4XXRA

Atomic resolution x-ray crystal structure of a ruthenocene conjugated beta-lactam antibiotic in complex with ctx-m-14 e166a beta-lactamase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
b'TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTAPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTX-M-14 Class A Beta-Lactamase
molecule tags Hydrolase/antibiotic
source organism Escherichia coli
publication title Antibacterial properties and atomic resolution X-ray complex crystal structure of a ruthenocene conjugated beta-lactam antibiotic.
pubmed doi rcsb
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4xxrA00
3BFEA 1CEFA 2EFUA 1K54A 2WYXA 3ZG7B 1BLPA 3JYIA 4JPMA 3UNWA 3FV7A 3IXBA 1PZPA 4DE3A 4PM5A 3Q7ZA 3IQAA 4RA7A 4C75A 4WELA 4P85A 3LO7A 1ZG6A 3OPPA 5AQAA 2XR0A 1NZUA 3OZHA 4MNRA 1PWGA 4KENB 5M19A 1NZOA 3A3EA 4MBKA 4YINA 4E3JA 4ZTKA 1EROA 4A5RA 4X69A 2WUQA 4EWFA 4DDYA 3Q07A 5EOOA 3HUNA 4N1XA 5CHUA 1ES2A 2XEPA 3NY4A 4KG5A 4UA7A 1I2WA 3UO9A 3M6HA 1MY8A 2A49A 4X6TA 4KZ5A 2XF3A 3PBTA 1KVMA 3VSKA 4U0TA 2WGWB 1MKIA 2HDQA 3ZVWA 2EXAA 4JF5A 3FKVA 3UPPA 3BFFA 5DF8A 4OONA 3VOZA 1SHVA 3DWZA 4OH0A 5A93A 2EX8A 1BSGA 3WRTA 1H8YA 2P9VA 4HEFA 3GRJA 5FQQA 3SS4A 5KSHA 3Q82A 5DF7A 4E3OA 4S2PA 4ZAMA 3NBLA 3QNCA 4JF6A 4PM8A 3C5AA 4DXBA 1L0DA 5GHZA 3BM6A 4S2NC 1W5DA 2XLNA 3V50A 4ZDXA 2ZM8A 5GLDA 1ESUA 2WADA 2J9PA 2Z2LB 3PBQA 3PAGA 5GHYA 3VP2A 4OQHA 1NYMA 5KSCA 3BRMA 1E3UD 3ZFZA 4FH2A 1LHYA 1K4EA 1L2SA 2R9XA 1FQGA 2ZQ9A 2EFXA 1I5QA 1BTLA 1YT4A 5EECA 2ZC7A 3HREA 2Y2IA 2UWXA 4R1GA 3VSLA 4D2OA 2PU4A 3UPNA 2XK1A 5D3OA 1K56A 3IXHA 5A92A 1TDGA 4GKUA 2WKHA 5CGXA 5M18A 2Y2PA 3ZVTA 5JYPA 1YM1A 1HZOA 3E2LA 5KZHA 3G35A 3IHBA 3I7JA 3VFFA 1L0EA 4X68A 3O87A 4B4ZA 3HL9A 1NJ4A 2DRWA 4KZ7A 4IVIA 4LENA 3VP3A 4EUZA 3BLMA 1IEMA 3RXXA 3ZNTA 3VMAA 1XXMA 3BECA 4OOLA 1GA0A 4KZ8A 3IF6C 3IHAA 3AGFA 3UE0A 4N9KA 4X53A 5G18A 5EVID 4S2JA 4B88A 3PBRA 2OSUA 1QMFA 1N4OA 4QHCA 2I72A 1ZKJA 3IWIA 4OPRA 4R4RA 1NY0A 5M1AA 1SCWA 2Q9MA 2Y91A 4NETA 4LCLA 3ZCZA 3A3IA 2G2WA 4C6YA 3NI9A 4UA9A 5GL9A 1ES3A 3UDXA 3A3JA 3SS5A 2JE5A 4FH4A 4OQ0A 3O3VA 3MXRA 2RCXA 1G68A 5FATA 1J9MA 1PWCA 5DVAA 2P74A 1GHIA 3G32A 3HBRA 3WS5A 3PBSA 3W8KA 1MWRA 5GLBA 3IF5A 2WZZA 3W4PA 3EQVA 3QHYA 4OP5A 5F1GA 1JWZA 4K91A 1GCEA 3ZG8B 4RYEA 2ZC4B 3P98A 4BL2A 1ONHA 4DE0A 2ZC6B 3LY4A 1Z6FA 3OC2A 5AQ9A 2FFYA 4OPYA 5FQJA 4DRTA 1ZG4A 3HLDA 4JXVA 2VGJA 4DKIA 5DTKA 4OPZA 3MZEA 4OQIA 3HUMA 3P09A 4R0QA 5EPHA 3GTCA 1E3UA 2XD5A 4BD0A 3AGEA 3G4PA 1MWTA 3Q7VB 2Y2NA 5HX9A 3UDIA 4U3TA 1L0GA 4N92A 2V20A 4PMAA 2ZQCA 4IEDA 3HLWA 4FCFA 5E2EA 3NDGA 1FOFA 3M2KA 3NC8A 5EVIC 1XP4A 4Y7PA 2Y55A 5EE8A 1K56D 4KG2A 1BT5A 1E25A 4OKPA 3WS1A 1PI4A 2ZD8A 1BUEA 1HVBA 2JCHA 4PPRA 1PWDA 4EV4A 2BLSA 1VQQA 2QZ6A 3MKFA 4GD6A 4DE2A 3PBOA 1LL5A 4Y0TA 1MBLA 2IWCA 3CJMA 1H5XA 5HARA 1CI8A 1PI5A 1IYOA 5FQ9A 3TSGA 3IWQA 3O88A 1YLTA 4JLFA 2ZC3B 5CRFA 1O7EA 3RXWA 4GNUA 1W79A 3LCEA 4IBRA 1K6SA 1AXBA 1KGFA 1LLBA 1GHMA 3RJUA 5EVLA 1YLYA 3IF6A 4OLGA 4GN2A 4FSFA 4R3JA 5CXWA 3S4XA 2DNSA 3G31A 4MBHA 5IHVA 3B3XA 3IT9A 5E43A 4BJPA 2P9VB 3QNBA 1OMEA 3WS4A 4OVDA 3ZNYA 1KDWA 3ITBA 1SKFA 4YFMA 1GA9A 1TDLA 3UN7A 1K38A 2ZC5B 1N9BA 2EXBA 1IYSA 1S6RA 1W8YA 5FI6A 5F1FA 1ERMA 3GMWA 3ZG9B 3ZDJA 3EQUA 5CGSA 1L0FA 5EVIB 1XGIA 2ZMAA 4PM7A 3G2ZA 1FCOA 1HTZA 1PW8A 3BFCA 3Q1FA 5FQMA 3SH9A 2EX2A 1LL9A 4KQQA 5GLAA 4E6WA 5FDHA 3C7UA 2WAEA 3VFHA 2IWDA 5HAQA 1BLCA 4QU3A 1XX2A 1WYBA 1K25A 5FASA 2HP9A 3N8LA 3FWLA 3G34A 2XD1A 5CTMA 1FCMA 4OOYA 5FI2A 2Y2MA 1DY6A 2DCFA 2PBYA 3M6BA 4GOGA 5FAQA 4DXCA 2H0YA 1SDEA 2B5RA 5JYOA 5TFQA 3ZHHA 4E3MA 4OOMA 4FD8A 3N8SA 3NCKA 3C7VA 4X55A 4GD8A 1FR1A 3HLGA 3OCNA 4S2NA 5EVIA 4N9LA 1CEGA 5U47A 4Q8IA 3LY3A 2Y2JA 1TVFA 3N6IA 1MPLA 1VM1A 1U60A 4BENA 5I94A 4NK3A 3FYZA 3GSGA 1JTGA 2XGNA 4S2LA 5AQBA 5HL1A 2OLVA 3HLBA 5FQIA 1RCJA 3MFDA 5CGWA 5BOHA 1KGEA 2BG1A 3M2JA 4LCMA 4WZ4A 4RX2A 3MZFA 4WYYA 2V1ZA 4K0WA 4WEJA 3ISGA 1ONGA 1KE0A 5DTTA 4CJNA 1FR6A 3C4PA 3Q7VA 3GQZA 4KZ9A 2ZJ9A 1KE3A 3IF6B 1BZAA 3MZDA 4P0MA 5EUAA 5E2FA 4BD1A 4JF4A 1RGYA 2ZQAA 4LV2A 2HDUA 2H10A 3IH8A 4E3NA 4QD4A 3V3SA 5A91A 4E3LA 3IXGA 1E4DA 3IWOA 1G6AA 4KZBA 3BYDA 1WYCA 3DWKA 1Q2PA 2XDMA 3SS3A 4JXGA 2Q9NA 1FCNA 2ZM2A 4EQIA 5FA7A 3GV9A 2PU2A 2WGIA 4OQGA 4QB8A 3SH8A 1KVLA 3VP0A 1IKGA 2JC7A 1JVJA 2HPBA 2ZM0A 3MXSA 5CEDA 1RGZA 3N8RA 4KQOA 1XKZA 1TEMA 5CERA 1K54C 2IWBA 1M6KA 2G2UA 3S22A 1XPBA 2GDNA 2V2FF 4Y0OA 4R4SA 1PIOA 1YMXA 1EI5A 3E2KA 2Z2MB 5FSRA 5FAPA 3HLCA 3UDFA 2CC1A 1DJAA 3CMZA 4OPQA 1C3BA 4DF6A 3N4IA 5HAPA 2E8IA 3GVBA 3TOIA 1JWPA 1IYQA 4BQMA 1YMSA 5F82A 1DJCA 4EBLA 1W7FA 2WKEA 4BL3A 1KDSA 4IBXA 4ZJ3A 1MWUA 4GDBA 1PZOA 2WGVA 1ALQA 1KE4A 4P87A 2HDSA 4WM9A 3FZCA 2H5SA 3OPRA 3ZGAB 3BEBA 4E3KA 1K4FA 2C5WB 1K57A 4KQRA 2WAFA 4X56A 1PW1A 4S2MA 4O7DA 1ZC2A 4N1HA 1FSYA 2J8YA 1K55C 3SOIA 2ZLYA 3S1YA 1WE4A 3ZG0A 3HLFA 4QY6A 3W4QA 1BLHA 3WS0A 1IELA 3LEZA 3BLSA 3O86A 1XA1A 3HVFA 3AGDA 2Y59A 2RL3A 3TG9A 4LV1A 4H8RA 2Y2LA 1MXOA 3DW0A 3BFGA 4OLDA 3DTMA 3OPHA 3WS2A 1I2SA 1RP5A 5EOEA 2XH9A 4ZJ2A 4MLLA 3IXDA 4UA6A 2JBFA 3PTEA 1Y54A 4GB7A 5TR7A 1CI9A 5E2GA 2QPNA 3IH9A 3V3RA 3A3FA 4CPKA 1CK3A 3V5MA 2X02A 3ZG5A 1BULA 4K0XA 4BLMA 5CECA 3HLEA 4EBNA 4WZ5A 5FAOA 1K57C 4Y0UA 1ES4A 1NRFA 4C3QA 3MKEA 3WWXA 3UPOA 4WMCD 3BFDA 4XXRA 2XFTA 4RVAA 1NYYA 2HDRA 4OP8A 4ID4A 4KZ3A 2OLUA 4GDNA 2H0TA 3UY6A 2Y2QA 3VP1A 1MWSA 1ESIA 3FKWA 4HBUA 2EX6A 1XGJA 5A90A 4WMCA 2VGKA 4F94A 4IVKA 4ZBEA 5HAIA 3UE1A 1JTDA 1PYYA 3V39A 5TGFA 3OCLA 4P6BA 3NDEA 4RX3A 1SDNA 2QMIA 3OPLA 4MEZA 2EX9A 4HESA 5DTSA 1YLJA 4UHUA 1NXYA 5GLCA 4L0LA 3G30A 1FSWA 5AQ7A 3VP4A 4DE1A 2FFFB 5CHJA 2Y2GA 1YLZA 4KZ4A 4Z9QA 1DJBA 4XUXA 4DDSA 1BLSA 3PBNA 4M3KA 5CTNA 5E2HA 5CEBA 2HP5A 4JXWA 3ITAA 3MBZA 1O07A 2ZQDA 4XUZA 1K6RA 4B4XA 2OV5A 3N7WA 3VOYA 1W8QA 5J8XA 2WZXA 1IYPA 1Q2QA 2WKIA 1JWVA 1IKIA 1YLWA 2Y2KA 4JXSA 1XA7A 4LV3A 4PM9A 2WGWA 4KZAA 2ZQ8A 4EBPA 3A3DA 3Q81A 3C4OA 5DF9A 4KZ6A 3HUOA 2Y2OA 4E6XA 3CG5A 5FI7A 1YLPA 3CZDA 4LV0A 4ZJ1A 4U0XA 2R9WA 3SH7A 4WZ5C 2J7VA 2A3UA 4R23A 1ES5A 3GR2A 3NIAA 4JKTA 5KMWA 1S0WA 4HBTA 5HW3A 2XQZA 1LI0A 5CHMA 2WK0A 4R3BA 4S2OA 1EWZA 3UE3A 1M40A 4QY5A 4UAAA 4PM6A 1QMEA 1YQSA 2X01A 4E3IA 5HFOA 1HD8A 2Y4AA 5FQKA 2X71A 4GZBA 3G2YA 5GHXA 5L2FA 3WRZA 2XFSA 2C6WB 2J9OA 4S2IA 3W4OA 1ERQA 1H8ZA 4JBFA 4KG6A 3PAEA 1GHPA 4WEKA 1LI9A 3D4FA 4WBGA 2HP6A 1K55A 2ZQ7A 4S2KA 5F83A 4QJGA 1KGGA 4MBFA 2Y2HA
chains in the Genus database with same CATH superfamily
3ZG7B 3JYIA 1PZPA 3IQAA 4C75A 4WELA 3LO7A 2W3DA 2XR0A 3OZHA 4ZTKA 4A5RA 3UMEA 4DDYA 2ACGA 2XEPA 4DMZA 1GSWA 1YSPA 4Y13A 2XF3A 4Z1WA 1KVMA 2EXAA 5G4YA 3BFFA 1Z09A 3QP4A 3VOZA 1STZA 5A93A 1GSXA 1LSVA 1FILA 5DF7A 4E3OA 4ZAMA 3S7NA 2OWHA 4PM8A 3F1OB 1W5DA 2J9PA 3PAGA 1NYMA 3BRMA 3MQOA 3T1QB 4HH2A 4NXEA 2L0WA 4R1GA 2V9AA 3CITA 2PU4A 1K56A 5A92A 4RQ9A 1F98A 5EM0A 5K5BA 2JKTI 3DTEA 1S1ZA 5KZHA 3I7JA 3VFFA 3O87A 4KZ7A 4EUZA 2HJEA 4EXOA 3VMAA 5AJGA 3UE0A 5G18A 5EVID 1QMFA 4QHCA 2I72A 3UB7A 1SCWA 1TS8A 2VZWA 4ARZA 2KOIA 4FH4A 3O3VA 2RCXA 1G28A 1UGUA 5DVAA 4QPRA 1GHIA 4GS9A 3WS5A 3KSIA 3PBSA 3T1RA 3IF5A 4O0PA 4RYEA 3P98A 4BL2A 2ZC6B 2FFYA 4O01A 5HDCA 4JXVA 3P09A 3GTCA 1E3UA 1MWTA 1YSQA 2Y2NA 4U3TA 3HLWA 4FCFA 4PKYA 4Y7PA 2Y55A 4NXGA 1E25A 4EESA 2ZD8A 1BUEA 4CLCD 1PWDA 1VQQA 4MN6A 4GD6A 2QYBA 5HDDA 3PBOA 4LLOB 1J3WA 3CJMA 1H5XA 1ACFA 5FQ9A 3TSGA 2V1BA 4HP9A 3IWQA 3LUQA 3O88A 4ETXA 5CRFA 3E4QA 3RXWA 3LCEA 4EQ1A 2V1AA 3RFBA 3DTKA 4R3JA 3TJZC 1LL8A 2PBDP 3JPUA 3F1NA 3G6OA 5L07A 2P9VB 3FPVA 2ZL1A 1N9BA 3LEQA 1L0FA 2KDKA 5FQMA 1HTZA 1PW8A 2GJ3A 2EX2A 1LL9A 2WAEA 5KIZA 5HAQA 4YOFA 1BLCA 3ZQ5A 2W1RA 1WYBA 3G34A 2Z6DA 1FCMA 1P97A 2DCFA 5FAQA 4DXCA 5JYOA 5L09A 3ZHHA 3N8SA 3E98A 3VOLA 3C7VA 2VK3A 3HLGA 4GD8A 2PD8A 3LY3A 1TVFA 3N6IA 1MPLA 1EW0A 1W63Q 1MZUA 2XGNA 4UQIM 1K0KA 4LCMA 4WEJA 5DTTA 3T50A 1FR6A 3IX3A 3Q7VA 3GQZA 3MZDA 1KE3A 1BZAA 3BW6A 5E2FA 4JF4A 1RGYA 3U2AA 1OT9A 3IXGA 4P6ZS 4KZBA 4Y2FA 1G6OA 1WYCA 3EWKA 5FA7A 1LT0A 3T4TA 4MN5A 4DJ3A 2ZM0A 4GJ4A 4F3LB 1K54C 3S22A 5HWVA 2PR5A 2V2FF 4R4SA 4E04A 3T4QA 4R6LA 2W27A 3LI8A 2Z2MB 1YPRA 3UDFA 1H8MA 3P01A 4DN0A 4Y5FA 4HIAA 4EBLA 4UEYA 4IBXA 4GDBA 3LI9A 1ZTUA 4WM9A 5HZHA 3FZCA 3OPRA 3BEBA 4KQRA 4X56A 4O7DA 2XSSA 3CPTB 4DJ2A 2ZLYA 3HLFA 3W4QA 1BLHA 3PR6A 4GHIA 3B47A 2Y59A 3TG9A 3DTMA 3WS2A 3H82A 3PXPA 1I2SA 5EOEA 2W3GA 2MJ6A 3IXDA 2JBFA 2XRNA 4GB7A 2JHEA 3IH9A 3V3RA 2PR6A 3CUEA 2V0WA 3DBAA 5L8MA 4WZ5A 4Y0UA 5HPFA 4OP8A 4KZ3A 2OLUA 4GDNA 2GX5A 4HBUA 2QKPA 1XGJA 5A90A 4WMCA 4B9OA 3OCLA 4GW9A 4RX3A 1YLJA 1AWIA 4R3AA 3S7OA 3MS6A 3T12B 1P9RA 5F5YA 1L3LA 4Z9QA 5CEBA 4JXWA 1Y28A 4I3IA 4XUZA 5A8BA 1UWPX 4BBUA 2WKIA 4JXSA 2K7SA 3CAXA 1SZVA 3VE3A 4XT2B 3ICYA 5DJTA 4KZAA 2V0UA 4ARZB 2B95A 3RH8B 3Q81A 3C4OA 4HI4A 5DF9A 4KZ6A 2Y2OA 4E6XA 2Y8HA 3BQAA 3CG5A 5FI7A 1ES5A 5LBRA 1LI0A 1XFNA 2A24A 4H6JA 4B93A 5HFOA 4GZBA 5GHXA 2XFSA 2JKTM 4BD0A 1H8ZA 4KG6A 3DTIA 5F83A 1CEFA 2EFUA 3UNWA 1TS0A 4RA7A 4P85A 2L4RA 4KENB 1NZOA 3A3EA 1VETA 4E3JA 4EWFA 4X69A 3Q07A 2LB5A 3HUNA 4N1XA 5CHUA 4UA7A 1I2WA 3UO9A 3M6HA 1MY8A 1YKDA 2WGWB 3KYEA 3JVUA 3D72A 1ZHHB 2J3TC 3GRJA 4WF0A 3Q82A 4JF6A 1L0DA 5GHZA 3BM6A 3V50A 5GLDA 2WADA 2Z2LB 3PBQA 3VP2A 3T4SA 4OQHA 2WKQA 5IS1A 1K4EA 4EEUA 1BTLA 2ZC7A 2I9VA 1UWNX 4Y17A 2XK1A 4HJ3A 5D3OA 3GDIA 2WKHA 2W0NA 1HZOA 3UB5P 3NOUC 2A24B 2ZMVA 4B4ZA 4NEED 3VP3A 4IVIA 4R38A 3RXXA 1GA0A 4KZ8A 3IF6C 3AGFA 3T4OA 3PBRA 4EETB 1ZKJA 4OPRA 4NETA 2Q9MA 3CI6A 4LCLA 3ZCZA 5I5LA 1ES3A 1G68A 5FATA 1J9MA 5F69A 1PWCA 3U4LP 3HBRA 4F3LA 3QHYA 1JWZA 3OBFA 1GCEA 1N9LA 1Z6FA 5FQJA 4DRTA 2VGJA 4WN5A 4OQIA 3HUMA 3HJKA 3AGEA 4LPZA 5HX9A 4H6JB 4N92A 2V20A 4IEDA 3NDGA 3NC8A 3IX4A 4P6ZM 5EE8A 1K56D 2PYPA 1BT5A 1XFQA 3BWLA 3MKFA 4DE2A 3K3CA 4X1MA 1HLUP 1CI8A 1IYOA 2Y79A 4JLFA 2ZC3B 2XA7M 4G3VA 1S4RA 1PNEA 1LLBA 5DJUA 2D01A 3RJUA 3IF6A 4GN2A 5HWTA 4MBHA 3B3XA 5E43A 4BJPA 3QNBA 2QJ5A 2HJ9C 3ITBA 3UN7A 2EXBA 1W8YA 3NULA 5FI6A 4AFIA 1ERMA 5F1FA 3GMWA 3EQUA 1FCOA 1ODVA 1CJFA 2JKGA 3SH9A 4KQQA 5GLAA 3E4OA 1D1JA 5FASA 2OAQ1 3FWLA 2XD1A 5CTMA 3JVVA 4CLCB 1S4SA 2PBYA 4GOGA 3R7WB 5TFQA 4OOMA 4FD8A 5J4EA 5EVIA 3OCNA 3OOVA 1CEGA 2VX8A 2Y2JA 1XJ3A 2H28A 3FYZA 5AQBA 5HL1A 5FQIA 1RCJA 3KO6A 3MFDA 5CGWA 4XT2A 3A0SA 4WZ4A 2V1ZA 4K0WA 5TJJA 4LRYC 1PFLA 4P0MA 2O9BA 2ZQAA 4QD4A 3V3SA 1G6AA 3BYDA 4JXGA 4EQIA 4QB8A 1VB6A 3SH8A 4PHTA 1IKGA 2JC7A 2KLIA 4L9FA 2HPBA 1RGZA 4NKPA 1TEMA 2IWBA 5DKLA 1XPBA 1PIOA 1EI5A 3E2KA 1OPXA 1LSXA 4CQHA 1DJAA 2VJWA 1C3BA 4Y3IA 3MSHA 5HAPA 2E8IA 2VEAA 3LIEA 1JWPA 2YKFA 1IYQA 1DP6A 1NWZA 4BQMA 4ZJ3A 1ALQA 3PYPA 4P87A 3ZYTA 2M7UA 5HPIA 1K4FA 2C5WB 2LB9A 1K57A 2WKRA 3MF0A 3R4KA 2WAFA 3LIBA 1PW1A 2YKHA 1WE4A 4R70A 1DRMA 4QY6A 1IELA 3LEZA 2P04A 1XA1A 3AGDA 3FC7A 3KSFA 4H8RA 4ME4A 3BFGA 3OPHA 5DKKA 4MLLA 1T18A 5TR7A 4G3KA 5E2GA 3A3FA 1CK3A 2X02A 3ZG5A 1BULA 4BBTA 1GSVA 3WWXA 4WMCD 4UQIS 4RVAA 2HDRA 3UY6A 2Y2QA 1MWSA 4Q0JA 2EX6A 2VGKA 4F94A 5HAIA 3UE1A 1JTDA 1PYYA 4P6BA 3EGDC 1SDNA 4MEZA 2O9AA 4UHUA 5GLCA 4L0LA 1DP9A 4DE1A 1IOUA 4WL9A 4XUXA 4DDSA 3KX0X 5CTNA 5E2HA 4EUVA 3MBZA 4ETZA 5J8XA 1IKIA 1G5UA 4LRZE 3T1XA 3HUOA 5AVFA 4FUWA 3CZDA 4LV0A 4ZJ1A 4WZ5C 3GR2A 2BTFP 3R7WA 4CLCA 3CUEC 5KMWA 1S0WA 4HH3A 2M7VA 4HBTA 2XQZA 2WK0A 4R3BA 3TRCA 2X01A 2HGVA 1HD8A 2PD7A 2Y4AA 2E8JA 3K3DA 2X71A 2JKRI 3WRZA 2PDRA 2V8FA 2C6WB 3MQ0A 4JBFA 1LI9A 3D4FA 2ZQ7A 1KGGA 3ISGA 3BFEA 2Y2HA 3S7PA 1K54A 2WYXA 1BLPA 2ZL1B 3FV7A 3IXBA 4DE3A 3UB6A 2VV8A 3QP8A 5F68A 4NG2A 3OPPA 5AQAA 3LYXA 1NZUA 2JKRM 5M19A 3FPWA 1EROA 2WUQA 1ES2A 1MKMA 5TBMB 1DP8A 2A49A 4X6TA 3VSKA 4U0TA 2HDQA 4JF5A 3FKVA 1SHVA 3DWZA 4OH0A 2EX8A 1BSGA 1H8YA 2P9VA 4HEFA 4IUKA 2IA2A 5FQQA 3SS4A 5MC7A 5KSHA 4S2PA 3C5AA 3MR0A 2XLNA 5DFYA 2ZM8A 4JGQA 5GHYA 1T1CA 1LHYA 1FQGA 2EFXA 2ZQ9A 1YT4A 1I5QA 4KQDA 5EECA 5AVEA 2Y2IA 3VSLA 4D2OA 3HJIA 4GKUA 3D9YA 2Y2PA 3IX8A 1YM1A 2L1MA 3H9WA 3CPTA 4CLCE 3G35A 4PAUA 3IHBA 1OT6A 3RTYA 1OTEA 1NJ4A 2DRWA 2D02A 3BLMA 3IS2A 3ZNTA 1XXMA 3BECA 4EEPA 3L7HA 4OOLA 4N9KA 4X53A 2A2LA 4S2JA 4B88A 2OSUA 1N4OA 3B33A 5M1AA 2Y91A 5FEFA 3A3IA 3LR5A 3NI9A 4L9EA 5GL9A 3MFXA 3UDXA 3A3JA 1OTIA 3SS5A 4OQ0A 1TD5A 1JNUA 5HSQA 1TS6A 3CHWP 1MWRA 3C38A 2WZZA 3EQVA 4OP5A 5F1GA 1KOUA 2FH5A 4K91A 4MCWA 4LRXC 5HD3A 4DE0A 2J80A 3OC2A 1PRQA 5DTKA 3KYQA 5EPHA 3G4PA 3Q7VB 1L0GA 2DMWA 3M2KA 5EVIC 1VEUB 4KG2A 3LR3A 4OKPA 3WS1A 1S66L 1HVBA 4PPRA 2BLSA 1IFQA 2ZOIA 4WUJA 2OOLA 3BJNA 4Y0TA 2IWCA 5HARA 1S67L 1YLTA 2VGLM 2AVXA 1O7EA 4GNUA 1K6SA 2NUPC 1AXBA 1GHMA 5EVLA 1YLYA 3QP6A 4FSFA 3G31A 5IHVA 3NECA 3IT9A 5J3WA 1OMEA 1GA9A 1TDLA 5HL6A 2ZC5B 1TF1A 3ZDJA 5CGSA 3LR4A 1X0OA 5EVIB 2ZMAA 4PM7A 3LIAA 3BFCA 3D3OA 4E6WA 5FDHA 1XX2A 1H3QA 3KYZA 2HP9A 3N8LA 4II7A 4JGRA 3QP2A 2Y2MA 2W1TB 1DY6A 5F6AA 2B5RA 4X25A 4E3MA 4X55A 1D06A 5IT5A 1FR1A 3A0VA 1W63M 1VM1A 1P0ZA 4NK3A 1JTGA 4S2LA 1T1AA 3NOPC 2OLVA 3HLBA 3TW8A 5BOHA 2BG1A 3M2JA 2EWVA 3MQQA 4RX2A 3MZFA 4I38A 1ONGA 1KE0A 3C4PA 4KZ9A 5J7EA 3IF6B 4BD1A 2NUTC 4LV2A 3IH8A 4E3NA 5A91A 1E4DA 3DWKA 2ZM2A 2PU2A 2WGIA 4OQGA 2FZ0A 1KVLA 3VP0A 2GNXA 1JVJA 3MXSA 5CEDA 1XKZA 5CERA 2G2UA 2GDNA 4HY8A 1YMXA 2P7JA 2VV6A 2Q0OA 3HLCA 3P7NA 2QHKA 4WLAA 4OPQA 4DF6A 2G7UA 3N4IA 3EGXC 3LIDA 2EWWA 4BL3A 1KDSA 2R78A 1MWUA 4GLQA 1BYWA 1PZOA 3NHQA 1S1YA 4Y15A 1F9IA 2HDSA 4X1LA 3HCYA 3ZGAB 5EV0A 2PYRA 3SZTA 1ZC2A 4BMWA 2J8YA 1K55C 5CX7A 3HVFA 3E0YA 2RL3A 4LV1A 3DW0A 3O5YA 4ZJ2A 4UA6A 3PTEA 1Y54A 1OTAA 3V5MA 4EBNA 5FAOA 1CF0A 1A0KA 1FIKA 2H0TA 4M4XA 3VP1A 5C5KA 3FKWA 4ZRRA 4EERA 4IVKA 4ZBEA 4ESPA 1XJ2A 5TGFA 3NDEA 3NJAA 2QMIA 3OPLA 3OLOA 2EX9A 4FOFA 2W1TA 1FSWA 2FFFB 2Y2GA 4KUOA 1DJBA 2ZOHA 4I5SA 1NLYA 1BLSA 3PBNA 4M3KA 2HP5A 4I3AA 3ITAA 1O07A 3BY9A 4B4XA 3VOYA 1IYPA 1JWVA 2Y2KA 4LV3A 4PM9A 4Q0HA 3A3DA 1YAXA 4MN7A 4U0XA 5TBMA 2J7VA 1P9WA 2A3UA 4R23A 1NRJA 3H7WA 4JKTA 4IUHA 5CHMA 3IBJA 1M40A 2K31A 4QY5A 4JGPA 4UAAA 3F1OA 4E3IA 3H7WB 5FQKA 3G2YA 5L2FA 2PHYA 5EM1A 4S2IA 3UE6A 4WEKA 1ERQA 4EU0A 3PAEA 1GHPA 2PRFA 4I3JA 4LGWA 4WBGA 4QJGA 1VEUA 2B18A 4JPMA 4PM5A 3Q7ZA 2KX6A 1ZG6A 2ZBBA 2M1CA 4MNRA 2P08A 1PWGA 4MBKA 4YINA 5EOOA 3NY4A 4KG5A 4NXBA 4KZ5A 3PBTA 1MKIA 3ZVWA 3UPPA 5DF8A 4OONA 3WRTA 1OJ5A 1F2KA 5L10A 3PHYA 3NBLA 1V9YA 3QNCA 3CLOA 2JN7A 4YNRA 4S2NC 4ZDXA 3BY8A 1ESUA 4G3WA 5KSCA 1E3UD 1Y4OA 3ZFZA 4FH2A 3IS2B 1L2SA 2R9XA 5G4ZA 3HREA 2UWXA 1LSWA 3UPNA 3IXHA 1TDGA 5CGXA 2ZMFA 5M18A 3ZVTA 5JYPA 3E2LA 2VGLS 3BQ8A 4KUKA 2HF6A 3TE8A 2INWA 1L0EA 2OAP1 3T4LA 3L9KA 4X68A 3HL9A 4LENA 4HNBA 2XROA 1IEMA 1MC0A 3IHAA 5HDSA 3B42A 3QP1A 2VKSA 3KSHA 3SW1A 3IWIA 4R4RA 1NY0A 2W3HA 2G2WA 2WKPA 4C6YA 4UA9A 2J3WA 3LICA 2JE5A 3MXRA 1XJ6A 4IHQA 2Z6CA 2P74A 3G32A 3UMDA 3W8KA 3MXQA 5GLBA 3W2ZA 2PT7A 3MJQA 3W4PA 3ZG8B 5HWWA 3EEHA 2ZC4B 1ONHA 3LY4A 3C2WA 5AQ9A 4OPYA 1ZG4A 3HLDA 4DKIA 4OPZA 3MZEA 4R0QA 4K08A 2XD5A 3C30A 3UDIA 1T19A 4PMAA 2ZQCA 2BASA 5E2EA 2PAVP 1OTBA 1FOFA 1XP4A 2K2NA 5DFXA 1PI4A 2JKFA 2W3EA 2JCHA 4EV4A 4Q0IA 2QZ6A 2CMNA 3CWFA 1LL5A 2EA9A 2XA7S 1MBLA 3GECA 1PI5A 2VLGA 3F1NB 5HD5A 1W79A 2QJ7A 4IBRA 1KGFA 4IJGA 4OLGA 3S4XA 5CXWA 2DNSA 2VA0A 3T4JA 1SKOB 3WS4A 4OVDA 3ZNYA 1KDWA 3LGOA 1SKFA 4YFMA 4LFUA 2O99A 1K38A 2O0YA 1IYSA 1S6RA 3ZG9B 3S7QA 1XJ4A 1XGIA 1SKOA 3G2ZA 4QWOA 3Q1FA 1V9ZA 3C7UA 3VFHA 2IWDA 3LFVA 4QU3A 1K25A 1OTDA 4OOYA 5FI2A 3M6BA 1OJGA 3NOTC 2H0YA 1SDEA 3NCKA 4S2NA 4EW7A 4N9LA 5U47A 4Q8IA 1U60A 4NXFA 4BENA 5I94A 3GSGA 2UV0E 4CLCC 3A0RA 5IU1A 5FEGA 1KGEA 2GZAA 3UB9A 4WYYA 4HHDA 4CJNA 2ZJ9A 5EUAA 4GCZA 4E3LA 2HDUA 2H10A 2V8CA 3IWOA 1Q2PA 2XDMA 3SS3A 2Q9NA 1FCNA 3GV9A 1T1BA 3T4KA 4O8GA 3F1PB 4FTXA 1N9OA 3N8RA 2QWSA 4KQOA 3VV4A 1M6KA 4Y0OA 2B02A 5FSRA 5FAPA 4MMNA 2CC1A 5EVEA 3CMZA 3UB8A 3GVBA 3TOIA 3EOIA 1YMSA 5F82A 1DJCA 2O9CA 2J3TD 1W7FA 2WKEA 3MMHA 2HZ5A 2WGVA 5EFWA 1KE4A 1VETB 2H5SA 4E3KA 4GS9B 3E4PA 4S2MA 4N1HA 1FSYA 3SOIA 3S1YA 3ZG0A 3WS0A 4HOIA 3BLSA 3O86A 1MXOA 2Y2LA 4HP4A 4OLDA 4L9GA 4BWIA 1RP5A 2XH9A 1CI9A 2QPNA 3K2NA 3LR0A 4CPKA 4K0XA 1CQAA 4BLMA 5CECA 3HLEA 3FG8A 1K57C 4C3QA 1ES4A 1NRFA 3MKEA 3UPOA 1H0MA 3BFDA 3QP5A 4XXRA 2XFTA 1NYYA 4ID4A 2W3FA 1ESIA 4BBVA 5FL3A 3DAVA 4MDZA 3V39A 4YWZA 3KSGA 2VV7A 4HESA 5DTSA 1NXYA 4HJ4A 3ULFA 4HJ6A 3G30A 5AQ7A 3VP4A 5CHJA 1YLZA 4KZ4A 1WA9A 1NLZA 3H82B 3C8CA 2HV1A 2ZQDA 4I39A 3EEAA 1K6RA 3V67A 2OV5A 3N7WA 1W8QA 2WZXA 4GHIB 3VE4A 1Q2QA 1YLWA 3T1SA 1XA7A 2WGWA 3LIFA 2ZQ8A 4EBPA 5FDSA 1YLPA 1F5MA 1D7EA 1TS7A 4D60A 2R9WA 4PKYG 3SH7A 1N9NA 3NIAA 1VHMA 5HW3A 4S2OA 3UE3A 1EWZA 4PM6A 1QMEA 1YQSA 3F1PA 3IBRA 4HQAA 2OWJA 2J9OA 3W4OA 2HP6A 1K55A 4JGOA 4S2KA 4DXBA 4MBFA
chains in the Genus database with same CATH topology
3BFEA 1CEFA 2EFUA 1K54A 2WYXA 3ZG7B 1BLPA 3JYIA 4JPMA 3UNWA 3FV7A 3IXBA 1PZPA 4DE3A 4PM5A 3Q7ZA 3IQAA 4RA7A 4C75A 4WELA 4P85A 3LO7A 1ZG6A 3OPPA 5AQAA 2XR0A 1NZUA 3OZHA 4MNRA 1PWGA 4KENB 5M19A 1NZOA 3A3EA 4MBKA 4YINA 4E3JA 4ZTKA 1EROA 4A5RA 4X69A 2WUQA 4EWFA 4DDYA 3Q07A 5EOOA 3HUNA 4N1XA 5CHUA 1ES2A 2XEPA 3NY4A 4KG5A 4UA7A 1I2WA 3UO9A 3M6HA 1MY8A 2A49A 4X6TA 4KZ5A 2XF3A 3PBTA 1KVMA 3VSKA 4U0TA 2WGWB 1MKIA 2HDQA 3ZVWA 2EXAA 4JF5A 3FKVA 3UPPA 3BFFA 5DF8A 4OONA 3VOZA 1SHVA 3DWZA 4OH0A 5A93A 2EX8A 1BSGA 3WRTA 1H8YA 2P9VA 4HEFA 3GRJA 5FQQA 3SS4A 5KSHA 3Q82A 5DF7A 4E3OA 4S2PA 4ZAMA 3NBLA 3QNCA 4JF6A 4PM8A 3C5AA 4DXBA 1L0DA 5GHZA 3BM6A 4S2NC 1W5DA 2XLNA 3V50A 4ZDXA 2ZM8A 5GLDA 1ESUA 2WADA 2J9PA 2Z2LB 3PBQA 3PAGA 5GHYA 3VP2A 4OQHA 1NYMA 5KSCA 3BRMA 1E3UD 3ZFZA 4FH2A 1LHYA 1K4EA 1L2SA 2R9XA 1FQGA 2ZQ9A 2EFXA 1I5QA 1BTLA 1YT4A 5EECA 2ZC7A 3HREA 2Y2IA 2UWXA 4R1GA 3VSLA 4D2OA 2PU4A 3UPNA 2XK1A 5D3OA 1K56A 3IXHA 5A92A 1TDGA 4GKUA 2WKHA 5CGXA 5M18A 2Y2PA 3ZVTA 5JYPA 1YM1A 1HZOA 3E2LA 5KZHA 3G35A 3IHBA 3I7JA 3VFFA 1L0EA 4X68A 3O87A 4B4ZA 3HL9A 1NJ4A 2DRWA 4KZ7A 4IVIA 4LENA 3VP3A 4EUZA 3BLMA 1IEMA 3RXXA 3ZNTA 3VMAA 1XXMA 3BECA 4OOLA 1GA0A 4KZ8A 3IF6C 3IHAA 3AGFA 3UE0A 4N9KA 4X53A 5G18A 5EVID 4S2JA 4B88A 3PBRA 2OSUA 1QMFA 1N4OA 4QHCA 2I72A 1ZKJA 3IWIA 4OPRA 4R4RA 1NY0A 5M1AA 1SCWA 2Q9MA 2Y91A 4NETA 4LCLA 3ZCZA 3A3IA 2G2WA 4C6YA 3NI9A 4UA9A 5GL9A 1ES3A 3UDXA 3A3JA 3SS5A 2JE5A 4FH4A 4OQ0A 3O3VA 3MXRA 2RCXA 1G68A 5FATA 1J9MA 1PWCA 5DVAA 2P74A 1GHIA 3G32A 3HBRA 3WS5A 3PBSA 3W8KA 1MWRA 5GLBA 3IF5A 2WZZA 3W4PA 3EQVA 3QHYA 4OP5A 5F1GA 1JWZA 4K91A 1GCEA 3ZG8B 4RYEA 2ZC4B 3P98A 4BL2A 1ONHA 4DE0A 2ZC6B 3LY4A 1Z6FA 3OC2A 5AQ9A 2FFYA 4OPYA 5FQJA 4DRTA 1ZG4A 3HLDA 4JXVA 2VGJA 4DKIA 5DTKA 4OPZA 3MZEA 4OQIA 3HUMA 3P09A 4R0QA 5EPHA 3GTCA 1E3UA 2XD5A 4BD0A 3AGEA 3G4PA 1MWTA 3Q7VB 2Y2NA 5HX9A 3UDIA 4U3TA 1L0GA 4N92A 2V20A 4PMAA 2ZQCA 4IEDA 3HLWA 4FCFA 5E2EA 3NDGA 1FOFA 3M2KA 3NC8A 5EVIC 1XP4A 4Y7PA 2Y55A 5EE8A 1K56D 4KG2A 1BT5A 1E25A 4OKPA 3WS1A 1PI4A 2ZD8A 1BUEA 1HVBA 2JCHA 4PPRA 1PWDA 4EV4A 2BLSA 1VQQA 2QZ6A 3MKFA 4GD6A 4DE2A 3PBOA 1LL5A 4Y0TA 1MBLA 2IWCA 3CJMA 1H5XA 5HARA 1CI8A 1PI5A 1IYOA 5FQ9A 3TSGA 3IWQA 3O88A 1YLTA 4JLFA 2ZC3B 5CRFA 1O7EA 3RXWA 4GNUA 1W79A 3LCEA 4IBRA 1K6SA 1AXBA 1KGFA 1LLBA 1GHMA 3RJUA 5EVLA 1YLYA 3IF6A 4OLGA 4GN2A 4FSFA 4R3JA 5CXWA 3S4XA 2DNSA 3G31A 4MBHA 5IHVA 3B3XA 3IT9A 5E43A 4BJPA 2P9VB 3QNBA 1OMEA 3WS4A 4OVDA 3ZNYA 1KDWA 3ITBA 1SKFA 4YFMA 1GA9A 1TDLA 3UN7A 1K38A 2ZC5B 1N9BA 2EXBA 1IYSA 1S6RA 1W8YA 5FI6A 5F1FA 1ERMA 3GMWA 3ZG9B 3ZDJA 3EQUA 5CGSA 1L0FA 5EVIB 1XGIA 2ZMAA 4PM7A 3G2ZA 1FCOA 1HTZA 1PW8A 3BFCA 3Q1FA 5FQMA 3SH9A 2EX2A 1LL9A 4KQQA 5GLAA 4E6WA 5FDHA 3C7UA 2WAEA 3VFHA 2IWDA 5HAQA 1BLCA 4QU3A 1XX2A 1WYBA 1K25A 5FASA 2HP9A 3N8LA 3FWLA 3G34A 2XD1A 5CTMA 1FCMA 4OOYA 5FI2A 2Y2MA 1DY6A 2DCFA 2PBYA 3M6BA 4GOGA 5FAQA 4DXCA 2H0YA 1SDEA 2B5RA 5JYOA 5TFQA 3ZHHA 4E3MA 4OOMA 4FD8A 3N8SA 3NCKA 3C7VA 4X55A 4GD8A 1FR1A 3HLGA 3OCNA 4S2NA 5EVIA 4N9LA 1CEGA 5U47A 4Q8IA 3LY3A 2Y2JA 1TVFA 3N6IA 1MPLA 1VM1A 1U60A 4BENA 5I94A 4NK3A 3FYZA 3GSGA 1JTGA 2XGNA 4S2LA 5AQBA 5HL1A 2OLVA 3HLBA 5FQIA 1RCJA 3MFDA 5CGWA 5BOHA 1KGEA 2BG1A 3M2JA 4LCMA 4WZ4A 4RX2A 3MZFA 4WYYA 2V1ZA 4K0WA 4WEJA 3ISGA 1ONGA 1KE0A 5DTTA 4CJNA 1FR6A 3C4PA 3Q7VA 3GQZA 4KZ9A 2ZJ9A 1KE3A 3IF6B 1BZAA 3MZDA 4P0MA 5EUAA 5E2FA 4BD1A 4JF4A 1RGYA 2ZQAA 4LV2A 2HDUA 2H10A 3IH8A 4E3NA 4QD4A 3V3SA 5A91A 4E3LA 3IXGA 1E4DA 3IWOA 1G6AA 4KZBA 3BYDA 1WYCA 3DWKA 1Q2PA 2XDMA 3SS3A 4JXGA 2Q9NA 1FCNA 2ZM2A 4EQIA 5FA7A 3GV9A 2PU2A 2WGIA 4OQGA 4QB8A 3SH8A 1KVLA 3VP0A 1IKGA 2JC7A 1JVJA 2HPBA 2ZM0A 3MXSA 5CEDA 1RGZA 3N8RA 4KQOA 1XKZA 1TEMA 5CERA 1K54C 2IWBA 1M6KA 2G2UA 3S22A 1XPBA 2GDNA 2V2FF 4Y0OA 4R4SA 1PIOA 1YMXA 1EI5A 3E2KA 2Z2MB 5FSRA 5FAPA 3HLCA 3UDFA 2CC1A 1DJAA 3CMZA 4OPQA 1C3BA 4DF6A 3N4IA 5HAPA 2E8IA 3GVBA 3TOIA 1JWPA 1IYQA 4BQMA 1YMSA 5F82A 1DJCA 4EBLA 1W7FA 2WKEA 4BL3A 1KDSA 4IBXA 4ZJ3A 1MWUA 4GDBA 1PZOA 2WGVA 1ALQA 1KE4A 4P87A 2HDSA 4WM9A 3FZCA 2H5SA 3OPRA 3ZGAB 3BEBA 4E3KA 1K4FA 2C5WB 1K57A 4KQRA 2WAFA 4X56A 1PW1A 4S2MA 4O7DA 1ZC2A 4N1HA 1FSYA 2J8YA 1K55C 3SOIA 2ZLYA 3S1YA 1WE4A 3ZG0A 3HLFA 4QY6A 3W4QA 1BLHA 3WS0A 1IELA 3LEZA 3BLSA 3O86A 1XA1A 3HVFA 3AGDA 2Y59A 2RL3A 3TG9A 4LV1A 4H8RA 2Y2LA 1MXOA 3DW0A 3BFGA 4OLDA 3DTMA 3OPHA 3WS2A 1I2SA 1RP5A 5EOEA 2XH9A 4ZJ2A 4MLLA 3IXDA 4UA6A 2JBFA 3PTEA 1Y54A 4GB7A 5TR7A 1CI9A 5E2GA 2QPNA 3IH9A 3V3RA 3A3FA 4CPKA 1CK3A 3V5MA 2X02A 3ZG5A 1BULA 4K0XA 4BLMA 5CECA 3HLEA 4EBNA 4WZ5A 5FAOA 1K57C 4Y0UA 1ES4A 1NRFA 4C3QA 3MKEA 3WWXA 3UPOA 4WMCD 3BFDA 4XXRA 2XFTA 4RVAA 1NYYA 2HDRA 4OP8A 4ID4A 4KZ3A 2OLUA 4GDNA 2H0TA 3UY6A 2Y2QA 3VP1A 1MWSA 1ESIA 3FKWA 4HBUA 2EX6A 1XGJA 5A90A 4WMCA 2VGKA 4F94A 4IVKA 4ZBEA 5HAIA 3UE1A 1JTDA 1PYYA 3V39A 5TGFA 3OCLA 4P6BA 3NDEA 4RX3A 1SDNA 2QMIA 3OPLA 4MEZA 2EX9A 4HESA 5DTSA 1YLJA 4UHUA 1NXYA 5GLCA 4L0LA 3G30A 1FSWA 5AQ7A 3VP4A 4DE1A 2FFFB 5CHJA 2Y2GA 1YLZA 4KZ4A 4Z9QA 1DJBA 4XUXA 4DDSA 1BLSA 3PBNA 4M3KA 5CTNA 5E2HA 5CEBA 2HP5A 4JXWA 3ITAA 3MBZA 1O07A 2ZQDA 4XUZA 1K6RA 4B4XA 2OV5A 3N7WA 3VOYA 1W8QA 5J8XA 2WZXA 1IYPA 1Q2QA 2WKIA 1JWVA 1IKIA 1YLWA 2Y2KA 4JXSA 1XA7A 4LV3A 4PM9A 2WGWA 4KZAA 2ZQ8A 4EBPA 3A3DA 3Q81A 3C4OA 5DF9A 4KZ6A 3HUOA 2Y2OA 4E6XA 3CG5A 5FI7A 1YLPA 3CZDA 4LV0A 4ZJ1A 4U0XA 2R9WA 3SH7A 4WZ5C 2J7VA 2A3UA 4R23A 1ES5A 3GR2A 3NIAA 4JKTA 5KMWA 1S0WA 4HBTA 5HW3A 2XQZA 1LI0A 5CHMA 2WK0A 4R3BA 4S2OA 1EWZA 3UE3A 1M40A 4QY5A 4UAAA 4PM6A 1QMEA 1YQSA 2X01A 4E3IA 5HFOA 1HD8A 2Y4AA 5FQKA 2X71A 4GZBA 3G2YA 5GHXA 5L2FA 3WRZA 2XFSA 2C6WB 2J9OA 4S2IA 3W4OA 1ERQA 1H8ZA 4JBFA 4KG6A 3PAEA 1GHPA 4WEKA 1LI9A 3D4FA 4WBGA 2HP6A 1K55A 2ZQ7A 4S2KA 5F83A 4QJGA 1KGGA 4MBFA 2Y2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFE A;  1CEF A;  2EFU A;  1K54 A;  2WYX A;  3ZG7 B;  1BLP A;  3JYI A;  4JPM A;  3UNW A;  3FV7 A;  3IXB A;  1PZP A;  4DE3 A;  4PM5 A;  3Q7Z A;  3IQA A;  4RA7 A;  4C75 A;  4WEL A;  4P85 A;  3LO7 A;  1ZG6 A;  3OPP A;  5AQA A;  2XR0 A;  1NZU A;  3OZH A;  4MNR A;  1PWG A;  4KEN B;  5M19 A;  1NZO A;  3A3E A;  4MBK A;  4YIN A;  4E3J A;  4ZTK A;  1ERO A;  4A5R A;  4X69 A;  2WUQ A;  4EWF A;  4DDY A;  3Q07 A;  5EOO A;  3HUN A;  4N1X A;  5CHU A;  1ES2 A;  2XEP A;  3NY4 A;  4KG5 A;  4UA7 A;  1I2W A;  3UO9 A;  3M6H A;  1MY8 A;  2A49 A;  4X6T A;  4KZ5 A;  2XF3 A;  3PBT A;  1KVM A;  3VSK A;  4U0T A;  2WGW B;  1MKI A;  2HDQ A;  3ZVW A;  2EXA A;  4JF5 A;  3FKV A;  3UPP A;  3BFF A;  5DF8 A;  4OON A;  3VOZ A;  1SHV A;  3DWZ A;  4OH0 A;  5A93 A;  2EX8 A;  1BSG A;  3WRT A;  1H8Y A;  2P9V A;  4HEF A;  3GRJ A;  5FQQ A;  3SS4 A;  5KSH A;  3Q82 A;  5DF7 A;  4E3O A;  4S2P A;  4ZAM A;  3NBL A;  3QNC A;  4JF6 A;  4PM8 A;  3C5A A;  4DXB A;  1L0D A;  5GHZ A;  3BM6 A;  4S2N C;  1W5D A;  2XLN A;  3V50 A;  4ZDX A;  2ZM8 A;  5GLD A;  1ESU A;  2WAD A;  2J9P A;  2Z2L B;  3PBQ A;  3PAG A;  5GHY A;  3VP2 A;  4OQH A;  1NYM A;  5KSC A;  3BRM A;  1E3U D;  3ZFZ A;  4FH2 A;  1LHY A;  1K4E A;  1L2S A;  2R9X A;  1FQG A;  2ZQ9 A;  2EFX A;  1I5Q A;  1BTL A;  1YT4 A;  5EEC A;  2ZC7 A;  3HRE A;  2Y2I A;  2UWX A;  4R1G A;  3VSL A;  4D2O A;  2PU4 A;  3UPN A;  2XK1 A;  5D3O A;  1K56 A;  3IXH A;  5A92 A;  1TDG A;  4GKU A;  2WKH A;  5CGX A;  5M18 A;  2Y2P A;  3ZVT A;  5JYP A;  1YM1 A;  1HZO A;  3E2L A;  5KZH A;  3G35 A;  3IHB A;  3I7J A;  3VFF A;  1L0E A;  4X68 A;  3O87 A;  4B4Z A;  3HL9 A;  1NJ4 A;  2DRW A;  4KZ7 A;  4IVI A;  4LEN A;  3VP3 A;  4EUZ A;  3BLM A;  1IEM A;  3RXX A;  3ZNT A;  3VMA A;  1XXM A;  3BEC A;  4OOL A;  1GA0 A;  4KZ8 A;  3IF6 C;  3IHA A;  3AGF A;  3UE0 A;  4N9K A;  4X53 A;  5G18 A;  5EVI D;  4S2J A;  4B88 A;  3PBR A;  2OSU A;  1QMF A;  1N4O A;  4QHC A;  2I72 A;  1ZKJ A;  3IWI A;  4OPR A;  4R4R A;  1NY0 A;  5M1A A;  1SCW A;  2Q9M A;  2Y91 A;  4NET A;  4LCL A;  3ZCZ A;  3A3I A;  2G2W A;  4C6Y A;  3NI9 A;  4UA9 A;  5GL9 A;  1ES3 A;  3UDX A;  3A3J A;  3SS5 A;  2JE5 A;  4FH4 A;  4OQ0 A;  3O3V A;  3MXR A;  2RCX A;  1G68 A;  5FAT A;  1J9M A;  1PWC A;  5DVA A;  2P74 A;  1GHI A;  3G32 A;  3HBR A;  3WS5 A;  3PBS A;  3W8K A;  1MWR A;  5GLB A;  3IF5 A;  2WZZ A;  3W4P A;  3EQV A;  3QHY A;  4OP5 A;  5F1G A;  1JWZ A;  4K91 A;  1GCE A;  3ZG8 B;  4RYE A;  2ZC4 B;  3P98 A;  4BL2 A;  1ONH A;  4DE0 A;  2ZC6 B;  3LY4 A;  1Z6F A;  3OC2 A;  5AQ9 A;  2FFY A;  4OPY A;  5FQJ A;  4DRT A;  1ZG4 A;  3HLD A;  4JXV A;  2VGJ A;  4DKI A;  5DTK A;  4OPZ A;  3MZE A;  4OQI A;  3HUM A;  3P09 A;  4R0Q A;  5EPH A;  3GTC A;  1E3U A;  2XD5 A;  4BD0 A;  3AGE A;  3G4P A;  1MWT A;  3Q7V B;  2Y2N A;  5HX9 A;  3UDI A;  4U3T A;  1L0G A;  4N92 A;  2V20 A;  4PMA A;  2ZQC A;  4IED A;  3HLW A;  4FCF A;  5E2E A;  3NDG A;  1FOF A;  3M2K A;  3NC8 A;  5EVI C;  1XP4 A;  4Y7P A;  2Y55 A;  5EE8 A;  1K56 D;  4KG2 A;  1BT5 A;  1E25 A;  4OKP A;  3WS1 A;  1PI4 A;  2ZD8 A;  1BUE A;  1HVB A;  2JCH A;  4PPR A;  1PWD A;  4EV4 A;  2BLS A;  1VQQ A;  2QZ6 A;  3MKF A;  4GD6 A;  4DE2 A;  3PBO A;  1LL5 A;  4Y0T A;  1MBL A;  2IWC A;  3CJM A;  1H5X A;  5HAR A;  1CI8 A;  1PI5 A;  1IYO A;  5FQ9 A;  3TSG A;  3IWQ A;  3O88 A;  1YLT A;  4JLF A;  2ZC3 B;  5CRF A;  1O7E A;  3RXW A;  4GNU A;  1W79 A;  3LCE A;  4IBR A;  1K6S A;  1AXB A;  1KGF A;  1LLB A;  1GHM A;  3RJU A;  5EVL A;  1YLY A;  3IF6 A;  4OLG A;  4GN2 A;  4FSF A;  4R3J A;  5CXW A;  3S4X A;  2DNS A;  3G31 A;  4MBH A;  5IHV A;  3B3X A;  3IT9 A;  5E43 A;  4BJP A;  2P9V B;  3QNB A;  1OME A;  3WS4 A;  4OVD A;  3ZNY A;  1KDW A;  3ITB A;  1SKF A;  4YFM A;  1GA9 A;  1TDL A;  3UN7 A;  1K38 A;  2ZC5 B;  1N9B A;  2EXB A;  1IYS A;  1S6R A;  1W8Y A;  5FI6 A;  5F1F A;  1ERM A;  3GMW A;  3ZG9 B;  3ZDJ A;  3EQU A;  5CGS A;  1L0F A;  5EVI B;  1XGI A;  2ZMA A;  4PM7 A;  3G2Z A;  1FCO A;  1HTZ A;  1PW8 A;  3BFC A;  3Q1F A;  5FQM A;  3SH9 A;  2EX2 A;  1LL9 A;  4KQQ A;  5GLA A;  4E6W A;  5FDH A;  3C7U A;  2WAE A;  3VFH A;  2IWD A;  5HAQ A;  1BLC A;  4QU3 A;  1XX2 A;  1WYB A;  1K25 A;  5FAS A;  2HP9 A;  3N8L A;  3FWL A;  3G34 A;  2XD1 A;  5CTM A;  1FCM A;  4OOY A;  5FI2 A;  2Y2M A;  1DY6 A;  2DCF A;  2PBY A;  3M6B A;  4GOG A;  5FAQ A;  4DXC A;  2H0Y A;  1SDE A;  2B5R A;  5JYO A;  5TFQ A;  3ZHH A;  4E3M A;  4OOM A;  4FD8 A;  3N8S A;  3NCK A;  3C7V A;  4X55 A;  4GD8 A;  1FR1 A;  3HLG A;  3OCN A;  4S2N A;  5EVI A;  4N9L A;  1CEG A;  5U47 A;  4Q8I A;  3LY3 A;  2Y2J A;  1TVF A;  3N6I A;  1MPL A;  1VM1 A;  1U60 A;  4BEN A;  5I94 A;  4NK3 A;  3FYZ A;  3GSG A;  1JTG A;  2XGN A;  4S2L A;  5AQB A;  5HL1 A;  2OLV A;  3HLB A;  5FQI A;  1RCJ A;  3MFD A;  5CGW A;  5BOH A;  1KGE A;  2BG1 A;  3M2J A;  4LCM A;  4WZ4 A;  4RX2 A;  3MZF A;  4WYY A;  2V1Z A;  4K0W A;  4WEJ A;  3ISG A;  1ONG A;  1KE0 A;  5DTT A;  4CJN A;  1FR6 A;  3C4P A;  3Q7V A;  3GQZ A;  4KZ9 A;  2ZJ9 A;  1KE3 A;  3IF6 B;  1BZA A;  3MZD A;  4P0M A;  5EUA A;  5E2F A;  4BD1 A;  4JF4 A;  1RGY A;  2ZQA A;  4LV2 A;  2HDU A;  2H10 A;  3IH8 A;  4E3N A;  4QD4 A;  3V3S A;  5A91 A;  4E3L A;  3IXG A;  1E4D A;  3IWO A;  1G6A A;  4KZB A;  3BYD A;  1WYC A;  3DWK A;  1Q2P A;  2XDM A;  3SS3 A;  4JXG A;  2Q9N A;  1FCN A;  2ZM2 A;  4EQI A;  5FA7 A;  3GV9 A;  2PU2 A;  2WGI A;  4OQG A;  4QB8 A;  3SH8 A;  1KVL A;  3VP0 A;  1IKG A;  2JC7 A;  1JVJ A;  2HPB A;  2ZM0 A;  3MXS A;  5CED A;  1RGZ A;  3N8R A;  4KQO A;  1XKZ A;  1TEM A;  5CER A;  1K54 C;  2IWB A;  1M6K A;  2G2U A;  3S22 A;  1XPB A;  2GDN A;  2V2F F;  4Y0O A;  4R4S A;  1PIO A;  1YMX A;  1EI5 A;  3E2K A;  2Z2M B;  5FSR A;  5FAP A;  3HLC A;  3UDF A;  2CC1 A;  1DJA A;  3CMZ A;  4OPQ A;  1C3B A;  4DF6 A;  3N4I A;  5HAP A;  2E8I A;  3GVB A;  3TOI A;  1JWP A;  1IYQ A;  4BQM A;  1YMS A;  5F82 A;  1DJC A;  4EBL A;  1W7F A;  2WKE A;  4BL3 A;  1KDS A;  4IBX A;  4ZJ3 A;  1MWU A;  4GDB A;  1PZO A;  2WGV A;  1ALQ A;  1KE4 A;  4P87 A;  2HDS A;  4WM9 A;  3FZC A;  2H5S A;  3OPR A;  3ZGA B;  3BEB A;  4E3K A;  1K4F A;  2C5W B;  1K57 A;  4KQR A;  2WAF A;  4X56 A;  1PW1 A;  4S2M A;  4O7D A;  1ZC2 A;  4N1H A;  1FSY A;  2J8Y A;  1K55 C;  3SOI A;  2ZLY A;  3S1Y A;  1WE4 A;  3ZG0 A;  3HLF A;  4QY6 A;  3W4Q A;  1BLH A;  3WS0 A;  1IEL A;  3LEZ A;  3BLS A;  3O86 A;  1XA1 A;  3HVF A;  3AGD A;  2Y59 A;  2RL3 A;  3TG9 A;  4LV1 A;  4H8R A;  2Y2L A;  1MXO A;  3DW0 A;  3BFG A;  4OLD A;  3DTM A;  3OPH A;  3WS2 A;  1I2S A;  1RP5 A;  5EOE A;  2XH9 A;  4ZJ2 A;  4MLL A;  3IXD A;  4UA6 A;  2JBF A;  3PTE A;  1Y54 A;  4GB7 A;  5TR7 A;  1CI9 A;  5E2G A;  2QPN A;  3IH9 A;  3V3R A;  3A3F A;  4CPK A;  1CK3 A;  3V5M A;  2X02 A;  3ZG5 A;  1BUL A;  4K0X A;  4BLM A;  5CEC A;  3HLE A;  4EBN A;  4WZ5 A;  5FAO A;  1K57 C;  4Y0U A;  1ES4 A;  1NRF A;  4C3Q A;  3MKE A;  3WWX A;  3UPO A;  4WMC D;  3BFD A;  4XXR A;  2XFT A;  4RVA A;  1NYY A;  2HDR A;  4OP8 A;  4ID4 A;  4KZ3 A;  2OLU A;  4GDN A;  2H0T A;  3UY6 A;  2Y2Q A;  3VP1 A;  1MWS A;  1ESI A;  3FKW A;  4HBU A;  2EX6 A;  1XGJ A;  5A90 A;  4WMC A;  2VGK A;  4F94 A;  4IVK A;  4ZBE A;  5HAI A;  3UE1 A;  1JTD A;  1PYY A;  3V39 A;  5TGF A;  3OCL A;  4P6B A;  3NDE A;  4RX3 A;  1SDN A;  2QMI A;  3OPL A;  4MEZ A;  2EX9 A;  4HES A;  5DTS A;  1YLJ A;  4UHU A;  1NXY A;  5GLC A;  4L0L A;  3G30 A;  1FSW A;  5AQ7 A;  3VP4 A;  4DE1 A;  2FFF B;  5CHJ A;  2Y2G A;  1YLZ A;  4KZ4 A;  4Z9Q A;  1DJB A;  4XUX A;  4DDS A;  1BLS A;  3PBN A;  4M3K A;  5CTN A;  5E2H A;  5CEB A;  2HP5 A;  4JXW A;  3ITA A;  3MBZ A;  1O07 A;  2ZQD A;  4XUZ A;  1K6R A;  4B4X A;  2OV5 A;  3N7W A;  3VOY A;  1W8Q A;  5J8X A;  2WZX A;  1IYP A;  1Q2Q A;  2WKI A;  1JWV A;  1IKI A;  1YLW A;  2Y2K A;  4JXS A;  1XA7 A;  4LV3 A;  4PM9 A;  2WGW A;  4KZA A;  2ZQ8 A;  4EBP A;  3A3D A;  3Q81 A;  3C4O A;  5DF9 A;  4KZ6 A;  3HUO A;  2Y2O A;  4E6X A;  3CG5 A;  5FI7 A;  1YLP A;  3CZD A;  4LV0 A;  4ZJ1 A;  4U0X A;  2R9W A;  3SH7 A;  4WZ5 C;  2J7V A;  2A3U A;  4R23 A;  1ES5 A;  3GR2 A;  3NIA A;  4JKT A;  5KMW A;  1S0W A;  4HBT A;  5HW3 A;  2XQZ A;  1LI0 A;  5CHM A;  2WK0 A;  4R3B A;  4S2O A;  1EWZ A;  3UE3 A;  1M40 A;  4QY5 A;  4UAA A;  4PM6 A;  1QME A;  1YQS A;  2X01 A;  4E3I A;  5HFO A;  1HD8 A;  2Y4A A;  5FQK A;  2X71 A;  4GZB A;  3G2Y A;  5GHX A;  5L2F A;  3WRZ A;  2XFS A;  2C6W B;  2J9O A;  4S2I A;  3W4O A;  1ERQ A;  1H8Z A;  4JBF A;  4KG6 A;  3PAE A;  1GHP A;  4WEK A;  1LI9 A;  3D4F A;  4WBG A;  2HP6 A;  1K55 A;  2ZQ7 A;  4S2K A;  5F83 A;  4QJG A;  1KGG A;  4MBF A;  2Y2H A; 
#chains in the Genus database with same CATH topology
 3ZG7 B;  3JYI A;  1PZP A;  3IQA A;  4C75 A;  4WEL A;  3LO7 A;  2W3D A;  2XR0 A;  3OZH A;  4ZTK A;  4A5R A;  3UME A;  4DDY A;  2ACG A;  2XEP A;  4DMZ A;  1GSW A;  1YSP A;  4Y13 A;  2XF3 A;  4Z1W A;  1KVM A;  2EXA A;  5G4Y A;  3BFF A;  1Z09 A;  3QP4 A;  3VOZ A;  1STZ A;  5A93 A;  1GSX A;  1LSV A;  1FIL A;  5DF7 A;  4E3O A;  4ZAM A;  3S7N A;  2OWH A;  4PM8 A;  3F1O B;  1W5D A;  2J9P A;  3PAG A;  1NYM A;  3BRM A;  3MQO A;  3T1Q B;  4HH2 A;  4NXE A;  2L0W A;  4R1G A;  2V9A A;  3CIT A;  2PU4 A;  1K56 A;  5A92 A;  4RQ9 A;  1F98 A;  5EM0 A;  5K5B A;  2JKT I;  3DTE A;  1S1Z A;  5KZH A;  3I7J A;  3VFF A;  3O87 A;  4KZ7 A;  4EUZ A;  2HJE A;  4EXO A;  3VMA A;  5AJG A;  3UE0 A;  5G18 A;  5EVI D;  1QMF A;  4QHC A;  2I72 A;  3UB7 A;  1SCW A;  1TS8 A;  2VZW A;  4ARZ A;  2KOI A;  4FH4 A;  3O3V A;  2RCX A;  1G28 A;  1UGU A;  5DVA A;  4QPR A;  1GHI A;  4GS9 A;  3WS5 A;  3KSI A;  3PBS A;  3T1R A;  3IF5 A;  4O0P A;  4RYE A;  3P98 A;  4BL2 A;  2ZC6 B;  2FFY A;  4O01 A;  5HDC A;  4JXV A;  3P09 A;  3GTC A;  1E3U A;  1MWT A;  1YSQ A;  2Y2N A;  4U3T A;  3HLW A;  4FCF A;  4PKY A;  4Y7P A;  2Y55 A;  4NXG A;  1E25 A;  4EES A;  2ZD8 A;  1BUE A;  4CLC D;  1PWD A;  1VQQ A;  4MN6 A;  4GD6 A;  2QYB A;  5HDD A;  3PBO A;  4LLO B;  1J3W A;  3CJM A;  1H5X A;  1ACF A;  5FQ9 A;  3TSG A;  2V1B A;  4HP9 A;  3IWQ A;  3LUQ A;  3O88 A;  4ETX A;  5CRF A;  3E4Q A;  3RXW A;  3LCE A;  4EQ1 A;  2V1A A;  3RFB A;  3DTK A;  4R3J A;  3TJZ C;  1LL8 A;  2PBD P;  3JPU A;  3F1N A;  3G6O A;  5L07 A;  2P9V B;  3FPV A;  2ZL1 A;  1N9B A;  3LEQ A;  1L0F A;  2KDK A;  5FQM A;  1HTZ A;  1PW8 A;  2GJ3 A;  2EX2 A;  1LL9 A;  2WAE A;  5KIZ A;  5HAQ A;  4YOF A;  1BLC A;  3ZQ5 A;  2W1R A;  1WYB A;  3G34 A;  2Z6D A;  1FCM A;  1P97 A;  2DCF A;  5FAQ A;  4DXC A;  5JYO A;  5L09 A;  3ZHH A;  3N8S A;  3E98 A;  3VOL A;  3C7V A;  2VK3 A;  3HLG A;  4GD8 A;  2PD8 A;  3LY3 A;  1TVF A;  3N6I A;  1MPL A;  1EW0 A;  1W63 Q;  1MZU A;  2XGN A;  4UQI M;  1K0K A;  4LCM A;  4WEJ A;  5DTT A;  3T50 A;  1FR6 A;  3IX3 A;  3Q7V A;  3GQZ A;  3MZD A;  1KE3 A;  1BZA A;  3BW6 A;  5E2F A;  4JF4 A;  1RGY A;  3U2A A;  1OT9 A;  3IXG A;  4P6Z S;  4KZB A;  4Y2F A;  1G6O A;  1WYC A;  3EWK A;  5FA7 A;  1LT0 A;  3T4T A;  4MN5 A;  4DJ3 A;  2ZM0 A;  4GJ4 A;  4F3L B;  1K54 C;  3S22 A;  5HWV A;  2PR5 A;  2V2F F;  4R4S A;  4E04 A;  3T4Q A;  4R6L A;  2W27 A;  3LI8 A;  2Z2M B;  1YPR A;  3UDF A;  1H8M A;  3P01 A;  4DN0 A;  4Y5F A;  4HIA A;  4EBL A;  4UEY A;  4IBX A;  4GDB A;  3LI9 A;  1ZTU A;  4WM9 A;  5HZH A;  3FZC A;  3OPR A;  3BEB A;  4KQR A;  4X56 A;  4O7D A;  2XSS A;  3CPT B;  4DJ2 A;  2ZLY A;  3HLF A;  3W4Q A;  1BLH A;  3PR6 A;  4GHI A;  3B47 A;  2Y59 A;  3TG9 A;  3DTM A;  3WS2 A;  3H82 A;  3PXP A;  1I2S A;  5EOE A;  2W3G A;  2MJ6 A;  3IXD A;  2JBF A;  2XRN A;  4GB7 A;  2JHE A;  3IH9 A;  3V3R A;  2PR6 A;  3CUE A;  2V0W A;  3DBA A;  5L8M A;  4WZ5 A;  4Y0U A;  5HPF A;  4OP8 A;  4KZ3 A;  2OLU A;  4GDN A;  2GX5 A;  4HBU A;  2QKP A;  1XGJ A;  5A90 A;  4WMC A;  4B9O A;  3OCL A;  4GW9 A;  4RX3 A;  1YLJ A;  1AWI A;  4R3A A;  3S7O A;  3MS6 A;  3T12 B;  1P9R A;  5F5Y A;  1L3L A;  4Z9Q A;  5CEB A;  4JXW A;  1Y28 A;  4I3I A;  4XUZ A;  5A8B A;  1UWP X;  4BBU A;  2WKI A;  4JXS A;  2K7S A;  3CAX A;  1SZV A;  3VE3 A;  4XT2 B;  3ICY A;  5DJT A;  4KZA A;  2V0U A;  4ARZ B;  2B95 A;  3RH8 B;  3Q81 A;  3C4O A;  4HI4 A;  5DF9 A;  4KZ6 A;  2Y2O A;  4E6X A;  2Y8H A;  3BQA A;  3CG5 A;  5FI7 A;  1ES5 A;  5LBR A;  1LI0 A;  1XFN A;  2A24 A;  4H6J A;  4B93 A;  5HFO A;  4GZB A;  5GHX A;  2XFS A;  2JKT M;  4BD0 A;  1H8Z A;  4KG6 A;  3DTI A;  5F83 A;  1CEF A;  2EFU A;  3UNW A;  1TS0 A;  4RA7 A;  4P85 A;  2L4R A;  4KEN B;  1NZO A;  3A3E A;  1VET A;  4E3J A;  4EWF A;  4X69 A;  3Q07 A;  2LB5 A;  3HUN A;  4N1X A;  5CHU A;  4UA7 A;  1I2W A;  3UO9 A;  3M6H A;  1MY8 A;  1YKD A;  2WGW B;  3KYE A;  3JVU A;  3D72 A;  1ZHH B;  2J3T C;  3GRJ A;  4WF0 A;  3Q82 A;  4JF6 A;  1L0D A;  5GHZ A;  3BM6 A;  3V50 A;  5GLD A;  2WAD A;  2Z2L B;  3PBQ A;  3VP2 A;  3T4S A;  4OQH A;  2WKQ A;  5IS1 A;  1K4E A;  4EEU A;  1BTL A;  2ZC7 A;  2I9V A;  1UWN X;  4Y17 A;  2XK1 A;  4HJ3 A;  5D3O A;  3GDI A;  2WKH A;  2W0N A;  1HZO A;  3UB5 P;  3NOU C;  2A24 B;  2ZMV A;  4B4Z A;  4NEE D;  3VP3 A;  4IVI A;  4R38 A;  3RXX A;  1GA0 A;  4KZ8 A;  3IF6 C;  3AGF A;  3T4O A;  3PBR A;  4EET B;  1ZKJ A;  4OPR A;  4NET A;  2Q9M A;  3CI6 A;  4LCL A;  3ZCZ A;  5I5L A;  1ES3 A;  1G68 A;  5FAT A;  1J9M A;  5F69 A;  1PWC A;  3U4L P;  3HBR A;  4F3L A;  3QHY A;  1JWZ A;  3OBF A;  1GCE A;  1N9L A;  1Z6F A;  5FQJ A;  4DRT A;  2VGJ A;  4WN5 A;  4OQI A;  3HUM A;  3HJK A;  3AGE A;  4LPZ A;  5HX9 A;  4H6J B;  4N92 A;  2V20 A;  4IED A;  3NDG A;  3NC8 A;  3IX4 A;  4P6Z M;  5EE8 A;  1K56 D;  2PYP A;  1BT5 A;  1XFQ A;  3BWL A;  3MKF A;  4DE2 A;  3K3C A;  4X1M A;  1HLU P;  1CI8 A;  1IYO A;  2Y79 A;  4JLF A;  2ZC3 B;  2XA7 M;  4G3V A;  1S4R A;  1PNE A;  1LLB A;  5DJU A;  2D01 A;  3RJU A;  3IF6 A;  4GN2 A;  5HWT A;  4MBH A;  3B3X A;  5E43 A;  4BJP A;  3QNB A;  2QJ5 A;  2HJ9 C;  3ITB A;  3UN7 A;  2EXB A;  1W8Y A;  3NUL A;  5FI6 A;  4AFI A;  1ERM A;  5F1F A;  3GMW A;  3EQU A;  1FCO A;  1ODV A;  1CJF A;  2JKG A;  3SH9 A;  4KQQ A;  5GLA A;  3E4O A;  1D1J A;  5FAS A;  2OAQ 1;  3FWL A;  2XD1 A;  5CTM A;  3JVV A;  4CLC B;  1S4S A;  2PBY A;  4GOG A;  3R7W B;  5TFQ A;  4OOM A;  4FD8 A;  5J4E A;  5EVI A;  3OCN A;  3OOV A;  1CEG A;  2VX8 A;  2Y2J A;  1XJ3 A;  2H28 A;  3FYZ A;  5AQB A;  5HL1 A;  5FQI A;  1RCJ A;  3KO6 A;  3MFD A;  5CGW A;  4XT2 A;  3A0S A;  4WZ4 A;  2V1Z A;  4K0W A;  5TJJ A;  4LRY C;  1PFL A;  4P0M A;  2O9B A;  2ZQA A;  4QD4 A;  3V3S A;  1G6A A;  3BYD A;  4JXG A;  4EQI A;  4QB8 A;  1VB6 A;  3SH8 A;  4PHT A;  1IKG A;  2JC7 A;  2KLI A;  4L9F A;  2HPB A;  1RGZ A;  4NKP A;  1TEM A;  2IWB A;  5DKL A;  1XPB A;  1PIO A;  1EI5 A;  3E2K A;  1OPX A;  1LSX A;  4CQH A;  1DJA A;  2VJW A;  1C3B A;  4Y3I A;  3MSH A;  5HAP A;  2E8I A;  2VEA A;  3LIE A;  1JWP A;  2YKF A;  1IYQ A;  1DP6 A;  1NWZ A;  4BQM A;  4ZJ3 A;  1ALQ A;  3PYP A;  4P87 A;  3ZYT A;  2M7U A;  5HPI A;  1K4F A;  2C5W B;  2LB9 A;  1K57 A;  2WKR A;  3MF0 A;  3R4K A;  2WAF A;  3LIB A;  1PW1 A;  2YKH A;  1WE4 A;  4R70 A;  1DRM A;  4QY6 A;  1IEL A;  3LEZ A;  2P04 A;  1XA1 A;  3AGD A;  3FC7 A;  3KSF A;  4H8R A;  4ME4 A;  3BFG A;  3OPH A;  5DKK A;  4MLL A;  1T18 A;  5TR7 A;  4G3K A;  5E2G A;  3A3F A;  1CK3 A;  2X02 A;  3ZG5 A;  1BUL A;  4BBT A;  1GSV A;  3WWX A;  4WMC D;  4UQI S;  4RVA A;  2HDR A;  3UY6 A;  2Y2Q A;  1MWS A;  4Q0J A;  2EX6 A;  2VGK A;  4F94 A;  5HAI A;  3UE1 A;  1JTD A;  1PYY A;  4P6B A;  3EGD C;  1SDN A;  4MEZ A;  2O9A A;  4UHU A;  5GLC A;  4L0L A;  1DP9 A;  4DE1 A;  1IOU A;  4WL9 A;  4XUX A;  4DDS A;  3KX0 X;  5CTN A;  5E2H A;  4EUV A;  3MBZ A;  4ETZ A;  5J8X A;  1IKI A;  1G5U A;  4LRZ E;  3T1X A;  3HUO A;  5AVF A;  4FUW A;  3CZD A;  4LV0 A;  4ZJ1 A;  4WZ5 C;  3GR2 A;  2BTF P;  3R7W A;  4CLC A;  3CUE C;  5KMW A;  1S0W A;  4HH3 A;  2M7V A;  4HBT A;  2XQZ A;  2WK0 A;  4R3B A;  3TRC A;  2X01 A;  2HGV A;  1HD8 A;  2PD7 A;  2Y4A A;  2E8J A;  3K3D A;  2X71 A;  2JKR I;  3WRZ A;  2PDR A;  2V8F A;  2C6W B;  3MQ0 A;  4JBF A;  1LI9 A;  3D4F A;  2ZQ7 A;  1KGG A;  3ISG A;  3BFE A;  2Y2H A;  3S7P A;  1K54 A;  2WYX A;  1BLP A;  2ZL1 B;  3FV7 A;  3IXB A;  4DE3 A;  3UB6 A;  2VV8 A;  3QP8 A;  5F68 A;  4NG2 A;  3OPP A;  5AQA A;  3LYX A;  1NZU A;  2JKR M;  5M19 A;  3FPW A;  1ERO A;  2WUQ A;  1ES2 A;  1MKM A;  5TBM B;  1DP8 A;  2A49 A;  4X6T A;  3VSK A;  4U0T A;  2HDQ A;  4JF5 A;  3FKV A;  1SHV A;  3DWZ A;  4OH0 A;  2EX8 A;  1BSG A;  1H8Y A;  2P9V A;  4HEF A;  4IUK A;  2IA2 A;  5FQQ A;  3SS4 A;  5MC7 A;  5KSH A;  4S2P A;  3C5A A;  3MR0 A;  2XLN A;  5DFY A;  2ZM8 A;  4JGQ A;  5GHY A;  1T1C A;  1LHY A;  1FQG A;  2EFX A;  2ZQ9 A;  1YT4 A;  1I5Q A;  4KQD A;  5EEC A;  5AVE A;  2Y2I A;  3VSL A;  4D2O A;  3HJI A;  4GKU A;  3D9Y A;  2Y2P A;  3IX8 A;  1YM1 A;  2L1M A;  3H9W A;  3CPT A;  4CLC E;  3G35 A;  4PAU A;  3IHB A;  1OT6 A;  3RTY A;  1OTE A;  1NJ4 A;  2DRW A;  2D02 A;  3BLM A;  3IS2 A;  3ZNT A;  1XXM A;  3BEC A;  4EEP A;  3L7H A;  4OOL A;  4N9K A;  4X53 A;  2A2L A;  4S2J A;  4B88 A;  2OSU A;  1N4O A;  3B33 A;  5M1A A;  2Y91 A;  5FEF A;  3A3I A;  3LR5 A;  3NI9 A;  4L9E A;  5GL9 A;  3MFX A;  3UDX A;  3A3J A;  1OTI A;  3SS5 A;  4OQ0 A;  1TD5 A;  1JNU A;  5HSQ A;  1TS6 A;  3CHW P;  1MWR A;  3C38 A;  2WZZ A;  3EQV A;  4OP5 A;  5F1G A;  1KOU A;  2FH5 A;  4K91 A;  4MCW A;  4LRX C;  5HD3 A;  4DE0 A;  2J80 A;  3OC2 A;  1PRQ A;  5DTK A;  3KYQ A;  5EPH A;  3G4P A;  3Q7V B;  1L0G A;  2DMW A;  3M2K A;  5EVI C;  1VEU B;  4KG2 A;  3LR3 A;  4OKP A;  3WS1 A;  1S66 L;  1HVB A;  4PPR A;  2BLS A;  1IFQ A;  2ZOI A;  4WUJ A;  2OOL A;  3BJN A;  4Y0T A;  2IWC A;  5HAR A;  1S67 L;  1YLT A;  2VGL M;  2AVX A;  1O7E A;  4GNU A;  1K6S A;  2NUP C;  1AXB A;  1GHM A;  5EVL A;  1YLY A;  3QP6 A;  4FSF A;  3G31 A;  5IHV A;  3NEC A;  3IT9 A;  5J3W A;  1OME A;  1GA9 A;  1TDL A;  5HL6 A;  2ZC5 B;  1TF1 A;  3ZDJ A;  5CGS A;  3LR4 A;  1X0O A;  5EVI B;  2ZMA A;  4PM7 A;  3LIA A;  3BFC A;  3D3O A;  4E6W A;  5FDH A;  1XX2 A;  1H3Q A;  3KYZ A;  2HP9 A;  3N8L A;  4II7 A;  4JGR A;  3QP2 A;  2Y2M A;  2W1T B;  1DY6 A;  5F6A A;  2B5R A;  4X25 A;  4E3M A;  4X55 A;  1D06 A;  5IT5 A;  1FR1 A;  3A0V A;  1W63 M;  1VM1 A;  1P0Z A;  4NK3 A;  1JTG A;  4S2L A;  1T1A A;  3NOP C;  2OLV A;  3HLB A;  3TW8 A;  5BOH A;  2BG1 A;  3M2J A;  2EWV A;  3MQQ A;  4RX2 A;  3MZF A;  4I38 A;  1ONG A;  1KE0 A;  3C4P A;  4KZ9 A;  5J7E A;  3IF6 B;  4BD1 A;  2NUT C;  4LV2 A;  3IH8 A;  4E3N A;  5A91 A;  1E4D A;  3DWK A;  2ZM2 A;  2PU2 A;  2WGI A;  4OQG A;  2FZ0 A;  1KVL A;  3VP0 A;  2GNX A;  1JVJ A;  3MXS A;  5CED A;  1XKZ A;  5CER A;  2G2U A;  2GDN A;  4HY8 A;  1YMX A;  2P7J A;  2VV6 A;  2Q0O A;  3HLC A;  3P7N A;  2QHK A;  4WLA A;  4OPQ A;  4DF6 A;  2G7U A;  3N4I A;  3EGX C;  3LID A;  2EWW A;  4BL3 A;  1KDS A;  2R78 A;  1MWU A;  4GLQ A;  1BYW A;  1PZO A;  3NHQ A;  1S1Y A;  4Y15 A;  1F9I A;  2HDS A;  4X1L A;  3HCY A;  3ZGA B;  5EV0 A;  2PYR A;  3SZT A;  1ZC2 A;  4BMW A;  2J8Y A;  1K55 C;  5CX7 A;  3HVF A;  3E0Y A;  2RL3 A;  4LV1 A;  3DW0 A;  3O5Y A;  4ZJ2 A;  4UA6 A;  3PTE A;  1Y54 A;  1OTA A;  3V5M A;  4EBN A;  5FAO A;  1CF0 A;  1A0K A;  1FIK A;  2H0T A;  4M4X A;  3VP1 A;  5C5K A;  3FKW A;  4ZRR A;  4EER A;  4IVK A;  4ZBE A;  4ESP A;  1XJ2 A;  5TGF A;  3NDE A;  3NJA A;  2QMI A;  3OPL A;  3OLO A;  2EX9 A;  4FOF A;  2W1T A;  1FSW A;  2FFF B;  2Y2G A;  4KUO A;  1DJB A;  2ZOH A;  4I5S A;  1NLY A;  1BLS A;  3PBN A;  4M3K A;  2HP5 A;  4I3A A;  3ITA A;  1O07 A;  3BY9 A;  4B4X A;  3VOY A;  1IYP A;  1JWV A;  2Y2K A;  4LV3 A;  4PM9 A;  4Q0H A;  3A3D A;  1YAX A;  4MN7 A;  4U0X A;  5TBM A;  2J7V A;  1P9W A;  2A3U A;  4R23 A;  1NRJ A;  3H7W A;  4JKT A;  4IUH A;  5CHM A;  3IBJ A;  1M40 A;  2K31 A;  4QY5 A;  4JGP A;  4UAA A;  3F1O A;  4E3I A;  3H7W B;  5FQK A;  3G2Y A;  5L2F A;  2PHY A;  5EM1 A;  4S2I A;  3UE6 A;  4WEK A;  1ERQ A;  4EU0 A;  3PAE A;  1GHP A;  2PRF A;  4I3J A;  4LGW A;  4WBG A;  4QJG A;  1VEU A;  2B18 A;  4JPM A;  4PM5 A;  3Q7Z A;  2KX6 A;  1ZG6 A;  2ZBB A;  2M1C A;  4MNR A;  2P08 A;  1PWG A;  4MBK A;  4YIN A;  5EOO A;  3NY4 A;  4KG5 A;  4NXB A;  4KZ5 A;  3PBT A;  1MKI A;  3ZVW A;  3UPP A;  5DF8 A;  4OON A;  3WRT A;  1OJ5 A;  1F2K A;  5L10 A;  3PHY A;  3NBL A;  1V9Y A;  3QNC A;  3CLO A;  2JN7 A;  4YNR A;  4S2N C;  4ZDX A;  3BY8 A;  1ESU A;  4G3W A;  5KSC A;  1E3U D;  1Y4O A;  3ZFZ A;  4FH2 A;  3IS2 B;  1L2S A;  2R9X A;  5G4Z A;  3HRE A;  2UWX A;  1LSW A;  3UPN A;  3IXH A;  1TDG A;  5CGX A;  2ZMF A;  5M18 A;  3ZVT A;  5JYP A;  3E2L A;  2VGL S;  3BQ8 A;  4KUK A;  2HF6 A;  3TE8 A;  2INW A;  1L0E A;  2OAP 1;  3T4L A;  3L9K A;  4X68 A;  3HL9 A;  4LEN A;  4HNB A;  2XRO A;  1IEM A;  1MC0 A;  3IHA A;  5HDS A;  3B42 A;  3QP1 A;  2VKS A;  3KSH A;  3SW1 A;  3IWI A;  4R4R A;  1NY0 A;  2W3H A;  2G2W A;  2WKP A;  4C6Y A;  4UA9 A;  2J3W A;  3LIC A;  2JE5 A;  3MXR A;  1XJ6 A;  4IHQ A;  2Z6C A;  2P74 A;  3G32 A;  3UMD A;  3W8K A;  3MXQ A;  5GLB A;  3W2Z A;  2PT7 A;  3MJQ A;  3W4P A;  3ZG8 B;  5HWW A;  3EEH A;  2ZC4 B;  1ONH A;  3LY4 A;  3C2W A;  5AQ9 A;  4OPY A;  1ZG4 A;  3HLD A;  4DKI A;  4OPZ A;  3MZE A;  4R0Q A;  4K08 A;  2XD5 A;  3C30 A;  3UDI A;  1T19 A;  4PMA A;  2ZQC A;  2BAS A;  5E2E A;  2PAV P;  1OTB A;  1FOF A;  1XP4 A;  2K2N A;  5DFX A;  1PI4 A;  2JKF A;  2W3E A;  2JCH A;  4EV4 A;  4Q0I A;  2QZ6 A;  2CMN A;  3CWF A;  1LL5 A;  2EA9 A;  2XA7 S;  1MBL A;  3GEC A;  1PI5 A;  2VLG A;  3F1N B;  5HD5 A;  1W79 A;  2QJ7 A;  4IBR A;  1KGF A;  4IJG A;  4OLG A;  3S4X A;  5CXW A;  2DNS A;  2VA0 A;  3T4J A;  1SKO B;  3WS4 A;  4OVD A;  3ZNY A;  1KDW A;  3LGO A;  1SKF A;  4YFM A;  4LFU A;  2O99 A;  1K38 A;  2O0Y A;  1IYS A;  1S6R A;  3ZG9 B;  3S7Q A;  1XJ4 A;  1XGI A;  1SKO A;  3G2Z A;  4QWO A;  3Q1F A;  1V9Z A;  3C7U A;  3VFH A;  2IWD A;  3LFV A;  4QU3 A;  1K25 A;  1OTD A;  4OOY A;  5FI2 A;  3M6B A;  1OJG A;  3NOT C;  2H0Y A;  1SDE A;  3NCK A;  4S2N A;  4EW7 A;  4N9L A;  5U47 A;  4Q8I A;  1U60 A;  4NXF A;  4BEN A;  5I94 A;  3GSG A;  2UV0 E;  4CLC C;  3A0R A;  5IU1 A;  5FEG A;  1KGE A;  2GZA A;  3UB9 A;  4WYY A;  4HHD A;  4CJN A;  2ZJ9 A;  5EUA A;  4GCZ A;  4E3L A;  2HDU A;  2H10 A;  2V8C A;  3IWO A;  1Q2P A;  2XDM A;  3SS3 A;  2Q9N A;  1FCN A;  3GV9 A;  1T1B A;  3T4K A;  4O8G A;  3F1P B;  4FTX A;  1N9O A;  3N8R A;  2QWS A;  4KQO A;  3VV4 A;  1M6K A;  4Y0O A;  2B02 A;  5FSR A;  5FAP A;  4MMN A;  2CC1 A;  5EVE A;  3CMZ A;  3UB8 A;  3GVB A;  3TOI A;  3EOI A;  1YMS A;  5F82 A;  1DJC A;  2O9C A;  2J3T D;  1W7F A;  2WKE A;  3MMH A;  2HZ5 A;  2WGV A;  5EFW A;  1KE4 A;  1VET B;  2H5S A;  4E3K A;  4GS9 B;  3E4P A;  4S2M A;  4N1H A;  1FSY A;  3SOI A;  3S1Y A;  3ZG0 A;  3WS0 A;  4HOI A;  3BLS A;  3O86 A;  1MXO A;  2Y2L A;  4HP4 A;  4OLD A;  4L9G A;  4BWI A;  1RP5 A;  2XH9 A;  1CI9 A;  2QPN A;  3K2N A;  3LR0 A;  4CPK A;  4K0X A;  1CQA A;  4BLM A;  5CEC A;  3HLE A;  3FG8 A;  1K57 C;  4C3Q A;  1ES4 A;  1NRF A;  3MKE A;  3UPO A;  1H0M A;  3BFD A;  3QP5 A;  4XXR A;  2XFT A;  1NYY A;  4ID4 A;  2W3F A;  1ESI A;  4BBV A;  5FL3 A;  3DAV A;  4MDZ A;  3V39 A;  4YWZ A;  3KSG A;  2VV7 A;  4HES A;  5DTS A;  1NXY A;  4HJ4 A;  3ULF A;  4HJ6 A;  3G30 A;  5AQ7 A;  3VP4 A;  5CHJ A;  1YLZ A;  4KZ4 A;  1WA9 A;  1NLZ A;  3H82 B;  3C8C A;  2HV1 A;  2ZQD A;  4I39 A;  3EEA A;  1K6R A;  3V67 A;  2OV5 A;  3N7W A;  1W8Q A;  2WZX A;  4GHI B;  3VE4 A;  1Q2Q A;  1YLW A;  3T1S A;  1XA7 A;  2WGW A;  3LIF A;  2ZQ8 A;  4EBP A;  5FDS A;  1YLP A;  1F5M A;  1D7E A;  1TS7 A;  4D60 A;  2R9W A;  4PKY G;  3SH7 A;  1N9N A;  3NIA A;  1VHM A;  5HW3 A;  4S2O A;  3UE3 A;  1EWZ A;  4PM6 A;  1QME A;  1YQS A;  3F1P A;  3IBR A;  4HQA A;  2OWJ A;  2J9O A;  3W4O A;  2HP6 A;  1K55 A;  4JGO A;  4S2K A;  4DXB A;  4MBF A; 
#chains in the Genus database with same CATH homology
 3BFE A;  1CEF A;  2EFU A;  1K54 A;  2WYX A;  3ZG7 B;  1BLP A;  3JYI A;  4JPM A;  3UNW A;  3FV7 A;  3IXB A;  1PZP A;  4DE3 A;  4PM5 A;  3Q7Z A;  3IQA A;  4RA7 A;  4C75 A;  4WEL A;  4P85 A;  3LO7 A;  1ZG6 A;  3OPP A;  5AQA A;  2XR0 A;  1NZU A;  3OZH A;  4MNR A;  1PWG A;  4KEN B;  5M19 A;  1NZO A;  3A3E A;  4MBK A;  4YIN A;  4E3J A;  4ZTK A;  1ERO A;  4A5R A;  4X69 A;  2WUQ A;  4EWF A;  4DDY A;  3Q07 A;  5EOO A;  3HUN A;  4N1X A;  5CHU A;  1ES2 A;  2XEP A;  3NY4 A;  4KG5 A;  4UA7 A;  1I2W A;  3UO9 A;  3M6H A;  1MY8 A;  2A49 A;  4X6T A;  4KZ5 A;  2XF3 A;  3PBT A;  1KVM A;  3VSK A;  4U0T A;  2WGW B;  1MKI A;  2HDQ A;  3ZVW A;  2EXA A;  4JF5 A;  3FKV A;  3UPP A;  3BFF A;  5DF8 A;  4OON A;  3VOZ A;  1SHV A;  3DWZ A;  4OH0 A;  5A93 A;  2EX8 A;  1BSG A;  3WRT A;  1H8Y A;  2P9V A;  4HEF A;  3GRJ A;  5FQQ A;  3SS4 A;  5KSH A;  3Q82 A;  5DF7 A;  4E3O A;  4S2P A;  4ZAM A;  3NBL A;  3QNC A;  4JF6 A;  4PM8 A;  3C5A A;  4DXB A;  1L0D A;  5GHZ A;  3BM6 A;  4S2N C;  1W5D A;  2XLN A;  3V50 A;  4ZDX A;  2ZM8 A;  5GLD A;  1ESU A;  2WAD A;  2J9P A;  2Z2L B;  3PBQ A;  3PAG A;  5GHY A;  3VP2 A;  4OQH A;  1NYM A;  5KSC A;  3BRM A;  1E3U D;  3ZFZ A;  4FH2 A;  1LHY A;  1K4E A;  1L2S A;  2R9X A;  1FQG A;  2ZQ9 A;  2EFX A;  1I5Q A;  1BTL A;  1YT4 A;  5EEC A;  2ZC7 A;  3HRE A;  2Y2I A;  2UWX A;  4R1G A;  3VSL A;  4D2O A;  2PU4 A;  3UPN A;  2XK1 A;  5D3O A;  1K56 A;  3IXH A;  5A92 A;  1TDG A;  4GKU A;  2WKH A;  5CGX A;  5M18 A;  2Y2P A;  3ZVT A;  5JYP A;  1YM1 A;  1HZO A;  3E2L A;  5KZH A;  3G35 A;  3IHB A;  3I7J A;  3VFF A;  1L0E A;  4X68 A;  3O87 A;  4B4Z A;  3HL9 A;  1NJ4 A;  2DRW A;  4KZ7 A;  4IVI A;  4LEN A;  3VP3 A;  4EUZ A;  3BLM A;  1IEM A;  3RXX A;  3ZNT A;  3VMA A;  1XXM A;  3BEC A;  4OOL A;  1GA0 A;  4KZ8 A;  3IF6 C;  3IHA A;  3AGF A;  3UE0 A;  4N9K A;  4X53 A;  5G18 A;  5EVI D;  4S2J A;  4B88 A;  3PBR A;  2OSU A;  1QMF A;  1N4O A;  4QHC A;  2I72 A;  1ZKJ A;  3IWI A;  4OPR A;  4R4R A;  1NY0 A;  5M1A A;  1SCW A;  2Q9M A;  2Y91 A;  4NET A;  4LCL A;  3ZCZ A;  3A3I A;  2G2W A;  4C6Y A;  3NI9 A;  4UA9 A;  5GL9 A;  1ES3 A;  3UDX A;  3A3J A;  3SS5 A;  2JE5 A;  4FH4 A;  4OQ0 A;  3O3V A;  3MXR A;  2RCX A;  1G68 A;  5FAT A;  1J9M A;  1PWC A;  5DVA A;  2P74 A;  1GHI A;  3G32 A;  3HBR A;  3WS5 A;  3PBS A;  3W8K A;  1MWR A;  5GLB A;  3IF5 A;  2WZZ A;  3W4P A;  3EQV A;  3QHY A;  4OP5 A;  5F1G A;  1JWZ A;  4K91 A;  1GCE A;  3ZG8 B;  4RYE A;  2ZC4 B;  3P98 A;  4BL2 A;  1ONH A;  4DE0 A;  2ZC6 B;  3LY4 A;  1Z6F A;  3OC2 A;  5AQ9 A;  2FFY A;  4OPY A;  5FQJ A;  4DRT A;  1ZG4 A;  3HLD A;  4JXV A;  2VGJ A;  4DKI A;  5DTK A;  4OPZ A;  3MZE A;  4OQI A;  3HUM A;  3P09 A;  4R0Q A;  5EPH A;  3GTC A;  1E3U A;  2XD5 A;  4BD0 A;  3AGE A;  3G4P A;  1MWT A;  3Q7V B;  2Y2N A;  5HX9 A;  3UDI A;  4U3T A;  1L0G A;  4N92 A;  2V20 A;  4PMA A;  2ZQC A;  4IED A;  3HLW A;  4FCF A;  5E2E A;  3NDG A;  1FOF A;  3M2K A;  3NC8 A;  5EVI C;  1XP4 A;  4Y7P A;  2Y55 A;  5EE8 A;  1K56 D;  4KG2 A;  1BT5 A;  1E25 A;  4OKP A;  3WS1 A;  1PI4 A;  2ZD8 A;  1BUE A;  1HVB A;  2JCH A;  4PPR A;  1PWD A;  4EV4 A;  2BLS A;  1VQQ A;  2QZ6 A;  3MKF A;  4GD6 A;  4DE2 A;  3PBO A;  1LL5 A;  4Y0T A;  1MBL A;  2IWC A;  3CJM A;  1H5X A;  5HAR A;  1CI8 A;  1PI5 A;  1IYO A;  5FQ9 A;  3TSG A;  3IWQ A;  3O88 A;  1YLT A;  4JLF A;  2ZC3 B;  5CRF A;  1O7E A;  3RXW A;  4GNU A;  1W79 A;  3LCE A;  4IBR A;  1K6S A;  1AXB A;  1KGF A;  1LLB A;  1GHM A;  3RJU A;  5EVL A;  1YLY A;  3IF6 A;  4OLG A;  4GN2 A;  4FSF A;  4R3J A;  5CXW A;  3S4X A;  2DNS A;  3G31 A;  4MBH A;  5IHV A;  3B3X A;  3IT9 A;  5E43 A;  4BJP A;  2P9V B;  3QNB A;  1OME A;  3WS4 A;  4OVD A;  3ZNY A;  1KDW A;  3ITB A;  1SKF A;  4YFM A;  1GA9 A;  1TDL A;  3UN7 A;  1K38 A;  2ZC5 B;  1N9B A;  2EXB A;  1IYS A;  1S6R A;  1W8Y A;  5FI6 A;  5F1F A;  1ERM A;  3GMW A;  3ZG9 B;  3ZDJ A;  3EQU A;  5CGS A;  1L0F A;  5EVI B;  1XGI A;  2ZMA A;  4PM7 A;  3G2Z A;  1FCO A;  1HTZ A;  1PW8 A;  3BFC A;  3Q1F A;  5FQM A;  3SH9 A;  2EX2 A;  1LL9 A;  4KQQ A;  5GLA A;  4E6W A;  5FDH A;  3C7U A;  2WAE A;  3VFH A;  2IWD A;  5HAQ A;  1BLC A;  4QU3 A;  1XX2 A;  1WYB A;  1K25 A;  5FAS A;  2HP9 A;  3N8L A;  3FWL A;  3G34 A;  2XD1 A;  5CTM A;  1FCM A;  4OOY A;  5FI2 A;  2Y2M A;  1DY6 A;  2DCF A;  2PBY A;  3M6B A;  4GOG A;  5FAQ A;  4DXC A;  2H0Y A;  1SDE A;  2B5R A;  5JYO A;  5TFQ A;  3ZHH A;  4E3M A;  4OOM A;  4FD8 A;  3N8S A;  3NCK A;  3C7V A;  4X55 A;  4GD8 A;  1FR1 A;  3HLG A;  3OCN A;  4S2N A;  5EVI A;  4N9L A;  1CEG A;  5U47 A;  4Q8I A;  3LY3 A;  2Y2J A;  1TVF A;  3N6I A;  1MPL A;  1VM1 A;  1U60 A;  4BEN A;  5I94 A;  4NK3 A;  3FYZ A;  3GSG A;  1JTG A;  2XGN A;  4S2L A;  5AQB A;  5HL1 A;  2OLV A;  3HLB A;  5FQI A;  1RCJ A;  3MFD A;  5CGW A;  5BOH A;  1KGE A;  2BG1 A;  3M2J A;  4LCM A;  4WZ4 A;  4RX2 A;  3MZF A;  4WYY A;  2V1Z A;  4K0W A;  4WEJ A;  3ISG A;  1ONG A;  1KE0 A;  5DTT A;  4CJN A;  1FR6 A;  3C4P A;  3Q7V A;  3GQZ A;  4KZ9 A;  2ZJ9 A;  1KE3 A;  3IF6 B;  1BZA A;  3MZD A;  4P0M A;  5EUA A;  5E2F A;  4BD1 A;  4JF4 A;  1RGY A;  2ZQA A;  4LV2 A;  2HDU A;  2H10 A;  3IH8 A;  4E3N A;  4QD4 A;  3V3S A;  5A91 A;  4E3L A;  3IXG A;  1E4D A;  3IWO A;  1G6A A;  4KZB A;  3BYD A;  1WYC A;  3DWK A;  1Q2P A;  2XDM A;  3SS3 A;  4JXG A;  2Q9N A;  1FCN A;  2ZM2 A;  4EQI A;  5FA7 A;  3GV9 A;  2PU2 A;  2WGI A;  4OQG A;  4QB8 A;  3SH8 A;  1KVL A;  3VP0 A;  1IKG A;  2JC7 A;  1JVJ A;  2HPB A;  2ZM0 A;  3MXS A;  5CED A;  1RGZ A;  3N8R A;  4KQO A;  1XKZ A;  1TEM A;  5CER A;  1K54 C;  2IWB A;  1M6K A;  2G2U A;  3S22 A;  1XPB A;  2GDN A;  2V2F F;  4Y0O A;  4R4S A;  1PIO A;  1YMX A;  1EI5 A;  3E2K A;  2Z2M B;  5FSR A;  5FAP A;  3HLC A;  3UDF A;  2CC1 A;  1DJA A;  3CMZ A;  4OPQ A;  1C3B A;  4DF6 A;  3N4I A;  5HAP A;  2E8I A;  3GVB A;  3TOI A;  1JWP A;  1IYQ A;  4BQM A;  1YMS A;  5F82 A;  1DJC A;  4EBL A;  1W7F A;  2WKE A;  4BL3 A;  1KDS A;  4IBX A;  4ZJ3 A;  1MWU A;  4GDB A;  1PZO A;  2WGV A;  1ALQ A;  1KE4 A;  4P87 A;  2HDS A;  4WM9 A;  3FZC A;  2H5S A;  3OPR A;  3ZGA B;  3BEB A;  4E3K A;  1K4F A;  2C5W B;  1K57 A;  4KQR A;  2WAF A;  4X56 A;  1PW1 A;  4S2M A;  4O7D A;  1ZC2 A;  4N1H A;  1FSY A;  2J8Y A;  1K55 C;  3SOI A;  2ZLY A;  3S1Y A;  1WE4 A;  3ZG0 A;  3HLF A;  4QY6 A;  3W4Q A;  1BLH A;  3WS0 A;  1IEL A;  3LEZ A;  3BLS A;  3O86 A;  1XA1 A;  3HVF A;  3AGD A;  2Y59 A;  2RL3 A;  3TG9 A;  4LV1 A;  4H8R A;  2Y2L A;  1MXO A;  3DW0 A;  3BFG A;  4OLD A;  3DTM A;  3OPH A;  3WS2 A;  1I2S A;  1RP5 A;  5EOE A;  2XH9 A;  4ZJ2 A;  4MLL A;  3IXD A;  4UA6 A;  2JBF A;  3PTE A;  1Y54 A;  4GB7 A;  5TR7 A;  1CI9 A;  5E2G A;  2QPN A;  3IH9 A;  3V3R A;  3A3F A;  4CPK A;  1CK3 A;  3V5M A;  2X02 A;  3ZG5 A;  1BUL A;  4K0X A;  4BLM A;  5CEC A;  3HLE A;  4EBN A;  4WZ5 A;  5FAO A;  1K57 C;  4Y0U A;  1ES4 A;  1NRF A;  4C3Q A;  3MKE A;  3WWX A;  3UPO A;  4WMC D;  3BFD A;  4XXR A;  2XFT A;  4RVA A;  1NYY A;  2HDR A;  4OP8 A;  4ID4 A;  4KZ3 A;  2OLU A;  4GDN A;  2H0T A;  3UY6 A;  2Y2Q A;  3VP1 A;  1MWS A;  1ESI A;  3FKW A;  4HBU A;  2EX6 A;  1XGJ A;  5A90 A;  4WMC A;  2VGK A;  4F94 A;  4IVK A;  4ZBE A;  5HAI A;  3UE1 A;  1JTD A;  1PYY A;  3V39 A;  5TGF A;  3OCL A;  4P6B A;  3NDE A;  4RX3 A;  1SDN A;  2QMI A;  3OPL A;  4MEZ A;  2EX9 A;  4HES A;  5DTS A;  1YLJ A;  4UHU A;  1NXY A;  5GLC A;  4L0L A;  3G30 A;  1FSW A;  5AQ7 A;  3VP4 A;  4DE1 A;  2FFF B;  5CHJ A;  2Y2G A;  1YLZ A;  4KZ4 A;  4Z9Q A;  1DJB A;  4XUX A;  4DDS A;  1BLS A;  3PBN A;  4M3K A;  5CTN A;  5E2H A;  5CEB A;  2HP5 A;  4JXW A;  3ITA A;  3MBZ A;  1O07 A;  2ZQD A;  4XUZ A;  1K6R A;  4B4X A;  2OV5 A;  3N7W A;  3VOY A;  1W8Q A;  5J8X A;  2WZX A;  1IYP A;  1Q2Q A;  2WKI A;  1JWV A;  1IKI A;  1YLW A;  2Y2K A;  4JXS A;  1XA7 A;  4LV3 A;  4PM9 A;  2WGW A;  4KZA A;  2ZQ8 A;  4EBP A;  3A3D A;  3Q81 A;  3C4O A;  5DF9 A;  4KZ6 A;  3HUO A;  2Y2O A;  4E6X A;  3CG5 A;  5FI7 A;  1YLP A;  3CZD A;  4LV0 A;  4ZJ1 A;  4U0X A;  2R9W A;  3SH7 A;  4WZ5 C;  2J7V A;  2A3U A;  4R23 A;  1ES5 A;  3GR2 A;  3NIA A;  4JKT A;  5KMW A;  1S0W A;  4HBT A;  5HW3 A;  2XQZ A;  1LI0 A;  5CHM A;  2WK0 A;  4R3B A;  4S2O A;  1EWZ A;  3UE3 A;  1M40 A;  4QY5 A;  4UAA A;  4PM6 A;  1QME A;  1YQS A;  2X01 A;  4E3I A;  5HFO A;  1HD8 A;  2Y4A A;  5FQK A;  2X71 A;  4GZB A;  3G2Y A;  5GHX A;  5L2F A;  3WRZ A;  2XFS A;  2C6W B;  2J9O A;  4S2I A;  3W4O A;  1ERQ A;  1H8Z A;  4JBF A;  4KG6 A;  3PAE A;  1GHP A;  4WEK A;  1LI9 A;  3D4F A;  4WBG A;  2HP6 A;  1K55 A;  2ZQ7 A;  4S2K A;  5F83 A;  4QJG A;  1KGG A;  4MBF A;  2Y2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...