4XXRA

Atomic resolution x-ray crystal structure of a ruthenocene conjugated beta-lactam antibiotic in complex with ctx-m-14 e166a beta-lactamase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTAPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibacterial properties and atomic resolution X-ray complex crystal structure of a ruthenocene conjugated beta-lactam antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
molecule keywords CTX-M-14 Class A Beta-Lactamase
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4xxrA00
1H8ZA 1MWTA 3UNWA 3GQZA 5HX9A 1N4OA 4EBPA 1MXOA 1KDSA 5CHUA 5GLDA 1H8YA 2G2WA 4WELA 2VGKA 5FQMA 1PWCA 4E3KA 2XDMA 3PBOA 4KQQA 5FATA 3ZCZA 3GSGA 3HLGA 5EVID 3G2YA 3FYZA 1FCMA 3ISGA 3VP1A 4CPKA 2ZQDA 4P6BA 3ZVWA 1KGGA 2E8IA 4DE0A 3NY4A 3E2KA 2Y2GA 2Y55A 3SH9A 1SHVA 4R4SA 5HAQA 3VP2A 1ZG4A 4YFMA 2WK0A 4DDYA 3FV7A 1ONHA 4MBHA 5M19A 3AGFA 1RGZA 4KZBA 2ZQ9A 1BUEA 2WAEA 1W8QA 3C7VA 3HLEA 2X02A 1AXBA 2XD1A 2A3UA 5M1AA 1K54A 3BM6A 4DE2A 2C5WB 4IEDA 2DNSA 2VGJA 3MKEA 1VM1A 2XR0A 1Q2QA 3ZG9B 3IT9A 3IF6A 1HVBA 3S1YA 4UA7A 2WGWA 3G34A 5CGSA 3M6HA 2Y2PA 4WMCA 2JCHA 1MPLA 1YLTA 3BFDA 1BSGA 4N9LA 3EQVA 5CEDA 4DDSA 4P87A 5FI7A 1L0DA 3VP4A 1DJBA 2UWXA 4LV2A 1YMXA 3N6IA 2IWCA 4OKPA 4DE3A 3FKWA 5FQJA 2WAFA 3TG9A 4QU3A 3V3RA 3PTEA 1QMFA 2Y2JA 5A93A 3OPRA 2XK1A 3UE1A 5CHMA 4RX2A 1PIOA 3BFEA 1FSWA 5CTNA 1LHYA 2CC1A 3C4PA 1N9BA 4BJPA 3FKVA 1GA9A 4DKIA 1KGEA 1O7EA 4QHCA 5A90A 4UA9A 3S22A 4OPZA 3A3DA 1JVJA 1IYSA 3OC2A 1LL9A 1W7FA 5HAPA 1K56A 2B5RA 3N8LA 5FAOA 1U60A 3IF6C 5KSCA 3V50A 2HDQA 2EFXA 4DE1A 3A3IA 4HBUA 1KE3A 4UAAA 1NYYA 1W8YA 1EROA 3LY3A 5FQ9A 4M3KA 5AQAA 3ZFZA 3UDFA 3SS3A 5AQBA 3E2LA 5GHZA 5GLAA 2Q9NA 3IXBA 3N8RA 4OPQA 4JXVA 2J8YA 4OPRA 5F82A 1XP4A 2ZMAA 4BQMA 1I5QA 1YM1A 3OCNA 3W4QA 5F83A 2WKEA 1LI9A 3C7UA 2ZJ9A 1MWRA 3Q1FA 5EVIA 4HESA 2XGNA 3MZDA 1Q2PA 3ZGAB 3HREA 4S2OA 5KZHA 3OZHA 4QY6A 3WS4A 3GRJA 3QNCA 2OV5A 2EX6A 4K0WA 4YINA 3UE3A 1GA0A 5HAIA 4EQIA 1YT4A 1CI9A 3W4OA 4ZTKA 5FAQA 4BLMA 3MFDA 3NIAA 5HL1A 2HDUA 5EOEA 3C5AA 1XX2A 3IXDA 2OLUA 4R3BA 3BFCA 1CEFA 1CEGA 3IQAA 5DF7A 3HLCA 3PBQA 3ITAA 1IEMA 1YLPA 3IHBA 1JTDA 3UY6A 2EX2A 4PM8A 5U47A 3IH8A 3OPHA 1H5XA 3DW0A 4GKUA 3SS4A 1BLHA 1GHPA 1K6RA 1K38A 4FCFA 2FFYA 1KDWA 3WRZA 4OOYA 3AGDA 5J8XA 1NRFA 2J9OA 4OOMA 4IBRA 1TDGA 5EPHA 2H5SA 4QY5A 4S2NC 2JBFA 4E6WA 2JE5A 4OQIA 2Y2HA 2ZM0A 1E3UD 1L0EA 3UPNA 5F1FA 1E25A 4U0XA 1K4EA 3HVFA 4RYEA 1BZAA 4KG5A 1TDLA 1XA1A 5FASA 3G2ZA 5CGXA 4JPMA 1QMEA 2WYXA 5FI2A 3WWXA 2J9PA 3I7JA 2XFTA 1KE0A 4K0XA 3HBRA 1ERQA 4OVDA 5EVIC 4B4ZA 5L2FA 4OLGA 3A3JA 5D3OA 3BFFA 3MBZA 1E3UA 3NDGA 1K54C 3BEBA 4GNUA 2HDRA 1Z6FA 3A3FA 5EE8A 1YQSA 1OMEA 2ZM8A 4LV1A 4JLFA 5E43A 2EX8A 4KENB 3RXXA 4E3MA 2QZ6A 2WKIA 3W4PA 2HDSA 4JKTA 1YLZA 1HD8A 4S2MA 3WS0A 3ZG5A 4S2IA 4UHUA 3CJMA 1CI8A 4ZBEA 2X01A 4Y0TA 3BLMA 3ZDJA 1ERMA 5AQ7A 1FQGA 3G31A 4KZ9A 3ZNYA 3GVBA 3VFFA 2R9WA 1DJAA 2EXAA 5FAPA 4OQHA 3LY4A 4XUZA 1HZOA 5DVAA 3IXGA 3IF6B 4KG6A 4NK3A 4OLDA 1MWUA 4WEKA 5DTTA 5G18A 3BLSA 4QB8A 2JC7A 5DTKA 4KQRA 4E3NA 3VP3A 4MBKA 5GHXA 1NY0A 3CZDA 3O88A 2IWBA 4R3JA 3BECA 4WYYA 5BOHA 5FQKA 3ZG0A 3OPLA 2WGIA 2RL3A 3PBRA 5FQIA 1IKIA 2WUQA 1ZKJA 1MY8A 3MKFA 1YLYA 1XXMA 4EBNA 1NXYA 1TEMA 4JXGA 4Y0UA 4E3JA 3MZEA 4FD8A 1JWPA 4RVAA 2WGWB 1K55A 4UA6A 1ES4A 3JYIA 4GB7A 2OSUA 4KZ3A 3LEZA 4L0LA 1G6AA 5E2HA 1MKIA 4KZ4A 3UN7A 4IVIA 4U0TA 1YLJA 2DRWA 5A92A 1S0WA 3BFGA 1FR1A 1YLWA 3PAGA 1KVMA 4GZBA 4WMCD 2V1ZA 4X53A 4LENA 3ITBA 4KG2A 4PMAA 5EOOA 1ONGA 4MLLA 4KZ6A 4JF5A 4X68A 4OQGA 2BG1A 2GDNA 1FCNA 3V3SA 4JXWA 1EI5A 1PI5A 4GOGA 2H0YA 4PM7A 4OPYA 3GV9A 2OLVA 5CXWA 2BLSA 1XKZA 3UDIA 1E4DA 1PW1A 4RA7A 2J7VA 4ZJ2A 1M6KA 2P74A 5GLBA 3O3VA 2Y2NA 1JTGA 1K55C 3NCKA 1WE4A 3OCLA 3Q7VB 4ID4A 4GN2A 4GDBA 4Y0OA 5TFQA 3W8KA 4JXSA 1LL5A 3UO9A 3ZHHA 3D4FA 1BTLA 4IVKA 1GCEA 4MNRA 1IYPA 4FSFA 2WKHA 1SCWA 4R23A 1IYOA 2ZQAA 5EECA 1G68A 5EVLA 4R0QA 4ZDXA 2I72A 2XQZA 2Y2KA 5E2GA 2RCXA 3G30A 2Y2MA 1ESUA 4BD0A 3ZVTA 5HFOA 4QJGA 1K4FA 3VOZA 4CJNA 3NDEA 2Y2QA 3WS5A 2PU4A 1WYBA 2WADA 3Q81A 3UE0A 5CRFA 5KMWA 3TOIA 1K57C 5EVIB 3WS1A 4PM5A 4OH0A 4KZ5A 5E2EA 1W79A 3P98A 4OP5A 4WZ5A 5F1GA 4LV3A 1BLSA 4QD4A 1ZC2A 3P09A 3DWZA 3LO7A 4Q8IA 3QNBA 3HLFA 2DCFA 2Y2OA 3Q07A 2PU2A 4KZ7A 2ZC5B 2FFFB 2EX9A 3ZG7B 2QMIA 4KZAA 4C6YA 4GD6A 3HUNA 1BLPA 3IWQA 1I2WA 4P85A 4U3TA 5CTMA 4EBLA 4S2LA 4BL2A 2XD5A 3RJUA 1ES2A 1FOFA 1KE4A 3ZNTA 2V2FF 2XLNA 1PZOA 3PAEA 4MEZA 4E3IA 2H10A 4B88A 3VP0A 4KZ8A 3GMWA 5FA7A 3ZG8B 1KVLA 4N1HA 1XPBA 1FSYA 1SDEA 3NI9A 1NZOA 3HLWA 1IKGA 3HUMA 1I2SA 3DTMA 2ZM2A 3IWOA 1MWSA 4EWFA 4GD8A 3SOIA 4A5RA 1J9MA 3O87A 1PWGA 2PBYA 1FR6A 4E3OA 2ZC7A 5FQQA 1YMSA 4JF4A 3IF5A 5JYOA 4HBTA 4WZ5C 4X55A 3UDXA 4KQOA 2P9VB 3EQUA 4BENA 2G2UA 2A49A 4PM9A 2Z2LB 3IH9A 4E3LA 1ESIA 3S4XA 4S2PA 4Y7PA 1IYQA 2WZZA 4LV0A 3N4IA 4R1GA 3HLDA 5FSRA 2R9XA 3HUOA 5EUAA 1DJCA 1NZUA 2Y2LA 3NBLA 2ZLYA 4WM9A 5IHVA 5JYPA 1K56D 3RXWA 4C75A 3TSGA 3Q82A 4BL3A 4DF6A 3G4PA 3A3EA 3VSKA 3FZCA 3PBTA 5KSHA 2H0TA 4DRTA 1NYMA 5E2FA 5CERA 4P0MA 2XH9A 1L0GA 1SDNA 4N9KA 2EFUA 4OOLA 4NETA 5GL9A 1PZPA 3AGEA 4LCMA 4BD1A 3VFHA 4WEJA 4EV4A 3C4OA 3CMZA 1JWVA 4HEFA 1PWDA 5DF9A 1GHIA 2XFSA 4X6TA 3MXRA 4ZJ3A 1EWZA 4DXBA 4OONA 3DWKA 4Z9QA 1SKFA 2ZC6B 3MXSA 4K91A 1XGJA 2XF3A 4XXRA 1RP5A 4EUZA 1WYCA 2WGVA 4RX3A 3BYDA 2V20A 5CECA 1HTZA 1ZG6A 2ZD8A 2IWDA 2Q9MA 5DF8A 1IELA 1K6SA 2QPNA 5TR7A 4F94A 3N7WA 4R4RA 4ZAMA 3BRMA 3WRTA 1K25A 4JF6A 4IBXA 5AQ9A 4O7DA 1L0FA 3M6BA 2Y59A 3M2KA 1BT5A 2XEPA 3GR2A 4XUXA 1FCOA 5M18A 2Y91A 3QHYA 4JBFA 1NJ4A 3HL9A 3UPOA 3PBNA 1L2SA 3UPPA 1M40A 1GHMA 3CG5A 2Y2IA 3N8SA 4FH4A 1JWZA 5GLCA 3V39A 2HP6A 3G32A 4WZ4A 5CEBA 5HARA 1VQQA 4FH2A 3PBSA 4ZJ1A 3NC8A 2P9VA 2ZC3B 3B3XA 3MZFA 2HP9A 4N92A 4S2NA 4S2JA 3OPPA 1O07A 5DTSA 4E6XA 1LLBA 1RGYA 3SS5A 1ES5A 1LI0A 4WBGA 3SH8A 4OP8A 2HP5A 5I94A 3HLBA 2Z2MB 3O86A 3IWIA 1DY6A 4GDNA 4LCLA 2ZQCA 1CK3A 1XA7A 1S6RA 1PI4A 2EXBA 2WZXA 5GHYA 5A91A 3IXHA 1BLCA 5HW3A 4S2KA 2HPBA 3IHAA 2ZQ7A 2X71A 2ZC4B 1MBLA 3GTCA 1KGFA 3FWLA 1W5DA 5CHJA 3Q7ZA 4N1XA 5FDHA 1RCJA 1Y54A 4H8RA 4PPRA 2C6WB 1ES3A 4DXCA 3VSLA 5CGWA 3G35A 4MBFA 1TVFA 4C3QA 1PYYA 3VMAA 4D2OA 1XGIA 1ALQA 4X56A 5TGFA 5FI6A 2ZQ8A 1BULA 3M2JA 4OQ0A 4PM6A 4X69A 4B4XA 3SH7A 1PW8A 3V5MA 3VOYA 3LCEA 3Q7VA 2Y4AA 1C3BA 1K57A 3WS2A
chains in the Genus database with same CATH superfamily
3UNWA 1A0KA 2J3WA 3GQZA 5FQMA 4E3KA 1OJGA 3PBOA 4KQQA 5EVID 2PHYA 2NUPC 4DDYA 1ZTUA 1RGZA 2ZQ9A 2J3TC 2WAEA 1W8QA 2W3EA 2A3UA 2VX8A 1W63M 4I38A 2HV1A 2W0NA 3B47A 1Q2QA 2W1TB 3IT9A 3S1YA 4L9FA 3GDIA 4LFUA 5HD5A 2Y2PA 4WMCA 2QKPA 4II7A 3BFDA 1H8MA 2V1AA 5FQJA 2WAFA 3V3RA 3PTEA 4Q0HA 2XK1A 2QHKA 3LIEA 1PIOA 3TE8A 1FSWA 4NEED 3S7OA 4EUVA 2CC1A 1F9IA 1N9BA 4I3AA 3A3DA 3EEHA 1IYSA 3OC2A 2B5RA 1MZUA 5L10A 3LYXA 3V50A 4HBUA 3H82A 3ZFZA 1NYYA 3TRCA 5AQAA 5GLAA 3IXBA 4OPRA 4KUOA 5F82A 2ZMAA 2R78A 4BQMA 4X1LA 3UMEA 3OCNA 2Y4AA 2Y8HA 5EVIA 4S2OA 5KZHA 3OZHA 4QY6A 3WS4A 4YINA 3W4OA 4BLMA 4ZTKA 3MFDA 2HDUA 4F3LB 4FOFA 3C5AA 1XX2A 5DF7A 1CEFA 3CAXA 1IEMA 4LRYC 5G4ZA 3IHBA 2V8FA 3KSIA 3OPHA 3SS4A 5F5YA 1K6RA 4FCFA 2J9OA 4IBRA 5AVFA 4CLCC 4ARZA 2Y2HA 2ZM0A 3UPNA 4NXBA 4U0XA 1S4RA 4HY8A 3KX0X 1BZAA 3B42A 3G2ZA 1QMEA 3I7JA 4K0XA 1ERQA 3EWKA 4OLGA 3MBZA 3DAVA 2NUTC 2HDRA 4GNUA 4P6ZS 1VEUA 1Z6FA 2EX8A 4E3MA 4R38A 1LT0A 2VLGA 1YLZA 3WS0A 3LI8A 4Y0TA 3ZDJA 1ERMA 5AQ7A 4M4XA 3VFFA 2VGLS 3LY4A 4NK3A 3BLSA 3KSHA 4KQRA 3BW6A 1ACFA 5HPFA 3UB9A 3PR6A 2WGIA 4EBNA 3T4KA 1NXYA 3T1RA 3MMHA 4E3JA 1JWPA 1K55A 2ACGA 3JYIA 3K3CA 5DJUA 1CF0A 3QP1A 1PNEA 1VHMA 1LSXA 1KVMA 1VEUB 3NOUC 2OOLA 3ITBA 2L1MA 4X68A 4OQGA 1GSWA 2W3FA 1VETA 3LIBA 4GOGA 4PM7A 2BLSA 2J80A 2J7VA 1M6KA 1JTGA 1K55C 3NCKA 3OCLA 2VV6A 3Q7VB 1MKMA 3W8KA 3IBJA 3PYPA 2KX6A 4FSFA 2WKHA 1TS7A 4DN0A 2ZQAA 1G68A 2OWHA 3UB6A 2Y2MA 4BD0A 1S1ZA 5HFOA 1K4FA 3TW8A 1PRQA 4L9EA 2V0WA 2PU4A 2JKFA 3NECA 3Q81A 4LGWA 3UE0A 4O0PA 5EVIB 3S7PA 4PM5A 5E2EA 4KZ5A 5F1GA 1W79A 3T4OA 1BLSA 1ZC2A 5KIZA 2K2NA 2DCFA 2Y2OA 4IUHA 2PU2A 4KZ7A 4Y15A 4D60A 4EBLA 3U2AA 4S2LA 4BL2A 3PXPA 3RJUA 5L8MA 3CUEA 4G3VA 4XT2A 3E98A 3ZG8B 3CHWP 3HJKA 1SDEA 3LICA 1NZOA 2W1TA 3HUMA 3DTMA 4ARZB 2D01A 1MWSA 4EWFA 3LR0A 3QP6A 4A5RA 1DP9A 2WKRA 1TD5A 4E3OA 2PBYA 1YMSA 2PYRA 5EFWA 3UDXA 2P9VB 4GHIB 5HWTA 5L07A 2ZOIA 2ZL1A 1K0KA 3HLDA 3HUOA 1NZUA 2ZLYA 2J3TD 4C75A 3BY9A 3G4PA 3FZCA 2GZAA 2L0WA 5E2FA 4P0MA 4OOLA 4NETA 4Y3IA 4LCMA 1T1BA 3CMZA 1JWVA 4ETXA 5DF9A 2XFSA 3MXRA 4Z9QA 4K91A 2V0UA 1YAXA 3BYDA 2ZD8A 2Q9MA 5DF8A 1IELA 3T4JA 4ZRRA 4X1MA 4ZAMA 4DJ2A 4IBXA 3M6BA 2Y59A 3M2KA 2ZMVA 4XUXA 1FCOA 3C2WA 1NJ4A 3HL9A 1M40A 1GHMA 3N8SA 4FH4A 1JWZA 2HP6A 3F1PB 3PBSA 2A24A 4N92A 4S2NA 3MZFA 2HP9A 3OPPA 1O07A 1F98A 5J3WA 5HZHA 3HLBA 3IWIA 4GDNA 2ZQCA 1PI4A 2K31A 1BLCA 2OAP1 4S2KA 4PKYG 5FDHA 1OTBA 1OPXA 2C6WB 1L3LA 1TVFA 4D2OA 1XGIA 2XROA 1NLZA 4JGRA 5J7EA 5FI6A 4OQ0A 5F69A 4MMNA 3V5MA 3F1OB 1K57A 3WS2A 1MWTA 1KDSA 3FG8A 5CHUA 1H8YA 2JHEA 1PWCA 2XDMA 3ZCZA 1TS0A 3GSGA 3HLGA 3G2YA 3ISGA 4CPKA 1KGGA 3E2KA 2Y2GA 4R4SA 1MC0A 3L7HA 5HAQA 1ZG4A 4GJ4A 5M19A 2P04A 4MBHA 3C7VA 4I3JA 2X02A 2XD1A 5M1AA 3CPTA 5DJTA 4IEDA 2VGJA 1T18A 1VM1A 5HDSA 3ZG9B 3IF6A 4UA7A 4HP4A 2WGWA 3M6HA 2JCHA 3FC7A 4N9LA 3EQVA 5HWWA 2B95A 5FI7A 1L0DA 2PRFA 1DJBA 3QP8A 5G4YA 4DE3A 3IBRA 3FKWA 4P6ZM 4QU3A 5A93A 3OPRA 2L4RA 5CHMA 4RX2A 5CTNA 2BTFP 1LHYA 3C4PA 3ICYA 3FKVA 4QHCA 4OPZA 1LL9A 1W7FA 3MR0A 1LSVA 4CLCD 3A3IA 1W8YA 3LY3A 4MN7A 1CJFA 3SS3A 3E2LA 4EEPA 3MJQA 2J8YA 2VV8A 1XP4A 1F5MA 2XRNA 3C7UA 2JKRI 2ZJ9A 1LSWA 4HESA 3RH8B 2XGNA 3MZDA 2M7VA 1CQAA 3QNCA 2EX6A 4MCWA 4EQIA 1S66L 3NIAA 1LL8A 5EOEA 1CEGA 3HLCA 3F1OA 1JTDA 3MS6A 3SW1A 4GKUA 1H5XA 1BLHA 3OBFA 1KDWA 1N9LA 1G28A 1YSPA 5J8XA 4OOMA 1TDGA 5EPHA 2H5SA 4QY5A 5IS1A 2JBFA 3L9KA 4E6WA 4ME4A 4OQIA 5EV0A 5F1FA 3T4LA 1XA1A 1UWPX 4NXFA 5CGXA 2W1RA 5DFYA 2WYXA 2J9PA 2XFTA 1KE0A 3C8CA 3HBRA 5L2FA 4WLAA 1E3UA 1K54C 2H28A 3LIFA 4LV1A 4JLFA 4H6JB 3W4PA 4EU0A 4I39A 4JKTA 4HQAA 4UHUA 3R7WA 2X01A 4ZBEA 3BLMA 2EXAA 4UQIS 3OOVA 1HZOA 3IF6B 4OLDA 1MWUA 5G18A 3BQ8A 4QB8A 5DTKA 4E3NA 3VP3A 1S1YA 5J4EA 4EQ1A 3MXQA 5FQKA 3ZG0A 4HJ4A 2RL3A 2WUQA 1MY8A 3UB5P 1J3WA 2PBDP 4Y0UA 4FD8A 4RVAA 2WGWB 2HJEA 1ES4A 2OSUA 3DTEA 4L0LA 5E2HA 1MKIA 4U0TA 2DRWA 4HOIA 1IOUA 3BFGA 3PAGA 4GZBA 5HD3A 4LENA 3IX8A 2ZOHA 4KG2A 5EOOA 1ONGA 4MLLA 2BG1A 4OPYA 3GV9A 2OLVA 3DBAA 3LUQA 4RA7A 2P74A 2D02A 1WE4A 3D4FA 1BTLA 1GCEA 4MNRA 4R23A 4CLCB 5EVLA 4ZDXA 2I72A 2XQZA 3H9WA 3LEQA 3VOZA 4CJNA 2Y2QA 1AWIA 4BBUA 1VB6A 5I5LA 5CRFA 2VJWA 3P98A 4OP5A 5TBMB 4ETZA 3P09A 5HPIA 4HJ3A 2EX9A 2JKTM 4PAUA 2Q0OA 5C5KA 4U3TA 3NULA 1ES2A 1NWZA 2V2FF 1PZOA 3LR4A 3GMWA 5FA7A 1KVLA 1XPBA 1I2SA 3IWOA 4GD8A 1YKDA 3VE4A 2ZC7A 3T1SA 5JYOA 4HBTA 5EM1A 4CLCA 4K08A 3FPWA 1F2KA 2PR5A 2A49A 4PM9A 2V9AA 4E3LA 1ESIA 2WZZA 3N4IA 2R9XA 5EUAA 2Y2LA 3NBLA 1K56D 3TSGA 3Q82A 1XJ2A 3VSKA 2H0TA 4DRTA 1NYMA 2XH9A 2VA0A 5GL9A 3QP4A 1P9RA 1FILA 2GJ3A 4EV4A 3C4OA 4X25A 1GHIA 4X6TA 4OONA 2ZC6B 1XGJA 1RP5A 4RX3A 2V20A 5CECA 2IWDA 1OTEA 2M1CA 1K6SA 5TR7A 4WN5A 2Z6DA 4O7DA 3VV4A 5IT5A 2OWJA 2DMWA 2P08A 3E4QA 3UPOA 3PBNA 1L2SA 1EW0A 3CG5A 3V39A 4WZ4A 1VQQA 4FH2A 1WA9A 3B3XA 1PFLA 3LFVA 1T1CA 1Y28A 1T19A 3SH8A 2HP5A 4R3AA 3T1XA 1CK3A 1S6RA 5GHYA 5HW3A 2ZQ7A 2ZC4B 4O01A 1KGFA 4N1XA 1Y54A 4H8RA 4IJGA 4DXCA 1ALQA 1NRJA 4Y17A 3Q7VA 3UB7A 1C3BA 1HLUP 3C30A 4R6LA 2VGLM 2ZBBA 4EBPA 1MXOA 5GLDA 4WELA 5TBMA 2VGKA 2QJ7A 5FATA 4GS9B 3FYZA 1FCMA 3VP1A 3C38A 4P6BA 3ZVWA 2V1BA 4DE0A 3NY4A 3SH9A 3VP2A 3FV7A 1ONHA 3AGFA 4KZBA 1BUEA 3EOIA 1D1JA 1YPRA 5HDDA 3BM6A 4DE2A 2DNSA 3S7QA 3MKEA 2XR0A 1HVBA 3R4KA 1OT9A 1FIKA 2W3HA 1MPLA 1YLTA 1BSGA 4KQDA 4DDSA 3VP4A 1YMXA 2PT7A 3BWLA 3TG9A 5F6AA 4Y5FA 3UE1A 4Z1WA 2M7UA 4BJPA 5EVEA 3S22A 5HAPA 3EGXC 5FAOA 1U60A 5KSCA 3ULFA 2HDQA 5FDSA 5FQ9A 4M3KA 3QP2A 5CX7A 2Q9NA 3NOPC 3D9YA 4JXVA 1GSXA 1I5QA 2Z6CA 3W4QA 5F83A 3Q1FA 2VZWA 3ZGAB 3HREA 2OV5A 2EWWA 4BBVA 2PD7A 5FAQA 2KLIA 3BFCA 1YLPA 3UY6A 5U47A 4PM8A 3E4PA 2B02A 3LIDA 1K38A 2FFYA 4OOYA 1NRFA 2V8CA 3HCYA 1OTAA 3KSGA 4S2NC 2IA2A 1L0EA 1E25A 3H82B 4G3KA 4RYEA 1OTIA 1G6OA 4E04A 5FI2A 4OVDA 3BFFA 3MQOA 3BEBA 2WKPA 3A3FA 4JGPA 1OMEA 2ZM8A 2LB9A 4KENB 3RXXA 4DMZA 2WKIA 2A2LA 2HDSA 3T4TA 3PHYA 3CJMA 4NKPA 3SZTA 3G31A 4KZ9A 3ZNYA 5HWVA 5FAPA 4BWIA 4XUZA 5DVAA 3IXGA 4KG6A 4Y2FA 4O8GA 2JC7A 4MN5A 1NY0A 3E4OA 3BECA 3LI9A 1YSQA 3PBRA 1IKIA 1ZKJA 4HP9A 3MKFA 1YLYA 1XXMA 4Q0JA 3IS2B 4JXGA 4F3LA 3MZEA 4LRXC 1NLYA 1ZHHB 4GB7A 2BASA 4HH3A 4KZ3A 3LEZA 1TS8A 1G6AA 4PHTA 2GX5A 3UN7A 4IVIA 1YLJA 5A92A 1DRMA 1YLWA 4WMCD 2V1ZA 4X53A 4PMAA 1GSVA 4G3WA 4KZ6A 1JNUA 3V3SA 4JXWA 3MF0A 3NOTC 1EI5A 2O9CA 3K2NA 2W3DA 1XFNA 4BBTA 1E4DA 3E0YA 4ZJ2A 4JGOA 1STZA 3IS2A 3O3VA 2Y2NA 4ID4A 4GN2A 4GDBA 3HJIA 1LL5A 1IYPA 2JKRM 1SCWA 1IYOA 4EETB 5EECA 4R0QA 2Y2KA 4WF0A 5E2GA 2RCXA 3G30A 4QJGA 3ZVTA 4CQHA 1WYBA 2WADA 3F1NA 3T4SA 3CLOA 5KMWA 3TOIA 1V9YA 1K57C 3WS1A 4WZ5A 4LV3A 4GS9A 3BY8A 3LO7A 4Q8IA 3Q07A 1G5UA 4GLQA 2ZC5B 2FFFB 4C6YA 3HUNA 1BLPA 3IWQA 5CTMA 2O9BA 2GNXA 3A0VA 2K7SA 1FOFA 1KE4A 3ZNTA 2QYBA 2XLNA 1XJ3A 3CWFA 1FSYA 2FZ0A 3HLWA 2ZM2A 1TS6A 3SOIA 1J9MA 3O87A 1FR6A 2HGVA 5FQQA 2PR6A 4WZ5C 3EQUA 4B9OA 2G2UA 1KOUA 2Z2LB 3IH9A 3G6OA 4Y7PA 3FPVA 4LV0A 5FSRA 4R1GA 3OLOA 1H0MA 4WM9A 4PKYA 3F1NB 5IHVA 2O0YA 3RXWA 3A3EA 2HF6A 2JKTI 3P01A 5CERA 2JN7A 1L0GA 1SDNA 4N9KA 2EFUA 1PZPA 3VFHA 3H7WA 3LR3A 4HEFA 4DXBA 3DTKA 2PD8A 5DFXA 1SKFA 3MXSA 2XF3A 2WGVA 3TJZC 1ZG6A 2PAVP 2QPNA 3KO6A 3N7WA 4EESA 3S7NA 5AQ9A 4XT2B 1L0FA 4IUKA 5EM0A 2ZL1B 1BT5A 5M18A 2Y91A 4EERA 5A8BA 3CPTB 3G32A 5HARA 2P9VA 2OAQ1 5DTSA 2UV0E 4E6XA 3SS5A 3CITA 1ES5A 1LI0A 4WBGA 4OP8A 2Z2MB 3O86A 1DY6A 4LPZA 5HDCA 3D72A 4LCLA 1XA7A 4I5SA 5A91A 3IXHA 1MBLA 4HNBA 3GTCA 3FWLA 3MQQA 4PPRA 1ES3A 5CGWA 3G35A 4MBFA 4C3QA 4X56A 5TGFA 2ZQ8A 1BULA 3M2JA 4PM6A 4B4XA 4L9GA 1PW8A 2PDRA 1T1AA 1H8ZA 5HX9A 1N4OA 3F1PA 2G2WA 4Y13A 3RTYA 1SKOB 2ZQDA 2E8IA 3UB8A 2Y55A 1SHVA 4YFMA 2WK0A 4WUJA 3HLEA 1AXBA 1X0OA 3A0SA 3NHQA 4EEUA 4YWZA 4AFIA 2A24B 1K54A 2C5WB 4BMWA 3KSFA 3G34A 5CGSA 4UQIM 5CEDA 4HJ6A 4GCZA 1OT6A 4P87A 2UWXA 4LV2A 2PYPA 3N6IA 2QWSA 1SKOA 2XA7M 4LRZE 3V67A 2IWCA 4OKPA 1VETB 2VK3A 1QMFA 2Y2JA 2CMNA 3CI6A 3BFEA 1GA9A 4DKIA 1KGEA 1O7EA 5A90A 4UA9A 1JVJA 3D3OA 5IU1A 1K56A 3N8LA 3IF6C 2EFXA 4DE1A 1KE3A 4UAAA 1EROA 4HHDA 3UDFA 2EA9A 5AQBA 5GHZA 2WKQA 3N8RA 4OPQA 1XJ4A 3H7WB 4UEYA 1V9ZA 5DKLA 4KUKA 3QP5A 1YM1A 3MSHA 2LB5A 3BQAA 2WKEA 1LI9A 2G7UA 2KOIA 1MWRA 1Q2PA 5LBRA 3GRJA 3BJNA 4K0WA 5F68A 3UE3A 1GA0A 5HAIA 1YT4A 1CI9A 5HL1A 4R70A 3IXDA 2OLUA 4R3BA 3IQAA 3UE6A 3PBQA 3ITAA 1OJ5A 2VKSA 2EX2A 3IH8A 1P0ZA 3DW0A 1GHPA 3GECA 4CLCE 3WRZA 3AGDA 2XA7S 1N9NA 2JKGA 2JE5A 1E3UD 3UMDA 3ZYTA 1K4EA 3HVFA 4KG5A 1TDLA 3VOLA 5FASA 1UGUA 3KYQA 4JPMA 2FH5A 3WWXA 5EVIC 3T12B 3A3JA 5D3OA 3NDGA 3LR5A 3T50A 5EE8A 4IHQA 3W2ZA 1YQSA 5E43A 4EXOA 2QZ6A 3O5YA 1HD8A 4S2MA 1D7EA 1Y4OA 3ZG5A 4S2IA 1CI8A 4QWOA 1S4SA 1FQGA 3GVBA 2R9WA 1DJAA 4OQHA 1XJ6A 3IX3A 4WEKA 5DTTA 2YKHA 4DJ3A 4MBKA 5GHXA 3U4LP 4NG2A 1ODVA 3CZDA 3O88A 2IWBA 4R3JA 4WYYA 5BOHA 3OPLA 4I3IA 5FQIA 3A0RA 1TEMA 2INWA 1W63Q 3MFXA 2B18A 1P9WA 4RQ9A 4UA6A 3R7WB 4WL9A 4KZ4A 2KDKA 1S0WA 3NJAA 1FR1A 2AVXA 4JF5A 3RFBA 3DTIA 4B93A 4YOFA 2GDNA 1UWNX 1FCNA 4MDZA 1PI5A 2H0YA 5CXWA 1XKZA 3JPUA 3UDIA 4FUWA 1PW1A 5L09A 2O99A 5GLBA 3K3DA 1N9OA 5FEGA 3CUEC 4Y0OA 5TFQA 4JXSA 3UO9A 3ZHHA 2QJ5A 4IVKA 2VEAA 2Y79A 3P7NA 2E8JA 5FL3A 1ESUA 3NDEA 4ESPA 3WS5A 1OTDA 2P7JA 5HSQA 3B33A 1SZVA 2HJ9C 4OH0A 1H3QA 4QD4A 4GHIA 3DWZA 2MJ6A 3QNBA 1D06A 3HLFA 4HIAA 3ZG7B 5DKKA 2QMIA 3JVUA 4KZAA 4GD6A 1IFQA 4MN6A 2YKFA 1I2WA 4P85A 5MC7A 4JGQA 2XD5A 4MEZA 3KYEA 3PAEA 4E3IA 2H10A 2VV7A 3VP0A 4KZ8A 4B88A 4N1HA 3NI9A 4FTXA 1IKGA 2W3GA 1PWGA 4JF4A 5AJGA 3IF5A 4X55A 4KQOA 4BENA 4GW9A 3S4XA 4S2PA 1IYQA 3LGOA 4EW7A 1P97A 1DJCA 5JYPA 5HL6A 4BL3A 4DF6A 5KSHA 3PBTA 1TF1A 2ZMFA 3T4QA 3AGEA 4BD1A 5FEFA 4WEJA 1PWDA 4Q0IA 4ZJ3A 1EWZA 3DWKA 4XXRA 4YNRA 4EUZA 1WYCA 4NXEA 1HTZA 2XSSA 3VE3A 4F94A 4R4RA 3BRMA 3WRTA 1K25A 4JF6A 3T1QB 2XEPA 3GR2A 3QHYA 4JBFA 3JVVA 3MQ0A 1XFQA 2EWVA 3UPPA 4B4ZA 5GLCA 2Y2IA 5CEBA 4ZJ1A 3NC8A 2ZC3B 4S2JA 1LLBA 1RGYA 5AVEA 1DP6A 4HI4A 5I94A 3IX4A 2W27A 1S67L 2EXBA 2WZXA 1DP8A 2HPBA 3IHAA 2X71A 3EEAA 3EGDC 4NXGA 3KYZA 5CHJA 1W5DA 3Q7ZA 1RCJA 4LLOB 2O9AA 3VSLA 3LIAA 4QPRA 1PYYA 3VMAA 1Z09A 4H6JA 1BYWA 5K5BA 2I9VA 4X69A 2HZ5A 3SH7A 3ZQ5A 3VOYA 3LCEA 4HH2A 5TJJA
chains in the Genus database with same CATH topology
1H8ZA 1MWTA 3UNWA 3GQZA 5HX9A 1N4OA 4EBPA 1MXOA 1KDSA 5CHUA 5GLDA 1H8YA 2G2WA 4WELA 2VGKA 5FQMA 1PWCA 4E3KA 2XDMA 3PBOA 4KQQA 5FATA 3ZCZA 3GSGA 3HLGA 5EVID 3G2YA 3FYZA 1FCMA 3ISGA 3VP1A 4CPKA 2ZQDA 4P6BA 3ZVWA 1KGGA 2E8IA 4DE0A 3NY4A 3E2KA 2Y2GA 2Y55A 3SH9A 1SHVA 4R4SA 5HAQA 3VP2A 1ZG4A 4YFMA 2WK0A 4DDYA 3FV7A 1ONHA 4MBHA 5M19A 3AGFA 1RGZA 4KZBA 2ZQ9A 1BUEA 2WAEA 1W8QA 3C7VA 3HLEA 2X02A 1AXBA 2XD1A 2A3UA 5M1AA 1K54A 3BM6A 4DE2A 2C5WB 4IEDA 2DNSA 2VGJA 3MKEA 1VM1A 2XR0A 1Q2QA 3ZG9B 3IT9A 3IF6A 1HVBA 3S1YA 4UA7A 2WGWA 3G34A 5CGSA 3M6HA 2Y2PA 4WMCA 2JCHA 1MPLA 1YLTA 3BFDA 1BSGA 4N9LA 3EQVA 5CEDA 4DDSA 4P87A 5FI7A 1L0DA 3VP4A 1DJBA 2UWXA 4LV2A 1YMXA 3N6IA 2IWCA 4OKPA 4DE3A 3FKWA 5FQJA 2WAFA 3TG9A 4QU3A 3V3RA 3PTEA 1QMFA 2Y2JA 5A93A 3OPRA 2XK1A 3UE1A 5CHMA 4RX2A 1PIOA 3BFEA 1FSWA 5CTNA 1LHYA 2CC1A 3C4PA 1N9BA 4BJPA 3FKVA 1GA9A 4DKIA 1KGEA 1O7EA 4QHCA 5A90A 4UA9A 3S22A 4OPZA 3A3DA 1JVJA 1IYSA 3OC2A 1LL9A 1W7FA 5HAPA 1K56A 2B5RA 3N8LA 5FAOA 1U60A 3IF6C 5KSCA 3V50A 2HDQA 2EFXA 4DE1A 3A3IA 4HBUA 1KE3A 4UAAA 1NYYA 1W8YA 1EROA 3LY3A 5FQ9A 4M3KA 5AQAA 3ZFZA 3UDFA 3SS3A 5AQBA 3E2LA 5GHZA 5GLAA 2Q9NA 3IXBA 3N8RA 4OPQA 4JXVA 2J8YA 4OPRA 5F82A 1XP4A 2ZMAA 4BQMA 1I5QA 1YM1A 3OCNA 3W4QA 5F83A 2WKEA 1LI9A 3C7UA 2ZJ9A 1MWRA 3Q1FA 5EVIA 4HESA 2XGNA 3MZDA 1Q2PA 3ZGAB 3HREA 4S2OA 5KZHA 3OZHA 4QY6A 3WS4A 3GRJA 3QNCA 2OV5A 2EX6A 4K0WA 4YINA 3UE3A 1GA0A 5HAIA 4EQIA 1YT4A 1CI9A 3W4OA 4ZTKA 5FAQA 4BLMA 3MFDA 3NIAA 5HL1A 2HDUA 5EOEA 3C5AA 1XX2A 3IXDA 2OLUA 4R3BA 3BFCA 1CEFA 1CEGA 3IQAA 5DF7A 3HLCA 3PBQA 3ITAA 1IEMA 1YLPA 3IHBA 1JTDA 3UY6A 2EX2A 4PM8A 5U47A 3IH8A 3OPHA 1H5XA 3DW0A 4GKUA 3SS4A 1BLHA 1GHPA 1K6RA 1K38A 4FCFA 2FFYA 1KDWA 3WRZA 4OOYA 3AGDA 5J8XA 1NRFA 2J9OA 4OOMA 4IBRA 1TDGA 5EPHA 2H5SA 4QY5A 4S2NC 2JBFA 4E6WA 2JE5A 4OQIA 2Y2HA 2ZM0A 1E3UD 1L0EA 3UPNA 5F1FA 1E25A 4U0XA 1K4EA 3HVFA 4RYEA 1BZAA 4KG5A 1TDLA 1XA1A 5FASA 3G2ZA 5CGXA 4JPMA 1QMEA 2WYXA 5FI2A 3WWXA 2J9PA 3I7JA 2XFTA 1KE0A 4K0XA 3HBRA 1ERQA 4OVDA 5EVIC 4B4ZA 5L2FA 4OLGA 3A3JA 5D3OA 3BFFA 3MBZA 1E3UA 3NDGA 1K54C 3BEBA 4GNUA 2HDRA 1Z6FA 3A3FA 5EE8A 1YQSA 1OMEA 2ZM8A 4LV1A 4JLFA 5E43A 2EX8A 4KENB 3RXXA 4E3MA 2QZ6A 2WKIA 3W4PA 2HDSA 4JKTA 1YLZA 1HD8A 4S2MA 3WS0A 3ZG5A 4S2IA 4UHUA 3CJMA 1CI8A 4ZBEA 2X01A 4Y0TA 3BLMA 3ZDJA 1ERMA 5AQ7A 1FQGA 3G31A 4KZ9A 3ZNYA 3GVBA 3VFFA 2R9WA 1DJAA 2EXAA 5FAPA 4OQHA 3LY4A 4XUZA 1HZOA 5DVAA 3IXGA 3IF6B 4KG6A 4NK3A 4OLDA 1MWUA 4WEKA 5DTTA 5G18A 3BLSA 4QB8A 2JC7A 5DTKA 4KQRA 4E3NA 3VP3A 4MBKA 5GHXA 1NY0A 3CZDA 3O88A 2IWBA 4R3JA 3BECA 4WYYA 5BOHA 5FQKA 3ZG0A 3OPLA 2WGIA 2RL3A 3PBRA 5FQIA 1IKIA 2WUQA 1ZKJA 1MY8A 3MKFA 1YLYA 1XXMA 4EBNA 1NXYA 1TEMA 4JXGA 4Y0UA 4E3JA 3MZEA 4FD8A 1JWPA 4RVAA 2WGWB 1K55A 4UA6A 1ES4A 3JYIA 4GB7A 2OSUA 4KZ3A 3LEZA 4L0LA 1G6AA 5E2HA 1MKIA 4KZ4A 3UN7A 4IVIA 4U0TA 1YLJA 2DRWA 5A92A 1S0WA 3BFGA 1FR1A 1YLWA 3PAGA 1KVMA 4GZBA 4WMCD 2V1ZA 4X53A 4LENA 3ITBA 4KG2A 4PMAA 5EOOA 1ONGA 4MLLA 4KZ6A 4JF5A 4X68A 4OQGA 2BG1A 2GDNA 1FCNA 3V3SA 4JXWA 1EI5A 1PI5A 4GOGA 2H0YA 4PM7A 4OPYA 3GV9A 2OLVA 5CXWA 2BLSA 1XKZA 3UDIA 1E4DA 1PW1A 4RA7A 2J7VA 4ZJ2A 1M6KA 2P74A 5GLBA 3O3VA 2Y2NA 1JTGA 1K55C 3NCKA 1WE4A 3OCLA 3Q7VB 4ID4A 4GN2A 4GDBA 4Y0OA 5TFQA 3W8KA 4JXSA 1LL5A 3UO9A 3ZHHA 3D4FA 1BTLA 4IVKA 1GCEA 4MNRA 1IYPA 4FSFA 2WKHA 1SCWA 4R23A 1IYOA 2ZQAA 5EECA 1G68A 5EVLA 4R0QA 4ZDXA 2I72A 2XQZA 2Y2KA 5E2GA 2RCXA 3G30A 2Y2MA 1ESUA 4BD0A 3ZVTA 5HFOA 4QJGA 1K4FA 3VOZA 4CJNA 3NDEA 2Y2QA 3WS5A 2PU4A 1WYBA 2WADA 3Q81A 3UE0A 5CRFA 5KMWA 3TOIA 1K57C 5EVIB 3WS1A 4PM5A 4OH0A 4KZ5A 5E2EA 1W79A 3P98A 4OP5A 4WZ5A 5F1GA 4LV3A 1BLSA 4QD4A 1ZC2A 3P09A 3DWZA 3LO7A 4Q8IA 3QNBA 3HLFA 2DCFA 2Y2OA 3Q07A 2PU2A 4KZ7A 2ZC5B 2FFFB 2EX9A 3ZG7B 2QMIA 4KZAA 4C6YA 4GD6A 3HUNA 1BLPA 3IWQA 1I2WA 4P85A 4U3TA 5CTMA 4EBLA 4S2LA 4BL2A 2XD5A 3RJUA 1ES2A 1FOFA 1KE4A 3ZNTA 2V2FF 2XLNA 1PZOA 3PAEA 4MEZA 4E3IA 2H10A 4B88A 3VP0A 4KZ8A 3GMWA 5FA7A 3ZG8B 1KVLA 4N1HA 1XPBA 1FSYA 1SDEA 3NI9A 1NZOA 3HLWA 1IKGA 3HUMA 1I2SA 3DTMA 2ZM2A 3IWOA 1MWSA 4EWFA 4GD8A 3SOIA 4A5RA 1J9MA 3O87A 1PWGA 2PBYA 1FR6A 4E3OA 2ZC7A 5FQQA 1YMSA 4JF4A 3IF5A 5JYOA 4HBTA 4WZ5C 4X55A 3UDXA 4KQOA 2P9VB 3EQUA 4BENA 2G2UA 2A49A 4PM9A 2Z2LB 3IH9A 4E3LA 1ESIA 3S4XA 4S2PA 4Y7PA 1IYQA 2WZZA 4LV0A 3N4IA 4R1GA 3HLDA 5FSRA 2R9XA 3HUOA 5EUAA 1DJCA 1NZUA 2Y2LA 3NBLA 2ZLYA 4WM9A 5IHVA 5JYPA 1K56D 3RXWA 4C75A 3TSGA 3Q82A 4BL3A 4DF6A 3G4PA 3A3EA 3VSKA 3FZCA 3PBTA 5KSHA 2H0TA 4DRTA 1NYMA 5E2FA 5CERA 4P0MA 2XH9A 1L0GA 1SDNA 4N9KA 2EFUA 4OOLA 4NETA 5GL9A 1PZPA 3AGEA 4LCMA 4BD1A 3VFHA 4WEJA 4EV4A 3C4OA 3CMZA 1JWVA 4HEFA 1PWDA 5DF9A 1GHIA 2XFSA 4X6TA 3MXRA 4ZJ3A 1EWZA 4DXBA 4OONA 3DWKA 4Z9QA 1SKFA 2ZC6B 3MXSA 4K91A 1XGJA 2XF3A 4XXRA 1RP5A 4EUZA 1WYCA 2WGVA 4RX3A 3BYDA 2V20A 5CECA 1HTZA 1ZG6A 2ZD8A 2IWDA 2Q9MA 5DF8A 1IELA 1K6SA 2QPNA 5TR7A 4F94A 3N7WA 4R4RA 4ZAMA 3BRMA 3WRTA 1K25A 4JF6A 4IBXA 5AQ9A 4O7DA 1L0FA 3M6BA 2Y59A 3M2KA 1BT5A 2XEPA 3GR2A 4XUXA 1FCOA 5M18A 2Y91A 3QHYA 4JBFA 1NJ4A 3HL9A 3UPOA 3PBNA 1L2SA 3UPPA 1M40A 1GHMA 3CG5A 2Y2IA 3N8SA 4FH4A 1JWZA 5GLCA 3V39A 2HP6A 3G32A 4WZ4A 5CEBA 5HARA 1VQQA 4FH2A 3PBSA 4ZJ1A 3NC8A 2P9VA 2ZC3B 3B3XA 3MZFA 2HP9A 4N92A 4S2NA 4S2JA 3OPPA 1O07A 5DTSA 4E6XA 1LLBA 1RGYA 3SS5A 1ES5A 1LI0A 4WBGA 3SH8A 4OP8A 2HP5A 5I94A 3HLBA 2Z2MB 3O86A 3IWIA 1DY6A 4GDNA 4LCLA 2ZQCA 1CK3A 1XA7A 1S6RA 1PI4A 2EXBA 2WZXA 5GHYA 5A91A 3IXHA 1BLCA 5HW3A 4S2KA 2HPBA 3IHAA 2ZQ7A 2X71A 2ZC4B 1MBLA 3GTCA 1KGFA 3FWLA 1W5DA 5CHJA 3Q7ZA 4N1XA 5FDHA 1RCJA 1Y54A 4H8RA 4PPRA 2C6WB 1ES3A 4DXCA 3VSLA 5CGWA 3G35A 4MBFA 1TVFA 4C3QA 1PYYA 3VMAA 4D2OA 1XGIA 1ALQA 4X56A 5TGFA 5FI6A 2ZQ8A 1BULA 3M2JA 4OQ0A 4PM6A 4X69A 4B4XA 3SH7A 1PW8A 3V5MA 3VOYA 3LCEA 3Q7VA 2Y4AA 1C3BA 1K57A 3WS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8Z A;  1MWT A;  3UNW A;  3GQZ A;  5HX9 A;  1N4O A;  4EBP A;  1MXO A;  1KDS A;  5CHU A;  5GLD A;  1H8Y A;  2G2W A;  4WEL A;  2VGK A;  5FQM A;  1PWC A;  4E3K A;  2XDM A;  3PBO A;  4KQQ A;  5FAT A;  3ZCZ A;  3GSG A;  3HLG A;  5EVI D;  3G2Y A;  3FYZ A;  1FCM A;  3ISG A;  3VP1 A;  4CPK A;  2ZQD A;  4P6B A;  3ZVW A;  1KGG A;  2E8I A;  4DE0 A;  3NY4 A;  3E2K A;  2Y2G A;  2Y55 A;  3SH9 A;  1SHV A;  4R4S A;  5HAQ A;  3VP2 A;  1ZG4 A;  4YFM A;  2WK0 A;  4DDY A;  3FV7 A;  1ONH A;  4MBH A;  5M19 A;  3AGF A;  1RGZ A;  4KZB A;  2ZQ9 A;  1BUE A;  2WAE A;  1W8Q A;  3C7V A;  3HLE A;  2X02 A;  1AXB A;  2XD1 A;  2A3U A;  5M1A A;  1K54 A;  3BM6 A;  4DE2 A;  2C5W B;  4IED A;  2DNS A;  2VGJ A;  3MKE A;  1VM1 A;  2XR0 A;  1Q2Q A;  3ZG9 B;  3IT9 A;  3IF6 A;  1HVB A;  3S1Y A;  4UA7 A;  2WGW A;  3G34 A;  5CGS A;  3M6H A;  2Y2P A;  4WMC A;  2JCH A;  1MPL A;  1YLT A;  3BFD A;  1BSG A;  4N9L A;  3EQV A;  5CED A;  4DDS A;  4P87 A;  5FI7 A;  1L0D A;  3VP4 A;  1DJB A;  2UWX A;  4LV2 A;  1YMX A;  3N6I A;  2IWC A;  4OKP A;  4DE3 A;  3FKW A;  5FQJ A;  2WAF A;  3TG9 A;  4QU3 A;  3V3R A;  3PTE A;  1QMF A;  2Y2J A;  5A93 A;  3OPR A;  2XK1 A;  3UE1 A;  5CHM A;  4RX2 A;  1PIO A;  3BFE A;  1FSW A;  5CTN A;  1LHY A;  2CC1 A;  3C4P A;  1N9B A;  4BJP A;  3FKV A;  1GA9 A;  4DKI A;  1KGE A;  1O7E A;  4QHC A;  5A90 A;  4UA9 A;  3S22 A;  4OPZ A;  3A3D A;  1JVJ A;  1IYS A;  3OC2 A;  1LL9 A;  1W7F A;  5HAP A;  1K56 A;  2B5R A;  3N8L A;  5FAO A;  1U60 A;  3IF6 C;  5KSC A;  3V50 A;  2HDQ A;  2EFX A;  4DE1 A;  3A3I A;  4HBU A;  1KE3 A;  4UAA A;  1NYY A;  1W8Y A;  1ERO A;  3LY3 A;  5FQ9 A;  4M3K A;  5AQA A;  3ZFZ A;  3UDF A;  3SS3 A;  5AQB A;  3E2L A;  5GHZ A;  5GLA A;  2Q9N A;  3IXB A;  3N8R A;  4OPQ A;  4JXV A;  2J8Y A;  4OPR A;  5F82 A;  1XP4 A;  2ZMA A;  4BQM A;  1I5Q A;  1YM1 A;  3OCN A;  3W4Q A;  5F83 A;  2WKE A;  1LI9 A;  3C7U A;  2ZJ9 A;  1MWR A;  3Q1F A;  5EVI A;  4HES A;  2XGN A;  3MZD A;  1Q2P A;  3ZGA B;  3HRE A;  4S2O A;  5KZH A;  3OZH A;  4QY6 A;  3WS4 A;  3GRJ A;  3QNC A;  2OV5 A;  2EX6 A;  4K0W A;  4YIN A;  3UE3 A;  1GA0 A;  5HAI A;  4EQI A;  1YT4 A;  1CI9 A;  3W4O A;  4ZTK A;  5FAQ A;  4BLM A;  3MFD A;  3NIA A;  5HL1 A;  2HDU A;  5EOE A;  3C5A A;  1XX2 A;  3IXD A;  2OLU A;  4R3B A;  3BFC A;  1CEF A;  1CEG A;  3IQA A;  5DF7 A;  3HLC A;  3PBQ A;  3ITA A;  1IEM A;  1YLP A;  3IHB A;  1JTD A;  3UY6 A;  2EX2 A;  4PM8 A;  5U47 A;  3IH8 A;  3OPH A;  1H5X A;  3DW0 A;  4GKU A;  3SS4 A;  1BLH A;  1GHP A;  1K6R A;  1K38 A;  4FCF A;  2FFY A;  1KDW A;  3WRZ A;  4OOY A;  3AGD A;  5J8X A;  1NRF A;  2J9O A;  4OOM A;  4IBR A;  1TDG A;  5EPH A;  2H5S A;  4QY5 A;  4S2N C;  2JBF A;  4E6W A;  2JE5 A;  4OQI A;  2Y2H A;  2ZM0 A;  1E3U D;  1L0E A;  3UPN A;  5F1F A;  1E25 A;  4U0X A;  1K4E A;  3HVF A;  4RYE A;  1BZA A;  4KG5 A;  1TDL A;  1XA1 A;  5FAS A;  3G2Z A;  5CGX A;  4JPM A;  1QME A;  2WYX A;  5FI2 A;  3WWX A;  2J9P A;  3I7J A;  2XFT A;  1KE0 A;  4K0X A;  3HBR A;  1ERQ A;  4OVD A;  5EVI C;  4B4Z A;  5L2F A;  4OLG A;  3A3J A;  5D3O A;  3BFF A;  3MBZ A;  1E3U A;  3NDG A;  1K54 C;  3BEB A;  4GNU A;  2HDR A;  1Z6F A;  3A3F A;  5EE8 A;  1YQS A;  1OME A;  2ZM8 A;  4LV1 A;  4JLF A;  5E43 A;  2EX8 A;  4KEN B;  3RXX A;  4E3M A;  2QZ6 A;  2WKI A;  3W4P A;  2HDS A;  4JKT A;  1YLZ A;  1HD8 A;  4S2M A;  3WS0 A;  3ZG5 A;  4S2I A;  4UHU A;  3CJM A;  1CI8 A;  4ZBE A;  2X01 A;  4Y0T A;  3BLM A;  3ZDJ A;  1ERM A;  5AQ7 A;  1FQG A;  3G31 A;  4KZ9 A;  3ZNY A;  3GVB A;  3VFF A;  2R9W A;  1DJA A;  2EXA A;  5FAP A;  4OQH A;  3LY4 A;  4XUZ A;  1HZO A;  5DVA A;  3IXG A;  3IF6 B;  4KG6 A;  4NK3 A;  4OLD A;  1MWU A;  4WEK A;  5DTT A;  5G18 A;  3BLS A;  4QB8 A;  2JC7 A;  5DTK A;  4KQR A;  4E3N A;  3VP3 A;  4MBK A;  5GHX A;  1NY0 A;  3CZD A;  3O88 A;  2IWB A;  4R3J A;  3BEC A;  4WYY A;  5BOH A;  5FQK A;  3ZG0 A;  3OPL A;  2WGI A;  2RL3 A;  3PBR A;  5FQI A;  1IKI A;  2WUQ A;  1ZKJ A;  1MY8 A;  3MKF A;  1YLY A;  1XXM A;  4EBN A;  1NXY A;  1TEM A;  4JXG A;  4Y0U A;  4E3J A;  3MZE A;  4FD8 A;  1JWP A;  4RVA A;  2WGW B;  1K55 A;  4UA6 A;  1ES4 A;  3JYI A;  4GB7 A;  2OSU A;  4KZ3 A;  3LEZ A;  4L0L A;  1G6A A;  5E2H A;  1MKI A;  4KZ4 A;  3UN7 A;  4IVI A;  4U0T A;  1YLJ A;  2DRW A;  5A92 A;  1S0W A;  3BFG A;  1FR1 A;  1YLW A;  3PAG A;  1KVM A;  4GZB A;  4WMC D;  2V1Z A;  4X53 A;  4LEN A;  3ITB A;  4KG2 A;  4PMA A;  5EOO A;  1ONG A;  4MLL A;  4KZ6 A;  4JF5 A;  4X68 A;  4OQG A;  2BG1 A;  2GDN A;  1FCN A;  3V3S A;  4JXW A;  1EI5 A;  1PI5 A;  4GOG A;  2H0Y A;  4PM7 A;  4OPY A;  3GV9 A;  2OLV A;  5CXW A;  2BLS A;  1XKZ A;  3UDI A;  1E4D A;  1PW1 A;  4RA7 A;  2J7V A;  4ZJ2 A;  1M6K A;  2P74 A;  5GLB A;  3O3V A;  2Y2N A;  1JTG A;  1K55 C;  3NCK A;  1WE4 A;  3OCL A;  3Q7V B;  4ID4 A;  4GN2 A;  4GDB A;  4Y0O A;  5TFQ A;  3W8K A;  4JXS A;  1LL5 A;  3UO9 A;  3ZHH A;  3D4F A;  1BTL A;  4IVK A;  1GCE A;  4MNR A;  1IYP A;  4FSF A;  2WKH A;  1SCW A;  4R23 A;  1IYO A;  2ZQA A;  5EEC A;  1G68 A;  5EVL A;  4R0Q A;  4ZDX A;  2I72 A;  2XQZ A;  2Y2K A;  5E2G A;  2RCX A;  3G30 A;  2Y2M A;  1ESU A;  4BD0 A;  3ZVT A;  5HFO A;  4QJG A;  1K4F A;  3VOZ A;  4CJN A;  3NDE A;  2Y2Q A;  3WS5 A;  2PU4 A;  1WYB A;  2WAD A;  3Q81 A;  3UE0 A;  5CRF A;  5KMW A;  3TOI A;  1K57 C;  5EVI B;  3WS1 A;  4PM5 A;  4OH0 A;  4KZ5 A;  5E2E A;  1W79 A;  3P98 A;  4OP5 A;  4WZ5 A;  5F1G A;  4LV3 A;  1BLS A;  4QD4 A;  1ZC2 A;  3P09 A;  3DWZ A;  3LO7 A;  4Q8I A;  3QNB A;  3HLF A;  2DCF A;  2Y2O A;  3Q07 A;  2PU2 A;  4KZ7 A;  2ZC5 B;  2FFF B;  2EX9 A;  3ZG7 B;  2QMI A;  4KZA A;  4C6Y A;  4GD6 A;  3HUN A;  1BLP A;  3IWQ A;  1I2W A;  4P85 A;  4U3T A;  5CTM A;  4EBL A;  4S2L A;  4BL2 A;  2XD5 A;  3RJU A;  1ES2 A;  1FOF A;  1KE4 A;  3ZNT A;  2V2F F;  2XLN A;  1PZO A;  3PAE A;  4MEZ A;  4E3I A;  2H10 A;  4B88 A;  3VP0 A;  4KZ8 A;  3GMW A;  5FA7 A;  3ZG8 B;  1KVL A;  4N1H A;  1XPB A;  1FSY A;  1SDE A;  3NI9 A;  1NZO A;  3HLW A;  1IKG A;  3HUM A;  1I2S A;  3DTM A;  2ZM2 A;  3IWO A;  1MWS A;  4EWF A;  4GD8 A;  3SOI A;  4A5R A;  1J9M A;  3O87 A;  1PWG A;  2PBY A;  1FR6 A;  4E3O A;  2ZC7 A;  5FQQ A;  1YMS A;  4JF4 A;  3IF5 A;  5JYO A;  4HBT A;  4WZ5 C;  4X55 A;  3UDX A;  4KQO A;  2P9V B;  3EQU A;  4BEN A;  2G2U A;  2A49 A;  4PM9 A;  2Z2L B;  3IH9 A;  4E3L A;  1ESI A;  3S4X A;  4S2P A;  4Y7P A;  1IYQ A;  2WZZ A;  4LV0 A;  3N4I A;  4R1G A;  3HLD A;  5FSR A;  2R9X A;  3HUO A;  5EUA A;  1DJC A;  1NZU A;  2Y2L A;  3NBL A;  2ZLY A;  4WM9 A;  5IHV A;  5JYP A;  1K56 D;  3RXW A;  4C75 A;  3TSG A;  3Q82 A;  4BL3 A;  4DF6 A;  3G4P A;  3A3E A;  3VSK A;  3FZC A;  3PBT A;  5KSH A;  2H0T A;  4DRT A;  1NYM A;  5E2F A;  5CER A;  4P0M A;  2XH9 A;  1L0G A;  1SDN A;  4N9K A;  2EFU A;  4OOL A;  4NET A;  5GL9 A;  1PZP A;  3AGE A;  4LCM A;  4BD1 A;  3VFH A;  4WEJ A;  4EV4 A;  3C4O A;  3CMZ A;  1JWV A;  4HEF A;  1PWD A;  5DF9 A;  1GHI A;  2XFS A;  4X6T A;  3MXR A;  4ZJ3 A;  1EWZ A;  4DXB A;  4OON A;  3DWK A;  4Z9Q A;  1SKF A;  2ZC6 B;  3MXS A;  4K91 A;  1XGJ A;  2XF3 A;  4XXR A;  1RP5 A;  4EUZ A;  1WYC A;  2WGV A;  4RX3 A;  3BYD A;  2V20 A;  5CEC A;  1HTZ A;  1ZG6 A;  2ZD8 A;  2IWD A;  2Q9M A;  5DF8 A;  1IEL A;  1K6S A;  2QPN A;  5TR7 A;  4F94 A;  3N7W A;  4R4R A;  4ZAM A;  3BRM A;  3WRT A;  1K25 A;  4JF6 A;  4IBX A;  5AQ9 A;  4O7D A;  1L0F A;  3M6B A;  2Y59 A;  3M2K A;  1BT5 A;  2XEP A;  3GR2 A;  4XUX A;  1FCO A;  5M18 A;  2Y91 A;  3QHY A;  4JBF A;  1NJ4 A;  3HL9 A;  3UPO A;  3PBN A;  1L2S A;  3UPP A;  1M40 A;  1GHM A;  3CG5 A;  2Y2I A;  3N8S A;  4FH4 A;  1JWZ A;  5GLC A;  3V39 A;  2HP6 A;  3G32 A;  4WZ4 A;  5CEB A;  5HAR A;  1VQQ A;  4FH2 A;  3PBS A;  4ZJ1 A;  3NC8 A;  2P9V A;  2ZC3 B;  3B3X A;  3MZF A;  2HP9 A;  4N92 A;  4S2N A;  4S2J A;  3OPP A;  1O07 A;  5DTS A;  4E6X A;  1LLB A;  1RGY A;  3SS5 A;  1ES5 A;  1LI0 A;  4WBG A;  3SH8 A;  4OP8 A;  2HP5 A;  5I94 A;  3HLB A;  2Z2M B;  3O86 A;  3IWI A;  1DY6 A;  4GDN A;  4LCL A;  2ZQC A;  1CK3 A;  1XA7 A;  1S6R A;  1PI4 A;  2EXB A;  2WZX A;  5GHY A;  5A91 A;  3IXH A;  1BLC A;  5HW3 A;  4S2K A;  2HPB A;  3IHA A;  2ZQ7 A;  2X71 A;  2ZC4 B;  1MBL A;  3GTC A;  1KGF A;  3FWL A;  1W5D A;  5CHJ A;  3Q7Z A;  4N1X A;  5FDH A;  1RCJ A;  1Y54 A;  4H8R A;  4PPR A;  2C6W B;  1ES3 A;  4DXC A;  3VSL A;  5CGW A;  3G35 A;  4MBF A;  1TVF A;  4C3Q A;  1PYY A;  3VMA A;  4D2O A;  1XGI A;  1ALQ A;  4X56 A;  5TGF A;  5FI6 A;  2ZQ8 A;  1BUL A;  3M2J A;  4OQ0 A;  4PM6 A;  4X69 A;  4B4X A;  3SH7 A;  1PW8 A;  3V5M A;  3VOY A;  3LCE A;  3Q7V A;  2Y4A A;  1C3B A;  1K57 A;  3WS2 A; 
#chains in the Genus database with same CATH topology
 3UNW A;  1A0K A;  2J3W A;  3GQZ A;  5FQM A;  4E3K A;  1OJG A;  3PBO A;  4KQQ A;  5EVI D;  2PHY A;  2NUP C;  4DDY A;  1ZTU A;  1RGZ A;  2ZQ9 A;  2J3T C;  2WAE A;  1W8Q A;  2W3E A;  2A3U A;  2VX8 A;  1W63 M;  4I38 A;  2HV1 A;  2W0N A;  3B47 A;  1Q2Q A;  2W1T B;  3IT9 A;  3S1Y A;  4L9F A;  3GDI A;  4LFU A;  5HD5 A;  2Y2P A;  4WMC A;  2QKP A;  4II7 A;  3BFD A;  1H8M A;  2V1A A;  5FQJ A;  2WAF A;  3V3R A;  3PTE A;  4Q0H A;  2XK1 A;  2QHK A;  3LIE A;  1PIO A;  3TE8 A;  1FSW A;  4NEE D;  3S7O A;  4EUV A;  2CC1 A;  1F9I A;  1N9B A;  4I3A A;  3A3D A;  3EEH A;  1IYS A;  3OC2 A;  2B5R A;  1MZU A;  5L10 A;  3LYX A;  3V50 A;  4HBU A;  3H82 A;  3ZFZ A;  1NYY A;  3TRC A;  5AQA A;  5GLA A;  3IXB A;  4OPR A;  4KUO A;  5F82 A;  2ZMA A;  2R78 A;  4BQM A;  4X1L A;  3UME A;  3OCN A;  2Y4A A;  2Y8H A;  5EVI A;  4S2O A;  5KZH A;  3OZH A;  4QY6 A;  3WS4 A;  4YIN A;  3W4O A;  4BLM A;  4ZTK A;  3MFD A;  2HDU A;  4F3L B;  4FOF A;  3C5A A;  1XX2 A;  5DF7 A;  1CEF A;  3CAX A;  1IEM A;  4LRY C;  5G4Z A;  3IHB A;  2V8F A;  3KSI A;  3OPH A;  3SS4 A;  5F5Y A;  1K6R A;  4FCF A;  2J9O A;  4IBR A;  5AVF A;  4CLC C;  4ARZ A;  2Y2H A;  2ZM0 A;  3UPN A;  4NXB A;  4U0X A;  1S4R A;  4HY8 A;  3KX0 X;  1BZA A;  3B42 A;  3G2Z A;  1QME A;  3I7J A;  4K0X A;  1ERQ A;  3EWK A;  4OLG A;  3MBZ A;  3DAV A;  2NUT C;  2HDR A;  4GNU A;  4P6Z S;  1VEU A;  1Z6F A;  2EX8 A;  4E3M A;  4R38 A;  1LT0 A;  2VLG A;  1YLZ A;  3WS0 A;  3LI8 A;  4Y0T A;  3ZDJ A;  1ERM A;  5AQ7 A;  4M4X A;  3VFF A;  2VGL S;  3LY4 A;  4NK3 A;  3BLS A;  3KSH A;  4KQR A;  3BW6 A;  1ACF A;  5HPF A;  3UB9 A;  3PR6 A;  2WGI A;  4EBN A;  3T4K A;  1NXY A;  3T1R A;  3MMH A;  4E3J A;  1JWP A;  1K55 A;  2ACG A;  3JYI A;  3K3C A;  5DJU A;  1CF0 A;  3QP1 A;  1PNE A;  1VHM A;  1LSX A;  1KVM A;  1VEU B;  3NOU C;  2OOL A;  3ITB A;  2L1M A;  4X68 A;  4OQG A;  1GSW A;  2W3F A;  1VET A;  3LIB A;  4GOG A;  4PM7 A;  2BLS A;  2J80 A;  2J7V A;  1M6K A;  1JTG A;  1K55 C;  3NCK A;  3OCL A;  2VV6 A;  3Q7V B;  1MKM A;  3W8K A;  3IBJ A;  3PYP A;  2KX6 A;  4FSF A;  2WKH A;  1TS7 A;  4DN0 A;  2ZQA A;  1G68 A;  2OWH A;  3UB6 A;  2Y2M A;  4BD0 A;  1S1Z A;  5HFO A;  1K4F A;  3TW8 A;  1PRQ A;  4L9E A;  2V0W A;  2PU4 A;  2JKF A;  3NEC A;  3Q81 A;  4LGW A;  3UE0 A;  4O0P A;  5EVI B;  3S7P A;  4PM5 A;  5E2E A;  4KZ5 A;  5F1G A;  1W79 A;  3T4O A;  1BLS A;  1ZC2 A;  5KIZ A;  2K2N A;  2DCF A;  2Y2O A;  4IUH A;  2PU2 A;  4KZ7 A;  4Y15 A;  4D60 A;  4EBL A;  3U2A A;  4S2L A;  4BL2 A;  3PXP A;  3RJU A;  5L8M A;  3CUE A;  4G3V A;  4XT2 A;  3E98 A;  3ZG8 B;  3CHW P;  3HJK A;  1SDE A;  3LIC A;  1NZO A;  2W1T A;  3HUM A;  3DTM A;  4ARZ B;  2D01 A;  1MWS A;  4EWF A;  3LR0 A;  3QP6 A;  4A5R A;  1DP9 A;  2WKR A;  1TD5 A;  4E3O A;  2PBY A;  1YMS A;  2PYR A;  5EFW A;  3UDX A;  2P9V B;  4GHI B;  5HWT A;  5L07 A;  2ZOI A;  2ZL1 A;  1K0K A;  3HLD A;  3HUO A;  1NZU A;  2ZLY A;  2J3T D;  4C75 A;  3BY9 A;  3G4P A;  3FZC A;  2GZA A;  2L0W A;  5E2F A;  4P0M A;  4OOL A;  4NET A;  4Y3I A;  4LCM A;  1T1B A;  3CMZ A;  1JWV A;  4ETX A;  5DF9 A;  2XFS A;  3MXR A;  4Z9Q A;  4K91 A;  2V0U A;  1YAX A;  3BYD A;  2ZD8 A;  2Q9M A;  5DF8 A;  1IEL A;  3T4J A;  4ZRR A;  4X1M A;  4ZAM A;  4DJ2 A;  4IBX A;  3M6B A;  2Y59 A;  3M2K A;  2ZMV A;  4XUX A;  1FCO A;  3C2W A;  1NJ4 A;  3HL9 A;  1M40 A;  1GHM A;  3N8S A;  4FH4 A;  1JWZ A;  2HP6 A;  3F1P B;  3PBS A;  2A24 A;  4N92 A;  4S2N A;  3MZF A;  2HP9 A;  3OPP A;  1O07 A;  1F98 A;  5J3W A;  5HZH A;  3HLB A;  3IWI A;  4GDN A;  2ZQC A;  1PI4 A;  2K31 A;  1BLC A;  2OAP 1;  4S2K A;  4PKY G;  5FDH A;  1OTB A;  1OPX A;  2C6W B;  1L3L A;  1TVF A;  4D2O A;  1XGI A;  2XRO A;  1NLZ A;  4JGR A;  5J7E A;  5FI6 A;  4OQ0 A;  5F69 A;  4MMN A;  3V5M A;  3F1O B;  1K57 A;  3WS2 A;  1MWT A;  1KDS A;  3FG8 A;  5CHU A;  1H8Y A;  2JHE A;  1PWC A;  2XDM A;  3ZCZ A;  1TS0 A;  3GSG A;  3HLG A;  3G2Y A;  3ISG A;  4CPK A;  1KGG A;  3E2K A;  2Y2G A;  4R4S A;  1MC0 A;  3L7H A;  5HAQ A;  1ZG4 A;  4GJ4 A;  5M19 A;  2P04 A;  4MBH A;  3C7V A;  4I3J A;  2X02 A;  2XD1 A;  5M1A A;  3CPT A;  5DJT A;  4IED A;  2VGJ A;  1T18 A;  1VM1 A;  5HDS A;  3ZG9 B;  3IF6 A;  4UA7 A;  4HP4 A;  2WGW A;  3M6H A;  2JCH A;  3FC7 A;  4N9L A;  3EQV A;  5HWW A;  2B95 A;  5FI7 A;  1L0D A;  2PRF A;  1DJB A;  3QP8 A;  5G4Y A;  4DE3 A;  3IBR A;  3FKW A;  4P6Z M;  4QU3 A;  5A93 A;  3OPR A;  2L4R A;  5CHM A;  4RX2 A;  5CTN A;  2BTF P;  1LHY A;  3C4P A;  3ICY A;  3FKV A;  4QHC A;  4OPZ A;  1LL9 A;  1W7F A;  3MR0 A;  1LSV A;  4CLC D;  3A3I A;  1W8Y A;  3LY3 A;  4MN7 A;  1CJF A;  3SS3 A;  3E2L A;  4EEP A;  3MJQ A;  2J8Y A;  2VV8 A;  1XP4 A;  1F5M A;  2XRN A;  3C7U A;  2JKR I;  2ZJ9 A;  1LSW A;  4HES A;  3RH8 B;  2XGN A;  3MZD A;  2M7V A;  1CQA A;  3QNC A;  2EX6 A;  4MCW A;  4EQI A;  1S66 L;  3NIA A;  1LL8 A;  5EOE A;  1CEG A;  3HLC A;  3F1O A;  1JTD A;  3MS6 A;  3SW1 A;  4GKU A;  1H5X A;  1BLH A;  3OBF A;  1KDW A;  1N9L A;  1G28 A;  1YSP A;  5J8X A;  4OOM A;  1TDG A;  5EPH A;  2H5S A;  4QY5 A;  5IS1 A;  2JBF A;  3L9K A;  4E6W A;  4ME4 A;  4OQI A;  5EV0 A;  5F1F A;  3T4L A;  1XA1 A;  1UWP X;  4NXF A;  5CGX A;  2W1R A;  5DFY A;  2WYX A;  2J9P A;  2XFT A;  1KE0 A;  3C8C A;  3HBR A;  5L2F A;  4WLA A;  1E3U A;  1K54 C;  2H28 A;  3LIF A;  4LV1 A;  4JLF A;  4H6J B;  3W4P A;  4EU0 A;  4I39 A;  4JKT A;  4HQA A;  4UHU A;  3R7W A;  2X01 A;  4ZBE A;  3BLM A;  2EXA A;  4UQI S;  3OOV A;  1HZO A;  3IF6 B;  4OLD A;  1MWU A;  5G18 A;  3BQ8 A;  4QB8 A;  5DTK A;  4E3N A;  3VP3 A;  1S1Y A;  5J4E A;  4EQ1 A;  3MXQ A;  5FQK A;  3ZG0 A;  4HJ4 A;  2RL3 A;  2WUQ A;  1MY8 A;  3UB5 P;  1J3W A;  2PBD P;  4Y0U A;  4FD8 A;  4RVA A;  2WGW B;  2HJE A;  1ES4 A;  2OSU A;  3DTE A;  4L0L A;  5E2H A;  1MKI A;  4U0T A;  2DRW A;  4HOI A;  1IOU A;  3BFG A;  3PAG A;  4GZB A;  5HD3 A;  4LEN A;  3IX8 A;  2ZOH A;  4KG2 A;  5EOO A;  1ONG A;  4MLL A;  2BG1 A;  4OPY A;  3GV9 A;  2OLV A;  3DBA A;  3LUQ A;  4RA7 A;  2P74 A;  2D02 A;  1WE4 A;  3D4F A;  1BTL A;  1GCE A;  4MNR A;  4R23 A;  4CLC B;  5EVL A;  4ZDX A;  2I72 A;  2XQZ A;  3H9W A;  3LEQ A;  3VOZ A;  4CJN A;  2Y2Q A;  1AWI A;  4BBU A;  1VB6 A;  5I5L A;  5CRF A;  2VJW A;  3P98 A;  4OP5 A;  5TBM B;  4ETZ A;  3P09 A;  5HPI A;  4HJ3 A;  2EX9 A;  2JKT M;  4PAU A;  2Q0O A;  5C5K A;  4U3T A;  3NUL A;  1ES2 A;  1NWZ A;  2V2F F;  1PZO A;  3LR4 A;  3GMW A;  5FA7 A;  1KVL A;  1XPB A;  1I2S A;  3IWO A;  4GD8 A;  1YKD A;  3VE4 A;  2ZC7 A;  3T1S A;  5JYO A;  4HBT A;  5EM1 A;  4CLC A;  4K08 A;  3FPW A;  1F2K A;  2PR5 A;  2A49 A;  4PM9 A;  2V9A A;  4E3L A;  1ESI A;  2WZZ A;  3N4I A;  2R9X A;  5EUA A;  2Y2L A;  3NBL A;  1K56 D;  3TSG A;  3Q82 A;  1XJ2 A;  3VSK A;  2H0T A;  4DRT A;  1NYM A;  2XH9 A;  2VA0 A;  5GL9 A;  3QP4 A;  1P9R A;  1FIL A;  2GJ3 A;  4EV4 A;  3C4O A;  4X25 A;  1GHI A;  4X6T A;  4OON A;  2ZC6 B;  1XGJ A;  1RP5 A;  4RX3 A;  2V20 A;  5CEC A;  2IWD A;  1OTE A;  2M1C A;  1K6S A;  5TR7 A;  4WN5 A;  2Z6D A;  4O7D A;  3VV4 A;  5IT5 A;  2OWJ A;  2DMW A;  2P08 A;  3E4Q A;  3UPO A;  3PBN A;  1L2S A;  1EW0 A;  3CG5 A;  3V39 A;  4WZ4 A;  1VQQ A;  4FH2 A;  1WA9 A;  3B3X A;  1PFL A;  3LFV A;  1T1C A;  1Y28 A;  1T19 A;  3SH8 A;  2HP5 A;  4R3A A;  3T1X A;  1CK3 A;  1S6R A;  5GHY A;  5HW3 A;  2ZQ7 A;  2ZC4 B;  4O01 A;  1KGF A;  4N1X A;  1Y54 A;  4H8R A;  4IJG A;  4DXC A;  1ALQ A;  1NRJ A;  4Y17 A;  3Q7V A;  3UB7 A;  1C3B A;  1HLU P;  3C30 A;  4R6L A;  2VGL M;  2ZBB A;  4EBP A;  1MXO A;  5GLD A;  4WEL A;  5TBM A;  2VGK A;  2QJ7 A;  5FAT A;  4GS9 B;  3FYZ A;  1FCM A;  3VP1 A;  3C38 A;  4P6B A;  3ZVW A;  2V1B A;  4DE0 A;  3NY4 A;  3SH9 A;  3VP2 A;  3FV7 A;  1ONH A;  3AGF A;  4KZB A;  1BUE A;  3EOI A;  1D1J A;  1YPR A;  5HDD A;  3BM6 A;  4DE2 A;  2DNS A;  3S7Q A;  3MKE A;  2XR0 A;  1HVB A;  3R4K A;  1OT9 A;  1FIK A;  2W3H A;  1MPL A;  1YLT A;  1BSG A;  4KQD A;  4DDS A;  3VP4 A;  1YMX A;  2PT7 A;  3BWL A;  3TG9 A;  5F6A A;  4Y5F A;  3UE1 A;  4Z1W A;  2M7U A;  4BJP A;  5EVE A;  3S22 A;  5HAP A;  3EGX C;  5FAO A;  1U60 A;  5KSC A;  3ULF A;  2HDQ A;  5FDS A;  5FQ9 A;  4M3K A;  3QP2 A;  5CX7 A;  2Q9N A;  3NOP C;  3D9Y A;  4JXV A;  1GSX A;  1I5Q A;  2Z6C A;  3W4Q A;  5F83 A;  3Q1F A;  2VZW A;  3ZGA B;  3HRE A;  2OV5 A;  2EWW A;  4BBV A;  2PD7 A;  5FAQ A;  2KLI A;  3BFC A;  1YLP A;  3UY6 A;  5U47 A;  4PM8 A;  3E4P A;  2B02 A;  3LID A;  1K38 A;  2FFY A;  4OOY A;  1NRF A;  2V8C A;  3HCY A;  1OTA A;  3KSG A;  4S2N C;  2IA2 A;  1L0E A;  1E25 A;  3H82 B;  4G3K A;  4RYE A;  1OTI A;  1G6O A;  4E04 A;  5FI2 A;  4OVD A;  3BFF A;  3MQO A;  3BEB A;  2WKP A;  3A3F A;  4JGP A;  1OME A;  2ZM8 A;  2LB9 A;  4KEN B;  3RXX A;  4DMZ A;  2WKI A;  2A2L A;  2HDS A;  3T4T A;  3PHY A;  3CJM A;  4NKP A;  3SZT A;  3G31 A;  4KZ9 A;  3ZNY A;  5HWV A;  5FAP A;  4BWI A;  4XUZ A;  5DVA A;  3IXG A;  4KG6 A;  4Y2F A;  4O8G A;  2JC7 A;  4MN5 A;  1NY0 A;  3E4O A;  3BEC A;  3LI9 A;  1YSQ A;  3PBR A;  1IKI A;  1ZKJ A;  4HP9 A;  3MKF A;  1YLY A;  1XXM A;  4Q0J A;  3IS2 B;  4JXG A;  4F3L A;  3MZE A;  4LRX C;  1NLY A;  1ZHH B;  4GB7 A;  2BAS A;  4HH3 A;  4KZ3 A;  3LEZ A;  1TS8 A;  1G6A A;  4PHT A;  2GX5 A;  3UN7 A;  4IVI A;  1YLJ A;  5A92 A;  1DRM A;  1YLW A;  4WMC D;  2V1Z A;  4X53 A;  4PMA A;  1GSV A;  4G3W A;  4KZ6 A;  1JNU A;  3V3S A;  4JXW A;  3MF0 A;  3NOT C;  1EI5 A;  2O9C A;  3K2N A;  2W3D A;  1XFN A;  4BBT A;  1E4D A;  3E0Y A;  4ZJ2 A;  4JGO A;  1STZ A;  3IS2 A;  3O3V A;  2Y2N A;  4ID4 A;  4GN2 A;  4GDB A;  3HJI A;  1LL5 A;  1IYP A;  2JKR M;  1SCW A;  1IYO A;  4EET B;  5EEC A;  4R0Q A;  2Y2K A;  4WF0 A;  5E2G A;  2RCX A;  3G30 A;  4QJG A;  3ZVT A;  4CQH A;  1WYB A;  2WAD A;  3F1N A;  3T4S A;  3CLO A;  5KMW A;  3TOI A;  1V9Y A;  1K57 C;  3WS1 A;  4WZ5 A;  4LV3 A;  4GS9 A;  3BY8 A;  3LO7 A;  4Q8I A;  3Q07 A;  1G5U A;  4GLQ A;  2ZC5 B;  2FFF B;  4C6Y A;  3HUN A;  1BLP A;  3IWQ A;  5CTM A;  2O9B A;  2GNX A;  3A0V A;  2K7S A;  1FOF A;  1KE4 A;  3ZNT A;  2QYB A;  2XLN A;  1XJ3 A;  3CWF A;  1FSY A;  2FZ0 A;  3HLW A;  2ZM2 A;  1TS6 A;  3SOI A;  1J9M A;  3O87 A;  1FR6 A;  2HGV A;  5FQQ A;  2PR6 A;  4WZ5 C;  3EQU A;  4B9O A;  2G2U A;  1KOU A;  2Z2L B;  3IH9 A;  3G6O A;  4Y7P A;  3FPV A;  4LV0 A;  5FSR A;  4R1G A;  3OLO A;  1H0M A;  4WM9 A;  4PKY A;  3F1N B;  5IHV A;  2O0Y A;  3RXW A;  3A3E A;  2HF6 A;  2JKT I;  3P01 A;  5CER A;  2JN7 A;  1L0G A;  1SDN A;  4N9K A;  2EFU A;  1PZP A;  3VFH A;  3H7W A;  3LR3 A;  4HEF A;  4DXB A;  3DTK A;  2PD8 A;  5DFX A;  1SKF A;  3MXS A;  2XF3 A;  2WGV A;  3TJZ C;  1ZG6 A;  2PAV P;  2QPN A;  3KO6 A;  3N7W A;  4EES A;  3S7N A;  5AQ9 A;  4XT2 B;  1L0F A;  4IUK A;  5EM0 A;  2ZL1 B;  1BT5 A;  5M18 A;  2Y91 A;  4EER A;  5A8B A;  3CPT B;  3G32 A;  5HAR A;  2P9V A;  2OAQ 1;  5DTS A;  2UV0 E;  4E6X A;  3SS5 A;  3CIT A;  1ES5 A;  1LI0 A;  4WBG A;  4OP8 A;  2Z2M B;  3O86 A;  1DY6 A;  4LPZ A;  5HDC A;  3D72 A;  4LCL A;  1XA7 A;  4I5S A;  5A91 A;  3IXH A;  1MBL A;  4HNB A;  3GTC A;  3FWL A;  3MQQ A;  4PPR A;  1ES3 A;  5CGW A;  3G35 A;  4MBF A;  4C3Q A;  4X56 A;  5TGF A;  2ZQ8 A;  1BUL A;  3M2J A;  4PM6 A;  4B4X A;  4L9G A;  1PW8 A;  2PDR A;  1T1A A;  1H8Z A;  5HX9 A;  1N4O A;  3F1P A;  2G2W A;  4Y13 A;  3RTY A;  1SKO B;  2ZQD A;  2E8I A;  3UB8 A;  2Y55 A;  1SHV A;  4YFM A;  2WK0 A;  4WUJ A;  3HLE A;  1AXB A;  1X0O A;  3A0S A;  3NHQ A;  4EEU A;  4YWZ A;  4AFI A;  2A24 B;  1K54 A;  2C5W B;  4BMW A;  3KSF A;  3G34 A;  5CGS A;  4UQI M;  5CED A;  4HJ6 A;  4GCZ A;  1OT6 A;  4P87 A;  2UWX A;  4LV2 A;  2PYP A;  3N6I A;  2QWS A;  1SKO A;  2XA7 M;  4LRZ E;  3V67 A;  2IWC A;  4OKP A;  1VET B;  2VK3 A;  1QMF A;  2Y2J A;  2CMN A;  3CI6 A;  3BFE A;  1GA9 A;  4DKI A;  1KGE A;  1O7E A;  5A90 A;  4UA9 A;  1JVJ A;  3D3O A;  5IU1 A;  1K56 A;  3N8L A;  3IF6 C;  2EFX A;  4DE1 A;  1KE3 A;  4UAA A;  1ERO A;  4HHD A;  3UDF A;  2EA9 A;  5AQB A;  5GHZ A;  2WKQ A;  3N8R A;  4OPQ A;  1XJ4 A;  3H7W B;  4UEY A;  1V9Z A;  5DKL A;  4KUK A;  3QP5 A;  1YM1 A;  3MSH A;  2LB5 A;  3BQA A;  2WKE A;  1LI9 A;  2G7U A;  2KOI A;  1MWR A;  1Q2P A;  5LBR A;  3GRJ A;  3BJN A;  4K0W A;  5F68 A;  3UE3 A;  1GA0 A;  5HAI A;  1YT4 A;  1CI9 A;  5HL1 A;  4R70 A;  3IXD A;  2OLU A;  4R3B A;  3IQA A;  3UE6 A;  3PBQ A;  3ITA A;  1OJ5 A;  2VKS A;  2EX2 A;  3IH8 A;  1P0Z A;  3DW0 A;  1GHP A;  3GEC A;  4CLC E;  3WRZ A;  3AGD A;  2XA7 S;  1N9N A;  2JKG A;  2JE5 A;  1E3U D;  3UMD A;  3ZYT A;  1K4E A;  3HVF A;  4KG5 A;  1TDL A;  3VOL A;  5FAS A;  1UGU A;  3KYQ A;  4JPM A;  2FH5 A;  3WWX A;  5EVI C;  3T12 B;  3A3J A;  5D3O A;  3NDG A;  3LR5 A;  3T50 A;  5EE8 A;  4IHQ A;  3W2Z A;  1YQS A;  5E43 A;  4EXO A;  2QZ6 A;  3O5Y A;  1HD8 A;  4S2M A;  1D7E A;  1Y4O A;  3ZG5 A;  4S2I A;  1CI8 A;  4QWO A;  1S4S A;  1FQG A;  3GVB A;  2R9W A;  1DJA A;  4OQH A;  1XJ6 A;  3IX3 A;  4WEK A;  5DTT A;  2YKH A;  4DJ3 A;  4MBK A;  5GHX A;  3U4L P;  4NG2 A;  1ODV A;  3CZD A;  3O88 A;  2IWB A;  4R3J A;  4WYY A;  5BOH A;  3OPL A;  4I3I A;  5FQI A;  3A0R A;  1TEM A;  2INW A;  1W63 Q;  3MFX A;  2B18 A;  1P9W A;  4RQ9 A;  4UA6 A;  3R7W B;  4WL9 A;  4KZ4 A;  2KDK A;  1S0W A;  3NJA A;  1FR1 A;  2AVX A;  4JF5 A;  3RFB A;  3DTI A;  4B93 A;  4YOF A;  2GDN A;  1UWN X;  1FCN A;  4MDZ A;  1PI5 A;  2H0Y A;  5CXW A;  1XKZ A;  3JPU A;  3UDI A;  4FUW A;  1PW1 A;  5L09 A;  2O99 A;  5GLB A;  3K3D A;  1N9O A;  5FEG A;  3CUE C;  4Y0O A;  5TFQ A;  4JXS A;  3UO9 A;  3ZHH A;  2QJ5 A;  4IVK A;  2VEA A;  2Y79 A;  3P7N A;  2E8J A;  5FL3 A;  1ESU A;  3NDE A;  4ESP A;  3WS5 A;  1OTD A;  2P7J A;  5HSQ A;  3B33 A;  1SZV A;  2HJ9 C;  4OH0 A;  1H3Q A;  4QD4 A;  4GHI A;  3DWZ A;  2MJ6 A;  3QNB A;  1D06 A;  3HLF A;  4HIA A;  3ZG7 B;  5DKK A;  2QMI A;  3JVU A;  4KZA A;  4GD6 A;  1IFQ A;  4MN6 A;  2YKF A;  1I2W A;  4P85 A;  5MC7 A;  4JGQ A;  2XD5 A;  4MEZ A;  3KYE A;  3PAE A;  4E3I A;  2H10 A;  2VV7 A;  3VP0 A;  4KZ8 A;  4B88 A;  4N1H A;  3NI9 A;  4FTX A;  1IKG A;  2W3G A;  1PWG A;  4JF4 A;  5AJG A;  3IF5 A;  4X55 A;  4KQO A;  4BEN A;  4GW9 A;  3S4X A;  4S2P A;  1IYQ A;  3LGO A;  4EW7 A;  1P97 A;  1DJC A;  5JYP A;  5HL6 A;  4BL3 A;  4DF6 A;  5KSH A;  3PBT A;  1TF1 A;  2ZMF A;  3T4Q A;  3AGE A;  4BD1 A;  5FEF A;  4WEJ A;  1PWD A;  4Q0I A;  4ZJ3 A;  1EWZ A;  3DWK A;  4XXR A;  4YNR A;  4EUZ A;  1WYC A;  4NXE A;  1HTZ A;  2XSS A;  3VE3 A;  4F94 A;  4R4R A;  3BRM A;  3WRT A;  1K25 A;  4JF6 A;  3T1Q B;  2XEP A;  3GR2 A;  3QHY A;  4JBF A;  3JVV A;  3MQ0 A;  1XFQ A;  2EWV A;  3UPP A;  4B4Z A;  5GLC A;  2Y2I A;  5CEB A;  4ZJ1 A;  3NC8 A;  2ZC3 B;  4S2J A;  1LLB A;  1RGY A;  5AVE A;  1DP6 A;  4HI4 A;  5I94 A;  3IX4 A;  2W27 A;  1S67 L;  2EXB A;  2WZX A;  1DP8 A;  2HPB A;  3IHA A;  2X71 A;  3EEA A;  3EGD C;  4NXG A;  3KYZ A;  5CHJ A;  1W5D A;  3Q7Z A;  1RCJ A;  4LLO B;  2O9A A;  3VSL A;  3LIA A;  4QPR A;  1PYY A;  3VMA A;  1Z09 A;  4H6J A;  1BYW A;  5K5B A;  2I9V A;  4X69 A;  2HZ5 A;  3SH7 A;  3ZQ5 A;  3VOY A;  3LCE A;  4HH2 A;  5TJJ A; 
#chains in the Genus database with same CATH homology
 1H8Z A;  1MWT A;  3UNW A;  3GQZ A;  5HX9 A;  1N4O A;  4EBP A;  1MXO A;  1KDS A;  5CHU A;  5GLD A;  1H8Y A;  2G2W A;  4WEL A;  2VGK A;  5FQM A;  1PWC A;  4E3K A;  2XDM A;  3PBO A;  4KQQ A;  5FAT A;  3ZCZ A;  3GSG A;  3HLG A;  5EVI D;  3G2Y A;  3FYZ A;  1FCM A;  3ISG A;  3VP1 A;  4CPK A;  2ZQD A;  4P6B A;  3ZVW A;  1KGG A;  2E8I A;  4DE0 A;  3NY4 A;  3E2K A;  2Y2G A;  2Y55 A;  3SH9 A;  1SHV A;  4R4S A;  5HAQ A;  3VP2 A;  1ZG4 A;  4YFM A;  2WK0 A;  4DDY A;  3FV7 A;  1ONH A;  4MBH A;  5M19 A;  3AGF A;  1RGZ A;  4KZB A;  2ZQ9 A;  1BUE A;  2WAE A;  1W8Q A;  3C7V A;  3HLE A;  2X02 A;  1AXB A;  2XD1 A;  2A3U A;  5M1A A;  1K54 A;  3BM6 A;  4DE2 A;  2C5W B;  4IED A;  2DNS A;  2VGJ A;  3MKE A;  1VM1 A;  2XR0 A;  1Q2Q A;  3ZG9 B;  3IT9 A;  3IF6 A;  1HVB A;  3S1Y A;  4UA7 A;  2WGW A;  3G34 A;  5CGS A;  3M6H A;  2Y2P A;  4WMC A;  2JCH A;  1MPL A;  1YLT A;  3BFD A;  1BSG A;  4N9L A;  3EQV A;  5CED A;  4DDS A;  4P87 A;  5FI7 A;  1L0D A;  3VP4 A;  1DJB A;  2UWX A;  4LV2 A;  1YMX A;  3N6I A;  2IWC A;  4OKP A;  4DE3 A;  3FKW A;  5FQJ A;  2WAF A;  3TG9 A;  4QU3 A;  3V3R A;  3PTE A;  1QMF A;  2Y2J A;  5A93 A;  3OPR A;  2XK1 A;  3UE1 A;  5CHM A;  4RX2 A;  1PIO A;  3BFE A;  1FSW A;  5CTN A;  1LHY A;  2CC1 A;  3C4P A;  1N9B A;  4BJP A;  3FKV A;  1GA9 A;  4DKI A;  1KGE A;  1O7E A;  4QHC A;  5A90 A;  4UA9 A;  3S22 A;  4OPZ A;  3A3D A;  1JVJ A;  1IYS A;  3OC2 A;  1LL9 A;  1W7F A;  5HAP A;  1K56 A;  2B5R A;  3N8L A;  5FAO A;  1U60 A;  3IF6 C;  5KSC A;  3V50 A;  2HDQ A;  2EFX A;  4DE1 A;  3A3I A;  4HBU A;  1KE3 A;  4UAA A;  1NYY A;  1W8Y A;  1ERO A;  3LY3 A;  5FQ9 A;  4M3K A;  5AQA A;  3ZFZ A;  3UDF A;  3SS3 A;  5AQB A;  3E2L A;  5GHZ A;  5GLA A;  2Q9N A;  3IXB A;  3N8R A;  4OPQ A;  4JXV A;  2J8Y A;  4OPR A;  5F82 A;  1XP4 A;  2ZMA A;  4BQM A;  1I5Q A;  1YM1 A;  3OCN A;  3W4Q A;  5F83 A;  2WKE A;  1LI9 A;  3C7U A;  2ZJ9 A;  1MWR A;  3Q1F A;  5EVI A;  4HES A;  2XGN A;  3MZD A;  1Q2P A;  3ZGA B;  3HRE A;  4S2O A;  5KZH A;  3OZH A;  4QY6 A;  3WS4 A;  3GRJ A;  3QNC A;  2OV5 A;  2EX6 A;  4K0W A;  4YIN A;  3UE3 A;  1GA0 A;  5HAI A;  4EQI A;  1YT4 A;  1CI9 A;  3W4O A;  4ZTK A;  5FAQ A;  4BLM A;  3MFD A;  3NIA A;  5HL1 A;  2HDU A;  5EOE A;  3C5A A;  1XX2 A;  3IXD A;  2OLU A;  4R3B A;  3BFC A;  1CEF A;  1CEG A;  3IQA A;  5DF7 A;  3HLC A;  3PBQ A;  3ITA A;  1IEM A;  1YLP A;  3IHB A;  1JTD A;  3UY6 A;  2EX2 A;  4PM8 A;  5U47 A;  3IH8 A;  3OPH A;  1H5X A;  3DW0 A;  4GKU A;  3SS4 A;  1BLH A;  1GHP A;  1K6R A;  1K38 A;  4FCF A;  2FFY A;  1KDW A;  3WRZ A;  4OOY A;  3AGD A;  5J8X A;  1NRF A;  2J9O A;  4OOM A;  4IBR A;  1TDG A;  5EPH A;  2H5S A;  4QY5 A;  4S2N C;  2JBF A;  4E6W A;  2JE5 A;  4OQI A;  2Y2H A;  2ZM0 A;  1E3U D;  1L0E A;  3UPN A;  5F1F A;  1E25 A;  4U0X A;  1K4E A;  3HVF A;  4RYE A;  1BZA A;  4KG5 A;  1TDL A;  1XA1 A;  5FAS A;  3G2Z A;  5CGX A;  4JPM A;  1QME A;  2WYX A;  5FI2 A;  3WWX A;  2J9P A;  3I7J A;  2XFT A;  1KE0 A;  4K0X A;  3HBR A;  1ERQ A;  4OVD A;  5EVI C;  4B4Z A;  5L2F A;  4OLG A;  3A3J A;  5D3O A;  3BFF A;  3MBZ A;  1E3U A;  3NDG A;  1K54 C;  3BEB A;  4GNU A;  2HDR A;  1Z6F A;  3A3F A;  5EE8 A;  1YQS A;  1OME A;  2ZM8 A;  4LV1 A;  4JLF A;  5E43 A;  2EX8 A;  4KEN B;  3RXX A;  4E3M A;  2QZ6 A;  2WKI A;  3W4P A;  2HDS A;  4JKT A;  1YLZ A;  1HD8 A;  4S2M A;  3WS0 A;  3ZG5 A;  4S2I A;  4UHU A;  3CJM A;  1CI8 A;  4ZBE A;  2X01 A;  4Y0T A;  3BLM A;  3ZDJ A;  1ERM A;  5AQ7 A;  1FQG A;  3G31 A;  4KZ9 A;  3ZNY A;  3GVB A;  3VFF A;  2R9W A;  1DJA A;  2EXA A;  5FAP A;  4OQH A;  3LY4 A;  4XUZ A;  1HZO A;  5DVA A;  3IXG A;  3IF6 B;  4KG6 A;  4NK3 A;  4OLD A;  1MWU A;  4WEK A;  5DTT A;  5G18 A;  3BLS A;  4QB8 A;  2JC7 A;  5DTK A;  4KQR A;  4E3N A;  3VP3 A;  4MBK A;  5GHX A;  1NY0 A;  3CZD A;  3O88 A;  2IWB A;  4R3J A;  3BEC A;  4WYY A;  5BOH A;  5FQK A;  3ZG0 A;  3OPL A;  2WGI A;  2RL3 A;  3PBR A;  5FQI A;  1IKI A;  2WUQ A;  1ZKJ A;  1MY8 A;  3MKF A;  1YLY A;  1XXM A;  4EBN A;  1NXY A;  1TEM A;  4JXG A;  4Y0U A;  4E3J A;  3MZE A;  4FD8 A;  1JWP A;  4RVA A;  2WGW B;  1K55 A;  4UA6 A;  1ES4 A;  3JYI A;  4GB7 A;  2OSU A;  4KZ3 A;  3LEZ A;  4L0L A;  1G6A A;  5E2H A;  1MKI A;  4KZ4 A;  3UN7 A;  4IVI A;  4U0T A;  1YLJ A;  2DRW A;  5A92 A;  1S0W A;  3BFG A;  1FR1 A;  1YLW A;  3PAG A;  1KVM A;  4GZB A;  4WMC D;  2V1Z A;  4X53 A;  4LEN A;  3ITB A;  4KG2 A;  4PMA A;  5EOO A;  1ONG A;  4MLL A;  4KZ6 A;  4JF5 A;  4X68 A;  4OQG A;  2BG1 A;  2GDN A;  1FCN A;  3V3S A;  4JXW A;  1EI5 A;  1PI5 A;  4GOG A;  2H0Y A;  4PM7 A;  4OPY A;  3GV9 A;  2OLV A;  5CXW A;  2BLS A;  1XKZ A;  3UDI A;  1E4D A;  1PW1 A;  4RA7 A;  2J7V A;  4ZJ2 A;  1M6K A;  2P74 A;  5GLB A;  3O3V A;  2Y2N A;  1JTG A;  1K55 C;  3NCK A;  1WE4 A;  3OCL A;  3Q7V B;  4ID4 A;  4GN2 A;  4GDB A;  4Y0O A;  5TFQ A;  3W8K A;  4JXS A;  1LL5 A;  3UO9 A;  3ZHH A;  3D4F A;  1BTL A;  4IVK A;  1GCE A;  4MNR A;  1IYP A;  4FSF A;  2WKH A;  1SCW A;  4R23 A;  1IYO A;  2ZQA A;  5EEC A;  1G68 A;  5EVL A;  4R0Q A;  4ZDX A;  2I72 A;  2XQZ A;  2Y2K A;  5E2G A;  2RCX A;  3G30 A;  2Y2M A;  1ESU A;  4BD0 A;  3ZVT A;  5HFO A;  4QJG A;  1K4F A;  3VOZ A;  4CJN A;  3NDE A;  2Y2Q A;  3WS5 A;  2PU4 A;  1WYB A;  2WAD A;  3Q81 A;  3UE0 A;  5CRF A;  5KMW A;  3TOI A;  1K57 C;  5EVI B;  3WS1 A;  4PM5 A;  4OH0 A;  4KZ5 A;  5E2E A;  1W79 A;  3P98 A;  4OP5 A;  4WZ5 A;  5F1G A;  4LV3 A;  1BLS A;  4QD4 A;  1ZC2 A;  3P09 A;  3DWZ A;  3LO7 A;  4Q8I A;  3QNB A;  3HLF A;  2DCF A;  2Y2O A;  3Q07 A;  2PU2 A;  4KZ7 A;  2ZC5 B;  2FFF B;  2EX9 A;  3ZG7 B;  2QMI A;  4KZA A;  4C6Y A;  4GD6 A;  3HUN A;  1BLP A;  3IWQ A;  1I2W A;  4P85 A;  4U3T A;  5CTM A;  4EBL A;  4S2L A;  4BL2 A;  2XD5 A;  3RJU A;  1ES2 A;  1FOF A;  1KE4 A;  3ZNT A;  2V2F F;  2XLN A;  1PZO A;  3PAE A;  4MEZ A;  4E3I A;  2H10 A;  4B88 A;  3VP0 A;  4KZ8 A;  3GMW A;  5FA7 A;  3ZG8 B;  1KVL A;  4N1H A;  1XPB A;  1FSY A;  1SDE A;  3NI9 A;  1NZO A;  3HLW A;  1IKG A;  3HUM A;  1I2S A;  3DTM A;  2ZM2 A;  3IWO A;  1MWS A;  4EWF A;  4GD8 A;  3SOI A;  4A5R A;  1J9M A;  3O87 A;  1PWG A;  2PBY A;  1FR6 A;  4E3O A;  2ZC7 A;  5FQQ A;  1YMS A;  4JF4 A;  3IF5 A;  5JYO A;  4HBT A;  4WZ5 C;  4X55 A;  3UDX A;  4KQO A;  2P9V B;  3EQU A;  4BEN A;  2G2U A;  2A49 A;  4PM9 A;  2Z2L B;  3IH9 A;  4E3L A;  1ESI A;  3S4X A;  4S2P A;  4Y7P A;  1IYQ A;  2WZZ A;  4LV0 A;  3N4I A;  4R1G A;  3HLD A;  5FSR A;  2R9X A;  3HUO A;  5EUA A;  1DJC A;  1NZU A;  2Y2L A;  3NBL A;  2ZLY A;  4WM9 A;  5IHV A;  5JYP A;  1K56 D;  3RXW A;  4C75 A;  3TSG A;  3Q82 A;  4BL3 A;  4DF6 A;  3G4P A;  3A3E A;  3VSK A;  3FZC A;  3PBT A;  5KSH A;  2H0T A;  4DRT A;  1NYM A;  5E2F A;  5CER A;  4P0M A;  2XH9 A;  1L0G A;  1SDN A;  4N9K A;  2EFU A;  4OOL A;  4NET A;  5GL9 A;  1PZP A;  3AGE A;  4LCM A;  4BD1 A;  3VFH A;  4WEJ A;  4EV4 A;  3C4O A;  3CMZ A;  1JWV A;  4HEF A;  1PWD A;  5DF9 A;  1GHI A;  2XFS A;  4X6T A;  3MXR A;  4ZJ3 A;  1EWZ A;  4DXB A;  4OON A;  3DWK A;  4Z9Q A;  1SKF A;  2ZC6 B;  3MXS A;  4K91 A;  1XGJ A;  2XF3 A;  4XXR A;  1RP5 A;  4EUZ A;  1WYC A;  2WGV A;  4RX3 A;  3BYD A;  2V20 A;  5CEC A;  1HTZ A;  1ZG6 A;  2ZD8 A;  2IWD A;  2Q9M A;  5DF8 A;  1IEL A;  1K6S A;  2QPN A;  5TR7 A;  4F94 A;  3N7W A;  4R4R A;  4ZAM A;  3BRM A;  3WRT A;  1K25 A;  4JF6 A;  4IBX A;  5AQ9 A;  4O7D A;  1L0F A;  3M6B A;  2Y59 A;  3M2K A;  1BT5 A;  2XEP A;  3GR2 A;  4XUX A;  1FCO A;  5M18 A;  2Y91 A;  3QHY A;  4JBF A;  1NJ4 A;  3HL9 A;  3UPO A;  3PBN A;  1L2S A;  3UPP A;  1M40 A;  1GHM A;  3CG5 A;  2Y2I A;  3N8S A;  4FH4 A;  1JWZ A;  5GLC A;  3V39 A;  2HP6 A;  3G32 A;  4WZ4 A;  5CEB A;  5HAR A;  1VQQ A;  4FH2 A;  3PBS A;  4ZJ1 A;  3NC8 A;  2P9V A;  2ZC3 B;  3B3X A;  3MZF A;  2HP9 A;  4N92 A;  4S2N A;  4S2J A;  3OPP A;  1O07 A;  5DTS A;  4E6X A;  1LLB A;  1RGY A;  3SS5 A;  1ES5 A;  1LI0 A;  4WBG A;  3SH8 A;  4OP8 A;  2HP5 A;  5I94 A;  3HLB A;  2Z2M B;  3O86 A;  3IWI A;  1DY6 A;  4GDN A;  4LCL A;  2ZQC A;  1CK3 A;  1XA7 A;  1S6R A;  1PI4 A;  2EXB A;  2WZX A;  5GHY A;  5A91 A;  3IXH A;  1BLC A;  5HW3 A;  4S2K A;  2HPB A;  3IHA A;  2ZQ7 A;  2X71 A;  2ZC4 B;  1MBL A;  3GTC A;  1KGF A;  3FWL A;  1W5D A;  5CHJ A;  3Q7Z A;  4N1X A;  5FDH A;  1RCJ A;  1Y54 A;  4H8R A;  4PPR A;  2C6W B;  1ES3 A;  4DXC A;  3VSL A;  5CGW A;  3G35 A;  4MBF A;  1TVF A;  4C3Q A;  1PYY A;  3VMA A;  4D2O A;  1XGI A;  1ALQ A;  4X56 A;  5TGF A;  5FI6 A;  2ZQ8 A;  1BUL A;  3M2J A;  4OQ0 A;  4PM6 A;  4X69 A;  4B4X A;  3SH7 A;  1PW8 A;  3V5M A;  3VOY A;  3LCE A;  3Q7V A;  2Y4A A;  1C3B A;  1K57 A;  3WS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...