A;  4JGO A;  4Y3I A;  3KO6 A;  2VA0 A;  1T1C A;  2L1M A;  4QPR A;  2Y8H A;  2PD8 A;  3PYP A;  2HF6 A;  2YKF A;  4FOF A;  2EWV A;  2PD7 A;  4CLC D;  4GJ4 A;  3GDI A;  3S7Q A;  2XRO A;  1F98 A;  3CWF A;  4KQO A;  3SW1 A;  3S7P A;  4G3V A;  5KIZ A;  3OC2 A;  4NXF A;  3VV4 A;  3UB6 A;  2J80 A;  5AJG A;  4WL9 A;  5CX7 A;  1OT6 A;  3TE8 A;  2VGL S;  2P04 A;  4I3I A;  5HPF A;  5DFX A;  3CLO A;  2B18 A;  3T4J A;  1DP8 A;  3C2W A;  3B47 A;  1MZU A;  3PHY A;  4F3L B;  3KSH A;  3F1N A;  3F1P B;  3HCY A;  1H8M A;  1W63 Q;  5F69 A;  3FPV A;  3T4T A;  3FG8 A;  1ZTU A;  2W27 A;  3ULF A;  4HP4 A;  4EER A;  2YKH A;  4ZRR A;  2PR6 A;  3KYQ A;  3LIE A;  2W3H A;  4MN5 A;  4I5S A;  2G7U A;  2PR5 A;  2K7S A;  3EQV A;  1LL8 A;  2WKR A;  3VE4 A;  5DF9 A;  1XFQ A;  1XFN A;  2W3F A;  3RH8 B;  1S67 L;  4BJP A;  2O9B A;  2PT7 A;  4DJ2 A;  5TBM A;  4XT2 B;  3C8C A;  1NRJ A;  3KX0 X;  4UQI S;  4AFI A;  1NLZ A;  1V9Y A;  4Q0I A;  3PBQ A;  1YSQ A;  5EFW A;  4B9O A;  2W1T B;  1S1Z A;  2WKP A;  2VZW A;  3OOV A;  3KSG A;  2B02 A;  4IHQ A;  1GSW A;  4FSF A;  5LBR A;  4JGR A;  5HWT A;  3E4O A;  2M7U A;  1DP6 A;  4KUO A;  4XT2 A;  2L4R A;  4HHD A;  3BQA A;  4R70 A;  3EQU A;  2ZMV A;  1WA9 A;  5HWW A;  5I5L A;  3EWK A;  2XA7 M;  2Z6D A;  5L8M A;  2JKR I;  5HWV A;  4H6J A;  4HH3 A;  1N9O A;  1LT0 A;  3LIC A;  1F9I A;  3R7W B;  2VKS A;  3EEA A;  1V9Z A;  4R3A A;  4NXB A;  1T19 A;  1ODV A;  2VJW A;  1YSP A;  5AVE A;  3TRC A;  4YWZ A;  4Y2F A;  1Y28 A;  3E4Q A;  4WEL A;  3BW6 A;  3VE3 A;  1P9W A;  1TD5 A;  3MQO A;  1TF1 A;  3LIA A;  4O0P A;  2A24 B;  3NOU C;  4HQA A;  2KX6 A;  2Y79 A;  4BMW A;  4L9F A;  2JKT I;  4NKP A;  4ARZ A;  3G6O A;  3LYX A;  2QJ5 A;  4HY8 A;  4EES A;  1X0O A;  1ZHH B;  3LR5 A;  4EXO A;  2W3E A;  5DKK A;  2XSS A;  4PKY A;  2VV6 A;  3MXQ A;  2I9V A;  5F5Y A;  3VOL A;  4G3W A;  4K08 A;  2V0U A;  2VGL M;  5TBM B;  4BBV A;  2QKP A;  3FPW A;  1XJ2 A;  3PR6 A;  3R7W A;  3IBJ A;  2J3T D;  5C5K A;  4GCZ A;  4WF0 A;  4EEU A;  1KOU A;  4I3A A;  3H9W A;  1S4S A;  4G3K A;  1GSV A;  3OBF A;  2VLG A;  2LB5 A;  4BBU A;  1S4R A;  1TS0 A;  4HP9 A;  5IS1 A;  4LRX C;  2ZMF A;  2A24 A;  3NJA A;  4WEK A;  3S7N A;  3JVU A;  1N9N A;  3D72 A;  3NHQ A;  3B42 A;  3LR3 A;  3KSF A;  5F68 A;  1F5M A;  4LLO B;  1LSV A;  1OJG A;  4KUK A;  1STZ A;  3F1O B;  4IUH A;  3S7O A;  3U2A A;  4DMZ A;  2O99 A;  4B93 A;  4NEE D;  2OOL A;  3UME A;  3O5Y A;  1N9L A;  2LB9 A;  5DFY A;  1OJ5 A;  3EOI A;  2JN7 A;  4IJG A;  4GS9 B;  4EU0 A;  1DP9 A;  2VV8 A;  1XJ3 A;  2P7J A;  4PHT A;  1TS7 A;  4L9E A;  4LPZ A;  3GEC A;  2K2N A;  4NXE A;  4MN7 A;  4HJ4 A;  4WLA A;  4ARZ B;  1UWP X;  4WEJ A;  2FH5 A;  5FL3 A;  3UB9 A;  2NUT C;  4MN6 A;  3OCL A;  2CMN A;  3PBR A;  5F6A A;  3LIB A;  5G4Y A;  3RTY A;  5HD3 A;  4UQI M;  4L9G A;  3IS2 B;  3C38 A;  2MJ6 A;  4PKY G;  1GSX A;  4MCW A;  1MC0 A;  4H6J B;  4EUV A;  3HJI A;  5G4Z A;  2Z6C A;  1LSW A;  4LRZ E;  1YKD A;  1VB6 A;  2QWS A;  4YNR A;  4CQH A;  2HJE A;  4L0L A;  4HIA A;  3A0R A;  3KSI A;  4ME4 A;  4YOF A;  4P6Z M;  1TS6 A;  4E04 A;  2W3D A;  3P01 A;  4Q0H A;  3LR0 A;  2NUP C;  1D7E A;  2GNX A;  2W0N A;  2W1T A;  1T1B A;  3W2Z A;  4R6L A;  1OPX A;  3MJQ A;  5AVF A;  2K31 A;  3PXP A;  4WUJ A;  4WN5 A;  2J3T C;  2M7V A;  3ICY A;  4OOL A;  2INW A;  4I3J A;  3LUQ A;  1DRM A;  4HH2 A;  5HDS A;  3D3O A;  4ETX A;  3MQQ A;  2M1C A;  5IU1 A;  4ETZ A;  4EW7 A;  4BWI A;  2KOI A;  3B33 A;  3T4K A;  5MC7 A;  4LRY C;  2J3W A;  4GHI B;  3V67 A;  1NLY A;  4EET B;  3R4K A;  2JHE A;  3ZYT A;  3FC7 A;  4I39 A;  3F1P A;  2XRN A;  3K2N A;  4HI4 A;  3T4Q A;  3PBO A;  3C30 A;  1IOU A;  3LIF A;  2XA7 S;  1IFQ A;  3PBN A;  4GHI A;  4JGQ A;  1LSX A;  2V9A A;  4CLC E;  4HOI A;  1MKM A;  1P9R A;  4P6Z S;  3UE6 A;  5IT5 A;  3T4L A;  2FZ0 A;  4GLQ A;  3MR0 A;  5HZH A;  3OCN A;  3DBA A;  4HJ6 A;  4UEY A;  3K3D A;  4CLC A;  3T50 A;  4R38 A;  1NWZ A;  3UB8 A;  2HV1 A;  2PYR A;  2V1B A;  2HJ9 C;  3EEH A;  4O8G A;  1T1A A;  3MF0 A;  2OWH A;  1OTI A;  2V1A A;  3LFV A;  3T4S A;  3LID A;  3NOT C;  5HDD A;  2WKQ A;  5DKL A;  1TS8 A;  3E0Y A;  3MFX A;  3CI6 A;  3BJN A;  3MQ0 A;  2VEA A;  4O01 A;  3JVV A;  1OTB A;  2VX8 A;  4M4X A;  5HDC A;  4I38 A;  5KSH A;  4Q0J A;  3LR4 A;  3K3C A;  3BY9 A;  1P97 A;  4OOM A;  1D06 A;  5HD5 A;  2HGV A;  3LI9 A;  4HJ3 A;  2PDR A;  3CUE A;  1T18 A;  2OAP 1;  3MMH A;  1OTA A;  2V0W A;  3CAX A;  4Z1W A;  3CIT A;  1BYW A;  2R78 A;  4F3L A;  2ZBB A;  2OWJ A;  2KDK A;  3PBT A;  5A8B A;  5K5B A;  3OLO A;  2GZA A;  2A2L A;  2BAS A;  1OT9 A;  2DMW A;  5HL6 A;  3UMD A;  1XJ4 A;  2D02 A;  4DJ3 A;  1G28 A;  1XJ6 A;  3A0V A;  3UB7 A;  2IA2 A;  3T4O A;  1W63 M;  2ZOH A;  4JGP A;  2H28 A;  4CLC B;  3TJZ C;  4EEP A;  5DJT A;  2O9A A;  3E4P A;  3EGX C;  2JKT M;  3IBR A;  4BBT A;  3E98 A;  3IS2 A;  2QYB A;  1S66 L;  4II7 A;  1UGU A;  3BWL A;  3H82 A;  4GW9 A;  5J4E A;  3H7W A;  5HSQ A;  5TJJ A;  2OAQ 1;  5DJU A;  1G6O A;  3HJK A;  2GJ3 A;  5HPI A;  4MDZ A;  4HNB A;  2VV7 A;  2P08 A;  4GS9 A;  3F1N B;  2QHK A;  1OTD A;  2PYP A;  3P7N A;  2O9C A;  4CLC C;  3RFB A;  4DN0 A;  2EA9 A;  3H7W B;  3BY8 A;  3NOP C;  3LI8 A;  3H82 B;  2KLI A;  1P0Z A;  3F1O A;  2L0W A;  1S1Y A;  3UE3 A;  2D01 A;  2EWW A;  2W1R A;  3KYZ A;  5J7E A;  2ZOI A;  4NXG A;  3BQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...