4XXRA

Atomic resolution x-ray crystal structure of a ruthenocene conjugated beta-lactam antibiotic in complex with ctx-m-14 e166a beta-lactamase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
TSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTAPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTX-M-14 Class A Beta-Lactamase
publication title Antibacterial properties and atomic resolution X-ray complex crystal structure of a ruthenocene conjugated beta-lactam antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
total genus 98
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4xxrA00
5CXWA 2VGJA 1BLPA 2XK1A 3IF5A 3HLEA 1JWZA 1G6AA 4FH2A 4BQMA 4P85A 2WKEA 4IEDA 2ZC4B 4K0WA 4U0TA 4PM9A 2A49A 5DF7A 3LCEA 1BLSA 2ZC6B 3S4XA 1TDLA 2Y2NA 1LL5A 3HL9A 3BYDA 4OLGA 3SH8A 4E3OA 2WAEA 3A3IA 1KVLA 1FOFA 1FCNA 4K91A 1IYPA 1FR6A 2XD1A 5JYOA 1K6SA 2GDNA 4QD4A 3EQUA 2HP9A 5CEDA 4Y7PA 4GOGA 3C7UA 3IHAA 2EX2A 1E3UD 1ES4A 2HDQA 3GR2A 4E3IA 1K57C 3HUNA 2WZXA 3ZHHA 5TR7A 4KZ7A 3NC8A 5TGFA 3UNWA 1M6KA 3PBTA 3VP3A 1XP4A 2J9OA 3N8SA 5FI2A 2PU4A 5CTMA 5HAIA 3DTMA 4JF5A 4OVDA 4QU3A 4X68A 3BFDA 2OV5A 1EROA 4MLLA 4RX3A 4IBRA 4S2MA 1ONGA 1QMEA 2E8IA 1L0GA 4E3JA 1CK3A 2UWXA 1ERMA 1MY8A 1DJBA 4WBGA 4Z9QA 1BZAA 1VM1A 3HUMA 5GHXA 4E3NA 4E3MA 3AGFA 2OLVA 3SS4A 3W4QA 5FQJA 3HLGA 1XXMA 4Q8IA 1IKGA 1XA1A 4DE0A 4PM7A 3PBOA 4KG6A 2J7VA 3HBRA 3MKFA 1K55C 1S0WA 2WKIA 4MBHA 4DE3A 1TVFA 3ZG9B 2OLUA 2ZQ9A 1CI9A 1FQGA 4N9LA 5AQ9A 1H5XA 4ZJ2A 4JKTA 2EFXA 3G30A 3G2ZA 4Y0TA 3ZVWA 4UA7A 3IXHA 3MZFA 2P74A 3ZNTA 5M18A 4NK3A 2JBFA 1WYBA 3MXRA 4S2KA 4S2IA 5F1FA 3E2LA 1IYSA 5CRFA 1RGZA 2WUQA 1BULA 2C6WB 1YLJA 3G4PA 5CGWA 5HW3A 3Q82A 2XR0A 5GLAA 1LLBA 3FKWA 1E4DA 2Y2JA 3NBLA 3MZEA 1KGFA 1RP5A 2ZC3B 5EVIC 3IF6C 1PWGA 4WMCD 4CJNA 4D2OA 3V50A 2WGWB 1MKIA 1ES5A 1QMFA 4ID4A 1K6RA 1OMEA 5FQQA 3GVBA 4UAAA 5AQBA 2Y55A 5HL1A 2XFTA 1ZC2A 2XLNA 2WZZA 3OPRA 4JLFA 5FASA 4X69A 3VFHA 3Q7VA 4K0XA 3TG9A 3MXSA 2Y91A 3NCKA 3IWIA 3VFFA 2Y2KA 1ESIA 5M1AA 3SH7A 2EX8A 3O87A 1W79A 3FZCA 4WM9A 3ITBA 3IT9A 5DTKA 1MWUA 2DRWA 5KSCA 1MWRA 2EX6A 4GD6A 4X55A 1HZOA 1PW1A 3WS2A 4UA6A 5IHVA 4KZ5A 2Y2MA 5KSHA 4O7DA 1J9MA 3G34A 1CEGA 2HP6A 1JTGA 5FI7A 5F83A 4BD0A 1SCWA 4WEKA 5A93A 5HAQA 3LO7A 4N1XA 4ZJ3A 3VP4A 4OP8A 3UPOA 2P9VB 1IELA 3VP0A 4Y0OA 5J8XA 3CZDA 3PAGA 2ZJ9A 2X01A 5DVAA 1YT4A 3BM6A 5L2FA 4S2OA 1FCMA 3IXGA 3UDIA 4JXVA 1BT5A 4DF6A 2WADA 1RGYA 3ZFZA 5CGXA 1IYQA 2H10A 4P6BA 5FA7A 3BFCA 2FFYA 4L0LA 1FSWA 1ES2A 3MKEA 3GMWA 4N92A 4DXCA 1JWPA 2ZM8A 4GZBA 2B5RA 3UO9A 3M2KA 1YLZA 4NETA 1E3UA 3OZHA 5FAQA 2WGIA 1K38A 5DF9A 1YM1A 1LI9A 1TDGA 1ZG4A 4ZJ1A 3C4PA 3HLDA 4FH4A 4RX2A 3BFEA 3HVFA 4KZ3A 3RXWA 4QY6A 3ZVTA 4UA9A 3BRMA 4CPKA 3Q07A 1NRFA 1SHVA 1W5DA 4YFMA 5EOOA 1O7EA 5HFOA 3TSGA 5A92A 4JPMA 3WS4A 3ZG0A 5CHJA 1YLYA 2PU2A 3C7VA 5FQIA 1GHMA 5F82A 4UHUA 5EOEA 2HDUA 3ZG5A 3HLFA 2JE5A 1PZPA 1EI5A 4LV1A 5EVLA 3RXXA 2G2WA 1K54A 2DCFA 1C3BA 2EX9A 3V3SA 4FCFA 5GLDA 4KZ6A 3ZGAB 1NYYA 2Y2OA 2HP5A 3M2JA 4KQQA 4IVKA 3S1YA 3WS0A 4EUZA 1YLPA 4WELA 3PBSA 2ZQCA 3VOZA 4GDBA 1K4FA 4ZTKA 3VMAA 2DNSA 4HBUA 5FDHA 3UN7A 1HVBA 1XGIA 4QB8A 1CEFA 1ES3A 3LEZA 3O3VA 3UDFA 1NZOA 4DE2A 3Q1FA 4GB7A 5EVIB 3IF6B 3M6BA 4B4ZA 4OPZA 4X53A 4WMCA 1KDWA 2ZQ7A 3GSGA 1MXOA 1PW8A 3LY4A 3PTEA 2FFFB 4C3QA 3UPPA 3BFGA 4B88A 3C5AA 5CHMA 1YMXA 4E6XA 5CGSA 1M40A 4BLMA 3MFDA 3ZG8B 2CC1A 3BLSA 2Y2PA 5KMWA 4OPQA 4EBNA 3GTCA 2HDRA 2JCHA 1RCJA 4LCMA 4GKUA 3FWLA 4GNUA 5U47A 1N9BA 3OCNA 2XGNA 1BLCA 2H5SA 3EQVA 3N8RA 1KDSA 3BECA 1KVMA 1ONHA 1Z6FA 5E2FA 4LENA 4JXSA 4WYYA 1H8ZA 3E2KA 1BLHA 2QMIA 4MBKA 3UY6A 3CMZA 1H8YA 4OOMA 1G68A 3IXBA 1SKFA 3ZCZA 5M19A 1LL9A 2VGKA 1XX2A 3OPPA 4MEZA 2R9WA 1K25A 2RCXA 4KG2A 5GHZA 1Q2PA 3VSKA 4N1HA 1CI8A 2Y4AA 3NIAA 5JYPA 3MBZA 3WRTA 4N9KA 3IHBA 3O86A 2IWBA 3IXDA 1IYOA 5F1GA 4XUXA 1WE4A 3O88A 3A3EA 4OOLA 3V39A 1L0EA 2EXBA 1JTDA 4A5RA 3G2YA 4S2NA 3ISGA 2Y2IA 4BENA 3N6IA 4IBXA 3OC2A 1VQQA 4Y0UA 3HLCA 2XFSA 2Q9NA 1KE0A 2R9XA 2WK0A 2QPNA 4R4RA 2Y2HA 1PYYA 3UPNA 4S2LA 1KGGA 1HTZA 4B4XA 2XQZA 1GHIA 4P87A 4KQRA 1NYMA 2IWDA 1MWTA 4MNRA 5EECA 3N8LA 4U0XA 4EQIA 5BOHA 3W8KA 4JXGA 4KZAA 1ZKJA 5TFQA 1XGJA 3WS1A 1BSGA 1ESUA 3W4PA 1KE3A 4C75A 1DJAA 3NDGA 3V3RA 2PBYA 4YINA 4HESA 4U3TA 2EFUA 4EWFA 3CJMA 2WKHA 4OQIA 4QJGA 2BG1A 5EVID 4RYEA 3UDXA 2A3UA 5E2EA 3G35A 3GV9A 3GQZA 2WGWA 5FATA 3HUOA 4BD1A 5EE8A 4WZ5A 1NY0A 5FI6A 1K56D 1MBLA 4E6WA 3A3FA 3NI9A 2C5WB 4OKPA 3OPHA 1PIOA 2Z2MB 5FQ9A 3G32A 1S6RA 4M3KA 5EPHA 4PM5A 3N4IA 4KQOA 1MPLA 4OH0A 2XD5A 1K54C 3NY4A 4GD8A 1GA0A 4JF4A 4WZ4A 4JXWA 3BLMA 5HARA 4OONA 5EUAA 2RL3A 4PPRA 1IKIA 1W8QA 5G18A 3N7WA 1PI5A 1U60A 3NDEA 2Y2LA 1PI4A 5DTTA 1Q2QA 1XA7A 5GHYA 1NXYA 2P9VA 4KZ9A 4LV0A 4R1GA 4S2PA 1YMSA 3QNBA 1O07A 4QHCA 3JYIA 2J8YA 2ZM0A 3VSLA 1MWSA 4KZBA 2QZ6A 4H8RA 1HD8A 3C4OA 2Y59A 3HLBA 2XH9A 4BJPA 4HBTA 4WEJA 3QNCA 1WYCA 4LV2A 5FAOA 4F94A 4OPRA 2BLSA 2ZMAA 3S22A 4EBLA 4PM8A 3Q7VB 2ZC5B 5DF8A 3HREA 3GRJA 4DDSA 2OSUA 1K57A 4ZBEA 4R4SA 1XKZA 2V20A 1ERQA 1KGEA 2Q9MA 1KE4A 2XEPA 3DW0A 3P98A 4LCLA 3UE3A 2ZQAA 2X71A 5AQ7A 1FSYA 1GA9A 3A3DA 2V1ZA 1L0FA 1YLTA 2HDSA 2H0YA 2ZC7A 3IH8A 3P09A 4EV4A 4OQGA 3PBNA 5E43A 3V5MA 5D3OA 4R3JA 4FSFA 4BL3A 3SS5A 1LHYA 3TOIA 1E25A 5HX9A 4OQHA 5GLBA 5HAPA 1Y54A 4R23A 5A90A 2Y2QA 2ZLYA 2HPBA 1W8YA 4DXBA 1L2SA 2H0TA 3ITAA 4ZDXA 1JVJA 3Q7ZA 1FCOA 1XPBA 2X02A 1I2SA 2J9PA 3SH9A 3UE1A 3QHYA 4KZ4A 4R0QA 4GDNA 4XXRA 4DKIA 1K55A 4EBPA 4XUZA 3I7JA 3ZNYA 4DDYA 1PWDA 1TEMA 1DY6A 1PZOA 3AGEA 5E2HA 4P0MA 5A91A 3Q81A 4RA7A 4S2NC 4OPYA 5CECA 2I72A 1BUEA 1FR1A 3FKVA 3FV7A 3IQAA 3ZDJA 2V2FF 3WWXA 2XF3A 1JWVA 3HLWA 1SDNA 1YQSA 2WGVA 3M6HA 4R3BA 1I5QA 2JC7A 1GCEA 1GHPA 3VOYA 2ZQDA 3D4FA 4KENB 5GL9A 2IWCA 4OP5A 1ALQA 5DTSA 4C6YA 1LI0A 1EWZA 1YLWA 3PAEA 3W4OA 2ZQ8A 3OPLA 5EVIA 4MBFA 3IF6A 3CG5A 3LY3A 2WYXA 2XDMA 3RJUA 3PBRA 3VP2A 4ZAMA 4X6TA 5FSRA 4FD8A 1DJCA 4BL2A 1K56A 1N4OA 3BFFA 4LV3A 4OQ0A 4OOYA 3PBQA 4HEFA 3SS3A 3WS5A 1W7FA 3G31A 5E2GA 4QY5A 3VP1A 3SOIA 3WRZA 1AXBA 1IEMA 3IH9A 4S2JA 2Z2LB 3MZDA 3B3XA 2EXAA 2Y2GA 4RVAA 3BEBA 4WZ5C 1NZUA 5I94A 3A3JA 5KZHA 2G2UA 4E3KA 3FYZA 5FQMA 1I2WA 2ZD8A 4IVIA 4KZ8A 4KG5A 5AQAA 4JF6A 5CERA 3OCLA 1K4EA 1ZG6A 5CTNA 4PM6A 5FQKA 3UE0A 2ZM2A 1NJ4A 4PMAA 2WAFA 5CEBA 4GN2A 5GLCA 4E3LA 1SDEA 3DWZA 5CHUA 3ZG7B 1PWCA 3AGDA 5FAPA 4DRTA 4OLDA 3DWKA 1L0DA 4JBFA 4X56A 1BTLA 3IWQA 3IWOA 4DE1A
chains in the Genus database with same CATH superfamily
4GS9B 1G6AA 3RH8B 2WKEA 1S1ZA 3MJQA 3VE4A 4X1MA 3OLOA 3KYEA 3S4XA 3HL9A 4OLGA 2D02A 3SH8A 3OOVA 4CLCA 4MCWA 1FR6A 4BWIA 1JNUA 4Q0HA 3EQUA 4Y7PA 4EW7A 4F3LA 3C7UA 1TS8A 4Z1WA 1ES4A 4E3IA 1K57C 3ZHHA 3PHYA 1PNEA 5HZHA 1DP8A 3T1SA 2J9OA 3DTMA 4X68A 1EROA 1L0GA 1CK3A 1OTAA 4WBGA 4Z9QA 1DJBA 4E3NA 1BZAA 1VM1A 5GHXA 1XXMA 1XA1A 1LT0A 4PM7A 2W1RA 2VV7A 3MKFA 4MBHA 2PD7A 3NHQA 1CI9A 2EFXA 1LSVA 3B33A 4UA7A 5M18A 4NK3A 3MXRA 1WYBA 4DJ2A 5FL3A 1YLJA 3F1OB 5GLAA 2J3TC 3FKWA 2HV1A 3TRCA 2OAP1 2Y2JA 1RP5A 3IF6C 3LEQA 4ID4A 1V9ZA 3LICA 4UAAA 2Y55A 2XFTA 1ZC2A 2WZZA 1MC0A 3IS2B 3VFHA 3TG9A 3F1NB 1ESIA 1YPRA 3SH7A 2EX8A 3E4QA 1W79A 5DTKA 4WM9A 3ITBA 3CLOA 4NXBA 2DRWA 2P7JA 3HJIA 4UA6A 5IHVA 4HH3A 4O7DA 3G34A 2HP6A 2LB9A 4BD0A 1SCWA 5HAQA 3LO7A 4I3JA 3UPOA 2P9VB 1IELA 2O99A 4R70A 3PAGA 2ZJ9A 5DVAA 3BM6A 3EEHA 4S2OA 2QWSA 4I38A 3UDIA 1CQAA 4DF6A 2H10A 3LIBA 1S4SA 5IT5A 2FFYA 4N92A 4DXCA 3GMWA 1JWPA 2ZM8A 3OZHA 5FAQA 5DF9A 4LLOB 1LI9A 4HY8A 3K2NA 5DFYA 3HVFA 3FG8A 5HD5A 5HFOA 4II7A 5A92A 4JPMA 3WS4A 5CHJA 1GHMA 3A0VA 4UHUA 2YKFA 3ZG5A 3HLFA 3F1PA 3RXXA 3ZGAB 4IVKA 2VK3A 3S1YA 3PBSA 2ZQCA 5HDCA 1K4FA 2OOLA 3VMAA 2DNSA 3UN7A 2A2LA 4EU0A 3LEZA 1ES3A 3O3VA 4FTXA 1NZOA 2HJEA 3E98A 3MQOA 5EVIB 4X53A 2NUTC 1KDWA 3LY4A 4MN5A 3KO6A 4I3AA 3UPPA 3C5AA 5CHMA 3U2AA 1M40A 3CITA 5EM1A 3CWFA 2JCHA 4LCMA 3H9WA 3MQQA 1KVMA 4LENA 3O5YA 4JXSA 4BBTA 4G3VA 3UY6A 3CMZA 1H8YA 3ZCZA 1XX2A 1TF1A 2RCXA 1CI8A 2Y4AA 3WRTA 4N9KA 3IHBA 5F1GA 1WE4A 3O88A 4A5RA 4LPZA 4S2NA 4UQIM 2V0WA 4Y0UA 1P9WA 3KYQA 1TS6A 2QPNA 4S2LA 4P87A 5EECA 3N8LA 3NOUC 5TFQA 5J7EA 2HJ9C 3UMEA 3LUQA 2PBYA 2J3TD 4ESPA 4U3TA 4EWFA 2PT7A 3CJMA 4QJGA 3UDXA 2WKPA 3GV9A 4BD1A 3HUOA 1D7EA 3L9KA 3DTEA 5FI6A 1MBLA 3A3FA 2VA0A 2C5WB 3MFXA 5A8BA 1PIOA 1VEUA 3G32A 4PKYG 4M3KA 1P9RA 2XD5A 3NY4A 4LRZE 4OONA 4B9OA 4PPRA 1W8QA 3A0RA 2GNXA 3QP6A 3NDEA 3IX3A 1PI4A 5DTTA 1Q2QA 1NXYA 4KZ9A 4LV0A 4S2PA 5F5YA 3JYIA 2Y59A 2KOIA 3E0YA 3HLBA 2XH9A 3QNCA 4OPRA 2BLSA 1P0ZA 3GRJA 3G6OA 4ZAMA 2XEPA 1KE4A 3UE3A 2X71A 1FSYA 1GA9A 4FUWA 3A3DA 2ZC7A 5E43A 5F6AA 4GCZA 1T18A 1TS0A 1LHYA 3IBJA 1YKDA 2ZLYA 4EQ1A 1OPXA 4ZDXA 1FCOA 4KZ4A 4R0QA 4XXRA 5K5BA 1FIKA 1PWDA 2VKSA 2EA9A 1DY6A 1PZOA 3AGEA 4P0MA 3Q81A 2EWVA 4L9GA 4OPYA 1FR1A 3FV7A 3R7WB 3HLWA 4D60A 2W1TB 2JC7A 1GCEA 3VOYA 3D4FA 5GL9A 3EOIA 5HD3A 3A0SA 2Y79A 2ZQ8A 3OPLA 3IX8A 4MBFA 1GSVA 3LY3A 3VP2A 3LGOA 4X6TA 2PAVP 1G28A 1NLYA 4LV3A 4OOYA 3WRZA 2VEAA 4QWOA 2Z2LB 3DAVA 2P08A 3BEBA 2G2UA 4YOFA 1I2WA 4KZ8A 1ZG6A 5CEBA 4GN2A 4E3LA 1V9YA 3DWZA 5EV0A 5FAPA 4EUVA 4JBFA 5TBMB 2XK1A 4NXEA 1JWZA 4BQMA 2K2NA 1D1JA 4K0WA 4U0TA 5L8MA 2Z6DA 1BLSA 2ZC6B 2W3EA 1TDLA 1LL5A 5DJTA 2WAEA 4IUKA 5L10A 4K91A 4G3WA 3LFVA 3LI8A 1E3UD 3GR2A 3JVVA 1P97A 1Y28A 2WZXA 2O9BA 5TR7A 5TGFA 3PBTA 3VP3A 5FI2A 5CTMA 3E4OA 3TW8A 3BFDA 4RX3A 4IBRA 4S2MA 1ONGA 1QMEA 2E8IA 1MY8A 2JKRI 3HUMA 3P01A 4HP4A 2OLVA 3SS4A 3W4QA 4LFUA 1W63M 2J7VA 3HBRA 1K55C 5HWTA 1YSQA 3CAXA 2OLUA 3T4JA 4ZJ2A 1XFNA 2P74A 4S2KA 3E2LA 3LIAA 2Q0OA 2WUQA 5CGWA 5HW3A 5G4YA 1LLBA 3NBLA 1KGFA 4CJNA 1L3LA 1QMFA 1H8MA 1OMEA 5FQQA 5HL1A 3LYXA 4K0XA 3IWIA 3VFFA 1Y4OA 5LBRA 3IT9A 1MWRA 2VZWA 4GD6A 4JGPA 1HZOA 3WS2A 1CEGA 2D01A 2L0WA 4O8GA 5FI7A 2JKTI 3VP4A 4NEED 3VP0A 4Y0OA 5J8XA 1YT4A 2JKFA 1FCMA 3IXGA 4JXVA 1VETB 4O01A 4HJ4A 3ZFZA 1IYQA 3BFCA 1FSWA 1ES2A 3MKEA 4GZBA 1SZVA 2WGIA 1YM1A 4CLCC 2W27A 1OJGA 4FH4A 1LSWA 4RX2A 4QY6A 1T1AA 4UA9A 3Q07A 1O7EA 4Y15A 3TSGA 1F5MA 3C7VA 3HCYA 3E4PA 2HDUA 2JE5A 3NJAA 1EI5A 1K54A 2DCFA 2EX9A 3V3SA 4KZ6A 1XJ6A 3VOZA 3T4SA 1XGIA 3CPTB 4EEUA 1UGUA 3Q1FA 4XT2A 4P6ZS 3IF6B 3M6BA 3NECA 4WMCA 4GS9A 3P7NA 3GSGA 1PW8A 2FFFB 2L1MA 4EEPA 5CGSA 4BLMA 3ZG8B 2CC1A 5TJJA 5KMWA 5L09A 4EBNA 3T4LA 3FWLA 4YWZA 2XGNA 1BLCA 3N8RA 4HP9A 1ONHA 5E2FA 4Q0JA 3UB5P 1H8ZA 2KX6A 2QMIA 1VHMA 4DN0A 1N9OA 4OOMA 1SKFA 4MEZA 1OTIA 3LIFA 3VSKA 5JYPA 4Y3IA 2IWBA 5HPIA 3IXDA 1IYOA 3V39A 3DTIA 4OOLA 5HWVA 5F69A 1LSXA 2M1CA 2Y2IA 3OC2A 3MR0A 2BASA 3LIEA 1KGGA 4KQRA 1NYMA 2IWDA 1MWTA 4MNRA 4EQIA 4JXGA 3T1RA 1XGJA 3LR0A 3F1PB 1ODVA 3T50A 1K0KA 3W4PA 5HWWA 3BY9A 3F1OA 5EM0A 4HESA 3T4TA 1GSXA 2WKHA 2A3UA 2YKHA 3G35A 5FATA 1XJ4A 1YAXA 1NY0A 3NOPC 4H6JB 2XRNA 4L9FA 3IS2A 4HQAA 3F1NA 1S6RA 2PDRA 1MPLA 3MSHA 3BJNA 4JF4A 3VE3A 4UEYA 2RL3A 3ICYA 1IKIA 1UWNX 4KUOA 4EESA 3BY8A 1WA9A 2Y2LA 2P9VA 4CQHA 3QNBA 1LL8A 1O07A 4KZBA 1FILA 1WYCA 2WKRA 4PM8A 3PXPA 2LB5A 3Q7VB 4JGOA 3MS6A 3HREA 3UB9A 4DDSA 2OSUA 4ZBEA 4R4SA 3P98A 3DW0A 2Q9MA 3GDIA 2ZL1B 2K31A 2PRFA 4CLCD 3D72A 4EV4A 2H0YA 3KSGA 3P09A 2GJ3A 4R3JA 4BL3A 3SW1A 2QJ5A 4R23A 3GECA 2Y2QA 2HPBA 1IFQA 4DXBA 3B42A 4JGQA 3Q7ZA 1I2SA 2J9PA 4NKPA 3UE1A 4DKIA 4O0PA 3I7JA 4DDYA 1OT6A 1MKMA 3LIDA 4S2NC 5CECA 2I72A 1BUEA 3K3CA 3FKVA 3IQAA 4HI4A 4MMNA 2ZMVA 2WGVA 4CLCE 3M6HA 1GHPA 2ZQDA 4KENB 2ACGA 2IWCA 4C6YA 1LI0A 3PAEA 3QP1A 5EVIA 5AVFA 1H3QA 3QP2A 2XDMA 3RJUA 3PBRA 2ZOIA 5FSRA 1DJCA 3CUEA 1K56A 1N4OA 3SS3A 4HEFA 3SZTA 1ACFA 1IEMA 3UE6A 3MZDA 2W3DA 2QJ7A 2Y2GA 3A3JA 2PYRA 4QPRA 4JF6A 1K4EA 3B47A 4PM6A 3MF0A 2WAFA 2DMWA 1PWCA 3H7WB 4OLDA 3DWKA 1L0DA 4X56A 1BTLA 3UB7A 4DE1A 1PFLA 1BLPA 3IF5A 4FH2A 2VV6A 4IEDA 4PM9A 2A49A 3LCEA 2KDKA 1DRMA 3EEAA 2Y2NA 1CF0A 3A3IA 1KVLA 1FOFA 1IYPA 4EETB 2WKQA 4LRXC 4QD4A 2HP9A 2R78A 5CEDA 4GOGA 5I5LA 3IHAA 4BBVA 2OAQ1 2HDQA 3HUNA 4KZ7A 1M6KA 2E8JA 3N8SA 2PU4A 5HAIA 4JF5A 2OV5A 2OWJA 2I9VA 4E3MA 5HSQA 3AGFA 3LI9A 5FQJA 3H82B 4Y2FA 4DE0A 2EWWA 3PBOA 5FEFA 3ZG9B 4B93A 3BQ8A 2ZQ9A 1FQGA 1XFQA 5AQ9A 1H5XA 4DJ3A 3CI6A 3G2ZA 4KQDA 3ZVWA 3IXHA 3ZNTA 2JBFA 5CRFA 1RGZA 1BULA 2C6WB 3Q82A 2XR0A 1E4DA 1YSPA 1PWGA 5HDSA 4D2OA 3L7HA 4PHTA 2WGWB 1MKIA 3V50A 1ES5A 2A24B 4LRYC 4JLFA 4X69A 3MXSA 2Y91A 3NCKA 1H0MA 3TJZC 5KSCA 1BYWA 1SKOB 1PW1A 2O9AA 1J9MA 4EXOA 3FC7A 3VOLA 2HF6A 5F83A 5A93A 2AVXA 4WEKA 3LR3A 4N1XA 4GHIB 4OP8A 4DMZA 1HLUP 3CZDA 2X01A 5L2FA 3QP8A 1BT5A 2WADA 4ARZB 2XA7S 5CGXA 4P6BA 2B5RA 3UO9A 2L4RA 3R7WA 4ME4A 2W1TA 1TDGA 1ZG4A 4ZJ1A 3C4PA 4CPKA 3BRMA 4GJ4A 1NRFA 4YFMA 1ZHHB 3ZG0A 1YLYA 2PU2A 5FQIA 2VJWA 4LV1A 2G2WA 2KLIA 2W3FA 1C3BA 5GLDA 5EFWA 1NYYA 2Y2OA 3M2JA 4KQQA 4EUZA 4WELA 1S66L 4GDBA 4HIAA 3C2WA 4ZTKA 4HBUA 5FDHA 1HVBA 4QB8A 2FZ0A 4DE2A 2HZ5A 4B4ZA 5TBMA 1MXOA 4K08A 3PTEA 5L07A 1OT9A 4ETZA 1YMXA 4I5SA 2JKRM 4E6XA 1OTDA 1IOUA 2Y2PA 3GTCA 2HDRA 1RCJA 3EWKA 4GNUA 1N9BA 2W3GA 1G6OA 4NXFA 4WYYA 3E2KA 4R3AA 4MBKA 2FH5A 3IXBA 5HL6A 1LL9A 2VGKA 2R9WA 4JGRA 5GHZA 1Q2PA 4UQIS 1D06A 3MBZA 3MXQA 4Y17A 1L0EA 1JTDA 1EW0A 1VQQA 3HLCA 2XFSA 1KE0A 5J4EA 4CLCB 2WK0A 4R4RA 3T1XA 4L9EA 5J3WA 4WN5A 4PAUA 1HTZA 4F3LB 3FPWA 5BOHA 3EGDC 5F68A 3UB6A 3QP4A 4KZAA 1ZKJA 3LR4A 1ESUA 1KE3A 3NDGA 2M7UA 1J3WA 1S1YA 2JKTM 2O9CA 3V67A 2BG1A 3PR6A 3GQZA 2XSSA 4WZ5A 4MN7A 5EE8A 3KYZA 5FQ9A 5EPHA 4OH0A 1K54C 3BLMA 5HARA 3JVUA 5EUAA 5G18A 2O0YA 1PI5A 4I39A 1KOUA 3T4QA 1U60A 3C30A 3R4KA 1XA7A 1OTEA 1MZUA 1Z09A 4R1GA 4WLAA 1YMSA 3TE8A 4Y5FA 2ZM0A 1VETA 1MWSA 3D9YA 1HD8A 4HBTA 4WEJA 2G7UA 4LV2A 5FAOA 4F94A 3S22A 4IUHA 3RFBA 3MMHA 1K57A 4HJ6A 2UV0E 1XKZA 2V20A 3RXWA 2ZQAA 1L0FA 2V1ZA 3IH8A 3PBNA 3V5MA 5D3OA 2M7VA 1STZA 4FOFA 5HX9A 4OQHA 5HAPA 1Y54A 4GW9A 4R6LA 1L2SA 2H0TA 5EVEA 5HPFA 1JVJA 3QHYA 4GDNA 4EBPA 3BW6A 3ZNYA 3DBAA 3VV4A 1XJ2A 1TEMA 5CX7A 2ZOHA 1N9NA 3BWLA 2V2FF 1JWVA 1SDNA 4R3BA 2OWHA 3LR5A 1ALQA 1EWZA 1YLWA 3CPTA 1F2KA 3IF6A 2WYXA 2GZAA 4I3IA 3BFFA 4OQ0A 4Q0IA 3VP1A 4QY5A 1CJFA 4M4XA 3B3XA 2EXAA 2MJ6A 2XROA 5KZHA 4E3KA 1XJ3A 2V1BA 5FQMA 3FPVA 1OTBA 4KG5A 5CTNA 2NUPC 3UE0A 2Z6CA 4PMAA 5GLCA 1SDEA 5CHUA 4EERA 3ZG7B 2PR6A 3AGDA 3C8CA 3KSIA 3CHWP 2VV8A 5CXWA 2VGJA 2VGLS 2XA7M 3HLEA 2VX8A 4P85A 2ZC4B 5DF7A 3EGXC 3BYDA 2V1AA 4E3OA 1FCNA 2XD1A 5JYOA 1K6SA 2GDNA 2B02A 2EX2A 4HJ3A 3NC8A 1T1BA 3UNWA 5DKLA 1XP4A 2QHKA 4OVDA 4QU3A 4MLLA 4E3JA 2UWXA 1ERMA 3IBRA 2PBDP 4GLQA 3HLGA 4Q8IA 4H6JA 2PR5A 1IKGA 3C38A 4KG6A 4DE3A 2J3WA 1S0WA 2WKIA 1TVFA 4RQ9A 4N9LA 4JKTA 1TS7A 3G30A 4Y0TA 1OJ5A 1TD5A 3MZFA 5G4ZA 1G5UA 4S2IA 5F1FA 1IYSA 1ZTUA 3G4PA 4BBUA 3RTYA 1UWPX 3MZEA 2ZC3B 5EVIC 3NULA 4WMCD 5DFXA 1K6RA 1DP6A 1T1CA 3GVBA 5AQBA 4AFIA 3CUEC 2XLNA 3OPRA 5FASA 3Q7VA 1VEUB 2Y2KA 5M1AA 3O87A 3FZCA 1DP9A 1MWUA 2ZL1A 2JHEA 2EX6A 4X55A 4KZ5A 2Y2MA 5KSHA 2GX5A 1JTGA 2HGVA 5MC7A 1S67L 4ZJ3A 3T4KA 3S7PA 5FEGA 4G3KA 4WF0A 1RGYA 5FA7A 4L0LA 3M2KA 1YLZA 4NETA 1E3UA 1K38A 3HLDA 3HJKA 3BFEA 2ZMFA 5AVEA 4KZ3A 3ZVTA 1W63Q 2PD8A 4HH2A 1W5DA 1SHVA 5EOOA 1T19A 5IS1A 5F82A 5EOEA 1PZPA 5EVLA 4MN6A 1F9IA 3S7NA 4FCFA 1GSWA 2HP5A 3WS0A 1NLZA 1YLPA 2VLGA 4ZRRA 1CEFA 3H7WA 1NRJA 1VB6A 3UDFA 3UB8A 4GB7A 4OPZA 2ZQ7A 4C3QA 3BFGA 4B88A 2JKGA 4P6ZM 3MFDA 3BLSA 4OPQA 1X0OA 2BTFP 4GKUA 5U47A 4R38A 3OCNA 2H5SA 3EQVA 1KDSA 2JN7A 3BECA 1Z6FA 5DKKA 3ZQ5A 4HOIA 4Y13A 2V8FA 1BLHA 2PHYA 1G68A 5M19A 3OPPA 1S4RA 1K25A 4KG2A 2W3HA 4IHQA 4N1HA 3NIAA 3O86A 4XUXA 3A3EA 2EXBA 3T12B 3G2YA 3ZYTA 2INWA 2K7SA 3ISGA 3H82A 3W2ZA 4BENA 3N6IA 4IBXA 3KSHA 4ETXA 2Q9NA 1NWZA 2R9XA 3BQAA 5FDSA 3UMDA 2ZBBA 2Y2HA 1PYYA 3UPNA 3ULFA 4B4XA 2XQZA 1GHIA 4U0XA 3QP5A 2B18A 3W8KA 4BMWA 3S7OA 3WS1A 1BSGA 4C75A 5AJGA 1DJAA 3V3RA 4YINA 2EFUA 3K3DA 5IU1A 4OQIA 5EVID 3OBFA 4RYEA 4NG2A 4X1LA 5E2EA 2WGWA 4NXGA 5DJUA 2A24A 2W0NA 1K56D 4E6WA 3NI9A 2CMNA 4OKPA 3OPHA 2Z2MB 4MDZA 4PM5A 3N4IA 4KQOA 4GD8A 4WL9A 1GA0A 4WZ4A 4JXWA 1SKOA 3N7WA 2P04A 2VGLM 2B95A 2QKPA 5GHYA 4GHIA 1PRQA 3U4LP 4QHCA 2J8YA 3VSLA 1F98A 2QZ6A 4H8RA 3C4OA 3KSFA 4ARZA 4BJPA 2V9AA 2ZMAA 4EBLA 3JPUA 2ZC5B 5DF8A 3NOTC 3DTKA 3T1QB 3T4OA 1ERQA 1KGEA 4LCLA 5AQ7A 1YLTA 2HDSA 4OQGA 4FSFA 1N9LA 2V0UA 1A0KA 3SS5A 3TOIA 1E25A 2IA2A 5GLBA 5A90A 3S7QA 1W8YA 3ITAA 4X25A 5KIZA 1XPBA 2X02A 3SH9A 1K55A 4XUZA 4HNBA 3PYPA 2J80A 4KUKA 5E2HA 5A91A 4RA7A 3ZDJA 3WWXA 2XF3A 4IJGA 1YQSA 1I5QA 3MQ0A 2PYPA 3KX0X 4E04A 4OP5A 5DTSA 5HDDA 3W4OA 3CG5A 2QYBA 4LGWA 1AWIA 4FD8A 4BL2A 2V8CA 2Y8HA 4YNRA 3PBQA 3WS5A 1W7FA 3G31A 5E2GA 4HHDA 3SOIA 1AXBA 5C5KA 3IH9A 4S2JA 3IX4A 4RVAA 4WZ5C 5I94A 1NZUA 3FYZA 4WUJA 4PKYA 2ZD8A 4IVIA 5AQAA 5CERA 3OCLA 5FQKA 2ZM2A 1NJ4A 3D3OA 4DRTA 2H28A 4XT2B 3IWQA 3IWOA
chains in the Genus database with same CATH topology
5CXWA 2VGJA 1BLPA 2XK1A 3IF5A 3HLEA 1JWZA 1G6AA 4FH2A 4BQMA 4P85A 2WKEA 4IEDA 2ZC4B 4K0WA 4U0TA 4PM9A 2A49A 5DF7A 3LCEA 1BLSA 2ZC6B 3S4XA 1TDLA 2Y2NA 1LL5A 3HL9A 3BYDA 4OLGA 3SH8A 4E3OA 2WAEA 3A3IA 1KVLA 1FOFA 1FCNA 4K91A 1IYPA 1FR6A 2XD1A 5JYOA 1K6SA 2GDNA 4QD4A 3EQUA 2HP9A 5CEDA 4Y7PA 4GOGA 3C7UA 3IHAA 2EX2A 1E3UD 1ES4A 2HDQA 3GR2A 4E3IA 1K57C 3HUNA 2WZXA 3ZHHA 5TR7A 4KZ7A 3NC8A 5TGFA 3UNWA 1M6KA 3PBTA 3VP3A 1XP4A 2J9OA 3N8SA 5FI2A 2PU4A 5CTMA 5HAIA 3DTMA 4JF5A 4OVDA 4QU3A 4X68A 3BFDA 2OV5A 1EROA 4MLLA 4RX3A 4IBRA 4S2MA 1ONGA 1QMEA 2E8IA 1L0GA 4E3JA 1CK3A 2UWXA 1ERMA 1MY8A 1DJBA 4WBGA 4Z9QA 1BZAA 1VM1A 3HUMA 5GHXA 4E3NA 4E3MA 3AGFA 2OLVA 3SS4A 3W4QA 5FQJA 3HLGA 1XXMA 4Q8IA 1IKGA 1XA1A 4DE0A 4PM7A 3PBOA 4KG6A 2J7VA 3HBRA 3MKFA 1K55C 1S0WA 2WKIA 4MBHA 4DE3A 1TVFA 3ZG9B 2OLUA 2ZQ9A 1CI9A 1FQGA 4N9LA 5AQ9A 1H5XA 4ZJ2A 4JKTA 2EFXA 3G30A 3G2ZA 4Y0TA 3ZVWA 4UA7A 3IXHA 3MZFA 2P74A 3ZNTA 5M18A 4NK3A 2JBFA 1WYBA 3MXRA 4S2KA 4S2IA 5F1FA 3E2LA 1IYSA 5CRFA 1RGZA 2WUQA 1BULA 2C6WB 1YLJA 3G4PA 5CGWA 5HW3A 3Q82A 2XR0A 5GLAA 1LLBA 3FKWA 1E4DA 2Y2JA 3NBLA 3MZEA 1KGFA 1RP5A 2ZC3B 5EVIC 3IF6C 1PWGA 4WMCD 4CJNA 4D2OA 3V50A 2WGWB 1MKIA 1ES5A 1QMFA 4ID4A 1K6RA 1OMEA 5FQQA 3GVBA 4UAAA 5AQBA 2Y55A 5HL1A 2XFTA 1ZC2A 2XLNA 2WZZA 3OPRA 4JLFA 5FASA 4X69A 3VFHA 3Q7VA 4K0XA 3TG9A 3MXSA 2Y91A 3NCKA 3IWIA 3VFFA 2Y2KA 1ESIA 5M1AA 3SH7A 2EX8A 3O87A 1W79A 3FZCA 4WM9A 3ITBA 3IT9A 5DTKA 1MWUA 2DRWA 5KSCA 1MWRA 2EX6A 4GD6A 4X55A 1HZOA 1PW1A 3WS2A 4UA6A 5IHVA 4KZ5A 2Y2MA 5KSHA 4O7DA 1J9MA 3G34A 1CEGA 2HP6A 1JTGA 5FI7A 5F83A 4BD0A 1SCWA 4WEKA 5A93A 5HAQA 3LO7A 4N1XA 4ZJ3A 3VP4A 4OP8A 3UPOA 2P9VB 1IELA 3VP0A 4Y0OA 5J8XA 3CZDA 3PAGA 2ZJ9A 2X01A 5DVAA 1YT4A 3BM6A 5L2FA 4S2OA 1FCMA 3IXGA 3UDIA 4JXVA 1BT5A 4DF6A 2WADA 1RGYA 3ZFZA 5CGXA 1IYQA 2H10A 4P6BA 5FA7A 3BFCA 2FFYA 4L0LA 1FSWA 1ES2A 3MKEA 3GMWA 4N92A 4DXCA 1JWPA 2ZM8A 4GZBA 2B5RA 3UO9A 3M2KA 1YLZA 4NETA 1E3UA 3OZHA 5FAQA 2WGIA 1K38A 5DF9A 1YM1A 1LI9A 1TDGA 1ZG4A 4ZJ1A 3C4PA 3HLDA 4FH4A 4RX2A 3BFEA 3HVFA 4KZ3A 3RXWA 4QY6A 3ZVTA 4UA9A 3BRMA 4CPKA 3Q07A 1NRFA 1SHVA 1W5DA 4YFMA 5EOOA 1O7EA 5HFOA 3TSGA 5A92A 4JPMA 3WS4A 3ZG0A 5CHJA 1YLYA 2PU2A 3C7VA 5FQIA 1GHMA 5F82A 4UHUA 5EOEA 2HDUA 3ZG5A 3HLFA 2JE5A 1PZPA 1EI5A 4LV1A 5EVLA 3RXXA 2G2WA 1K54A 2DCFA 1C3BA 2EX9A 3V3SA 4FCFA 5GLDA 4KZ6A 3ZGAB 1NYYA 2Y2OA 2HP5A 3M2JA 4KQQA 4IVKA 3S1YA 3WS0A 4EUZA 1YLPA 4WELA 3PBSA 2ZQCA 3VOZA 4GDBA 1K4FA 4ZTKA 3VMAA 2DNSA 4HBUA 5FDHA 3UN7A 1HVBA 1XGIA 4QB8A 1CEFA 1ES3A 3LEZA 3O3VA 3UDFA 1NZOA 4DE2A 3Q1FA 4GB7A 5EVIB 3IF6B 3M6BA 4B4ZA 4OPZA 4X53A 4WMCA 1KDWA 2ZQ7A 3GSGA 1MXOA 1PW8A 3LY4A 3PTEA 2FFFB 4C3QA 3UPPA 3BFGA 4B88A 3C5AA 5CHMA 1YMXA 4E6XA 5CGSA 1M40A 4BLMA 3MFDA 3ZG8B 2CC1A 3BLSA 2Y2PA 5KMWA 4OPQA 4EBNA 3GTCA 2HDRA 2JCHA 1RCJA 4LCMA 4GKUA 3FWLA 4GNUA 5U47A 1N9BA 3OCNA 2XGNA 1BLCA 2H5SA 3EQVA 3N8RA 1KDSA 3BECA 1KVMA 1ONHA 1Z6FA 5E2FA 4LENA 4JXSA 4WYYA 1H8ZA 3E2KA 1BLHA 2QMIA 4MBKA 3UY6A 3CMZA 1H8YA 4OOMA 1G68A 3IXBA 1SKFA 3ZCZA 5M19A 1LL9A 2VGKA 1XX2A 3OPPA 4MEZA 2R9WA 1K25A 2RCXA 4KG2A 5GHZA 1Q2PA 3VSKA 4N1HA 1CI8A 2Y4AA 3NIAA 5JYPA 3MBZA 3WRTA 4N9KA 3IHBA 3O86A 2IWBA 3IXDA 1IYOA 5F1GA 4XUXA 1WE4A 3O88A 3A3EA 4OOLA 3V39A 1L0EA 2EXBA 1JTDA 4A5RA 3G2YA 4S2NA 3ISGA 2Y2IA 4BENA 3N6IA 4IBXA 3OC2A 1VQQA 4Y0UA 3HLCA 2XFSA 2Q9NA 1KE0A 2R9XA 2WK0A 2QPNA 4R4RA 2Y2HA 1PYYA 3UPNA 4S2LA 1KGGA 1HTZA 4B4XA 2XQZA 1GHIA 4P87A 4KQRA 1NYMA 2IWDA 1MWTA 4MNRA 5EECA 3N8LA 4U0XA 4EQIA 5BOHA 3W8KA 4JXGA 4KZAA 1ZKJA 5TFQA 1XGJA 3WS1A 1BSGA 1ESUA 3W4PA 1KE3A 4C75A 1DJAA 3NDGA 3V3RA 2PBYA 4YINA 4HESA 4U3TA 2EFUA 4EWFA 3CJMA 2WKHA 4OQIA 4QJGA 2BG1A 5EVID 4RYEA 3UDXA 2A3UA 5E2EA 3G35A 3GV9A 3GQZA 2WGWA 5FATA 3HUOA 4BD1A 5EE8A 4WZ5A 1NY0A 5FI6A 1K56D 1MBLA 4E6WA 3A3FA 3NI9A 2C5WB 4OKPA 3OPHA 1PIOA 2Z2MB 5FQ9A 3G32A 1S6RA 4M3KA 5EPHA 4PM5A 3N4IA 4KQOA 1MPLA 4OH0A 2XD5A 1K54C 3NY4A 4GD8A 1GA0A 4JF4A 4WZ4A 4JXWA 3BLMA 5HARA 4OONA 5EUAA 2RL3A 4PPRA 1IKIA 1W8QA 5G18A 3N7WA 1PI5A 1U60A 3NDEA 2Y2LA 1PI4A 5DTTA 1Q2QA 1XA7A 5GHYA 1NXYA 2P9VA 4KZ9A 4LV0A 4R1GA 4S2PA 1YMSA 3QNBA 1O07A 4QHCA 3JYIA 2J8YA 2ZM0A 3VSLA 1MWSA 4KZBA 2QZ6A 4H8RA 1HD8A 3C4OA 2Y59A 3HLBA 2XH9A 4BJPA 4HBTA 4WEJA 3QNCA 1WYCA 4LV2A 5FAOA 4F94A 4OPRA 2BLSA 2ZMAA 3S22A 4EBLA 4PM8A 3Q7VB 2ZC5B 5DF8A 3HREA 3GRJA 4DDSA 2OSUA 1K57A 4ZBEA 4R4SA 1XKZA 2V20A 1ERQA 1KGEA 2Q9MA 1KE4A 2XEPA 3DW0A 3P98A 4LCLA 3UE3A 2ZQAA 2X71A 5AQ7A 1FSYA 1GA9A 3A3DA 2V1ZA 1L0FA 1YLTA 2HDSA 2H0YA 2ZC7A 3IH8A 3P09A 4EV4A 4OQGA 3PBNA 5E43A 3V5MA 5D3OA 4R3JA 4FSFA 4BL3A 3SS5A 1LHYA 3TOIA 1E25A 5HX9A 4OQHA 5GLBA 5HAPA 1Y54A 4R23A 5A90A 2Y2QA 2ZLYA 2HPBA 1W8YA 4DXBA 1L2SA 2H0TA 3ITAA 4ZDXA 1JVJA 3Q7ZA 1FCOA 1XPBA 2X02A 1I2SA 2J9PA 3SH9A 3UE1A 3QHYA 4KZ4A 4R0QA 4GDNA 4XXRA 4DKIA 1K55A 4EBPA 4XUZA 3I7JA 3ZNYA 4DDYA 1PWDA 1TEMA 1DY6A 1PZOA 3AGEA 5E2HA 4P0MA 5A91A 3Q81A 4RA7A 4S2NC 4OPYA 5CECA 2I72A 1BUEA 1FR1A 3FKVA 3FV7A 3IQAA 3ZDJA 2V2FF 3WWXA 2XF3A 1JWVA 3HLWA 1SDNA 1YQSA 2WGVA 3M6HA 4R3BA 1I5QA 2JC7A 1GCEA 1GHPA 3VOYA 2ZQDA 3D4FA 4KENB 5GL9A 2IWCA 4OP5A 1ALQA 5DTSA 4C6YA 1LI0A 1EWZA 1YLWA 3PAEA 3W4OA 2ZQ8A 3OPLA 5EVIA 4MBFA 3IF6A 3CG5A 3LY3A 2WYXA 2XDMA 3RJUA 3PBRA 3VP2A 4ZAMA 4X6TA 5FSRA 4FD8A 1DJCA 4BL2A 1K56A 1N4OA 3BFFA 4LV3A 4OQ0A 4OOYA 3PBQA 4HEFA 3SS3A 3WS5A 1W7FA 3G31A 5E2GA 4QY5A 3VP1A 3SOIA 3WRZA 1AXBA 1IEMA 3IH9A 4S2JA 2Z2LB 3MZDA 3B3XA 2EXAA 2Y2GA 4RVAA 3BEBA 4WZ5C 1NZUA 5I94A 3A3JA 5KZHA 2G2UA 4E3KA 3FYZA 5FQMA 1I2WA 2ZD8A 4IVIA 4KZ8A 4KG5A 5AQAA 4JF6A 5CERA 3OCLA 1K4EA 1ZG6A 5CTNA 4PM6A 5FQKA 3UE0A 2ZM2A 1NJ4A 4PMAA 2WAFA 5CEBA 4GN2A 5GLCA 4E3LA 1SDEA 3DWZA 5CHUA 3ZG7B 1PWCA 3AGDA 5FAPA 4DRTA 4OLDA 3DWKA 1L0DA 4JBFA 4X56A 1BTLA 3IWQA 3IWOA 4DE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXW A;  2VGJ A;  1BLP A;  2XK1 A;  3IF5 A;  3HLE A;  1JWZ A;  1G6A A;  4FH2 A;  4BQM A;  4P85 A;  2WKE A;  4IED A;  2ZC4 B;  4K0W A;  4U0T A;  4PM9 A;  2A49 A;  5DF7 A;  3LCE A;  1BLS A;  2ZC6 B;  3S4X A;  1TDL A;  2Y2N A;  1LL5 A;  3HL9 A;  3BYD A;  4OLG A;  3SH8 A;  4E3O A;  2WAE A;  3A3I A;  1KVL A;  1FOF A;  1FCN A;  4K91 A;  1IYP A;  1FR6 A;  2XD1 A;  5JYO A;  1K6S A;  2GDN A;  4QD4 A;  3EQU A;  2HP9 A;  5CED A;  4Y7P A;  4GOG A;  3C7U A;  3IHA A;  2EX2 A;  1E3U D;  1ES4 A;  2HDQ A;  3GR2 A;  4E3I A;  1K57 C;  3HUN A;  2WZX A;  3ZHH A;  5TR7 A;  4KZ7 A;  3NC8 A;  5TGF A;  3UNW A;  1M6K A;  3PBT A;  3VP3 A;  1XP4 A;  2J9O A;  3N8S A;  5FI2 A;  2PU4 A;  5CTM A;  5HAI A;  3DTM A;  4JF5 A;  4OVD A;  4QU3 A;  4X68 A;  3BFD A;  2OV5 A;  1ERO A;  4MLL A;  4RX3 A;  4IBR A;  4S2M A;  1ONG A;  1QME A;  2E8I A;  1L0G A;  4E3J A;  1CK3 A;  2UWX A;  1ERM A;  1MY8 A;  1DJB A;  4WBG A;  4Z9Q A;  1BZA A;  1VM1 A;  3HUM A;  5GHX A;  4E3N A;  4E3M A;  3AGF A;  2OLV A;  3SS4 A;  3W4Q A;  5FQJ A;  3HLG A;  1XXM A;  4Q8I A;  1IKG A;  1XA1 A;  4DE0 A;  4PM7 A;  3PBO A;  4KG6 A;  2J7V A;  3HBR A;  3MKF A;  1K55 C;  1S0W A;  2WKI A;  4MBH A;  4DE3 A;  1TVF A;  3ZG9 B;  2OLU A;  2ZQ9 A;  1CI9 A;  1FQG A;  4N9L A;  5AQ9 A;  1H5X A;  4ZJ2 A;  4JKT A;  2EFX A;  3G30 A;  3G2Z A;  4Y0T A;  3ZVW A;  4UA7 A;  3IXH A;  3MZF A;  2P74 A;  3ZNT A;  5M18 A;  4NK3 A;  2JBF A;  1WYB A;  3MXR A;  4S2K A;  4S2I A;  5F1F A;  3E2L A;  1IYS A;  5CRF A;  1RGZ A;  2WUQ A;  1BUL A;  2C6W B;  1YLJ A;  3G4P A;  5CGW A;  5HW3 A;  3Q82 A;  2XR0 A;  5GLA A;  1LLB A;  3FKW A;  1E4D A;  2Y2J A;  3NBL A;  3MZE A;  1KGF A;  1RP5 A;  2ZC3 B;  5EVI C;  3IF6 C;  1PWG A;  4WMC D;  4CJN A;  4D2O A;  3V50 A;  2WGW B;  1MKI A;  1ES5 A;  1QMF A;  4ID4 A;  1K6R A;  1OME A;  5FQQ A;  3GVB A;  4UAA A;  5AQB A;  2Y55 A;  5HL1 A;  2XFT A;  1ZC2 A;  2XLN A;  2WZZ A;  3OPR A;  4JLF A;  5FAS A;  4X69 A;  3VFH A;  3Q7V A;  4K0X A;  3TG9 A;  3MXS A;  2Y91 A;  3NCK A;  3IWI A;  3VFF A;  2Y2K A;  1ESI A;  5M1A A;  3SH7 A;  2EX8 A;  3O87 A;  1W79 A;  3FZC A;  4WM9 A;  3ITB A;  3IT9 A;  5DTK A;  1MWU A;  2DRW A;  5KSC A;  1MWR A;  2EX6 A;  4GD6 A;  4X55 A;  1HZO A;  1PW1 A;  3WS2 A;  4UA6 A;  5IHV A;  4KZ5 A;  2Y2M A;  5KSH A;  4O7D A;  1J9M A;  3G34 A;  1CEG A;  2HP6 A;  1JTG A;  5FI7 A;  5F83 A;  4BD0 A;  1SCW A;  4WEK A;  5A93 A;  5HAQ A;  3LO7 A;  4N1X A;  4ZJ3 A;  3VP4 A;  4OP8 A;  3UPO A;  2P9V B;  1IEL A;  3VP0 A;  4Y0O A;  5J8X A;  3CZD A;  3PAG A;  2ZJ9 A;  2X01 A;  5DVA A;  1YT4 A;  3BM6 A;  5L2F A;  4S2O A;  1FCM A;  3IXG A;  3UDI A;  4JXV A;  1BT5 A;  4DF6 A;  2WAD A;  1RGY A;  3ZFZ A;  5CGX A;  1IYQ A;  2H10 A;  4P6B A;  5FA7 A;  3BFC A;  2FFY A;  4L0L A;  1FSW A;  1ES2 A;  3MKE A;  3GMW A;  4N92 A;  4DXC A;  1JWP A;  2ZM8 A;  4GZB A;  2B5R A;  3UO9 A;  3M2K A;  1YLZ A;  4NET A;  1E3U A;  3OZH A;  5FAQ A;  2WGI A;  1K38 A;  5DF9 A;  1YM1 A;  1LI9 A;  1TDG A;  1ZG4 A;  4ZJ1 A;  3C4P A;  3HLD A;  4FH4 A;  4RX2 A;  3BFE A;  3HVF A;  4KZ3 A;  3RXW A;  4QY6 A;  3ZVT A;  4UA9 A;  3BRM A;  4CPK A;  3Q07 A;  1NRF A;  1SHV A;  1W5D A;  4YFM A;  5EOO A;  1O7E A;  5HFO A;  3TSG A;  5A92 A;  4JPM A;  3WS4 A;  3ZG0 A;  5CHJ A;  1YLY A;  2PU2 A;  3C7V A;  5FQI A;  1GHM A;  5F82 A;  4UHU A;  5EOE A;  2HDU A;  3ZG5 A;  3HLF A;  2JE5 A;  1PZP A;  1EI5 A;  4LV1 A;  5EVL A;  3RXX A;  2G2W A;  1K54 A;  2DCF A;  1C3B A;  2EX9 A;  3V3S A;  4FCF A;  5GLD A;  4KZ6 A;  3ZGA B;  1NYY A;  2Y2O A;  2HP5 A;  3M2J A;  4KQQ A;  4IVK A;  3S1Y A;  3WS0 A;  4EUZ A;  1YLP A;  4WEL A;  3PBS A;  2ZQC A;  3VOZ A;  4GDB A;  1K4F A;  4ZTK A;  3VMA A;  2DNS A;  4HBU A;  5FDH A;  3UN7 A;  1HVB A;  1XGI A;  4QB8 A;  1CEF A;  1ES3 A;  3LEZ A;  3O3V A;  3UDF A;  1NZO A;  4DE2 A;  3Q1F A;  4GB7 A;  5EVI B;  3IF6 B;  3M6B A;  4B4Z A;  4OPZ A;  4X53 A;  4WMC A;  1KDW A;  2ZQ7 A;  3GSG A;  1MXO A;  1PW8 A;  3LY4 A;  3PTE A;  2FFF B;  4C3Q A;  3UPP A;  3BFG A;  4B88 A;  3C5A A;  5CHM A;  1YMX A;  4E6X A;  5CGS A;  1M40 A;  4BLM A;  3MFD A;  3ZG8 B;  2CC1 A;  3BLS A;  2Y2P A;  5KMW A;  4OPQ A;  4EBN A;  3GTC A;  2HDR A;  2JCH A;  1RCJ A;  4LCM A;  4GKU A;  3FWL A;  4GNU A;  5U47 A;  1N9B A;  3OCN A;  2XGN A;  1BLC A;  2H5S A;  3EQV A;  3N8R A;  1KDS A;  3BEC A;  1KVM A;  1ONH A;  1Z6F A;  5E2F A;  4LEN A;  4JXS A;  4WYY A;  1H8Z A;  3E2K A;  1BLH A;  2QMI A;  4MBK A;  3UY6 A;  3CMZ A;  1H8Y A;  4OOM A;  1G68 A;  3IXB A;  1SKF A;  3ZCZ A;  5M19 A;  1LL9 A;  2VGK A;  1XX2 A;  3OPP A;  4MEZ A;  2R9W A;  1K25 A;  2RCX A;  4KG2 A;  5GHZ A;  1Q2P A;  3VSK A;  4N1H A;  1CI8 A;  2Y4A A;  3NIA A;  5JYP A;  3MBZ A;  3WRT A;  4N9K A;  3IHB A;  3O86 A;  2IWB A;  3IXD A;  1IYO A;  5F1G A;  4XUX A;  1WE4 A;  3O88 A;  3A3E A;  4OOL A;  3V39 A;  1L0E A;  2EXB A;  1JTD A;  4A5R A;  3G2Y A;  4S2N A;  3ISG A;  2Y2I A;  4BEN A;  3N6I A;  4IBX A;  3OC2 A;  1VQQ A;  4Y0U A;  3HLC A;  2XFS A;  2Q9N A;  1KE0 A;  2R9X A;  2WK0 A;  2QPN A;  4R4R A;  2Y2H A;  1PYY A;  3UPN A;  4S2L A;  1KGG A;  1HTZ A;  4B4X A;  2XQZ A;  1GHI A;  4P87 A;  4KQR A;  1NYM A;  2IWD A;  1MWT A;  4MNR A;  5EEC A;  3N8L A;  4U0X A;  4EQI A;  5BOH A;  3W8K A;  4JXG A;  4KZA A;  1ZKJ A;  5TFQ A;  1XGJ A;  3WS1 A;  1BSG A;  1ESU A;  3W4P A;  1KE3 A;  4C75 A;  1DJA A;  3NDG A;  3V3R A;  2PBY A;  4YIN A;  4HES A;  4U3T A;  2EFU A;  4EWF A;  3CJM A;  2WKH A;  4OQI A;  4QJG A;  2BG1 A;  5EVI D;  4RYE A;  3UDX A;  2A3U A;  5E2E A;  3G35 A;  3GV9 A;  3GQZ A;  2WGW A;  5FAT A;  3HUO A;  4BD1 A;  5EE8 A;  4WZ5 A;  1NY0 A;  5FI6 A;  1K56 D;  1MBL A;  4E6W A;  3A3F A;  3NI9 A;  2C5W B;  4OKP A;  3OPH A;  1PIO A;  2Z2M B;  5FQ9 A;  3G32 A;  1S6R A;  4M3K A;  5EPH A;  4PM5 A;  3N4I A;  4KQO A;  1MPL A;  4OH0 A;  2XD5 A;  1K54 C;  3NY4 A;  4GD8 A;  1GA0 A;  4JF4 A;  4WZ4 A;  4JXW A;  3BLM A;  5HAR A;  4OON A;  5EUA A;  2RL3 A;  4PPR A;  1IKI A;  1W8Q A;  5G18 A;  3N7W A;  1PI5 A;  1U60 A;  3NDE A;  2Y2L A;  1PI4 A;  5DTT A;  1Q2Q A;  1XA7 A;  5GHY A;  1NXY A;  2P9V A;  4KZ9 A;  4LV0 A;  4R1G A;  4S2P A;  1YMS A;  3QNB A;  1O07 A;  4QHC A;  3JYI A;  2J8Y A;  2ZM0 A;  3VSL A;  1MWS A;  4KZB A;  2QZ6 A;  4H8R A;  1HD8 A;  3C4O A;  2Y59 A;  3HLB A;  2XH9 A;  4BJP A;  4HBT A;  4WEJ A;  3QNC A;  1WYC A;  4LV2 A;  5FAO A;  4F94 A;  4OPR A;  2BLS A;  2ZMA A;  3S22 A;  4EBL A;  4PM8 A;  3Q7V B;  2ZC5 B;  5DF8 A;  3HRE A;  3GRJ A;  4DDS A;  2OSU A;  1K57 A;  4ZBE A;  4R4S A;  1XKZ A;  2V20 A;  1ERQ A;  1KGE A;  2Q9M A;  1KE4 A;  2XEP A;  3DW0 A;  3P98 A;  4LCL A;  3UE3 A;  2ZQA A;  2X71 A;  5AQ7 A;  1FSY A;  1GA9 A;  3A3D A;  2V1Z A;  1L0F A;  1YLT A;  2HDS A;  2H0Y A;  2ZC7 A;  3IH8 A;  3P09 A;  4EV4 A;  4OQG A;  3PBN A;  5E43 A;  3V5M A;  5D3O A;  4R3J A;  4FSF A;  4BL3 A;  3SS5 A;  1LHY A;  3TOI A;  1E25 A;  5HX9 A;  4OQH A;  5GLB A;  5HAP A;  1Y54 A;  4R23 A;  5A90 A;  2Y2Q A;  2ZLY A;  2HPB A;  1W8Y A;  4DXB A;  1L2S A;  2H0T A;  3ITA A;  4ZDX A;  1JVJ A;  3Q7Z A;  1FCO A;  1XPB A;  2X02 A;  1I2S A;  2J9P A;  3SH9 A;  3UE1 A;  3QHY A;  4KZ4 A;  4R0Q A;  4GDN A;  4XXR A;  4DKI A;  1K55 A;  4EBP A;  4XUZ A;  3I7J A;  3ZNY A;  4DDY A;  1PWD A;  1TEM A;  1DY6 A;  1PZO A;  3AGE A;  5E2H A;  4P0M A;  5A91 A;  3Q81 A;  4RA7 A;  4S2N C;  4OPY A;  5CEC A;  2I72 A;  1BUE A;  1FR1 A;  3FKV A;  3FV7 A;  3IQA A;  3ZDJ A;  2V2F F;  3WWX A;  2XF3 A;  1JWV A;  3HLW A;  1SDN A;  1YQS A;  2WGV A;  3M6H A;  4R3B A;  1I5Q A;  2JC7 A;  1GCE A;  1GHP A;  3VOY A;  2ZQD A;  3D4F A;  4KEN B;  5GL9 A;  2IWC A;  4OP5 A;  1ALQ A;  5DTS A;  4C6Y A;  1LI0 A;  1EWZ A;  1YLW A;  3PAE A;  3W4O A;  2ZQ8 A;  3OPL A;  5EVI A;  4MBF A;  3IF6 A;  3CG5 A;  3LY3 A;  2WYX A;  2XDM A;  3RJU A;  3PBR A;  3VP2 A;  4ZAM A;  4X6T A;  5FSR A;  4FD8 A;  1DJC A;  4BL2 A;  1K56 A;  1N4O A;  3BFF A;  4LV3 A;  4OQ0 A;  4OOY A;  3PBQ A;  4HEF A;  3SS3 A;  3WS5 A;  1W7F A;  3G31 A;  5E2G A;  4QY5 A;  3VP1 A;  3SOI A;  3WRZ A;  1AXB A;  1IEM A;  3IH9 A;  4S2J A;  2Z2L B;  3MZD A;  3B3X A;  2EXA A;  2Y2G A;  4RVA A;  3BEB A;  4WZ5 C;  1NZU A;  5I94 A;  3A3J A;  5KZH A;  2G2U A;  4E3K A;  3FYZ A;  5FQM A;  1I2W A;  2ZD8 A;  4IVI A;  4KZ8 A;  4KG5 A;  5AQA A;  4JF6 A;  5CER A;  3OCL A;  1K4E A;  1ZG6 A;  5CTN A;  4PM6 A;  5FQK A;  3UE0 A;  2ZM2 A;  1NJ4 A;  4PMA A;  2WAF A;  5CEB A;  4GN2 A;  5GLC A;  4E3L A;  1SDE A;  3DWZ A;  5CHU A;  3ZG7 B;  1PWC A;  3AGD A;  5FAP A;  4DRT A;  4OLD A;  3DWK A;  1L0D A;  4JBF A;  4X56 A;  1BTL A;  3IWQ A;  3IWO A;  4DE1 A; 
#chains in the Genus database with same CATH topology
 4GS9 B;  1G6A A;  3RH8 B;  2WKE A;  1S1Z A;  3MJQ A;  3VE4 A;  4X1M A;  3OLO A;  3KYE A;  3S4X A;  3HL9 A;  4OLG A;  2D02 A;  3SH8 A;  3OOV A;  4CLC A;  4MCW A;  1FR6 A;  4BWI A;  1JNU A;  4Q0H A;  3EQU A;  4Y7P A;  4EW7 A;  4F3L A;  3C7U A;  1TS8 A;  4Z1W A;  1ES4 A;  4E3I A;  1K57 C;  3ZHH A;  3PHY A;  1PNE A;  5HZH A;  1DP8 A;  3T1S A;  2J9O A;  3DTM A;  4X68 A;  1ERO A;  1L0G A;  1CK3 A;  1OTA A;  4WBG A;  4Z9Q A;  1DJB A;  4E3N A;  1BZA A;  1VM1 A;  5GHX A;  1XXM A;  1XA1 A;  1LT0 A;  4PM7 A;  2W1R A;  2VV7 A;  3MKF A;  4MBH A;  2PD7 A;  3NHQ A;  1CI9 A;  2EFX A;  1LSV A;  3B33 A;  4UA7 A;  5M18 A;  4NK3 A;  3MXR A;  1WYB A;  4DJ2 A;  5FL3 A;  1YLJ A;  3F1O B;  5GLA A;  2J3T C;  3FKW A;  2HV1 A;  3TRC A;  2OAP 1;  2Y2J A;  1RP5 A;  3IF6 C;  3LEQ A;  4ID4 A;  1V9Z A;  3LIC A;  4UAA A;  2Y55 A;  2XFT A;  1ZC2 A;  2WZZ A;  1MC0 A;  3IS2 B;  3VFH A;  3TG9 A;  3F1N B;  1ESI A;  1YPR A;  3SH7 A;  2EX8 A;  3E4Q A;  1W79 A;  5DTK A;  4WM9 A;  3ITB A;  3CLO A;  4NXB A;  2DRW A;  2P7J A;  3HJI A;  4UA6 A;  5IHV A;  4HH3 A;  4O7D A;  3G34 A;  2HP6 A;  2LB9 A;  4BD0 A;  1SCW A;  5HAQ A;  3LO7 A;  4I3J A;  3UPO A;  2P9V B;  1IEL A;  2O99 A;  4R70 A;  3PAG A;  2ZJ9 A;  5DVA A;  3BM6 A;  3EEH A;  4S2O A;  2QWS A;  4I38 A;  3UDI A;  1CQA A;  4DF6 A;  2H10 A;  3LIB A;  1S4S A;  5IT5 A;  2FFY A;  4N92 A;  4DXC A;  3GMW A;  1JWP A;  2ZM8 A;  3OZH A;  5FAQ A;  5DF9 A;  4LLO B;  1LI9 A;  4HY8 A;  3K2N A;  5DFY A;  3HVF A;  3FG8 A;  5HD5 A;  5HFO A;  4II7 A;  5A92 A;  4JPM A;  3WS4 A;  5CHJ A;  1GHM A;  3A0V A;  4UHU A;  2YKF A;  3ZG5 A;  3HLF A;  3F1P A;  3RXX A;  3ZGA B;  4IVK A;  2VK3 A;  3S1Y A;  3PBS A;  2ZQC A;  5HDC A;  1K4F A;  2OOL A;  3VMA A;  2DNS A;  3UN7 A;  2A2L A;  4EU0 A;  3LEZ A;  1ES3 A;  3O3V A;  4FTX A;  1NZO A;  2HJE A;  3E98 A;  3MQO A;  5EVI B;  4X53 A;  2NUT C;  1KDW A;  3LY4 A;  4MN5 A;  3KO6 A;  4I3A A;  3UPP A;  3C5A A;  5CHM A;  3U2A A;  1M40 A;  3CIT A;  5EM1 A;  3CWF A;  2JCH A;  4LCM A;  3H9W A;  3MQQ A;  1KVM A;  4LEN A;  3O5Y A;  4JXS A;  4BBT A;  4G3V A;  3UY6 A;  3CMZ A;  1H8Y A;  3ZCZ A;  1XX2 A;  1TF1 A;  2RCX A;  1CI8 A;  2Y4A A;  3WRT A;  4N9K A;  3IHB A;  5F1G A;  1WE4 A;  3O88 A;  4A5R A;  4LPZ A;  4S2N A;  4UQI M;  2V0W A;  4Y0U A;  1P9W A;  3KYQ A;  1TS6 A;  2QPN A;  4S2L A;  4P87 A;  5EEC A;  3N8L A;  3NOU C;  5TFQ A;  5J7E A;  2HJ9 C;  3UME A;  3LUQ A;  2PBY A;  2J3T D;  4ESP A;  4U3T A;  4EWF A;  2PT7 A;  3CJM A;  4QJG A;  3UDX A;  2WKP A;  3GV9 A;  4BD1 A;  3HUO A;  1D7E A;  3L9K A;  3DTE A;  5FI6 A;  1MBL A;  3A3F A;  2VA0 A;  2C5W B;  3MFX A;  5A8B A;  1PIO A;  1VEU A;  3G32 A;  4PKY G;  4M3K A;  1P9R A;  2XD5 A;  3NY4 A;  4LRZ E;  4OON A;  4B9O A;  4PPR A;  1W8Q A;  3A0R A;  2GNX A;  3QP6 A;  3NDE A;  3IX3 A;  1PI4 A;  5DTT A;  1Q2Q A;  1NXY A;  4KZ9 A;  4LV0 A;  4S2P A;  5F5Y A;  3JYI A;  2Y59 A;  2KOI A;  3E0Y A;  3HLB A;  2XH9 A;  3QNC A;  4OPR A;  2BLS A;  1P0Z A;  3GRJ A;  3G6O A;  4ZAM A;  2XEP A;  1KE4 A;  3UE3 A;  2X71 A;  1FSY A;  1GA9 A;  4FUW A;  3A3D A;  2ZC7 A;  5E43 A;  5F6A A;  4GCZ A;  1T18 A;  1TS0 A;  1LHY A;  3IBJ A;  1YKD A;  2ZLY A;  4EQ1 A;  1OPX A;  4ZDX A;  1FCO A;  4KZ4 A;  4R0Q A;  4XXR A;  5K5B A;  1FIK A;  1PWD A;  2VKS A;  2EA9 A;  1DY6 A;  1PZO A;  3AGE A;  4P0M A;  3Q81 A;  2EWV A;  4L9G A;  4OPY A;  1FR1 A;  3FV7 A;  3R7W B;  3HLW A;  4D60 A;  2W1T B;  2JC7 A;  1GCE A;  3VOY A;  3D4F A;  5GL9 A;  3EOI A;  5HD3 A;  3A0S A;  2Y79 A;  2ZQ8 A;  3OPL A;  3IX8 A;  4MBF A;  1GSV A;  3LY3 A;  3VP2 A;  3LGO A;  4X6T A;  2PAV P;  1G28 A;  1NLY A;  4LV3 A;  4OOY A;  3WRZ A;  2VEA A;  4QWO A;  2Z2L B;  3DAV A;  2P08 A;  3BEB A;  2G2U A;  4YOF A;  1I2W A;  4KZ8 A;  1ZG6 A;  5CEB A;  4GN2 A;  4E3L A;  1V9Y A;  3DWZ A;  5EV0 A;  5FAP A;  4EUV A;  4JBF A;  5TBM B;  2XK1 A;  4NXE A;  1JWZ A;  4BQM A;  2K2N A;  1D1J A;  4K0W A;  4U0T A;  5L8M A;  2Z6D A;  1BLS A;  2ZC6 B;  2W3E A;  1TDL A;  1LL5 A;  5DJT A;  2WAE A;  4IUK A;  5L10 A;  4K91 A;  4G3W A;  3LFV A;  3LI8 A;  1E3U D;  3GR2 A;  3JVV A;  1P97 A;  1Y28 A;  2WZX A;  2O9B A;  5TR7 A;  5TGF A;  3PBT A;  3VP3 A;  5FI2 A;  5CTM A;  3E4O A;  3TW8 A;  3BFD A;  4RX3 A;  4IBR A;  4S2M A;  1ONG A;  1QME A;  2E8I A;  1MY8 A;  2JKR I;  3HUM A;  3P01 A;  4HP4 A;  2OLV A;  3SS4 A;  3W4Q A;  4LFU A;  1W63 M;  2J7V A;  3HBR A;  1K55 C;  5HWT A;  1YSQ A;  3CAX A;  2OLU A;  3T4J A;  4ZJ2 A;  1XFN A;  2P74 A;  4S2K A;  3E2L A;  3LIA A;  2Q0O A;  2WUQ A;  5CGW A;  5HW3 A;  5G4Y A;  1LLB A;  3NBL A;  1KGF A;  4CJN A;  1L3L A;  1QMF A;  1H8M A;  1OME A;  5FQQ A;  5HL1 A;  3LYX A;  4K0X A;  3IWI A;  3VFF A;  1Y4O A;  5LBR A;  3IT9 A;  1MWR A;  2VZW A;  4GD6 A;  4JGP A;  1HZO A;  3WS2 A;  1CEG A;  2D01 A;  2L0W A;  4O8G A;  5FI7 A;  2JKT I;  3VP4 A;  4NEE D;  3VP0 A;  4Y0O A;  5J8X A;  1YT4 A;  2JKF A;  1FCM A;  3IXG A;  4JXV A;  1VET B;  4O01 A;  4HJ4 A;  3ZFZ A;  1IYQ A;  3BFC A;  1FSW A;  1ES2 A;  3MKE A;  4GZB A;  1SZV A;  2WGI A;  1YM1 A;  4CLC C;  2W27 A;  1OJG A;  4FH4 A;  1LSW A;  4RX2 A;  4QY6 A;  1T1A A;  4UA9 A;  3Q07 A;  1O7E A;  4Y15 A;  3TSG A;  1F5M A;  3C7V A;  3HCY A;  3E4P A;  2HDU A;  2JE5 A;  3NJA A;  1EI5 A;  1K54 A;  2DCF A;  2EX9 A;  3V3S A;  4KZ6 A;  1XJ6 A;  3VOZ A;  3T4S A;  1XGI A;  3CPT B;  4EEU A;  1UGU A;  3Q1F A;  4XT2 A;  4P6Z S;  3IF6 B;  3M6B A;  3NEC A;  4WMC A;  4GS9 A;  3P7N A;  3GSG A;  1PW8 A;  2FFF B;  2L1M A;  4EEP A;  5CGS A;  4BLM A;  3ZG8 B;  2CC1 A;  5TJJ A;  5KMW A;  5L09 A;  4EBN A;  3T4L A;  3FWL A;  4YWZ A;  2XGN A;  1BLC A;  3N8R A;  4HP9 A;  1ONH A;  5E2F A;  4Q0J A;  3UB5 P;  1H8Z A;  2KX6 A;  2QMI A;  1VHM A;  4DN0 A;  1N9O A;  4OOM A;  1SKF A;  4MEZ A;  1OTI A;  3LIF A;  3VSK A;  5JYP A;  4Y3I A;  2IWB A;  5HPI A;  3IXD A;  1IYO A;  3V39 A;  3DTI A;  4OOL A;  5HWV A;  5F69 A;  1LSX A;  2M1C A;  2Y2I A;  3OC2 A;  3MR0 A;  2BAS A;  3LIE A;  1KGG A;  4KQR A;  1NYM A;  2IWD A;  1MWT A;  4MNR A;  4EQI A;  4JXG A;  3T1R A;  1XGJ A;  3LR0 A;  3F1P B;  1ODV A;  3T50 A;  1K0K A;  3W4P A;  5HWW A;  3BY9 A;  3F1O A;  5EM0 A;  4HES A;  3T4T A;  1GSX A;  2WKH A;  2A3U A;  2YKH A;  3G35 A;  5FAT A;  1XJ4 A;  1YAX A;  1NY0 A;  3NOP C;  4H6J B;  2XRN A;  4L9F A;  3IS2 A;  4HQA A;  3F1N A;  1S6R A;  2PDR A;  1MPL A;  3MSH A;  3BJN A;  4JF4 A;  3VE3 A;  4UEY A;  2RL3 A;  3ICY A;  1IKI A;  1UWN X;  4KUO A;  4EES A;  3BY8 A;  1WA9 A;  2Y2L A;  2P9V A;  4CQH A;  3QNB A;  1LL8 A;  1O07 A;  4KZB A;  1FIL A;  1WYC A;  2WKR A;  4PM8 A;  3PXP A;  2LB5 A;  3Q7V B;  4JGO A;  3MS6 A;  3HRE A;  3UB9 A;  4DDS A;  2OSU A;  4ZBE A;  4R4S A;  3P98 A;  3DW0 A;  2Q9M A;  3GDI A;  2ZL1 B;  2K31 A;  2PRF A;  4CLC D;  3D72 A;  4EV4 A;  2H0Y A;  3KSG A;  3P09 A;  2GJ3 A;  4R3J A;  4BL3 A;  3SW1 A;  2QJ5 A;  4R23 A;  3GEC A;  2Y2Q A;  2HPB A;  1IFQ A;  4DXB A;  3B42 A;  4JGQ A;  3Q7Z A;  1I2S A;  2J9P A;  4NKP A;  3UE1 A;  4DKI A;  4O0P A;  3I7J A;  4DDY A;  1OT6 A;  1MKM A;  3LID A;  4S2N C;  5CEC A;  2I72 A;  1BUE A;  3K3C A;  3FKV A;  3IQA A;  4HI4 A;  4MMN A;  2ZMV A;  2WGV A;  4CLC E;  3M6H A;  1GHP A;  2ZQD A;  4KEN B;  2ACG A;  2IWC A;  4C6Y A;  1LI0 A;  3PAE A;  3QP1 A;  5EVI A;  5AVF A;  1H3Q A;  3QP2 A;  2XDM A;  3RJU A;  3PBR A;  2ZOI A;  5FSR A;  1DJC A;  3CUE A;  1K56 A;  1N4O A;  3SS3 A;  4HEF A;  3SZT A;  1ACF A;  1IEM A;  3UE6 A;  3MZD A;  2W3D A;  2QJ7 A;  2Y2G A;  3A3J A;  2PYR A;  4QPR A;  4JF6 A;  1K4E A;  3B47 A;  4PM6 A;  3MF0 A;  2WAF A;  2DMW A;  1PWC A;  3H7W B;  4OLD A;  3DWK A;  1L0D A;  4X56 A;  1BTL A;  3UB7 A;  4DE1 A;  1PFL A;  1BLP A;  3IF5 A;  4FH2 A;  2VV6 A;  4IED A;  4PM9 A;  2A49 A;  3LCE A;  2KDK A;  1DRM A;  3EEA A;  2Y2N A;  1CF0 A;  3A3I A;  1KVL A;  1FOF A;  1IYP A;  4EET B;  2WKQ A;  4LRX C;  4QD4 A;  2HP9 A;  2R78 A;  5CED A;  4GOG A;  5I5L A;  3IHA A;  4BBV A;  2OAQ 1;  2HDQ A;  3HUN A;  4KZ7 A;  1M6K A;  2E8J A;  3N8S A;  2PU4 A;  5HAI A;  4JF5 A;  2OV5 A;  2OWJ A;  2I9V A;  4E3M A;  5HSQ A;  3AGF A;  3LI9 A;  5FQJ A;  3H82 B;  4Y2F A;  4DE0 A;  2EWW A;  3PBO A;  5FEF A;  3ZG9 B;  4B93 A;  3BQ8 A;  2ZQ9 A;  1FQG A;  1XFQ A;  5AQ9 A;  1H5X A;  4DJ3 A;  3CI6 A;  3G2Z A;  4KQD A;  3ZVW A;  3IXH A;  3ZNT A;  2JBF A;  5CRF A;  1RGZ A;  1BUL A;  2C6W B;  3Q82 A;  2XR0 A;  1E4D A;  1YSP A;  1PWG A;  5HDS A;  4D2O A;  3L7H A;  4PHT A;  2WGW B;  1MKI A;  3V50 A;  1ES5 A;  2A24 B;  4LRY C;  4JLF A;  4X69 A;  3MXS A;  2Y91 A;  3NCK A;  1H0M A;  3TJZ C;  5KSC A;  1BYW A;  1SKO B;  1PW1 A;  2O9A A;  1J9M A;  4EXO A;  3FC7 A;  3VOL A;  2HF6 A;  5F83 A;  5A93 A;  2AVX A;  4WEK A;  3LR3 A;  4N1X A;  4GHI B;  4OP8 A;  4DMZ A;  1HLU P;  3CZD A;  2X01 A;  5L2F A;  3QP8 A;  1BT5 A;  2WAD A;  4ARZ B;  2XA7 S;  5CGX A;  4P6B A;  2B5R A;  3UO9 A;  2L4R A;  3R7W A;  4ME4 A;  2W1T A;  1TDG A;  1ZG4 A;  4ZJ1 A;  3C4P A;  4CPK A;  3BRM A;  4GJ4 A;  1NRF A;  4YFM A;  1ZHH B;  3ZG0 A;  1YLY A;  2PU2 A;  5FQI A;  2VJW A;  4LV1 A;  2G2W A;  2KLI A;  2W3F A;  1C3B A;  5GLD A;  5EFW A;  1NYY A;  2Y2O A;  3M2J A;  4KQQ A;  4EUZ A;  4WEL A;  1S66 L;  4GDB A;  4HIA A;  3C2W A;  4ZTK A;  4HBU A;  5FDH A;  1HVB A;  4QB8 A;  2FZ0 A;  4DE2 A;  2HZ5 A;  4B4Z A;  5TBM A;  1MXO A;  4K08 A;  3PTE A;  5L07 A;  1OT9 A;  4ETZ A;  1YMX A;  4I5S A;  2JKR M;  4E6X A;  1OTD A;  1IOU A;  2Y2P A;  3GTC A;  2HDR A;  1RCJ A;  3EWK A;  4GNU A;  1N9B A;  2W3G A;  1G6O A;  4NXF A;  4WYY A;  3E2K A;  4R3A A;  4MBK A;  2FH5 A;  3IXB A;  5HL6 A;  1LL9 A;  2VGK A;  2R9W A;  4JGR A;  5GHZ A;  1Q2P A;  4UQI S;  1D06 A;  3MBZ A;  3MXQ A;  4Y17 A;  1L0E A;  1JTD A;  1EW0 A;  1VQQ A;  3HLC A;  2XFS A;  1KE0 A;  5J4E A;  4CLC B;  2WK0 A;  4R4R A;  3T1X A;  4L9E A;  5J3W A;  4WN5 A;  4PAU A;  1HTZ A;  4F3L B;  3FPW A;  5BOH A;  3EGD C;  5F68 A;  3UB6 A;  3QP4 A;  4KZA A;  1ZKJ A;  3LR4 A;  1ESU A;  1KE3 A;  3NDG A;  2M7U A;  1J3W A;  1S1Y A;  2JKT M;  2O9C A;  3V67 A;  2BG1 A;  3PR6 A;  3GQZ A;  2XSS A;  4WZ5 A;  4MN7 A;  5EE8 A;  3KYZ A;  5FQ9 A;  5EPH A;  4OH0 A;  1K54 C;  3BLM A;  5HAR A;  3JVU A;  5EUA A;  5G18 A;  2O0Y A;  1PI5 A;  4I39 A;  1KOU A;  3T4Q A;  1U60 A;  3C30 A;  3R4K A;  1XA7 A;  1OTE A;  1MZU A;  1Z09 A;  4R1G A;  4WLA A;  1YMS A;  3TE8 A;  4Y5F A;  2ZM0 A;  1VET A;  1MWS A;  3D9Y A;  1HD8 A;  4HBT A;  4WEJ A;  2G7U A;  4LV2 A;  5FAO A;  4F94 A;  3S22 A;  4IUH A;  3RFB A;  3MMH A;  1K57 A;  4HJ6 A;  2UV0 E;  1XKZ A;  2V20 A;  3RXW A;  2ZQA A;  1L0F A;  2V1Z A;  3IH8 A;  3PBN A;  3V5M A;  5D3O A;  2M7V A;  1STZ A;  4FOF A;  5HX9 A;  4OQH A;  5HAP A;  1Y54 A;  4GW9 A;  4R6L A;  1L2S A;  2H0T A;  5EVE A;  5HPF A;  1JVJ A;  3QHY A;  4GDN A;  4EBP A;  3BW6 A;  3ZNY A;  3DBA A;  3VV4 A;  1XJ2 A;  1TEM A;  5CX7 A;  2ZOH A;  1N9N A;  3BWL A;  2V2F F;  1JWV A;  1SDN A;  4R3B A;  2OWH A;  3LR5 A;  1ALQ A;  1EWZ A;  1YLW A;  3CPT A;  1F2K A;  3IF6 A;  2WYX A;  2GZA A;  4I3I A;  3BFF A;  4OQ0 A;  4Q0I A;  3VP1 A;  4QY5 A;  1CJF A;  4M4X A;  3B3X A;  2EXA A;  2MJ6 A;  2XRO A;  5KZH A;  4E3K A;  1XJ3 A;  2V1B A;  5FQM A;  3FPV A;  1OTB A;  4KG5 A;  5CTN A;  2NUP C;  3UE0 A;  2Z6C A;  4PMA A;  5GLC A;  1SDE A;  5CHU A;  4EER A;  3ZG7 B;  2PR6 A;  3AGD A;  3C8C A;  3KSI A;  3CHW P;  2VV8 A;  5CXW A;  2VGJ A;  2VGL S;  2XA7 M;  3HLE A;  2VX8 A;  4P85 A;  2ZC4 B;  5DF7 A;  3EGX C;  3BYD A;  2V1A A;  4E3O A;  1FCN A;  2XD1 A;  5JYO A;  1K6S A;  2GDN A;  2B02 A;  2EX2 A;  4HJ3 A;  3NC8 A;  1T1B A;  3UNW A;  5DKL A;  1XP4 A;  2QHK A;  4OVD A;  4QU3 A;  4MLL A;  4E3J A;  2UWX A;  1ERM A;  3IBR A;  2PBD P;  4GLQ A;  3HLG A;  4Q8I A;  4H6J A;  2PR5 A;  1IKG A;  3C38 A;  4KG6 A;  4DE3 A;  2J3W A;  1S0W A;  2WKI A;  1TVF A;  4RQ9 A;  4N9L A;  4JKT A;  1TS7 A;  3G30 A;  4Y0T A;  1OJ5 A;  1TD5 A;  3MZF A;  5G4Z A;  1G5U A;  4S2I A;  5F1F A;  1IYS A;  1ZTU A;  3G4P A;  4BBU A;  3RTY A;  1UWP X;  3MZE A;  2ZC3 B;  5EVI C;  3NUL A;  4WMC D;  5DFX A;  1K6R A;  1DP6 A;  1T1C A;  3GVB A;  5AQB A;  4AFI A;  3CUE C;  2XLN A;  3OPR A;  5FAS A;  3Q7V A;  1VEU B;  2Y2K A;  5M1A A;  3O87 A;  3FZC A;  1DP9 A;  1MWU A;  2ZL1 A;  2JHE A;  2EX6 A;  4X55 A;  4KZ5 A;  2Y2M A;  5KSH A;  2GX5 A;  1JTG A;  2HGV A;  5MC7 A;  1S67 L;  4ZJ3 A;  3T4K A;  3S7P A;  5FEG A;  4G3K A;  4WF0 A;  1RGY A;  5FA7 A;  4L0L A;  3M2K A;  1YLZ A;  4NET A;  1E3U A;  1K38 A;  3HLD A;  3HJK A;  3BFE A;  2ZMF A;  5AVE A;  4KZ3 A;  3ZVT A;  1W63 Q;  2PD8 A;  4HH2 A;  1W5D A;  1SHV A;  5EOO A;  1T19 A;  5IS1 A;  5F82 A;  5EOE A;  1PZP A;  5EVL A;  4MN6 A;  1F9I A;  3S7N A;  4FCF A;  1GSW A;  2HP5 A;  3WS0 A;  1NLZ A;  1YLP A;  2VLG A;  4ZRR A;  1CEF A;  3H7W A;  1NRJ A;  1VB6 A;  3UDF A;  3UB8 A;  4GB7 A;  4OPZ A;  2ZQ7 A;  4C3Q A;  3BFG A;  4B88 A;  2JKG A;  4P6Z M;  3MFD A;  3BLS A;  4OPQ A;  1X0O A;  2BTF P;  4GKU A;  5U47 A;  4R38 A;  3OCN A;  2H5S A;  3EQV A;  1KDS A;  2JN7 A;  3BEC A;  1Z6F A;  5DKK A;  3ZQ5 A;  4HOI A;  4Y13 A;  2V8F A;  1BLH A;  2PHY A;  1G68 A;  5M19 A;  3OPP A;  1S4R A;  1K25 A;  4KG2 A;  2W3H A;  4IHQ A;  4N1H A;  3NIA A;  3O86 A;  4XUX A;  3A3E A;  2EXB A;  3T12 B;  3G2Y A;  3ZYT A;  2INW A;  2K7S A;  3ISG A;  3H82 A;  3W2Z A;  4BEN A;  3N6I A;  4IBX A;  3KSH A;  4ETX A;  2Q9N A;  1NWZ A;  2R9X A;  3BQA A;  5FDS A;  3UMD A;  2ZBB A;  2Y2H A;  1PYY A;  3UPN A;  3ULF A;  4B4X A;  2XQZ A;  1GHI A;  4U0X A;  3QP5 A;  2B18 A;  3W8K A;  4BMW A;  3S7O A;  3WS1 A;  1BSG A;  4C75 A;  5AJG A;  1DJA A;  3V3R A;  4YIN A;  2EFU A;  3K3D A;  5IU1 A;  4OQI A;  5EVI D;  3OBF A;  4RYE A;  4NG2 A;  4X1L A;  5E2E A;  2WGW A;  4NXG A;  5DJU A;  2A24 A;  2W0N A;  1K56 D;  4E6W A;  3NI9 A;  2CMN A;  4OKP A;  3OPH A;  2Z2M B;  4MDZ A;  4PM5 A;  3N4I A;  4KQO A;  4GD8 A;  4WL9 A;  1GA0 A;  4WZ4 A;  4JXW A;  1SKO A;  3N7W A;  2P04 A;  2VGL M;  2B95 A;  2QKP A;  5GHY A;  4GHI A;  1PRQ A;  3U4L P;  4QHC A;  2J8Y A;  3VSL A;  1F98 A;  2QZ6 A;  4H8R A;  3C4O A;  3KSF A;  4ARZ A;  4BJP A;  2V9A A;  2ZMA A;  4EBL A;  3JPU A;  2ZC5 B;  5DF8 A;  3NOT C;  3DTK A;  3T1Q B;  3T4O A;  1ERQ A;  1KGE A;  4LCL A;  5AQ7 A;  1YLT A;  2HDS A;  4OQG A;  4FSF A;  1N9L A;  2V0U A;  1A0K A;  3SS5 A;  3TOI A;  1E25 A;  2IA2 A;  5GLB A;  5A90 A;  3S7Q A;  1W8Y A;  3ITA A;  4X25 A;  5KIZ A;  1XPB A;  2X02 A;  3SH9 A;  1K55 A;  4XUZ A;  4HNB A;  3PYP A;  2J80 A;  4KUK A;  5E2H A;  5A91 A;  4RA7 A;  3ZDJ A;  3WWX A;  2XF3 A;  4IJG A;  1YQS A;  1I5Q A;  3MQ0 A;  2PYP A;  3KX0 X;  4E04 A;  4OP5 A;  5DTS A;  5HDD A;  3W4O A;  3CG5 A;  2QYB A;  4LGW A;  1AWI A;  4FD8 A;  4BL2 A;  2V8C A;  2Y8H A;  4YNR A;  3PBQ A;  3WS5 A;  1W7F A;  3G31 A;  5E2G A;  4HHD A;  3SOI A;  1AXB A;  5C5K A;  3IH9 A;  4S2J A;  3IX4 A;  4RVA A;  4WZ5 C;  5I94 A;  1NZU A;  3FYZ A;  4WUJ A;  4PKY A;  2ZD8 A;  4IVI A;  5AQA A;  5CER A;  3OCL A;  5FQK A;  2ZM2 A;  1NJ4 A;  3D3O A;  4DRT A;  2H28 A;  4XT2 B;  3IWQ A;  3IWO A; 
#chains in the Genus database with same CATH homology
 5CXW A;  2VGJ A;  1BLP A;  2XK1 A;  3IF5 A;  3HLE A;  1JWZ A;  1G6A A;  4FH2 A;  4BQM A;  4P85 A;  2WKE A;  4IED A;  2ZC4 B;  4K0W A;  4U0T A;  4PM9 A;  2A49 A;  5DF7 A;  3LCE A;  1BLS A;  2ZC6 B;  3S4X A;  1TDL A;  2Y2N A;  1LL5 A;  3HL9 A;  3BYD A;  4OLG A;  3SH8 A;  4E3O A;  2WAE A;  3A3I A;  1KVL A;  1FOF A;  1FCN A;  4K91 A;  1IYP A;  1FR6 A;  2XD1 A;  5JYO A;  1K6S A;  2GDN A;  4QD4 A;  3EQU A;  2HP9 A;  5CED A;  4Y7P A;  4GOG A;  3C7U A;  3IHA A;  2EX2 A;  1E3U D;  1ES4 A;  2HDQ A;  3GR2 A;  4E3I A;  1K57 C;  3HUN A;  2WZX A;  3ZHH A;  5TR7 A;  4KZ7 A;  3NC8 A;  5TGF A;  3UNW A;  1M6K A;  3PBT A;  3VP3 A;  1XP4 A;  2J9O A;  3N8S A;  5FI2 A;  2PU4 A;  5CTM A;  5HAI A;  3DTM A;  4JF5 A;  4OVD A;  4QU3 A;  4X68 A;  3BFD A;  2OV5 A;  1ERO A;  4MLL A;  4RX3 A;  4IBR A;  4S2M A;  1ONG A;  1QME A;  2E8I A;  1L0G A;  4E3J A;  1CK3 A;  2UWX A;  1ERM A;  1MY8 A;  1DJB A;  4WBG A;  4Z9Q A;  1BZA A;  1VM1 A;  3HUM A;  5GHX A;  4E3N A;  4E3M A;  3AGF A;  2OLV A;  3SS4 A;  3W4Q A;  5FQJ A;  3HLG A;  1XXM A;  4Q8I A;  1IKG A;  1XA1 A;  4DE0 A;  4PM7 A;  3PBO A;  4KG6 A;  2J7V A;  3HBR A;  3MKF A;  1K55 C;  1S0W A;  2WKI A;  4MBH A;  4DE3 A;  1TVF A;  3ZG9 B;  2OLU A;  2ZQ9 A;  1CI9 A;  1FQG A;  4N9L A;  5AQ9 A;  1H5X A;  4ZJ2 A;  4JKT A;  2EFX A;  3G30 A;  3G2Z A;  4Y0T A;  3ZVW A;  4UA7 A;  3IXH A;  3MZF A;  2P74 A;  3ZNT A;  5M18 A;  4NK3 A;  2JBF A;  1WYB A;  3MXR A;  4S2K A;  4S2I A;  5F1F A;  3E2L A;  1IYS A;  5CRF A;  1RGZ A;  2WUQ A;  1BUL A;  2C6W B;  1YLJ A;  3G4P A;  5CGW A;  5HW3 A;  3Q82 A;  2XR0 A;  5GLA A;  1LLB A;  3FKW A;  1E4D A;  2Y2J A;  3NBL A;  3MZE A;  1KGF A;  1RP5 A;  2ZC3 B;  5EVI C;  3IF6 C;  1PWG A;  4WMC D;  4CJN A;  4D2O A;  3V50 A;  2WGW B;  1MKI A;  1ES5 A;  1QMF A;  4ID4 A;  1K6R A;  1OME A;  5FQQ A;  3GVB A;  4UAA A;  5AQB A;  2Y55 A;  5HL1 A;  2XFT A;  1ZC2 A;  2XLN A;  2WZZ A;  3OPR A;  4JLF A;  5FAS A;  4X69 A;  3VFH A;  3Q7V A;  4K0X A;  3TG9 A;  3MXS A;  2Y91 A;  3NCK A;  3IWI A;  3VFF A;  2Y2K A;  1ESI A;  5M1A A;  3SH7 A;  2EX8 A;  3O87 A;  1W79 A;  3FZC A;  4WM9 A;  3ITB A;  3IT9 A;  5DTK A;  1MWU A;  2DRW A;  5KSC A;  1MWR A;  2EX6 A;  4GD6 A;  4X55 A;  1HZO A;  1PW1 A;  3WS2 A;  4UA6 A;  5IHV A;  4KZ5 A;  2Y2M A;  5KSH A;  4O7D A;  1J9M A;  3G34 A;  1CEG A;  2HP6 A;  1JTG A;  5FI7 A;  5F83 A;  4BD0 A;  1SCW A;  4WEK A;  5A93 A;  5HAQ A;  3LO7 A;  4N1X A;  4ZJ3 A;  3VP4 A;  4OP8 A;  3UPO A;  2P9V B;  1IEL A;  3VP0 A;  4Y0O A;  5J8X A;  3CZD A;  3PAG A;  2ZJ9 A;  2X01 A;  5DVA A;  1YT4 A;  3BM6 A;  5L2F A;  4S2O A;  1FCM A;  3IXG A;  3UDI A;  4JXV A;  1BT5 A;  4DF6 A;  2WAD A;  1RGY A;  3ZFZ A;  5CGX A;  1IYQ A;  2H10 A;  4P6B A;  5FA7 A;  3BFC A;  2FFY A;  4L0L A;  1FSW A;  1ES2 A;  3MKE A;  3GMW A;  4N92 A;  4DXC A;  1JWP A;  2ZM8 A;  4GZB A;  2B5R A;  3UO9 A;  3M2K A;  1YLZ A;  4NET A;  1E3U A;  3OZH A;  5FAQ A;  2WGI A;  1K38 A;  5DF9 A;  1YM1 A;  1LI9 A;  1TDG A;  1ZG4 A;  4ZJ1 A;  3C4P A;  3HLD A;  4FH4 A;  4RX2 A;  3BFE A;  3HVF A;  4KZ3 A;  3RXW A;  4QY6 A;  3ZVT A;  4UA9 A;  3BRM A;  4CPK A;  3Q07 A;  1NRF A;  1SHV A;  1W5D A;  4YFM A;  5EOO A;  1O7E A;  5HFO A;  3TSG A;  5A92 A;  4JPM A;  3WS4 A;  3ZG0 A;  5CHJ A;  1YLY A;  2PU2 A;  3C7V A;  5FQI A;  1GHM A;  5F82 A;  4UHU A;  5EOE A;  2HDU A;  3ZG5 A;  3HLF A;  2JE5 A;  1PZP A;  1EI5 A;  4LV1 A;  5EVL A;  3RXX A;  2G2W A;  1K54 A;  2DCF A;  1C3B A;  2EX9 A;  3V3S A;  4FCF A;  5GLD A;  4KZ6 A;  3ZGA B;  1NYY A;  2Y2O A;  2HP5 A;  3M2J A;  4KQQ A;  4IVK A;  3S1Y A;  3WS0 A;  4EUZ A;  1YLP A;  4WEL A;  3PBS A;  2ZQC A;  3VOZ A;  4GDB A;  1K4F A;  4ZTK A;  3VMA A;  2DNS A;  4HBU A;  5FDH A;  3UN7 A;  1HVB A;  1XGI A;  4QB8 A;  1CEF A;  1ES3 A;  3LEZ A;  3O3V A;  3UDF A;  1NZO A;  4DE2 A;  3Q1F A;  4GB7 A;  5EVI B;  3IF6 B;  3M6B A;  4B4Z A;  4OPZ A;  4X53 A;  4WMC A;  1KDW A;  2ZQ7 A;  3GSG A;  1MXO A;  1PW8 A;  3LY4 A;  3PTE A;  2FFF B;  4C3Q A;  3UPP A;  3BFG A;  4B88 A;  3C5A A;  5CHM A;  1YMX A;  4E6X A;  5CGS A;  1M40 A;  4BLM A;  3MFD A;  3ZG8 B;  2CC1 A;  3BLS A;  2Y2P A;  5KMW A;  4OPQ A;  4EBN A;  3GTC A;  2HDR A;  2JCH A;  1RCJ A;  4LCM A;  4GKU A;  3FWL A;  4GNU A;  5U47 A;  1N9B A;  3OCN A;  2XGN A;  1BLC A;  2H5S A;  3EQV A;  3N8R A;  1KDS A;  3BEC A;  1KVM A;  1ONH A;  1Z6F A;  5E2F A;  4LEN A;  4JXS A;  4WYY A;  1H8Z A;  3E2K A;  1BLH A;  2QMI A;  4MBK A;  3UY6 A;  3CMZ A;  1H8Y A;  4OOM A;  1G68 A;  3IXB A;  1SKF A;  3ZCZ A;  5M19 A;  1LL9 A;  2VGK A;  1XX2 A;  3OPP A;  4MEZ A;  2R9W A;  1K25 A;  2RCX A;  4KG2 A;  5GHZ A;  1Q2P A;  3VSK A;  4N1H A;  1CI8 A;  2Y4A A;  3NIA A;  5JYP A;  3MBZ A;  3WRT A;  4N9K A;  3IHB A;  3O86 A;  2IWB A;  3IXD A;  1IYO A;  5F1G A;  4XUX A;  1WE4 A;  3O88 A;  3A3E A;  4OOL A;  3V39 A;  1L0E A;  2EXB A;  1JTD A;  4A5R A;  3G2Y A;  4S2N A;  3ISG A;  2Y2I A;  4BEN A;  3N6I A;  4IBX A;  3OC2 A;  1VQQ A;  4Y0U A;  3HLC A;  2XFS A;  2Q9N A;  1KE0 A;  2R9X A;  2WK0 A;  2QPN A;  4R4R A;  2Y2H A;  1PYY A;  3UPN A;  4S2L A;  1KGG A;  1HTZ A;  4B4X A;  2XQZ A;  1GHI A;  4P87 A;  4KQR A;  1NYM A;  2IWD A;  1MWT A;  4MNR A;  5EEC A;  3N8L A;  4U0X A;  4EQI A;  5BOH A;  3W8K A;  4JXG A;  4KZA A;  1ZKJ A;  5TFQ A;  1XGJ A;  3WS1 A;  1BSG A;  1ESU A;  3W4P A;  1KE3 A;  4C75 A;  1DJA A;  3NDG A;  3V3R A;  2PBY A;  4YIN A;  4HES A;  4U3T A;  2EFU A;  4EWF A;  3CJM A;  2WKH A;  4OQI A;  4QJG A;  2BG1 A;  5EVI D;  4RYE A;  3UDX A;  2A3U A;  5E2E A;  3G35 A;  3GV9 A;  3GQZ A;  2WGW A;  5FAT A;  3HUO A;  4BD1 A;  5EE8 A;  4WZ5 A;  1NY0 A;  5FI6 A;  1K56 D;  1MBL A;  4E6W A;  3A3F A;  3NI9 A;  2C5W B;  4OKP A;  3OPH A;  1PIO A;  2Z2M B;  5FQ9 A;  3G32 A;  1S6R A;  4M3K A;  5EPH A;  4PM5 A;  3N4I A;  4KQO A;  1MPL A;  4OH0 A;  2XD5 A;  1K54 C;  3NY4 A;  4GD8 A;  1GA0 A;  4JF4 A;  4WZ4 A;  4JXW A;  3BLM A;  5HAR A;  4OON A;  5EUA A;  2RL3 A;  4PPR A;  1IKI A;  1W8Q A;  5G18 A;  3N7W A;  1PI5 A;  1U60 A;  3NDE A;  2Y2L A;  1PI4 A;  5DTT A;  1Q2Q A;  1XA7 A;  5GHY A;  1NXY A;  2P9V A;  4KZ9 A;  4LV0 A;  4R1G A;  4S2P A;  1YMS A;  3QNB A;  1O07 A;  4QHC A;  3JYI A;  2J8Y A;  2ZM0 A;  3VSL A;  1MWS A;  4KZB A;  2QZ6 A;  4H8R A;  1HD8 A;  3C4O A;  2Y59 A;  3HLB A;  2XH9 A;  4BJP A;  4HBT A;  4WEJ A;  3QNC A;  1WYC A;  4LV2 A;  5FAO A;  4F94 A;  4OPR A;  2BLS A;  2ZMA A;  3S22 A;  4EBL A;  4PM8 A;  3Q7V B;  2ZC5 B;  5DF8 A;  3HRE A;  3GRJ A;  4DDS A;  2OSU A;  1K57 A;  4ZBE A;  4R4S A;  1XKZ A;  2V20 A;  1ERQ A;  1KGE A;  2Q9M A;  1KE4 A;  2XEP A;  3DW0 A;  3P98 A;  4LCL A;  3UE3 A;  2ZQA A;  2X71 A;  5AQ7 A;  1FSY A;  1GA9 A;  3A3D A;  2V1Z A;  1L0F A;  1YLT A;  2HDS A;  2H0Y A;  2ZC7 A;  3IH8 A;  3P09 A;  4EV4 A;  4OQG A;  3PBN A;  5E43 A;  3V5M A;  5D3O A;  4R3J A;  4FSF A;  4BL3 A;  3SS5 A;  1LHY A;  3TOI A;  1E25 A;  5HX9 A;  4OQH A;  5GLB A;  5HAP A;  1Y54 A;  4R23 A;  5A90 A;  2Y2Q A;  2ZLY A;  2HPB A;  1W8Y A;  4DXB A;  1L2S A;  2H0T A;  3ITA A;  4ZDX A;  1JVJ A;  3Q7Z A;  1FCO A;  1XPB A;  2X02 A;  1I2S A;  2J9P A;  3SH9 A;  3UE1 A;  3QHY A;  4KZ4 A;  4R0Q A;  4GDN A;  4XXR A;  4DKI A;  1K55 A;  4EBP A;  4XUZ A;  3I7J A;  3ZNY A;  4DDY A;  1PWD A;  1TEM A;  1DY6 A;  1PZO A;  3AGE A;  5E2H A;  4P0M A;  5A91 A;  3Q81 A;  4RA7 A;  4S2N C;  4OPY A;  5CEC A;  2I72 A;  1BUE A;  1FR1 A;  3FKV A;  3FV7 A;  3IQA A;  3ZDJ A;  2V2F F;  3WWX A;  2XF3 A;  1JWV A;  3HLW A;  1SDN A;  1YQS A;  2WGV A;  3M6H A;  4R3B A;  1I5Q A;  2JC7 A;  1GCE A;  1GHP A;  3VOY A;  2ZQD A;  3D4F A;  4KEN B;  5GL9 A;  2IWC A;  4OP5 A;  1ALQ A;  5DTS A;  4C6Y A;  1LI0 A;  1EWZ A;  1YLW A;  3PAE A;  3W4O A;  2ZQ8 A;  3OPL A;  5EVI A;  4MBF A;  3IF6 A;  3CG5 A;  3LY3 A;  2WYX A;  2XDM A;  3RJU A;  3PBR A;  3VP2 A;  4ZAM A;  4X6T A;  5FSR A;  4FD8 A;  1DJC A;  4BL2 A;  1K56 A;  1N4O A;  3BFF A;  4LV3 A;  4OQ0 A;  4OOY A;  3PBQ A;  4HEF A;  3SS3 A;  3WS5 A;  1W7F A;  3G31 A;  5E2G A;  4QY5 A;  3VP1 A;  3SOI A;  3WRZ A;  1AXB A;  1IEM A;  3IH9 A;  4S2J A;  2Z2L B;  3MZD A;  3B3X A;  2EXA A;  2Y2G A;  4RVA A;  3BEB A;  4WZ5 C;  1NZU A;  5I94 A;  3A3J A;  5KZH A;  2G2U A;  4E3K A;  3FYZ A;  5FQM A;  1I2W A;  2ZD8 A;  4IVI A;  4KZ8 A;  4KG5 A;  5AQA A;  4JF6 A;  5CER A;  3OCL A;  1K4E A;  1ZG6 A;  5CTN A;  4PM6 A;  5FQK A;  3UE0 A;  2ZM2 A;  1NJ4 A;  4PMA A;  2WAF A;  5CEB A;  4GN2 A;  5GLC A;  4E3L A;  1SDE A;  3DWZ A;  5CHU A;  3ZG7 B;  1PWC A;  3AGD A;  5FAP A;  4DRT A;  4OLD A;  3DWK A;  1L0D A;  4JBF A;  4X56 A;  1BTL A;  3IWQ A;  3IWO A;  4DE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...