4XXRA

Atomic resolution x-ray crystal structure of a ruthenocene conjugated beta-lactam antibiotic in complex with ctx-m-14 e166a beta-lactamase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
b'TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTAPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTX-M-14 Class A Beta-Lactamase
publication title Antibacterial properties and atomic resolution X-ray complex crystal structure of a ruthenocene conjugated beta-lactam antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4xxrA00
1W7FA 1K56A 3O86A 4PMAA 5HFOA 1CEGA 3ZNYA 5EE8A 5D3OA 1YM1A 1U60A 5GLAA 1PWCA 1MWSA 1TEMA 3BFEA 1KDWA 4S2KA 3MBZA 1ZC2A 1IYPA 1SHVA 3IWIA 1FSYA 3M2KA 4XUXA 2Z2LB 4GZBA 3W8KA 3ZG7B 1IEMA 1WYBA 4ZJ1A 1LI0A 1YLZA 3BFFA 1TVFA 3G4PA 1EROA 1SKFA 5CTMA 5EVIA 3HVFA 4R4RA 1NZUA 1W8YA 3ZDJA 4BQMA 4R4SA 1K25A 2BG1A 2ZM8A 3GVBA 4P85A 1MBLA 4K0XA 4S2PA 3ZFZA 5DTSA 5FASA 2J9PA 4PM8A 4EBLA 2HDQA 4QY6A 2JBFA 5JYPA 4EWFA 4E3KA 2WUQA 4N9LA 3QNCA 3SS5A 1KGGA 1YMSA 3MZFA 2FFYA 3OPHA 2EFXA 2QZ6A 4ZTKA 5TGFA 1LHYA 2Y2HA 2ZQ9A 3IWOA 4GNUA 4R3JA 3HLCA 5FAPA 5AQAA 4FH4A 3BECA 3PBNA 4RX3A 3C4OA 1DY6A 2Y2GA 3CMZA 5CRFA 5CTNA 3G32A 1MKIA 1H5XA 2WGWA 4FH2A 1GCEA 1JVJA 3GMWA 4GKUA 3Q7VA 5CGWA 1NXYA 3NCKA 4EBPA 1MWTA 1K57A 1ZG6A 4P6BA 3RXWA 5M18A 4WEJA 1PW1A 1KE0A 2G2WA 4MLLA 4QU3A 1Y54A 3N4IA 4LV3A 1NY0A 3G30A 3UPPA 3UY6A 1J9MA 4OQ0A 5GLBA 4UAAA 3HLEA 1RCJA 3M2JA 5FI2A 4MBKA 1ES2A 4JBFA 1JWZA 1KVLA 3UDXA 1W8QA 3VSLA 4OLDA 5FQKA 4JF4A 1ESIA 2XR0A 4C75A 4EQIA 2EX8A 3UE1A 1K57C 4LENA 3PAEA 4LV1A 1YLJA 3V3SA 4YFMA 1O7EA 5CHJA 3GRJA 1PW8A 4KQRA 5EOEA 4DDSA 1PYYA 4JF6A 4KZBA 1GHMA 2Y2IA 1CI9A 1WYCA 4QD4A 3Q07A 2WAFA 1LL5A 2FFFB 1YLWA 5FQQA 3WRZA 1CI8A 1XX2A 3G34A 2ZC6B 1XKZA 2Y55A 3FYZA 3DTMA 3C5AA 3EQVA 4ZJ2A 2V20A 3VP3A 4OPQA 4P0MA 4P87A 4DXBA 4OPZA 3LO7A 2XEPA 4QHCA 2WK0A 1N9BA 4DKIA 1ONHA 5CHMA 1FQGA 1BLHA 1I5QA 1GHPA 5DTTA 3A3DA 2X01A 5M19A 3IH8A 1E3UA 1BTLA 3LY4A 4JXGA 2EX2A 3RXXA 3EQUA 2J8YA 4OPYA 4ZBEA 4MNRA 4WZ4A 3VSKA 3ZGAB 5CEBA 3HLGA 3MXSA 4BENA 1N4OA 4OOMA 3IH9A 2H10A 2RCXA 3O87A 4X56A 2ZJ9A 2J7VA 3S22A 3V3RA 4DRTA 4E3MA 3OC2A 2WZZA 2ZQ7A 5AQBA 5KZHA 4OP5A 4RVAA 3W4OA 1MPLA 3IF6A 1JWVA 3OCLA 4C6YA 4WMCA 1YLPA 2IWBA 4DF6A 3ZCZA 2WKEA 1XA1A 2ZC7A 1BT5A 4KZ3A 4WELA 3G2YA 4D2OA 3UNWA 4OONA 5GHYA 3FKVA 3FV7A 1S0WA 5FSRA 1E25A 4N9KA 3Q7ZA 3UE0A 2A3UA 1CK3A 4KQQA 5FQ9A 5HAIA 3GTCA 3TSGA 5CEDA 4KZAA 1XGJA 2A49A 2EX6A 1PIOA 4JXVA 3SH8A 1IYSA 1YLTA 3HLFA 3IF6C 4JF5A 1WE4A 5HAPA 4R23A 4OPRA 4WZ5C 5CGSA 4BLMA 2CC1A 4DE0A 3Q82A 3N6IA 3S1YA 5FAOA 5A93A 1PI4A 4DE2A 2ZM2A 4KZ8A 2JE5A 4F94A 2R9XA 2WAEA 5CHUA 3WS5A 4E6WA 3IT9A 1L0DA 1FCMA 2XF3A 2P74A 1XXMA 3P98A 5EOOA 2XDMA 3IXBA 3NBLA 3Q81A 2Y2MA 5CECA 4CJNA 1PWGA 1BLPA 4DE1A 3BFDA 3HLWA 2HP6A 1PWDA 4Y0OA 5HARA 4L0LA 1Q2PA 3AGDA 1NJ4A 5E43A 2DRWA 1ERQA 1KGFA 5FDHA 5HW3A 3PBOA 4GOGA 4BJPA 3N7WA 2JCHA 1K6SA 3WWXA 3ZVWA 1IKGA 3Q1FA 4FCFA 3A3IA 4R1GA 2OV5A 4MBFA 5HL1A 4PM7A 2XQZA 4DE3A 2P9VB 3C7VA 3UDFA 4GD8A 5EVIC 2JC7A 3NDEA 4HEFA 5EPHA 2B5RA 3PAGA 1L2SA 4HESA 4IBRA 1L0GA 3BEBA 2ZQDA 3A3FA 4KG6A 1IYOA 4EBNA 1EI5A 1FR6A 2ZQ8A 1ESUA 4WM9A 5A91A 4HBTA 2OLVA 2X02A 3HL9A 4NK3A 1RP5A 5G18A 1XGIA 3ZG8B 1JTDA 2EX9A 1IKIA 5GLDA 3S4XA 2PU2A 3ITBA 3MZEA 4XXRA 1FCOA 4E3OA 5KSHA 3OPPA 2ZM0A 4FSFA 5CXWA 4LV0A 4IBXA 4S2MA 3FWLA 5JYOA 2Y2LA 4K91A 1HD8A 1BLCA 5DF7A 1JTGA 5TFQA 1MWRA 1IYQA 2DNSA 4Z9QA 4RA7A 3WRTA 2ZQAA 4OQHA 3V50A 4JXWA 1KDSA 2RL3A 2HP9A 2ZC4B 1MXOA 3M6HA 1LLBA 3VMAA 3NY4A 1I2WA 3MFDA 1PZPA 3HUOA 3ZG0A 4KQOA 3W4PA 4CPKA 1AXBA 4H8RA 3UPOA 1XPBA 5FAQA 3IHAA 3G35A 1YT4A 2IWDA 4N92A 3TG9A 2XLNA 3WS2A 4E3NA 3O88A 2QPNA 3WS1A 4WEKA 3MXRA 1H8ZA 2Z2MB 4XUZA 3VP1A 3MKEA 1JWPA 1GA9A 2BLSA 1TDGA 3E2KA 3GV9A 4OOLA 5BOHA 4B88A 1K38A 2V2FF 4UA7A 3TOIA 3UO9A 3C4PA 3UE3A 5I94A 3OZHA 5A92A 2G2UA 3FKWA 1FR1A 3ZG5A 5GHZA 5J8XA 1K6RA 4BD1A 5M1AA 1DJBA 2C6WB 5E2EA 4E3LA 1NYMA 3HREA 2HDUA 4OKPA 5EVLA 3A3EA 4PPRA 1BULA 2E8IA 2ZMAA 4QJGA 3ZVTA 3PBRA 3Q7VB 4BD0A 3G2ZA 3V39A 1K56D 1HTZA 3MKFA 4FD8A 3GSGA 3IXGA 1H8YA 2PU4A 1KE3A 1M40A 2Y4AA 4HBUA 4MBHA 5DF8A 1K55A 3VFFA 1LI9A 3ZG9B 4BL2A 3C7UA 4GDBA 3V5MA 4PM5A 4LV2A 1GA0A 3JYIA 5FA7A 4LCMA 3CJMA 3DWZA 4OQIA 3G31A 4C3QA 5EECA 1K4FA 3A3JA 4ZJ3A 2P9VA 5EVID 4E3JA 1PI5A 3DW0A 3HBRA 4S2LA 4WBGA 4WYYA 3BFGA 1FOFA 1DJAA 1S6RA 4S2NA 4OP8A 3NIAA 4IVIA 2OLUA 4ID4A 3PBQA 2EXAA 2XH9A 1K55C 3W4QA 1HVBA 3BM6A 1ALQA 4YINA 2WKHA 1RGZA 5HX9A 1NRFA 2WGIA 1XP4A 2ZC3B 2EXBA 1W79A 3RJUA 1Q2QA 2Q9NA 5TR7A 2ZD8A 5FQMA 4Y7PA 4KG2A 3N8LA 4M3KA 2V1ZA 4S2IA 3SOIA 4PM9A 3SH9A 4GD6A 2HPBA 4S2OA 5FATA 2X71A 3VP0A 2XK1A 1QMEA 1KGEA 4S2NC 1OMEA 4X68A 2XGNA 4GDNA 5KSCA 4UHUA 2Y2NA 5DTKA 1ONGA 3SS3A 1L0FA 1MWUA 3O3VA 5AQ7A 5KMWA 5AQ9A 4DDYA 1GHIA 1BUEA 4GN2A 2WYXA 5DF9A 5GLCA 4QB8A 5IHVA 1ES4A 3IF6B 2Y91A 1K4EA 1BLSA 3BYDA 3VOZA 2HDRA 4UA6A 4BL3A 2Y2OA 2OSUA 5F1FA 3PBSA 1VM1A 1ERMA 3AGFA 3CG5A 1SDNA 3UDIA 1YLYA 5E2GA 5A90A 2Y2PA 4NETA 4OLGA 3UPNA 1HZOA 4JPMA 1NYYA 1XA7A 4U0XA 1K54A 1FSWA 1ES5A 1SCWA 3IXDA 5F82A 3LY3A 3QHYA 1FCNA 3N8RA 4B4XA 2GDNA 4OOYA 2UWXA 4Y0UA 3IF5A 4JKTA 2ZLYA 3NC8A 4Y0TA 1E4DA 1C3BA 5E2HA 3PTEA 1SDEA 3I7JA 3HLDA 3OPLA 3P09A 4MEZA 3ZNTA 3BRMA 3QNBA 2ZC5B 3ITAA 3BFCA 4X69A 4ZAMA 3HLBA 4N1HA 2Y2QA 5HAQA 5FI6A 3OPRA 2XD5A 4JLFA 4KZ5A 3N8SA 4O7DA 1K54C 4X6TA 5EVIB 4B4ZA 2VGKA 1E3UD 3VP4A 3NI9A 4KENB 3MZDA 4KZ4A 1I2SA 1KVMA 2QMIA 4N1XA 3GQZA 1O07A 2HDSA 1ES3A 1W5DA 2WADA 2XD1A 2WGVA 3SH7A 4KG5A 2Q9MA 1DJCA 1TDLA 4DXCA 1CEFA 4IEDA 2H5SA 4U3TA 4Q8IA 3ISGA 3IWQA 4WMCD 5FQIA 3VFHA 1EWZA 1BZAA 4LCLA 3DWKA 4U0TA 1G6AA 3BLSA 3LEZA 2PBYA 4EUZA 4OQGA 3IQAA 1KE4A 4QY5A 5F1GA 2WGWB 2Y2JA 4KZ6A 3VP2A 4OH0A 1VQQA 2C5WB 4GB7A 5EUAA 4JXSA 5GHXA 3HUMA 3BLMA 1QMFA 4K0WA 3ZHHA 2XFSA 3AGEA 4PM6A 5FI7A 4IVKA 4UA9A 5F83A 4R3BA 5GL9A 1G68A 3B3XA 3WS4A 1NZOA 5U47A 3E2LA 3IXHA 4ZDXA 1MY8A 5DVAA 1ZKJA 4E6XA 2VGJA 1PZOA 3OCNA 4EV4A 1M6KA 3VOYA 3CZDA 2XFTA 2IWCA 1BSGA 4A5RA 1YMXA 3WS0A 2H0YA 5E2FA 5CGXA 3HUNA 3UN7A 2R9WA 1Z6FA 2J9OA 2DCFA 2I72A 3FZCA 4S2JA 4WZ5A 1L0EA 5CERA 4KZ9A 2Y59A 4KZ7A 1LL9A 4X53A 3IHBA 2HP5A 3PBTA 2WZXA 3M6BA 2EFUA 4R0QA 2Y2KA 4X55A 2WKIA 5FQJA 5L2FA 3GR2A 4RYEA 1RGYA 1IELA 4RX2A 1YQSA 3NDGA 4OVDA 4E3IA 3D4FA 3SS4A 2H0TA 1ZG4A 3LCEA 2ZQCA
chains in the Genus database with same CATH superfamily
3QP6A 3RH8B 2ZOHA 1U60A 5GLAA 3BFEA 4S2KA 1PRQA 2Z6CA 4EEUA 2QKPA 3M2KA 2VGLS 1P9RA 1IEMA 1WYBA 4JGOA 1YLZA 2GNXA 3BFFA 5KIZA 3G4PA 5EVIA 1Z09A 1XFNA 1W8YA 1K25A 3T1QB 3KYZA 1NWZA 2JBFA 3SS5A 4R3AA 3MQ0A 1YMSA 2EFXA 5TGFA 3HJKA 1LHYA 3IWOA 3F1PB 4ESPA 3T4QA 4FUWA 5FAPA 5HWVA 5AQAA 3QP5A 5CRFA 5CTNA 3JVVA 3NOTC 1MKIA 2WGWA 1GCEA 1F5MA 2HGVA 3NCKA 1F9IA 1MWTA 1GSWA 2QYBA 3LI9A 5MC7A 1K0KA 5M18A 1PW1A 3CPTB 2FH5A 1Y54A 2P08A 1NY0A 2P04A 4KUKA 4UAAA 1RCJA 4X1LA 1FIKA 3T1SA 2JKGA 1O7EA 3TRCA 4DDSA 4QD4A 1GHMA 3C30A 5FQQA 1CI8A 4YNRA 2Y55A 3FYZA 3MQQA 4FOFA 4P87A 5CHMA 1FQGA 1I5QA 3LY4A 4MN5A 3EQUA 2J8YA 2PYRA 4BBTA 3MXSA 2GZAA 2H10A 4E3MA 2ZJ9A 2J7VA 5F69A 3V3RA 2ZQ7A 1Y4OA 3W4OA 1MPLA 1SZVA 2W1TA 1D7EA 3IS2B 4X1MA 1MC0A 1XA1A 3FKVA 4L9EA 4N9KA 2L4RA 3F1PA 4KQQA 3GTCA 3TSGA 2O9BA 4KZAA 1XGJA 3HLFA 4R23A 5CGSA 4DE0A 4CLCA 2ZM2A 2JE5A 5FDSA 2R9XA 3IBRA 3T4SA 4Y13A 3CPTA 4YWZA 4E6WA 2PR6A 1FCMA 4GJ4A 3UB5P 2XF3A 2P74A 3P98A 5EOOA 4PKYA 5HDDA 2VZWA 3IXBA 1BLPA 2J3TC 4DE1A 3BFDA 2HP6A 3LYXA 3BJNA 4L0LA 3AGDA 1F2KA 5FDHA 5HW3A 4BJPA 1S67L 3N7WA 4CLCC 2XROA 3Q1FA 4DE3A 1W63Q 2B5RA 3CUEC 4IBRA 1L0GA 3BEBA 3A3FA 2VV8A 4EBNA 1FILA 3NULA 1FR6A 4DJ3A 4WM9A 2X02A 5GLDA 3MZEA 4YOFA 2HV1A 4IBXA 1JTGA 2DNSA 4GCZA 4PHTA 2ZQAA 1XFQA 1MZUA 4HHDA 3IS2A 2PHYA 1STZA 3MFDA 3ZG0A 4KQOA 2JKTI 3HJIA 2B95A 4H8RA 3UPOA 5FAQA 3IHAA 1NLZA 2IWDA 4HOIA 3KSFA 3O88A 3WS1A 4WEKA 2M7UA 4XUZA 2BLSA 1GA9A 1V9ZA 3GV9A 4OOLA 3FC7A 3MXQA 3UO9A 4UA7A 5I94A 2EWWA 4RQ9A 4Y15A 3JVUA 1GSXA 4MDZA 4L9GA 1K6RA 4BD1A 5M1AA 1DJBA 4IUHA 4ME4A 4E3LA 1NYMA 1BULA 2E8IA 3ZVTA 4II7A 2JKFA 3G2ZA 3V39A 4NXEA 2Y4AA 5DF8A 1K55A 4BMWA 1LI9A 3C7UA 3V5MA 4LV2A 3CJMA 3PXPA 1H8MA 1K4FA 3C8CA 3A3JA 3VE3A 4WF0A 1YPRA 1DJAA 4S2NA 1N9OA 3NIAA 2OLUA 3BY8A 1OTAA 4ID4A 3PBQA 3UB9A 3K3DA 1K55C 1ALQA 4BWIA 2WKHA 1RGZA 1X0OA 4I3JA 2EXBA 3LR3A 3RJUA 2HJ9C 4KG2A 5HDSA 2V1ZA 4S2IA 4JGQA 3MSHA 4S2NC 3LI8A 4GDNA 2Y2NA 1ONGA 2JKTM 1L0FA 5AQ7A 2VV6A 2WYXA 4GN2A 3IF6B 1K4EA 2OSUA 3AGFA 3CG5A 2HJEA 1YLYA 5A90A 4OLGA 1YSQA 3UPNA 1XA7A 1FSWA 3A0VA 4HJ4A 2H28A 5F82A 1FCNA 2GDNA 2ACGA 4F3LB 5AVEA 1E4DA 1C3BA 1SDEA 1CJFA 3HLDA 2G7UA 3ZNTA 2ZC5B 1T19A 4ZAMA 3HLBA 1XJ4A 4HQAA 4N1HA 5AVFA 4KZ5A 3N8SA 4LRZE 2VGKA 1E3UD 4N1XA 1KVMA 3GQZA 3H9WA 3SH7A 4DXCA 4Q0HA 1J3WA 5J4EA 3VFHA 4WMCD 4EETB 3BLSA 3LEZA 2L0WA 4EUZA 4R6LA 4OQGA 3IQAA 2O9CA 1VQQA 2C5WB 5EUAA 3BLMA 4K0WA 4Y5FA 3ZHHA 5F83A 4R3BA 3B3XA 3WS4A 3E2LA 1G28A 5DVAA 4JGPA 1ZKJA 4E6XA 1PZOA 2B02A 2V0UA 3EGDC 3CZDA 4MN6A 2H0YA 1DP6A 2R9WA 2J9OA 2DCFA 2I72A 1VB6A 4KZ7A 2VLGA 5C5KA 2EFUA 5FQJA 5L2FA 3GR2A 1RGYA 3NHQA 2H0TA 1CQAA 4PMAA 3B42A 5J3WA 1CEGA 5EE8A 5D3OA 4F3LA 4XT2B 1MWSA 1TEMA 3RFBA 3LEQA 1ZC2A 1SHVA 1OJ5A 2Z2LB 2B18A 3MJQA 1UWPX 1LI0A 4I39A 1TVFA 1EROA 1SKFA 4GHIB 3PYPA 4HP4A 4NKPA 2BG1A 3GVBA 1MBLA 4K0XA 4S2PA 5HPIA 1TD5A 2J9PA 4PM8A 3MFXA 2WUQA 4N9LA 3QNCA 2O99A 4ZTKA 2ZQ9A 4R3JA 1G6OA 2VV7A 4RX3A 1LSWA 1NLYA 3G32A 1H5XA 4O8GA 3H82A 4GKUA 5CGWA 4Z1WA 4MN7A 4Q0JA 1K57A 4P6BA 4R70A 3RXWA 2VGLM 3T1RA 2PR5A 2PT7A 4JGRA 4G3VA 1D1JA 3UY6A 3ZQ5A 3NECA 5FI2A 4MBKA 4JBFA 1JWZA 5EM1A 3UDXA 5FL3A 4OLDA 1ESIA 3OLOA 4HP9A 4EQIA 3UE1A 1K57C 2YKHA 4LENA 3PAEA 5TBMB 4YFMA 4LFUA 2WAFA 4ARZB 1YLWA 2VJWA 3WRZA 1XX2A 3G34A 3DBAA 1XJ6A 2V20A 3VP3A 4OPQA 4Y17A 2JN7A 3LO7A 2XEPA 2OOLA 1N9BA 4DKIA 5DTTA 3T4KA 4H6JA 3HLGA 5F6AA 2RCXA 4X56A 3GDIA 3OC2A 5KZHA 5AQBA 2KX6A 1JWVA 4KQDA 4DF6A 4E04A 2WKEA 2ZC7A 1BT5A 3S7OA 4D2OA 4OONA 5GHYA 3FV7A 3S7QA 2A49A 2EX6A 3LICA 1V9YA 2KLIA 1TS8A 4NG2A 5HAPA 3H7WB 4WZ5C 4BLMA 2ZL1B 1OT9A 3DAVA 3KO6A 3S1YA 1PNEA 4IHQA 5FAOA 4DE2A 4F94A 5CHUA 4ETXA 2XDMA 2Y2MA 2PD7A 4CJNA 1IOUA 4LPZA 1VETA 1ERQA 1KGFA 3TE8A 4UQIS 1K6SA 4AFIA 3WWXA 4FCFA 5TBMA 2XQZA 5EVIC 5EPHA 4I3AA 3PAGA 1L2SA 4KG6A 2J3WA 1EI5A 3VOLA 5A91A 1LSVA 2OLVA 3HL9A 3SZTA 3ZG8B 3D72A 3MF0A 3UMEA 2XRNA 4E3OA 4FSFA 4S2MA 3FWLA 5JYOA 1BLCA 5DF7A 1IYQA 4RA7A 3PR6A 2RL3A 1WA9A 2V9AA 3NY4A 1VEUA 3LUQA 4CPKA 4B9OA 2BASA 4GS9B 2QPNA 5AJGA 1XJ3A 1H8ZA 2Z2MB 1JWPA 1TDGA 4GLQA 5BOHA 1ZHHB 4B88A 1OJGA 3H7WA 2ZL1A 3C4PA 3FKWA 3ZG5A 5GHZA 5J8XA 2C6WB 1SKOB 5HZHA 5EVLA 3A3EA 3B47A 4PPRA 5G4ZA 4QJGA 3Q7VB 2LB5A 1T1BA 1DP9A 1K56D 3KSIA 2Z6DA 3IXGA 4HBUA 1M40A 3LGOA 4MBHA 3VFFA 3ZG9B 3ICYA 4PM5A 2K7SA 3DWZA 1BYWA 5HWTA 1EW0A 3NJAA 1S1YA 2KDKA 3CWFA 3LIAA 4EXOA 4E3JA 1PI5A 3DW0A 4S2LA 4WBGA 4WYYA 3BFGA 2I9VA 5HWWA 1HVBA 3BM6A 1GSVA 3BQAA 3NOPC 5EM0A 5HX9A 2CMNA 1NRFA 2LB9A 2Q9NA 5FQMA 3T4JA 1YAXA 3N8LA 3PHYA 4PM9A 3CLOA 3SH9A 2HPBA 5FATA 1N9LA 2X71A 3VP0A 3F1NB 1A0KA 1QMEA 2XGNA 4UHUA 3O3VA 5L07A 5IHVA 5GLCA 4QB8A 5K5BA 4CQHA 2Y91A 1BLSA 3VOZA 4UA6A 1T18A 3PBSA 1ERMA 1SDNA 5IT5A 1P9WA 2ZBBA 4JPMA 4O0PA 5EVEA 1NYYA 4U0XA 1ES5A 3BY9A 3QHYA 3N8RA 2UWXA 4LLOB 3O5YA 3P09A 5HDCA 4MEZA 2YKFA 3BFCA 3LR5A 4B93A 2ZMVA 3NOUC 4X25A 5HAQA 2QHKA 5FI6A 4UEYA 3OPRA 4O7DA 4X6TA 3VP4A 3NI9A 3MZDA 1I2SA 2QMIA 3CAXA 2WADA 2XD1A 5TJJA 1DJCA 1TDLA 4KUOA 4IEDA 2H5SA 1CF0A 2Y8HA 3ISGA 3IWQA 3T50A 1BZAA 3DWKA 3BQ8A 5IS1A 3FG8A 4EEPA 4WLAA 1KE4A 4QY5A 3VP2A 4OH0A 1OTDA 1KOUA 4JXSA 3HUMA 4QWOA 1QMFA 2JKRI 4LGWA 2GX5A 4UA9A 5GL9A 3IX4A 1NZOA 3IXHA 4ZDXA 1MY8A 2OWHA 2VGJA 1M6KA 3LFVA 3VOYA 2IWCA 5E2FA 5CGXA 4HJ6A 3UN7A 4S2JA 1L0EA 1S4RA 1P0ZA 3IHBA 2HP5A 4R0QA 2Y2KA 1IELA 4RX2A 1YQSA 3C38A 3D4FA 2FZ0A 3OZHA 1W7FA 3O86A 5HFOA 1PWCA 3E0YA 2L1MA 1LT0A 3MBZA 3IWIA 1FSYA 3ZG7B 3W8KA 3R7WB 3MS6A 3F1OB 3D3OA 4R4RA 1NZUA 3ZDJA 5J7EA 4R4SA 2ZM8A 3LIEA 4P85A 3S7NA 5FASA 2R78A 3LIBA 4EBLA 2HDQA 4EWFA 3OPHA 2FFYA 2Y2HA 4GNUA 3HLCA 4FH4A 3BECA 2JKRM 3C4OA 1DY6A 2Y2GA 3GMWA 1JVJA 1JNUA 1NXYA 2A2LA 1D06A 3CITA 1S1ZA 3KYQA 5IU1A 4EW7A 2G2WA 3VV4A 1T1AA 3G30A 1J9MA 4OQ0A 3MR0A 5GLBA 3HLEA 3M2JA 1W8QA 3VSLA 2V8CA 4C75A 4JF4A 2XR0A 3P01A 1YLJA 3GRJA 1PW8A 2MJ6A 4KZBA 2Y2IA 3Q07A 3UB8A 1OTEA 1XKZA 2ZC6B 1T1CA 1UGUA 3DTMA 3EQVA 2HZ5A 4ZJ2A 4P0MA 2WK0A 3GECA 5I5LA 1GHPA 2X01A 1E3UA 2EX2A 3RXXA 4ZBEA 4OPYA 3VSKA 5CEBA 3ZGAB 2XSSA 1N4OA 2K31A 3IH9A 3O87A 3K3CA 2XA7M 4DRTA 3F1OA 1IFQA 1NRJA 4RVAA 3IF6A 2V8FA 3OCLA 4C6YA 4WMCA 1YLPA 2IWBA 3ZCZA 4WN5A 5L8MA 1G5UA 3UNWA 4MMNA 2A3UA 1CK3A 5HAIA 1PIOA 1TS7A 3SH8A 1YLTA 3IF6C 1WE4A 4OPRA 2QJ7A 3LIFA 3A0SA 4KZ8A 3ZYTA 2WAEA 1ZTUA 3WS5A 3IT9A 1L0DA 1XXMA 2WKQA 3D9YA 4HH3A 3NBLA 3Q81A 3U4LP 1PWGA 3R4KA 5HARA 5E43A 2V1AA 3PBOA 4GOGA 3ZVWA 1IKGA 4Y3IA 1OT6A 4R1GA 2OV5A 4MBFA 4G3WA 4PM7A 4M4XA 4EERA 3C7VA 3NDEA 3MMHA 4HESA 1MKMA 3QP4A 5DFYA 1IYOA 1H0MA 3T4LA 5A8BA 4HBTA 4NK3A 1XGIA 2EX9A 4NEED 2Q0OA 3S4XA 3K2NA 3ITBA 4P6ZS 1FCOA 5KSHA 4R38A 3OPPA 1S66L 3T4TA 2ZM0A 5CXWA 4L9FA 4K91A 3W2ZA 4Z9QA 2QWSA 1KDSA 2HP9A 2Y79A 1I2WA 1PZPA 2D02A 3W4PA 1AXBA 1YT4A 4N92A 3WS2A 3EOIA 3MXRA 2WKRA 4XT2A 1K38A 3TOIA 3S7PA 1FR1A 3QP2A 5E2EA 3HREA 4OKPA 4GHIA 2ZMAA 4WUJA 3LIDA 4FD8A 3MKFA 3FPVA 2DMWA 4GDBA 3JYIA 5FA7A 4LCMA 4OQIA 3G31A 5EECA 4HJ3A 5EVID 4PKYG 3HBRA 1P97A 2PDRA 2W3DA 1S6RA 4IVIA 1TS6A 4YINA 4HNBA 3ULFA 5LBRA 1XP4A 2D01A 1W79A 1Q2QA 3CI6A 5TR7A 4I3IA 2ZD8A 2O9AA 5L09A 4Y7PA 5DKLA 3UMDA 2PYPA 2OAP1 2PAVP 3T1XA 4EUVA 1VHMA 2M1CA 1OMEA 5KSCA 3KX0X 2INWA 3SS3A 5KMWA 1MWUA 1BUEA 2NUPC 5DF9A 1ES4A 2W1TB 3BYDA 4ARZA 4BL3A 4EQ1A 2Y2OA 2W0NA 1HZOA 1YKDA 3SW1A 1L3LA 4EESA 5FEFA 1SCWA 3IXDA 1S4SA 3LY3A 2M7VA 3EEHA 4NXBA 4OOYA 4Y0UA 2UV0E 4JKTA 4Y0TA 3OPLA 4CLCB 4X69A 5HD3A 3UB6A 4B4ZA 4FTXA 4I38A 3L9KA 1F98A 2K2NA 4KENB 4KZ4A 1O07A 1W5DA 3P7NA 3E98A 4KG5A 2Q9MA 1CEFA 3EEAA 4U3TA 3IX8A 5FQIA 4DMZA 1EWZA 4U0TA 2W3HA 5HL6A 5F1GA 2Y2JA 4CLCE 4IVKA 5L10A 2J3TD 1G68A 5CX7A 2OAQ1 5DJTA 3LR0A 4CLCD 3MQOA 1OPXA 3HCYA 2W1RA 2XFTA 4DN0A 1BSGA 4A5RA 3DTEA 1LL9A 3DTIA 4HY8A 3PBTA 2WZXA 3NDGA 3IX3A 4OVDA 3SS4A 3TJZC 4JXVA 1ZG4A 3LCEA 3Q82A 1ACFA 1K56A 3FPWA 3ZNYA 1YM1A 1KDWA 1IYPA 4XUXA 4GZBA 4ZJ1A 5CTMA 4GW9A 3HVFA 1TF1A 4BQMA 3CUEA 1LL8A 3ZFZA 5DTSA 4LRXC 4GS9A 4QY6A 5JYPA 5HSQA 4E3KA 2EA9A 1KGGA 3MZFA 2QZ6A 2ZOIA 3KSHA 3PBNA 4NXGA 3CMZA 1SKOA 3E4PA 4FH2A 3Q7VA 3JPUA 4EU0A 4EBPA 3BWLA 1AWIA 1PFLA 3KSGA 2W3GA 4QPRA 1ZG6A 3VE4A 4O01A 4WEJA 4QU3A 1KE0A 2ZMFA 4MLLA 3N4IA 4LV3A 3UPPA 5HPFA 2E8JA 1ES2A 1KVLA 5FQKA 2EX8A 5EFWA 4LV1A 3V3SA 5F5YA 5CHJA 4KQRA 5EOEA 1PYYA 4JF6A 1CI9A 1WYCA 1LL5A 2FFFB 4NXFA 5HD5A 3C5AA 2AVXA 4DXBA 4OPZA 4QHCA 1ONHA 1BLHA 3A3DA 3F1NA 5M19A 3IH8A 4JXGA 1BTLA 1N9NA 4MNRA 4WZ4A 4BENA 3LR4A 4OOMA 3S22A 2WZZA 1TS0A 3QP8A 4OP5A 2QJ5A 4K08A 4KZ3A 4WELA 3G2YA 1ODVA 1S0WA 5FSRA 1E25A 3Q7ZA 3UE0A 5EV0A 5FQ9A 5CEDA 1IYSA 4JF5A 2W27A 2CC1A 1YSPA 2WKPA 3N6IA 5A93A 1PI4A 5G4YA 1XJ2A 5FEGA 5CECA 3HLWA 4Y0OA 1PWDA 1Q2PA 2NUTC 1NJ4A 2DRWA 3V67A 2JCHA 3C2WA 4G3KA 3A3IA 5HL1A 2P9VB 3UDFA 4GD8A 2JC7A 4HEFA 2ZQDA 2ZQ8A 3E4QA 2VEAA 1ESUA 4LRYC 1RP5A 5G18A 1JTDA 1IKIA 2PU2A 3IBJA 5DJUA 1DP8A 4XXRA 3U2AA 4LV0A 2Y2LA 1HD8A 5TFQA 3RTYA 1MWRA 3WRTA 1HLUP 4OQHA 3V50A 4JXWA 2ZC4B 3M6HA 1MXOA 2BTFP 1LLBA 3VMAA 3HUOA 1XPBA 4I5SA 3G35A 3TG9A 2XLNA 4E3NA 2P7JA 4IUKA 3VP1A 3MKEA 3E2KA 2V2FF 3UE3A 5A92A 4HI4A 2G2UA 3EWKA 3R7WA 2HDUA 4ETZA 4P6ZM 3H82B 3PBRA 4BD0A 4Y2FA 3EGXC 1HTZA 5DKKA 1OTIA 3GSGA 1H8YA 2PU4A 1KE3A 1Y28A 2J80A 4BL2A 3QP1A 1H3QA 3B33A 1GA0A 5DFXA 3T12B 3G6OA 1DRMA 4C3QA 2A24B 4ZJ3A 2P9VA 1FOFA 4OP8A 2EXAA 2XH9A 2O0YA 3W4QA 3TW8A 2WGIA 2ZC3B 2PBDP 4PAUA 4M3KA 3DTKA 3SOIA 4BBUA 4D60A 4GD6A 4S2OA 2XK1A 1KGEA 2GJ3A 1W63M 4X68A 4H6JB 5DTKA 2V0WA 4Q0IA 2VK3A 5AQ9A 4WL9A 4HH2A 4DDYA 3UB7A 1GHIA 2VX8A 2VA0A 2PRFA 3T4OA 2HDRA 5F1FA 1VM1A 3UE6A 3UDIA 5E2GA 2Y2PA 4NETA 1UWNX 1K54A 4MCWA 4DJ2A 4B4XA 3BW6A 2VKSA 3IF5A 2ZLYA 1OTBA 3NC8A 2V1BA 3PTEA 5E2HA 3I7JA 3BRMA 3QNBA 3ITAA 2Y2QA 4IJGA 4UQIM 2IA2A 2OWJA 2XD5A 4JLFA 5EVIB 1K54C 2PD8A 2XA7S 2HDSA 1ES3A 2JHEA 1VETB 2A24A 2WGVA 4Q8IA 4BBVA 3A0RA 3KYEA 3E4OA 4LCLA 1G6AA 2PBYA 3OBFA 3CHWP 2WGWB 4KZ6A 4GB7A 2W3FA 5GHXA 2XFSA 3AGEA 4PM6A 5FI7A 5F68A 5U47A 2HF6A 3OCNA 4EV4A 2EWVA 2KOIA 1YMXA 3WS0A 3HUNA 1Z6FA 3FZCA 4ZRRA 5CERA 4WZ5A 4KZ9A 2Y59A 3OOVA 3L7HA 4X53A 3M6BA 1VEUB 4X55A 2WKIA 2W3EA 4RYEA 4HIAA 4E3IA 1LSXA 2ZQCA
chains in the Genus database with same CATH topology
1W7FA 1K56A 3O86A 4PMAA 5HFOA 1CEGA 3ZNYA 5EE8A 5D3OA 1YM1A 1U60A 5GLAA 1PWCA 1MWSA 1TEMA 3BFEA 1KDWA 4S2KA 3MBZA 1ZC2A 1IYPA 1SHVA 3IWIA 1FSYA 3M2KA 4XUXA 2Z2LB 4GZBA 3W8KA 3ZG7B 1IEMA 1WYBA 4ZJ1A 1LI0A 1YLZA 3BFFA 1TVFA 3G4PA 1EROA 1SKFA 5CTMA 5EVIA 3HVFA 4R4RA 1NZUA 1W8YA 3ZDJA 4BQMA 4R4SA 1K25A 2BG1A 2ZM8A 3GVBA 4P85A 1MBLA 4K0XA 4S2PA 3ZFZA 5DTSA 5FASA 2J9PA 4PM8A 4EBLA 2HDQA 4QY6A 2JBFA 5JYPA 4EWFA 4E3KA 2WUQA 4N9LA 3QNCA 3SS5A 1KGGA 1YMSA 3MZFA 2FFYA 3OPHA 2EFXA 2QZ6A 4ZTKA 5TGFA 1LHYA 2Y2HA 2ZQ9A 3IWOA 4GNUA 4R3JA 3HLCA 5FAPA 5AQAA 4FH4A 3BECA 3PBNA 4RX3A 3C4OA 1DY6A 2Y2GA 3CMZA 5CRFA 5CTNA 3G32A 1MKIA 1H5XA 2WGWA 4FH2A 1GCEA 1JVJA 3GMWA 4GKUA 3Q7VA 5CGWA 1NXYA 3NCKA 4EBPA 1MWTA 1K57A 1ZG6A 4P6BA 3RXWA 5M18A 4WEJA 1PW1A 1KE0A 2G2WA 4MLLA 4QU3A 1Y54A 3N4IA 4LV3A 1NY0A 3G30A 3UPPA 3UY6A 1J9MA 4OQ0A 5GLBA 4UAAA 3HLEA 1RCJA 3M2JA 5FI2A 4MBKA 1ES2A 4JBFA 1JWZA 1KVLA 3UDXA 1W8QA 3VSLA 4OLDA 5FQKA 4JF4A 1ESIA 2XR0A 4C75A 4EQIA 2EX8A 3UE1A 1K57C 4LENA 3PAEA 4LV1A 1YLJA 3V3SA 4YFMA 1O7EA 5CHJA 3GRJA 1PW8A 4KQRA 5EOEA 4DDSA 1PYYA 4JF6A 4KZBA 1GHMA 2Y2IA 1CI9A 1WYCA 4QD4A 3Q07A 2WAFA 1LL5A 2FFFB 1YLWA 5FQQA 3WRZA 1CI8A 1XX2A 3G34A 2ZC6B 1XKZA 2Y55A 3FYZA 3DTMA 3C5AA 3EQVA 4ZJ2A 2V20A 3VP3A 4OPQA 4P0MA 4P87A 4DXBA 4OPZA 3LO7A 2XEPA 4QHCA 2WK0A 1N9BA 4DKIA 1ONHA 5CHMA 1FQGA 1BLHA 1I5QA 1GHPA 5DTTA 3A3DA 2X01A 5M19A 3IH8A 1E3UA 1BTLA 3LY4A 4JXGA 2EX2A 3RXXA 3EQUA 2J8YA 4OPYA 4ZBEA 4MNRA 4WZ4A 3VSKA 3ZGAB 5CEBA 3HLGA 3MXSA 4BENA 1N4OA 4OOMA 3IH9A 2H10A 2RCXA 3O87A 4X56A 2ZJ9A 2J7VA 3S22A 3V3RA 4DRTA 4E3MA 3OC2A 2WZZA 2ZQ7A 5AQBA 5KZHA 4OP5A 4RVAA 3W4OA 1MPLA 3IF6A 1JWVA 3OCLA 4C6YA 4WMCA 1YLPA 2IWBA 4DF6A 3ZCZA 2WKEA 1XA1A 2ZC7A 1BT5A 4KZ3A 4WELA 3G2YA 4D2OA 3UNWA 4OONA 5GHYA 3FKVA 3FV7A 1S0WA 5FSRA 1E25A 4N9KA 3Q7ZA 3UE0A 2A3UA 1CK3A 4KQQA 5FQ9A 5HAIA 3GTCA 3TSGA 5CEDA 4KZAA 1XGJA 2A49A 2EX6A 1PIOA 4JXVA 3SH8A 1IYSA 1YLTA 3HLFA 3IF6C 4JF5A 1WE4A 5HAPA 4R23A 4OPRA 4WZ5C 5CGSA 4BLMA 2CC1A 4DE0A 3Q82A 3N6IA 3S1YA 5FAOA 5A93A 1PI4A 4DE2A 2ZM2A 4KZ8A 2JE5A 4F94A 2R9XA 2WAEA 5CHUA 3WS5A 4E6WA 3IT9A 1L0DA 1FCMA 2XF3A 2P74A 1XXMA 3P98A 5EOOA 2XDMA 3IXBA 3NBLA 3Q81A 2Y2MA 5CECA 4CJNA 1PWGA 1BLPA 4DE1A 3BFDA 3HLWA 2HP6A 1PWDA 4Y0OA 5HARA 4L0LA 1Q2PA 3AGDA 1NJ4A 5E43A 2DRWA 1ERQA 1KGFA 5FDHA 5HW3A 3PBOA 4GOGA 4BJPA 3N7WA 2JCHA 1K6SA 3WWXA 3ZVWA 1IKGA 3Q1FA 4FCFA 3A3IA 4R1GA 2OV5A 4MBFA 5HL1A 4PM7A 2XQZA 4DE3A 2P9VB 3C7VA 3UDFA 4GD8A 5EVIC 2JC7A 3NDEA 4HEFA 5EPHA 2B5RA 3PAGA 1L2SA 4HESA 4IBRA 1L0GA 3BEBA 2ZQDA 3A3FA 4KG6A 1IYOA 4EBNA 1EI5A 1FR6A 2ZQ8A 1ESUA 4WM9A 5A91A 4HBTA 2OLVA 2X02A 3HL9A 4NK3A 1RP5A 5G18A 1XGIA 3ZG8B 1JTDA 2EX9A 1IKIA 5GLDA 3S4XA 2PU2A 3ITBA 3MZEA 4XXRA 1FCOA 4E3OA 5KSHA 3OPPA 2ZM0A 4FSFA 5CXWA 4LV0A 4IBXA 4S2MA 3FWLA 5JYOA 2Y2LA 4K91A 1HD8A 1BLCA 5DF7A 1JTGA 5TFQA 1MWRA 1IYQA 2DNSA 4Z9QA 4RA7A 3WRTA 2ZQAA 4OQHA 3V50A 4JXWA 1KDSA 2RL3A 2HP9A 2ZC4B 1MXOA 3M6HA 1LLBA 3VMAA 3NY4A 1I2WA 3MFDA 1PZPA 3HUOA 3ZG0A 4KQOA 3W4PA 4CPKA 1AXBA 4H8RA 3UPOA 1XPBA 5FAQA 3IHAA 3G35A 1YT4A 2IWDA 4N92A 3TG9A 2XLNA 3WS2A 4E3NA 3O88A 2QPNA 3WS1A 4WEKA 3MXRA 1H8ZA 2Z2MB 4XUZA 3VP1A 3MKEA 1JWPA 1GA9A 2BLSA 1TDGA 3E2KA 3GV9A 4OOLA 5BOHA 4B88A 1K38A 2V2FF 4UA7A 3TOIA 3UO9A 3C4PA 3UE3A 5I94A 3OZHA 5A92A 2G2UA 3FKWA 1FR1A 3ZG5A 5GHZA 5J8XA 1K6RA 4BD1A 5M1AA 1DJBA 2C6WB 5E2EA 4E3LA 1NYMA 3HREA 2HDUA 4OKPA 5EVLA 3A3EA 4PPRA 1BULA 2E8IA 2ZMAA 4QJGA 3ZVTA 3PBRA 3Q7VB 4BD0A 3G2ZA 3V39A 1K56D 1HTZA 3MKFA 4FD8A 3GSGA 3IXGA 1H8YA 2PU4A 1KE3A 1M40A 2Y4AA 4HBUA 4MBHA 5DF8A 1K55A 3VFFA 1LI9A 3ZG9B 4BL2A 3C7UA 4GDBA 3V5MA 4PM5A 4LV2A 1GA0A 3JYIA 5FA7A 4LCMA 3CJMA 3DWZA 4OQIA 3G31A 4C3QA 5EECA 1K4FA 3A3JA 4ZJ3A 2P9VA 5EVID 4E3JA 1PI5A 3DW0A 3HBRA 4S2LA 4WBGA 4WYYA 3BFGA 1FOFA 1DJAA 1S6RA 4S2NA 4OP8A 3NIAA 4IVIA 2OLUA 4ID4A 3PBQA 2EXAA 2XH9A 1K55C 3W4QA 1HVBA 3BM6A 1ALQA 4YINA 2WKHA 1RGZA 5HX9A 1NRFA 2WGIA 1XP4A 2ZC3B 2EXBA 1W79A 3RJUA 1Q2QA 2Q9NA 5TR7A 2ZD8A 5FQMA 4Y7PA 4KG2A 3N8LA 4M3KA 2V1ZA 4S2IA 3SOIA 4PM9A 3SH9A 4GD6A 2HPBA 4S2OA 5FATA 2X71A 3VP0A 2XK1A 1QMEA 1KGEA 4S2NC 1OMEA 4X68A 2XGNA 4GDNA 5KSCA 4UHUA 2Y2NA 5DTKA 1ONGA 3SS3A 1L0FA 1MWUA 3O3VA 5AQ7A 5KMWA 5AQ9A 4DDYA 1GHIA 1BUEA 4GN2A 2WYXA 5DF9A 5GLCA 4QB8A 5IHVA 1ES4A 3IF6B 2Y91A 1K4EA 1BLSA 3BYDA 3VOZA 2HDRA 4UA6A 4BL3A 2Y2OA 2OSUA 5F1FA 3PBSA 1VM1A 1ERMA 3AGFA 3CG5A 1SDNA 3UDIA 1YLYA 5E2GA 5A90A 2Y2PA 4NETA 4OLGA 3UPNA 1HZOA 4JPMA 1NYYA 1XA7A 4U0XA 1K54A 1FSWA 1ES5A 1SCWA 3IXDA 5F82A 3LY3A 3QHYA 1FCNA 3N8RA 4B4XA 2GDNA 4OOYA 2UWXA 4Y0UA 3IF5A 4JKTA 2ZLYA 3NC8A 4Y0TA 1E4DA 1C3BA 5E2HA 3PTEA 1SDEA 3I7JA 3HLDA 3OPLA 3P09A 4MEZA 3ZNTA 3BRMA 3QNBA 2ZC5B 3ITAA 3BFCA 4X69A 4ZAMA 3HLBA 4N1HA 2Y2QA 5HAQA 5FI6A 3OPRA 2XD5A 4JLFA 4KZ5A 3N8SA 4O7DA 1K54C 4X6TA 5EVIB 4B4ZA 2VGKA 1E3UD 3VP4A 3NI9A 4KENB 3MZDA 4KZ4A 1I2SA 1KVMA 2QMIA 4N1XA 3GQZA 1O07A 2HDSA 1ES3A 1W5DA 2WADA 2XD1A 2WGVA 3SH7A 4KG5A 2Q9MA 1DJCA 1TDLA 4DXCA 1CEFA 4IEDA 2H5SA 4U3TA 4Q8IA 3ISGA 3IWQA 4WMCD 5FQIA 3VFHA 1EWZA 1BZAA 4LCLA 3DWKA 4U0TA 1G6AA 3BLSA 3LEZA 2PBYA 4EUZA 4OQGA 3IQAA 1KE4A 4QY5A 5F1GA 2WGWB 2Y2JA 4KZ6A 3VP2A 4OH0A 1VQQA 2C5WB 4GB7A 5EUAA 4JXSA 5GHXA 3HUMA 3BLMA 1QMFA 4K0WA 3ZHHA 2XFSA 3AGEA 4PM6A 5FI7A 4IVKA 4UA9A 5F83A 4R3BA 5GL9A 1G68A 3B3XA 3WS4A 1NZOA 5U47A 3E2LA 3IXHA 4ZDXA 1MY8A 5DVAA 1ZKJA 4E6XA 2VGJA 1PZOA 3OCNA 4EV4A 1M6KA 3VOYA 3CZDA 2XFTA 2IWCA 1BSGA 4A5RA 1YMXA 3WS0A 2H0YA 5E2FA 5CGXA 3HUNA 3UN7A 2R9WA 1Z6FA 2J9OA 2DCFA 2I72A 3FZCA 4S2JA 4WZ5A 1L0EA 5CERA 4KZ9A 2Y59A 4KZ7A 1LL9A 4X53A 3IHBA 2HP5A 3PBTA 2WZXA 3M6BA 2EFUA 4R0QA 2Y2KA 4X55A 2WKIA 5FQJA 5L2FA 3GR2A 4RYEA 1RGYA 1IELA 4RX2A 1YQSA 3NDGA 4OVDA 4E3IA 3D4FA 3SS4A 2H0TA 1ZG4A 3LCEA 2ZQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W7F A;  1K56 A;  3O86 A;  4PMA A;  5HFO A;  1CEG A;  3ZNY A;  5EE8 A;  5D3O A;  1YM1 A;  1U60 A;  5GLA A;  1PWC A;  1MWS A;  1TEM A;  3BFE A;  1KDW A;  4S2K A;  3MBZ A;  1ZC2 A;  1IYP A;  1SHV A;  3IWI A;  1FSY A;  3M2K A;  4XUX A;  2Z2L B;  4GZB A;  3W8K A;  3ZG7 B;  1IEM A;  1WYB A;  4ZJ1 A;  1LI0 A;  1YLZ A;  3BFF A;  1TVF A;  3G4P A;  1ERO A;  1SKF A;  5CTM A;  5EVI A;  3HVF A;  4R4R A;  1NZU A;  1W8Y A;  3ZDJ A;  4BQM A;  4R4S A;  1K25 A;  2BG1 A;  2ZM8 A;  3GVB A;  4P85 A;  1MBL A;  4K0X A;  4S2P A;  3ZFZ A;  5DTS A;  5FAS A;  2J9P A;  4PM8 A;  4EBL A;  2HDQ A;  4QY6 A;  2JBF A;  5JYP A;  4EWF A;  4E3K A;  2WUQ A;  4N9L A;  3QNC A;  3SS5 A;  1KGG A;  1YMS A;  3MZF A;  2FFY A;  3OPH A;  2EFX A;  2QZ6 A;  4ZTK A;  5TGF A;  1LHY A;  2Y2H A;  2ZQ9 A;  3IWO A;  4GNU A;  4R3J A;  3HLC A;  5FAP A;  5AQA A;  4FH4 A;  3BEC A;  3PBN A;  4RX3 A;  3C4O A;  1DY6 A;  2Y2G A;  3CMZ A;  5CRF A;  5CTN A;  3G32 A;  1MKI A;  1H5X A;  2WGW A;  4FH2 A;  1GCE A;  1JVJ A;  3GMW A;  4GKU A;  3Q7V A;  5CGW A;  1NXY A;  3NCK A;  4EBP A;  1MWT A;  1K57 A;  1ZG6 A;  4P6B A;  3RXW A;  5M18 A;  4WEJ A;  1PW1 A;  1KE0 A;  2G2W A;  4MLL A;  4QU3 A;  1Y54 A;  3N4I A;  4LV3 A;  1NY0 A;  3G30 A;  3UPP A;  3UY6 A;  1J9M A;  4OQ0 A;  5GLB A;  4UAA A;  3HLE A;  1RCJ A;  3M2J A;  5FI2 A;  4MBK A;  1ES2 A;  4JBF A;  1JWZ A;  1KVL A;  3UDX A;  1W8Q A;  3VSL A;  4OLD A;  5FQK A;  4JF4 A;  1ESI A;  2XR0 A;  4C75 A;  4EQI A;  2EX8 A;  3UE1 A;  1K57 C;  4LEN A;  3PAE A;  4LV1 A;  1YLJ A;  3V3S A;  4YFM A;  1O7E A;  5CHJ A;  3GRJ A;  1PW8 A;  4KQR A;  5EOE A;  4DDS A;  1PYY A;  4JF6 A;  4KZB A;  1GHM A;  2Y2I A;  1CI9 A;  1WYC A;  4QD4 A;  3Q07 A;  2WAF A;  1LL5 A;  2FFF B;  1YLW A;  5FQQ A;  3WRZ A;  1CI8 A;  1XX2 A;  3G34 A;  2ZC6 B;  1XKZ A;  2Y55 A;  3FYZ A;  3DTM A;  3C5A A;  3EQV A;  4ZJ2 A;  2V20 A;  3VP3 A;  4OPQ A;  4P0M A;  4P87 A;  4DXB A;  4OPZ A;  3LO7 A;  2XEP A;  4QHC A;  2WK0 A;  1N9B A;  4DKI A;  1ONH A;  5CHM A;  1FQG A;  1BLH A;  1I5Q A;  1GHP A;  5DTT A;  3A3D A;  2X01 A;  5M19 A;  3IH8 A;  1E3U A;  1BTL A;  3LY4 A;  4JXG A;  2EX2 A;  3RXX A;  3EQU A;  2J8Y A;  4OPY A;  4ZBE A;  4MNR A;  4WZ4 A;  3VSK A;  3ZGA B;  5CEB A;  3HLG A;  3MXS A;  4BEN A;  1N4O A;  4OOM A;  3IH9 A;  2H10 A;  2RCX A;  3O87 A;  4X56 A;  2ZJ9 A;  2J7V A;  3S22 A;  3V3R A;  4DRT A;  4E3M A;  3OC2 A;  2WZZ A;  2ZQ7 A;  5AQB A;  5KZH A;  4OP5 A;  4RVA A;  3W4O A;  1MPL A;  3IF6 A;  1JWV A;  3OCL A;  4C6Y A;  4WMC A;  1YLP A;  2IWB A;  4DF6 A;  3ZCZ A;  2WKE A;  1XA1 A;  2ZC7 A;  1BT5 A;  4KZ3 A;  4WEL A;  3G2Y A;  4D2O A;  3UNW A;  4OON A;  5GHY A;  3FKV A;  3FV7 A;  1S0W A;  5FSR A;  1E25 A;  4N9K A;  3Q7Z A;  3UE0 A;  2A3U A;  1CK3 A;  4KQQ A;  5FQ9 A;  5HAI A;  3GTC A;  3TSG A;  5CED A;  4KZA A;  1XGJ A;  2A49 A;  2EX6 A;  1PIO A;  4JXV A;  3SH8 A;  1IYS A;  1YLT A;  3HLF A;  3IF6 C;  4JF5 A;  1WE4 A;  5HAP A;  4R23 A;  4OPR A;  4WZ5 C;  5CGS A;  4BLM A;  2CC1 A;  4DE0 A;  3Q82 A;  3N6I A;  3S1Y A;  5FAO A;  5A93 A;  1PI4 A;  4DE2 A;  2ZM2 A;  4KZ8 A;  2JE5 A;  4F94 A;  2R9X A;  2WAE A;  5CHU A;  3WS5 A;  4E6W A;  3IT9 A;  1L0D A;  1FCM A;  2XF3 A;  2P74 A;  1XXM A;  3P98 A;  5EOO A;  2XDM A;  3IXB A;  3NBL A;  3Q81 A;  2Y2M A;  5CEC A;  4CJN A;  1PWG A;  1BLP A;  4DE1 A;  3BFD A;  3HLW A;  2HP6 A;  1PWD A;  4Y0O A;  5HAR A;  4L0L A;  1Q2P A;  3AGD A;  1NJ4 A;  5E43 A;  2DRW A;  1ERQ A;  1KGF A;  5FDH A;  5HW3 A;  3PBO A;  4GOG A;  4BJP A;  3N7W A;  2JCH A;  1K6S A;  3WWX A;  3ZVW A;  1IKG A;  3Q1F A;  4FCF A;  3A3I A;  4R1G A;  2OV5 A;  4MBF A;  5HL1 A;  4PM7 A;  2XQZ A;  4DE3 A;  2P9V B;  3C7V A;  3UDF A;  4GD8 A;  5EVI C;  2JC7 A;  3NDE A;  4HEF A;  5EPH A;  2B5R A;  3PAG A;  1L2S A;  4HES A;  4IBR A;  1L0G A;  3BEB A;  2ZQD A;  3A3F A;  4KG6 A;  1IYO A;  4EBN A;  1EI5 A;  1FR6 A;  2ZQ8 A;  1ESU A;  4WM9 A;  5A91 A;  4HBT A;  2OLV A;  2X02 A;  3HL9 A;  4NK3 A;  1RP5 A;  5G18 A;  1XGI A;  3ZG8 B;  1JTD A;  2EX9 A;  1IKI A;  5GLD A;  3S4X A;  2PU2 A;  3ITB A;  3MZE A;  4XXR A;  1FCO A;  4E3O A;  5KSH A;  3OPP A;  2ZM0 A;  4FSF A;  5CXW A;  4LV0 A;  4IBX A;  4S2M A;  3FWL A;  5JYO A;  2Y2L A;  4K91 A;  1HD8 A;  1BLC A;  5DF7 A;  1JTG A;  5TFQ A;  1MWR A;  1IYQ A;  2DNS A;  4Z9Q A;  4RA7 A;  3WRT A;  2ZQA A;  4OQH A;  3V50 A;  4JXW A;  1KDS A;  2RL3 A;  2HP9 A;  2ZC4 B;  1MXO A;  3M6H A;  1LLB A;  3VMA A;  3NY4 A;  1I2W A;  3MFD A;  1PZP A;  3HUO A;  3ZG0 A;  4KQO A;  3W4P A;  4CPK A;  1AXB A;  4H8R A;  3UPO A;  1XPB A;  5FAQ A;  3IHA A;  3G35 A;  1YT4 A;  2IWD A;  4N92 A;  3TG9 A;  2XLN A;  3WS2 A;  4E3N A;  3O88 A;  2QPN A;  3WS1 A;  4WEK A;  3MXR A;  1H8Z A;  2Z2M B;  4XUZ A;  3VP1 A;  3MKE A;  1JWP A;  1GA9 A;  2BLS A;  1TDG A;  3E2K A;  3GV9 A;  4OOL A;  5BOH A;  4B88 A;  1K38 A;  2V2F F;  4UA7 A;  3TOI A;  3UO9 A;  3C4P A;  3UE3 A;  5I94 A;  3OZH A;  5A92 A;  2G2U A;  3FKW A;  1FR1 A;  3ZG5 A;  5GHZ A;  5J8X A;  1K6R A;  4BD1 A;  5M1A A;  1DJB A;  2C6W B;  5E2E A;  4E3L A;  1NYM A;  3HRE A;  2HDU A;  4OKP A;  5EVL A;  3A3E A;  4PPR A;  1BUL A;  2E8I A;  2ZMA A;  4QJG A;  3ZVT A;  3PBR A;  3Q7V B;  4BD0 A;  3G2Z A;  3V39 A;  1K56 D;  1HTZ A;  3MKF A;  4FD8 A;  3GSG A;  3IXG A;  1H8Y A;  2PU4 A;  1KE3 A;  1M40 A;  2Y4A A;  4HBU A;  4MBH A;  5DF8 A;  1K55 A;  3VFF A;  1LI9 A;  3ZG9 B;  4BL2 A;  3C7U A;  4GDB A;  3V5M A;  4PM5 A;  4LV2 A;  1GA0 A;  3JYI A;  5FA7 A;  4LCM A;  3CJM A;  3DWZ A;  4OQI A;  3G31 A;  4C3Q A;  5EEC A;  1K4F A;  3A3J A;  4ZJ3 A;  2P9V A;  5EVI D;  4E3J A;  1PI5 A;  3DW0 A;  3HBR A;  4S2L A;  4WBG A;  4WYY A;  3BFG A;  1FOF A;  1DJA A;  1S6R A;  4S2N A;  4OP8 A;  3NIA A;  4IVI A;  2OLU A;  4ID4 A;  3PBQ A;  2EXA A;  2XH9 A;  1K55 C;  3W4Q A;  1HVB A;  3BM6 A;  1ALQ A;  4YIN A;  2WKH A;  1RGZ A;  5HX9 A;  1NRF A;  2WGI A;  1XP4 A;  2ZC3 B;  2EXB A;  1W79 A;  3RJU A;  1Q2Q A;  2Q9N A;  5TR7 A;  2ZD8 A;  5FQM A;  4Y7P A;  4KG2 A;  3N8L A;  4M3K A;  2V1Z A;  4S2I A;  3SOI A;  4PM9 A;  3SH9 A;  4GD6 A;  2HPB A;  4S2O A;  5FAT A;  2X71 A;  3VP0 A;  2XK1 A;  1QME A;  1KGE A;  4S2N C;  1OME A;  4X68 A;  2XGN A;  4GDN A;  5KSC A;  4UHU A;  2Y2N A;  5DTK A;  1ONG A;  3SS3 A;  1L0F A;  1MWU A;  3O3V A;  5AQ7 A;  5KMW A;  5AQ9 A;  4DDY A;  1GHI A;  1BUE A;  4GN2 A;  2WYX A;  5DF9 A;  5GLC A;  4QB8 A;  5IHV A;  1ES4 A;  3IF6 B;  2Y91 A;  1K4E A;  1BLS A;  3BYD A;  3VOZ A;  2HDR A;  4UA6 A;  4BL3 A;  2Y2O A;  2OSU A;  5F1F A;  3PBS A;  1VM1 A;  1ERM A;  3AGF A;  3CG5 A;  1SDN A;  3UDI A;  1YLY A;  5E2G A;  5A90 A;  2Y2P A;  4NET A;  4OLG A;  3UPN A;  1HZO A;  4JPM A;  1NYY A;  1XA7 A;  4U0X A;  1K54 A;  1FSW A;  1ES5 A;  1SCW A;  3IXD A;  5F82 A;  3LY3 A;  3QHY A;  1FCN A;  3N8R A;  4B4X A;  2GDN A;  4OOY A;  2UWX A;  4Y0U A;  3IF5 A;  4JKT A;  2ZLY A;  3NC8 A;  4Y0T A;  1E4D A;  1C3B A;  5E2H A;  3PTE A;  1SDE A;  3I7J A;  3HLD A;  3OPL A;  3P09 A;  4MEZ A;  3ZNT A;  3BRM A;  3QNB A;  2ZC5 B;  3ITA A;  3BFC A;  4X69 A;  4ZAM A;  3HLB A;  4N1H A;  2Y2Q A;  5HAQ A;  5FI6 A;  3OPR A;  2XD5 A;  4JLF A;  4KZ5 A;  3N8S A;  4O7D A;  1K54 C;  4X6T A;  5EVI B;  4B4Z A;  2VGK A;  1E3U D;  3VP4 A;  3NI9 A;  4KEN B;  3MZD A;  4KZ4 A;  1I2S A;  1KVM A;  2QMI A;  4N1X A;  3GQZ A;  1O07 A;  2HDS A;  1ES3 A;  1W5D A;  2WAD A;  2XD1 A;  2WGV A;  3SH7 A;  4KG5 A;  2Q9M A;  1DJC A;  1TDL A;  4DXC A;  1CEF A;  4IED A;  2H5S A;  4U3T A;  4Q8I A;  3ISG A;  3IWQ A;  4WMC D;  5FQI A;  3VFH A;  1EWZ A;  1BZA A;  4LCL A;  3DWK A;  4U0T A;  1G6A A;  3BLS A;  3LEZ A;  2PBY A;  4EUZ A;  4OQG A;  3IQA A;  1KE4 A;  4QY5 A;  5F1G A;  2WGW B;  2Y2J A;  4KZ6 A;  3VP2 A;  4OH0 A;  1VQQ A;  2C5W B;  4GB7 A;  5EUA A;  4JXS A;  5GHX A;  3HUM A;  3BLM A;  1QMF A;  4K0W A;  3ZHH A;  2XFS A;  3AGE A;  4PM6 A;  5FI7 A;  4IVK A;  4UA9 A;  5F83 A;  4R3B A;  5GL9 A;  1G68 A;  3B3X A;  3WS4 A;  1NZO A;  5U47 A;  3E2L A;  3IXH A;  4ZDX A;  1MY8 A;  5DVA A;  1ZKJ A;  4E6X A;  2VGJ A;  1PZO A;  3OCN A;  4EV4 A;  1M6K A;  3VOY A;  3CZD A;  2XFT A;  2IWC A;  1BSG A;  4A5R A;  1YMX A;  3WS0 A;  2H0Y A;  5E2F A;  5CGX A;  3HUN A;  3UN7 A;  2R9W A;  1Z6F A;  2J9O A;  2DCF A;  2I72 A;  3FZC A;  4S2J A;  4WZ5 A;  1L0E A;  5CER A;  4KZ9 A;  2Y59 A;  4KZ7 A;  1LL9 A;  4X53 A;  3IHB A;  2HP5 A;  3PBT A;  2WZX A;  3M6B A;  2EFU A;  4R0Q A;  2Y2K A;  4X55 A;  2WKI A;  5FQJ A;  5L2F A;  3GR2 A;  4RYE A;  1RGY A;  1IEL A;  4RX2 A;  1YQS A;  3NDG A;  4OVD A;  4E3I A;  3D4F A;  3SS4 A;  2H0T A;  1ZG4 A;  3LCE A;  2ZQC A; 
#chains in the Genus database with same CATH topology
 3QP6 A;  3RH8 B;  2ZOH A;  1U60 A;  5GLA A;  3BFE A;  4S2K A;  1PRQ A;  2Z6C A;  4EEU A;  2QKP A;  3M2K A;  2VGL S;  1P9R A;  1IEM A;  1WYB A;  4JGO A;  1YLZ A;  2GNX A;  3BFF A;  5KIZ A;  3G4P A;  5EVI A;  1Z09 A;  1XFN A;  1W8Y A;  1K25 A;  3T1Q B;  3KYZ A;  1NWZ A;  2JBF A;  3SS5 A;  4R3A A;  3MQ0 A;  1YMS A;  2EFX A;  5TGF A;  3HJK A;  1LHY A;  3IWO A;  3F1P B;  4ESP A;  3T4Q A;  4FUW A;  5FAP A;  5HWV A;  5AQA A;  3QP5 A;  5CRF A;  5CTN A;  3JVV A;  3NOT C;  1MKI A;  2WGW A;  1GCE A;  1F5M A;  2HGV A;  3NCK A;  1F9I A;  1MWT A;  1GSW A;  2QYB A;  3LI9 A;  5MC7 A;  1K0K A;  5M18 A;  1PW1 A;  3CPT B;  2FH5 A;  1Y54 A;  2P08 A;  1NY0 A;  2P04 A;  4KUK A;  4UAA A;  1RCJ A;  4X1L A;  1FIK A;  3T1S A;  2JKG A;  1O7E A;  3TRC A;  4DDS A;  4QD4 A;  1GHM A;  3C30 A;  5FQQ A;  1CI8 A;  4YNR A;  2Y55 A;  3FYZ A;  3MQQ A;  4FOF A;  4P87 A;  5CHM A;  1FQG A;  1I5Q A;  3LY4 A;  4MN5 A;  3EQU A;  2J8Y A;  2PYR A;  4BBT A;  3MXS A;  2GZA A;  2H10 A;  4E3M A;  2ZJ9 A;  2J7V A;  5F69 A;  3V3R A;  2ZQ7 A;  1Y4O A;  3W4O A;  1MPL A;  1SZV A;  2W1T A;  1D7E A;  3IS2 B;  4X1M A;  1MC0 A;  1XA1 A;  3FKV A;  4L9E A;  4N9K A;  2L4R A;  3F1P A;  4KQQ A;  3GTC A;  3TSG A;  2O9B A;  4KZA A;  1XGJ A;  3HLF A;  4R23 A;  5CGS A;  4DE0 A;  4CLC A;  2ZM2 A;  2JE5 A;  5FDS A;  2R9X A;  3IBR A;  3T4S A;  4Y13 A;  3CPT A;  4YWZ A;  4E6W A;  2PR6 A;  1FCM A;  4GJ4 A;  3UB5 P;  2XF3 A;  2P74 A;  3P98 A;  5EOO A;  4PKY A;  5HDD A;  2VZW A;  3IXB A;  1BLP A;  2J3T C;  4DE1 A;  3BFD A;  2HP6 A;  3LYX A;  3BJN A;  4L0L A;  3AGD A;  1F2K A;  5FDH A;  5HW3 A;  4BJP A;  1S67 L;  3N7W A;  4CLC C;  2XRO A;  3Q1F A;  4DE3 A;  1W63 Q;  2B5R A;  3CUE C;  4IBR A;  1L0G A;  3BEB A;  3A3F A;  2VV8 A;  4EBN A;  1FIL A;  3NUL A;  1FR6 A;  4DJ3 A;  4WM9 A;  2X02 A;  5GLD A;  3MZE A;  4YOF A;  2HV1 A;  4IBX A;  1JTG A;  2DNS A;  4GCZ A;  4PHT A;  2ZQA A;  1XFQ A;  1MZU A;  4HHD A;  3IS2 A;  2PHY A;  1STZ A;  3MFD A;  3ZG0 A;  4KQO A;  2JKT I;  3HJI A;  2B95 A;  4H8R A;  3UPO A;  5FAQ A;  3IHA A;  1NLZ A;  2IWD A;  4HOI A;  3KSF A;  3O88 A;  3WS1 A;  4WEK A;  2M7U A;  4XUZ A;  2BLS A;  1GA9 A;  1V9Z A;  3GV9 A;  4OOL A;  3FC7 A;  3MXQ A;  3UO9 A;  4UA7 A;  5I94 A;  2EWW A;  4RQ9 A;  4Y15 A;  3JVU A;  1GSX A;  4MDZ A;  4L9G A;  1K6R A;  4BD1 A;  5M1A A;  1DJB A;  4IUH A;  4ME4 A;  4E3L A;  1NYM A;  1BUL A;  2E8I A;  3ZVT A;  4II7 A;  2JKF A;  3G2Z A;  3V39 A;  4NXE A;  2Y4A A;  5DF8 A;  1K55 A;  4BMW A;  1LI9 A;  3C7U A;  3V5M A;  4LV2 A;  3CJM A;  3PXP A;  1H8M A;  1K4F A;  3C8C A;  3A3J A;  3VE3 A;  4WF0 A;  1YPR A;  1DJA A;  4S2N A;  1N9O A;  3NIA A;  2OLU A;  3BY8 A;  1OTA A;  4ID4 A;  3PBQ A;  3UB9 A;  3K3D A;  1K55 C;  1ALQ A;  4BWI A;  2WKH A;  1RGZ A;  1X0O A;  4I3J A;  2EXB A;  3LR3 A;  3RJU A;  2HJ9 C;  4KG2 A;  5HDS A;  2V1Z A;  4S2I A;  4JGQ A;  3MSH A;  4S2N C;  3LI8 A;  4GDN A;  2Y2N A;  1ONG A;  2JKT M;  1L0F A;  5AQ7 A;  2VV6 A;  2WYX A;  4GN2 A;  3IF6 B;  1K4E A;  2OSU A;  3AGF A;  3CG5 A;  2HJE A;  1YLY A;  5A90 A;  4OLG A;  1YSQ A;  3UPN A;  1XA7 A;  1FSW A;  3A0V A;  4HJ4 A;  2H28 A;  5F82 A;  1FCN A;  2GDN A;  2ACG A;  4F3L B;  5AVE A;  1E4D A;  1C3B A;  1SDE A;  1CJF A;  3HLD A;  2G7U A;  3ZNT A;  2ZC5 B;  1T19 A;  4ZAM A;  3HLB A;  1XJ4 A;  4HQA A;  4N1H A;  5AVF A;  4KZ5 A;  3N8S A;  4LRZ E;  2VGK A;  1E3U D;  4N1X A;  1KVM A;  3GQZ A;  3H9W A;  3SH7 A;  4DXC A;  4Q0H A;  1J3W A;  5J4E A;  3VFH A;  4WMC D;  4EET B;  3BLS A;  3LEZ A;  2L0W A;  4EUZ A;  4R6L A;  4OQG A;  3IQA A;  2O9C A;  1VQQ A;  2C5W B;  5EUA A;  3BLM A;  4K0W A;  4Y5F A;  3ZHH A;  5F83 A;  4R3B A;  3B3X A;  3WS4 A;  3E2L A;  1G28 A;  5DVA A;  4JGP A;  1ZKJ A;  4E6X A;  1PZO A;  2B02 A;  2V0U A;  3EGD C;  3CZD A;  4MN6 A;  2H0Y A;  1DP6 A;  2R9W A;  2J9O A;  2DCF A;  2I72 A;  1VB6 A;  4KZ7 A;  2VLG A;  5C5K A;  2EFU A;  5FQJ A;  5L2F A;  3GR2 A;  1RGY A;  3NHQ A;  2H0T A;  1CQA A;  4PMA A;  3B42 A;  5J3W A;  1CEG A;  5EE8 A;  5D3O A;  4F3L A;  4XT2 B;  1MWS A;  1TEM A;  3RFB A;  3LEQ A;  1ZC2 A;  1SHV A;  1OJ5 A;  2Z2L B;  2B18 A;  3MJQ A;  1UWP X;  1LI0 A;  4I39 A;  1TVF A;  1ERO A;  1SKF A;  4GHI B;  3PYP A;  4HP4 A;  4NKP A;  2BG1 A;  3GVB A;  1MBL A;  4K0X A;  4S2P A;  5HPI A;  1TD5 A;  2J9P A;  4PM8 A;  3MFX A;  2WUQ A;  4N9L A;  3QNC A;  2O99 A;  4ZTK A;  2ZQ9 A;  4R3J A;  1G6O A;  2VV7 A;  4RX3 A;  1LSW A;  1NLY A;  3G32 A;  1H5X A;  4O8G A;  3H82 A;  4GKU A;  5CGW A;  4Z1W A;  4MN7 A;  4Q0J A;  1K57 A;  4P6B A;  4R70 A;  3RXW A;  2VGL M;  3T1R A;  2PR5 A;  2PT7 A;  4JGR A;  4G3V A;  1D1J A;  3UY6 A;  3ZQ5 A;  3NEC A;  5FI2 A;  4MBK A;  4JBF A;  1JWZ A;  5EM1 A;  3UDX A;  5FL3 A;  4OLD A;  1ESI A;  3OLO A;  4HP9 A;  4EQI A;  3UE1 A;  1K57 C;  2YKH A;  4LEN A;  3PAE A;  5TBM B;  4YFM A;  4LFU A;  2WAF A;  4ARZ B;  1YLW A;  2VJW A;  3WRZ A;  1XX2 A;  3G34 A;  3DBA A;  1XJ6 A;  2V20 A;  3VP3 A;  4OPQ A;  4Y17 A;  2JN7 A;  3LO7 A;  2XEP A;  2OOL A;  1N9B A;  4DKI A;  5DTT A;  3T4K A;  4H6J A;  3HLG A;  5F6A A;  2RCX A;  4X56 A;  3GDI A;  3OC2 A;  5KZH A;  5AQB A;  2KX6 A;  1JWV A;  4KQD A;  4DF6 A;  4E04 A;  2WKE A;  2ZC7 A;  1BT5 A;  3S7O A;  4D2O A;  4OON A;  5GHY A;  3FV7 A;  3S7Q A;  2A49 A;  2EX6 A;  3LIC A;  1V9Y A;  2KLI A;  1TS8 A;  4NG2 A;  5HAP A;  3H7W B;  4WZ5 C;  4BLM A;  2ZL1 B;  1OT9 A;  3DAV A;  3KO6 A;  3S1Y A;  1PNE A;  4IHQ A;  5FAO A;  4DE2 A;  4F94 A;  5CHU A;  4ETX A;  2XDM A;  2Y2M A;  2PD7 A;  4CJN A;  1IOU A;  4LPZ A;  1VET A;  1ERQ A;  1KGF A;  3TE8 A;  4UQI S;  1K6S A;  4AFI A;  3WWX A;  4FCF A;  5TBM A;  2XQZ A;  5EVI C;  5EPH A;  4I3A A;  3PAG A;  1L2S A;  4KG6 A;  2J3W A;  1EI5 A;  3VOL A;  5A91 A;  1LSV A;  2OLV A;  3HL9 A;  3SZT A;  3ZG8 B;  3D72 A;  3MF0 A;  3UME A;  2XRN A;  4E3O A;  4FSF A;  4S2M A;  3FWL A;  5JYO A;  1BLC A;  5DF7 A;  1IYQ A;  4RA7 A;  3PR6 A;  2RL3 A;  1WA9 A;  2V9A A;  3NY4 A;  1VEU A;  3LUQ A;  4CPK A;  4B9O A;  2BAS A;  4GS9 B;  2QPN A;  5AJG A;  1XJ3 A;  1H8Z A;  2Z2M B;  1JWP A;  1TDG A;  4GLQ A;  5BOH A;  1ZHH B;  4B88 A;  1OJG A;  3H7W A;  2ZL1 A;  3C4P A;  3FKW A;  3ZG5 A;  5GHZ A;  5J8X A;  2C6W B;  1SKO B;  5HZH A;  5EVL A;  3A3E A;  3B47 A;  4PPR A;  5G4Z A;  4QJG A;  3Q7V B;  2LB5 A;  1T1B A;  1DP9 A;  1K56 D;  3KSI A;  2Z6D A;  3IXG A;  4HBU A;  1M40 A;  3LGO A;  4MBH A;  3VFF A;  3ZG9 B;  3ICY A;  4PM5 A;  2K7S A;  3DWZ A;  1BYW A;  5HWT A;  1EW0 A;  3NJA A;  1S1Y A;  2KDK A;  3CWF A;  3LIA A;  4EXO A;  4E3J A;  1PI5 A;  3DW0 A;  4S2L A;  4WBG A;  4WYY A;  3BFG A;  2I9V A;  5HWW A;  1HVB A;  3BM6 A;  1GSV A;  3BQA A;  3NOP C;  5EM0 A;  5HX9 A;  2CMN A;  1NRF A;  2LB9 A;  2Q9N A;  5FQM A;  3T4J A;  1YAX A;  3N8L A;  3PHY A;  4PM9 A;  3CLO A;  3SH9 A;  2HPB A;  5FAT A;  1N9L A;  2X71 A;  3VP0 A;  3F1N B;  1A0K A;  1QME A;  2XGN A;  4UHU A;  3O3V A;  5L07 A;  5IHV A;  5GLC A;  4QB8 A;  5K5B A;  4CQH A;  2Y91 A;  1BLS A;  3VOZ A;  4UA6 A;  1T18 A;  3PBS A;  1ERM A;  1SDN A;  5IT5 A;  1P9W A;  2ZBB A;  4JPM A;  4O0P A;  5EVE A;  1NYY A;  4U0X A;  1ES5 A;  3BY9 A;  3QHY A;  3N8R A;  2UWX A;  4LLO B;  3O5Y A;  3P09 A;  5HDC A;  4MEZ A;  2YKF A;  3BFC A;  3LR5 A;  4B93 A;  2ZMV A;  3NOU C;  4X25 A;  5HAQ A;  2QHK A;  5FI6 A;  4UEY A;  3OPR A;  4O7D A;  4X6T A;  3VP4 A;  3NI9 A;  3MZD A;  1I2S A;  2QMI A;  3CAX A;  2WAD A;  2XD1 A;  5TJJ A;  1DJC A;  1TDL A;  4KUO A;  4IED A;  2H5S A;  1CF0 A;  2Y8H A;  3ISG A;  3IWQ A;  3T50 A;  1BZA A;  3DWK A;  3BQ8 A;  5IS1 A;  3FG8 A;  4EEP A;  4WLA A;  1KE4 A;  4QY5 A;  3VP2 A;  4OH0 A;  1OTD A;  1KOU A;  4JXS A;  3HUM A;  4QWO A;  1QMF A;  2JKR I;  4LGW A;  2GX5 A;  4UA9 A;  5GL9 A;  3IX4 A;  1NZO A;  3IXH A;  4ZDX A;  1MY8 A;  2OWH A;  2VGJ A;  1M6K A;  3LFV A;  3VOY A;  2IWC A;  5E2F A;  5CGX A;  4HJ6 A;  3UN7 A;  4S2J A;  1L0E A;  1S4R A;  1P0Z A;  3IHB A;  2HP5 A;  4R0Q A;  2Y2K A;  1IEL A;  4RX2 A;  1YQS A;  3C38 A;  3D4F A;  2FZ0 A;  3OZH A;  1W7F A;  3O86 A;  5HFO A;  1PWC A;  3E0Y A;  2L1M A;  1LT0 A;  3MBZ A;  3IWI A;  1FSY A;  3ZG7 B;  3W8K A;  3R7W B;  3MS6 A;  3F1O B;  3D3O A;  4R4R A;  1NZU A;  3ZDJ A;  5J7E A;  4R4S A;  2ZM8 A;  3LIE A;  4P85 A;  3S7N A;  5FAS A;  2R78 A;  3LIB A;  4EBL A;  2HDQ A;  4EWF A;  3OPH A;  2FFY A;  2Y2H A;  4GNU A;  3HLC A;  4FH4 A;  3BEC A;  2JKR M;  3C4O A;  1DY6 A;  2Y2G A;  3GMW A;  1JVJ A;  1JNU A;  1NXY A;  2A2L A;  1D06 A;  3CIT A;  1S1Z A;  3KYQ A;  5IU1 A;  4EW7 A;  2G2W A;  3VV4 A;  1T1A A;  3G30 A;  1J9M A;  4OQ0 A;  3MR0 A;  5GLB A;  3HLE A;  3M2J A;  1W8Q A;  3VSL A;  2V8C A;  4C75 A;  4JF4 A;  2XR0 A;  3P01 A;  1YLJ A;  3GRJ A;  1PW8 A;  2MJ6 A;  4KZB A;  2Y2I A;  3Q07 A;  3UB8 A;  1OTE A;  1XKZ A;  2ZC6 B;  1T1C A;  1UGU A;  3DTM A;  3EQV A;  2HZ5 A;  4ZJ2 A;  4P0M A;  2WK0 A;  3GEC A;  5I5L A;  1GHP A;  2X01 A;  1E3U A;  2EX2 A;  3RXX A;  4ZBE A;  4OPY A;  3VSK A;  5CEB A;  3ZGA B;  2XSS A;  1N4O A;  2K31 A;  3IH9 A;  3O87 A;  3K3C A;  2XA7 M;  4DRT A;  3F1O A;  1IFQ A;  1NRJ A;  4RVA A;  3IF6 A;  2V8F A;  3OCL A;  4C6Y A;  4WMC A;  1YLP A;  2IWB A;  3ZCZ A;  4WN5 A;  5L8M A;  1G5U A;  3UNW A;  4MMN A;  2A3U A;  1CK3 A;  5HAI A;  1PIO A;  1TS7 A;  3SH8 A;  1YLT A;  3IF6 C;  1WE4 A;  4OPR A;  2QJ7 A;  3LIF A;  3A0S A;  4KZ8 A;  3ZYT A;  2WAE A;  1ZTU A;  3WS5 A;  3IT9 A;  1L0D A;  1XXM A;  2WKQ A;  3D9Y A;  4HH3 A;  3NBL A;  3Q81 A;  3U4L P;  1PWG A;  3R4K A;  5HAR A;  5E43 A;  2V1A A;  3PBO A;  4GOG A;  3ZVW A;  1IKG A;  4Y3I A;  1OT6 A;  4R1G A;  2OV5 A;  4MBF A;  4G3W A;  4PM7 A;  4M4X A;  4EER A;  3C7V A;  3NDE A;  3MMH A;  4HES A;  1MKM A;  3QP4 A;  5DFY A;  1IYO A;  1H0M A;  3T4L A;  5A8B A;  4HBT A;  4NK3 A;  1XGI A;  2EX9 A;  4NEE D;  2Q0O A;  3S4X A;  3K2N A;  3ITB A;  4P6Z S;  1FCO A;  5KSH A;  4R38 A;  3OPP A;  1S66 L;  3T4T A;  2ZM0 A;  5CXW A;  4L9F A;  4K91 A;  3W2Z A;  4Z9Q A;  2QWS A;  1KDS A;  2HP9 A;  2Y79 A;  1I2W A;  1PZP A;  2D02 A;  3W4P A;  1AXB A;  1YT4 A;  4N92 A;  3WS2 A;  3EOI A;  3MXR A;  2WKR A;  4XT2 A;  1K38 A;  3TOI A;  3S7P A;  1FR1 A;  3QP2 A;  5E2E A;  3HRE A;  4OKP A;  4GHI A;  2ZMA A;  4WUJ A;  3LID A;  4FD8 A;  3MKF A;  3FPV A;  2DMW A;  4GDB A;  3JYI A;  5FA7 A;  4LCM A;  4OQI A;  3G31 A;  5EEC A;  4HJ3 A;  5EVI D;  4PKY G;  3HBR A;  1P97 A;  2PDR A;  2W3D A;  1S6R A;  4IVI A;  1TS6 A;  4YIN A;  4HNB A;  3ULF A;  5LBR A;  1XP4 A;  2D01 A;  1W79 A;  1Q2Q A;  3CI6 A;  5TR7 A;  4I3I A;  2ZD8 A;  2O9A A;  5L09 A;  4Y7P A;  5DKL A;  3UMD A;  2PYP A;  2OAP 1;  2PAV P;  3T1X A;  4EUV A;  1VHM A;  2M1C A;  1OME A;  5KSC A;  3KX0 X;  2INW A;  3SS3 A;  5KMW A;  1MWU A;  1BUE A;  2NUP C;  5DF9 A;  1ES4 A;  2W1T B;  3BYD A;  4ARZ A;  4BL3 A;  4EQ1 A;  2Y2O A;  2W0N A;  1HZO A;  1YKD A;  3SW1 A;  1L3L A;  4EES A;  5FEF A;  1SCW A;  3IXD A;  1S4S A;  3LY3 A;  2M7V A;  3EEH A;  4NXB A;  4OOY A;  4Y0U A;  2UV0 E;  4JKT A;  4Y0T A;  3OPL A;  4CLC B;  4X69 A;  5HD3 A;  3UB6 A;  4B4Z A;  4FTX A;  4I38 A;  3L9K A;  1F98 A;  2K2N A;  4KEN B;  4KZ4 A;  1O07 A;  1W5D A;  3P7N A;  3E98 A;  4KG5 A;  2Q9M A;  1CEF A;  3EEA A;  4U3T A;  3IX8 A;  5FQI A;  4DMZ A;  1EWZ A;  4U0T A;  2W3H A;  5HL6 A;  5F1G A;  2Y2J A;  4CLC E;  4IVK A;  5L10 A;  2J3T D;  1G68 A;  5CX7 A;  2OAQ 1;  5DJT A;  3LR0 A;  4CLC D;  3MQO A;  1OPX A;  3HCY A;  2W1R A;  2XFT A;  4DN0 A;  1BSG A;  4A5R A;  3DTE A;  1LL9 A;  3DTI A;  4HY8 A;  3PBT A;  2WZX A;  3NDG A;  3IX3 A;  4OVD A;  3SS4 A;  3TJZ C;  4JXV A;  1ZG4 A;  3LCE A;  3Q82 A;  1ACF A;  1K56 A;  3FPW A;  3ZNY A;  1YM1 A;  1KDW A;  1IYP A;  4XUX A;  4GZB A;  4ZJ1 A;  5CTM A;  4GW9 A;  3HVF A;  1TF1 A;  4BQM A;  3CUE A;  1LL8 A;  3ZFZ A;  5DTS A;  4LRX C;  4GS9 A;  4QY6 A;  5JYP A;  5HSQ A;  4E3K A;  2EA9 A;  1KGG A;  3MZF A;  2QZ6 A;  2ZOI A;  3KSH A;  3PBN A;  4NXG A;  3CMZ A;  1SKO A;  3E4P A;  4FH2 A;  3Q7V A;  3JPU A;  4EU0 A;  4EBP A;  3BWL A;  1AWI A;  1PFL A;  3KSG A;  2W3G A;  4QPR A;  1ZG6 A;  3VE4 A;  4O01 A;  4WEJ A;  4QU3 A;  1KE0 A;  2ZMF A;  4MLL A;  3N4I A;  4LV3 A;  3UPP A;  5HPF A;  2E8J A;  1ES2 A;  1KVL A;  5FQK A;  2EX8 A;  5EFW A;  4LV1 A;  3V3S A;  5F5Y A;  5CHJ A;  4KQR A;  5EOE A;  1PYY A;  4JF6 A;  1CI9 A;  1WYC A;  1LL5 A;  2FFF B;  4NXF A;  5HD5 A;  3C5A A;  2AVX A;  4DXB A;  4OPZ A;  4QHC A;  1ONH A;  1BLH A;  3A3D A;  3F1N A;  5M19 A;  3IH8 A;  4JXG A;  1BTL A;  1N9N A;  4MNR A;  4WZ4 A;  4BEN A;  3LR4 A;  4OOM A;  3S22 A;  2WZZ A;  1TS0 A;  3QP8 A;  4OP5 A;  2QJ5 A;  4K08 A;  4KZ3 A;  4WEL A;  3G2Y A;  1ODV A;  1S0W A;  5FSR A;  1E25 A;  3Q7Z A;  3UE0 A;  5EV0 A;  5FQ9 A;  5CED A;  1IYS A;  4JF5 A;  2W27 A;  2CC1 A;  1YSP A;  2WKP A;  3N6I A;  5A93 A;  1PI4 A;  5G4Y A;  1XJ2 A;  5FEG A;  5CEC A;  3HLW A;  4Y0O A;  1PWD A;  1Q2P A;  2NUT C;  1NJ4 A;  2DRW A;  3V67 A;  2JCH A;  3C2W A;  4G3K A;  3A3I A;  5HL1 A;  2P9V B;  3UDF A;  4GD8 A;  2JC7 A;  4HEF A;  2ZQD A;  2ZQ8 A;  3E4Q A;  2VEA A;  1ESU A;  4LRY C;  1RP5 A;  5G18 A;  1JTD A;  1IKI A;  2PU2 A;  3IBJ A;  5DJU A;  1DP8 A;  4XXR A;  3U2A A;  4LV0 A;  2Y2L A;  1HD8 A;  5TFQ A;  3RTY A;  1MWR A;  3WRT A;  1HLU P;  4OQH A;  3V50 A;  4JXW A;  2ZC4 B;  3M6H A;  1MXO A;  2BTF P;  1LLB A;  3VMA A;  3HUO A;  1XPB A;  4I5S A;  3G35 A;  3TG9 A;  2XLN A;  4E3N A;  2P7J A;  4IUK A;  3VP1 A;  3MKE A;  3E2K A;  2V2F F;  3UE3 A;  5A92 A;  4HI4 A;  2G2U A;  3EWK A;  3R7W A;  2HDU A;  4ETZ A;  4P6Z M;  3H82 B;  3PBR A;  4BD0 A;  4Y2F A;  3EGX C;  1HTZ A;  5DKK A;  1OTI A;  3GSG A;  1H8Y A;  2PU4 A;  1KE3 A;  1Y28 A;  2J80 A;  4BL2 A;  3QP1 A;  1H3Q A;  3B33 A;  1GA0 A;  5DFX A;  3T12 B;  3G6O A;  1DRM A;  4C3Q A;  2A24 B;  4ZJ3 A;  2P9V A;  1FOF A;  4OP8 A;  2EXA A;  2XH9 A;  2O0Y A;  3W4Q A;  3TW8 A;  2WGI A;  2ZC3 B;  2PBD P;  4PAU A;  4M3K A;  3DTK A;  3SOI A;  4BBU A;  4D60 A;  4GD6 A;  4S2O A;  2XK1 A;  1KGE A;  2GJ3 A;  1W63 M;  4X68 A;  4H6J B;  5DTK A;  2V0W A;  4Q0I A;  2VK3 A;  5AQ9 A;  4WL9 A;  4HH2 A;  4DDY A;  3UB7 A;  1GHI A;  2VX8 A;  2VA0 A;  2PRF A;  3T4O A;  2HDR A;  5F1F A;  1VM1 A;  3UE6 A;  3UDI A;  5E2G A;  2Y2P A;  4NET A;  1UWN X;  1K54 A;  4MCW A;  4DJ2 A;  4B4X A;  3BW6 A;  2VKS A;  3IF5 A;  2ZLY A;  1OTB A;  3NC8 A;  2V1B A;  3PTE A;  5E2H A;  3I7J A;  3BRM A;  3QNB A;  3ITA A;  2Y2Q A;  4IJG A;  4UQI M;  2IA2 A;  2OWJ A;  2XD5 A;  4JLF A;  5EVI B;  1K54 C;  2PD8 A;  2XA7 S;  2HDS A;  1ES3 A;  2JHE A;  1VET B;  2A24 A;  2WGV A;  4Q8I A;  4BBV A;  3A0R A;  3KYE A;  3E4O A;  4LCL A;  1G6A A;  2PBY A;  3OBF A;  3CHW P;  2WGW B;  4KZ6 A;  4GB7 A;  2W3F A;  5GHX A;  2XFS A;  3AGE A;  4PM6 A;  5FI7 A;  5F68 A;  5U47 A;  2HF6 A;  3OCN A;  4EV4 A;  2EWV A;  2KOI A;  1YMX A;  3WS0 A;  3HUN A;  1Z6F A;  3FZC A;  4ZRR A;  5CER A;  4WZ5 A;  4KZ9 A;  2Y59 A;  3OOV A;  3L7H A;  4X53 A;  3M6B A;  1VEU B;  4X55 A;  2WKI A;  2W3E A;  4RYE A;  4HIA A;  4E3I A;  1LSX A;  2ZQC A; 
#chains in the Genus database with same CATH homology
 1W7F A;  1K56 A;  3O86 A;  4PMA A;  5HFO A;  1CEG A;  3ZNY A;  5EE8 A;  5D3O A;  1YM1 A;  1U60 A;  5GLA A;  1PWC A;  1MWS A;  1TEM A;  3BFE A;  1KDW A;  4S2K A;  3MBZ A;  1ZC2 A;  1IYP A;  1SHV A;  3IWI A;  1FSY A;  3M2K A;  4XUX A;  2Z2L B;  4GZB A;  3W8K A;  3ZG7 B;  1IEM A;  1WYB A;  4ZJ1 A;  1LI0 A;  1YLZ A;  3BFF A;  1TVF A;  3G4P A;  1ERO A;  1SKF A;  5CTM A;  5EVI A;  3HVF A;  4R4R A;  1NZU A;  1W8Y A;  3ZDJ A;  4BQM A;  4R4S A;  1K25 A;  2BG1 A;  2ZM8 A;  3GVB A;  4P85 A;  1MBL A;  4K0X A;  4S2P A;  3ZFZ A;  5DTS A;  5FAS A;  2J9P A;  4PM8 A;  4EBL A;  2HDQ A;  4QY6 A;  2JBF A;  5JYP A;  4EWF A;  4E3K A;  2WUQ A;  4N9L A;  3QNC A;  3SS5 A;  1KGG A;  1YMS A;  3MZF A;  2FFY A;  3OPH A;  2EFX A;  2QZ6 A;  4ZTK A;  5TGF A;  1LHY A;  2Y2H A;  2ZQ9 A;  3IWO A;  4GNU A;  4R3J A;  3HLC A;  5FAP A;  5AQA A;  4FH4 A;  3BEC A;  3PBN A;  4RX3 A;  3C4O A;  1DY6 A;  2Y2G A;  3CMZ A;  5CRF A;  5CTN A;  3G32 A;  1MKI A;  1H5X A;  2WGW A;  4FH2 A;  1GCE A;  1JVJ A;  3GMW A;  4GKU A;  3Q7V A;  5CGW A;  1NXY A;  3NCK A;  4EBP A;  1MWT A;  1K57 A;  1ZG6 A;  4P6B A;  3RXW A;  5M18 A;  4WEJ A;  1PW1 A;  1KE0 A;  2G2W A;  4MLL A;  4QU3 A;  1Y54 A;  3N4I A;  4LV3 A;  1NY0 A;  3G30 A;  3UPP A;  3UY6 A;  1J9M A;  4OQ0 A;  5GLB A;  4UAA A;  3HLE A;  1RCJ A;  3M2J A;  5FI2 A;  4MBK A;  1ES2 A;  4JBF A;  1JWZ A;  1KVL A;  3UDX A;  1W8Q A;  3VSL A;  4OLD A;  5FQK A;  4JF4 A;  1ESI A;  2XR0 A;  4C75 A;  4EQI A;  2EX8 A;  3UE1 A;  1K57 C;  4LEN A;  3PAE A;  4LV1 A;  1YLJ A;  3V3S A;  4YFM A;  1O7E A;  5CHJ A;  3GRJ A;  1PW8 A;  4KQR A;  5EOE A;  4DDS A;  1PYY A;  4JF6 A;  4KZB A;  1GHM A;  2Y2I A;  1CI9 A;  1WYC A;  4QD4 A;  3Q07 A;  2WAF A;  1LL5 A;  2FFF B;  1YLW A;  5FQQ A;  3WRZ A;  1CI8 A;  1XX2 A;  3G34 A;  2ZC6 B;  1XKZ A;  2Y55 A;  3FYZ A;  3DTM A;  3C5A A;  3EQV A;  4ZJ2 A;  2V20 A;  3VP3 A;  4OPQ A;  4P0M A;  4P87 A;  4DXB A;  4OPZ A;  3LO7 A;  2XEP A;  4QHC A;  2WK0 A;  1N9B A;  4DKI A;  1ONH A;  5CHM A;  1FQG A;  1BLH A;  1I5Q A;  1GHP A;  5DTT A;  3A3D A;  2X01 A;  5M19 A;  3IH8 A;  1E3U A;  1BTL A;  3LY4 A;  4JXG A;  2EX2 A;  3RXX A;  3EQU A;  2J8Y A;  4OPY A;  4ZBE A;  4MNR A;  4WZ4 A;  3VSK A;  3ZGA B;  5CEB A;  3HLG A;  3MXS A;  4BEN A;  1N4O A;  4OOM A;  3IH9 A;  2H10 A;  2RCX A;  3O87 A;  4X56 A;  2ZJ9 A;  2J7V A;  3S22 A;  3V3R A;  4DRT A;  4E3M A;  3OC2 A;  2WZZ A;  2ZQ7 A;  5AQB A;  5KZH A;  4OP5 A;  4RVA A;  3W4O A;  1MPL A;  3IF6 A;  1JWV A;  3OCL A;  4C6Y A;  4WMC A;  1YLP A;  2IWB A;  4DF6 A;  3ZCZ A;  2WKE A;  1XA1 A;  2ZC7 A;  1BT5 A;  4KZ3 A;  4WEL A;  3G2Y A;  4D2O A;  3UNW A;  4OON A;  5GHY A;  3FKV A;  3FV7 A;  1S0W A;  5FSR A;  1E25 A;  4N9K A;  3Q7Z A;  3UE0 A;  2A3U A;  1CK3 A;  4KQQ A;  5FQ9 A;  5HAI A;  3GTC A;  3TSG A;  5CED A;  4KZA A;  1XGJ A;  2A49 A;  2EX6 A;  1PIO A;  4JXV A;  3SH8 A;  1IYS A;  1YLT A;  3HLF A;  3IF6 C;  4JF5 A;  1WE4 A;  5HAP A;  4R23 A;  4OPR A;  4WZ5 C;  5CGS A;  4BLM A;  2CC1 A;  4DE0 A;  3Q82 A;  3N6I A;  3S1Y A;  5FAO A;  5A93 A;  1PI4 A;  4DE2 A;  2ZM2 A;  4KZ8 A;  2JE5 A;  4F94 A;  2R9X A;  2WAE A;  5CHU A;  3WS5 A;  4E6W A;  3IT9 A;  1L0D A;  1FCM A;  2XF3 A;  2P74 A;  1XXM A;  3P98 A;  5EOO A;  2XDM A;  3IXB A;  3NBL A;  3Q81 A;  2Y2M A;  5CEC A;  4CJN A;  1PWG A;  1BLP A;  4DE1 A;  3BFD A;  3HLW A;  2HP6 A;  1PWD A;  4Y0O A;  5HAR A;  4L0L A;  1Q2P A;  3AGD A;  1NJ4 A;  5E43 A;  2DRW A;  1ERQ A;  1KGF A;  5FDH A;  5HW3 A;  3PBO A;  4GOG A;  4BJP A;  3N7W A;  2JCH A;  1K6S A;  3WWX A;  3ZVW A;  1IKG A;  3Q1F A;  4FCF A;  3A3I A;  4R1G A;  2OV5 A;  4MBF A;  5HL1 A;  4PM7 A;  2XQZ A;  4DE3 A;  2P9V B;  3C7V A;  3UDF A;  4GD8 A;  5EVI C;  2JC7 A;  3NDE A;  4HEF A;  5EPH A;  2B5R A;  3PAG A;  1L2S A;  4HES A;  4IBR A;  1L0G A;  3BEB A;  2ZQD A;  3A3F A;  4KG6 A;  1IYO A;  4EBN A;  1EI5 A;  1FR6 A;  2ZQ8 A;  1ESU A;  4WM9 A;  5A91 A;  4HBT A;  2OLV A;  2X02 A;  3HL9 A;  4NK3 A;  1RP5 A;  5G18 A;  1XGI A;  3ZG8 B;  1JTD A;  2EX9 A;  1IKI A;  5GLD A;  3S4X A;  2PU2 A;  3ITB A;  3MZE A;  4XXR A;  1FCO A;  4E3O A;  5KSH A;  3OPP A;  2ZM0 A;  4FSF A;  5CXW A;  4LV0 A;  4IBX A;  4S2M A;  3FWL A;  5JYO A;  2Y2L A;  4K91 A;  1HD8 A;  1BLC A;  5DF7 A;  1JTG A;  5TFQ A;  1MWR A;  1IYQ A;  2DNS A;  4Z9Q A;  4RA7 A;  3WRT A;  2ZQA A;  4OQH A;  3V50 A;  4JXW A;  1KDS A;  2RL3 A;  2HP9 A;  2ZC4 B;  1MXO A;  3M6H A;  1LLB A;  3VMA A;  3NY4 A;  1I2W A;  3MFD A;  1PZP A;  3HUO A;  3ZG0 A;  4KQO A;  3W4P A;  4CPK A;  1AXB A;  4H8R A;  3UPO A;  1XPB A;  5FAQ A;  3IHA A;  3G35 A;  1YT4 A;  2IWD A;  4N92 A;  3TG9 A;  2XLN A;  3WS2 A;  4E3N A;  3O88 A;  2QPN A;  3WS1 A;  4WEK A;  3MXR A;  1H8Z A;  2Z2M B;  4XUZ A;  3VP1 A;  3MKE A;  1JWP A;  1GA9 A;  2BLS A;  1TDG A;  3E2K A;  3GV9 A;  4OOL A;  5BOH A;  4B88 A;  1K38 A;  2V2F F;  4UA7 A;  3TOI A;  3UO9 A;  3C4P A;  3UE3 A;  5I94 A;  3OZH A;  5A92 A;  2G2U A;  3FKW A;  1FR1 A;  3ZG5 A;  5GHZ A;  5J8X A;  1K6R A;  4BD1 A;  5M1A A;  1DJB A;  2C6W B;  5E2E A;  4E3L A;  1NYM A;  3HRE A;  2HDU A;  4OKP A;  5EVL A;  3A3E A;  4PPR A;  1BUL A;  2E8I A;  2ZMA A;  4QJG A;  3ZVT A;  3PBR A;  3Q7V B;  4BD0 A;  3G2Z A;  3V39 A;  1K56 D;  1HTZ A;  3MKF A;  4FD8 A;  3GSG A;  3IXG A;  1H8Y A;  2PU4 A;  1KE3 A;  1M40 A;  2Y4A A;  4HBU A;  4MBH A;  5DF8 A;  1K55 A;  3VFF A;  1LI9 A;  3ZG9 B;  4BL2 A;  3C7U A;  4GDB A;  3V5M A;  4PM5 A;  4LV2 A;  1GA0 A;  3JYI A;  5FA7 A;  4LCM A;  3CJM A;  3DWZ A;  4OQI A;  3G31 A;  4C3Q A;  5EEC A;  1K4F A;  3A3J A;  4ZJ3 A;  2P9V A;  5EVI D;  4E3J A;  1PI5 A;  3DW0 A;  3HBR A;  4S2L A;  4WBG A;  4WYY A;  3BFG A;  1FOF A;  1DJA A;  1S6R A;  4S2N A;  4OP8 A;  3NIA A;  4IVI A;  2OLU A;  4ID4 A;  3PBQ A;  2EXA A;  2XH9 A;  1K55 C;  3W4Q A;  1HVB A;  3BM6 A;  1ALQ A;  4YIN A;  2WKH A;  1RGZ A;  5HX9 A;  1NRF A;  2WGI A;  1XP4 A;  2ZC3 B;  2EXB A;  1W79 A;  3RJU A;  1Q2Q A;  2Q9N A;  5TR7 A;  2ZD8 A;  5FQM A;  4Y7P A;  4KG2 A;  3N8L A;  4M3K A;  2V1Z A;  4S2I A;  3SOI A;  4PM9 A;  3SH9 A;  4GD6 A;  2HPB A;  4S2O A;  5FAT A;  2X71 A;  3VP0 A;  2XK1 A;  1QME A;  1KGE A;  4S2N C;  1OME A;  4X68 A;  2XGN A;  4GDN A;  5KSC A;  4UHU A;  2Y2N A;  5DTK A;  1ONG A;  3SS3 A;  1L0F A;  1MWU A;  3O3V A;  5AQ7 A;  5KMW A;  5AQ9 A;  4DDY A;  1GHI A;  1BUE A;  4GN2 A;  2WYX A;  5DF9 A;  5GLC A;  4QB8 A;  5IHV A;  1ES4 A;  3IF6 B;  2Y91 A;  1K4E A;  1BLS A;  3BYD A;  3VOZ A;  2HDR A;  4UA6 A;  4BL3 A;  2Y2O A;  2OSU A;  5F1F A;  3PBS A;  1VM1 A;  1ERM A;  3AGF A;  3CG5 A;  1SDN A;  3UDI A;  1YLY A;  5E2G A;  5A90 A;  2Y2P A;  4NET A;  4OLG A;  3UPN A;  1HZO A;  4JPM A;  1NYY A;  1XA7 A;  4U0X A;  1K54 A;  1FSW A;  1ES5 A;  1SCW A;  3IXD A;  5F82 A;  3LY3 A;  3QHY A;  1FCN A;  3N8R A;  4B4X A;  2GDN A;  4OOY A;  2UWX A;  4Y0U A;  3IF5 A;  4JKT A;  2ZLY A;  3NC8 A;  4Y0T A;  1E4D A;  1C3B A;  5E2H A;  3PTE A;  1SDE A;  3I7J A;  3HLD A;  3OPL A;  3P09 A;  4MEZ A;  3ZNT A;  3BRM A;  3QNB A;  2ZC5 B;  3ITA A;  3BFC A;  4X69 A;  4ZAM A;  3HLB A;  4N1H A;  2Y2Q A;  5HAQ A;  5FI6 A;  3OPR A;  2XD5 A;  4JLF A;  4KZ5 A;  3N8S A;  4O7D A;  1K54 C;  4X6T A;  5EVI B;  4B4Z A;  2VGK A;  1E3U D;  3VP4 A;  3NI9 A;  4KEN B;  3MZD A;  4KZ4 A;  1I2S A;  1KVM A;  2QMI A;  4N1X A;  3GQZ A;  1O07 A;  2HDS A;  1ES3 A;  1W5D A;  2WAD A;  2XD1 A;  2WGV A;  3SH7 A;  4KG5 A;  2Q9M A;  1DJC A;  1TDL A;  4DXC A;  1CEF A;  4IED A;  2H5S A;  4U3T A;  4Q8I A;  3ISG A;  3IWQ A;  4WMC D;  5FQI A;  3VFH A;  1EWZ A;  1BZA A;  4LCL A;  3DWK A;  4U0T A;  1G6A A;  3BLS A;  3LEZ A;  2PBY A;  4EUZ A;  4OQG A;  3IQA A;  1KE4 A;  4QY5 A;  5F1G A;  2WGW B;  2Y2J A;  4KZ6 A;  3VP2 A;  4OH0 A;  1VQQ A;  2C5W B;  4GB7 A;  5EUA A;  4JXS A;  5GHX A;  3HUM A;  3BLM A;  1QMF A;  4K0W A;  3ZHH A;  2XFS A;  3AGE A;  4PM6 A;  5FI7 A;  4IVK A;  4UA9 A;  5F83 A;  4R3B A;  5GL9 A;  1G68 A;  3B3X A;  3WS4 A;  1NZO A;  5U47 A;  3E2L A;  3IXH A;  4ZDX A;  1MY8 A;  5DVA A;  1ZKJ A;  4E6X A;  2VGJ A;  1PZO A;  3OCN A;  4EV4 A;  1M6K A;  3VOY A;  3CZD A;  2XFT A;  2IWC A;  1BSG A;  4A5R A;  1YMX A;  3WS0 A;  2H0Y A;  5E2F A;  5CGX A;  3HUN A;  3UN7 A;  2R9W A;  1Z6F A;  2J9O A;  2DCF A;  2I72 A;  3FZC A;  4S2J A;  4WZ5 A;  1L0E A;  5CER A;  4KZ9 A;  2Y59 A;  4KZ7 A;  1LL9 A;  4X53 A;  3IHB A;  2HP5 A;  3PBT A;  2WZX A;  3M6B A;  2EFU A;  4R0Q A;  2Y2K A;  4X55 A;  2WKI A;  5FQJ A;  5L2F A;  3GR2 A;  4RYE A;  1RGY A;  1IEL A;  4RX2 A;  1YQS A;  3NDG A;  4OVD A;  4E3I A;  3D4F A;  3SS4 A;  2H0T A;  1ZG4 A;  3LCE A;  2ZQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...