2A3UA

Crystal structure of sulbactam bound to e166a variant of shv-1 beta-lactamase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
publication title High Resolution Crystal Structures of the trans-Enamine Intermediates Formed by Sulbactam and Clavulanic Acid and E166A SHV-1 {beta}-Lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 96
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2a3uA00
3HUMA 4HBUA 4RX3A 4BENA 4X55A 1SCWA 3BRMA 4MBHA 3OPPA 3G32A 2J9OA 3FWLA 3S1YA 3P98A 3UDIA 5CEBA 1BT5A 2ZJ9A 1ZC2A 2ZQ9A 3CJMA 1BULA 5M1AA 2IWBA 1SDEA 4UA9A 3S4XA 2EXBA 3ZNTA 4XUXA 3CZDA 1FCNA 2WKHA 3G4PA 3PBQA 4KZ6A 3G30A 4GD6A 4Z9QA 1FSYA 2X02A 5GL9A 1E3UD 2R9WA 1BZAA 2DNSA 4KZ8A 2Y2KA 2WKIA 5FA7A 5FQMA 5DTSA 1LLBA 1BLCA 4WBGA 1K55C 4K0XA 3W8KA 1Q2PA 2PBYA 1JWZA 1CEFA 1M40A 1BUEA 3IXGA 1SKFA 2X01A 1LI9A 4WMCA 1Z6FA 4KZAA 5JYOA 2Y2JA 3HUOA 1FCMA 3RXWA 2OV5A 2BG1A 3G35A 3IWIA 5GLBA 1MKIA 1MPLA 3I7JA 4GKUA 3C4PA 2XK1A 5E43A 3DWKA 2ZM8A 3FV7A 4OPYA 4QY5A 4IBXA 4MLLA 4JF5A 3ZG8B 1MY8A 2HDRA 2OLVA 4JXWA 5CERA 2WKEA 3V3SA 1ZG4A 1IKGA 4QY6A 2V20A 2HP9A 3G2YA 3UO9A 3PAEA 1ONGA 1NXYA 1PI4A 4MEZA 1IELA 2Q9NA 1CI9A 2FFFB 3S22A 3G34A 4BL3A 3CMZA 2JE5A 4DRTA 4Y7PA 1JWVA 1KDWA 4OQIA 1N9BA 4YFMA 4DE1A 3NY4A 2QPNA 1XGIA 3UDXA 3C7UA 3PBSA 5FASA 5KSCA 3IXBA 3C7VA 3NDEA 5M18A 1KDSA 4GB7A 1NYMA 3A3JA 4ID4A 1PWDA 1E25A 1XA1A 4OKPA 4OOYA 3ZNYA 2EFXA 1NRFA 3A3IA 4BL2A 3M6BA 2XQZA 1BLHA 4C6YA 1N4OA 4P6BA 4DE2A 4R23A 4E3LA 4JPMA 3NDGA 5EOEA 1H8YA 1S0WA 3GV9A 4OQHA 2ZM2A 2V1ZA 3WRTA 1MWSA 2ZLYA 1ES3A 1FOFA 4PMAA 3HVFA 2UWXA 3UE0A 3E2LA 4XXRA 4X6TA 2QZ6A 4KQQA 3C5AA 4NK3A 2WAFA 2HDQA 5DTKA 1ZKJA 4R1GA 3HLGA 3IXHA 4JXSA 4R4RA 4UAAA 4EBNA 1KE0A 4RYEA 5AQ7A 1XP4A 3QHYA 4H8RA 5G18A 4KZ3A 3W4PA 5J8XA 3SH9A 1YLYA 2WUQA 4E3OA 4DKIA 1YLWA 1IKIA 5IHVA 4WM9A 1I2WA 4PM7A 3ZFZA 3UNWA 1DJBA 2Y2HA 4WZ4A 4R3BA 5HAQA 3PBOA 1GHMA 4S2JA 2WGIA 2Y2QA 3N7WA 2EFUA 5FDHA 2C6WB 5HFOA 1M6KA 2XDMA 3MKEA 3QNBA 4M3KA 1RGZA 4OP5A 4OPRA 3VFFA 4DDYA 5L2FA 3B3XA 2ZQ7A 3HLWA 4S2MA 3D4FA 1YLJA 5FQKA 1W8YA 3GMWA 2H0YA 5EE8A 1TEMA 2G2UA 2X71A 4PM8A 3FKWA 3ZDJA 3LEZA 4GDNA 4S2OA 4ZJ3A 4KENB 1K4EA 5EVIB 2ZQDA 3VP3A 1O07A 4EWFA 1U60A 5FQIA 1Q2QA 3MBZA 3PTEA 1CI8A 5E2GA 2DRWA 4JLFA 1SHVA 2G2WA 4WELA 5CHJA 3SH7A 3UPNA 3M2KA 1KE3A 2ZC6B 3HLFA 3SOIA 4R3JA 4IVKA 5EVIA 4P87A 5FQQA 2WZXA 1EROA 3MXSA 3SS4A 1H8ZA 5AQBA 4DF6A 2OLUA 4S2KA 1FR6A 3WWXA 3CG5A 1XA7A 5FQ9A 3IF6B 1WYCA 1PZPA 5HARA 4DDSA 4N9LA 1W5DA 3BYDA 3IF5A 3MZEA 4FD8A 3O86A 4JXGA 2Z2MB 4Y0TA 5FSRA 1MWUA 3RXXA 4D2OA 3HLEA 3NBLA 1K25A 4HBTA 2ZD8A 2Y2LA 3IF6A 5AQ9A 4ZJ1A 4KZBA 4QJGA 3IQAA 2ZQAA 4KZ4A 1ERMA 1FQGA 4K91A 4FH2A 5EUAA 3MZFA 2JBFA 3IHAA 3ZVWA 1ESUA 2ZC7A 1J9MA 1ESIA 5HAPA 2EX8A 3Q07A 3VOYA 3HLBA 2HDSA 3IT9A 3JYIA 2QMIA 4Y0UA 3WS0A 1L2SA 4LV0A 2Y2MA 1E3UA 1QMEA 1JTGA 3Q82A 2H0TA 2ZC4B 3A3DA 3LO7A 5M19A 2ZQ8A 1BSGA 2XLNA 4N1XA 5EECA 3GR2A 3O88A 2XR0A 1L0GA 4BD1A 2JCHA 3VSKA 1FCOA 1BLPA 4KG6A 4MBKA 2ZM0A 4S2NA 5FAOA 4E6XA 1FR1A 1ALQA 1YMSA 5A92A 5CTMA 2HP6A 4DXBA 4U3TA 1MBLA 2J8YA 4X68A 5EOOA 4OH0A 5CGWA 5E2FA 4JF4A 1FSWA 1KGEA 4DE0A 4X53A 4ZTKA 4ZAMA 1PW8A 3PBTA 4OOMA 3BEBA 3M2JA 1YQSA 3UDFA 4A5RA 2FFYA 3OPLA 1OMEA 4C3QA 5U47A 1K57A 5A91A 2ZMAA 1ERQA 1ZG6A 1KVLA 5FQJA 3HBRA 5E2EA 3UPPA 2I72A 1W79A 5DVAA 3ISGA 4OVDA 2XFSA 2ZC3B 3VP2A 4S2IA 4MNRA 3NI9A 3Q1FA 5F83A 3GRJA 3P09A 3VP1A 4LCMA 1L0EA 3BFGA 4IBRA 4BD0A 4BLMA 3MZDA 3UE3A 4RVAA 3VOZA 5AQAA 3HREA 4GD8A 4PM5A 1JVJA 3HLDA 5EVIC 5DF7A 2HPBA 1GCEA 2EX9A 2V2FF 4QD4A 5FI2A 3ZG0A 4FSFA 1DJAA 3GTCA 3PBNA 4IVIA 2XD5A 4WEJA 5HAIA 3PBRA 3E2KA 3MFDA 1TDLA 4B4XA 1NYYA 3M6HA 4ZDXA 2BLSA 3LY4A 1GA9A 2Y2IA 1IYSA 2R9XA 3W4QA 1EI5A 2EX2A 3SH8A 1AXBA 3HLCA 4OPZA 4PPRA 4EBPA 3OCLA 2XGNA 3IH8A 3OCNA 3IF6C 3IWOA 2B5RA 3TSGA 3BM6A 2WYXA 4GNUA 2XFTA 1KE4A 4JKTA 1PWGA 1PW1A 2H10A 4HESA 3BECA 1MXOA 3Q81A 3GQZA 4E3IA 4KG2A 4EUZA 4UHUA 3OPHA 5KMWA 4PM6A 5EPHA 3WS5A 4EBLA 1GHPA 1RP5A 4RA7A 5F1GA 1G6AA 1XPBA 1E4DA 5CGXA 1S6RA 1GHIA 1K38A 4BQMA 4JXVA 3BFEA 4UA6A 2DCFA 1K56D 4E3NA 4QU3A 5FAQA 4OLGA 1VQQA 4OOLA 1JWPA 3LY3A 3LCEA 3SS5A 4RX2A 3WRZA 1LL9A 3N4IA 3ITBA 3UPOA 1HVBA 3O87A 4K0WA 1IEMA 4WYYA 2A49A 3V50A 1YLTA 3C4OA 2WADA 3G31A 4CPKA 1DJCA 3N8RA 4WZ5A 4EQIA 4ZBEA 2IWCA 5F82A 4KQRA 1RGYA 4GOGA 2E8IA 1ES4A 1W8QA 1EWZA 3IXDA 1RCJA 2J7VA 4KG5A 3VFHA 4GN2A 3TOIA 3IH9A 2Y4AA 4X56A 5CHUA 4OQ0A 2ZQCA 1IYPA 3RJUA 4BJPA 1K57C 1NZUA 4E3JA 5GLDA 2RL3A 1G68A 3AGEA 3AGFA 2WGWB 5A90A 4KZ9A 4EV4A 2Y91A 3PAGA 1ES2A 5BOHA 4R4SA 1YLZA 1NZOA 1TVFA 4WMCD 2PU4A 5HL1A 2PU2A 1SDNA 5GLCA 4N92A 1IYOA 2RCXA 3ZGAB 1XX2A 2WGWA 2XF3A 5HX9A 2J9PA 4N9KA 4ZJ2A 2HP5A 1PIOA 1W7FA 4IEDA 4LV1A 1L0DA 2JC7A 3IWQA 5CEDA 5GHYA 1KVMA 3TG9A 3Q7VB 1ONHA 3Q7ZA 4UA7A 5CXWA 3GVBA 3G2ZA 3QNCA 4LV3A 4JBFA 4OQGA 5CTNA 1K54A 5EVLA 3UY6A 3NIAA 1KGFA 3VP0A 5I94A 1MWRA 4LV2A 2H5SA 4DE3A 5FI6A 4PM9A 1VM1A 3Q7VA 4FCFA 4E6WA 1PWCA 2Y2OA 3BLMA 4OONA 3VP4A 1BLSA 4U0XA 2WZZA 3VSLA 2XEPA 5CECA 2OSUA 1QMFA 3ZCZA 3ZG5A 4X69A 2IWDA 5D3OA 3V3RA 3DTMA 1YLPA 3NCKA 1TDGA 4L0LA 4YINA 4JF6A 1NJ4A 3HUNA 1PZOA 3WS4A 5CGSA 3MKFA 4OLDA 5DTTA 5DF9A 4OP8A 5F1FA 3ZVTA 2WGVA 3ITAA 5CHMA 1LI0A 4LENA 1BTLA 2C5WB 5CRFA 1WYBA 5FI7A 3ZHHA 3BFCA 3UN7A 4KZ7A 4P0MA 2WAEA 4U0TA 4B4ZA 4E3KA 5HW3A 3MXRA 1L0FA 3N6IA 5TR7A 4CJNA 4E3MA 3OC2A 2Y55A 4R0QA 5DF8A 4QHCA 1K55A 1YT4A 5E2HA 1GA0A 2ZC5B 4WZ5C 5GLAA 5GHZA 1HTZA 3N8SA 4KZ5A 4F94A 4NETA 4O7DA 4GDBA 1K6RA 4S2LA 3OZHA 2WK0A 1I2SA 5KZHA 1PI5A 3HL9A 2CC1A 4KQOA 3FKVA 1I5QA 1XXMA 5FATA 2Y59A 2Z2LB 3A3EA 5TFQA 3UE1A 2XD1A 5A93A 1XGJA 4FH4A 5TGFA 4N1HA 4LCLA 1JTDA 2Y2PA 3W4OA 2EX6A 1K4FA 4DXCA 4C75A 2HDUA 3V39A 1XKZA 2Q9MA 1MWTA 1YMXA 3NC8A 3EQVA 3ZG7B 4Q8IA 2P9VB 2EXAA 2P74A 1K6SA 4Y0OA 1Y54A 1PYYA 3SS3A 4WEKA 3V5MA 5FAPA 4MBFA 1C3BA 4HEFA 3BFDA 2XH9A 2Y2NA 1IYQA 1HD8A 2A3UA 2VGKA 3A3FA 4OPQA 3N8LA 1CEGA 1LL5A 1KGGA 1LHYA 4GZBA 1ES5A 3FZCA 2P9VA 4S2NC 1NY0A 3EQUA 1DY6A 1H5XA 3DW0A 2VGJA 4B88A 3WS2A 5JYPA 1YM1A 3BLSA 3GSGA 5EVID 2Y2GA 3ZG9B 3DWZA 4P85A 1WE4A 1K54C 3OPRA 3WS1A 1CK3A 1HZOA 3O3VA 3FYZA 4S2PA 4QB8A 4XUZA 2GDNA 3BFFA 3IHBA 5KSHA 1K56A 1O7EA 5GHXA 3AGDA 3VMAA
chains in the Genus database with same CATH superfamily
1XFNA 4RX3A 2ZMVA 3C30A 2J9OA 3FWLA 5CEBA 3UDIA 4HNBA 3UMEA 1SDEA 4UA9A 2WKHA 3G4PA 3LIEA 3PBQA 4KZ6A 4Z9QA 5J7EA 2X02A 2DNSA 2Y2KA 2INWA 5FA7A 2KOIA 2EA9A 1BLCA 1JWZA 1CEFA 3IXGA 4NXBA 2X01A 4WMCA 1Z6FA 4MCWA 4DMZA 2W1RA 3T4TA 3RXWA 2OV5A 3G35A 3GECA 3I7JA 1XJ2A 3C4PA 4QY5A 4NXFA 4FTXA 3V3SA 4QY6A 4HI4A 1NXYA 1OTDA 1PI4A 1IELA 1CI9A 2FFFB 2PD8A 3S22A 4BL3A 4Y7PA 1JWVA 1DP8A 3D9YA 2V0UA 3NDEA 2K2NA 4EXOA 4GB7A 4OKPA 4OOYA 4ID4A 2QHKA 4I3IA 5HWWA 3E0YA 3UB9A 1FOFA 4IHQA 1GSXA 3KYEA 3A0SA 5DTKA 4R1GA 4R4RA 4RYEA 4G3VA 4H8RA 4WUJA 3CUEC 4E3OA 4DKIA 3H9WA 1I2WA 4PM7A 2Y2HA 4NXEA 4WZ4A 2K7SA 3PBOA 2B95A 2C6WB 5HFOA 1M6KA 4KUOA 4BBTA 3PYPA 1RGZA 4OP5A 4DDYA 1W8YA 5EE8A 1OT9A 3T1RA 5EM0A 3ZDJA 4EETB 4S2OA 3HCYA 5TJJA 2ZQDA 2NUPC 1W63Q 3LGOA 1G6OA 4MDZA 3PTEA 5E2GA 1SHVA 4WELA 3UPNA 4Q0HA 3SOIA 2J3WA 4IVKA 2HZ5A 2VV6A 4P87A 5FQQA 2G7UA 1S4SA 2HGVA 4R6LA 5FQ9A 1PZPA 2OAQ1 2OWJA 1DP9A 3RXXA 2YKHA 2XRNA 3T4JA 3LUQA 4KZBA 1ERMA 3ZVWA 1ESUA 3Q07A 3VOYA 3QP8A 2HDSA 3WS0A 4LV0A 1E3UA 1QMEA 1S1YA 3A3DA 3S7PA 3NULA 4N1XA 4BD1A 2XR0A 3VSKA 3F1NB 4MBKA 4KG6A 4S2NA 4E6XA 1VHMA 5A92A 3PXPA 2QJ5A 2MJ6A 3F1NA 1FSWA 1KGEA 4DE0A 4X53A 4ZTKA 4ZAMA 4OOMA 2BASA 1YQSA 2FFYA 3OPLA 2ZMAA 4KQDA 5FQJA 4GS9B 2ZC3B 2ACGA 1OPXA 4MNRA 3L7HA 1Z09A 4S2IA 4Y17A 4IBRA 2XSSA 4RVAA 4GD8A 4GS9A 1JVJA 2JKRM 2V2FF 3BQ8A 5FI2A 1DJAA 2XD5A 3W2ZA 3E2KA 1V9ZA 2AVXA 2Y2IA 2R9XA 1EI5A 3UE6A 3HLCA 4EBPA 1YKDA 3OCLA 3OCNA 2PT7A 4GNUA 2XFTA 1KE4A 1MKMA 1MXOA 4E3IA 4KG2A 3OPHA 5C5KA 4EBLA 4RA7A 1G6AA 2OAP1 5CGXA 1F5MA 4BQMA 2DCFA 4O0PA 4E3NA 3MQQA 3GDIA 3O5YA 3N4IA 3O87A 2A49A 1VB6A 4HQAA 1YLTA 4NEED 2WADA 2IWCA 2J3TC 5F82A 4KQRA 1RGYA 2ZBBA 3VFHA 4KG5A 1EWZA 3RJUA 4BJPA 3ICYA 4WN5A 1G68A 3CITA 4I3JA 1CJFA 2W3FA 3LR4A 2W3DA 1YLZA 5HL1A 2PU4A 4CLCD 1SDNA 4N92A 1IYOA 1XX2A 2Z6DA 4JGQA 3KX0X 4IEDA 4Y5FA 1LT0A 5CEDA 1MC0A 1KVMA 3LIDA 3Q7VB 3GVBA 3DBAA 1K54A 5EFWA 5AVEA 1XFQA 3Q7VA 3VE3A 3BLMA 3VOLA 4OONA 3LI8A 2XEPA 2O9AA 4XT2B 2IWDA 1TDGA 3QP6A 2I9VA 3IS2B 1PZOA 3R7WB 2W1TB 4XT2A 1LI0A 4LENA 1BTLA 5CRFA 3MJQA 3ZHHA 3IS2A 4P0MA 4B4ZA 3BY8A 3N6IA 4GLQA 3RFBA 4CJNA 3OC2A 2Y55A 4E3MA 3R7WA 2W1TA 5DF8A 1YSPA 1YT4A 5E2HA 5GHZA 3N8SA 4GDBA 3EOIA 2WK0A 3NOPC 3FPVA 4KQOA 1XXMA 2Z2LB 4HY8A 5TGFA 4N1HA 2EX6A 1VEUB 2HDUA 3EGXC 2P9VB 3T1XA 1PYYA 1IYQA 2VGKA 1VEUA 5F68A 1CEGA 4WL9A 2P9VA 1DY6A 3DW0A 4B88A 1XJ6A 3WS2A 3BLSA 3RTYA 4Y2FA 2Y2GA 2WKRA 2VKSA 4QB8A 2D01A 5KIZA 4FOFA 2QJ7A 4HP4A 2KLIA 4BENA 2WKQA 1SCWA 3OPPA 3NOUC 1ZC2A 4QPRA 2IWBA 3ZNTA 3G30A 3KO6A 3QP4A 2E8JA 2WKIA 3OOVA 5FQMA 4WBGA 4K0XA 2PBYA 1M40A 1BUEA 3P7NA 1NLZA 4G3WA 3V67A 3HUOA 4PHTA 2J3TD 2XK1A 5E43A 2ZM8A 3ZG8B 4JF5A 5CERA 2OLVA 4JXWA 2WKEA 1ZG4A 1IKGA 3UO9A 1ONGA 4MEZA 2Q9NA 1DRMA 3G34A 5F6AA 2JE5A 4DRTA 3HJKA 2HJEA 4OQIA 4YFMA 2QPNA 4IUHA 3B42A 1F9IA 3IXBA 3C7VA 1PWDA 4CQHA 3CI6A 2YKFA 4BL2A 3M6BA 2XQZA 1BLHA 4P6BA 4BWIA 4FUWA 3BQAA 3NDGA 5EOEA 1XJ4A 4WF0A 3FC7A 2V1ZA 1MWSA 3LIFA 2UWXA 4XXRA 4KQQA 1LSVA 5G4YA 2HDQA 2VGLS 5J3WA 3IXHA 3R4KA 5G18A 3W4PA 4JGPA 4KZ3A 4ARZB 1IKIA 1BYWA 2W3GA 4WM9A 2HJ9C 5HAQA 3EWKA 4S2JA 2Y2QA 3N7WA 3KSGA 2EFUA 4ARZA 4EU0A 3U2AA 3QNBA 4M3KA 2ZQ7A 1L3LA 4S2MA 5FQKA 3GMWA 2H0YA 1TEMA 4DJ3A 3T1SA 5EVIB 1O07A 4EWFA 5FQIA 3CPTB 3NHQA 3MBZA 1CQAA 4Q0JA 2DRWA 4JLFA 2O9BA 3SH7A 5A8BA 3HLFA 3LYXA 2HV1A 5EVIA 2P04A 2WZXA 3MXSA 3CPTA 2OLUA 2J80A 3LICA 3IF6B 3E4OA 4FD8A 4JXGA 3O86A 2M7VA 4HBTA 3IF6A 4ZJ1A 1JNUA 4BBUA 4KZ4A 3IX3A 4K91A 4EEPA 3MZFA 2ZC7A 1J9MA 2EX8A 3JVUA 3JYIA 2QMIA 4Y0UA 1L2SA 2Y2MA 2ZC4B 3H82B 2ZQ8A 3BY9A 5DFYA 3BWLA 1L0GA 1IFQA 1FCOA 1BLPA 2ZM0A 1FR1A 2A24B 2BTFP 2O9CA 3H82A 3HJIA 4HJ3A 4DXBA 2V8CA 4X68A 4AFIA 1PW8A 2A24A 3BEBA 3M2JA 4A5RA 1K57A 5A91A 1KVLA 1ZG6A 5E2EA 2I72A 4L9EA 4OVDA 2XFSA 3Q1FA 4L9FA 3GRJA 4LRXC 3UE3A 3HREA 4PM5A 2HPBA 1GCEA 2EX9A 3TJZC 3ZG0A 3GTCA 3MFDA 4KUKA 2B18A 4ZDXA 2BLSA 2PHYA 2Y79A 3W4QA 3SH8A 4OPZA 1AXBA 4PPRA 4NG2A 3U4LP 5HDCA 3IWOA 3S7OA 2P08A 3BM6A 4WLAA 1D06A 1PWGA 2H10A 4G3KA 3GQZA 4EUZA 4CLCC 5EPHA 3WS5A 2VLGA 2PYRA 1GHIA 1K38A 1K56D 5FAQA 4OLGA 1JWPA 3LY3A 3RH8B 1LL9A 1HVBA 4K0WA 1IEMA 4WYYA 3BW6A 2L0WA 4CPKA 2JKTM 4WZ5A 4EQIA 3QP2A 2E8IA 1S1ZA 3IXDA 4JGOA 3TOIA 4DN0A 2Y4AA 4X56A 5CHUA 1LSWA 5J4EA 2ZQCA 2M7UA 3G6OA 2RL3A 5A90A 3AGEA 2WGWB 4EV4A 5L07A 1ES2A 1NZOA 4WMCD 4EW7A 2RCXA 3ZGAB 2WGWA 1EW0A 5HX9A 3VE4A 2J9PA 3B47A 4N9KA 2CMNA 3KSHA 4LV1A 2Y8HA 1WA9A 3MQ0A 3Q7ZA 3G2ZA 4LV3A 4OQGA 5EVLA 3UY6A 2W3EA 1KGFA 5G4ZA 3VP0A 3JPUA 2H5SA 4LV2A 5FI6A 3L9KA 4ESPA 2Y2OA 3VP4A 4U0XA 1T1BA 3VSLA 4MN7A 2OSUA 5CECA 3ZCZA 4LLOB 3NECA 3DTMA 4YINA 1K0KA 3HUNA 3E98A 3WS4A 3UB5P 1IOUA 2H28A 5EVEA 2C5WB 1WYBA 2R78A 1PFLA 2WAEA 4U0TA 4I3AA 4E3KA 5TR7A 5EM1A 4UQIS 1K55A 1N9NA 4ZRRA 4KZ5A 5HZHA 4O7DA 1K6RA 2VEAA 1I2SA 4LFUA 5KZHA 1PI5A 2JHEA 2CC1A 3TRCA 3FKVA 5TFQA 3UE1A 4PAUA 2Y2PA 1K4FA 4DXCA 4C75A 3B33A 1YMXA 3EQVA 4EQ1A 4Q8IA 2EXAA 2P74A 4MBFA 1C3BA 4HEFA 4YNRA 5DKKA 3BFDA 4OPQA 1LHYA 2O99A 1H5XA 3MMHA 1Y4OA 1T1CA 3ZG9B 4P85A 1K54C 3OPRA 3WS1A 2VGLM 1CK3A 4S2PA 4XUZA 3BFFA 3IHBA 5FASA 1O7EA 3VMAA 1OTEA 2DMWA 3BRMA 1SKOB 3P98A 5I5LA 1BT5A 4HIAA 3T4QA 5M1AA 2EXBA 3SZTA 4XUXA 3CZDA 1FCNA 1SKOA 2VX8A 2P7JA 1FSYA 1E3UD 1TD5A 3TE8A 1LLBA 3W8KA 3DTEA 1SKFA 1LI9A 2VV7A 3FPWA 5JYOA 2Y2JA 1MZUA 4GCZA 3IX8A 2BG1A 3MFXA 3IWIA 3EEHA 1MKIA 4GKUA 1H3QA 3DWKA 4OPYA 4IBXA 1MY8A 4MN6A 1OJ5A 5HPIA 2V20A 1YAXA 3G2YA 1KDWA 4DE1A 1N9BA 3NY4A 1LL8A 3C7UA 1NYMA 3A3JA 2JKFA 1NRFA 3A3IA 3A0RA 1N4OA 4DE2A 1P9RA 1S0WA 3GV9A 5FL3A 1HLUP 4B9OA 4LRYC 3UE0A 2GZAA 2QZ6A 2GNXA 4EBNA 2A2LA 5J8XA 3SH9A 1YLYA 2WUQA 2EWVA 1YLWA 5IHVA 3ZFZA 1DJBA 1YPRA 5HD5A 4HH2A 2WGIA 5FDHA 4RQ9A 3MKEA 1D7EA 3VFFA 3B3XA 3HLWA 3D4FA 1YLJA 2G2UA 2X71A 4PM8A 4GDNA 1NWZA 4NKPA 4ZJ3A 3FG8A 1VETB 4GW9A 1CI8A 5CHJA 4Y15A 2IA2A 3LFVA 1KE3A 3NJAA 2ZC6B 1XJ3A 4R3JA 1EROA 1H8ZA 1VETA 5AQBA 4DF6A 1FR6A 3LR0A 1XA7A 5FEFA 1UWNX 2V0WA 1W5DA 3OBFA 3BYDA 2V9AA 3MZEA 4Y0TA 2Z2MB 1MWUA 4MN5A 1K25A 5AQ9A 3H7WB 3SW1A 3IQAA 2ZQAA 2PYPA 2PR5A 3T4LA 5HAPA 3IT9A 3H7WA 1T18A 2H0TA 3LO7A 5M19A 1BSGA 2OOLA 5EECA 1ODVA 2GJ3A 3LIBA 5FAOA 5CTMA 1MBLA 2J8YA 5EOOA 5CGWA 1TS0A 4JF4A 5DJTA 3PBTA 4LPZA 3IBJA 2JKRI 3OLOA 3TW8A 1OMEA 4C3QA 5U47A 3HBRA 3UPPA 3KSIA 1OJGA 4I39A 1L0EA 5AJGA 5DJUA 4BD0A 3MZDA 1LSXA 3VOZA 3PR6A 3CAXA 3D3OA 1NLYA 1X0OA 3HLDA 5EVIC 3PBNA 4BBVA 3JVVA 2ZOIA 4B4XA 3M6HA 3T4KA 3LY4A 2ZL1B 2EX2A 3KSFA 3IH8A 3IF6C 3TSGA 2B5RA 2WYXA 5EV0A 3DAVA 1PW1A 4L9GA 4Y3IA 2ZL1A 3Q81A 2LB9A 4UHUA 1OT6A 2JN7A 1GHPA 1RP5A 2W27A 3MR0A 1OTAA 1XPBA 1E4DA 2Q0OA 1S6RA 4UQIM 5MC7A 3CWFA 2NUTC 2M1CA 1VQQA 3SS5A 4P6ZS 4RX2A 3ITBA 3V50A 3C4OA 2VZWA 1DJCA 4IUKA 4F3LB 4ZBEA 4GHIB 4GOGA 1ES4A 1RCJA 2J7VA 4GN2A 3IH9A 4II7A 4OQ0A 1IYPA 1K57C 4F3LA 4E3JA 4GHIA 3AGFA 1ZTUA 4R70A 4KZ9A 3UB8A 3PAGA 4NXGA 4R4SA 4ETXA 1H8MA 2VA0A 1S4RA 5HDSA 2PDRA 2HP5A 4E04A 4D60A 4HP9A 2W3HA 1ONHA 5CXWA 4Y13A 5I94A 1MWRA 4DE3A 4PM9A 5IS1A 3NOTC 4I5SA 1PWCA 2WZZA 2LB5A 2XA7S 4X69A 5D3OA 3MXQA 3V3RA 3NCKA 2VK3A 4L0LA 5CGSA 4OLDA 4O01A 5DTTA 1G5UA 4HJ6A 3ZVTA 4EEUA 5F69A 3F1PB 3UMDA 5FI7A 3BFCA 3UN7A 4PKYG 4R3AA 1ZHHB 4QHCA 4WZ5C 3F1PA 5GLAA 3DTKA 1D1JA 4F94A 4S2LA 3OZHA 1TS7A 3HL9A 1F2KA 3D72A 3ULFA 3S7QA 2Y59A 1TS8A 3A3EA 4FH4A 3W4OA 1JTDA 2O0YA 4I38A 1A0KA 3V39A 2Q9MA 1MWTA 3ZG7B 1K6SA 4Y0OA 1Y54A 4WEKA 1G28A 3LI9A 3A3FA 1NRJA 1KGGA 4K08A 3FZCA 4S2NC 1NY0A 5HWTA 5JYPA 1YM1A 3GSGA 4PKYA 5EVID 2GX5A 1WE4A 4MMNA 4YWZA 2GDNA 5K5BA 5KSHA 3AGDA 3HUMA 4HBUA 3IX4A 4X55A 5F5YA 4MBHA 3P01A 3G32A 3S1YA 2ZJ9A 2ZQ9A 2EWWA 3CJMA 1BULA 3S4XA 4UEYA 4HOIA 3CUEA 4GD6A 3VV4A 5GL9A 2R9WA 4Q0IA 1BZAA 4KZ8A 4CLCB 5AVFA 5DTSA 2VJWA 1K55C 1Q2PA 2PBDP 4CLCA 4KZAA 4LRZE 1FCMA 3F1OB 5GLBA 1MPLA 2ZOHA 1S67L 3FV7A 4MLLA 2HDRA 1PRQA 2QYBA 3F1OA 2HP9A 3PAEA 2L1MA 5HL6A 1P9WA 3T4OA 3A0VA 3CMZA 2XROA 2OWHA 1XGIA 3T50A 3UDXA 3PBSA 5HD3A 5KSCA 5M18A 1KDSA 1E25A 1XA1A 3ZNYA 2EFXA 3KYQA 2WKPA 4C6YA 4R23A 4E3LA 4JPMA 1H8YA 5IT5A 4OQHA 1T19A 2ZM2A 4R38A 3WRTA 2ZLYA 1ES3A 4PMAA 1PNEA 3HVFA 3ZQ5A 3E2LA 4X6TA 4EUVA 1ACFA 3C5AA 3DTIA 4NK3A 2WAFA 1ZKJA 1YSQA 3HLGA 4JXSA 4UAAA 1KE0A 5AQ7A 1XP4A 3MSHA 3QHYA 1STZA 3UB6A 5HPFA 1TS6A 2PR6A 1OTIA 2ZMFA 3UNWA 3CHWP 3CLOA 4R3BA 1GHMA 1UWPX 2XDMA 4OPRA 5L2FA 3MQOA 3FKWA 3LEZA 3K3DA 2FH5A 3ZYTA 3PHYA 4KENB 1K4EA 3VP3A 1P0ZA 1U60A 1Q2QA 2KDKA 3K3CA 2G2WA 3M2KA 1S66L 3EEAA 3SS4A 1P97A 4S2KA 3WWXA 3CG5A 2KX6A 1WYCA 5HARA 4ME4A 4DDSA 4N9LA 3IF5A 5FSRA 4D2OA 3HLEA 3LIAA 3NBLA 5TBMB 2ZD8A 2Y2LA 4QJGA 1FQGA 4FH2A 5EUAA 2JBFA 3IHAA 2L4RA 1ESIA 5TBMA 4P6ZM 5FEGA 3HLBA 3QP5A 2UV0E 4X1LA 3Q82A 1JTGA 1Y28A 5DKLA 3LR3A 3BJNA 2XLNA 3MS6A 3GR2A 3O88A 2JCHA 1ALQA 1YMSA 3C8CA 2HP6A 4U3TA 5L10A 4OH0A 5E2FA 4O8GA 1SZVA 3UDFA 3T1QB 1ERQA 4HHDA 4M4XA 1W79A 5DVAA 3ISGA 3VP2A 3NI9A 5F83A 3P09A 3VP1A 4LCMA 4B93A 3BFGA 4BLMA 3LEQA 5AQAA 5DF7A 4QD4A 1H0MA 4FSFA 2Z6CA 4IVIA 4WEJA 1FIKA 5HAIA 3PBRA 5FDSA 1TDLA 2V1AA 1NYYA 2V1BA 1GA9A 3E4PA 1IYSA 1W63M 1CF0A 1FILA 2XA7M 3K2NA 2XGNA 4QWOA 2PD7A 4GJ4A 5CX7A 4JKTA 4HESA 3BECA 5IU1A 2V8FA 5KMWA 4PM6A 2JKTI 5F1GA 5L8MA 4HJ4A 2W0NA 5DFXA 4JXVA 3BFEA 4UA6A 4QU3A 4OOLA 3LCEA 4YOFA 3WRZA 3UPOA 4EERA 1UGUA 2QKPA 3G31A 3N8RA 1W8QA 2QWSA 1T1AA 2FZ0A 1NZUA 5GLDA 4Z1WA 1F98A 5HWVA 2Y91A 3IBRA 1GSVA 2VV8A 5BOHA 2PAVP 1TVFA 2PU2A 5GLCA 3T4SA 1TF1A 1V9YA 2XF3A 4ZJ2A 1GSWA 1PIOA 1W7FA 5L09A 4X1MA 1L0DA 2JC7A 3IWQA 5GHYA 3TG9A 3T12B 5HDDA 4UA7A 3QNCA 4JBFA 5CTNA 4HH3A 3C2WA 4BMWA 3NIAA 2B02A 2D02A 4IJGA 1VM1A 4FCFA 1J3WA 3UB7A 5HSQA 4E6WA 3KYZA 1BLSA 3LR5A 1QMFA 3ZG5A 1YLPA 4JF6A 1NJ4A 2PRFA 3MKFA 3MF0A 3QP1A 4OP8A 5DF9A 5F1FA 3EGDC 2WGVA 3ITAA 5CHMA 4X25A 1N9OA 4KZ7A 1KOUA 5HW3A 3MXRA 1L0FA 1AWIA 4R0QA 1GA0A 2JKGA 2ZC5B 3S7NA 1HTZA 2HF6A 4NETA 4ETZA 4EESA 1I5QA 5FATA 2XD1A 5A93A 1XGJA 1DP6A 4LCLA 1XKZA 3NC8A 3SS3A 3V5MA 5FAPA 2XH9A 2Y2NA 3C38A 4H6JB 1HD8A 2A3UA 3N8LA 1LL5A 1OTBA 1ES5A 4GZBA 3EQUA 4JGRA 2VGJA 1N9LA 4H6JA 5LBRA 4LGWA 3DWZA 4DJ2A 1HZOA 3O3VA 3FYZA 4CLCE 2K31A 3E4QA 1K56A 5GHXA
chains in the Genus database with same CATH topology
3HUMA 4HBUA 4RX3A 4BENA 4X55A 1SCWA 3BRMA 4MBHA 3OPPA 3G32A 2J9OA 3FWLA 3S1YA 3P98A 3UDIA 5CEBA 1BT5A 2ZJ9A 1ZC2A 2ZQ9A 3CJMA 1BULA 5M1AA 2IWBA 1SDEA 4UA9A 3S4XA 2EXBA 3ZNTA 4XUXA 3CZDA 1FCNA 2WKHA 3G4PA 3PBQA 4KZ6A 3G30A 4GD6A 4Z9QA 1FSYA 2X02A 5GL9A 1E3UD 2R9WA 1BZAA 2DNSA 4KZ8A 2Y2KA 2WKIA 5FA7A 5FQMA 5DTSA 1LLBA 1BLCA 4WBGA 1K55C 4K0XA 3W8KA 1Q2PA 2PBYA 1JWZA 1CEFA 1M40A 1BUEA 3IXGA 1SKFA 2X01A 1LI9A 4WMCA 1Z6FA 4KZAA 5JYOA 2Y2JA 3HUOA 1FCMA 3RXWA 2OV5A 2BG1A 3G35A 3IWIA 5GLBA 1MKIA 1MPLA 3I7JA 4GKUA 3C4PA 2XK1A 5E43A 3DWKA 2ZM8A 3FV7A 4OPYA 4QY5A 4IBXA 4MLLA 4JF5A 3ZG8B 1MY8A 2HDRA 2OLVA 4JXWA 5CERA 2WKEA 3V3SA 1ZG4A 1IKGA 4QY6A 2V20A 2HP9A 3G2YA 3UO9A 3PAEA 1ONGA 1NXYA 1PI4A 4MEZA 1IELA 2Q9NA 1CI9A 2FFFB 3S22A 3G34A 4BL3A 3CMZA 2JE5A 4DRTA 4Y7PA 1JWVA 1KDWA 4OQIA 1N9BA 4YFMA 4DE1A 3NY4A 2QPNA 1XGIA 3UDXA 3C7UA 3PBSA 5FASA 5KSCA 3IXBA 3C7VA 3NDEA 5M18A 1KDSA 4GB7A 1NYMA 3A3JA 4ID4A 1PWDA 1E25A 1XA1A 4OKPA 4OOYA 3ZNYA 2EFXA 1NRFA 3A3IA 4BL2A 3M6BA 2XQZA 1BLHA 4C6YA 1N4OA 4P6BA 4DE2A 4R23A 4E3LA 4JPMA 3NDGA 5EOEA 1H8YA 1S0WA 3GV9A 4OQHA 2ZM2A 2V1ZA 3WRTA 1MWSA 2ZLYA 1ES3A 1FOFA 4PMAA 3HVFA 2UWXA 3UE0A 3E2LA 4XXRA 4X6TA 2QZ6A 4KQQA 3C5AA 4NK3A 2WAFA 2HDQA 5DTKA 1ZKJA 4R1GA 3HLGA 3IXHA 4JXSA 4R4RA 4UAAA 4EBNA 1KE0A 4RYEA 5AQ7A 1XP4A 3QHYA 4H8RA 5G18A 4KZ3A 3W4PA 5J8XA 3SH9A 1YLYA 2WUQA 4E3OA 4DKIA 1YLWA 1IKIA 5IHVA 4WM9A 1I2WA 4PM7A 3ZFZA 3UNWA 1DJBA 2Y2HA 4WZ4A 4R3BA 5HAQA 3PBOA 1GHMA 4S2JA 2WGIA 2Y2QA 3N7WA 2EFUA 5FDHA 2C6WB 5HFOA 1M6KA 2XDMA 3MKEA 3QNBA 4M3KA 1RGZA 4OP5A 4OPRA 3VFFA 4DDYA 5L2FA 3B3XA 2ZQ7A 3HLWA 4S2MA 3D4FA 1YLJA 5FQKA 1W8YA 3GMWA 2H0YA 5EE8A 1TEMA 2G2UA 2X71A 4PM8A 3FKWA 3ZDJA 3LEZA 4GDNA 4S2OA 4ZJ3A 4KENB 1K4EA 5EVIB 2ZQDA 3VP3A 1O07A 4EWFA 1U60A 5FQIA 1Q2QA 3MBZA 3PTEA 1CI8A 5E2GA 2DRWA 4JLFA 1SHVA 2G2WA 4WELA 5CHJA 3SH7A 3UPNA 3M2KA 1KE3A 2ZC6B 3HLFA 3SOIA 4R3JA 4IVKA 5EVIA 4P87A 5FQQA 2WZXA 1EROA 3MXSA 3SS4A 1H8ZA 5AQBA 4DF6A 2OLUA 4S2KA 1FR6A 3WWXA 3CG5A 1XA7A 5FQ9A 3IF6B 1WYCA 1PZPA 5HARA 4DDSA 4N9LA 1W5DA 3BYDA 3IF5A 3MZEA 4FD8A 3O86A 4JXGA 2Z2MB 4Y0TA 5FSRA 1MWUA 3RXXA 4D2OA 3HLEA 3NBLA 1K25A 4HBTA 2ZD8A 2Y2LA 3IF6A 5AQ9A 4ZJ1A 4KZBA 4QJGA 3IQAA 2ZQAA 4KZ4A 1ERMA 1FQGA 4K91A 4FH2A 5EUAA 3MZFA 2JBFA 3IHAA 3ZVWA 1ESUA 2ZC7A 1J9MA 1ESIA 5HAPA 2EX8A 3Q07A 3VOYA 3HLBA 2HDSA 3IT9A 3JYIA 2QMIA 4Y0UA 3WS0A 1L2SA 4LV0A 2Y2MA 1E3UA 1QMEA 1JTGA 3Q82A 2H0TA 2ZC4B 3A3DA 3LO7A 5M19A 2ZQ8A 1BSGA 2XLNA 4N1XA 5EECA 3GR2A 3O88A 2XR0A 1L0GA 4BD1A 2JCHA 3VSKA 1FCOA 1BLPA 4KG6A 4MBKA 2ZM0A 4S2NA 5FAOA 4E6XA 1FR1A 1ALQA 1YMSA 5A92A 5CTMA 2HP6A 4DXBA 4U3TA 1MBLA 2J8YA 4X68A 5EOOA 4OH0A 5CGWA 5E2FA 4JF4A 1FSWA 1KGEA 4DE0A 4X53A 4ZTKA 4ZAMA 1PW8A 3PBTA 4OOMA 3BEBA 3M2JA 1YQSA 3UDFA 4A5RA 2FFYA 3OPLA 1OMEA 4C3QA 5U47A 1K57A 5A91A 2ZMAA 1ERQA 1ZG6A 1KVLA 5FQJA 3HBRA 5E2EA 3UPPA 2I72A 1W79A 5DVAA 3ISGA 4OVDA 2XFSA 2ZC3B 3VP2A 4S2IA 4MNRA 3NI9A 3Q1FA 5F83A 3GRJA 3P09A 3VP1A 4LCMA 1L0EA 3BFGA 4IBRA 4BD0A 4BLMA 3MZDA 3UE3A 4RVAA 3VOZA 5AQAA 3HREA 4GD8A 4PM5A 1JVJA 3HLDA 5EVIC 5DF7A 2HPBA 1GCEA 2EX9A 2V2FF 4QD4A 5FI2A 3ZG0A 4FSFA 1DJAA 3GTCA 3PBNA 4IVIA 2XD5A 4WEJA 5HAIA 3PBRA 3E2KA 3MFDA 1TDLA 4B4XA 1NYYA 3M6HA 4ZDXA 2BLSA 3LY4A 1GA9A 2Y2IA 1IYSA 2R9XA 3W4QA 1EI5A 2EX2A 3SH8A 1AXBA 3HLCA 4OPZA 4PPRA 4EBPA 3OCLA 2XGNA 3IH8A 3OCNA 3IF6C 3IWOA 2B5RA 3TSGA 3BM6A 2WYXA 4GNUA 2XFTA 1KE4A 4JKTA 1PWGA 1PW1A 2H10A 4HESA 3BECA 1MXOA 3Q81A 3GQZA 4E3IA 4KG2A 4EUZA 4UHUA 3OPHA 5KMWA 4PM6A 5EPHA 3WS5A 4EBLA 1GHPA 1RP5A 4RA7A 5F1GA 1G6AA 1XPBA 1E4DA 5CGXA 1S6RA 1GHIA 1K38A 4BQMA 4JXVA 3BFEA 4UA6A 2DCFA 1K56D 4E3NA 4QU3A 5FAQA 4OLGA 1VQQA 4OOLA 1JWPA 3LY3A 3LCEA 3SS5A 4RX2A 3WRZA 1LL9A 3N4IA 3ITBA 3UPOA 1HVBA 3O87A 4K0WA 1IEMA 4WYYA 2A49A 3V50A 1YLTA 3C4OA 2WADA 3G31A 4CPKA 1DJCA 3N8RA 4WZ5A 4EQIA 4ZBEA 2IWCA 5F82A 4KQRA 1RGYA 4GOGA 2E8IA 1ES4A 1W8QA 1EWZA 3IXDA 1RCJA 2J7VA 4KG5A 3VFHA 4GN2A 3TOIA 3IH9A 2Y4AA 4X56A 5CHUA 4OQ0A 2ZQCA 1IYPA 3RJUA 4BJPA 1K57C 1NZUA 4E3JA 5GLDA 2RL3A 1G68A 3AGEA 3AGFA 2WGWB 5A90A 4KZ9A 4EV4A 2Y91A 3PAGA 1ES2A 5BOHA 4R4SA 1YLZA 1NZOA 1TVFA 4WMCD 2PU4A 5HL1A 2PU2A 1SDNA 5GLCA 4N92A 1IYOA 2RCXA 3ZGAB 1XX2A 2WGWA 2XF3A 5HX9A 2J9PA 4N9KA 4ZJ2A 2HP5A 1PIOA 1W7FA 4IEDA 4LV1A 1L0DA 2JC7A 3IWQA 5CEDA 5GHYA 1KVMA 3TG9A 3Q7VB 1ONHA 3Q7ZA 4UA7A 5CXWA 3GVBA 3G2ZA 3QNCA 4LV3A 4JBFA 4OQGA 5CTNA 1K54A 5EVLA 3UY6A 3NIAA 1KGFA 3VP0A 5I94A 1MWRA 4LV2A 2H5SA 4DE3A 5FI6A 4PM9A 1VM1A 3Q7VA 4FCFA 4E6WA 1PWCA 2Y2OA 3BLMA 4OONA 3VP4A 1BLSA 4U0XA 2WZZA 3VSLA 2XEPA 5CECA 2OSUA 1QMFA 3ZCZA 3ZG5A 4X69A 2IWDA 5D3OA 3V3RA 3DTMA 1YLPA 3NCKA 1TDGA 4L0LA 4YINA 4JF6A 1NJ4A 3HUNA 1PZOA 3WS4A 5CGSA 3MKFA 4OLDA 5DTTA 5DF9A 4OP8A 5F1FA 3ZVTA 2WGVA 3ITAA 5CHMA 1LI0A 4LENA 1BTLA 2C5WB 5CRFA 1WYBA 5FI7A 3ZHHA 3BFCA 3UN7A 4KZ7A 4P0MA 2WAEA 4U0TA 4B4ZA 4E3KA 5HW3A 3MXRA 1L0FA 3N6IA 5TR7A 4CJNA 4E3MA 3OC2A 2Y55A 4R0QA 5DF8A 4QHCA 1K55A 1YT4A 5E2HA 1GA0A 2ZC5B 4WZ5C 5GLAA 5GHZA 1HTZA 3N8SA 4KZ5A 4F94A 4NETA 4O7DA 4GDBA 1K6RA 4S2LA 3OZHA 2WK0A 1I2SA 5KZHA 1PI5A 3HL9A 2CC1A 4KQOA 3FKVA 1I5QA 1XXMA 5FATA 2Y59A 2Z2LB 3A3EA 5TFQA 3UE1A 2XD1A 5A93A 1XGJA 4FH4A 5TGFA 4N1HA 4LCLA 1JTDA 2Y2PA 3W4OA 2EX6A 1K4FA 4DXCA 4C75A 2HDUA 3V39A 1XKZA 2Q9MA 1MWTA 1YMXA 3NC8A 3EQVA 3ZG7B 4Q8IA 2P9VB 2EXAA 2P74A 1K6SA 4Y0OA 1Y54A 1PYYA 3SS3A 4WEKA 3V5MA 5FAPA 4MBFA 1C3BA 4HEFA 3BFDA 2XH9A 2Y2NA 1IYQA 1HD8A 2A3UA 2VGKA 3A3FA 4OPQA 3N8LA 1CEGA 1LL5A 1KGGA 1LHYA 4GZBA 1ES5A 3FZCA 2P9VA 4S2NC 1NY0A 3EQUA 1DY6A 1H5XA 3DW0A 2VGJA 4B88A 3WS2A 5JYPA 1YM1A 3BLSA 3GSGA 5EVID 2Y2GA 3ZG9B 3DWZA 4P85A 1WE4A 1K54C 3OPRA 3WS1A 1CK3A 1HZOA 3O3VA 3FYZA 4S2PA 4QB8A 4XUZA 2GDNA 3BFFA 3IHBA 5KSHA 1K56A 1O7EA 5GHXA 3AGDA 3VMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUM A;  4HBU A;  4RX3 A;  4BEN A;  4X55 A;  1SCW A;  3BRM A;  4MBH A;  3OPP A;  3G32 A;  2J9O A;  3FWL A;  3S1Y A;  3P98 A;  3UDI A;  5CEB A;  1BT5 A;  2ZJ9 A;  1ZC2 A;  2ZQ9 A;  3CJM A;  1BUL A;  5M1A A;  2IWB A;  1SDE A;  4UA9 A;  3S4X A;  2EXB A;  3ZNT A;  4XUX A;  3CZD A;  1FCN A;  2WKH A;  3G4P A;  3PBQ A;  4KZ6 A;  3G30 A;  4GD6 A;  4Z9Q A;  1FSY A;  2X02 A;  5GL9 A;  1E3U D;  2R9W A;  1BZA A;  2DNS A;  4KZ8 A;  2Y2K A;  2WKI A;  5FA7 A;  5FQM A;  5DTS A;  1LLB A;  1BLC A;  4WBG A;  1K55 C;  4K0X A;  3W8K A;  1Q2P A;  2PBY A;  1JWZ A;  1CEF A;  1M40 A;  1BUE A;  3IXG A;  1SKF A;  2X01 A;  1LI9 A;  4WMC A;  1Z6F A;  4KZA A;  5JYO A;  2Y2J A;  3HUO A;  1FCM A;  3RXW A;  2OV5 A;  2BG1 A;  3G35 A;  3IWI A;  5GLB A;  1MKI A;  1MPL A;  3I7J A;  4GKU A;  3C4P A;  2XK1 A;  5E43 A;  3DWK A;  2ZM8 A;  3FV7 A;  4OPY A;  4QY5 A;  4IBX A;  4MLL A;  4JF5 A;  3ZG8 B;  1MY8 A;  2HDR A;  2OLV A;  4JXW A;  5CER A;  2WKE A;  3V3S A;  1ZG4 A;  1IKG A;  4QY6 A;  2V20 A;  2HP9 A;  3G2Y A;  3UO9 A;  3PAE A;  1ONG A;  1NXY A;  1PI4 A;  4MEZ A;  1IEL A;  2Q9N A;  1CI9 A;  2FFF B;  3S22 A;  3G34 A;  4BL3 A;  3CMZ A;  2JE5 A;  4DRT A;  4Y7P A;  1JWV A;  1KDW A;  4OQI A;  1N9B A;  4YFM A;  4DE1 A;  3NY4 A;  2QPN A;  1XGI A;  3UDX A;  3C7U A;  3PBS A;  5FAS A;  5KSC A;  3IXB A;  3C7V A;  3NDE A;  5M18 A;  1KDS A;  4GB7 A;  1NYM A;  3A3J A;  4ID4 A;  1PWD A;  1E25 A;  1XA1 A;  4OKP A;  4OOY A;  3ZNY A;  2EFX A;  1NRF A;  3A3I A;  4BL2 A;  3M6B A;  2XQZ A;  1BLH A;  4C6Y A;  1N4O A;  4P6B A;  4DE2 A;  4R23 A;  4E3L A;  4JPM A;  3NDG A;  5EOE A;  1H8Y A;  1S0W A;  3GV9 A;  4OQH A;  2ZM2 A;  2V1Z A;  3WRT A;  1MWS A;  2ZLY A;  1ES3 A;  1FOF A;  4PMA A;  3HVF A;  2UWX A;  3UE0 A;  3E2L A;  4XXR A;  4X6T A;  2QZ6 A;  4KQQ A;  3C5A A;  4NK3 A;  2WAF A;  2HDQ A;  5DTK A;  1ZKJ A;  4R1G A;  3HLG A;  3IXH A;  4JXS A;  4R4R A;  4UAA A;  4EBN A;  1KE0 A;  4RYE A;  5AQ7 A;  1XP4 A;  3QHY A;  4H8R A;  5G18 A;  4KZ3 A;  3W4P A;  5J8X A;  3SH9 A;  1YLY A;  2WUQ A;  4E3O A;  4DKI A;  1YLW A;  1IKI A;  5IHV A;  4WM9 A;  1I2W A;  4PM7 A;  3ZFZ A;  3UNW A;  1DJB A;  2Y2H A;  4WZ4 A;  4R3B A;  5HAQ A;  3PBO A;  1GHM A;  4S2J A;  2WGI A;  2Y2Q A;  3N7W A;  2EFU A;  5FDH A;  2C6W B;  5HFO A;  1M6K A;  2XDM A;  3MKE A;  3QNB A;  4M3K A;  1RGZ A;  4OP5 A;  4OPR A;  3VFF A;  4DDY A;  5L2F A;  3B3X A;  2ZQ7 A;  3HLW A;  4S2M A;  3D4F A;  1YLJ A;  5FQK A;  1W8Y A;  3GMW A;  2H0Y A;  5EE8 A;  1TEM A;  2G2U A;  2X71 A;  4PM8 A;  3FKW A;  3ZDJ A;  3LEZ A;  4GDN A;  4S2O A;  4ZJ3 A;  4KEN B;  1K4E A;  5EVI B;  2ZQD A;  3VP3 A;  1O07 A;  4EWF A;  1U60 A;  5FQI A;  1Q2Q A;  3MBZ A;  3PTE A;  1CI8 A;  5E2G A;  2DRW A;  4JLF A;  1SHV A;  2G2W A;  4WEL A;  5CHJ A;  3SH7 A;  3UPN A;  3M2K A;  1KE3 A;  2ZC6 B;  3HLF A;  3SOI A;  4R3J A;  4IVK A;  5EVI A;  4P87 A;  5FQQ A;  2WZX A;  1ERO A;  3MXS A;  3SS4 A;  1H8Z A;  5AQB A;  4DF6 A;  2OLU A;  4S2K A;  1FR6 A;  3WWX A;  3CG5 A;  1XA7 A;  5FQ9 A;  3IF6 B;  1WYC A;  1PZP A;  5HAR A;  4DDS A;  4N9L A;  1W5D A;  3BYD A;  3IF5 A;  3MZE A;  4FD8 A;  3O86 A;  4JXG A;  2Z2M B;  4Y0T A;  5FSR A;  1MWU A;  3RXX A;  4D2O A;  3HLE A;  3NBL A;  1K25 A;  4HBT A;  2ZD8 A;  2Y2L A;  3IF6 A;  5AQ9 A;  4ZJ1 A;  4KZB A;  4QJG A;  3IQA A;  2ZQA A;  4KZ4 A;  1ERM A;  1FQG A;  4K91 A;  4FH2 A;  5EUA A;  3MZF A;  2JBF A;  3IHA A;  3ZVW A;  1ESU A;  2ZC7 A;  1J9M A;  1ESI A;  5HAP A;  2EX8 A;  3Q07 A;  3VOY A;  3HLB A;  2HDS A;  3IT9 A;  3JYI A;  2QMI A;  4Y0U A;  3WS0 A;  1L2S A;  4LV0 A;  2Y2M A;  1E3U A;  1QME A;  1JTG A;  3Q82 A;  2H0T A;  2ZC4 B;  3A3D A;  3LO7 A;  5M19 A;  2ZQ8 A;  1BSG A;  2XLN A;  4N1X A;  5EEC A;  3GR2 A;  3O88 A;  2XR0 A;  1L0G A;  4BD1 A;  2JCH A;  3VSK A;  1FCO A;  1BLP A;  4KG6 A;  4MBK A;  2ZM0 A;  4S2N A;  5FAO A;  4E6X A;  1FR1 A;  1ALQ A;  1YMS A;  5A92 A;  5CTM A;  2HP6 A;  4DXB A;  4U3T A;  1MBL A;  2J8Y A;  4X68 A;  5EOO A;  4OH0 A;  5CGW A;  5E2F A;  4JF4 A;  1FSW A;  1KGE A;  4DE0 A;  4X53 A;  4ZTK A;  4ZAM A;  1PW8 A;  3PBT A;  4OOM A;  3BEB A;  3M2J A;  1YQS A;  3UDF A;  4A5R A;  2FFY A;  3OPL A;  1OME A;  4C3Q A;  5U47 A;  1K57 A;  5A91 A;  2ZMA A;  1ERQ A;  1ZG6 A;  1KVL A;  5FQJ A;  3HBR A;  5E2E A;  3UPP A;  2I72 A;  1W79 A;  5DVA A;  3ISG A;  4OVD A;  2XFS A;  2ZC3 B;  3VP2 A;  4S2I A;  4MNR A;  3NI9 A;  3Q1F A;  5F83 A;  3GRJ A;  3P09 A;  3VP1 A;  4LCM A;  1L0E A;  3BFG A;  4IBR A;  4BD0 A;  4BLM A;  3MZD A;  3UE3 A;  4RVA A;  3VOZ A;  5AQA A;  3HRE A;  4GD8 A;  4PM5 A;  1JVJ A;  3HLD A;  5EVI C;  5DF7 A;  2HPB A;  1GCE A;  2EX9 A;  2V2F F;  4QD4 A;  5FI2 A;  3ZG0 A;  4FSF A;  1DJA A;  3GTC A;  3PBN A;  4IVI A;  2XD5 A;  4WEJ A;  5HAI A;  3PBR A;  3E2K A;  3MFD A;  1TDL A;  4B4X A;  1NYY A;  3M6H A;  4ZDX A;  2BLS A;  3LY4 A;  1GA9 A;  2Y2I A;  1IYS A;  2R9X A;  3W4Q A;  1EI5 A;  2EX2 A;  3SH8 A;  1AXB A;  3HLC A;  4OPZ A;  4PPR A;  4EBP A;  3OCL A;  2XGN A;  3IH8 A;  3OCN A;  3IF6 C;  3IWO A;  2B5R A;  3TSG A;  3BM6 A;  2WYX A;  4GNU A;  2XFT A;  1KE4 A;  4JKT A;  1PWG A;  1PW1 A;  2H10 A;  4HES A;  3BEC A;  1MXO A;  3Q81 A;  3GQZ A;  4E3I A;  4KG2 A;  4EUZ A;  4UHU A;  3OPH A;  5KMW A;  4PM6 A;  5EPH A;  3WS5 A;  4EBL A;  1GHP A;  1RP5 A;  4RA7 A;  5F1G A;  1G6A A;  1XPB A;  1E4D A;  5CGX A;  1S6R A;  1GHI A;  1K38 A;  4BQM A;  4JXV A;  3BFE A;  4UA6 A;  2DCF A;  1K56 D;  4E3N A;  4QU3 A;  5FAQ A;  4OLG A;  1VQQ A;  4OOL A;  1JWP A;  3LY3 A;  3LCE A;  3SS5 A;  4RX2 A;  3WRZ A;  1LL9 A;  3N4I A;  3ITB A;  3UPO A;  1HVB A;  3O87 A;  4K0W A;  1IEM A;  4WYY A;  2A49 A;  3V50 A;  1YLT A;  3C4O A;  2WAD A;  3G31 A;  4CPK A;  1DJC A;  3N8R A;  4WZ5 A;  4EQI A;  4ZBE A;  2IWC A;  5F82 A;  4KQR A;  1RGY A;  4GOG A;  2E8I A;  1ES4 A;  1W8Q A;  1EWZ A;  3IXD A;  1RCJ A;  2J7V A;  4KG5 A;  3VFH A;  4GN2 A;  3TOI A;  3IH9 A;  2Y4A A;  4X56 A;  5CHU A;  4OQ0 A;  2ZQC A;  1IYP A;  3RJU A;  4BJP A;  1K57 C;  1NZU A;  4E3J A;  5GLD A;  2RL3 A;  1G68 A;  3AGE A;  3AGF A;  2WGW B;  5A90 A;  4KZ9 A;  4EV4 A;  2Y91 A;  3PAG A;  1ES2 A;  5BOH A;  4R4S A;  1YLZ A;  1NZO A;  1TVF A;  4WMC D;  2PU4 A;  5HL1 A;  2PU2 A;  1SDN A;  5GLC A;  4N92 A;  1IYO A;  2RCX A;  3ZGA B;  1XX2 A;  2WGW A;  2XF3 A;  5HX9 A;  2J9P A;  4N9K A;  4ZJ2 A;  2HP5 A;  1PIO A;  1W7F A;  4IED A;  4LV1 A;  1L0D A;  2JC7 A;  3IWQ A;  5CED A;  5GHY A;  1KVM A;  3TG9 A;  3Q7V B;  1ONH A;  3Q7Z A;  4UA7 A;  5CXW A;  3GVB A;  3G2Z A;  3QNC A;  4LV3 A;  4JBF A;  4OQG A;  5CTN A;  1K54 A;  5EVL A;  3UY6 A;  3NIA A;  1KGF A;  3VP0 A;  5I94 A;  1MWR A;  4LV2 A;  2H5S A;  4DE3 A;  5FI6 A;  4PM9 A;  1VM1 A;  3Q7V A;  4FCF A;  4E6W A;  1PWC A;  2Y2O A;  3BLM A;  4OON A;  3VP4 A;  1BLS A;  4U0X A;  2WZZ A;  3VSL A;  2XEP A;  5CEC A;  2OSU A;  1QMF A;  3ZCZ A;  3ZG5 A;  4X69 A;  2IWD A;  5D3O A;  3V3R A;  3DTM A;  1YLP A;  3NCK A;  1TDG A;  4L0L A;  4YIN A;  4JF6 A;  1NJ4 A;  3HUN A;  1PZO A;  3WS4 A;  5CGS A;  3MKF A;  4OLD A;  5DTT A;  5DF9 A;  4OP8 A;  5F1F A;  3ZVT A;  2WGV A;  3ITA A;  5CHM A;  1LI0 A;  4LEN A;  1BTL A;  2C5W B;  5CRF A;  1WYB A;  5FI7 A;  3ZHH A;  3BFC A;  3UN7 A;  4KZ7 A;  4P0M A;  2WAE A;  4U0T A;  4B4Z A;  4E3K A;  5HW3 A;  3MXR A;  1L0F A;  3N6I A;  5TR7 A;  4CJN A;  4E3M A;  3OC2 A;  2Y55 A;  4R0Q A;  5DF8 A;  4QHC A;  1K55 A;  1YT4 A;  5E2H A;  1GA0 A;  2ZC5 B;  4WZ5 C;  5GLA A;  5GHZ A;  1HTZ A;  3N8S A;  4KZ5 A;  4F94 A;  4NET A;  4O7D A;  4GDB A;  1K6R A;  4S2L A;  3OZH A;  2WK0 A;  1I2S A;  5KZH A;  1PI5 A;  3HL9 A;  2CC1 A;  4KQO A;  3FKV A;  1I5Q A;  1XXM A;  5FAT A;  2Y59 A;  2Z2L B;  3A3E A;  5TFQ A;  3UE1 A;  2XD1 A;  5A93 A;  1XGJ A;  4FH4 A;  5TGF A;  4N1H A;  4LCL A;  1JTD A;  2Y2P A;  3W4O A;  2EX6 A;  1K4F A;  4DXC A;  4C75 A;  2HDU A;  3V39 A;  1XKZ A;  2Q9M A;  1MWT A;  1YMX A;  3NC8 A;  3EQV A;  3ZG7 B;  4Q8I A;  2P9V B;  2EXA A;  2P74 A;  1K6S A;  4Y0O A;  1Y54 A;  1PYY A;  3SS3 A;  4WEK A;  3V5M A;  5FAP A;  4MBF A;  1C3B A;  4HEF A;  3BFD A;  2XH9 A;  2Y2N A;  1IYQ A;  1HD8 A;  2A3U A;  2VGK A;  3A3F A;  4OPQ A;  3N8L A;  1CEG A;  1LL5 A;  1KGG A;  1LHY A;  4GZB A;  1ES5 A;  3FZC A;  2P9V A;  4S2N C;  1NY0 A;  3EQU A;  1DY6 A;  1H5X A;  3DW0 A;  2VGJ A;  4B88 A;  3WS2 A;  5JYP A;  1YM1 A;  3BLS A;  3GSG A;  5EVI D;  2Y2G A;  3ZG9 B;  3DWZ A;  4P85 A;  1WE4 A;  1K54 C;  3OPR A;  3WS1 A;  1CK3 A;  1HZO A;  3O3V A;  3FYZ A;  4S2P A;  4QB8 A;  4XUZ A;  2GDN A;  3BFF A;  3IHB A;  5KSH A;  1K56 A;  1O7E A;  5GHX A;  3AGD A;  3VMA A; 
#chains in the Genus database with same CATH topology
 1XFN A;  4RX3 A;  2ZMV A;  3C30 A;  2J9O A;  3FWL A;  5CEB A;  3UDI A;  4HNB A;  3UME A;  1SDE A;  4UA9 A;  2WKH A;  3G4P A;  3LIE A;  3PBQ A;  4KZ6 A;  4Z9Q A;  5J7E A;  2X02 A;  2DNS A;  2Y2K A;  2INW A;  5FA7 A;  2KOI A;  2EA9 A;  1BLC A;  1JWZ A;  1CEF A;  3IXG A;  4NXB A;  2X01 A;  4WMC A;  1Z6F A;  4MCW A;  4DMZ A;  2W1R A;  3T4T A;  3RXW A;  2OV5 A;  3G35 A;  3GEC A;  3I7J A;  1XJ2 A;  3C4P A;  4QY5 A;  4NXF A;  4FTX A;  3V3S A;  4QY6 A;  4HI4 A;  1NXY A;  1OTD A;  1PI4 A;  1IEL A;  1CI9 A;  2FFF B;  2PD8 A;  3S22 A;  4BL3 A;  4Y7P A;  1JWV A;  1DP8 A;  3D9Y A;  2V0U A;  3NDE A;  2K2N A;  4EXO A;  4GB7 A;  4OKP A;  4OOY A;  4ID4 A;  2QHK A;  4I3I A;  5HWW A;  3E0Y A;  3UB9 A;  1FOF A;  4IHQ A;  1GSX A;  3KYE A;  3A0S A;  5DTK A;  4R1G A;  4R4R A;  4RYE A;  4G3V A;  4H8R A;  4WUJ A;  3CUE C;  4E3O A;  4DKI A;  3H9W A;  1I2W A;  4PM7 A;  2Y2H A;  4NXE A;  4WZ4 A;  2K7S A;  3PBO A;  2B95 A;  2C6W B;  5HFO A;  1M6K A;  4KUO A;  4BBT A;  3PYP A;  1RGZ A;  4OP5 A;  4DDY A;  1W8Y A;  5EE8 A;  1OT9 A;  3T1R A;  5EM0 A;  3ZDJ A;  4EET B;  4S2O A;  3HCY A;  5TJJ A;  2ZQD A;  2NUP C;  1W63 Q;  3LGO A;  1G6O A;  4MDZ A;  3PTE A;  5E2G A;  1SHV A;  4WEL A;  3UPN A;  4Q0H A;  3SOI A;  2J3W A;  4IVK A;  2HZ5 A;  2VV6 A;  4P87 A;  5FQQ A;  2G7U A;  1S4S A;  2HGV A;  4R6L A;  5FQ9 A;  1PZP A;  2OAQ 1;  2OWJ A;  1DP9 A;  3RXX A;  2YKH A;  2XRN A;  3T4J A;  3LUQ A;  4KZB A;  1ERM A;  3ZVW A;  1ESU A;  3Q07 A;  3VOY A;  3QP8 A;  2HDS A;  3WS0 A;  4LV0 A;  1E3U A;  1QME A;  1S1Y A;  3A3D A;  3S7P A;  3NUL A;  4N1X A;  4BD1 A;  2XR0 A;  3VSK A;  3F1N B;  4MBK A;  4KG6 A;  4S2N A;  4E6X A;  1VHM A;  5A92 A;  3PXP A;  2QJ5 A;  2MJ6 A;  3F1N A;  1FSW A;  1KGE A;  4DE0 A;  4X53 A;  4ZTK A;  4ZAM A;  4OOM A;  2BAS A;  1YQS A;  2FFY A;  3OPL A;  2ZMA A;  4KQD A;  5FQJ A;  4GS9 B;  2ZC3 B;  2ACG A;  1OPX A;  4MNR A;  3L7H A;  1Z09 A;  4S2I A;  4Y17 A;  4IBR A;  2XSS A;  4RVA A;  4GD8 A;  4GS9 A;  1JVJ A;  2JKR M;  2V2F F;  3BQ8 A;  5FI2 A;  1DJA A;  2XD5 A;  3W2Z A;  3E2K A;  1V9Z A;  2AVX A;  2Y2I A;  2R9X A;  1EI5 A;  3UE6 A;  3HLC A;  4EBP A;  1YKD A;  3OCL A;  3OCN A;  2PT7 A;  4GNU A;  2XFT A;  1KE4 A;  1MKM A;  1MXO A;  4E3I A;  4KG2 A;  3OPH A;  5C5K A;  4EBL A;  4RA7 A;  1G6A A;  2OAP 1;  5CGX A;  1F5M A;  4BQM A;  2DCF A;  4O0P A;  4E3N A;  3MQQ A;  3GDI A;  3O5Y A;  3N4I A;  3O87 A;  2A49 A;  1VB6 A;  4HQA A;  1YLT A;  4NEE D;  2WAD A;  2IWC A;  2J3T C;  5F82 A;  4KQR A;  1RGY A;  2ZBB A;  3VFH A;  4KG5 A;  1EWZ A;  3RJU A;  4BJP A;  3ICY A;  4WN5 A;  1G68 A;  3CIT A;  4I3J A;  1CJF A;  2W3F A;  3LR4 A;  2W3D A;  1YLZ A;  5HL1 A;  2PU4 A;  4CLC D;  1SDN A;  4N92 A;  1IYO A;  1XX2 A;  2Z6D A;  4JGQ A;  3KX0 X;  4IED A;  4Y5F A;  1LT0 A;  5CED A;  1MC0 A;  1KVM A;  3LID A;  3Q7V B;  3GVB A;  3DBA A;  1K54 A;  5EFW A;  5AVE A;  1XFQ A;  3Q7V A;  3VE3 A;  3BLM A;  3VOL A;  4OON A;  3LI8 A;  2XEP A;  2O9A A;  4XT2 B;  2IWD A;  1TDG A;  3QP6 A;  2I9V A;  3IS2 B;  1PZO A;  3R7W B;  2W1T B;  4XT2 A;  1LI0 A;  4LEN A;  1BTL A;  5CRF A;  3MJQ A;  3ZHH A;  3IS2 A;  4P0M A;  4B4Z A;  3BY8 A;  3N6I A;  4GLQ A;  3RFB A;  4CJN A;  3OC2 A;  2Y55 A;  4E3M A;  3R7W A;  2W1T A;  5DF8 A;  1YSP A;  1YT4 A;  5E2H A;  5GHZ A;  3N8S A;  4GDB A;  3EOI A;  2WK0 A;  3NOP C;  3FPV A;  4KQO A;  1XXM A;  2Z2L B;  4HY8 A;  5TGF A;  4N1H A;  2EX6 A;  1VEU B;  2HDU A;  3EGX C;  2P9V B;  3T1X A;  1PYY A;  1IYQ A;  2VGK A;  1VEU A;  5F68 A;  1CEG A;  4WL9 A;  2P9V A;  1DY6 A;  3DW0 A;  4B88 A;  1XJ6 A;  3WS2 A;  3BLS A;  3RTY A;  4Y2F A;  2Y2G A;  2WKR A;  2VKS A;  4QB8 A;  2D01 A;  5KIZ A;  4FOF A;  2QJ7 A;  4HP4 A;  2KLI A;  4BEN A;  2WKQ A;  1SCW A;  3OPP A;  3NOU C;  1ZC2 A;  4QPR A;  2IWB A;  3ZNT A;  3G30 A;  3KO6 A;  3QP4 A;  2E8J A;  2WKI A;  3OOV A;  5FQM A;  4WBG A;  4K0X A;  2PBY A;  1M40 A;  1BUE A;  3P7N A;  1NLZ A;  4G3W A;  3V67 A;  3HUO A;  4PHT A;  2J3T D;  2XK1 A;  5E43 A;  2ZM8 A;  3ZG8 B;  4JF5 A;  5CER A;  2OLV A;  4JXW A;  2WKE A;  1ZG4 A;  1IKG A;  3UO9 A;  1ONG A;  4MEZ A;  2Q9N A;  1DRM A;  3G34 A;  5F6A A;  2JE5 A;  4DRT A;  3HJK A;  2HJE A;  4OQI A;  4YFM A;  2QPN A;  4IUH A;  3B42 A;  1F9I A;  3IXB A;  3C7V A;  1PWD A;  4CQH A;  3CI6 A;  2YKF A;  4BL2 A;  3M6B A;  2XQZ A;  1BLH A;  4P6B A;  4BWI A;  4FUW A;  3BQA A;  3NDG A;  5EOE A;  1XJ4 A;  4WF0 A;  3FC7 A;  2V1Z A;  1MWS A;  3LIF A;  2UWX A;  4XXR A;  4KQQ A;  1LSV A;  5G4Y A;  2HDQ A;  2VGL S;  5J3W A;  3IXH A;  3R4K A;  5G18 A;  3W4P A;  4JGP A;  4KZ3 A;  4ARZ B;  1IKI A;  1BYW A;  2W3G A;  4WM9 A;  2HJ9 C;  5HAQ A;  3EWK A;  4S2J A;  2Y2Q A;  3N7W A;  3KSG A;  2EFU A;  4ARZ A;  4EU0 A;  3U2A A;  3QNB A;  4M3K A;  2ZQ7 A;  1L3L A;  4S2M A;  5FQK A;  3GMW A;  2H0Y A;  1TEM A;  4DJ3 A;  3T1S A;  5EVI B;  1O07 A;  4EWF A;  5FQI A;  3CPT B;  3NHQ A;  3MBZ A;  1CQA A;  4Q0J A;  2DRW A;  4JLF A;  2O9B A;  3SH7 A;  5A8B A;  3HLF A;  3LYX A;  2HV1 A;  5EVI A;  2P04 A;  2WZX A;  3MXS A;  3CPT A;  2OLU A;  2J80 A;  3LIC A;  3IF6 B;  3E4O A;  4FD8 A;  4JXG A;  3O86 A;  2M7V A;  4HBT A;  3IF6 A;  4ZJ1 A;  1JNU A;  4BBU A;  4KZ4 A;  3IX3 A;  4K91 A;  4EEP A;  3MZF A;  2ZC7 A;  1J9M A;  2EX8 A;  3JVU A;  3JYI A;  2QMI A;  4Y0U A;  1L2S A;  2Y2M A;  2ZC4 B;  3H82 B;  2ZQ8 A;  3BY9 A;  5DFY A;  3BWL A;  1L0G A;  1IFQ A;  1FCO A;  1BLP A;  2ZM0 A;  1FR1 A;  2A24 B;  2BTF P;  2O9C A;  3H82 A;  3HJI A;  4HJ3 A;  4DXB A;  2V8C A;  4X68 A;  4AFI A;  1PW8 A;  2A24 A;  3BEB A;  3M2J A;  4A5R A;  1K57 A;  5A91 A;  1KVL A;  1ZG6 A;  5E2E A;  2I72 A;  4L9E A;  4OVD A;  2XFS A;  3Q1F A;  4L9F A;  3GRJ A;  4LRX C;  3UE3 A;  3HRE A;  4PM5 A;  2HPB A;  1GCE A;  2EX9 A;  3TJZ C;  3ZG0 A;  3GTC A;  3MFD A;  4KUK A;  2B18 A;  4ZDX A;  2BLS A;  2PHY A;  2Y79 A;  3W4Q A;  3SH8 A;  4OPZ A;  1AXB A;  4PPR A;  4NG2 A;  3U4L P;  5HDC A;  3IWO A;  3S7O A;  2P08 A;  3BM6 A;  4WLA A;  1D06 A;  1PWG A;  2H10 A;  4G3K A;  3GQZ A;  4EUZ A;  4CLC C;  5EPH A;  3WS5 A;  2VLG A;  2PYR A;  1GHI A;  1K38 A;  1K56 D;  5FAQ A;  4OLG A;  1JWP A;  3LY3 A;  3RH8 B;  1LL9 A;  1HVB A;  4K0W A;  1IEM A;  4WYY A;  3BW6 A;  2L0W A;  4CPK A;  2JKT M;  4WZ5 A;  4EQI A;  3QP2 A;  2E8I A;  1S1Z A;  3IXD A;  4JGO A;  3TOI A;  4DN0 A;  2Y4A A;  4X56 A;  5CHU A;  1LSW A;  5J4E A;  2ZQC A;  2M7U A;  3G6O A;  2RL3 A;  5A90 A;  3AGE A;  2WGW B;  4EV4 A;  5L07 A;  1ES2 A;  1NZO A;  4WMC D;  4EW7 A;  2RCX A;  3ZGA B;  2WGW A;  1EW0 A;  5HX9 A;  3VE4 A;  2J9P A;  3B47 A;  4N9K A;  2CMN A;  3KSH A;  4LV1 A;  2Y8H A;  1WA9 A;  3MQ0 A;  3Q7Z A;  3G2Z A;  4LV3 A;  4OQG A;  5EVL A;  3UY6 A;  2W3E A;  1KGF A;  5G4Z A;  3VP0 A;  3JPU A;  2H5S A;  4LV2 A;  5FI6 A;  3L9K A;  4ESP A;  2Y2O A;  3VP4 A;  4U0X A;  1T1B A;  3VSL A;  4MN7 A;  2OSU A;  5CEC A;  3ZCZ A;  4LLO B;  3NEC A;  3DTM A;  4YIN A;  1K0K A;  3HUN A;  3E98 A;  3WS4 A;  3UB5 P;  1IOU A;  2H28 A;  5EVE A;  2C5W B;  1WYB A;  2R78 A;  1PFL A;  2WAE A;  4U0T A;  4I3A A;  4E3K A;  5TR7 A;  5EM1 A;  4UQI S;  1K55 A;  1N9N A;  4ZRR A;  4KZ5 A;  5HZH A;  4O7D A;  1K6R A;  2VEA A;  1I2S A;  4LFU A;  5KZH A;  1PI5 A;  2JHE A;  2CC1 A;  3TRC A;  3FKV A;  5TFQ A;  3UE1 A;  4PAU A;  2Y2P A;  1K4F A;  4DXC A;  4C75 A;  3B33 A;  1YMX A;  3EQV A;  4EQ1 A;  4Q8I A;  2EXA A;  2P74 A;  4MBF A;  1C3B A;  4HEF A;  4YNR A;  5DKK A;  3BFD A;  4OPQ A;  1LHY A;  2O99 A;  1H5X A;  3MMH A;  1Y4O A;  1T1C A;  3ZG9 B;  4P85 A;  1K54 C;  3OPR A;  3WS1 A;  2VGL M;  1CK3 A;  4S2P A;  4XUZ A;  3BFF A;  3IHB A;  5FAS A;  1O7E A;  3VMA A;  1OTE A;  2DMW A;  3BRM A;  1SKO B;  3P98 A;  5I5L A;  1BT5 A;  4HIA A;  3T4Q A;  5M1A A;  2EXB A;  3SZT A;  4XUX A;  3CZD A;  1FCN A;  1SKO A;  2VX8 A;  2P7J A;  1FSY A;  1E3U D;  1TD5 A;  3TE8 A;  1LLB A;  3W8K A;  3DTE A;  1SKF A;  1LI9 A;  2VV7 A;  3FPW A;  5JYO A;  2Y2J A;  1MZU A;  4GCZ A;  3IX8 A;  2BG1 A;  3MFX A;  3IWI A;  3EEH A;  1MKI A;  4GKU A;  1H3Q A;  3DWK A;  4OPY A;  4IBX A;  1MY8 A;  4MN6 A;  1OJ5 A;  5HPI A;  2V20 A;  1YAX A;  3G2Y A;  1KDW A;  4DE1 A;  1N9B A;  3NY4 A;  1LL8 A;  3C7U A;  1NYM A;  3A3J A;  2JKF A;  1NRF A;  3A3I A;  3A0R A;  1N4O A;  4DE2 A;  1P9R A;  1S0W A;  3GV9 A;  5FL3 A;  1HLU P;  4B9O A;  4LRY C;  3UE0 A;  2GZA A;  2QZ6 A;  2GNX A;  4EBN A;  2A2L A;  5J8X A;  3SH9 A;  1YLY A;  2WUQ A;  2EWV A;  1YLW A;  5IHV A;  3ZFZ A;  1DJB A;  1YPR A;  5HD5 A;  4HH2 A;  2WGI A;  5FDH A;  4RQ9 A;  3MKE A;  1D7E A;  3VFF A;  3B3X A;  3HLW A;  3D4F A;  1YLJ A;  2G2U A;  2X71 A;  4PM8 A;  4GDN A;  1NWZ A;  4NKP A;  4ZJ3 A;  3FG8 A;  1VET B;  4GW9 A;  1CI8 A;  5CHJ A;  4Y15 A;  2IA2 A;  3LFV A;  1KE3 A;  3NJA A;  2ZC6 B;  1XJ3 A;  4R3J A;  1ERO A;  1H8Z A;  1VET A;  5AQB A;  4DF6 A;  1FR6 A;  3LR0 A;  1XA7 A;  5FEF A;  1UWN X;  2V0W A;  1W5D A;  3OBF A;  3BYD A;  2V9A A;  3MZE A;  4Y0T A;  2Z2M B;  1MWU A;  4MN5 A;  1K25 A;  5AQ9 A;  3H7W B;  3SW1 A;  3IQA A;  2ZQA A;  2PYP A;  2PR5 A;  3T4L A;  5HAP A;  3IT9 A;  3H7W A;  1T18 A;  2H0T A;  3LO7 A;  5M19 A;  1BSG A;  2OOL A;  5EEC A;  1ODV A;  2GJ3 A;  3LIB A;  5FAO A;  5CTM A;  1MBL A;  2J8Y A;  5EOO A;  5CGW A;  1TS0 A;  4JF4 A;  5DJT A;  3PBT A;  4LPZ A;  3IBJ A;  2JKR I;  3OLO A;  3TW8 A;  1OME A;  4C3Q A;  5U47 A;  3HBR A;  3UPP A;  3KSI A;  1OJG A;  4I39 A;  1L0E A;  5AJG A;  5DJU A;  4BD0 A;  3MZD A;  1LSX A;  3VOZ A;  3PR6 A;  3CAX A;  3D3O A;  1NLY A;  1X0O A;  3HLD A;  5EVI C;  3PBN A;  4BBV A;  3JVV A;  2ZOI A;  4B4X A;  3M6H A;  3T4K A;  3LY4 A;  2ZL1 B;  2EX2 A;  3KSF A;  3IH8 A;  3IF6 C;  3TSG A;  2B5R A;  2WYX A;  5EV0 A;  3DAV A;  1PW1 A;  4L9G A;  4Y3I A;  2ZL1 A;  3Q81 A;  2LB9 A;  4UHU A;  1OT6 A;  2JN7 A;  1GHP A;  1RP5 A;  2W27 A;  3MR0 A;  1OTA A;  1XPB A;  1E4D A;  2Q0O A;  1S6R A;  4UQI M;  5MC7 A;  3CWF A;  2NUT C;  2M1C A;  1VQQ A;  3SS5 A;  4P6Z S;  4RX2 A;  3ITB A;  3V50 A;  3C4O A;  2VZW A;  1DJC A;  4IUK A;  4F3L B;  4ZBE A;  4GHI B;  4GOG A;  1ES4 A;  1RCJ A;  2J7V A;  4GN2 A;  3IH9 A;  4II7 A;  4OQ0 A;  1IYP A;  1K57 C;  4F3L A;  4E3J A;  4GHI A;  3AGF A;  1ZTU A;  4R70 A;  4KZ9 A;  3UB8 A;  3PAG A;  4NXG A;  4R4S A;  4ETX A;  1H8M A;  2VA0 A;  1S4R A;  5HDS A;  2PDR A;  2HP5 A;  4E04 A;  4D60 A;  4HP9 A;  2W3H A;  1ONH A;  5CXW A;  4Y13 A;  5I94 A;  1MWR A;  4DE3 A;  4PM9 A;  5IS1 A;  3NOT C;  4I5S A;  1PWC A;  2WZZ A;  2LB5 A;  2XA7 S;  4X69 A;  5D3O A;  3MXQ A;  3V3R A;  3NCK A;  2VK3 A;  4L0L A;  5CGS A;  4OLD A;  4O01 A;  5DTT A;  1G5U A;  4HJ6 A;  3ZVT A;  4EEU A;  5F69 A;  3F1P B;  3UMD A;  5FI7 A;  3BFC A;  3UN7 A;  4PKY G;  4R3A A;  1ZHH B;  4QHC A;  4WZ5 C;  3F1P A;  5GLA A;  3DTK A;  1D1J A;  4F94 A;  4S2L A;  3OZH A;  1TS7 A;  3HL9 A;  1F2K A;  3D72 A;  3ULF A;  3S7Q A;  2Y59 A;  1TS8 A;  3A3E A;  4FH4 A;  3W4O A;  1JTD A;  2O0Y A;  4I38 A;  1A0K A;  3V39 A;  2Q9M A;  1MWT A;  3ZG7 B;  1K6S A;  4Y0O A;  1Y54 A;  4WEK A;  1G28 A;  3LI9 A;  3A3F A;  1NRJ A;  1KGG A;  4K08 A;  3FZC A;  4S2N C;  1NY0 A;  5HWT A;  5JYP A;  1YM1 A;  3GSG A;  4PKY A;  5EVI D;  2GX5 A;  1WE4 A;  4MMN A;  4YWZ A;  2GDN A;  5K5B A;  5KSH A;  3AGD A;  3HUM A;  4HBU A;  3IX4 A;  4X55 A;  5F5Y A;  4MBH A;  3P01 A;  3G32 A;  3S1Y A;  2ZJ9 A;  2ZQ9 A;  2EWW A;  3CJM A;  1BUL A;  3S4X A;  4UEY A;  4HOI A;  3CUE A;  4GD6 A;  3VV4 A;  5GL9 A;  2R9W A;  4Q0I A;  1BZA A;  4KZ8 A;  4CLC B;  5AVF A;  5DTS A;  2VJW A;  1K55 C;  1Q2P A;  2PBD P;  4CLC A;  4KZA A;  4LRZ E;  1FCM A;  3F1O B;  5GLB A;  1MPL A;  2ZOH A;  1S67 L;  3FV7 A;  4MLL A;  2HDR A;  1PRQ A;  2QYB A;  3F1O A;  2HP9 A;  3PAE A;  2L1M A;  5HL6 A;  1P9W A;  3T4O A;  3A0V A;  3CMZ A;  2XRO A;  2OWH A;  1XGI A;  3T50 A;  3UDX A;  3PBS A;  5HD3 A;  5KSC A;  5M18 A;  1KDS A;  1E25 A;  1XA1 A;  3ZNY A;  2EFX A;  3KYQ A;  2WKP A;  4C6Y A;  4R23 A;  4E3L A;  4JPM A;  1H8Y A;  5IT5 A;  4OQH A;  1T19 A;  2ZM2 A;  4R38 A;  3WRT A;  2ZLY A;  1ES3 A;  4PMA A;  1PNE A;  3HVF A;  3ZQ5 A;  3E2L A;  4X6T A;  4EUV A;  1ACF A;  3C5A A;  3DTI A;  4NK3 A;  2WAF A;  1ZKJ A;  1YSQ A;  3HLG A;  4JXS A;  4UAA A;  1KE0 A;  5AQ7 A;  1XP4 A;  3MSH A;  3QHY A;  1STZ A;  3UB6 A;  5HPF A;  1TS6 A;  2PR6 A;  1OTI A;  2ZMF A;  3UNW A;  3CHW P;  3CLO A;  4R3B A;  1GHM A;  1UWP X;  2XDM A;  4OPR A;  5L2F A;  3MQO A;  3FKW A;  3LEZ A;  3K3D A;  2FH5 A;  3ZYT A;  3PHY A;  4KEN B;  1K4E A;  3VP3 A;  1P0Z A;  1U60 A;  1Q2Q A;  2KDK A;  3K3C A;  2G2W A;  3M2K A;  1S66 L;  3EEA A;  3SS4 A;  1P97 A;  4S2K A;  3WWX A;  3CG5 A;  2KX6 A;  1WYC A;  5HAR A;  4ME4 A;  4DDS A;  4N9L A;  3IF5 A;  5FSR A;  4D2O A;  3HLE A;  3LIA A;  3NBL A;  5TBM B;  2ZD8 A;  2Y2L A;  4QJG A;  1FQG A;  4FH2 A;  5EUA A;  2JBF A;  3IHA A;  2L4R A;  1ESI A;  5TBM A;  4P6Z M;  5FEG A;  3HLB A;  3QP5 A;  2UV0 E;  4X1L A;  3Q82 A;  1JTG A;  1Y28 A;  5DKL A;  3LR3 A;  3BJN A;  2XLN A;  3MS6 A;  3GR2 A;  3O88 A;  2JCH A;  1ALQ A;  1YMS A;  3C8C A;  2HP6 A;  4U3T A;  5L10 A;  4OH0 A;  5E2F A;  4O8G A;  1SZV A;  3UDF A;  3T1Q B;  1ERQ A;  4HHD A;  4M4X A;  1W79 A;  5DVA A;  3ISG A;  3VP2 A;  3NI9 A;  5F83 A;  3P09 A;  3VP1 A;  4LCM A;  4B93 A;  3BFG A;  4BLM A;  3LEQ A;  5AQA A;  5DF7 A;  4QD4 A;  1H0M A;  4FSF A;  2Z6C A;  4IVI A;  4WEJ A;  1FIK A;  5HAI A;  3PBR A;  5FDS A;  1TDL A;  2V1A A;  1NYY A;  2V1B A;  1GA9 A;  3E4P A;  1IYS A;  1W63 M;  1CF0 A;  1FIL A;  2XA7 M;  3K2N A;  2XGN A;  4QWO A;  2PD7 A;  4GJ4 A;  5CX7 A;  4JKT A;  4HES A;  3BEC A;  5IU1 A;  2V8F A;  5KMW A;  4PM6 A;  2JKT I;  5F1G A;  5L8M A;  4HJ4 A;  2W0N A;  5DFX A;  4JXV A;  3BFE A;  4UA6 A;  4QU3 A;  4OOL A;  3LCE A;  4YOF A;  3WRZ A;  3UPO A;  4EER A;  1UGU A;  2QKP A;  3G31 A;  3N8R A;  1W8Q A;  2QWS A;  1T1A A;  2FZ0 A;  1NZU A;  5GLD A;  4Z1W A;  1F98 A;  5HWV A;  2Y91 A;  3IBR A;  1GSV A;  2VV8 A;  5BOH A;  2PAV P;  1TVF A;  2PU2 A;  5GLC A;  3T4S A;  1TF1 A;  1V9Y A;  2XF3 A;  4ZJ2 A;  1GSW A;  1PIO A;  1W7F A;  5L09 A;  4X1M A;  1L0D A;  2JC7 A;  3IWQ A;  5GHY A;  3TG9 A;  3T12 B;  5HDD A;  4UA7 A;  3QNC A;  4JBF A;  5CTN A;  4HH3 A;  3C2W A;  4BMW A;  3NIA A;  2B02 A;  2D02 A;  4IJG A;  1VM1 A;  4FCF A;  1J3W A;  3UB7 A;  5HSQ A;  4E6W A;  3KYZ A;  1BLS A;  3LR5 A;  1QMF A;  3ZG5 A;  1YLP A;  4JF6 A;  1NJ4 A;  2PRF A;  3MKF A;  3MF0 A;  3QP1 A;  4OP8 A;  5DF9 A;  5F1F A;  3EGD C;  2WGV A;  3ITA A;  5CHM A;  4X25 A;  1N9O A;  4KZ7 A;  1KOU A;  5HW3 A;  3MXR A;  1L0F A;  1AWI A;  4R0Q A;  1GA0 A;  2JKG A;  2ZC5 B;  3S7N A;  1HTZ A;  2HF6 A;  4NET A;  4ETZ A;  4EES A;  1I5Q A;  5FAT A;  2XD1 A;  5A93 A;  1XGJ A;  1DP6 A;  4LCL A;  1XKZ A;  3NC8 A;  3SS3 A;  3V5M A;  5FAP A;  2XH9 A;  2Y2N A;  3C38 A;  4H6J B;  1HD8 A;  2A3U A;  3N8L A;  1LL5 A;  1OTB A;  1ES5 A;  4GZB A;  3EQU A;  4JGR A;  2VGJ A;  1N9L A;  4H6J A;  5LBR A;  4LGW A;  3DWZ A;  4DJ2 A;  1HZO A;  3O3V A;  3FYZ A;  4CLC E;  2K31 A;  3E4Q A;  1K56 A;  5GHX A; 
#chains in the Genus database with same CATH homology
 3HUM A;  4HBU A;  4RX3 A;  4BEN A;  4X55 A;  1SCW A;  3BRM A;  4MBH A;  3OPP A;  3G32 A;  2J9O A;  3FWL A;  3S1Y A;  3P98 A;  3UDI A;  5CEB A;  1BT5 A;  2ZJ9 A;  1ZC2 A;  2ZQ9 A;  3CJM A;  1BUL A;  5M1A A;  2IWB A;  1SDE A;  4UA9 A;  3S4X A;  2EXB A;  3ZNT A;  4XUX A;  3CZD A;  1FCN A;  2WKH A;  3G4P A;  3PBQ A;  4KZ6 A;  3G30 A;  4GD6 A;  4Z9Q A;  1FSY A;  2X02 A;  5GL9 A;  1E3U D;  2R9W A;  1BZA A;  2DNS A;  4KZ8 A;  2Y2K A;  2WKI A;  5FA7 A;  5FQM A;  5DTS A;  1LLB A;  1BLC A;  4WBG A;  1K55 C;  4K0X A;  3W8K A;  1Q2P A;  2PBY A;  1JWZ A;  1CEF A;  1M40 A;  1BUE A;  3IXG A;  1SKF A;  2X01 A;  1LI9 A;  4WMC A;  1Z6F A;  4KZA A;  5JYO A;  2Y2J A;  3HUO A;  1FCM A;  3RXW A;  2OV5 A;  2BG1 A;  3G35 A;  3IWI A;  5GLB A;  1MKI A;  1MPL A;  3I7J A;  4GKU A;  3C4P A;  2XK1 A;  5E43 A;  3DWK A;  2ZM8 A;  3FV7 A;  4OPY A;  4QY5 A;  4IBX A;  4MLL A;  4JF5 A;  3ZG8 B;  1MY8 A;  2HDR A;  2OLV A;  4JXW A;  5CER A;  2WKE A;  3V3S A;  1ZG4 A;  1IKG A;  4QY6 A;  2V20 A;  2HP9 A;  3G2Y A;  3UO9 A;  3PAE A;  1ONG A;  1NXY A;  1PI4 A;  4MEZ A;  1IEL A;  2Q9N A;  1CI9 A;  2FFF B;  3S22 A;  3G34 A;  4BL3 A;  3CMZ A;  2JE5 A;  4DRT A;  4Y7P A;  1JWV A;  1KDW A;  4OQI A;  1N9B A;  4YFM A;  4DE1 A;  3NY4 A;  2QPN A;  1XGI A;  3UDX A;  3C7U A;  3PBS A;  5FAS A;  5KSC A;  3IXB A;  3C7V A;  3NDE A;  5M18 A;  1KDS A;  4GB7 A;  1NYM A;  3A3J A;  4ID4 A;  1PWD A;  1E25 A;  1XA1 A;  4OKP A;  4OOY A;  3ZNY A;  2EFX A;  1NRF A;  3A3I A;  4BL2 A;  3M6B A;  2XQZ A;  1BLH A;  4C6Y A;  1N4O A;  4P6B A;  4DE2 A;  4R23 A;  4E3L A;  4JPM A;  3NDG A;  5EOE A;  1H8Y A;  1S0W A;  3GV9 A;  4OQH A;  2ZM2 A;  2V1Z A;  3WRT A;  1MWS A;  2ZLY A;  1ES3 A;  1FOF A;  4PMA A;  3HVF A;  2UWX A;  3UE0 A;  3E2L A;  4XXR A;  4X6T A;  2QZ6 A;  4KQQ A;  3C5A A;  4NK3 A;  2WAF A;  2HDQ A;  5DTK A;  1ZKJ A;  4R1G A;  3HLG A;  3IXH A;  4JXS A;  4R4R A;  4UAA A;  4EBN A;  1KE0 A;  4RYE A;  5AQ7 A;  1XP4 A;  3QHY A;  4H8R A;  5G18 A;  4KZ3 A;  3W4P A;  5J8X A;  3SH9 A;  1YLY A;  2WUQ A;  4E3O A;  4DKI A;  1YLW A;  1IKI A;  5IHV A;  4WM9 A;  1I2W A;  4PM7 A;  3ZFZ A;  3UNW A;  1DJB A;  2Y2H A;  4WZ4 A;  4R3B A;  5HAQ A;  3PBO A;  1GHM A;  4S2J A;  2WGI A;  2Y2Q A;  3N7W A;  2EFU A;  5FDH A;  2C6W B;  5HFO A;  1M6K A;  2XDM A;  3MKE A;  3QNB A;  4M3K A;  1RGZ A;  4OP5 A;  4OPR A;  3VFF A;  4DDY A;  5L2F A;  3B3X A;  2ZQ7 A;  3HLW A;  4S2M A;  3D4F A;  1YLJ A;  5FQK A;  1W8Y A;  3GMW A;  2H0Y A;  5EE8 A;  1TEM A;  2G2U A;  2X71 A;  4PM8 A;  3FKW A;  3ZDJ A;  3LEZ A;  4GDN A;  4S2O A;  4ZJ3 A;  4KEN B;  1K4E A;  5EVI B;  2ZQD A;  3VP3 A;  1O07 A;  4EWF A;  1U60 A;  5FQI A;  1Q2Q A;  3MBZ A;  3PTE A;  1CI8 A;  5E2G A;  2DRW A;  4JLF A;  1SHV A;  2G2W A;  4WEL A;  5CHJ A;  3SH7 A;  3UPN A;  3M2K A;  1KE3 A;  2ZC6 B;  3HLF A;  3SOI A;  4R3J A;  4IVK A;  5EVI A;  4P87 A;  5FQQ A;  2WZX A;  1ERO A;  3MXS A;  3SS4 A;  1H8Z A;  5AQB A;  4DF6 A;  2OLU A;  4S2K A;  1FR6 A;  3WWX A;  3CG5 A;  1XA7 A;  5FQ9 A;  3IF6 B;  1WYC A;  1PZP A;  5HAR A;  4DDS A;  4N9L A;  1W5D A;  3BYD A;  3IF5 A;  3MZE A;  4FD8 A;  3O86 A;  4JXG A;  2Z2M B;  4Y0T A;  5FSR A;  1MWU A;  3RXX A;  4D2O A;  3HLE A;  3NBL A;  1K25 A;  4HBT A;  2ZD8 A;  2Y2L A;  3IF6 A;  5AQ9 A;  4ZJ1 A;  4KZB A;  4QJG A;  3IQA A;  2ZQA A;  4KZ4 A;  1ERM A;  1FQG A;  4K91 A;  4FH2 A;  5EUA A;  3MZF A;  2JBF A;  3IHA A;  3ZVW A;  1ESU A;  2ZC7 A;  1J9M A;  1ESI A;  5HAP A;  2EX8 A;  3Q07 A;  3VOY A;  3HLB A;  2HDS A;  3IT9 A;  3JYI A;  2QMI A;  4Y0U A;  3WS0 A;  1L2S A;  4LV0 A;  2Y2M A;  1E3U A;  1QME A;  1JTG A;  3Q82 A;  2H0T A;  2ZC4 B;  3A3D A;  3LO7 A;  5M19 A;  2ZQ8 A;  1BSG A;  2XLN A;  4N1X A;  5EEC A;  3GR2 A;  3O88 A;  2XR0 A;  1L0G A;  4BD1 A;  2JCH A;  3VSK A;  1FCO A;  1BLP A;  4KG6 A;  4MBK A;  2ZM0 A;  4S2N A;  5FAO A;  4E6X A;  1FR1 A;  1ALQ A;  1YMS A;  5A92 A;  5CTM A;  2HP6 A;  4DXB A;  4U3T A;  1MBL A;  2J8Y A;  4X68 A;  5EOO A;  4OH0 A;  5CGW A;  5E2F A;  4JF4 A;  1FSW A;  1KGE A;  4DE0 A;  4X53 A;  4ZTK A;  4ZAM A;  1PW8 A;  3PBT A;  4OOM A;  3BEB A;  3M2J A;  1YQS A;  3UDF A;  4A5R A;  2FFY A;  3OPL A;  1OME A;  4C3Q A;  5U47 A;  1K57 A;  5A91 A;  2ZMA A;  1ERQ A;  1ZG6 A;  1KVL A;  5FQJ A;  3HBR A;  5E2E A;  3UPP A;  2I72 A;  1W79 A;  5DVA A;  3ISG A;  4OVD A;  2XFS A;  2ZC3 B;  3VP2 A;  4S2I A;  4MNR A;  3NI9 A;  3Q1F A;  5F83 A;  3GRJ A;  3P09 A;  3VP1 A;  4LCM A;  1L0E A;  3BFG A;  4IBR A;  4BD0 A;  4BLM A;  3MZD A;  3UE3 A;  4RVA A;  3VOZ A;  5AQA A;  3HRE A;  4GD8 A;  4PM5 A;  1JVJ A;  3HLD A;  5EVI C;  5DF7 A;  2HPB A;  1GCE A;  2EX9 A;  2V2F F;  4QD4 A;  5FI2 A;  3ZG0 A;  4FSF A;  1DJA A;  3GTC A;  3PBN A;  4IVI A;  2XD5 A;  4WEJ A;  5HAI A;  3PBR A;  3E2K A;  3MFD A;  1TDL A;  4B4X A;  1NYY A;  3M6H A;  4ZDX A;  2BLS A;  3LY4 A;  1GA9 A;  2Y2I A;  1IYS A;  2R9X A;  3W4Q A;  1EI5 A;  2EX2 A;  3SH8 A;  1AXB A;  3HLC A;  4OPZ A;  4PPR A;  4EBP A;  3OCL A;  2XGN A;  3IH8 A;  3OCN A;  3IF6 C;  3IWO A;  2B5R A;  3TSG A;  3BM6 A;  2WYX A;  4GNU A;  2XFT A;  1KE4 A;  4JKT A;  1PWG A;  1PW1 A;  2H10 A;  4HES A;  3BEC A;  1MXO A;  3Q81 A;  3GQZ A;  4E3I A;  4KG2 A;  4EUZ A;  4UHU A;  3OPH A;  5KMW A;  4PM6 A;  5EPH A;  3WS5 A;  4EBL A;  1GHP A;  1RP5 A;  4RA7 A;  5F1G A;  1G6A A;  1XPB A;  1E4D A;  5CGX A;  1S6R A;  1GHI A;  1K38 A;  4BQM A;  4JXV A;  3BFE A;  4UA6 A;  2DCF A;  1K56 D;  4E3N A;  4QU3 A;  5FAQ A;  4OLG A;  1VQQ A;  4OOL A;  1JWP A;  3LY3 A;  3LCE A;  3SS5 A;  4RX2 A;  3WRZ A;  1LL9 A;  3N4I A;  3ITB A;  3UPO A;  1HVB A;  3O87 A;  4K0W A;  1IEM A;  4WYY A;  2A49 A;  3V50 A;  1YLT A;  3C4O A;  2WAD A;  3G31 A;  4CPK A;  1DJC A;  3N8R A;  4WZ5 A;  4EQI A;  4ZBE A;  2IWC A;  5F82 A;  4KQR A;  1RGY A;  4GOG A;  2E8I A;  1ES4 A;  1W8Q A;  1EWZ A;  3IXD A;  1RCJ A;  2J7V A;  4KG5 A;  3VFH A;  4GN2 A;  3TOI A;  3IH9 A;  2Y4A A;  4X56 A;  5CHU A;  4OQ0 A;  2ZQC A;  1IYP A;  3RJU A;  4BJP A;  1K57 C;  1NZU A;  4E3J A;  5GLD A;  2RL3 A;  1G68 A;  3AGE A;  3AGF A;  2WGW B;  5A90 A;  4KZ9 A;  4EV4 A;  2Y91 A;  3PAG A;  1ES2 A;  5BOH A;  4R4S A;  1YLZ A;  1NZO A;  1TVF A;  4WMC D;  2PU4 A;  5HL1 A;  2PU2 A;  1SDN A;  5GLC A;  4N92 A;  1IYO A;  2RCX A;  3ZGA B;  1XX2 A;  2WGW A;  2XF3 A;  5HX9 A;  2J9P A;  4N9K A;  4ZJ2 A;  2HP5 A;  1PIO A;  1W7F A;  4IED A;  4LV1 A;  1L0D A;  2JC7 A;  3IWQ A;  5CED A;  5GHY A;  1KVM A;  3TG9 A;  3Q7V B;  1ONH A;  3Q7Z A;  4UA7 A;  5CXW A;  3GVB A;  3G2Z A;  3QNC A;  4LV3 A;  4JBF A;  4OQG A;  5CTN A;  1K54 A;  5EVL A;  3UY6 A;  3NIA A;  1KGF A;  3VP0 A;  5I94 A;  1MWR A;  4LV2 A;  2H5S A;  4DE3 A;  5FI6 A;  4PM9 A;  1VM1 A;  3Q7V A;  4FCF A;  4E6W A;  1PWC A;  2Y2O A;  3BLM A;  4OON A;  3VP4 A;  1BLS A;  4U0X A;  2WZZ A;  3VSL A;  2XEP A;  5CEC A;  2OSU A;  1QMF A;  3ZCZ A;  3ZG5 A;  4X69 A;  2IWD A;  5D3O A;  3V3R A;  3DTM A;  1YLP A;  3NCK A;  1TDG A;  4L0L A;  4YIN A;  4JF6 A;  1NJ4 A;  3HUN A;  1PZO A;  3WS4 A;  5CGS A;  3MKF A;  4OLD A;  5DTT A;  5DF9 A;  4OP8 A;  5F1F A;  3ZVT A;  2WGV A;  3ITA A;  5CHM A;  1LI0 A;  4LEN A;  1BTL A;  2C5W B;  5CRF A;  1WYB A;  5FI7 A;  3ZHH A;  3BFC A;  3UN7 A;  4KZ7 A;  4P0M A;  2WAE A;  4U0T A;  4B4Z A;  4E3K A;  5HW3 A;  3MXR A;  1L0F A;  3N6I A;  5TR7 A;  4CJN A;  4E3M A;  3OC2 A;  2Y55 A;  4R0Q A;  5DF8 A;  4QHC A;  1K55 A;  1YT4 A;  5E2H A;  1GA0 A;  2ZC5 B;  4WZ5 C;  5GLA A;  5GHZ A;  1HTZ A;  3N8S A;  4KZ5 A;  4F94 A;  4NET A;  4O7D A;  4GDB A;  1K6R A;  4S2L A;  3OZH A;  2WK0 A;  1I2S A;  5KZH A;  1PI5 A;  3HL9 A;  2CC1 A;  4KQO A;  3FKV A;  1I5Q A;  1XXM A;  5FAT A;  2Y59 A;  2Z2L B;  3A3E A;  5TFQ A;  3UE1 A;  2XD1 A;  5A93 A;  1XGJ A;  4FH4 A;  5TGF A;  4N1H A;  4LCL A;  1JTD A;  2Y2P A;  3W4O A;  2EX6 A;  1K4F A;  4DXC A;  4C75 A;  2HDU A;  3V39 A;  1XKZ A;  2Q9M A;  1MWT A;  1YMX A;  3NC8 A;  3EQV A;  3ZG7 B;  4Q8I A;  2P9V B;  2EXA A;  2P74 A;  1K6S A;  4Y0O A;  1Y54 A;  1PYY A;  3SS3 A;  4WEK A;  3V5M A;  5FAP A;  4MBF A;  1C3B A;  4HEF A;  3BFD A;  2XH9 A;  2Y2N A;  1IYQ A;  1HD8 A;  2A3U A;  2VGK A;  3A3F A;  4OPQ A;  3N8L A;  1CEG A;  1LL5 A;  1KGG A;  1LHY A;  4GZB A;  1ES5 A;  3FZC A;  2P9V A;  4S2N C;  1NY0 A;  3EQU A;  1DY6 A;  1H5X A;  3DW0 A;  2VGJ A;  4B88 A;  3WS2 A;  5JYP A;  1YM1 A;  3BLS A;  3GSG A;  5EVI D;  2Y2G A;  3ZG9 B;  3DWZ A;  4P85 A;  1WE4 A;  1K54 C;  3OPR A;  3WS1 A;  1CK3 A;  1HZO A;  3O3V A;  3FYZ A;  4S2P A;  4QB8 A;  4XUZ A;  2GDN A;  3BFF A;  3IHB A;  5KSH A;  1K56 A;  1O7E A;  5GHX A;  3AGD A;  3VMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...