4XXRA

Atomic resolution x-ray crystal structure of a ruthenocene conjugated beta-lactam antibiotic in complex with ctx-m-14 e166a beta-lactamase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTAPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibacterial properties and atomic resolution X-ray complex crystal structure of a ruthenocene conjugated beta-lactam antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
molecule keywords CTX-M-14 Class A Beta-Lactamase
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4xxrA00
1K56A 5FQ9A 1PIOA 1E3UD 1KVLA 1WE4A 2JE5A 3CZDA 5L2FA 1YT4A 5GL9A 2ZLYA 4IBRA 4S2PA 4KZBA 4WBGA 5DF8A 5FAQA 3O86A 3HLWA 3LO7A 1I5QA 3N8RA 3O3VA 4P6BA 1TVFA 3WRZA 4WZ5C 1K55C 2ZC7A 4KZAA 1ALQA 4KZ7A 4JBFA 1M40A 3GV9A 4PM9A 4B4XA 1K55A 1L0FA 5KSHA 1BZAA 2JBFA 3QHYA 5EOOA 2H0YA 4UA7A 3A3DA 5F82A 2Y55A 2ZC3B 4DE3A 4WMCA 4LV0A 1PWGA 4YINA 5FAPA 3NI9A 1JTGA 3NBLA 1W7FA 3FV7A 1PWCA 5E2HA 1E3UA 1LHYA 2PBYA 1MBLA 3OPPA 4PM7A 4E3OA 1FCOA 4EBPA 4S2NC 3MXRA 4KQRA 2OV5A 2ZQCA 3ZHHA 3G32A 5E2GA 1EROA 3RJUA 3S1YA 4OQIA 2IWCA 4MBHA 4HBTA 5EE8A 3C5AA 5F1FA 1NYMA 4OVDA 1W79A 4XUZA 5D3OA 3DTMA 4RYEA 4O7DA 3SS4A 3HLGA 3BLMA 3N6IA 1XGJA 4WEKA 1KVMA 3VP4A 1GHMA 2R9XA 4X56A 4DE1A 5JYPA 1YLYA 3VP1A 2XGNA 4GN2A 4QY5A 4B88A 3A3IA 4H8RA 2A3UA 3NCKA 5EVIA 4E6WA 2FFYA 1BLSA 4X6TA 4WZ4A 3W4OA 3WS0A 2WAEA 4E3LA 4UA9A 3G2ZA 2J9PA 1VM1A 5HW3A 5FQJA 1YLWA 3GR2A 5E43A 2XLNA 3BECA 3IXHA 1L0EA 3LY4A 5FI6A 3CJMA 4QD4A 1C3BA 2JCHA 2DNSA 4KG5A 3ZFZA 3N8SA 1IYOA 5M19A 4R23A 3N8LA 3WWXA 1GA9A 4JF5A 4X68A 3ISGA 2HDRA 2Y2PA 4N92A 5FQIA 1FSYA 3UDFA 1I2WA 5GLBA 1NXYA 1LI9A 2G2UA 2Y2LA 4DDYA 1MWRA 3ZNYA 2ZQDA 4JXWA 4OPRA 5TR7A 4F94A 1KE3A 2IWBA 4PM8A 4Z9QA 3DW0A 2ZC4B 1LL5A 3DWZA 1KGEA 3LY3A 3MZFA 3VOYA 4OP5A 3C4OA 3ITBA 1PW8A 5DF9A 3ZG0A 1K54A 1MXOA 3UE1A 2Y2QA 1J9MA 4OQHA 4Y0UA 3O87A 1BLHA 4S2OA 3ZCZA 2ZD8A 1W8YA 1RGYA 4QHCA 3ZGAB 1XXMA 1Q2QA 3MZEA 3PAGA 1H8YA 3IHBA 4Y7PA 3E2LA 4KQQA 1PZOA 3A3EA 3FWLA 3HUOA 3N4IA 1K4EA 4X55A 4R1GA 4OOYA 3RXXA 3GRJA 2Y4AA 4KZ8A 5FQMA 5CEDA 5JYOA 4WELA 3N7WA 4BL2A 3EQUA 3V50A 1DJAA 3SS3A 1XGIA 2OLUA 4PMAA 1SCWA 4E3MA 3BEBA 1NY0A 3AGDA 1K56D 1JTDA 2WAFA 3JYIA 1JVJA 2ZM8A 4P87A 4ZTKA 4S2LA 2V2FF 1SHVA 4LENA 1OMEA 5GHXA 1LI0A 4EV4A 1JWPA 1NZUA 3WS5A 5CHUA 4Y0TA 4BENA 2EXAA 4BJPA 3UPOA 1AXBA 1MWUA 2EX9A 4OOLA 4OP8A 5TGFA 5BOHA 3PTEA 4R3JA 2C6WB 1E4DA 1ES4A 4HEFA 5EVLA 1LL9A 4ZAMA 2Y2OA 1MKIA 3NDEA 4GDNA 2X71A 1BLPA 4LV1A 4NETA 1PWDA 4C75A 2XK1A 4FD8A 2EXBA 2P9VA 3FYZA 5AQBA 4FCFA 4Q8IA 3ZDJA 1DY6A 4R3BA 4E3JA 3UE0A 1DJCA 3Q07A 4WMCD 3ZG7B 3HLFA 1K57A 1K4FA 2ZJ9A 2ZQ9A 5FI7A 1NRFA 4QY6A 4UA6A 2J7VA 3MZDA 4KG2A 1K6SA 1TEMA 3HLDA 4R4RA 5IHVA 3PBNA 4HESA 2OLVA 5FSRA 1NYYA 1IEMA 1ES2A 2QPNA 1MWSA 3GVBA 5E2FA 4DE2A 3G30A 3TOIA 3HLCA 2WYXA 3I7JA 3MKFA 4PM6A 4KZ3A 3ZNTA 2WZZA 2DRWA 2Q9NA 4XUXA 5CGSA 3WS4A 2GDNA 2X02A 3HBRA 4MEZA 4OLGA 4E3IA 4JXSA 2IWDA 4E6XA 3OPRA 1EI5A 2FFFB 5HX9A 1G68A 1NZOA 3IHAA 3VFHA 2Y2NA 3BRMA 3SH9A 1ONGA 3P09A 5FDHA 4QJGA 2XFTA 3VP2A 1M6KA 5GLDA 3TG9A 3C7UA 4FH4A 1ERQA 2Y2IA 5FQKA 5AQAA 2ZQ7A 5CTNA 3VP3A 3IT9A 2HPBA 4D2OA 1L2SA 5HAIA 2WZXA 4WYYA 2DCFA 3UY6A 4GD6A 4EQIA 4LCLA 5HAPA 5A92A 3BFCA 2UWXA 4S2NA 1W5DA 3GTCA 2WUQA 3OCNA 4JXGA 4LV3A 2WKIA 4GDBA 1IKIA 4OPZA 4UAAA 1TDGA 2G2WA 3IXDA 1PI4A 3C7VA 2H5SA 3BFFA 2ZM0A 2WGWB 4N9LA 1H5XA 4FH2A 4K0WA 4WEJA 5EECA 2Y2MA 3BM6A 2E8IA 3WS2A 1QMEA 5GHZA 3S22A 5HFOA 3RXWA 1SKFA 3V3RA 2XFSA 1E25A 4OQGA 1FSWA 1H8ZA 5CHMA 3Q7VB 2C5WB 2XF3A 1PW1A 3IF6B 2XD5A 5EOEA 3HREA 1RGZA 3IF5A 4EWFA 1XA1A 2Y2HA 1GCEA 4MBFA 4FSFA 3PBOA 1XPBA 1HZOA 4GOGA 2HDQA 4QU3A 1KE0A 4GKUA 4MBKA 3S4XA 2J8YA 4BD1A 1I2SA 4EUZA 4OONA 3B3XA 4JLFA 2Y59A 1HTZA 1MWTA 4S2JA 3OZHA 1KE4A 2HP5A 3MXSA 2Z2MB 2VGJA 1BT5A 1PYYA 4L0LA 4MLLA 1IKGA 2R9WA 5CGWA 2HDUA 1ESIA 4U0TA 3PBTA 3VFFA 5HAQA 4C3QA 1XX2A 2WADA 3CMZA 3M6HA 4XXRA 4C6YA 1Y54A 5CTMA 3MFDA 5F1GA 1XKZA 3C4PA 5EVID 3BYDA 5FASA 3BFDA 3WS1A 2XH9A 4OQ0A 4BQMA 1HD8A 1SDNA 5EVIC 4ZBEA 2A49A 2WK0A 1JWVA 4OLDA 5CECA 1G6AA 4OOMA 2HP9A 4OKPA 1KDSA 2EX2A 2Y91A 4CPKA 1IYQA 3A3JA 4OPQA 1YLPA 3IWIA 1K54C 3IH9A 1U60A 2XDMA 4JF4A 1CK3A 2EFUA 1DJBA 2HP6A 5HL1A 2HDSA 1WYBA 1SDEA 3MKEA 1O07A 4X69A 4ID4A 1O7EA 3G35A 5CERA 2WKEA 3QNCA 1KGFA 3PBQA 1BULA 4U3TA 3BFGA 3VSLA 4DKIA 1LLBA 2BLSA 1NJ4A 4E3NA 3G4PA 3UN7A 1FQGA 4KG6A 5DTKA 3VOZA 3TSGA 2XEPA 5FQQA 3W4PA 4GZBA 3SH7A 3G2YA 4PPRA 5GHYA 5CGXA 1BTLA 1W8QA 3BFEA 4PM5A 3OC2A 4IEDA 1K57C 1MPLA 3UDIA 3UPPA 5I94A 2H10A 1EWZA 2Y2KA 4YFMA 3ZVTA 5KSCA 3AGFA 3IWQA 4S2KA 4GNUA 4MNRA 4Y0OA 1ZG6A 5GLCA 3Q1FA 5TFQA 2ZMAA 5U47A 3ITAA 1VQQA 2B5RA 1FR1A 3G34A 3NC8A 4N1HA 5EVIB 5F83A 3SS5A 4M3KA 1K25A 2ZM2A 4DE0A 1YMSA 1ZC2A 2H0TA 3HUMA 4R0QA 3IXBA 1BLCA 4HBUA 4KZ9A 4RX2A 3IQAA 3HL9A 4LV2A 5CRFA 2BG1A 3SOIA 4RX3A 2Q9MA 2WGIA 2JC7A 4JXVA 5J8XA 3Q82A 4IBXA 3UO9A 3NDGA 3HLBA 5G18A 2J9OA 2PU4A 4X53A 3V39A 1XP4A 1RP5A 5A90A 3Q81A 3EQVA 3IWOA 4RA7A 5EUAA 4ZJ1A 2EFXA 2VGKA 4UHUA 3GQZA 4DF6A 2WKHA 4BD0A 3HLEA 4GB7A 1ES3A 4R4SA 2XQZA 3M2KA 5CHJA 5FATA 4B4ZA 5M18A 4WZ5A 1QMFA 2RCXA 3D4FA 3DWKA 4JPMA 3HUNA 2PU2A 5AQ7A 1ERMA 5FA7A 1ESUA 2X01A 5DF7A 3E2KA 2Y2GA 1FCNA 3M6BA 4KZ5A 2ZQAA 3WRTA 4S2MA 2ZC6B 4OH0A 4DDSA 2Y2JA 3OCLA 4K91A 3CG5A 2CC1A 3G31A 4BLMA 4QB8A 4EBLA 1ONHA 1RCJA 3PBRA 5AQ9A 3UPNA 1YLJA 5CEBA 3ZG5A 1GA0A 2EX6A 3HVFA 4CJNA 4U0XA 4ZJ2A 1KDWA 3FKVA 1IYPA 5E2EA 1BUEA 4EBNA 3UNWA 3MBZA 1ES5A 1FCMA 1K38A 2Z2LB 3W8KA 5KZHA 1FR6A 3UE3A 1FOFA 1L0DA 1YLZA 1Z6FA 3QNBA 3ZG8B 2V1ZA 3W4QA 2RL3A 1YMXA 4JF6A 1WYCA 2P9VB 1CEFA 3ZVWA 3IF6A 4ZJ3A 5CXWA 4JKTA 3P98A 3IF6C 4E3KA 1XA7A 3OPHA 4NK3A 5A91A 5DTSA 1YLTA 1CEGA 4DRTA 1N4OA 3BLSA 1ZG4A 3IXGA 1HVBA 3V5MA 4P85A 4DXCA 3O88A 1YQSA 1MY8A 1BSGA 2WGVA 4KZ4A 3VSKA 3FKWA 4KENB 2I72A 3LEZA 4IVKA 5M1AA 1K6RA 3UDXA 3V3SA 3GMWA 5GLAA 3ZG9B 3NIAA 2ZC5B 1PZPA 1S0WA 4DXBA 2XD1A 3M2JA 4A5RA 2WGWA 4N9KA 4OPYA 3PBSA 3A3FA 5DTTA 4GD8A 4N1XA 1TDLA 1Q2PA 1GHPA 3GSGA 3AGEA 5EPHA 2ZQ8A 3IH8A 4S2IA 5DVAA 1IYSA 2V20A 4K0XA 3Q7VA 5KMWA 4LCMA 3SH8A 1CI8A 2EX8A 2OSUA 4ZDXA 1GHIA 1S6RA 2P74A 4KQOA 1YM1A 4BL3A 1KGGA 3FZCA 3LCEA 1IELA 5FI2A 2QZ6A 1PI5A 3VMAA 4KZ6A 1ZKJA 2XR0A 4RVAA 1N9BA 4WM9A 3PAEA 3Q7ZA 3VP0A 2QMIA 5FAOA 4IVIA 5HARA 1L0GA 3OPLA 5A93A 1CI9A 3NY4A 1JWZA 4P0MA
chains in the Genus database with same CATH superfamily
1K56A 2BTFP 3LFVA 1KVLA 2KDKA 3CZDA 4IBRA 1T1AA 5FAQA 4P6BA 2E8JA 5LBRA 1K55C 3EEHA 1GSWA 4KZAA 1M40A 1XJ6A 2JKFA 4JGPA 1D06A 5EFWA 3A3DA 2ZC3B 1SKOA 4WMCA 4YINA 4I38A 3KSIA 1E3UA 3KYEA 2W1TB 1FCOA 2W1RA 2JKTM 4LRYC 3MXRA 4KQRA 3K3CA 2OV5A 3ZHHA 3QP8A 5DJUA 1ZHHB 4ARZB 1EROA 4HNBA 3LUQA 3C5AA 1CJFA 3NHQA 1NYMA 2XA7M 1W79A 3OLOA 4OVDA 3DTMA 3BLMA 2CMNA 2PDRA 2PT7A 4QY5A 3G6OA 4WZ4A 3G2ZA 2J9PA 1J3WA 5E43A 1OT6A 5FI6A 3CJMA 3ZFZA 2DNSA 5F6AA 3IBJA 4PKYG 5F69A 3ISGA 3T4TA 3UDFA 1F98A 2PR5A 3PHYA 2Y2LA 2PHYA 1KE3A 2IWBA 2IA2A 1YKDA 1DP8A 5EM1A 4FUWA 3GDIA 1KGEA 5TJJA 5HWTA 2B02A 3FPVA 3O87A 5TBMA 4O0PA 3ZGAB 3MZEA 1S67L 2V9AA 3HUOA 3T4JA 2KOIA 4R1GA 5FQMA 5CEDA 4WELA 5HDSA 4NKPA 2OLUA 4PMAA 2DMWA 1ZTUA 2M1CA 3AGDA 2WAFA 1JVJA 2ZM8A 4P87A 1Y4OA 2WKQA 2V2FF 1NZUA 3QP5A 4GJ4A 2VV7A 2EXAA 1AXBA 1MWUA 1XJ3A 3PTEA 4DJ3A 5EVLA 1LL9A 5EV0A 2GJ3A 4WN5A 2X71A 1BLPA 4NETA 1TF1A 3BY9A 4FCFA 1MKMA 5DJTA 3Q07A 3HLFA 2A24A 2I9VA 3CPTA 4G3KA 4QY6A 3MZDA 1K6SA 2OLVA 1K0KA 1ES2A 5J4EA 3TOIA 3MKFA 3TJZC 2WZZA 2DRWA 2X02A 3HBRA 2OAQ1 1ACFA 3L7HA 1VEUA 2FZ0A 5HX9A 3QP6A 1LSXA 1ONGA 3BWLA 3P09A 1KOUA 2V1AA 3EGDC 4FH4A 3P01A 5AQAA 5DFYA 4D2OA 2HPBA 3LIFA 4B9OA 2DCFA 3UY6A 4GD6A 1D7EA 5HAPA 1T1CA 3GTCA 4O8GA 2WUQA 4JXGA 4LV3A 1TDGA 3IXDA 1T1BA 4N9LA 4FH2A 4K0WA 5EECA 3S22A 5HFOA 3RXWA 1SKFA 3V3RA 2XFSA 1FSWA 1H8ZA 4F3LA 5HSQA 1RGZA 4IJGA 1XA1A 4CLCE 1HZOA 5J3WA 4DMZA 1LT0A 4EEPA 4GKUA 4MBKA 1T19A 4JGQA 3NOUC 4I3IA 3H7WB 4Y15A 1KE4A 5F68A 3R7WB 3D3OA 1G5UA 3VFFA 2W3FA 3PBTA 2WADA 3M6HA 3C4PA 5EVID 4IUHA 3BFDA 4GLQA 4BQMA 3NOPC 2WK0A 5AVEA 5CECA 1G6AA 2HP9A 1KDSA 3A3JA 1CK3A 3PYPA 3E0YA 2V8FA 5HL1A 3DAVA 1O7EA 1LLBA 1NJ4A 3G4PA 4FTXA 4GZBA 3SH7A 4PPRA 1W8QA 4IEDA 1K57C 3UPPA 1YPRA 3IWQA 5GLCA 4GNUA 4MNRA 3Q1FA 2V1BA 2W3HA 3G34A 5F83A 4LRZE 4M3KA 3HUMA 4R0QA 1BLCA 4HBUA 3IQAA 3HL9A 2EA9A 2Q9MA 2JC7A 5J8XA 3NECA 4Q0JA 3UO9A 2V0WA 2J9OA 3T4OA 2PU4A 4X53A 3UB6A 3T4SA 2VGKA 3MMHA 3M2KA 2O9BA 1EW0A 2PU2A 1FCNA 4KZ5A 1BYWA 3OCLA 4H6JB 2OAP1 5L09A 3KSFA 1RCJA 3ZG5A 1GA0A 3HVFA 1N9NA 2INWA 4HHDA 1BUEA 3MFXA 4GS9A 1Z6FA 2RL3A 2Z6CA 3IF6C 5A91A 3S7NA 4DRTA 4GHIB 4L9FA 4KZ4A 3FKWA 4KENB 2I72A 5M1AA 3V3SA 3ZYTA 5GLAA 1S0WA 4OPYA 5DTTA 4GD8A 3GSGA 5EPHA 3IH8A 4S2IA 3Q7VA 4IHQA 3PR6A 5KMWA 1CI8A 2OSUA 3BY8A 4ZDXA 3VOLA 2YKHA 2HZ5A 3LR5A 5HL6A 1KGGA 3LCEA 2QZ6A 4EQ1A 1PI5A 4RVAA 3R4KA 1P9WA 3NY4A 1S1ZA 4P0MA 3LIBA 5HZHA 4EEUA 1UWPX 1E3UD 1WE4A 1YT4A 5GL9A 3O86A 3LO7A 1I5QA 3WRZA 4B93A 4WZ5C 1ALQA 4KZ7A 3MSHA 1BZAA 5EOOA 4CQHA 2Y55A 4LV0A 5FAPA 5HPIA 3NBLA 4GHIA 2PBYA 3OPPA 4PM7A 4E3OA 4EBPA 4EETB 4CLCD 4S2NC 2ZQCA 5E2GA 4OQIA 4MBHA 3LR3A 4BBVA 3SS4A 1XGJA 4X56A 3T4QA 1YLYA 1G28A 3VP1A 4GN2A 3A3IA 4Y13A 2A3UA 5EVIA 1LL8A 2WAEA 3T12B 1VM1A 5HW3A 5FQJA 1YLWA 3GR2A 2XLNA 3IXHA 4I3JA 4KG5A 3U2AA 3N8SA 4R23A 3E98A 3WWXA 2P7JA 4HJ6A 2VK3A 1GA9A 4XT2B 4X68A 3S7QA 2Y2PA 4EXOA 5FQIA 1NXYA 1LI9A 4DDYA 4NXEA 1MZUA 4JXWA 5TR7A 3DW0A 1LL5A 3T1QB 2PBDP 3MQOA 3C4OA 5DF9A 1K54A 4OQHA 4HJ3A 4S2OA 4EESA 2ZD8A 4HIAA 4QHCA 3PAGA 3TW8A 3IHBA 1PZOA 3C8CA 3NULA 4OOYA 3GRJA 2Y4AA 5JYOA 3EQUA 1CQAA 3SS3A 4L9EA 1TS8A 1SCWA 1NRJA 2ZL1B 3BEBA 3LEQA 1K56D 1JTDA 4ZTKA 2QJ7A 2L0WA 1OMEA 5GHXA 3FG8A 4EV4A 5CHUA 4Y0TA 3W2ZA 4BJPA 5HDCA 4F3LB 4OOLA 5TGFA 4R3JA 2C6WB 1E4DA 3NDEA 1PWDA 4XT2A 2P9VA 5HWWA 3FYZA 3LI9A 3ZDJA 1DY6A 4R3BA 3ZG7B 2ZQ9A 5FI7A 5HD3A 4KG2A 4R4RA 1TEMA 5IHVA 3PBNA 4MMNA 2QPNA 5E2FA 1MWSA 2L4RA 1S4RA 2GDNA 4OLGA 4PHTA 4MEZA 4JXSA 1G68A 1NZOA 2Y2NA 5HPFA 5DKLA 2XFTA 3C2WA 1M6KA 3C7UA 3CI6A 5FQKA 2Y2IA 2Q0OA 3B42A 2ZQ7A 2JKRM 5HAIA 5CX7A 2WZXA 1PNEA 3IS2A 1TD5A 2QKPA 4LCLA 5DKKA 1VHMA 2O99A 2QYBA 1VEUB 4S2NA 1SKOB 3OCNA 1V9ZA 5G4YA 4UAAA 4OPZA 1IKIA 2G2WA 2KLIA 1PI4A 2ZM0A 4WEJA 3P7NA 3T4LA 5GHZA 2ZMVA 1E25A 3CUEA 4PAUA 4P6ZS 5EOEA 3ICYA 3IF5A 3LGOA 1GCEA 4MBFA 4FSFA 3PBOA 3OOVA 4QU3A 4HP9A 3S4XA 2J8YA 4BD1A 1I2SA 4KQDA 1OJGA 2LB5A 4PKYA 1MWTA 3B33A 4MLLA 2VGJA 1PYYA 3EOIA 4EUVA 1IKGA 5CGWA 4KUKA 5IS1A 1F5MA 3CMZA 5F1GA 3NOTC 3BYDA 5FASA 3WS1A 3LIEA 2XH9A 1OTEA 2JHEA 1GSXA 2JKRI 1JWVA 2V0UA 4II7A 2HF6A 3UB9A 4OPQA 3CLOA 1U60A 2XDMA 5HD5A 1DJBA 2MJ6A 3T4KA 1SDEA 4I3AA 4X69A 3G35A 2WKEA 3QNCA 3F1PA 1KGFA 1UWNX 3BFGA 3VSLA 5TBMB 1OPXA 5AVFA 3UN7A 2PD7A 4KG6A 1V9YA 4IUKA 3BFEA 3UDIA 3F1NB 1EWZA 5KSCA 3AGFA 4Y0OA 1ZG6A 2ZMAA 4N1HA 2H0TA 3IXBA 3JVUA 2EWWA 3CUEC 5CRFA 2BG1A 2G7UA 3CITA 4JGOA 4I5SA 1DRMA 3HLBA 3RTYA 3DBAA 4ARZA 3V39A 5A90A 4UHUA 5L07A 3GQZA 3HLEA 5C5KA 4R4SA 2XQZA 5CHJA 5FEFA 3E4PA 2RCXA 3DWKA 2JKGA 5FA7A 2VJWA 3F1PB 5DF7A 1NWZA 4LGWA 2WKRA 1LSVA 4S2MA 4DDSA 2Y2JA 1VETA 4BLMA 1ONHA 3PBRA 5AQ9A 2VA0A 1YLJA 4O01A 5CEBA 2EX6A 2Z6DA 4ZJ2A 5E2EA 3T50A 3UNWA 3W8KA 1FCMA 5KZHA 3UE3A 5L8MA 1FOFA 1YAXA 1L0DA 3CPTB 3QP2A 1WYCA 4AFIA 3ZVWA 4ZJ3A 3P98A 4EW7A 4E3KA 3OPHA 4NK3A 1XJ4A 4YNRA 2QHKA 3IS2B 1N4OA 4NXGA 3BQ8A 1HVBA 1X0OA 3ULFA 2Y8HA 3VSKA 3CAXA 4X1MA 1K6RA 3GMWA 2WGWA 4N9KA 3PBSA 1Q2PA 4NXBA 2ZQ8A 4QWOA 2GNXA 1S6RA 4KQOA 4R38A 5FI2A 1OTIA 4KZ6A 3T1RA 2XR0A 1N9BA 4WM9A 3Q7ZA 4HP4A 1JWZA 4A5RA 4CLCA 1S1YA 1S66L 5FQ9A 2P08A 2J3TD 2JE5A 4S2PA 4WBGA 3HLWA 1TVFA 2ZC7A 4JBFA 3GV9A 4PM9A 5EM0A 1K55A 3JPUA 5KSHA 2W3GA 2JBFA 2H0YA 4UA7A 4BBTA 4KUOA 4X25A 3S7OA 5F82A 4DE3A 3SW1A 3EGXC 1PWGA 4M4XA 1JTGA 3FV7A 1PWCA 5E2HA 4CLCC 4P6ZM 1LHYA 1MBLA 1AWIA 1PRQA 3LR4A 1G6OA 4UQIS 3RJUA 4HBTA 2WKPA 5D3OA 3KX0X 4O7DA 3HLGA 3N6IA 2HJ9C 1KVMA 2VZWA 3H82B 3VP4A 2R9XA 3L9KA 3NCKA 2GZAA 2FFYA 1BLSA 3W4OA 4E3LA 4ZRRA 3CHWP 4NXFA 2K31A 3BECA 4QD4A 1IOUA 1IYOA 2ZMFA 4JF5A 2OWJA 3LIAA 2HDRA 4N92A 1FSYA 1I2WA 3F1OA 1TS6A 3QP4A 5GLBA 2G2UA 3ZNYA 2ZQDA 4OPRA 3IBRA 4WUJA 4F94A 1F9IA 4PM8A 1VETB 2ZC4B 1Z09A 2PYPA 3MZFA 1UGUA 4OP5A 3ITBA 4QPRA 4GW9A 1SZVA 1MXOA 3UE1A 1J9MA 4Y0UA 3ZCZA 4ETXA 1W8YA 4MN5A 3VE3A 1Q2QA 4WLAA 3A3EA 3FWLA 4LFUA 5AJGA 4X55A 1K4EA 3RXXA 1NLYA 4YWZA 1F2KA 3V50A 1DJAA 1XGIA 1NY0A 2NUPC 2J3TC 3JYIA 1H0MA 4S2LA 1JWPA 3WS5A 4BENA 4OP8A 4HEFA 3C30A 4GDNA 1STZA 2XK1A 4FD8A 2EXBA 3DTIA 4E3JA 4MN6A 1DJCA 2P04A 1K4FA 2ZJ9A 1NRFA 2JN7A 3VV4A 2J7VA 5FSRA 1IEMA 4DE2A 4JGRA 2VLGA 1FIKA 2XA7S 2R78A 4PM6A 3ZNTA 4XUXA 3WS4A 4CLCB 2IWDA 3OPRA 1EI5A 1P97A 2O9AA 3LYXA 3E4OA 5FDHA 5GLDA 3MJQA 1TS0A 4HH2A 1ERQA 5CTNA 3KYZA 3LR0A 4D60A 2D01A 2J3WA 5A92A 3BFCA 1H8MA 3A0VA 2WKIA 4DN0A 3C7VA 2H5SA 2WGWB 3BM6A 2KX6A 2UV0E 3IX4A 1DP9A 5CHMA 2C5WB 2XF3A 1PW1A 3IF6B 3BJNA 2Y2HA 1WA9A 4GOGA 3K2NA 2HDQA 4UQIM 3BQAA 3MXQA 4OONA 5KIZA 4S2JA 2M7VA 2Z2MB 1BT5A 4L0LA 2HDUA 3LI8A 4U0TA 5HAQA 3MR0A 1XX2A 4HY8A 4C6YA 2Y79A 4OQ0A 1SDNA 1H3QA 2W27A 3KYQA 4OOMA 3B47A 2EX2A 4RQ9A 4CPKA 1IYQA 3IWIA 1K54C 4JF4A 3EEAA 2EFUA 2HP6A 2YKFA 1DP6A 3MKEA 3F1NA 4ID4A 3PBQA 4U3TA 3IX8A 3H9WA 2BLSA 4E3NA 1FQGA 3DTKA 5DTKA 3VOZA 3TSGA 2XEPA 3W4PA 5GHYA 5CGXA 1BTLA 3OC2A 2XSSA 4YFMA 3ZVTA 4S2KA 2B5RA 3SS5A 1FR1A 3NC8A 3UMEA 1K25A 2VKSA 2ZM2A 1ZC2A 2PYRA 1HLUP 3SOIA 2WGIA 4JXVA 4MCWA 5I5LA 2J80A 3NDGA 5G18A 1NLZA 1XP4A 1RP5A 3QP1A 3EQVA 4ZJ1A 2EFXA 4DF6A 2WKHA 3H7WA 4BD0A 1ES3A 4B4ZA 5M18A 5FATA 4WZ5A 1QMFA 4JPMA 2ZL1A 3HUNA 1W63Q 1D1JA 3V67A 1ESUA 3E2KA 3M6BA 3WRTA 2ZC6B 4OH0A 4HI4A 3UPNA 4HH3A 1L3LA 1KDWA 1PFLA 1IYPA 2VGLM 3FKVA 4EBNA 1K38A 2Z2LB 4R3AA 1YLZA 3QNBA 1YMXA 1CEFA 4R70A 4JKTA 3KO6A 1XA7A 1YLTA 3SZTA 3BLSA 1ZG4A 4Y17A 4P85A 4K08A 3O88A 4MN7A 4Y3IA 3LEZA 3UDXA 1N9OA 2HV1A 3ZG9B 3NIAA 2XROA 2ZC5B 1PZPA 4DXBA 2XD1A 3M2JA 4I39A 3A3FA 3KSGA 2OWHA 2V20A 3T1XA 1JNUA 4LCMA 4HQAA 3SH8A 4HOIA 2EX8A 1GHIA 1YM1A 4BWIA 4ESPA 3FZCA 4X1LA 2O0YA 1P9RA 3VMAA 4BBUA 3VP0A 2QMIA 1L0GA 3OPLA 5A93A 3K3DA 2AVXA 2W3DA 1PIOA 3HJKA 5L2FA 2ZLYA 4KZBA 5DF8A 2VX8A 5FEGA 3N8RA 3O3VA 2VV8A 3T1SA 4B4XA 1L0FA 3QHYA 4Z1WA 3MF0A 4HJ4A 3NI9A 1W7FA 3O5YA 1A0KA 3G32A 3S1YA 2PRFA 2IWCA 5EE8A 5F1FA 4XUZA 4RYEA 4WEKA 1GHMA 4DE1A 5JYPA 3RFBA 2HGVA 2XGNA 2M7UA 2D02A 2QWSA 4B88A 4H8RA 4E6WA 1LSWA 4X6TA 3WS0A 4EERA 4UA9A 3VE4A 1L0EA 2EWVA 3LY4A 2FH5A 1C3BA 2JCHA 5M19A 1ODVA 3N8LA 4BMWA 2W3EA 3MQQA 4LRXC 2PAVP 3EWKA 5FL3A 4YOFA 2H28A 1XJ2A 3RH8B 1MWRA 4Z9QA 4H6JA 1TS7A 5A8BA 3DWZA 2VV6A 3LY3A 3VOYA 1PW8A 3ZG0A 2Y2QA 1BLHA 2ACGA 2PR6A 1GSVA 1RGYA 2K2NA 1XXMA 1H8YA 4Y7PA 3E2LA 4KQQA 3LICA 3N4IA 4KZ8A 3N7WA 4BL2A 4E3MA 1OJ5A 5G4ZA 3D9YA 5HWVA 1SHVA 4LENA 1LI0A 3CWFA 1N9LA 5IU1A 3UPOA 2ZOIA 5EVEA 2EX9A 5BOHA 1ES4A 1OTAA 2W1TA 2PD8A 4ZAMA 2Y2OA 1MKIA 4LV1A 4C75A 3E4QA 5AQBA 1T18A 4Q8IA 5MC7A 3UE0A 4WMCD 3A0RA 2B95A 1K57A 1VB6A 1FILA 4UA6A 3HLDA 3PXPA 4LLOB 3ZQ5A 1W63M 3FC7A 4HESA 4MDZA 1NYYA 3GVBA 3G30A 3HLCA 2WYXA 3I7JA 1CF0A 4KZ3A 2Q9NA 5CGSA 3HJIA 3UMDA 3KSHA 4E3IA 4E6XA 2FFFB 3IHAA 3VFHA 3D72A 2VGLS 3BRMA 3SH9A 4LPZA 4QJGA 3VP2A 3TG9A 4NEED 3NJAA 4G3VA 3VP3A 2V8CA 3BW6A 3IT9A 1L2SA 4E04A 4WYYA 3H82A 4EQIA 2UWXA 5L10A 1W5DA 4FOFA 5FDSA 4GDBA 3BFFA 3TE8A 1H5XA 1YSPA 5IT5A 2Y2MA 3UE6A 2E8IA 3WS2A 4GS9B 1QMEA 4OQGA 4UEYA 3Q7VB 2XD5A 3OBFA 3HREA 4EWFA 1XPBA 1KE0A 3FPWA 4EUZA 3B3XA 3U4LP 4ETZA 4JLFA 2Y59A 1HTZA 2XRNA 4DJ2A 3IX3A 3OZHA 5K5BA 4GCZA 2HP5A 3MXSA 2R9WA 1ESIA 3TRCA 4C3QA 4XXRA 1Y54A 3JVVA 5CTMA 3MFDA 1XKZA 5HDDA 1HD8A 2ZOHA 5EVIC 4ZBEA 2A49A 3MQ0A 4OLDA 2HJEA 4OKPA 2Y91A 1XFNA 1YLPA 3IH9A 4L9GA 2HDSA 1WYBA 3LIDA 1O07A 5CERA 1BULA 4DKIA 1MC0A 2GX5A 5FQQA 2LB9A 3G2YA 2O9CA 4PM5A 1MPLA 5DFXA 5I94A 3F1OB 2H10A 2JKTI 2Y2KA 5TFQA 5U47A 3C38A 3ITAA 1VQQA 5EVIB 2A24B 5J7EA 5F5YA 4DE0A 3S7PA 1YMSA 4KZ9A 4Y2FA 4RX2A 4LV2A 4RX3A 3GECA 3Q82A 3A0SA 4IBXA 2K7SA 3UB8A 2BASA 3HCYA 3Q81A 1YSQA 3IWOA 4RA7A 5EUAA 1OTBA 4WL9A 1XFQA 4GB7A 1S4SA 3D4FA 2NUTC 5AQ7A 1ERMA 2X01A 2Y2GA 2ZQAA 2VEAA 4K91A 1P0ZA 2CC1A 2QJ5A 3CG5A 3G31A 4QB8A 4EBLA 2W0NA 1OT9A 1IFQA 3R7WA 4CJNA 4U0XA 4Y5FA 4WF0A 3MBZA 1ES5A 1FR6A 2A2LA 3ZG8B 2V1ZA 4Q0HA 3W4QA 4JF6A 2P9VB 2ZBBA 3IF6A 4G3WA 5CXWA 3DTEA 5DTSA 1CEGA 3UB7A 3IXGA 3V5MA 1Y28A 3MS6A 4DXCA 1YQSA 1MY8A 1BSGA 2WGVA 4IVKA 3UB5P 4N1XA 4Q0IA 1TDLA 1GHPA 3AGEA 5DVAA 1IYSA 4K0XA 1OTDA 4R6LA 2OOLA 2P74A 4BL3A 4EU0A 1IELA 4NG2A 4ME4A 1ZKJA 3PAEA 2B18A 5FAOA 4IVIA 5HARA 1CI9A 2L1MA
chains in the Genus database with same CATH topology
1K56A 5FQ9A 1PIOA 1E3UD 1KVLA 1WE4A 2JE5A 3CZDA 5L2FA 1YT4A 5GL9A 2ZLYA 4IBRA 4S2PA 4KZBA 4WBGA 5DF8A 5FAQA 3O86A 3HLWA 3LO7A 1I5QA 3N8RA 3O3VA 4P6BA 1TVFA 3WRZA 4WZ5C 1K55C 2ZC7A 4KZAA 1ALQA 4KZ7A 4JBFA 1M40A 3GV9A 4PM9A 4B4XA 1K55A 1L0FA 5KSHA 1BZAA 2JBFA 3QHYA 5EOOA 2H0YA 4UA7A 3A3DA 5F82A 2Y55A 2ZC3B 4DE3A 4WMCA 4LV0A 1PWGA 4YINA 5FAPA 3NI9A 1JTGA 3NBLA 1W7FA 3FV7A 1PWCA 5E2HA 1E3UA 1LHYA 2PBYA 1MBLA 3OPPA 4PM7A 4E3OA 1FCOA 4EBPA 4S2NC 3MXRA 4KQRA 2OV5A 2ZQCA 3ZHHA 3G32A 5E2GA 1EROA 3RJUA 3S1YA 4OQIA 2IWCA 4MBHA 4HBTA 5EE8A 3C5AA 5F1FA 1NYMA 4OVDA 1W79A 4XUZA 5D3OA 3DTMA 4RYEA 4O7DA 3SS4A 3HLGA 3BLMA 3N6IA 1XGJA 4WEKA 1KVMA 3VP4A 1GHMA 2R9XA 4X56A 4DE1A 5JYPA 1YLYA 3VP1A 2XGNA 4GN2A 4QY5A 4B88A 3A3IA 4H8RA 2A3UA 3NCKA 5EVIA 4E6WA 2FFYA 1BLSA 4X6TA 4WZ4A 3W4OA 3WS0A 2WAEA 4E3LA 4UA9A 3G2ZA 2J9PA 1VM1A 5HW3A 5FQJA 1YLWA 3GR2A 5E43A 2XLNA 3BECA 3IXHA 1L0EA 3LY4A 5FI6A 3CJMA 4QD4A 1C3BA 2JCHA 2DNSA 4KG5A 3ZFZA 3N8SA 1IYOA 5M19A 4R23A 3N8LA 3WWXA 1GA9A 4JF5A 4X68A 3ISGA 2HDRA 2Y2PA 4N92A 5FQIA 1FSYA 3UDFA 1I2WA 5GLBA 1NXYA 1LI9A 2G2UA 2Y2LA 4DDYA 1MWRA 3ZNYA 2ZQDA 4JXWA 4OPRA 5TR7A 4F94A 1KE3A 2IWBA 4PM8A 4Z9QA 3DW0A 2ZC4B 1LL5A 3DWZA 1KGEA 3LY3A 3MZFA 3VOYA 4OP5A 3C4OA 3ITBA 1PW8A 5DF9A 3ZG0A 1K54A 1MXOA 3UE1A 2Y2QA 1J9MA 4OQHA 4Y0UA 3O87A 1BLHA 4S2OA 3ZCZA 2ZD8A 1W8YA 1RGYA 4QHCA 3ZGAB 1XXMA 1Q2QA 3MZEA 3PAGA 1H8YA 3IHBA 4Y7PA 3E2LA 4KQQA 1PZOA 3A3EA 3FWLA 3HUOA 3N4IA 1K4EA 4X55A 4R1GA 4OOYA 3RXXA 3GRJA 2Y4AA 4KZ8A 5FQMA 5CEDA 5JYOA 4WELA 3N7WA 4BL2A 3EQUA 3V50A 1DJAA 3SS3A 1XGIA 2OLUA 4PMAA 1SCWA 4E3MA 3BEBA 1NY0A 3AGDA 1K56D 1JTDA 2WAFA 3JYIA 1JVJA 2ZM8A 4P87A 4ZTKA 4S2LA 2V2FF 1SHVA 4LENA 1OMEA 5GHXA 1LI0A 4EV4A 1JWPA 1NZUA 3WS5A 5CHUA 4Y0TA 4BENA 2EXAA 4BJPA 3UPOA 1AXBA 1MWUA 2EX9A 4OOLA 4OP8A 5TGFA 5BOHA 3PTEA 4R3JA 2C6WB 1E4DA 1ES4A 4HEFA 5EVLA 1LL9A 4ZAMA 2Y2OA 1MKIA 3NDEA 4GDNA 2X71A 1BLPA 4LV1A 4NETA 1PWDA 4C75A 2XK1A 4FD8A 2EXBA 2P9VA 3FYZA 5AQBA 4FCFA 4Q8IA 3ZDJA 1DY6A 4R3BA 4E3JA 3UE0A 1DJCA 3Q07A 4WMCD 3ZG7B 3HLFA 1K57A 1K4FA 2ZJ9A 2ZQ9A 5FI7A 1NRFA 4QY6A 4UA6A 2J7VA 3MZDA 4KG2A 1K6SA 1TEMA 3HLDA 4R4RA 5IHVA 3PBNA 4HESA 2OLVA 5FSRA 1NYYA 1IEMA 1ES2A 2QPNA 1MWSA 3GVBA 5E2FA 4DE2A 3G30A 3TOIA 3HLCA 2WYXA 3I7JA 3MKFA 4PM6A 4KZ3A 3ZNTA 2WZZA 2DRWA 2Q9NA 4XUXA 5CGSA 3WS4A 2GDNA 2X02A 3HBRA 4MEZA 4OLGA 4E3IA 4JXSA 2IWDA 4E6XA 3OPRA 1EI5A 2FFFB 5HX9A 1G68A 1NZOA 3IHAA 3VFHA 2Y2NA 3BRMA 3SH9A 1ONGA 3P09A 5FDHA 4QJGA 2XFTA 3VP2A 1M6KA 5GLDA 3TG9A 3C7UA 4FH4A 1ERQA 2Y2IA 5FQKA 5AQAA 2ZQ7A 5CTNA 3VP3A 3IT9A 2HPBA 4D2OA 1L2SA 5HAIA 2WZXA 4WYYA 2DCFA 3UY6A 4GD6A 4EQIA 4LCLA 5HAPA 5A92A 3BFCA 2UWXA 4S2NA 1W5DA 3GTCA 2WUQA 3OCNA 4JXGA 4LV3A 2WKIA 4GDBA 1IKIA 4OPZA 4UAAA 1TDGA 2G2WA 3IXDA 1PI4A 3C7VA 2H5SA 3BFFA 2ZM0A 2WGWB 4N9LA 1H5XA 4FH2A 4K0WA 4WEJA 5EECA 2Y2MA 3BM6A 2E8IA 3WS2A 1QMEA 5GHZA 3S22A 5HFOA 3RXWA 1SKFA 3V3RA 2XFSA 1E25A 4OQGA 1FSWA 1H8ZA 5CHMA 3Q7VB 2C5WB 2XF3A 1PW1A 3IF6B 2XD5A 5EOEA 3HREA 1RGZA 3IF5A 4EWFA 1XA1A 2Y2HA 1GCEA 4MBFA 4FSFA 3PBOA 1XPBA 1HZOA 4GOGA 2HDQA 4QU3A 1KE0A 4GKUA 4MBKA 3S4XA 2J8YA 4BD1A 1I2SA 4EUZA 4OONA 3B3XA 4JLFA 2Y59A 1HTZA 1MWTA 4S2JA 3OZHA 1KE4A 2HP5A 3MXSA 2Z2MB 2VGJA 1BT5A 1PYYA 4L0LA 4MLLA 1IKGA 2R9WA 5CGWA 2HDUA 1ESIA 4U0TA 3PBTA 3VFFA 5HAQA 4C3QA 1XX2A 2WADA 3CMZA 3M6HA 4XXRA 4C6YA 1Y54A 5CTMA 3MFDA 5F1GA 1XKZA 3C4PA 5EVID 3BYDA 5FASA 3BFDA 3WS1A 2XH9A 4OQ0A 4BQMA 1HD8A 1SDNA 5EVIC 4ZBEA 2A49A 2WK0A 1JWVA 4OLDA 5CECA 1G6AA 4OOMA 2HP9A 4OKPA 1KDSA 2EX2A 2Y91A 4CPKA 1IYQA 3A3JA 4OPQA 1YLPA 3IWIA 1K54C 3IH9A 1U60A 2XDMA 4JF4A 1CK3A 2EFUA 1DJBA 2HP6A 5HL1A 2HDSA 1WYBA 1SDEA 3MKEA 1O07A 4X69A 4ID4A 1O7EA 3G35A 5CERA 2WKEA 3QNCA 1KGFA 3PBQA 1BULA 4U3TA 3BFGA 3VSLA 4DKIA 1LLBA 2BLSA 1NJ4A 4E3NA 3G4PA 3UN7A 1FQGA 4KG6A 5DTKA 3VOZA 3TSGA 2XEPA 5FQQA 3W4PA 4GZBA 3SH7A 3G2YA 4PPRA 5GHYA 5CGXA 1BTLA 1W8QA 3BFEA 4PM5A 3OC2A 4IEDA 1K57C 1MPLA 3UDIA 3UPPA 5I94A 2H10A 1EWZA 2Y2KA 4YFMA 3ZVTA 5KSCA 3AGFA 3IWQA 4S2KA 4GNUA 4MNRA 4Y0OA 1ZG6A 5GLCA 3Q1FA 5TFQA 2ZMAA 5U47A 3ITAA 1VQQA 2B5RA 1FR1A 3G34A 3NC8A 4N1HA 5EVIB 5F83A 3SS5A 4M3KA 1K25A 2ZM2A 4DE0A 1YMSA 1ZC2A 2H0TA 3HUMA 4R0QA 3IXBA 1BLCA 4HBUA 4KZ9A 4RX2A 3IQAA 3HL9A 4LV2A 5CRFA 2BG1A 3SOIA 4RX3A 2Q9MA 2WGIA 2JC7A 4JXVA 5J8XA 3Q82A 4IBXA 3UO9A 3NDGA 3HLBA 5G18A 2J9OA 2PU4A 4X53A 3V39A 1XP4A 1RP5A 5A90A 3Q81A 3EQVA 3IWOA 4RA7A 5EUAA 4ZJ1A 2EFXA 2VGKA 4UHUA 3GQZA 4DF6A 2WKHA 4BD0A 3HLEA 4GB7A 1ES3A 4R4SA 2XQZA 3M2KA 5CHJA 5FATA 4B4ZA 5M18A 4WZ5A 1QMFA 2RCXA 3D4FA 3DWKA 4JPMA 3HUNA 2PU2A 5AQ7A 1ERMA 5FA7A 1ESUA 2X01A 5DF7A 3E2KA 2Y2GA 1FCNA 3M6BA 4KZ5A 2ZQAA 3WRTA 4S2MA 2ZC6B 4OH0A 4DDSA 2Y2JA 3OCLA 4K91A 3CG5A 2CC1A 3G31A 4BLMA 4QB8A 4EBLA 1ONHA 1RCJA 3PBRA 5AQ9A 3UPNA 1YLJA 5CEBA 3ZG5A 1GA0A 2EX6A 3HVFA 4CJNA 4U0XA 4ZJ2A 1KDWA 3FKVA 1IYPA 5E2EA 1BUEA 4EBNA 3UNWA 3MBZA 1ES5A 1FCMA 1K38A 2Z2LB 3W8KA 5KZHA 1FR6A 3UE3A 1FOFA 1L0DA 1YLZA 1Z6FA 3QNBA 3ZG8B 2V1ZA 3W4QA 2RL3A 1YMXA 4JF6A 1WYCA 2P9VB 1CEFA 3ZVWA 3IF6A 4ZJ3A 5CXWA 4JKTA 3P98A 3IF6C 4E3KA 1XA7A 3OPHA 4NK3A 5A91A 5DTSA 1YLTA 1CEGA 4DRTA 1N4OA 3BLSA 1ZG4A 3IXGA 1HVBA 3V5MA 4P85A 4DXCA 3O88A 1YQSA 1MY8A 1BSGA 2WGVA 4KZ4A 3VSKA 3FKWA 4KENB 2I72A 3LEZA 4IVKA 5M1AA 1K6RA 3UDXA 3V3SA 3GMWA 5GLAA 3ZG9B 3NIAA 2ZC5B 1PZPA 1S0WA 4DXBA 2XD1A 3M2JA 4A5RA 2WGWA 4N9KA 4OPYA 3PBSA 3A3FA 5DTTA 4GD8A 4N1XA 1TDLA 1Q2PA 1GHPA 3GSGA 3AGEA 5EPHA 2ZQ8A 3IH8A 4S2IA 5DVAA 1IYSA 2V20A 4K0XA 3Q7VA 5KMWA 4LCMA 3SH8A 1CI8A 2EX8A 2OSUA 4ZDXA 1GHIA 1S6RA 2P74A 4KQOA 1YM1A 4BL3A 1KGGA 3FZCA 3LCEA 1IELA 5FI2A 2QZ6A 1PI5A 3VMAA 4KZ6A 1ZKJA 2XR0A 4RVAA 1N9BA 4WM9A 3PAEA 3Q7ZA 3VP0A 2QMIA 5FAOA 4IVIA 5HARA 1L0GA 3OPLA 5A93A 1CI9A 3NY4A 1JWZA 4P0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K56 A;  5FQ9 A;  1PIO A;  1E3U D;  1KVL A;  1WE4 A;  2JE5 A;  3CZD A;  5L2F A;  1YT4 A;  5GL9 A;  2ZLY A;  4IBR A;  4S2P A;  4KZB A;  4WBG A;  5DF8 A;  5FAQ A;  3O86 A;  3HLW A;  3LO7 A;  1I5Q A;  3N8R A;  3O3V A;  4P6B A;  1TVF A;  3WRZ A;  4WZ5 C;  1K55 C;  2ZC7 A;  4KZA A;  1ALQ A;  4KZ7 A;  4JBF A;  1M40 A;  3GV9 A;  4PM9 A;  4B4X A;  1K55 A;  1L0F A;  5KSH A;  1BZA A;  2JBF A;  3QHY A;  5EOO A;  2H0Y A;  4UA7 A;  3A3D A;  5F82 A;  2Y55 A;  2ZC3 B;  4DE3 A;  4WMC A;  4LV0 A;  1PWG A;  4YIN A;  5FAP A;  3NI9 A;  1JTG A;  3NBL A;  1W7F A;  3FV7 A;  1PWC A;  5E2H A;  1E3U A;  1LHY A;  2PBY A;  1MBL A;  3OPP A;  4PM7 A;  4E3O A;  1FCO A;  4EBP A;  4S2N C;  3MXR A;  4KQR A;  2OV5 A;  2ZQC A;  3ZHH A;  3G32 A;  5E2G A;  1ERO A;  3RJU A;  3S1Y A;  4OQI A;  2IWC A;  4MBH A;  4HBT A;  5EE8 A;  3C5A A;  5F1F A;  1NYM A;  4OVD A;  1W79 A;  4XUZ A;  5D3O A;  3DTM A;  4RYE A;  4O7D A;  3SS4 A;  3HLG A;  3BLM A;  3N6I A;  1XGJ A;  4WEK A;  1KVM A;  3VP4 A;  1GHM A;  2R9X A;  4X56 A;  4DE1 A;  5JYP A;  1YLY A;  3VP1 A;  2XGN A;  4GN2 A;  4QY5 A;  4B88 A;  3A3I A;  4H8R A;  2A3U A;  3NCK A;  5EVI A;  4E6W A;  2FFY A;  1BLS A;  4X6T A;  4WZ4 A;  3W4O A;  3WS0 A;  2WAE A;  4E3L A;  4UA9 A;  3G2Z A;  2J9P A;  1VM1 A;  5HW3 A;  5FQJ A;  1YLW A;  3GR2 A;  5E43 A;  2XLN A;  3BEC A;  3IXH A;  1L0E A;  3LY4 A;  5FI6 A;  3CJM A;  4QD4 A;  1C3B A;  2JCH A;  2DNS A;  4KG5 A;  3ZFZ A;  3N8S A;  1IYO A;  5M19 A;  4R23 A;  3N8L A;  3WWX A;  1GA9 A;  4JF5 A;  4X68 A;  3ISG A;  2HDR A;  2Y2P A;  4N92 A;  5FQI A;  1FSY A;  3UDF A;  1I2W A;  5GLB A;  1NXY A;  1LI9 A;  2G2U A;  2Y2L A;  4DDY A;  1MWR A;  3ZNY A;  2ZQD A;  4JXW A;  4OPR A;  5TR7 A;  4F94 A;  1KE3 A;  2IWB A;  4PM8 A;  4Z9Q A;  3DW0 A;  2ZC4 B;  1LL5 A;  3DWZ A;  1KGE A;  3LY3 A;  3MZF A;  3VOY A;  4OP5 A;  3C4O A;  3ITB A;  1PW8 A;  5DF9 A;  3ZG0 A;  1K54 A;  1MXO A;  3UE1 A;  2Y2Q A;  1J9M A;  4OQH A;  4Y0U A;  3O87 A;  1BLH A;  4S2O A;  3ZCZ A;  2ZD8 A;  1W8Y A;  1RGY A;  4QHC A;  3ZGA B;  1XXM A;  1Q2Q A;  3MZE A;  3PAG A;  1H8Y A;  3IHB A;  4Y7P A;  3E2L A;  4KQQ A;  1PZO A;  3A3E A;  3FWL A;  3HUO A;  3N4I A;  1K4E A;  4X55 A;  4R1G A;  4OOY A;  3RXX A;  3GRJ A;  2Y4A A;  4KZ8 A;  5FQM A;  5CED A;  5JYO A;  4WEL A;  3N7W A;  4BL2 A;  3EQU A;  3V50 A;  1DJA A;  3SS3 A;  1XGI A;  2OLU A;  4PMA A;  1SCW A;  4E3M A;  3BEB A;  1NY0 A;  3AGD A;  1K56 D;  1JTD A;  2WAF A;  3JYI A;  1JVJ A;  2ZM8 A;  4P87 A;  4ZTK A;  4S2L A;  2V2F F;  1SHV A;  4LEN A;  1OME A;  5GHX A;  1LI0 A;  4EV4 A;  1JWP A;  1NZU A;  3WS5 A;  5CHU A;  4Y0T A;  4BEN A;  2EXA A;  4BJP A;  3UPO A;  1AXB A;  1MWU A;  2EX9 A;  4OOL A;  4OP8 A;  5TGF A;  5BOH A;  3PTE A;  4R3J A;  2C6W B;  1E4D A;  1ES4 A;  4HEF A;  5EVL A;  1LL9 A;  4ZAM A;  2Y2O A;  1MKI A;  3NDE A;  4GDN A;  2X71 A;  1BLP A;  4LV1 A;  4NET A;  1PWD A;  4C75 A;  2XK1 A;  4FD8 A;  2EXB A;  2P9V A;  3FYZ A;  5AQB A;  4FCF A;  4Q8I A;  3ZDJ A;  1DY6 A;  4R3B A;  4E3J A;  3UE0 A;  1DJC A;  3Q07 A;  4WMC D;  3ZG7 B;  3HLF A;  1K57 A;  1K4F A;  2ZJ9 A;  2ZQ9 A;  5FI7 A;  1NRF A;  4QY6 A;  4UA6 A;  2J7V A;  3MZD A;  4KG2 A;  1K6S A;  1TEM A;  3HLD A;  4R4R A;  5IHV A;  3PBN A;  4HES A;  2OLV A;  5FSR A;  1NYY A;  1IEM A;  1ES2 A;  2QPN A;  1MWS A;  3GVB A;  5E2F A;  4DE2 A;  3G30 A;  3TOI A;  3HLC A;  2WYX A;  3I7J A;  3MKF A;  4PM6 A;  4KZ3 A;  3ZNT A;  2WZZ A;  2DRW A;  2Q9N A;  4XUX A;  5CGS A;  3WS4 A;  2GDN A;  2X02 A;  3HBR A;  4MEZ A;  4OLG A;  4E3I A;  4JXS A;  2IWD A;  4E6X A;  3OPR A;  1EI5 A;  2FFF B;  5HX9 A;  1G68 A;  1NZO A;  3IHA A;  3VFH A;  2Y2N A;  3BRM A;  3SH9 A;  1ONG A;  3P09 A;  5FDH A;  4QJG A;  2XFT A;  3VP2 A;  1M6K A;  5GLD A;  3TG9 A;  3C7U A;  4FH4 A;  1ERQ A;  2Y2I A;  5FQK A;  5AQA A;  2ZQ7 A;  5CTN A;  3VP3 A;  3IT9 A;  2HPB A;  4D2O A;  1L2S A;  5HAI A;  2WZX A;  4WYY A;  2DCF A;  3UY6 A;  4GD6 A;  4EQI A;  4LCL A;  5HAP A;  5A92 A;  3BFC A;  2UWX A;  4S2N A;  1W5D A;  3GTC A;  2WUQ A;  3OCN A;  4JXG A;  4LV3 A;  2WKI A;  4GDB A;  1IKI A;  4OPZ A;  4UAA A;  1TDG A;  2G2W A;  3IXD A;  1PI4 A;  3C7V A;  2H5S A;  3BFF A;  2ZM0 A;  2WGW B;  4N9L A;  1H5X A;  4FH2 A;  4K0W A;  4WEJ A;  5EEC A;  2Y2M A;  3BM6 A;  2E8I A;  3WS2 A;  1QME A;  5GHZ A;  3S22 A;  5HFO A;  3RXW A;  1SKF A;  3V3R A;  2XFS A;  1E25 A;  4OQG A;  1FSW A;  1H8Z A;  5CHM A;  3Q7V B;  2C5W B;  2XF3 A;  1PW1 A;  3IF6 B;  2XD5 A;  5EOE A;  3HRE A;  1RGZ A;  3IF5 A;  4EWF A;  1XA1 A;  2Y2H A;  1GCE A;  4MBF A;  4FSF A;  3PBO A;  1XPB A;  1HZO A;  4GOG A;  2HDQ A;  4QU3 A;  1KE0 A;  4GKU A;  4MBK A;  3S4X A;  2J8Y A;  4BD1 A;  1I2S A;  4EUZ A;  4OON A;  3B3X A;  4JLF A;  2Y59 A;  1HTZ A;  1MWT A;  4S2J A;  3OZH A;  1KE4 A;  2HP5 A;  3MXS A;  2Z2M B;  2VGJ A;  1BT5 A;  1PYY A;  4L0L A;  4MLL A;  1IKG A;  2R9W A;  5CGW A;  2HDU A;  1ESI A;  4U0T A;  3PBT A;  3VFF A;  5HAQ A;  4C3Q A;  1XX2 A;  2WAD A;  3CMZ A;  3M6H A;  4XXR A;  4C6Y A;  1Y54 A;  5CTM A;  3MFD A;  5F1G A;  1XKZ A;  3C4P A;  5EVI D;  3BYD A;  5FAS A;  3BFD A;  3WS1 A;  2XH9 A;  4OQ0 A;  4BQM A;  1HD8 A;  1SDN A;  5EVI C;  4ZBE A;  2A49 A;  2WK0 A;  1JWV A;  4OLD A;  5CEC A;  1G6A A;  4OOM A;  2HP9 A;  4OKP A;  1KDS A;  2EX2 A;  2Y91 A;  4CPK A;  1IYQ A;  3A3J A;  4OPQ A;  1YLP A;  3IWI A;  1K54 C;  3IH9 A;  1U60 A;  2XDM A;  4JF4 A;  1CK3 A;  2EFU A;  1DJB A;  2HP6 A;  5HL1 A;  2HDS A;  1WYB A;  1SDE A;  3MKE A;  1O07 A;  4X69 A;  4ID4 A;  1O7E A;  3G35 A;  5CER A;  2WKE A;  3QNC A;  1KGF A;  3PBQ A;  1BUL A;  4U3T A;  3BFG A;  3VSL A;  4DKI A;  1LLB A;  2BLS A;  1NJ4 A;  4E3N A;  3G4P A;  3UN7 A;  1FQG A;  4KG6 A;  5DTK A;  3VOZ A;  3TSG A;  2XEP A;  5FQQ A;  3W4P A;  4GZB A;  3SH7 A;  3G2Y A;  4PPR A;  5GHY A;  5CGX A;  1BTL A;  1W8Q A;  3BFE A;  4PM5 A;  3OC2 A;  4IED A;  1K57 C;  1MPL A;  3UDI A;  3UPP A;  5I94 A;  2H10 A;  1EWZ A;  2Y2K A;  4YFM A;  3ZVT A;  5KSC A;  3AGF A;  3IWQ A;  4S2K A;  4GNU A;  4MNR A;  4Y0O A;  1ZG6 A;  5GLC A;  3Q1F A;  5TFQ A;  2ZMA A;  5U47 A;  3ITA A;  1VQQ A;  2B5R A;  1FR1 A;  3G34 A;  3NC8 A;  4N1H A;  5EVI B;  5F83 A;  3SS5 A;  4M3K A;  1K25 A;  2ZM2 A;  4DE0 A;  1YMS A;  1ZC2 A;  2H0T A;  3HUM A;  4R0Q A;  3IXB A;  1BLC A;  4HBU A;  4KZ9 A;  4RX2 A;  3IQA A;  3HL9 A;  4LV2 A;  5CRF A;  2BG1 A;  3SOI A;  4RX3 A;  2Q9M A;  2WGI A;  2JC7 A;  4JXV A;  5J8X A;  3Q82 A;  4IBX A;  3UO9 A;  3NDG A;  3HLB A;  5G18 A;  2J9O A;  2PU4 A;  4X53 A;  3V39 A;  1XP4 A;  1RP5 A;  5A90 A;  3Q81 A;  3EQV A;  3IWO A;  4RA7 A;  5EUA A;  4ZJ1 A;  2EFX A;  2VGK A;  4UHU A;  3GQZ A;  4DF6 A;  2WKH A;  4BD0 A;  3HLE A;  4GB7 A;  1ES3 A;  4R4S A;  2XQZ A;  3M2K A;  5CHJ A;  5FAT A;  4B4Z A;  5M18 A;  4WZ5 A;  1QMF A;  2RCX A;  3D4F A;  3DWK A;  4JPM A;  3HUN A;  2PU2 A;  5AQ7 A;  1ERM A;  5FA7 A;  1ESU A;  2X01 A;  5DF7 A;  3E2K A;  2Y2G A;  1FCN A;  3M6B A;  4KZ5 A;  2ZQA A;  3WRT A;  4S2M A;  2ZC6 B;  4OH0 A;  4DDS A;  2Y2J A;  3OCL A;  4K91 A;  3CG5 A;  2CC1 A;  3G31 A;  4BLM A;  4QB8 A;  4EBL A;  1ONH A;  1RCJ A;  3PBR A;  5AQ9 A;  3UPN A;  1YLJ A;  5CEB A;  3ZG5 A;  1GA0 A;  2EX6 A;  3HVF A;  4CJN A;  4U0X A;  4ZJ2 A;  1KDW A;  3FKV A;  1IYP A;  5E2E A;  1BUE A;  4EBN A;  3UNW A;  3MBZ A;  1ES5 A;  1FCM A;  1K38 A;  2Z2L B;  3W8K A;  5KZH A;  1FR6 A;  3UE3 A;  1FOF A;  1L0D A;  1YLZ A;  1Z6F A;  3QNB A;  3ZG8 B;  2V1Z A;  3W4Q A;  2RL3 A;  1YMX A;  4JF6 A;  1WYC A;  2P9V B;  1CEF A;  3ZVW A;  3IF6 A;  4ZJ3 A;  5CXW A;  4JKT A;  3P98 A;  3IF6 C;  4E3K A;  1XA7 A;  3OPH A;  4NK3 A;  5A91 A;  5DTS A;  1YLT A;  1CEG A;  4DRT A;  1N4O A;  3BLS A;  1ZG4 A;  3IXG A;  1HVB A;  3V5M A;  4P85 A;  4DXC A;  3O88 A;  1YQS A;  1MY8 A;  1BSG A;  2WGV A;  4KZ4 A;  3VSK A;  3FKW A;  4KEN B;  2I72 A;  3LEZ A;  4IVK A;  5M1A A;  1K6R A;  3UDX A;  3V3S A;  3GMW A;  5GLA A;  3ZG9 B;  3NIA A;  2ZC5 B;  1PZP A;  1S0W A;  4DXB A;  2XD1 A;  3M2J A;  4A5R A;  2WGW A;  4N9K A;  4OPY A;  3PBS A;  3A3F A;  5DTT A;  4GD8 A;  4N1X A;  1TDL A;  1Q2P A;  1GHP A;  3GSG A;  3AGE A;  5EPH A;  2ZQ8 A;  3IH8 A;  4S2I A;  5DVA A;  1IYS A;  2V20 A;  4K0X A;  3Q7V A;  5KMW A;  4LCM A;  3SH8 A;  1CI8 A;  2EX8 A;  2OSU A;  4ZDX A;  1GHI A;  1S6R A;  2P74 A;  4KQO A;  1YM1 A;  4BL3 A;  1KGG A;  3FZC A;  3LCE A;  1IEL A;  5FI2 A;  2QZ6 A;  1PI5 A;  3VMA A;  4KZ6 A;  1ZKJ A;  2XR0 A;  4RVA A;  1N9B A;  4WM9 A;  3PAE A;  3Q7Z A;  3VP0 A;  2QMI A;  5FAO A;  4IVI A;  5HAR A;  1L0G A;  3OPL A;  5A93 A;  1CI9 A;  3NY4 A;  1JWZ A;  4P0M A; 
#chains in the Genus database with same CATH topology
 1K56 A;  2BTF P;  3LFV A;  1KVL A;  2KDK A;  3CZD A;  4IBR A;  1T1A A;  5FAQ A;  4P6B A;  2E8J A;  5LBR A;  1K55 C;  3EEH A;  1GSW A;  4KZA A;  1M40 A;  1XJ6 A;  2JKF A;  4JGP A;  1D06 A;  5EFW A;  3A3D A;  2ZC3 B;  1SKO A;  4WMC A;  4YIN A;  4I38 A;  3KSI A;  1E3U A;  3KYE A;  2W1T B;  1FCO A;  2W1R A;  2JKT M;  4LRY C;  3MXR A;  4KQR A;  3K3C A;  2OV5 A;  3ZHH A;  3QP8 A;  5DJU A;  1ZHH B;  4ARZ B;  1ERO A;  4HNB A;  3LUQ A;  3C5A A;  1CJF A;  3NHQ A;  1NYM A;  2XA7 M;  1W79 A;  3OLO A;  4OVD A;  3DTM A;  3BLM A;  2CMN A;  2PDR A;  2PT7 A;  4QY5 A;  3G6O A;  4WZ4 A;  3G2Z A;  2J9P A;  1J3W A;  5E43 A;  1OT6 A;  5FI6 A;  3CJM A;  3ZFZ A;  2DNS A;  5F6A A;  3IBJ A;  4PKY G;  5F69 A;  3ISG A;  3T4T A;  3UDF A;  1F98 A;  2PR5 A;  3PHY A;  2Y2L A;  2PHY A;  1KE3 A;  2IWB A;  2IA2 A;  1YKD A;  1DP8 A;  5EM1 A;  4FUW A;  3GDI A;  1KGE A;  5TJJ A;  5HWT A;  2B02 A;  3FPV A;  3O87 A;  5TBM A;  4O0P A;  3ZGA B;  3MZE A;  1S67 L;  2V9A A;  3HUO A;  3T4J A;  2KOI A;  4R1G A;  5FQM A;  5CED A;  4WEL A;  5HDS A;  4NKP A;  2OLU A;  4PMA A;  2DMW A;  1ZTU A;  2M1C A;  3AGD A;  2WAF A;  1JVJ A;  2ZM8 A;  4P87 A;  1Y4O A;  2WKQ A;  2V2F F;  1NZU A;  3QP5 A;  4GJ4 A;  2VV7 A;  2EXA A;  1AXB A;  1MWU A;  1XJ3 A;  3PTE A;  4DJ3 A;  5EVL A;  1LL9 A;  5EV0 A;  2GJ3 A;  4WN5 A;  2X71 A;  1BLP A;  4NET A;  1TF1 A;  3BY9 A;  4FCF A;  1MKM A;  5DJT A;  3Q07 A;  3HLF A;  2A24 A;  2I9V A;  3CPT A;  4G3K A;  4QY6 A;  3MZD A;  1K6S A;  2OLV A;  1K0K A;  1ES2 A;  5J4E A;  3TOI A;  3MKF A;  3TJZ C;  2WZZ A;  2DRW A;  2X02 A;  3HBR A;  2OAQ 1;  1ACF A;  3L7H A;  1VEU A;  2FZ0 A;  5HX9 A;  3QP6 A;  1LSX A;  1ONG A;  3BWL A;  3P09 A;  1KOU A;  2V1A A;  3EGD C;  4FH4 A;  3P01 A;  5AQA A;  5DFY A;  4D2O A;  2HPB A;  3LIF A;  4B9O A;  2DCF A;  3UY6 A;  4GD6 A;  1D7E A;  5HAP A;  1T1C A;  3GTC A;  4O8G A;  2WUQ A;  4JXG A;  4LV3 A;  1TDG A;  3IXD A;  1T1B A;  4N9L A;  4FH2 A;  4K0W A;  5EEC A;  3S22 A;  5HFO A;  3RXW A;  1SKF A;  3V3R A;  2XFS A;  1FSW A;  1H8Z A;  4F3L A;  5HSQ A;  1RGZ A;  4IJG A;  1XA1 A;  4CLC E;  1HZO A;  5J3W A;  4DMZ A;  1LT0 A;  4EEP A;  4GKU A;  4MBK A;  1T19 A;  4JGQ A;  3NOU C;  4I3I A;  3H7W B;  4Y15 A;  1KE4 A;  5F68 A;  3R7W B;  3D3O A;  1G5U A;  3VFF A;  2W3F A;  3PBT A;  2WAD A;  3M6H A;  3C4P A;  5EVI D;  4IUH A;  3BFD A;  4GLQ A;  4BQM A;  3NOP C;  2WK0 A;  5AVE A;  5CEC A;  1G6A A;  2HP9 A;  1KDS A;  3A3J A;  1CK3 A;  3PYP A;  3E0Y A;  2V8F A;  5HL1 A;  3DAV A;  1O7E A;  1LLB A;  1NJ4 A;  3G4P A;  4FTX A;  4GZB A;  3SH7 A;  4PPR A;  1W8Q A;  4IED A;  1K57 C;  3UPP A;  1YPR A;  3IWQ A;  5GLC A;  4GNU A;  4MNR A;  3Q1F A;  2V1B A;  2W3H A;  3G34 A;  5F83 A;  4LRZ E;  4M3K A;  3HUM A;  4R0Q A;  1BLC A;  4HBU A;  3IQA A;  3HL9 A;  2EA9 A;  2Q9M A;  2JC7 A;  5J8X A;  3NEC A;  4Q0J A;  3UO9 A;  2V0W A;  2J9O A;  3T4O A;  2PU4 A;  4X53 A;  3UB6 A;  3T4S A;  2VGK A;  3MMH A;  3M2K A;  2O9B A;  1EW0 A;  2PU2 A;  1FCN A;  4KZ5 A;  1BYW A;  3OCL A;  4H6J B;  2OAP 1;  5L09 A;  3KSF A;  1RCJ A;  3ZG5 A;  1GA0 A;  3HVF A;  1N9N A;  2INW A;  4HHD A;  1BUE A;  3MFX A;  4GS9 A;  1Z6F A;  2RL3 A;  2Z6C A;  3IF6 C;  5A91 A;  3S7N A;  4DRT A;  4GHI B;  4L9F A;  4KZ4 A;  3FKW A;  4KEN B;  2I72 A;  5M1A A;  3V3S A;  3ZYT A;  5GLA A;  1S0W A;  4OPY A;  5DTT A;  4GD8 A;  3GSG A;  5EPH A;  3IH8 A;  4S2I A;  3Q7V A;  4IHQ A;  3PR6 A;  5KMW A;  1CI8 A;  2OSU A;  3BY8 A;  4ZDX A;  3VOL A;  2YKH A;  2HZ5 A;  3LR5 A;  5HL6 A;  1KGG A;  3LCE A;  2QZ6 A;  4EQ1 A;  1PI5 A;  4RVA A;  3R4K A;  1P9W A;  3NY4 A;  1S1Z A;  4P0M A;  3LIB A;  5HZH A;  4EEU A;  1UWP X;  1E3U D;  1WE4 A;  1YT4 A;  5GL9 A;  3O86 A;  3LO7 A;  1I5Q A;  3WRZ A;  4B93 A;  4WZ5 C;  1ALQ A;  4KZ7 A;  3MSH A;  1BZA A;  5EOO A;  4CQH A;  2Y55 A;  4LV0 A;  5FAP A;  5HPI A;  3NBL A;  4GHI A;  2PBY A;  3OPP A;  4PM7 A;  4E3O A;  4EBP A;  4EET B;  4CLC D;  4S2N C;  2ZQC A;  5E2G A;  4OQI A;  4MBH A;  3LR3 A;  4BBV A;  3SS4 A;  1XGJ A;  4X56 A;  3T4Q A;  1YLY A;  1G28 A;  3VP1 A;  4GN2 A;  3A3I A;  4Y13 A;  2A3U A;  5EVI A;  1LL8 A;  2WAE A;  3T12 B;  1VM1 A;  5HW3 A;  5FQJ A;  1YLW A;  3GR2 A;  2XLN A;  3IXH A;  4I3J A;  4KG5 A;  3U2A A;  3N8S A;  4R23 A;  3E98 A;  3WWX A;  2P7J A;  4HJ6 A;  2VK3 A;  1GA9 A;  4XT2 B;  4X68 A;  3S7Q A;  2Y2P A;  4EXO A;  5FQI A;  1NXY A;  1LI9 A;  4DDY A;  4NXE A;  1MZU A;  4JXW A;  5TR7 A;  3DW0 A;  1LL5 A;  3T1Q B;  2PBD P;  3MQO A;  3C4O A;  5DF9 A;  1K54 A;  4OQH A;  4HJ3 A;  4S2O A;  4EES A;  2ZD8 A;  4HIA A;  4QHC A;  3PAG A;  3TW8 A;  3IHB A;  1PZO A;  3C8C A;  3NUL A;  4OOY A;  3GRJ A;  2Y4A A;  5JYO A;  3EQU A;  1CQA A;  3SS3 A;  4L9E A;  1TS8 A;  1SCW A;  1NRJ A;  2ZL1 B;  3BEB A;  3LEQ A;  1K56 D;  1JTD A;  4ZTK A;  2QJ7 A;  2L0W A;  1OME A;  5GHX A;  3FG8 A;  4EV4 A;  5CHU A;  4Y0T A;  3W2Z A;  4BJP A;  5HDC A;  4F3L B;  4OOL A;  5TGF A;  4R3J A;  2C6W B;  1E4D A;  3NDE A;  1PWD A;  4XT2 A;  2P9V A;  5HWW A;  3FYZ A;  3LI9 A;  3ZDJ A;  1DY6 A;  4R3B A;  3ZG7 B;  2ZQ9 A;  5FI7 A;  5HD3 A;  4KG2 A;  4R4R A;  1TEM A;  5IHV A;  3PBN A;  4MMN A;  2QPN A;  5E2F A;  1MWS A;  2L4R A;  1S4R A;  2GDN A;  4OLG A;  4PHT A;  4MEZ A;  4JXS A;  1G68 A;  1NZO A;  2Y2N A;  5HPF A;  5DKL A;  2XFT A;  3C2W A;  1M6K A;  3C7U A;  3CI6 A;  5FQK A;  2Y2I A;  2Q0O A;  3B42 A;  2ZQ7 A;  2JKR M;  5HAI A;  5CX7 A;  2WZX A;  1PNE A;  3IS2 A;  1TD5 A;  2QKP A;  4LCL A;  5DKK A;  1VHM A;  2O99 A;  2QYB A;  1VEU B;  4S2N A;  1SKO B;  3OCN A;  1V9Z A;  5G4Y A;  4UAA A;  4OPZ A;  1IKI A;  2G2W A;  2KLI A;  1PI4 A;  2ZM0 A;  4WEJ A;  3P7N A;  3T4L A;  5GHZ A;  2ZMV A;  1E25 A;  3CUE A;  4PAU A;  4P6Z S;  5EOE A;  3ICY A;  3IF5 A;  3LGO A;  1GCE A;  4MBF A;  4FSF A;  3PBO A;  3OOV A;  4QU3 A;  4HP9 A;  3S4X A;  2J8Y A;  4BD1 A;  1I2S A;  4KQD A;  1OJG A;  2LB5 A;  4PKY A;  1MWT A;  3B33 A;  4MLL A;  2VGJ A;  1PYY A;  3EOI A;  4EUV A;  1IKG A;  5CGW A;  4KUK A;  5IS1 A;  1F5M A;  3CMZ A;  5F1G A;  3NOT C;  3BYD A;  5FAS A;  3WS1 A;  3LIE A;  2XH9 A;  1OTE A;  2JHE A;  1GSX A;  2JKR I;  1JWV A;  2V0U A;  4II7 A;  2HF6 A;  3UB9 A;  4OPQ A;  3CLO A;  1U60 A;  2XDM A;  5HD5 A;  1DJB A;  2MJ6 A;  3T4K A;  1SDE A;  4I3A A;  4X69 A;  3G35 A;  2WKE A;  3QNC A;  3F1P A;  1KGF A;  1UWN X;  3BFG A;  3VSL A;  5TBM B;  1OPX A;  5AVF A;  3UN7 A;  2PD7 A;  4KG6 A;  1V9Y A;  4IUK A;  3BFE A;  3UDI A;  3F1N B;  1EWZ A;  5KSC A;  3AGF A;  4Y0O A;  1ZG6 A;  2ZMA A;  4N1H A;  2H0T A;  3IXB A;  3JVU A;  2EWW A;  3CUE C;  5CRF A;  2BG1 A;  2G7U A;  3CIT A;  4JGO A;  4I5S A;  1DRM A;  3HLB A;  3RTY A;  3DBA A;  4ARZ A;  3V39 A;  5A90 A;  4UHU A;  5L07 A;  3GQZ A;  3HLE A;  5C5K A;  4R4S A;  2XQZ A;  5CHJ A;  5FEF A;  3E4P A;  2RCX A;  3DWK A;  2JKG A;  5FA7 A;  2VJW A;  3F1P B;  5DF7 A;  1NWZ A;  4LGW A;  2WKR A;  1LSV A;  4S2M A;  4DDS A;  2Y2J A;  1VET A;  4BLM A;  1ONH A;  3PBR A;  5AQ9 A;  2VA0 A;  1YLJ A;  4O01 A;  5CEB A;  2EX6 A;  2Z6D A;  4ZJ2 A;  5E2E A;  3T50 A;  3UNW A;  3W8K A;  1FCM A;  5KZH A;  3UE3 A;  5L8M A;  1FOF A;  1YAX A;  1L0D A;  3CPT B;  3QP2 A;  1WYC A;  4AFI A;  3ZVW A;  4ZJ3 A;  3P98 A;  4EW7 A;  4E3K A;  3OPH A;  4NK3 A;  1XJ4 A;  4YNR A;  2QHK A;  3IS2 B;  1N4O A;  4NXG A;  3BQ8 A;  1HVB A;  1X0O A;  3ULF A;  2Y8H A;  3VSK A;  3CAX A;  4X1M A;  1K6R A;  3GMW A;  2WGW A;  4N9K A;  3PBS A;  1Q2P A;  4NXB A;  2ZQ8 A;  4QWO A;  2GNX A;  1S6R A;  4KQO A;  4R38 A;  5FI2 A;  1OTI A;  4KZ6 A;  3T1R A;  2XR0 A;  1N9B A;  4WM9 A;  3Q7Z A;  4HP4 A;  1JWZ A;  4A5R A;  4CLC A;  1S1Y A;  1S66 L;  5FQ9 A;  2P08 A;  2J3T D;  2JE5 A;  4S2P A;  4WBG A;  3HLW A;  1TVF A;  2ZC7 A;  4JBF A;  3GV9 A;  4PM9 A;  5EM0 A;  1K55 A;  3JPU A;  5KSH A;  2W3G A;  2JBF A;  2H0Y A;  4UA7 A;  4BBT A;  4KUO A;  4X25 A;  3S7O A;  5F82 A;  4DE3 A;  3SW1 A;  3EGX C;  1PWG A;  4M4X A;  1JTG A;  3FV7 A;  1PWC A;  5E2H A;  4CLC C;  4P6Z M;  1LHY A;  1MBL A;  1AWI A;  1PRQ A;  3LR4 A;  1G6O A;  4UQI S;  3RJU A;  4HBT A;  2WKP A;  5D3O A;  3KX0 X;  4O7D A;  3HLG A;  3N6I A;  2HJ9 C;  1KVM A;  2VZW A;  3H82 B;  3VP4 A;  2R9X A;  3L9K A;  3NCK A;  2GZA A;  2FFY A;  1BLS A;  3W4O A;  4E3L A;  4ZRR A;  3CHW P;  4NXF A;  2K31 A;  3BEC A;  4QD4 A;  1IOU A;  1IYO A;  2ZMF A;  4JF5 A;  2OWJ A;  3LIA A;  2HDR A;  4N92 A;  1FSY A;  1I2W A;  3F1O A;  1TS6 A;  3QP4 A;  5GLB A;  2G2U A;  3ZNY A;  2ZQD A;  4OPR A;  3IBR A;  4WUJ A;  4F94 A;  1F9I A;  4PM8 A;  1VET B;  2ZC4 B;  1Z09 A;  2PYP A;  3MZF A;  1UGU A;  4OP5 A;  3ITB A;  4QPR A;  4GW9 A;  1SZV A;  1MXO A;  3UE1 A;  1J9M A;  4Y0U A;  3ZCZ A;  4ETX A;  1W8Y A;  4MN5 A;  3VE3 A;  1Q2Q A;  4WLA A;  3A3E A;  3FWL A;  4LFU A;  5AJG A;  4X55 A;  1K4E A;  3RXX A;  1NLY A;  4YWZ A;  1F2K A;  3V50 A;  1DJA A;  1XGI A;  1NY0 A;  2NUP C;  2J3T C;  3JYI A;  1H0M A;  4S2L A;  1JWP A;  3WS5 A;  4BEN A;  4OP8 A;  4HEF A;  3C30 A;  4GDN A;  1STZ A;  2XK1 A;  4FD8 A;  2EXB A;  3DTI A;  4E3J A;  4MN6 A;  1DJC A;  2P04 A;  1K4F A;  2ZJ9 A;  1NRF A;  2JN7 A;  3VV4 A;  2J7V A;  5FSR A;  1IEM A;  4DE2 A;  4JGR A;  2VLG A;  1FIK A;  2XA7 S;  2R78 A;  4PM6 A;  3ZNT A;  4XUX A;  3WS4 A;  4CLC B;  2IWD A;  3OPR A;  1EI5 A;  1P97 A;  2O9A A;  3LYX A;  3E4O A;  5FDH A;  5GLD A;  3MJQ A;  1TS0 A;  4HH2 A;  1ERQ A;  5CTN A;  3KYZ A;  3LR0 A;  4D60 A;  2D01 A;  2J3W A;  5A92 A;  3BFC A;  1H8M A;  3A0V A;  2WKI A;  4DN0 A;  3C7V A;  2H5S A;  2WGW B;  3BM6 A;  2KX6 A;  2UV0 E;  3IX4 A;  1DP9 A;  5CHM A;  2C5W B;  2XF3 A;  1PW1 A;  3IF6 B;  3BJN A;  2Y2H A;  1WA9 A;  4GOG A;  3K2N A;  2HDQ A;  4UQI M;  3BQA A;  3MXQ A;  4OON A;  5KIZ A;  4S2J A;  2M7V A;  2Z2M B;  1BT5 A;  4L0L A;  2HDU A;  3LI8 A;  4U0T A;  5HAQ A;  3MR0 A;  1XX2 A;  4HY8 A;  4C6Y A;  2Y79 A;  4OQ0 A;  1SDN A;  1H3Q A;  2W27 A;  3KYQ A;  4OOM A;  3B47 A;  2EX2 A;  4RQ9 A;  4CPK A;  1IYQ A;  3IWI A;  1K54 C;  4JF4 A;  3EEA A;  2EFU A;  2HP6 A;  2YKF A;  1DP6 A;  3MKE A;  3F1N A;  4ID4 A;  3PBQ A;  4U3T A;  3IX8 A;  3H9W A;  2BLS A;  4E3N A;  1FQG A;  3DTK A;  5DTK A;  3VOZ A;  3TSG A;  2XEP A;  3W4P A;  5GHY A;  5CGX A;  1BTL A;  3OC2 A;  2XSS A;  4YFM A;  3ZVT A;  4S2K A;  2B5R A;  3SS5 A;  1FR1 A;  3NC8 A;  3UME A;  1K25 A;  2VKS A;  2ZM2 A;  1ZC2 A;  2PYR A;  1HLU P;  3SOI A;  2WGI A;  4JXV A;  4MCW A;  5I5L A;  2J80 A;  3NDG A;  5G18 A;  1NLZ A;  1XP4 A;  1RP5 A;  3QP1 A;  3EQV A;  4ZJ1 A;  2EFX A;  4DF6 A;  2WKH A;  3H7W A;  4BD0 A;  1ES3 A;  4B4Z A;  5M18 A;  5FAT A;  4WZ5 A;  1QMF A;  4JPM A;  2ZL1 A;  3HUN A;  1W63 Q;  1D1J A;  3V67 A;  1ESU A;  3E2K A;  3M6B A;  3WRT A;  2ZC6 B;  4OH0 A;  4HI4 A;  3UPN A;  4HH3 A;  1L3L A;  1KDW A;  1PFL A;  1IYP A;  2VGL M;  3FKV A;  4EBN A;  1K38 A;  2Z2L B;  4R3A A;  1YLZ A;  3QNB A;  1YMX A;  1CEF A;  4R70 A;  4JKT A;  3KO6 A;  1XA7 A;  1YLT A;  3SZT A;  3BLS A;  1ZG4 A;  4Y17 A;  4P85 A;  4K08 A;  3O88 A;  4MN7 A;  4Y3I A;  3LEZ A;  3UDX A;  1N9O A;  2HV1 A;  3ZG9 B;  3NIA A;  2XRO A;  2ZC5 B;  1PZP A;  4DXB A;  2XD1 A;  3M2J A;  4I39 A;  3A3F A;  3KSG A;  2OWH A;  2V20 A;  3T1X A;  1JNU A;  4LCM A;  4HQA A;  3SH8 A;  4HOI A;  2EX8 A;  1GHI A;  1YM1 A;  4BWI A;  4ESP A;  3FZC A;  4X1L A;  2O0Y A;  1P9R A;  3VMA A;  4BBU A;  3VP0 A;  2QMI A;  1L0G A;  3OPL A;  5A93 A;  3K3D A;  2AVX A;  2W3D A;  1PIO A;  3HJK A;  5L2F A;  2ZLY A;  4KZB A;  5DF8 A;  2VX8 A;  5FEG A;  3N8R A;  3O3V A;  2VV8 A;  3T1S A;  4B4X A;  1L0F A;  3QHY A;  4Z1W A;  3MF0 A;  4HJ4 A;  3NI9 A;  1W7F A;  3O5Y A;  1A0K A;  3G32 A;  3S1Y A;  2PRF A;  2IWC A;  5EE8 A;  5F1F A;  4XUZ A;  4RYE A;  4WEK A;  1GHM A;  4DE1 A;  5JYP A;  3RFB A;  2HGV A;  2XGN A;  2M7U A;  2D02 A;  2QWS A;  4B88 A;  4H8R A;  4E6W A;  1LSW A;  4X6T A;  3WS0 A;  4EER A;  4UA9 A;  3VE4 A;  1L0E A;  2EWV A;  3LY4 A;  2FH5 A;  1C3B A;  2JCH A;  5M19 A;  1ODV A;  3N8L A;  4BMW A;  2W3E A;  3MQQ A;  4LRX C;  2PAV P;  3EWK A;  5FL3 A;  4YOF A;  2H28 A;  1XJ2 A;  3RH8 B;  1MWR A;  4Z9Q A;  4H6J A;  1TS7 A;  5A8B A;  3DWZ A;  2VV6 A;  3LY3 A;  3VOY A;  1PW8 A;  3ZG0 A;  2Y2Q A;  1BLH A;  2ACG A;  2PR6 A;  1GSV A;  1RGY A;  2K2N A;  1XXM A;  1H8Y A;  4Y7P A;  3E2L A;  4KQQ A;  3LIC A;  3N4I A;  4KZ8 A;  3N7W A;  4BL2 A;  4E3M A;  1OJ5 A;  5G4Z A;  3D9Y A;  5HWV A;  1SHV A;  4LEN A;  1LI0 A;  3CWF A;  1N9L A;  5IU1 A;  3UPO A;  2ZOI A;  5EVE A;  2EX9 A;  5BOH A;  1ES4 A;  1OTA A;  2W1T A;  2PD8 A;  4ZAM A;  2Y2O A;  1MKI A;  4LV1 A;  4C75 A;  3E4Q A;  5AQB A;  1T18 A;  4Q8I A;  5MC7 A;  3UE0 A;  4WMC D;  3A0R A;  2B95 A;  1K57 A;  1VB6 A;  1FIL A;  4UA6 A;  3HLD A;  3PXP A;  4LLO B;  3ZQ5 A;  1W63 M;  3FC7 A;  4HES A;  4MDZ A;  1NYY A;  3GVB A;  3G30 A;  3HLC A;  2WYX A;  3I7J A;  1CF0 A;  4KZ3 A;  2Q9N A;  5CGS A;  3HJI A;  3UMD A;  3KSH A;  4E3I A;  4E6X A;  2FFF B;  3IHA A;  3VFH A;  3D72 A;  2VGL S;  3BRM A;  3SH9 A;  4LPZ A;  4QJG A;  3VP2 A;  3TG9 A;  4NEE D;  3NJA A;  4G3V A;  3VP3 A;  2V8C A;  3BW6 A;  3IT9 A;  1L2S A;  4E04 A;  4WYY A;  3H82 A;  4EQI A;  2UWX A;  5L10 A;  1W5D A;  4FOF A;  5FDS A;  4GDB A;  3BFF A;  3TE8 A;  1H5X A;  1YSP A;  5IT5 A;  2Y2M A;  3UE6 A;  2E8I A;  3WS2 A;  4GS9 B;  1QME A;  4OQG A;  4UEY A;  3Q7V B;  2XD5 A;  3OBF A;  3HRE A;  4EWF A;  1XPB A;  1KE0 A;  3FPW A;  4EUZ A;  3B3X A;  3U4L P;  4ETZ A;  4JLF A;  2Y59 A;  1HTZ A;  2XRN A;  4DJ2 A;  3IX3 A;  3OZH A;  5K5B A;  4GCZ A;  2HP5 A;  3MXS A;  2R9W A;  1ESI A;  3TRC A;  4C3Q A;  4XXR A;  1Y54 A;  3JVV A;  5CTM A;  3MFD A;  1XKZ A;  5HDD A;  1HD8 A;  2ZOH A;  5EVI C;  4ZBE A;  2A49 A;  3MQ0 A;  4OLD A;  2HJE A;  4OKP A;  2Y91 A;  1XFN A;  1YLP A;  3IH9 A;  4L9G A;  2HDS A;  1WYB A;  3LID A;  1O07 A;  5CER A;  1BUL A;  4DKI A;  1MC0 A;  2GX5 A;  5FQQ A;  2LB9 A;  3G2Y A;  2O9C A;  4PM5 A;  1MPL A;  5DFX A;  5I94 A;  3F1O B;  2H10 A;  2JKT I;  2Y2K A;  5TFQ A;  5U47 A;  3C38 A;  3ITA A;  1VQQ A;  5EVI B;  2A24 B;  5J7E A;  5F5Y A;  4DE0 A;  3S7P A;  1YMS A;  4KZ9 A;  4Y2F A;  4RX2 A;  4LV2 A;  4RX3 A;  3GEC A;  3Q82 A;  3A0S A;  4IBX A;  2K7S A;  3UB8 A;  2BAS A;  3HCY A;  3Q81 A;  1YSQ A;  3IWO A;  4RA7 A;  5EUA A;  1OTB A;  4WL9 A;  1XFQ A;  4GB7 A;  1S4S A;  3D4F A;  2NUT C;  5AQ7 A;  1ERM A;  2X01 A;  2Y2G A;  2ZQA A;  2VEA A;  4K91 A;  1P0Z A;  2CC1 A;  2QJ5 A;  3CG5 A;  3G31 A;  4QB8 A;  4EBL A;  2W0N A;  1OT9 A;  1IFQ A;  3R7W A;  4CJN A;  4U0X A;  4Y5F A;  4WF0 A;  3MBZ A;  1ES5 A;  1FR6 A;  2A2L A;  3ZG8 B;  2V1Z A;  4Q0H A;  3W4Q A;  4JF6 A;  2P9V B;  2ZBB A;  3IF6 A;  4G3W A;  5CXW A;  3DTE A;  5DTS A;  1CEG A;  3UB7 A;  3IXG A;  3V5M A;  1Y28 A;  3MS6 A;  4DXC A;  1YQS A;  1MY8 A;  1BSG A;  2WGV A;  4IVK A;  3UB5 P;  4N1X A;  4Q0I A;  1TDL A;  1GHP A;  3AGE A;  5DVA A;  1IYS A;  4K0X A;  1OTD A;  4R6L A;  2OOL A;  2P74 A;  4BL3 A;  4EU0 A;  1IEL A;  4NG2 A;  4ME4 A;  1ZKJ A;  3PAE A;  2B18 A;  5FAO A;  4IVI A;  5HAR A;  1CI9 A;  2L1M A; 
#chains in the Genus database with same CATH homology
 1K56 A;  5FQ9 A;  1PIO A;  1E3U D;  1KVL A;  1WE4 A;  2JE5 A;  3CZD A;  5L2F A;  1YT4 A;  5GL9 A;  2ZLY A;  4IBR A;  4S2P A;  4KZB A;  4WBG A;  5DF8 A;  5FAQ A;  3O86 A;  3HLW A;  3LO7 A;  1I5Q A;  3N8R A;  3O3V A;  4P6B A;  1TVF A;  3WRZ A;  4WZ5 C;  1K55 C;  2ZC7 A;  4KZA A;  1ALQ A;  4KZ7 A;  4JBF A;  1M40 A;  3GV9 A;  4PM9 A;  4B4X A;  1K55 A;  1L0F A;  5KSH A;  1BZA A;  2JBF A;  3QHY A;  5EOO A;  2H0Y A;  4UA7 A;  3A3D A;  5F82 A;  2Y55 A;  2ZC3 B;  4DE3 A;  4WMC A;  4LV0 A;  1PWG A;  4YIN A;  5FAP A;  3NI9 A;  1JTG A;  3NBL A;  1W7F A;  3FV7 A;  1PWC A;  5E2H A;  1E3U A;  1LHY A;  2PBY A;  1MBL A;  3OPP A;  4PM7 A;  4E3O A;  1FCO A;  4EBP A;  4S2N C;  3MXR A;  4KQR A;  2OV5 A;  2ZQC A;  3ZHH A;  3G32 A;  5E2G A;  1ERO A;  3RJU A;  3S1Y A;  4OQI A;  2IWC A;  4MBH A;  4HBT A;  5EE8 A;  3C5A A;  5F1F A;  1NYM A;  4OVD A;  1W79 A;  4XUZ A;  5D3O A;  3DTM A;  4RYE A;  4O7D A;  3SS4 A;  3HLG A;  3BLM A;  3N6I A;  1XGJ A;  4WEK A;  1KVM A;  3VP4 A;  1GHM A;  2R9X A;  4X56 A;  4DE1 A;  5JYP A;  1YLY A;  3VP1 A;  2XGN A;  4GN2 A;  4QY5 A;  4B88 A;  3A3I A;  4H8R A;  2A3U A;  3NCK A;  5EVI A;  4E6W A;  2FFY A;  1BLS A;  4X6T A;  4WZ4 A;  3W4O A;  3WS0 A;  2WAE A;  4E3L A;  4UA9 A;  3G2Z A;  2J9P A;  1VM1 A;  5HW3 A;  5FQJ A;  1YLW A;  3GR2 A;  5E43 A;  2XLN A;  3BEC A;  3IXH A;  1L0E A;  3LY4 A;  5FI6 A;  3CJM A;  4QD4 A;  1C3B A;  2JCH A;  2DNS A;  4KG5 A;  3ZFZ A;  3N8S A;  1IYO A;  5M19 A;  4R23 A;  3N8L A;  3WWX A;  1GA9 A;  4JF5 A;  4X68 A;  3ISG A;  2HDR A;  2Y2P A;  4N92 A;  5FQI A;  1FSY A;  3UDF A;  1I2W A;  5GLB A;  1NXY A;  1LI9 A;  2G2U A;  2Y2L A;  4DDY A;  1MWR A;  3ZNY A;  2ZQD A;  4JXW A;  4OPR A;  5TR7 A;  4F94 A;  1KE3 A;  2IWB A;  4PM8 A;  4Z9Q A;  3DW0 A;  2ZC4 B;  1LL5 A;  3DWZ A;  1KGE A;  3LY3 A;  3MZF A;  3VOY A;  4OP5 A;  3C4O A;  3ITB A;  1PW8 A;  5DF9 A;  3ZG0 A;  1K54 A;  1MXO A;  3UE1 A;  2Y2Q A;  1J9M A;  4OQH A;  4Y0U A;  3O87 A;  1BLH A;  4S2O A;  3ZCZ A;  2ZD8 A;  1W8Y A;  1RGY A;  4QHC A;  3ZGA B;  1XXM A;  1Q2Q A;  3MZE A;  3PAG A;  1H8Y A;  3IHB A;  4Y7P A;  3E2L A;  4KQQ A;  1PZO A;  3A3E A;  3FWL A;  3HUO A;  3N4I A;  1K4E A;  4X55 A;  4R1G A;  4OOY A;  3RXX A;  3GRJ A;  2Y4A A;  4KZ8 A;  5FQM A;  5CED A;  5JYO A;  4WEL A;  3N7W A;  4BL2 A;  3EQU A;  3V50 A;  1DJA A;  3SS3 A;  1XGI A;  2OLU A;  4PMA A;  1SCW A;  4E3M A;  3BEB A;  1NY0 A;  3AGD A;  1K56 D;  1JTD A;  2WAF A;  3JYI A;  1JVJ A;  2ZM8 A;  4P87 A;  4ZTK A;  4S2L A;  2V2F F;  1SHV A;  4LEN A;  1OME A;  5GHX A;  1LI0 A;  4EV4 A;  1JWP A;  1NZU A;  3WS5 A;  5CHU A;  4Y0T A;  4BEN A;  2EXA A;  4BJP A;  3UPO A;  1AXB A;  1MWU A;  2EX9 A;  4OOL A;  4OP8 A;  5TGF A;  5BOH A;  3PTE A;  4R3J A;  2C6W B;  1E4D A;  1ES4 A;  4HEF A;  5EVL A;  1LL9 A;  4ZAM A;  2Y2O A;  1MKI A;  3NDE A;  4GDN A;  2X71 A;  1BLP A;  4LV1 A;  4NET A;  1PWD A;  4C75 A;  2XK1 A;  4FD8 A;  2EXB A;  2P9V A;  3FYZ A;  5AQB A;  4FCF A;  4Q8I A;  3ZDJ A;  1DY6 A;  4R3B A;  4E3J A;  3UE0 A;  1DJC A;  3Q07 A;  4WMC D;  3ZG7 B;  3HLF A;  1K57 A;  1K4F A;  2ZJ9 A;  2ZQ9 A;  5FI7 A;  1NRF A;  4QY6 A;  4UA6 A;  2J7V A;  3MZD A;  4KG2 A;  1K6S A;  1TEM A;  3HLD A;  4R4R A;  5IHV A;  3PBN A;  4HES A;  2OLV A;  5FSR A;  1NYY A;  1IEM A;  1ES2 A;  2QPN A;  1MWS A;  3GVB A;  5E2F A;  4DE2 A;  3G30 A;  3TOI A;  3HLC A;  2WYX A;  3I7J A;  3MKF A;  4PM6 A;  4KZ3 A;  3ZNT A;  2WZZ A;  2DRW A;  2Q9N A;  4XUX A;  5CGS A;  3WS4 A;  2GDN A;  2X02 A;  3HBR A;  4MEZ A;  4OLG A;  4E3I A;  4JXS A;  2IWD A;  4E6X A;  3OPR A;  1EI5 A;  2FFF B;  5HX9 A;  1G68 A;  1NZO A;  3IHA A;  3VFH A;  2Y2N A;  3BRM A;  3SH9 A;  1ONG A;  3P09 A;  5FDH A;  4QJG A;  2XFT A;  3VP2 A;  1M6K A;  5GLD A;  3TG9 A;  3C7U A;  4FH4 A;  1ERQ A;  2Y2I A;  5FQK A;  5AQA A;  2ZQ7 A;  5CTN A;  3VP3 A;  3IT9 A;  2HPB A;  4D2O A;  1L2S A;  5HAI A;  2WZX A;  4WYY A;  2DCF A;  3UY6 A;  4GD6 A;  4EQI A;  4LCL A;  5HAP A;  5A92 A;  3BFC A;  2UWX A;  4S2N A;  1W5D A;  3GTC A;  2WUQ A;  3OCN A;  4JXG A;  4LV3 A;  2WKI A;  4GDB A;  1IKI A;  4OPZ A;  4UAA A;  1TDG A;  2G2W A;  3IXD A;  1PI4 A;  3C7V A;  2H5S A;  3BFF A;  2ZM0 A;  2WGW B;  4N9L A;  1H5X A;  4FH2 A;  4K0W A;  4WEJ A;  5EEC A;  2Y2M A;  3BM6 A;  2E8I A;  3WS2 A;  1QME A;  5GHZ A;  3S22 A;  5HFO A;  3RXW A;  1SKF A;  3V3R A;  2XFS A;  1E25 A;  4OQG A;  1FSW A;  1H8Z A;  5CHM A;  3Q7V B;  2C5W B;  2XF3 A;  1PW1 A;  3IF6 B;  2XD5 A;  5EOE A;  3HRE A;  1RGZ A;  3IF5 A;  4EWF A;  1XA1 A;  2Y2H A;  1GCE A;  4MBF A;  4FSF A;  3PBO A;  1XPB A;  1HZO A;  4GOG A;  2HDQ A;  4QU3 A;  1KE0 A;  4GKU A;  4MBK A;  3S4X A;  2J8Y A;  4BD1 A;  1I2S A;  4EUZ A;  4OON A;  3B3X A;  4JLF A;  2Y59 A;  1HTZ A;  1MWT A;  4S2J A;  3OZH A;  1KE4 A;  2HP5 A;  3MXS A;  2Z2M B;  2VGJ A;  1BT5 A;  1PYY A;  4L0L A;  4MLL A;  1IKG A;  2R9W A;  5CGW A;  2HDU A;  1ESI A;  4U0T A;  3PBT A;  3VFF A;  5HAQ A;  4C3Q A;  1XX2 A;  2WAD A;  3CMZ A;  3M6H A;  4XXR A;  4C6Y A;  1Y54 A;  5CTM A;  3MFD A;  5F1G A;  1XKZ A;  3C4P A;  5EVI D;  3BYD A;  5FAS A;  3BFD A;  3WS1 A;  2XH9 A;  4OQ0 A;  4BQM A;  1HD8 A;  1SDN A;  5EVI C;  4ZBE A;  2A49 A;  2WK0 A;  1JWV A;  4OLD A;  5CEC A;  1G6A A;  4OOM A;  2HP9 A;  4OKP A;  1KDS A;  2EX2 A;  2Y91 A;  4CPK A;  1IYQ A;  3A3J A;  4OPQ A;  1YLP A;  3IWI A;  1K54 C;  3IH9 A;  1U60 A;  2XDM A;  4JF4 A;  1CK3 A;  2EFU A;  1DJB A;  2HP6 A;  5HL1 A;  2HDS A;  1WYB A;  1SDE A;  3MKE A;  1O07 A;  4X69 A;  4ID4 A;  1O7E A;  3G35 A;  5CER A;  2WKE A;  3QNC A;  1KGF A;  3PBQ A;  1BUL A;  4U3T A;  3BFG A;  3VSL A;  4DKI A;  1LLB A;  2BLS A;  1NJ4 A;  4E3N A;  3G4P A;  3UN7 A;  1FQG A;  4KG6 A;  5DTK A;  3VOZ A;  3TSG A;  2XEP A;  5FQQ A;  3W4P A;  4GZB A;  3SH7 A;  3G2Y A;  4PPR A;  5GHY A;  5CGX A;  1BTL A;  1W8Q A;  3BFE A;  4PM5 A;  3OC2 A;  4IED A;  1K57 C;  1MPL A;  3UDI A;  3UPP A;  5I94 A;  2H10 A;  1EWZ A;  2Y2K A;  4YFM A;  3ZVT A;  5KSC A;  3AGF A;  3IWQ A;  4S2K A;  4GNU A;  4MNR A;  4Y0O A;  1ZG6 A;  5GLC A;  3Q1F A;  5TFQ A;  2ZMA A;  5U47 A;  3ITA A;  1VQQ A;  2B5R A;  1FR1 A;  3G34 A;  3NC8 A;  4N1H A;  5EVI B;  5F83 A;  3SS5 A;  4M3K A;  1K25 A;  2ZM2 A;  4DE0 A;  1YMS A;  1ZC2 A;  2H0T A;  3HUM A;  4R0Q A;  3IXB A;  1BLC A;  4HBU A;  4KZ9 A;  4RX2 A;  3IQA A;  3HL9 A;  4LV2 A;  5CRF A;  2BG1 A;  3SOI A;  4RX3 A;  2Q9M A;  2WGI A;  2JC7 A;  4JXV A;  5J8X A;  3Q82 A;  4IBX A;  3UO9 A;  3NDG A;  3HLB A;  5G18 A;  2J9O A;  2PU4 A;  4X53 A;  3V39 A;  1XP4 A;  1RP5 A;  5A90 A;  3Q81 A;  3EQV A;  3IWO A;  4RA7 A;  5EUA A;  4ZJ1 A;  2EFX A;  2VGK A;  4UHU A;  3GQZ A;  4DF6 A;  2WKH A;  4BD0 A;  3HLE A;  4GB7 A;  1ES3 A;  4R4S A;  2XQZ A;  3M2K A;  5CHJ A;  5FAT A;  4B4Z A;  5M18 A;  4WZ5 A;  1QMF A;  2RCX A;  3D4F A;  3DWK A;  4JPM A;  3HUN A;  2PU2 A;  5AQ7 A;  1ERM A;  5FA7 A;  1ESU A;  2X01 A;  5DF7 A;  3E2K A;  2Y2G A;  1FCN A;  3M6B A;  4KZ5 A;  2ZQA A;  3WRT A;  4S2M A;  2ZC6 B;  4OH0 A;  4DDS A;  2Y2J A;  3OCL A;  4K91 A;  3CG5 A;  2CC1 A;  3G31 A;  4BLM A;  4QB8 A;  4EBL A;  1ONH A;  1RCJ A;  3PBR A;  5AQ9 A;  3UPN A;  1YLJ A;  5CEB A;  3ZG5 A;  1GA0 A;  2EX6 A;  3HVF A;  4CJN A;  4U0X A;  4ZJ2 A;  1KDW A;  3FKV A;  1IYP A;  5E2E A;  1BUE A;  4EBN A;  3UNW A;  3MBZ A;  1ES5 A;  1FCM A;  1K38 A;  2Z2L B;  3W8K A;  5KZH A;  1FR6 A;  3UE3 A;  1FOF A;  1L0D A;  1YLZ A;  1Z6F A;  3QNB A;  3ZG8 B;  2V1Z A;  3W4Q A;  2RL3 A;  1YMX A;  4JF6 A;  1WYC A;  2P9V B;  1CEF A;  3ZVW A;  3IF6 A;  4ZJ3 A;  5CXW A;  4JKT A;  3P98 A;  3IF6 C;  4E3K A;  1XA7 A;  3OPH A;  4NK3 A;  5A91 A;  5DTS A;  1YLT A;  1CEG A;  4DRT A;  1N4O A;  3BLS A;  1ZG4 A;  3IXG A;  1HVB A;  3V5M A;  4P85 A;  4DXC A;  3O88 A;  1YQS A;  1MY8 A;  1BSG A;  2WGV A;  4KZ4 A;  3VSK A;  3FKW A;  4KEN B;  2I72 A;  3LEZ A;  4IVK A;  5M1A A;  1K6R A;  3UDX A;  3V3S A;  3GMW A;  5GLA A;  3ZG9 B;  3NIA A;  2ZC5 B;  1PZP A;  1S0W A;  4DXB A;  2XD1 A;  3M2J A;  4A5R A;  2WGW A;  4N9K A;  4OPY A;  3PBS A;  3A3F A;  5DTT A;  4GD8 A;  4N1X A;  1TDL A;  1Q2P A;  1GHP A;  3GSG A;  3AGE A;  5EPH A;  2ZQ8 A;  3IH8 A;  4S2I A;  5DVA A;  1IYS A;  2V20 A;  4K0X A;  3Q7V A;  5KMW A;  4LCM A;  3SH8 A;  1CI8 A;  2EX8 A;  2OSU A;  4ZDX A;  1GHI A;  1S6R A;  2P74 A;  4KQO A;  1YM1 A;  4BL3 A;  1KGG A;  3FZC A;  3LCE A;  1IEL A;  5FI2 A;  2QZ6 A;  1PI5 A;  3VMA A;  4KZ6 A;  1ZKJ A;  2XR0 A;  4RVA A;  1N9B A;  4WM9 A;  3PAE A;  3Q7Z A;  3VP0 A;  2QMI A;  5FAO A;  4IVI A;  5HAR A;  1L0G A;  3OPL A;  5A93 A;  1CI9 A;  3NY4 A;  1JWZ A;  4P0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...