2A3UA

Crystal structure of sulbactam bound to e166a variant of shv-1 beta-lactamase
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of the trans-Enamine Intermediates Formed by Sulbactam and Clavulanic Acid and E166A SHV-1 {beta}-Lactamase.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
molecule keywords Beta-lactamase SHV-1
total genus 96
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2005-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2a3uA00
3PTEA 4PPRA 3MXSA 1MY8A 3NC8A 3S1YA 3OPHA 3UDXA 3IF6C 4ZJ3A 1YMXA 2OLUA 2ZQAA 4KZ8A 3UN7A 2IWCA 3LY3A 3BFGA 3G2YA 5BOHA 5F1FA 4S2PA 4WYYA 5G18A 1MWTA 2WADA 1L0GA 3UNWA 4C6YA 3NCKA 2OV5A 3W4PA 4ZBEA 2P9VA 4OOYA 5EVID 2X02A 2DNSA 4EUZA 3M2JA 3IH9A 5DVAA 3GMWA 3O3VA 1MPLA 2XD1A 1IYSA 4S2NC 1ONHA 3WRTA 3C5AA 4D2OA 3EQVA 4LCLA 5EVIB 3MBZA 4MNRA 1DJAA 2PU2A 2WZZA 5HAIA 5AQ7A 3C4OA 3VFHA 4R23A 4X68A 1NYYA 1YLYA 1W5DA 2B5RA 1PWGA 1FOFA 4KZ7A 1K56D 4WMCD 4P87A 3AGDA 4FD8A 4Z9QA 3TOIA 3JYIA 1IYOA 3BFCA 4OP8A 5CXWA 3G30A 3OPRA 5U47A 3BLSA 5CTNA 1H5XA 4A5RA 3GV9A 4OONA 4DKIA 1G68A 2ZM2A 4R3BA 2Q9MA 5CEBA 1M40A 2Y2HA 4RX2A 5CHJA 4C75A 1WE4A 1E3UA 3ZCZA 1K6SA 4DE1A 5KMWA 4OQIA 1BLPA 1W79A 3CJMA 1ES4A 1TVFA 5A93A 1KDWA 1CEGA 1NXYA 1XP4A 5DF9A 3FKVA 5F82A 5HW3A 4IBXA 1BTLA 1FR6A 3IWIA 1BUEA 4JLFA 3VSKA 3M6BA 3HLWA 1ES5A 1NRFA 2EFUA 2J9OA 4ZDXA 2HP6A 3E2LA 3BFDA 4KG2A 1QMEA 5I94A 4S2IA 3IXHA 2EX6A 3DWZA 3CZDA 3G35A 5FQKA 1DY6A 2ZD8A 1PZPA 2E8IA 2OLVA 2X01A 5FATA 4QD4A 2V1ZA 1BLHA 1SCWA 3Q7VB 3SH8A 4BL2A 2HDRA 4WELA 1Y54A 3N8RA 3UPOA 3IWOA 3GTCA 1PIOA 1YLJA 1ZG6A 2FFYA 4HEFA 3UPNA 3S22A 3BRMA 1GA0A 4N9LA 4KZ3A 3HLEA 2DCFA 4OPZA 4RX3A 3NY4A 4IBRA 4OP5A 5DTTA 3VP1A 2ZC7A 2WGWB 5FQ9A 1QMFA 3IXDA 4GDNA 2ZMAA 3WS5A 3D4FA 3VOYA 4IEDA 1K38A 1O7EA 1PI4A 3HLCA 2H5SA 2XH9A 3O88A 1KGFA 2XQZA 3RXWA 5HFOA 1TEMA 4S2LA 1JWZA 1EROA 5A92A 1NJ4A 4E3IA 5HL1A 1CK3A 2QPNA 4LV2A 3GR2A 1ZC2A 3WS2A 2C5WB 5IHVA 4Q8IA 5AQ9A 2IWDA 3SH9A 5AQBA 4QY6A 3HVFA 5E2HA 1KE4A 3AGEA 2WAEA 1GHMA 4HBTA 3PBNA 1I2WA 2PBYA 3CG5A 3Q81A 3Q82A 5HX9A 3VMAA 1ERQA 4LENA 3IF6B 4N9KA 4R4SA 4E6WA 3HL9A 2DRWA 2XGNA 4QB8A 3BEBA 1ES3A 3ZGAB 5L2FA 4KQRA 2QMIA 3UE0A 1XX2A 1JWPA 3MZEA 4U0TA 4S2JA 2ZJ9A 5EOOA 1ZG4A 2V2FF 2V20A 5DTKA 2UWXA 3W8KA 3ZDJA 1ONGA 1XGJA 2QZ6A 4CPKA 2FFFB 3FWLA 1L0DA 3NDGA 1XKZA 1K4EA 1YT4A 1FR1A 1IYQA 4ZJ1A 1YMSA 3IHAA 5GHYA 5FAPA 2EX9A 1K55A 1ALQA 1JVJA 2WK0A 4PM8A 1ZKJA 4QY5A 4KZAA 1YM1A 4DF6A 1K57C 2A3UA 4EQIA 1YQSA 1VQQA 4M3KA 1GCEA 3P09A 3BFFA 3I7JA 4QHCA 5E2EA 3V3RA 1BSGA 1KGGA 1GA9A 2ZM0A 3CMZA 3E2KA 2CC1A 3GSGA 4DXBA 2JCHA 4CJNA 4UA9A 3SH7A 3W4QA 2XR0A 1VM1A 1NY0A 1DJBA 1WYBA 3B3XA 4WMCA 4DXCA 4E3LA 3ZNTA 3BFEA 2HDSA 3PBTA 1MBLA 3M6HA 3W4OA 1LHYA 2Z2MB 4QU3A 5GHZA 4BJPA 1IKGA 5CGXA 4R3JA 4ZJ2A 1E3UD 3LO7A 2EX8A 5JYPA 1J9MA 4OLGA 3PAGA 4GDBA 2ZQ7A 2WKHA 4GD6A 4KZ5A 3VFFA 4JPMA 4DRTA 4DE2A 4N92A 1W8QA 3OPLA 3UE3A 4OH0A 3HUOA 4JF6A 4X69A 4DDSA 2XLNA 4KG6A 5FI6A 4R4RA 1MWSA 3ZNYA 3NI9A 1YLZA 1IEMA 5HARA 5FDHA 5FA7A 4KQOA 1K54C 2JBFA 4BD1A 3M2KA 3FZCA 1JTGA 2JE5A 2XFSA 3VP0A 3QNCA 1SHVA 1HD8A 1I2SA 3QHYA 4UA6A 4HBUA 4RYEA 2HPBA 4OVDA 3ZG7B 2ZM8A 1PYYA 4E3MA 3WS4A 3NIAA 3IH8A 2XD5A 3GQZA 1H8YA 2BG1A 4WBGA 4OPQA 4PM7A 3MKEA 1M6KA 4LV0A 2XEPA 3BYDA 1E25A 3G32A 1K56A 4RVAA 3ZG5A 1KE3A 1NZUA 3IT9A 4ZAMA 4GN2A 5E2FA 3LEZA 5GLAA 1YLTA 3N4IA 4FH4A 4WZ5C 3IXGA 1CI8A 2WYXA 3IXBA 2P74A 2WKEA 4GNUA 4EV4A 2WGVA 2J9PA 2P9VB 5A91A 2EXAA 3DWKA 3N8LA 5F1GA 5FQQA 1XXMA 5TR7A 5FASA 1C3BA 1RGYA 4OOMA 2Y2NA 3A3DA 3OC2A 1N4OA 5FQJA 3TG9A 4UHUA 5M18A 3HBRA 4YINA 3AGFA 3V39A 3SS4A 1MKIA 1KDSA 5CGSA 5EVIA 3UO9A 5TFQA 1KVMA 1JTDA 1JWVA 2H10A 4IVKA 5CEDA 2EX2A 3HUNA 3VP2A 4KG5A 3ZG8B 4KZ9A 3PBQA 2ZC6B 5J8XA 1PW1A 4Y0OA 4N1XA 5FQIA 1S0WA 4WM9A 1LI9A 2HDQA 3UY6A 1KVLA 5HAQA 5GL9A 2Q9NA 1W7FA 2ZQCA 4BLMA 3V5MA 4N1HA 5KZHA 2X71A 5CECA 2Y2GA 5D3OA 3A3JA 1MWUA 1IKIA 5E2GA 5DF8A 3MFDA 3TSGA 4KZBA 1U60A 4HESA 2WAFA 3WS0A 3IQAA 3FYZA 2Y2PA 4MBFA 4X53A 4EWFA 3WWXA 4L0LA 4BL3A 5M1AA 3RXXA 2ZC5B 1K54A 3ZG0A 1PW8A 3SS5A 5KSCA 1IYPA 2VGKA 5AQAA 5HAPA 4KZ4A 3HLGA 1K25A 3WRZA 3BM6A 4S2OA 1SDEA 3MKFA 1HVBA 1XGIA 3MZDA 4E3NA 1NYMA 1EWZA 3IF5A 4X6TA 3EQUA 4GD8A 3OPPA 2OSUA 1L0EA 1MXOA 4JF4A 3OCLA 4P6BA 1YLWA 3HREA 5EOEA 4Y7PA 3VP3A 1E4DA 5FAQA 3VP4A 5F83A 1FCOA 4WEJA 3ZG9B 4MBHA 3PBOA 5M19A 4OQGA 4PM9A 2WUQA 1I5QA 1GHPA 2Y2MA 1GHIA 4S2KA 5GLDA 2PU4A 2Y2OA 3LY4A 4O7DA 2JC7A 3Q7VA 4U3TA 4E3JA 4Y0UA 2XFTA 3IWQA 3ZVTA 5GLBA 1K6RA 4DDYA 4EBNA 2XK1A 3A3FA 2ZC4B 4JBFA 3UDIA 3HUMA 4KZ6A 1XA7A 4NK3A 3Q7ZA 2WKIA 2Y2KA 4ID4A 3DTMA 4MBKA 1XPBA 4UA7A 5FAOA 3NBLA 3Q1FA 3S4XA 2H0TA 2RL3A 3G31A 2RCXA 2Y4AA 3PAEA 4LV3A 2WGWA 2XF3A 1RGZA 1FSYA 4JKTA 3UE1A 4E6XA 1EI5A 4OQHA 4IVIA 3SOIA 3DW0A 4OOLA 1LLBA 1PWDA 1XA1A 4FCFA 5CRFA 1IELA 4B4XA 3OCNA 4RA7A 1Z6FA 4BENA 1RCJA 1K55C 5GHXA 1BLSA 2A49A 1KGEA 1ES2A 5EUAA 2Y59A 3N7WA 1OMEA 5FI2A 2XDMA 1Q2QA 4ZTKA 2ZQ8A 2G2WA 1MWRA 4GKUA 5CTMA 4MEZA 3G34A 1DJCA 5JYOA 1WYCA 2Y2LA 4GB7A 4JXGA 4NETA 4OKPA 4P0MA 3MXRA 4X56A 5EVLA 2GDNA 3UPPA 3N8SA 3ZFZA 1CEFA 4OPYA 4MLLA 3IF6A 2ZQ9A 4K0XA 4UAAA 3G4PA 5E43A 5DTSA 1TDGA 5EVIC 2BLSA 1LL5A 5A90A 1O07A 5TGFA 3A3IA 4BD0A 3O86A 1KE0A 2Y91A 1K4FA 3P98A 4KQQA 1FSWA 3UDFA 3A3EA 4OPRA 3O87A 4XUZA 2H0YA 4U0XA 1BULA 4C3QA 4R0QA 5CERA 3MZFA 5EE8A 2VGJA 4WZ5A 3ISGA 3OZHA 3Q07A 1H8ZA 3HLDA 3ZHHA 2C6WB 2ZQDA 4E3OA 4XXRA 1W8YA 1G6AA 3N6IA 3ZVWA 3ITAA 5CGWA 4WEKA 3C7UA 2ZLYA 2IWBA 5FQMA 2Y2IA 4R1GA 3ITBA 4DE0A 1HTZA 3FV7A 1HZOA 4LCMA 4K91A 4XUXA 1YLPA 3VOZA 4Y0TA 1PWCA 1LI0A 3PBSA 2WGIA 5FI7A 4YFMA 4EBPA 2G2UA 3G2ZA 1SKFA 4QJGA 1PZOA 3IHBA 4PMAA 3V50A 4JF5A 4OQ0A 1RP5A 4FSFA 4JXSA 2J7VA 3VSLA 5DF7A 1BLCA 4B88A 3SS3A 4BQMA 2EFXA 1Q2PA 2R9WA 1PI5A 2HDUA 2HP5A 4PM6A 3GVBA 3WS1A 4DE3A 5CHMA 1K57A 1L0FA 4KENB 3NDEA 3C4PA 1BT5A 4H8RA 3BLMA 1AXBA 3HLFA 1S6RA 5CHUA 5FSRA 3FKWA 2HP9A 3LCEA 1NZOA 4GOGA 4X55A 2ZC3B 3V3SA 1FQGA 3HLBA 1L2SA 2Z2LB 5EECA 3PBRA 1SDNA 4FH2A 5KSHA 4B4ZA 1BZAA 4JXWA 1FCNA 2EXBA 4JXVA 4LV1A 1N9BA 3C7VA 4S2MA 4P85A 3RJUA 4WZ4A 5EPHA 4E3KA 3GRJA 1CI9A 2Y2QA 2Y2JA 5GLCA 3BECA 1ERMA 4GZBA 4K0WA 4F94A 2J8YA 4PM5A 4S2NA 1ESUA 2I72A 2R9XA 1TDLA 3QNBA 1FCMA 1LL9A 4OLDA 2Y55A 2WZXA 1ESIA 4EBLA
chains in the Genus database with same CATH superfamily
3A0SA 3UDXA 1MY8A 3IF6C 4FTXA 5AVEA 1H8MA 3LY3A 3HJIA 4IUHA 5BOHA 5HDSA 1L0GA 3NCKA 2P9VA 4OOYA 4HI4A 3UB5P 2DNSA 4EUZA 1T19A 1VB6A 3GECA 2ZOHA 2K7SA 3GMWA 5AVFA 3C5AA 4D2OA 2D01A 1ZTUA 1DJAA 5HAIA 2Z6DA 3R7WA 4LFUA 4X68A 2B5RA 4KZ7A 2W1RA 3TOIA 3E4PA 3NOPC 3B47A 3BLSA 5CTNA 4X1LA 3D72A 2OAP1 1M40A 4NXEA 4RX2A 2A2LA 3ZCZA 1K6SA 4DE1A 2HGVA 1CEGA 5DJTA 5DF9A 4JGQA 4X25A 3CWFA 5TBMB 3MS6A 4WL9A 1W63M 3E2LA 3BFDA 5F5YA 4WLAA 3IXHA 1NLYA 1DY6A 2Y8HA 3EEHA 1SCWA 3N8RA 5EFWA 1ZG6A 4KQDA 3UPNA 1GA0A 4OPZA 1VETA 1QMFA 3IXDA 5AJGA 3CPTB 4I3IA 1O7EA 3UMEA 4ESPA 1SZVA 5A92A 2KDKA 4LV2A 3GR2A 3LGOA 4LRZE 2VV7A 5AQ9A 3E4QA 5AQBA 3HVFA 2EWVA 3CUEC 2DMWA 5FL3A 1GHMA 2PBYA 3CG5A 4Y17A 3MJQA 2ZOIA 2XGNA 2QJ5A 5L2FA 4KQRA 1XX2A 1JWPA 2ZJ9A 4EQ1A 1EW0A 3CITA 2FZ0A 2V20A 2UWXA 2LB9A 3W8KA 3ZDJA 1CJFA 2QZ6A 3MR0A 5HWVA 4EU0A 5L07A 2E8JA 3RFBA 2EX9A 4NXGA 1JVJA 2D02A 2WK0A 4QY5A 1YM1A 1VQQA 4NG2A 3P09A 1BSGA 4L9GA 3E2KA 1GA9A 4GCZA 3GSGA 1NRJA 3W4QA 4E3LA 1NY0A 3CHWP 4WMCA 2V8FA 3ZNTA 4GJ4A 3PBTA 3E0YA 4IUKA 4CLCE 3PHYA 4ZJ2A 4BWIA 1JNUA 2EX8A 5JYPA 4L9FA 4GDBA 1GSWA 2VK3A 4O01A 3A0VA 3UE3A 3TJZC 4DDSA 4KG6A 4R4RA 1MWSA 1IEMA 4WF0A 2JBFA 3VP0A 3QNCA 2V1BA 1I2SA 3QHYA 4UA6A 3ZG7B 3GQZA 3SW1A 3CUEA 2BG1A 4WBGA 4G3VA 5A8BA 2JKTM 4ZAMA 4GN2A 4WZ5C 3IXGA 2J9PA 5TR7A 3TG9A 1RGYA 5FQJA 3OC2A 1N4OA 4UHUA 3BY8A 3HBRA 2ZL1A 3AGFA 1MKIA 2H28A 1PW1A 4N1XA 1S0WA 4WM9A 3R7WB 4R3AA 2QWSA 1NWZA 4BLMA 2Q9NA 1W7FA 2ZQCA 5EVEA 3O5YA 3T4OA 3MFDA 2WAFA 2ZMVA 2Y2PA 3WWXA 2VGLS 5M1AA 1K54A 1PW8A 2VGKA 1K25A 3MKFA 1LT0A 4H6JA 4E3NA 4GD8A 3OPPA 4JF4A 2A24B 4P6BA 3HREA 4Y7PA 3RH8B 3VP3A 1FCOA 4O8GA 4WEJA 3VE4A 3BQAA 5M19A 1GHPA 1GHIA 1OJGA 1CQAA 2ZMFA 3LY4A 3KX0X 2M7VA 5CX7A 4DDYA 2XK1A 3HUMA 4NK3A 2P7JA 2Y2KA 3L7HA 1LSXA 4LV3A 5L09A 2XF3A 4JKTA 4E6XA 3CPTA 4OQHA 4IVIA 2ZBBA 1XA1A 3NECA 3OCNA 4RA7A 1Z6FA 1YSQA 1RCJA 5GHXA 1LSVA 1ES2A 4ZTKA 5HSQA 2ZQ8A 2G2WA 3IX3A 4MEZA 1XFQA 1S1ZA 2VV6A 4GB7A 2Y2LA 4JXGA 3A0RA 4P0MA 3ZFZA 4ETXA 4D60A 1AWIA 3KSGA 1GSXA 1TDGA 2BLSA 3C30A 3LIDA 1S4RA 1KE0A 2J3TC 3K3CA 4BBVA 2H0YA 1IFQA 2KLIA 5CERA 1TS7A 4WZ5A 3OZHA 3B33A 4E3OA 3HLDA 2XRNA 2C6WB 1W8YA 3ITAA 3IBRA 3ITBA 4DE0A 1DRMA 4LCMA 4XUXA 4P6ZM 4Y0TA 1PWCA 1LI0A 3PR6A 2WGIA 5FI7A 4EBPA 3IHBA 4PMAA 2GNXA 5HZHA 3T50A 3VSLA 1Q2PA 4ETZA 2HDUA 4PM6A 2XROA 4H8RA 3BLMA 4HH3A 5CHUA 4JGOA 2HP9A 2ZC3B 1G28A 2Z2LB 3PBRA 2B02A 4GW9A 5KSHA 4B4ZA 4JXWA 4WZ4A 3BECA 3DBAA 4K0WA 3W2ZA 2J8YA 2K2NA 4PM5A 4Y5FA 1ESUA 1XJ6A 1TDLA 3UB7A 2Y55A 4EBLA 2QKPA 4PPRA 4ZJ3A 2ZQAA 4KZ8A 2OWJA 3G2YA 1P97A 5G18A 1MWTA 5EM0A 4C6YA 3W4PA 5EVID 2X02A 3M2JA 5DVAA 3O3VA 2O9BA 1SKOB 4S2NC 1XFNA 2ZL1B 4LCLA 5EVIB 2OAQ1 3MBZA 2VKSA 5DKLA 2WZZA 3LYXA 3UB6A 2PD8A 1BYWA 3VFHA 4R23A 1FOFA 1K56D 2YKFA 3JYIA 5CXWA 5U47A 3KYEA 3GV9A 3T4SA 4OONA 3MQ0A 2Q9MA 3T4QA 5CEBA 2Y2HA 5CHJA 3LIBA 1WE4A 2J3TD 5LBRA 5MC7A 1W79A 3CJMA 4H6JB 1NXYA 2XA7M 3NULA 3FKVA 2JN7A 1X0OA 2A24A 1ES5A 2J9OA 2EFUA 1QMEA 2GX5A 4S2IA 3LIFA 5IS1A 4QD4A 1BLHA 3SH8A 4BL2A 2HDRA 1Y54A 3IWOA 3GTCA 5HD3A 1F5MA 1YLJA 3F1NA 3S22A 3CLOA 2DCFA 4IBRA 3VP1A 3HCYA 5FQ9A 4GDNA 3WS5A 2ZMAA 3VOYA 2NUTC 1Y4OA 1DP9A 4IEDA 4LRYC 1K38A 1TD5A 3HLCA 3O88A 3RXWA 1TS8A 1TEMA 2PYPA 5L10A 4S2LA 1JWZA 5HL1A 4CQHA 3LR3A 4Q8IA 1I2WA 3Q82A 5HX9A 1ERQA 4WN5A 4E6WA 2W3EA 3ZGAB 4KUKA 3UE0A 4I3JA 2V2FF 4JGRA 5DTKA 1ONGA 4CPKA 2FFFB 3BY9A 3NDGA 4BBTA 4PHTA 3IHAA 4LPZA 3S7PA 2L4RA 3T1QB 2JKRI 4DF6A 1K57C 1YQSA 4QHCA 4DXBA 2CC1A 1WYBA 2XR0A 4DXCA 3BFEA 3T12B 1MBLA 4F3LA 2Z2MB 4BJPA 1IKGA 5CGXA 4R3JA 1E3UD 1J9MA 3MFXA 4OLGA 2ZQ7A 4KZ5A 3VFFA 2V0UA 3IBJA 4AFIA 1PRQA 2G7UA 4DE2A 3T1XA 3HUOA 4JF6A 1CF0A 1YLZA 1P0ZA 5FDHA 5FA7A 3S7QA 4KQOA 2XFSA 3QP2A 1SHVA 4MMNA 4EERA 4RYEA 4OVDA 1PYYA 3HJKA 3IH8A 2XD5A 1M6KA 2XEPA 3BYDA 3G32A 1KE3A 4R38A 1NZUA 1T1CA 1CI8A 2WYXA 2WKEA 2WGVA 2GZAA 5F1GA 3DWKA 4I39A 2JKFA 4K08A 1VEUA 1C3BA 3PXPA 2B95A 1SKOA 4YINA 3V39A 4Y13A 5EVIA 3UO9A 3V67A 4IVKA 3VE3A 3ZG8B 3PBQA 5FQIA 4Y0OA 2HDQA 4N1HA 1W63Q 3TSGA 4KZBA 3WS0A 3IQAA 4E04A 1OTDA 2HF6A 4EWFA 3JPUA 5J7EA 4HHDA 4L0LA 4BL3A 2ZC5B 3CAXA 1DP6A 2AVXA 5AQAA 5HAPA 3HLGA 1ACFA 3BM6A 2L0WA 1NYMA 4II7A 3IF5A 3EQUA 1L0EA 3F1OA 1OPXA 3B42A 5FAQA 4MBHA 4OQGA 2WUQA 2Y2MA 5GLDA 3LI9A 3UE6A 4O7DA 2JC7A 4U3TA 4Y0UA 5GLBA 3A3FA 4JBFA 2ZC4B 3UDIA 3F1NB 4UA7A 4ID4A 2WKIA 3DTMA 3Q7ZA 4MBKA 3QP1A 5KIZA 3Q1FA 2RCXA 4CLCB 2Y4AA 1RGZA 1FSYA 3T4LA 3MXQA 3DW0A 4B4XA 1K55C 2A49A 4HH2A 4QPRA 1F2KA 3MQOA 2HV1A 4IJGA 1MWRA 3G34A 1DJCA 3P7NA 5JYOA 2PR5A 3MXRA 2GDNA 4BBUA 1NLZA 4OPYA 4K0XA 4UAAA 5DTSA 4UEYA 2W3HA 5A90A 1ODVA 5TGFA 4B9OA 3O86A 3P98A 2W3FA 4XUZA 3LI8A 1D1JA 4KUOA 4R0QA 1GSVA 5HPFA 3UB8A 3LUQA 4FOFA 3LEQA 3G6OA 4R1GA 4R70A 1UWNX 4ARZB 4Q0IA 3VOZA 1V9YA 3GDIA 1SKFA 2PT7A 2VEAA 3V50A 4M4XA 4FSFA 4JXSA 4GS9A 3SS3A 4B88A 2EFXA 3DTIA 4F3LB 1K57A 1MKMA 1L0FA 3NDEA 4WUJA 1BT5A 1OTIA 1AXBA 3PYPA 1TS0A 3LCEA 2O9CA 3V3SA 1L2SA 1F98A 3KSIA 1BZAA 1N9OA 4PKYA 1FILA 1CI9A 3F1PB 1ERMA 4F94A 4GHIB 2I72A 2R9XA 3QNBA 4MCWA 4OLDA 3A3DA 1ESIA 3NC8A 3OPHA 3K3DA 5HWTA 3UN7A 2IWCA 3BFGA 5K5BA 2P04A 4S2PA 4WYYA 3UNWA 4UQIM 4ZBEA 3IS2A 1Z09A 3IH9A 1VEUB 3ICYA 1MPLA 2XD1A 3WRTA 3EQVA 4MNRA 2Q0OA 2PU2A 4MN5A 5AQ7A 3C4OA 1F9IA 1NYYA 5L8MA 4WMCD 2BTFP 1IYOA 3BFCA 3K2NA 3G30A 2VJWA 1H0MA 3OPRA 2B18A 1H5XA 4G3KA 1G68A 2ZM2A 4R3BA 4C75A 4DJ2A 1E3UA 5IU1A 1TVFA 1KDWA 3T4TA 3F1OB 1P9RA 5F82A 4IBXA 1BUEA 2CMNA 4KG2A 3DWZA 3G35A 5FQKA 2ZD8A 1PZPA 2X01A 3NJAA 5FATA 2V1ZA 4Y15A 3UPOA 4HEFA 3E98A 1MZUA 1OT6A 3BRMA 4HY8A 4N9LA 1LL8A 4RX3A 5DTTA 2VA0A 4OP5A 2J3WA 2ZC7A 3EWKA 4CLCA 2WGWB 1PI4A 2XH9A 4FUWA 2XQZA 5HFOA 2QHKA 4E3IA 1CK3A 2QPNA 1ZC2A 4NKPA 2KOIA 4YNRA 5IHVA 3SH9A 4QY6A 1KE4A 3AGEA 2EA9A 3LR4A 3VMAA 4CLCC 3IF6B 4QWOA 3R4KA 4G3WA 3MMHA 4QB8A 2M1CA 3BEBA 2QMIA 3D9YA 4S2JA 5EOOA 2PDRA 1YT4A 1FR1A 3VV4A 3QP8A 1L3LA 1YMSA 5GHYA 1K55A 2Z6CA 1ALQA 2PD7A 4PM8A 1MC0A 2V0WA 4KZAA 4ARZA 2A3UA 4EQIA 1OT9A 5C5KA 3BFFA 3I7JA 4JGPA 5E2EA 4L9EA 1YKDA 1KGGA 3CMZA 2JCHA 1VM1A 4GS9B 1DJBA 3B3XA 2HDSA 3U2AA 3M6HA 4QU3A 5GHZA 2W0NA 4EEPA 2VV8A 4GD6A 4JPMA 4DRTA 4N92A 2PYRA 3OPLA 4OH0A 4X69A 5FI6A 3QP4A 1H3QA 5TJJA 3ZNYA 5HARA 3JVVA 3MF0A 4BD1A 3M2KA 3FZCA 2FH5A 2BASA 3F1PA 1HD8A 3H7WA 1YAXA 4GHIA 4HBUA 2HPBA 2JKTI 3WS4A 3NIAA 4UQIS 4PKYG 5DKKA 1H8YA 5FEFA 4PM7A 3MKEA 5F68A 4RVAA 1K56A 1OTBA 3IT9A 5GLAA 3LEZA 1YLTA 3N4IA 1J3WA 3BWLA 5A91A 3IS2B 5FQQA 2HJEA 5FASA 4OOMA 2Y2NA 5M18A 3LR0A 3SS4A 1KDSA 5CGSA 1JTDA 2H10A 5CEDA 2EX2A 4KG5A 4KZ9A 2VLGA 3DTKA 3UY6A 2M7UA 4LGWA 5KZHA 2X71A 5D3OA 3A3JA 1IKIA 5E2GA 5DF8A 4X53A 4MBFA 2WKQA 3SS5A 3OLOA 3QP6A 3WRZA 2O9AA 4S2OA 1SDEA 1XGIA 3MZDA 3S7NA 2WKRA 4X6TA 4XT2A 4HIAA 2JKRM 1MXOA 3JVUA 1E4DA 3KSFA 3VP4A 3ZG9B 3T1RA 4PM9A 1K0KA 1S67L 2PU4A 3Q7VA 3ZVTA 2VGLM 3H9WA 5FAOA 4YWZA 3NBLA 3S4XA 2H0TA 2RL3A 3PAEA 2WGWA 3UE1A 3U4LP 3SOIA 3TE8A 1V9ZA 1PWDA 4FCFA 1IELA 4HNBA 1KGEA 5EUAA 3T4JA 3N7WA 2HZ5A 4HJ3A 3CI6A 3LIAA 1Q2QA 4GKUA 5CTMA 3T1SA 1OJ5A 2JHEA 3BJNA 4OKPA 1LSWA 3N8SA 1CEFA 3IF6A 3LR5A 2I9VA 3H82B 1LL5A 3EOIA 3NHQA 4HJ4A 2Y91A 1K4FA 4KQQA 3A3EA 4U0XA 2PAVP 4C3QA 3UB9A 3MZFA 5EE8A 2VGJA 1A0KA 1H8ZA 2ZQDA 1G6AA 5CGWA 1ZHHB 3EEAA 4WEKA 3C7UA 2VZWA 2ZLYA 5FQMA 4LRXC 5DJUA 3E4OA 1HTZA 3FV7A 4YOFA 1HZOA 1YLPA 3OBFA 1XJ2A 3PBSA 4YFMA 3G2ZA 3FG8A 1PZOA 4OQ0A 1RP5A 3ZYTA 5DF7A 4BQMA 3MSHA 2HP5A 3GVBA 3WS1A 1FIKA 4KENB 3D3OA 3HLFA 5FSRA 3KSHA 3HLBA 5EECA 1N9NA 4IHQA 5HL6A 4FH2A 4JXVA 3RTYA 1N9BA 3C7VA 4P85A 1KOUA 4GZBA 3H7WB 3T4KA 4S2NA 1FCMA 2WZXA 1UWPX 2W1TA 3PTEA 3MXSA 3S1YA 3ZQ5A 1YMXA 2OLUA 4HQAA 3TRCA 4Q0HA 5F1FA 2WADA 4MN6A 4R6LA 2OV5A 2O99A 4EUVA 4NXFA 5G4ZA 1IYSA 1ONHA 1XJ3A 2QYBA 1T1BA 5HPIA 1N9LA 5IT5A 1YLYA 1W5DA 1XJ4A 1PWGA 4P87A 3AGDA 4FD8A 4Z9QA 4OP8A 4A5RA 4Z1WA 4DKIA 2J80A 1T1AA 2K31A 4PAUA 1IOUA 2KX6A 5KMWA 4OQIA 1BLPA 1ES4A 5A93A 4NEED 1XP4A 4XT2B 5HW3A 2W3GA 1BTLA 1FR6A 3IWIA 3VSKA 4JLFA 3M6BA 3HLWA 2L1MA 3S7OA 1NRFA 5DFXA 4ZDXA 2EWWA 3TW8A 2HP6A 4NXBA 2LB5A 5I94A 2PBDP 2EX6A 3CZDA 2E8IA 2OLVA 3Q7VB 4O0PA 4WELA 3BW6A 1PIOA 2FFYA 4KZ3A 3HLEA 2OWHA 3NY4A 1WA9A 3D4FA 4EW7A 2OOLA 2H5SA 3ULFA 1KGFA 4RQ9A 1EROA 1NJ4A 4B93A 3WS2A 2C5WB 1VHMA 4HOIA 2IWDA 5E2HA 2WAEA 4HBTA 3PBNA 3Q81A 4LENA 4N9KA 4R4SA 3HL9A 2DRWA 3H82A 5HDCA 1ES3A 5F69A 1G5UA 5EV0A 3MZEA 4U0TA 1ZG4A 1S66L 2HJ9C 1XGJA 1Y28A 3FWLA 1L0DA 2VX8A 1XKZA 1K4EA 1IYQA 4ZJ1A 5FAPA 5HWWA 1ZKJA 3KO6A 4M3KA 4DN0A 1GCEA 3V3RA 2ZM0A 4EETB 4CJNA 4UA9A 3SH7A 2PRFA 4Y2FA 3W4OA 1LHYA 3LO7A 3PAGA 2WKHA 2INWA 4X1MA 2XSSA 1W8QA 2XLNA 3NI9A 4HJ6A 1TF1A 3IX4A 4ZRRA 1K54C 1JTGA 2JE5A 1P9WA 3QP5A 2ZM8A 4E3MA 2W1TB 2MJ6A 2P08A 4OPQA 4LV0A 1E25A 3ZG5A 1YPRA 5E2FA 3LFVA 3EGDC 3LICA 4FH4A 3IXBA 4EESA 2P74A 2V8CA 4GNUA 3L9KA 1D7EA 4EV4A 5G4YA 3VOLA 2P9VB 4MN7A 2EXAA 3N8LA 1XXMA 4DMZA 4BMWA 2V9AA 3OOVA 3C8CA 5TFQA 5FEGA 1KVMA 1JWVA 3HUNA 3VP2A 1G6OA 3MQQA 2ZC6B 5J8XA 4Q0JA 1LI9A 1KVLA 5HAQA 5GL9A 2O0YA 3V5MA 5CECA 1HLUP 2Y2GA 4EXOA 1MWUA 5FDSA 4I5SA 1U60A 4HESA 3FYZA 3RXXA 4HP4A 3ZG0A 5KSCA 1IYPA 1OTEA 4KZ4A 3BQ8A 1TS6A 1HVBA 3UMDA 3DAVA 2Y79A 1EWZA 2OSUA 3OCLA 1YLWA 5EOEA 2XA7S 5TBMA 4I3AA 4Y3IA 5F83A 3PBOA 4MDZA 3FPVA 1I5QA 4S2KA 1UGUA 1PFLA 4HP9A 2Y2OA 4E3JA 4LLOB 2XFTA 3IWQA 3KYQA 1K6RA 4EBNA 4KZ6A 1XA7A 3NOTC 1XPBA 3NOUC 3G31A 1PNEA 1VETB 2WKPA 4I38A 1EI5A 1T18A 4OOLA 5HDDA 1LLBA 2R78A 5CRFA 2JKGA 1DP8A 4BENA 3C2WA 4GLQA 1BLSA 4DJ3A 2Y59A 1OMEA 5FI2A 2XDMA 3FPWA 1WYCA 4NETA 4ME4A 4X56A 5EVLA 2NUPC 3UPPA 4MLLA 2ZQ9A 5E43A 3G4PA 4EEUA 5F6AA 5EVIC 1OTAA 1O07A 3A3IA 4BD0A 3DTEA 1FSWA 3UDFA 4OPRA 2V1AA 3O87A 3KYZA 1BULA 3ISGA 3IX8A 3Q07A 3ZHHA 4XXRA 3LIEA 3N6IA 3ZVWA 2IWBA 2Y2IA 1YSPA 5J3WA 3C38A 4K91A 2G2UA 4QJGA 3FC7A 2ACGA 4JF5A 2J7VA 2QJ7A 1D06A 2IA2A 1BLCA 2PHYA 2R9WA 5J4EA 1PI5A 2W27A 3EGXC 5CHMA 4DE3A 3C4PA 2YKHA 1S6RA 2GJ3A 3P01A 3SZTA 3FKWA 1NZOA 4GOGA 4X55A 5I5LA 1FQGA 5DFYA 2PR6A 1SDNA 5EM1A 1FCNA 2EXBA 2W3DA 4LV1A 4S2MA 3RJUA 4CLCD 5EPHA 4E3KA 3GRJA 2Y2QA 2Y2JA 5GLCA 2UV0E 1STZA 4P6ZS 1S4SA 1LL9A 1S1YA 5HD5A
chains in the Genus database with same CATH topology
3PTEA 4PPRA 3MXSA 1MY8A 3NC8A 3S1YA 3OPHA 3UDXA 3IF6C 4ZJ3A 1YMXA 2OLUA 2ZQAA 4KZ8A 3UN7A 2IWCA 3LY3A 3BFGA 3G2YA 5BOHA 5F1FA 4S2PA 4WYYA 5G18A 1MWTA 2WADA 1L0GA 3UNWA 4C6YA 3NCKA 2OV5A 3W4PA 4ZBEA 2P9VA 4OOYA 5EVID 2X02A 2DNSA 4EUZA 3M2JA 3IH9A 5DVAA 3GMWA 3O3VA 1MPLA 2XD1A 1IYSA 4S2NC 1ONHA 3WRTA 3C5AA 4D2OA 3EQVA 4LCLA 5EVIB 3MBZA 4MNRA 1DJAA 2PU2A 2WZZA 5HAIA 5AQ7A 3C4OA 3VFHA 4R23A 4X68A 1NYYA 1YLYA 1W5DA 2B5RA 1PWGA 1FOFA 4KZ7A 1K56D 4WMCD 4P87A 3AGDA 4FD8A 4Z9QA 3TOIA 3JYIA 1IYOA 3BFCA 4OP8A 5CXWA 3G30A 3OPRA 5U47A 3BLSA 5CTNA 1H5XA 4A5RA 3GV9A 4OONA 4DKIA 1G68A 2ZM2A 4R3BA 2Q9MA 5CEBA 1M40A 2Y2HA 4RX2A 5CHJA 4C75A 1WE4A 1E3UA 3ZCZA 1K6SA 4DE1A 5KMWA 4OQIA 1BLPA 1W79A 3CJMA 1ES4A 1TVFA 5A93A 1KDWA 1CEGA 1NXYA 1XP4A 5DF9A 3FKVA 5F82A 5HW3A 4IBXA 1BTLA 1FR6A 3IWIA 1BUEA 4JLFA 3VSKA 3M6BA 3HLWA 1ES5A 1NRFA 2EFUA 2J9OA 4ZDXA 2HP6A 3E2LA 3BFDA 4KG2A 1QMEA 5I94A 4S2IA 3IXHA 2EX6A 3DWZA 3CZDA 3G35A 5FQKA 1DY6A 2ZD8A 1PZPA 2E8IA 2OLVA 2X01A 5FATA 4QD4A 2V1ZA 1BLHA 1SCWA 3Q7VB 3SH8A 4BL2A 2HDRA 4WELA 1Y54A 3N8RA 3UPOA 3IWOA 3GTCA 1PIOA 1YLJA 1ZG6A 2FFYA 4HEFA 3UPNA 3S22A 3BRMA 1GA0A 4N9LA 4KZ3A 3HLEA 2DCFA 4OPZA 4RX3A 3NY4A 4IBRA 4OP5A 5DTTA 3VP1A 2ZC7A 2WGWB 5FQ9A 1QMFA 3IXDA 4GDNA 2ZMAA 3WS5A 3D4FA 3VOYA 4IEDA 1K38A 1O7EA 1PI4A 3HLCA 2H5SA 2XH9A 3O88A 1KGFA 2XQZA 3RXWA 5HFOA 1TEMA 4S2LA 1JWZA 1EROA 5A92A 1NJ4A 4E3IA 5HL1A 1CK3A 2QPNA 4LV2A 3GR2A 1ZC2A 3WS2A 2C5WB 5IHVA 4Q8IA 5AQ9A 2IWDA 3SH9A 5AQBA 4QY6A 3HVFA 5E2HA 1KE4A 3AGEA 2WAEA 1GHMA 4HBTA 3PBNA 1I2WA 2PBYA 3CG5A 3Q81A 3Q82A 5HX9A 3VMAA 1ERQA 4LENA 3IF6B 4N9KA 4R4SA 4E6WA 3HL9A 2DRWA 2XGNA 4QB8A 3BEBA 1ES3A 3ZGAB 5L2FA 4KQRA 2QMIA 3UE0A 1XX2A 1JWPA 3MZEA 4U0TA 4S2JA 2ZJ9A 5EOOA 1ZG4A 2V2FF 2V20A 5DTKA 2UWXA 3W8KA 3ZDJA 1ONGA 1XGJA 2QZ6A 4CPKA 2FFFB 3FWLA 1L0DA 3NDGA 1XKZA 1K4EA 1YT4A 1FR1A 1IYQA 4ZJ1A 1YMSA 3IHAA 5GHYA 5FAPA 2EX9A 1K55A 1ALQA 1JVJA 2WK0A 4PM8A 1ZKJA 4QY5A 4KZAA 1YM1A 4DF6A 1K57C 2A3UA 4EQIA 1YQSA 1VQQA 4M3KA 1GCEA 3P09A 3BFFA 3I7JA 4QHCA 5E2EA 3V3RA 1BSGA 1KGGA 1GA9A 2ZM0A 3CMZA 3E2KA 2CC1A 3GSGA 4DXBA 2JCHA 4CJNA 4UA9A 3SH7A 3W4QA 2XR0A 1VM1A 1NY0A 1DJBA 1WYBA 3B3XA 4WMCA 4DXCA 4E3LA 3ZNTA 3BFEA 2HDSA 3PBTA 1MBLA 3M6HA 3W4OA 1LHYA 2Z2MB 4QU3A 5GHZA 4BJPA 1IKGA 5CGXA 4R3JA 4ZJ2A 1E3UD 3LO7A 2EX8A 5JYPA 1J9MA 4OLGA 3PAGA 4GDBA 2ZQ7A 2WKHA 4GD6A 4KZ5A 3VFFA 4JPMA 4DRTA 4DE2A 4N92A 1W8QA 3OPLA 3UE3A 4OH0A 3HUOA 4JF6A 4X69A 4DDSA 2XLNA 4KG6A 5FI6A 4R4RA 1MWSA 3ZNYA 3NI9A 1YLZA 1IEMA 5HARA 5FDHA 5FA7A 4KQOA 1K54C 2JBFA 4BD1A 3M2KA 3FZCA 1JTGA 2JE5A 2XFSA 3VP0A 3QNCA 1SHVA 1HD8A 1I2SA 3QHYA 4UA6A 4HBUA 4RYEA 2HPBA 4OVDA 3ZG7B 2ZM8A 1PYYA 4E3MA 3WS4A 3NIAA 3IH8A 2XD5A 3GQZA 1H8YA 2BG1A 4WBGA 4OPQA 4PM7A 3MKEA 1M6KA 4LV0A 2XEPA 3BYDA 1E25A 3G32A 1K56A 4RVAA 3ZG5A 1KE3A 1NZUA 3IT9A 4ZAMA 4GN2A 5E2FA 3LEZA 5GLAA 1YLTA 3N4IA 4FH4A 4WZ5C 3IXGA 1CI8A 2WYXA 3IXBA 2P74A 2WKEA 4GNUA 4EV4A 2WGVA 2J9PA 2P9VB 5A91A 2EXAA 3DWKA 3N8LA 5F1GA 5FQQA 1XXMA 5TR7A 5FASA 1C3BA 1RGYA 4OOMA 2Y2NA 3A3DA 3OC2A 1N4OA 5FQJA 3TG9A 4UHUA 5M18A 3HBRA 4YINA 3AGFA 3V39A 3SS4A 1MKIA 1KDSA 5CGSA 5EVIA 3UO9A 5TFQA 1KVMA 1JTDA 1JWVA 2H10A 4IVKA 5CEDA 2EX2A 3HUNA 3VP2A 4KG5A 3ZG8B 4KZ9A 3PBQA 2ZC6B 5J8XA 1PW1A 4Y0OA 4N1XA 5FQIA 1S0WA 4WM9A 1LI9A 2HDQA 3UY6A 1KVLA 5HAQA 5GL9A 2Q9NA 1W7FA 2ZQCA 4BLMA 3V5MA 4N1HA 5KZHA 2X71A 5CECA 2Y2GA 5D3OA 3A3JA 1MWUA 1IKIA 5E2GA 5DF8A 3MFDA 3TSGA 4KZBA 1U60A 4HESA 2WAFA 3WS0A 3IQAA 3FYZA 2Y2PA 4MBFA 4X53A 4EWFA 3WWXA 4L0LA 4BL3A 5M1AA 3RXXA 2ZC5B 1K54A 3ZG0A 1PW8A 3SS5A 5KSCA 1IYPA 2VGKA 5AQAA 5HAPA 4KZ4A 3HLGA 1K25A 3WRZA 3BM6A 4S2OA 1SDEA 3MKFA 1HVBA 1XGIA 3MZDA 4E3NA 1NYMA 1EWZA 3IF5A 4X6TA 3EQUA 4GD8A 3OPPA 2OSUA 1L0EA 1MXOA 4JF4A 3OCLA 4P6BA 1YLWA 3HREA 5EOEA 4Y7PA 3VP3A 1E4DA 5FAQA 3VP4A 5F83A 1FCOA 4WEJA 3ZG9B 4MBHA 3PBOA 5M19A 4OQGA 4PM9A 2WUQA 1I5QA 1GHPA 2Y2MA 1GHIA 4S2KA 5GLDA 2PU4A 2Y2OA 3LY4A 4O7DA 2JC7A 3Q7VA 4U3TA 4E3JA 4Y0UA 2XFTA 3IWQA 3ZVTA 5GLBA 1K6RA 4DDYA 4EBNA 2XK1A 3A3FA 2ZC4B 4JBFA 3UDIA 3HUMA 4KZ6A 1XA7A 4NK3A 3Q7ZA 2WKIA 2Y2KA 4ID4A 3DTMA 4MBKA 1XPBA 4UA7A 5FAOA 3NBLA 3Q1FA 3S4XA 2H0TA 2RL3A 3G31A 2RCXA 2Y4AA 3PAEA 4LV3A 2WGWA 2XF3A 1RGZA 1FSYA 4JKTA 3UE1A 4E6XA 1EI5A 4OQHA 4IVIA 3SOIA 3DW0A 4OOLA 1LLBA 1PWDA 1XA1A 4FCFA 5CRFA 1IELA 4B4XA 3OCNA 4RA7A 1Z6FA 4BENA 1RCJA 1K55C 5GHXA 1BLSA 2A49A 1KGEA 1ES2A 5EUAA 2Y59A 3N7WA 1OMEA 5FI2A 2XDMA 1Q2QA 4ZTKA 2ZQ8A 2G2WA 1MWRA 4GKUA 5CTMA 4MEZA 3G34A 1DJCA 5JYOA 1WYCA 2Y2LA 4GB7A 4JXGA 4NETA 4OKPA 4P0MA 3MXRA 4X56A 5EVLA 2GDNA 3UPPA 3N8SA 3ZFZA 1CEFA 4OPYA 4MLLA 3IF6A 2ZQ9A 4K0XA 4UAAA 3G4PA 5E43A 5DTSA 1TDGA 5EVIC 2BLSA 1LL5A 5A90A 1O07A 5TGFA 3A3IA 4BD0A 3O86A 1KE0A 2Y91A 1K4FA 3P98A 4KQQA 1FSWA 3UDFA 3A3EA 4OPRA 3O87A 4XUZA 2H0YA 4U0XA 1BULA 4C3QA 4R0QA 5CERA 3MZFA 5EE8A 2VGJA 4WZ5A 3ISGA 3OZHA 3Q07A 1H8ZA 3HLDA 3ZHHA 2C6WB 2ZQDA 4E3OA 4XXRA 1W8YA 1G6AA 3N6IA 3ZVWA 3ITAA 5CGWA 4WEKA 3C7UA 2ZLYA 2IWBA 5FQMA 2Y2IA 4R1GA 3ITBA 4DE0A 1HTZA 3FV7A 1HZOA 4LCMA 4K91A 4XUXA 1YLPA 3VOZA 4Y0TA 1PWCA 1LI0A 3PBSA 2WGIA 5FI7A 4YFMA 4EBPA 2G2UA 3G2ZA 1SKFA 4QJGA 1PZOA 3IHBA 4PMAA 3V50A 4JF5A 4OQ0A 1RP5A 4FSFA 4JXSA 2J7VA 3VSLA 5DF7A 1BLCA 4B88A 3SS3A 4BQMA 2EFXA 1Q2PA 2R9WA 1PI5A 2HDUA 2HP5A 4PM6A 3GVBA 3WS1A 4DE3A 5CHMA 1K57A 1L0FA 4KENB 3NDEA 3C4PA 1BT5A 4H8RA 3BLMA 1AXBA 3HLFA 1S6RA 5CHUA 5FSRA 3FKWA 2HP9A 3LCEA 1NZOA 4GOGA 4X55A 2ZC3B 3V3SA 1FQGA 3HLBA 1L2SA 2Z2LB 5EECA 3PBRA 1SDNA 4FH2A 5KSHA 4B4ZA 1BZAA 4JXWA 1FCNA 2EXBA 4JXVA 4LV1A 1N9BA 3C7VA 4S2MA 4P85A 3RJUA 4WZ4A 5EPHA 4E3KA 3GRJA 1CI9A 2Y2QA 2Y2JA 5GLCA 3BECA 1ERMA 4GZBA 4K0WA 4F94A 2J8YA 4PM5A 4S2NA 1ESUA 2I72A 2R9XA 1TDLA 3QNBA 1FCMA 1LL9A 4OLDA 2Y55A 2WZXA 1ESIA 4EBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PTE A;  4PPR A;  3MXS A;  1MY8 A;  3NC8 A;  3S1Y A;  3OPH A;  3UDX A;  3IF6 C;  4ZJ3 A;  1YMX A;  2OLU A;  2ZQA A;  4KZ8 A;  3UN7 A;  2IWC A;  3LY3 A;  3BFG A;  3G2Y A;  5BOH A;  5F1F A;  4S2P A;  4WYY A;  5G18 A;  1MWT A;  2WAD A;  1L0G A;  3UNW A;  4C6Y A;  3NCK A;  2OV5 A;  3W4P A;  4ZBE A;  2P9V A;  4OOY A;  5EVI D;  2X02 A;  2DNS A;  4EUZ A;  3M2J A;  3IH9 A;  5DVA A;  3GMW A;  3O3V A;  1MPL A;  2XD1 A;  1IYS A;  4S2N C;  1ONH A;  3WRT A;  3C5A A;  4D2O A;  3EQV A;  4LCL A;  5EVI B;  3MBZ A;  4MNR A;  1DJA A;  2PU2 A;  2WZZ A;  5HAI A;  5AQ7 A;  3C4O A;  3VFH A;  4R23 A;  4X68 A;  1NYY A;  1YLY A;  1W5D A;  2B5R A;  1PWG A;  1FOF A;  4KZ7 A;  1K56 D;  4WMC D;  4P87 A;  3AGD A;  4FD8 A;  4Z9Q A;  3TOI A;  3JYI A;  1IYO A;  3BFC A;  4OP8 A;  5CXW A;  3G30 A;  3OPR A;  5U47 A;  3BLS A;  5CTN A;  1H5X A;  4A5R A;  3GV9 A;  4OON A;  4DKI A;  1G68 A;  2ZM2 A;  4R3B A;  2Q9M A;  5CEB A;  1M40 A;  2Y2H A;  4RX2 A;  5CHJ A;  4C75 A;  1WE4 A;  1E3U A;  3ZCZ A;  1K6S A;  4DE1 A;  5KMW A;  4OQI A;  1BLP A;  1W79 A;  3CJM A;  1ES4 A;  1TVF A;  5A93 A;  1KDW A;  1CEG A;  1NXY A;  1XP4 A;  5DF9 A;  3FKV A;  5F82 A;  5HW3 A;  4IBX A;  1BTL A;  1FR6 A;  3IWI A;  1BUE A;  4JLF A;  3VSK A;  3M6B A;  3HLW A;  1ES5 A;  1NRF A;  2EFU A;  2J9O A;  4ZDX A;  2HP6 A;  3E2L A;  3BFD A;  4KG2 A;  1QME A;  5I94 A;  4S2I A;  3IXH A;  2EX6 A;  3DWZ A;  3CZD A;  3G35 A;  5FQK A;  1DY6 A;  2ZD8 A;  1PZP A;  2E8I A;  2OLV A;  2X01 A;  5FAT A;  4QD4 A;  2V1Z A;  1BLH A;  1SCW A;  3Q7V B;  3SH8 A;  4BL2 A;  2HDR A;  4WEL A;  1Y54 A;  3N8R A;  3UPO A;  3IWO A;  3GTC A;  1PIO A;  1YLJ A;  1ZG6 A;  2FFY A;  4HEF A;  3UPN A;  3S22 A;  3BRM A;  1GA0 A;  4N9L A;  4KZ3 A;  3HLE A;  2DCF A;  4OPZ A;  4RX3 A;  3NY4 A;  4IBR A;  4OP5 A;  5DTT A;  3VP1 A;  2ZC7 A;  2WGW B;  5FQ9 A;  1QMF A;  3IXD A;  4GDN A;  2ZMA A;  3WS5 A;  3D4F A;  3VOY A;  4IED A;  1K38 A;  1O7E A;  1PI4 A;  3HLC A;  2H5S A;  2XH9 A;  3O88 A;  1KGF A;  2XQZ A;  3RXW A;  5HFO A;  1TEM A;  4S2L A;  1JWZ A;  1ERO A;  5A92 A;  1NJ4 A;  4E3I A;  5HL1 A;  1CK3 A;  2QPN A;  4LV2 A;  3GR2 A;  1ZC2 A;  3WS2 A;  2C5W B;  5IHV A;  4Q8I A;  5AQ9 A;  2IWD A;  3SH9 A;  5AQB A;  4QY6 A;  3HVF A;  5E2H A;  1KE4 A;  3AGE A;  2WAE A;  1GHM A;  4HBT A;  3PBN A;  1I2W A;  2PBY A;  3CG5 A;  3Q81 A;  3Q82 A;  5HX9 A;  3VMA A;  1ERQ A;  4LEN A;  3IF6 B;  4N9K A;  4R4S A;  4E6W A;  3HL9 A;  2DRW A;  2XGN A;  4QB8 A;  3BEB A;  1ES3 A;  3ZGA B;  5L2F A;  4KQR A;  2QMI A;  3UE0 A;  1XX2 A;  1JWP A;  3MZE A;  4U0T A;  4S2J A;  2ZJ9 A;  5EOO A;  1ZG4 A;  2V2F F;  2V20 A;  5DTK A;  2UWX A;  3W8K A;  3ZDJ A;  1ONG A;  1XGJ A;  2QZ6 A;  4CPK A;  2FFF B;  3FWL A;  1L0D A;  3NDG A;  1XKZ A;  1K4E A;  1YT4 A;  1FR1 A;  1IYQ A;  4ZJ1 A;  1YMS A;  3IHA A;  5GHY A;  5FAP A;  2EX9 A;  1K55 A;  1ALQ A;  1JVJ A;  2WK0 A;  4PM8 A;  1ZKJ A;  4QY5 A;  4KZA A;  1YM1 A;  4DF6 A;  1K57 C;  2A3U A;  4EQI A;  1YQS A;  1VQQ A;  4M3K A;  1GCE A;  3P09 A;  3BFF A;  3I7J A;  4QHC A;  5E2E A;  3V3R A;  1BSG A;  1KGG A;  1GA9 A;  2ZM0 A;  3CMZ A;  3E2K A;  2CC1 A;  3GSG A;  4DXB A;  2JCH A;  4CJN A;  4UA9 A;  3SH7 A;  3W4Q A;  2XR0 A;  1VM1 A;  1NY0 A;  1DJB A;  1WYB A;  3B3X A;  4WMC A;  4DXC A;  4E3L A;  3ZNT A;  3BFE A;  2HDS A;  3PBT A;  1MBL A;  3M6H A;  3W4O A;  1LHY A;  2Z2M B;  4QU3 A;  5GHZ A;  4BJP A;  1IKG A;  5CGX A;  4R3J A;  4ZJ2 A;  1E3U D;  3LO7 A;  2EX8 A;  5JYP A;  1J9M A;  4OLG A;  3PAG A;  4GDB A;  2ZQ7 A;  2WKH A;  4GD6 A;  4KZ5 A;  3VFF A;  4JPM A;  4DRT A;  4DE2 A;  4N92 A;  1W8Q A;  3OPL A;  3UE3 A;  4OH0 A;  3HUO A;  4JF6 A;  4X69 A;  4DDS A;  2XLN A;  4KG6 A;  5FI6 A;  4R4R A;  1MWS A;  3ZNY A;  3NI9 A;  1YLZ A;  1IEM A;  5HAR A;  5FDH A;  5FA7 A;  4KQO A;  1K54 C;  2JBF A;  4BD1 A;  3M2K A;  3FZC A;  1JTG A;  2JE5 A;  2XFS A;  3VP0 A;  3QNC A;  1SHV A;  1HD8 A;  1I2S A;  3QHY A;  4UA6 A;  4HBU A;  4RYE A;  2HPB A;  4OVD A;  3ZG7 B;  2ZM8 A;  1PYY A;  4E3M A;  3WS4 A;  3NIA A;  3IH8 A;  2XD5 A;  3GQZ A;  1H8Y A;  2BG1 A;  4WBG A;  4OPQ A;  4PM7 A;  3MKE A;  1M6K A;  4LV0 A;  2XEP A;  3BYD A;  1E25 A;  3G32 A;  1K56 A;  4RVA A;  3ZG5 A;  1KE3 A;  1NZU A;  3IT9 A;  4ZAM A;  4GN2 A;  5E2F A;  3LEZ A;  5GLA A;  1YLT A;  3N4I A;  4FH4 A;  4WZ5 C;  3IXG A;  1CI8 A;  2WYX A;  3IXB A;  2P74 A;  2WKE A;  4GNU A;  4EV4 A;  2WGV A;  2J9P A;  2P9V B;  5A91 A;  2EXA A;  3DWK A;  3N8L A;  5F1G A;  5FQQ A;  1XXM A;  5TR7 A;  5FAS A;  1C3B A;  1RGY A;  4OOM A;  2Y2N A;  3A3D A;  3OC2 A;  1N4O A;  5FQJ A;  3TG9 A;  4UHU A;  5M18 A;  3HBR A;  4YIN A;  3AGF A;  3V39 A;  3SS4 A;  1MKI A;  1KDS A;  5CGS A;  5EVI A;  3UO9 A;  5TFQ A;  1KVM A;  1JTD A;  1JWV A;  2H10 A;  4IVK A;  5CED A;  2EX2 A;  3HUN A;  3VP2 A;  4KG5 A;  3ZG8 B;  4KZ9 A;  3PBQ A;  2ZC6 B;  5J8X A;  1PW1 A;  4Y0O A;  4N1X A;  5FQI A;  1S0W A;  4WM9 A;  1LI9 A;  2HDQ A;  3UY6 A;  1KVL A;  5HAQ A;  5GL9 A;  2Q9N A;  1W7F A;  2ZQC A;  4BLM A;  3V5M A;  4N1H A;  5KZH A;  2X71 A;  5CEC A;  2Y2G A;  5D3O A;  3A3J A;  1MWU A;  1IKI A;  5E2G A;  5DF8 A;  3MFD A;  3TSG A;  4KZB A;  1U60 A;  4HES A;  2WAF A;  3WS0 A;  3IQA A;  3FYZ A;  2Y2P A;  4MBF A;  4X53 A;  4EWF A;  3WWX A;  4L0L A;  4BL3 A;  5M1A A;  3RXX A;  2ZC5 B;  1K54 A;  3ZG0 A;  1PW8 A;  3SS5 A;  5KSC A;  1IYP A;  2VGK A;  5AQA A;  5HAP A;  4KZ4 A;  3HLG A;  1K25 A;  3WRZ A;  3BM6 A;  4S2O A;  1SDE A;  3MKF A;  1HVB A;  1XGI A;  3MZD A;  4E3N A;  1NYM A;  1EWZ A;  3IF5 A;  4X6T A;  3EQU A;  4GD8 A;  3OPP A;  2OSU A;  1L0E A;  1MXO A;  4JF4 A;  3OCL A;  4P6B A;  1YLW A;  3HRE A;  5EOE A;  4Y7P A;  3VP3 A;  1E4D A;  5FAQ A;  3VP4 A;  5F83 A;  1FCO A;  4WEJ A;  3ZG9 B;  4MBH A;  3PBO A;  5M19 A;  4OQG A;  4PM9 A;  2WUQ A;  1I5Q A;  1GHP A;  2Y2M A;  1GHI A;  4S2K A;  5GLD A;  2PU4 A;  2Y2O A;  3LY4 A;  4O7D A;  2JC7 A;  3Q7V A;  4U3T A;  4E3J A;  4Y0U A;  2XFT A;  3IWQ A;  3ZVT A;  5GLB A;  1K6R A;  4DDY A;  4EBN A;  2XK1 A;  3A3F A;  2ZC4 B;  4JBF A;  3UDI A;  3HUM A;  4KZ6 A;  1XA7 A;  4NK3 A;  3Q7Z A;  2WKI A;  2Y2K A;  4ID4 A;  3DTM A;  4MBK A;  1XPB A;  4UA7 A;  5FAO A;  3NBL A;  3Q1F A;  3S4X A;  2H0T A;  2RL3 A;  3G31 A;  2RCX A;  2Y4A A;  3PAE A;  4LV3 A;  2WGW A;  2XF3 A;  1RGZ A;  1FSY A;  4JKT A;  3UE1 A;  4E6X A;  1EI5 A;  4OQH A;  4IVI A;  3SOI A;  3DW0 A;  4OOL A;  1LLB A;  1PWD A;  1XA1 A;  4FCF A;  5CRF A;  1IEL A;  4B4X A;  3OCN A;  4RA7 A;  1Z6F A;  4BEN A;  1RCJ A;  1K55 C;  5GHX A;  1BLS A;  2A49 A;  1KGE A;  1ES2 A;  5EUA A;  2Y59 A;  3N7W A;  1OME A;  5FI2 A;  2XDM A;  1Q2Q A;  4ZTK A;  2ZQ8 A;  2G2W A;  1MWR A;  4GKU A;  5CTM A;  4MEZ A;  3G34 A;  1DJC A;  5JYO A;  1WYC A;  2Y2L A;  4GB7 A;  4JXG A;  4NET A;  4OKP A;  4P0M A;  3MXR A;  4X56 A;  5EVL A;  2GDN A;  3UPP A;  3N8S A;  3ZFZ A;  1CEF A;  4OPY A;  4MLL A;  3IF6 A;  2ZQ9 A;  4K0X A;  4UAA A;  3G4P A;  5E43 A;  5DTS A;  1TDG A;  5EVI C;  2BLS A;  1LL5 A;  5A90 A;  1O07 A;  5TGF A;  3A3I A;  4BD0 A;  3O86 A;  1KE0 A;  2Y91 A;  1K4F A;  3P98 A;  4KQQ A;  1FSW A;  3UDF A;  3A3E A;  4OPR A;  3O87 A;  4XUZ A;  2H0Y A;  4U0X A;  1BUL A;  4C3Q A;  4R0Q A;  5CER A;  3MZF A;  5EE8 A;  2VGJ A;  4WZ5 A;  3ISG A;  3OZH A;  3Q07 A;  1H8Z A;  3HLD A;  3ZHH A;  2C6W B;  2ZQD A;  4E3O A;  4XXR A;  1W8Y A;  1G6A A;  3N6I A;  3ZVW A;  3ITA A;  5CGW A;  4WEK A;  3C7U A;  2ZLY A;  2IWB A;  5FQM A;  2Y2I A;  4R1G A;  3ITB A;  4DE0 A;  1HTZ A;  3FV7 A;  1HZO A;  4LCM A;  4K91 A;  4XUX A;  1YLP A;  3VOZ A;  4Y0T A;  1PWC A;  1LI0 A;  3PBS A;  2WGI A;  5FI7 A;  4YFM A;  4EBP A;  2G2U A;  3G2Z A;  1SKF A;  4QJG A;  1PZO A;  3IHB A;  4PMA A;  3V50 A;  4JF5 A;  4OQ0 A;  1RP5 A;  4FSF A;  4JXS A;  2J7V A;  3VSL A;  5DF7 A;  1BLC A;  4B88 A;  3SS3 A;  4BQM A;  2EFX A;  1Q2P A;  2R9W A;  1PI5 A;  2HDU A;  2HP5 A;  4PM6 A;  3GVB A;  3WS1 A;  4DE3 A;  5CHM A;  1K57 A;  1L0F A;  4KEN B;  3NDE A;  3C4P A;  1BT5 A;  4H8R A;  3BLM A;  1AXB A;  3HLF A;  1S6R A;  5CHU A;  5FSR A;  3FKW A;  2HP9 A;  3LCE A;  1NZO A;  4GOG A;  4X55 A;  2ZC3 B;  3V3S A;  1FQG A;  3HLB A;  1L2S A;  2Z2L B;  5EEC A;  3PBR A;  1SDN A;  4FH2 A;  5KSH A;  4B4Z A;  1BZA A;  4JXW A;  1FCN A;  2EXB A;  4JXV A;  4LV1 A;  1N9B A;  3C7V A;  4S2M A;  4P85 A;  3RJU A;  4WZ4 A;  5EPH A;  4E3K A;  3GRJ A;  1CI9 A;  2Y2Q A;  2Y2J A;  5GLC A;  3BEC A;  1ERM A;  4GZB A;  4K0W A;  4F94 A;  2J8Y A;  4PM5 A;  4S2N A;  1ESU A;  2I72 A;  2R9X A;  1TDL A;  3QNB A;  1FCM A;  1LL9 A;  4OLD A;  2Y55 A;  2WZX A;  1ESI A;  4EBL A; 
#chains in the Genus database with same CATH topology
 3A0S A;  3UDX A;  1MY8 A;  3IF6 C;  4FTX A;  5AVE A;  1H8M A;  3LY3 A;  3HJI A;  4IUH A;  5BOH A;  5HDS A;  1L0G A;  3NCK A;  2P9V A;  4OOY A;  4HI4 A;  3UB5 P;  2DNS A;  4EUZ A;  1T19 A;  1VB6 A;  3GEC A;  2ZOH A;  2K7S A;  3GMW A;  5AVF A;  3C5A A;  4D2O A;  2D01 A;  1ZTU A;  1DJA A;  5HAI A;  2Z6D A;  3R7W A;  4LFU A;  4X68 A;  2B5R A;  4KZ7 A;  2W1R A;  3TOI A;  3E4P A;  3NOP C;  3B47 A;  3BLS A;  5CTN A;  4X1L A;  3D72 A;  2OAP 1;  1M40 A;  4NXE A;  4RX2 A;  2A2L A;  3ZCZ A;  1K6S A;  4DE1 A;  2HGV A;  1CEG A;  5DJT A;  5DF9 A;  4JGQ A;  4X25 A;  3CWF A;  5TBM B;  3MS6 A;  4WL9 A;  1W63 M;  3E2L A;  3BFD A;  5F5Y A;  4WLA A;  3IXH A;  1NLY A;  1DY6 A;  2Y8H A;  3EEH A;  1SCW A;  3N8R A;  5EFW A;  1ZG6 A;  4KQD A;  3UPN A;  1GA0 A;  4OPZ A;  1VET A;  1QMF A;  3IXD A;  5AJG A;  3CPT B;  4I3I A;  1O7E A;  3UME A;  4ESP A;  1SZV A;  5A92 A;  2KDK A;  4LV2 A;  3GR2 A;  3LGO A;  4LRZ E;  2VV7 A;  5AQ9 A;  3E4Q A;  5AQB A;  3HVF A;  2EWV A;  3CUE C;  2DMW A;  5FL3 A;  1GHM A;  2PBY A;  3CG5 A;  4Y17 A;  3MJQ A;  2ZOI A;  2XGN A;  2QJ5 A;  5L2F A;  4KQR A;  1XX2 A;  1JWP A;  2ZJ9 A;  4EQ1 A;  1EW0 A;  3CIT A;  2FZ0 A;  2V20 A;  2UWX A;  2LB9 A;  3W8K A;  3ZDJ A;  1CJF A;  2QZ6 A;  3MR0 A;  5HWV A;  4EU0 A;  5L07 A;  2E8J A;  3RFB A;  2EX9 A;  4NXG A;  1JVJ A;  2D02 A;  2WK0 A;  4QY5 A;  1YM1 A;  1VQQ A;  4NG2 A;  3P09 A;  1BSG A;  4L9G A;  3E2K A;  1GA9 A;  4GCZ A;  3GSG A;  1NRJ A;  3W4Q A;  4E3L A;  1NY0 A;  3CHW P;  4WMC A;  2V8F A;  3ZNT A;  4GJ4 A;  3PBT A;  3E0Y A;  4IUK A;  4CLC E;  3PHY A;  4ZJ2 A;  4BWI A;  1JNU A;  2EX8 A;  5JYP A;  4L9F A;  4GDB A;  1GSW A;  2VK3 A;  4O01 A;  3A0V A;  3UE3 A;  3TJZ C;  4DDS A;  4KG6 A;  4R4R A;  1MWS A;  1IEM A;  4WF0 A;  2JBF A;  3VP0 A;  3QNC A;  2V1B A;  1I2S A;  3QHY A;  4UA6 A;  3ZG7 B;  3GQZ A;  3SW1 A;  3CUE A;  2BG1 A;  4WBG A;  4G3V A;  5A8B A;  2JKT M;  4ZAM A;  4GN2 A;  4WZ5 C;  3IXG A;  2J9P A;  5TR7 A;  3TG9 A;  1RGY A;  5FQJ A;  3OC2 A;  1N4O A;  4UHU A;  3BY8 A;  3HBR A;  2ZL1 A;  3AGF A;  1MKI A;  2H28 A;  1PW1 A;  4N1X A;  1S0W A;  4WM9 A;  3R7W B;  4R3A A;  2QWS A;  1NWZ A;  4BLM A;  2Q9N A;  1W7F A;  2ZQC A;  5EVE A;  3O5Y A;  3T4O A;  3MFD A;  2WAF A;  2ZMV A;  2Y2P A;  3WWX A;  2VGL S;  5M1A A;  1K54 A;  1PW8 A;  2VGK A;  1K25 A;  3MKF A;  1LT0 A;  4H6J A;  4E3N A;  4GD8 A;  3OPP A;  4JF4 A;  2A24 B;  4P6B A;  3HRE A;  4Y7P A;  3RH8 B;  3VP3 A;  1FCO A;  4O8G A;  4WEJ A;  3VE4 A;  3BQA A;  5M19 A;  1GHP A;  1GHI A;  1OJG A;  1CQA A;  2ZMF A;  3LY4 A;  3KX0 X;  2M7V A;  5CX7 A;  4DDY A;  2XK1 A;  3HUM A;  4NK3 A;  2P7J A;  2Y2K A;  3L7H A;  1LSX A;  4LV3 A;  5L09 A;  2XF3 A;  4JKT A;  4E6X A;  3CPT A;  4OQH A;  4IVI A;  2ZBB A;  1XA1 A;  3NEC A;  3OCN A;  4RA7 A;  1Z6F A;  1YSQ A;  1RCJ A;  5GHX A;  1LSV A;  1ES2 A;  4ZTK A;  5HSQ A;  2ZQ8 A;  2G2W A;  3IX3 A;  4MEZ A;  1XFQ A;  1S1Z A;  2VV6 A;  4GB7 A;  2Y2L A;  4JXG A;  3A0R A;  4P0M A;  3ZFZ A;  4ETX A;  4D60 A;  1AWI A;  3KSG A;  1GSX A;  1TDG A;  2BLS A;  3C30 A;  3LID A;  1S4R A;  1KE0 A;  2J3T C;  3K3C A;  4BBV A;  2H0Y A;  1IFQ A;  2KLI A;  5CER A;  1TS7 A;  4WZ5 A;  3OZH A;  3B33 A;  4E3O A;  3HLD A;  2XRN A;  2C6W B;  1W8Y A;  3ITA A;  3IBR A;  3ITB A;  4DE0 A;  1DRM A;  4LCM A;  4XUX A;  4P6Z M;  4Y0T A;  1PWC A;  1LI0 A;  3PR6 A;  2WGI A;  5FI7 A;  4EBP A;  3IHB A;  4PMA A;  2GNX A;  5HZH A;  3T50 A;  3VSL A;  1Q2P A;  4ETZ A;  2HDU A;  4PM6 A;  2XRO A;  4H8R A;  3BLM A;  4HH3 A;  5CHU A;  4JGO A;  2HP9 A;  2ZC3 B;  1G28 A;  2Z2L B;  3PBR A;  2B02 A;  4GW9 A;  5KSH A;  4B4Z A;  4JXW A;  4WZ4 A;  3BEC A;  3DBA A;  4K0W A;  3W2Z A;  2J8Y A;  2K2N A;  4PM5 A;  4Y5F A;  1ESU A;  1XJ6 A;  1TDL A;  3UB7 A;  2Y55 A;  4EBL A;  2QKP A;  4PPR A;  4ZJ3 A;  2ZQA A;  4KZ8 A;  2OWJ A;  3G2Y A;  1P97 A;  5G18 A;  1MWT A;  5EM0 A;  4C6Y A;  3W4P A;  5EVI D;  2X02 A;  3M2J A;  5DVA A;  3O3V A;  2O9B A;  1SKO B;  4S2N C;  1XFN A;  2ZL1 B;  4LCL A;  5EVI B;  2OAQ 1;  3MBZ A;  2VKS A;  5DKL A;  2WZZ A;  3LYX A;  3UB6 A;  2PD8 A;  1BYW A;  3VFH A;  4R23 A;  1FOF A;  1K56 D;  2YKF A;  3JYI A;  5CXW A;  5U47 A;  3KYE A;  3GV9 A;  3T4S A;  4OON A;  3MQ0 A;  2Q9M A;  3T4Q A;  5CEB A;  2Y2H A;  5CHJ A;  3LIB A;  1WE4 A;  2J3T D;  5LBR A;  5MC7 A;  1W79 A;  3CJM A;  4H6J B;  1NXY A;  2XA7 M;  3NUL A;  3FKV A;  2JN7 A;  1X0O A;  2A24 A;  1ES5 A;  2J9O A;  2EFU A;  1QME A;  2GX5 A;  4S2I A;  3LIF A;  5IS1 A;  4QD4 A;  1BLH A;  3SH8 A;  4BL2 A;  2HDR A;  1Y54 A;  3IWO A;  3GTC A;  5HD3 A;  1F5M A;  1YLJ A;  3F1N A;  3S22 A;  3CLO A;  2DCF A;  4IBR A;  3VP1 A;  3HCY A;  5FQ9 A;  4GDN A;  3WS5 A;  2ZMA A;  3VOY A;  2NUT C;  1Y4O A;  1DP9 A;  4IED A;  4LRY C;  1K38 A;  1TD5 A;  3HLC A;  3O88 A;  3RXW A;  1TS8 A;  1TEM A;  2PYP A;  5L10 A;  4S2L A;  1JWZ A;  5HL1 A;  4CQH A;  3LR3 A;  4Q8I A;  1I2W A;  3Q82 A;  5HX9 A;  1ERQ A;  4WN5 A;  4E6W A;  2W3E A;  3ZGA B;  4KUK A;  3UE0 A;  4I3J A;  2V2F F;  4JGR A;  5DTK A;  1ONG A;  4CPK A;  2FFF B;  3BY9 A;  3NDG A;  4BBT A;  4PHT A;  3IHA A;  4LPZ A;  3S7P A;  2L4R A;  3T1Q B;  2JKR I;  4DF6 A;  1K57 C;  1YQS A;  4QHC A;  4DXB A;  2CC1 A;  1WYB A;  2XR0 A;  4DXC A;  3BFE A;  3T12 B;  1MBL A;  4F3L A;  2Z2M B;  4BJP A;  1IKG A;  5CGX A;  4R3J A;  1E3U D;  1J9M A;  3MFX A;  4OLG A;  2ZQ7 A;  4KZ5 A;  3VFF A;  2V0U A;  3IBJ A;  4AFI A;  1PRQ A;  2G7U A;  4DE2 A;  3T1X A;  3HUO A;  4JF6 A;  1CF0 A;  1YLZ A;  1P0Z A;  5FDH A;  5FA7 A;  3S7Q A;  4KQO A;  2XFS A;  3QP2 A;  1SHV A;  4MMN A;  4EER A;  4RYE A;  4OVD A;  1PYY A;  3HJK A;  3IH8 A;  2XD5 A;  1M6K A;  2XEP A;  3BYD A;  3G32 A;  1KE3 A;  4R38 A;  1NZU A;  1T1C A;  1CI8 A;  2WYX A;  2WKE A;  2WGV A;  2GZA A;  5F1G A;  3DWK A;  4I39 A;  2JKF A;  4K08 A;  1VEU A;  1C3B A;  3PXP A;  2B95 A;  1SKO A;  4YIN A;  3V39 A;  4Y13 A;  5EVI A;  3UO9 A;  3V67 A;  4IVK A;  3VE3 A;  3ZG8 B;  3PBQ A;  5FQI A;  4Y0O A;  2HDQ A;  4N1H A;  1W63 Q;  3TSG A;  4KZB A;  3WS0 A;  3IQA A;  4E04 A;  1OTD A;  2HF6 A;  4EWF A;  3JPU A;  5J7E A;  4HHD A;  4L0L A;  4BL3 A;  2ZC5 B;  3CAX A;  1DP6 A;  2AVX A;  5AQA A;  5HAP A;  3HLG A;  1ACF A;  3BM6 A;  2L0W A;  1NYM A;  4II7 A;  3IF5 A;  3EQU A;  1L0E A;  3F1O A;  1OPX A;  3B42 A;  5FAQ A;  4MBH A;  4OQG A;  2WUQ A;  2Y2M A;  5GLD A;  3LI9 A;  3UE6 A;  4O7D A;  2JC7 A;  4U3T A;  4Y0U A;  5GLB A;  3A3F A;  4JBF A;  2ZC4 B;  3UDI A;  3F1N B;  4UA7 A;  4ID4 A;  2WKI A;  3DTM A;  3Q7Z A;  4MBK A;  3QP1 A;  5KIZ A;  3Q1F A;  2RCX A;  4CLC B;  2Y4A A;  1RGZ A;  1FSY A;  3T4L A;  3MXQ A;  3DW0 A;  4B4X A;  1K55 C;  2A49 A;  4HH2 A;  4QPR A;  1F2K A;  3MQO A;  2HV1 A;  4IJG A;  1MWR A;  3G34 A;  1DJC A;  3P7N A;  5JYO A;  2PR5 A;  3MXR A;  2GDN A;  4BBU A;  1NLZ A;  4OPY A;  4K0X A;  4UAA A;  5DTS A;  4UEY A;  2W3H A;  5A90 A;  1ODV A;  5TGF A;  4B9O A;  3O86 A;  3P98 A;  2W3F A;  4XUZ A;  3LI8 A;  1D1J A;  4KUO A;  4R0Q A;  1GSV A;  5HPF A;  3UB8 A;  3LUQ A;  4FOF A;  3LEQ A;  3G6O A;  4R1G A;  4R70 A;  1UWN X;  4ARZ B;  4Q0I A;  3VOZ A;  1V9Y A;  3GDI A;  1SKF A;  2PT7 A;  2VEA A;  3V50 A;  4M4X A;  4FSF A;  4JXS A;  4GS9 A;  3SS3 A;  4B88 A;  2EFX A;  3DTI A;  4F3L B;  1K57 A;  1MKM A;  1L0F A;  3NDE A;  4WUJ A;  1BT5 A;  1OTI A;  1AXB A;  3PYP A;  1TS0 A;  3LCE A;  2O9C A;  3V3S A;  1L2S A;  1F98 A;  3KSI A;  1BZA A;  1N9O A;  4PKY A;  1FIL A;  1CI9 A;  3F1P B;  1ERM A;  4F94 A;  4GHI B;  2I72 A;  2R9X A;  3QNB A;  4MCW A;  4OLD A;  3A3D A;  1ESI A;  3NC8 A;  3OPH A;  3K3D A;  5HWT A;  3UN7 A;  2IWC A;  3BFG A;  5K5B A;  2P04 A;  4S2P A;  4WYY A;  3UNW A;  4UQI M;  4ZBE A;  3IS2 A;  1Z09 A;  3IH9 A;  1VEU B;  3ICY A;  1MPL A;  2XD1 A;  3WRT A;  3EQV A;  4MNR A;  2Q0O A;  2PU2 A;  4MN5 A;  5AQ7 A;  3C4O A;  1F9I A;  1NYY A;  5L8M A;  4WMC D;  2BTF P;  1IYO A;  3BFC A;  3K2N A;  3G30 A;  2VJW A;  1H0M A;  3OPR A;  2B18 A;  1H5X A;  4G3K A;  1G68 A;  2ZM2 A;  4R3B A;  4C75 A;  4DJ2 A;  1E3U A;  5IU1 A;  1TVF A;  1KDW A;  3T4T A;  3F1O B;  1P9R A;  5F82 A;  4IBX A;  1BUE A;  2CMN A;  4KG2 A;  3DWZ A;  3G35 A;  5FQK A;  2ZD8 A;  1PZP A;  2X01 A;  3NJA A;  5FAT A;  2V1Z A;  4Y15 A;  3UPO A;  4HEF A;  3E98 A;  1MZU A;  1OT6 A;  3BRM A;  4HY8 A;  4N9L A;  1LL8 A;  4RX3 A;  5DTT A;  2VA0 A;  4OP5 A;  2J3W A;  2ZC7 A;  3EWK A;  4CLC A;  2WGW B;  1PI4 A;  2XH9 A;  4FUW A;  2XQZ A;  5HFO A;  2QHK A;  4E3I A;  1CK3 A;  2QPN A;  1ZC2 A;  4NKP A;  2KOI A;  4YNR A;  5IHV A;  3SH9 A;  4QY6 A;  1KE4 A;  3AGE A;  2EA9 A;  3LR4 A;  3VMA A;  4CLC C;  3IF6 B;  4QWO A;  3R4K A;  4G3W A;  3MMH A;  4QB8 A;  2M1C A;  3BEB A;  2QMI A;  3D9Y A;  4S2J A;  5EOO A;  2PDR A;  1YT4 A;  1FR1 A;  3VV4 A;  3QP8 A;  1L3L A;  1YMS A;  5GHY A;  1K55 A;  2Z6C A;  1ALQ A;  2PD7 A;  4PM8 A;  1MC0 A;  2V0W A;  4KZA A;  4ARZ A;  2A3U A;  4EQI A;  1OT9 A;  5C5K A;  3BFF A;  3I7J A;  4JGP A;  5E2E A;  4L9E A;  1YKD A;  1KGG A;  3CMZ A;  2JCH A;  1VM1 A;  4GS9 B;  1DJB A;  3B3X A;  2HDS A;  3U2A A;  3M6H A;  4QU3 A;  5GHZ A;  2W0N A;  4EEP A;  2VV8 A;  4GD6 A;  4JPM A;  4DRT A;  4N92 A;  2PYR A;  3OPL A;  4OH0 A;  4X69 A;  5FI6 A;  3QP4 A;  1H3Q A;  5TJJ A;  3ZNY A;  5HAR A;  3JVV A;  3MF0 A;  4BD1 A;  3M2K A;  3FZC A;  2FH5 A;  2BAS A;  3F1P A;  1HD8 A;  3H7W A;  1YAX A;  4GHI A;  4HBU A;  2HPB A;  2JKT I;  3WS4 A;  3NIA A;  4UQI S;  4PKY G;  5DKK A;  1H8Y A;  5FEF A;  4PM7 A;  3MKE A;  5F68 A;  4RVA A;  1K56 A;  1OTB A;  3IT9 A;  5GLA A;  3LEZ A;  1YLT A;  3N4I A;  1J3W A;  3BWL A;  5A91 A;  3IS2 B;  5FQQ A;  2HJE A;  5FAS A;  4OOM A;  2Y2N A;  5M18 A;  3LR0 A;  3SS4 A;  1KDS A;  5CGS A;  1JTD A;  2H10 A;  5CED A;  2EX2 A;  4KG5 A;  4KZ9 A;  2VLG A;  3DTK A;  3UY6 A;  2M7U A;  4LGW A;  5KZH A;  2X71 A;  5D3O A;  3A3J A;  1IKI A;  5E2G A;  5DF8 A;  4X53 A;  4MBF A;  2WKQ A;  3SS5 A;  3OLO A;  3QP6 A;  3WRZ A;  2O9A A;  4S2O A;  1SDE A;  1XGI A;  3MZD A;  3S7N A;  2WKR A;  4X6T A;  4XT2 A;  4HIA A;  2JKR M;  1MXO A;  3JVU A;  1E4D A;  3KSF A;  3VP4 A;  3ZG9 B;  3T1R A;  4PM9 A;  1K0K A;  1S67 L;  2PU4 A;  3Q7V A;  3ZVT A;  2VGL M;  3H9W A;  5FAO A;  4YWZ A;  3NBL A;  3S4X A;  2H0T A;  2RL3 A;  3PAE A;  2WGW A;  3UE1 A;  3U4L P;  3SOI A;  3TE8 A;  1V9Z A;  1PWD A;  4FCF A;  1IEL A;  4HNB A;  1KGE A;  5EUA A;  3T4J A;  3N7W A;  2HZ5 A;  4HJ3 A;  3CI6 A;  3LIA A;  1Q2Q A;  4GKU A;  5CTM A;  3T1S A;  1OJ5 A;  2JHE A;  3BJN A;  4OKP A;  1LSW A;  3N8S A;  1CEF A;  3IF6 A;  3LR5 A;  2I9V A;  3H82 B;  1LL5 A;  3EOI A;  3NHQ A;  4HJ4 A;  2Y91 A;  1K4F A;  4KQQ A;  3A3E A;  4U0X A;  2PAV P;  4C3Q A;  3UB9 A;  3MZF A;  5EE8 A;  2VGJ A;  1A0K A;  1H8Z A;  2ZQD A;  1G6A A;  5CGW A;  1ZHH B;  3EEA A;  4WEK A;  3C7U A;  2VZW A;  2ZLY A;  5FQM A;  4LRX C;  5DJU A;  3E4O A;  1HTZ A;  3FV7 A;  4YOF A;  1HZO A;  1YLP A;  3OBF A;  1XJ2 A;  3PBS A;  4YFM A;  3G2Z A;  3FG8 A;  1PZO A;  4OQ0 A;  1RP5 A;  3ZYT A;  5DF7 A;  4BQM A;  3MSH A;  2HP5 A;  3GVB A;  3WS1 A;  1FIK A;  4KEN B;  3D3O A;  3HLF A;  5FSR A;  3KSH A;  3HLB A;  5EEC A;  1N9N A;  4IHQ A;  5HL6 A;  4FH2 A;  4JXV A;  3RTY A;  1N9B A;  3C7V A;  4P85 A;  1KOU A;  4GZB A;  3H7W B;  3T4K A;  4S2N A;  1FCM A;  2WZX A;  1UWP X;  2W1T A;  3PTE A;  3MXS A;  3S1Y A;  3ZQ5 A;  1YMX A;  2OLU A;  4HQA A;  3TRC A;  4Q0H A;  5F1F A;  2WAD A;  4MN6 A;  4R6L A;  2OV5 A;  2O99 A;  4EUV A;  4NXF A;  5G4Z A;  1IYS A;  1ONH A;  1XJ3 A;  2QYB A;  1T1B A;  5HPI A;  1N9L A;  5IT5 A;  1YLY A;  1W5D A;  1XJ4 A;  1PWG A;  4P87 A;  3AGD A;  4FD8 A;  4Z9Q A;  4OP8 A;  4A5R A;  4Z1W A;  4DKI A;  2J80 A;  1T1A A;  2K31 A;  4PAU A;  1IOU A;  2KX6 A;  5KMW A;  4OQI A;  1BLP A;  1ES4 A;  5A93 A;  4NEE D;  1XP4 A;  4XT2 B;  5HW3 A;  2W3G A;  1BTL A;  1FR6 A;  3IWI A;  3VSK A;  4JLF A;  3M6B A;  3HLW A;  2L1M A;  3S7O A;  1NRF A;  5DFX A;  4ZDX A;  2EWW A;  3TW8 A;  2HP6 A;  4NXB A;  2LB5 A;  5I94 A;  2PBD P;  2EX6 A;  3CZD A;  2E8I A;  2OLV A;  3Q7V B;  4O0P A;  4WEL A;  3BW6 A;  1PIO A;  2FFY A;  4KZ3 A;  3HLE A;  2OWH A;  3NY4 A;  1WA9 A;  3D4F A;  4EW7 A;  2OOL A;  2H5S A;  3ULF A;  1KGF A;  4RQ9 A;  1ERO A;  1NJ4 A;  4B93 A;  3WS2 A;  2C5W B;  1VHM A;  4HOI A;  2IWD A;  5E2H A;  2WAE A;  4HBT A;  3PBN A;  3Q81 A;  4LEN A;  4N9K A;  4R4S A;  3HL9 A;  2DRW A;  3H82 A;  5HDC A;  1ES3 A;  5F69 A;  1G5U A;  5EV0 A;  3MZE A;  4U0T A;  1ZG4 A;  1S66 L;  2HJ9 C;  1XGJ A;  1Y28 A;  3FWL A;  1L0D A;  2VX8 A;  1XKZ A;  1K4E A;  1IYQ A;  4ZJ1 A;  5FAP A;  5HWW A;  1ZKJ A;  3KO6 A;  4M3K A;  4DN0 A;  1GCE A;  3V3R A;  2ZM0 A;  4EET B;  4CJN A;  4UA9 A;  3SH7 A;  2PRF A;  4Y2F A;  3W4O A;  1LHY A;  3LO7 A;  3PAG A;  2WKH A;  2INW A;  4X1M A;  2XSS A;  1W8Q A;  2XLN A;  3NI9 A;  4HJ6 A;  1TF1 A;  3IX4 A;  4ZRR A;  1K54 C;  1JTG A;  2JE5 A;  1P9W A;  3QP5 A;  2ZM8 A;  4E3M A;  2W1T B;  2MJ6 A;  2P08 A;  4OPQ A;  4LV0 A;  1E25 A;  3ZG5 A;  1YPR A;  5E2F A;  3LFV A;  3EGD C;  3LIC A;  4FH4 A;  3IXB A;  4EES A;  2P74 A;  2V8C A;  4GNU A;  3L9K A;  1D7E A;  4EV4 A;  5G4Y A;  3VOL A;  2P9V B;  4MN7 A;  2EXA A;  3N8L A;  1XXM A;  4DMZ A;  4BMW A;  2V9A A;  3OOV A;  3C8C A;  5TFQ A;  5FEG A;  1KVM A;  1JWV A;  3HUN A;  3VP2 A;  1G6O A;  3MQQ A;  2ZC6 B;  5J8X A;  4Q0J A;  1LI9 A;  1KVL A;  5HAQ A;  5GL9 A;  2O0Y A;  3V5M A;  5CEC A;  1HLU P;  2Y2G A;  4EXO A;  1MWU A;  5FDS A;  4I5S A;  1U60 A;  4HES A;  3FYZ A;  3RXX A;  4HP4 A;  3ZG0 A;  5KSC A;  1IYP A;  1OTE A;  4KZ4 A;  3BQ8 A;  1TS6 A;  1HVB A;  3UMD A;  3DAV A;  2Y79 A;  1EWZ A;  2OSU A;  3OCL A;  1YLW A;  5EOE A;  2XA7 S;  5TBM A;  4I3A A;  4Y3I A;  5F83 A;  3PBO A;  4MDZ A;  3FPV A;  1I5Q A;  4S2K A;  1UGU A;  1PFL A;  4HP9 A;  2Y2O A;  4E3J A;  4LLO B;  2XFT A;  3IWQ A;  3KYQ A;  1K6R A;  4EBN A;  4KZ6 A;  1XA7 A;  3NOT C;  1XPB A;  3NOU C;  3G31 A;  1PNE A;  1VET B;  2WKP A;  4I38 A;  1EI5 A;  1T18 A;  4OOL A;  5HDD A;  1LLB A;  2R78 A;  5CRF A;  2JKG A;  1DP8 A;  4BEN A;  3C2W A;  4GLQ A;  1BLS A;  4DJ3 A;  2Y59 A;  1OME A;  5FI2 A;  2XDM A;  3FPW A;  1WYC A;  4NET A;  4ME4 A;  4X56 A;  5EVL A;  2NUP C;  3UPP A;  4MLL A;  2ZQ9 A;  5E43 A;  3G4P A;  4EEU A;  5F6A A;  5EVI C;  1OTA A;  1O07 A;  3A3I A;  4BD0 A;  3DTE A;  1FSW A;  3UDF A;  4OPR A;  2V1A A;  3O87 A;  3KYZ A;  1BUL A;  3ISG A;  3IX8 A;  3Q07 A;  3ZHH A;  4XXR A;  3LIE A;  3N6I A;  3ZVW A;  2IWB A;  2Y2I A;  1YSP A;  5J3W A;  3C38 A;  4K91 A;  2G2U A;  4QJG A;  3FC7 A;  2ACG A;  4JF5 A;  2J7V A;  2QJ7 A;  1D06 A;  2IA2 A;  1BLC A;  2PHY A;  2R9W A;  5J4E A;  1PI5 A;  2W27 A;  3EGX C;  5CHM A;  4DE3 A;  3C4P A;  2YKH A;  1S6R A;  2GJ3 A;  3P01 A;  3SZT A;  3FKW A;  1NZO A;  4GOG A;  4X55 A;  5I5L A;  1FQG A;  5DFY A;  2PR6 A;  1SDN A;  5EM1 A;  1FCN A;  2EXB A;  2W3D A;  4LV1 A;  4S2M A;  3RJU A;  4CLC D;  5EPH A;  4E3K A;  3GRJ A;  2Y2Q A;  2Y2J A;  5GLC A;  2UV0 E;  1STZ A;  4P6Z S;  1S4S A;  1LL9 A;  1S1Y A;  5HD5 A; 
#chains in the Genus database with same CATH homology
 3PTE A;  4PPR A;  3MXS A;  1MY8 A;  3NC8 A;  3S1Y A;  3OPH A;  3UDX A;  3IF6 C;  4ZJ3 A;  1YMX A;  2OLU A;  2ZQA A;  4KZ8 A;  3UN7 A;  2IWC A;  3LY3 A;  3BFG A;  3G2Y A;  5BOH A;  5F1F A;  4S2P A;  4WYY A;  5G18 A;  1MWT A;  2WAD A;  1L0G A;  3UNW A;  4C6Y A;  3NCK A;  2OV5 A;  3W4P A;  4ZBE A;  2P9V A;  4OOY A;  5EVI D;  2X02 A;  2DNS A;  4EUZ A;  3M2J A;  3IH9 A;  5DVA A;  3GMW A;  3O3V A;  1MPL A;  2XD1 A;  1IYS A;  4S2N C;  1ONH A;  3WRT A;  3C5A A;  4D2O A;  3EQV A;  4LCL A;  5EVI B;  3MBZ A;  4MNR A;  1DJA A;  2PU2 A;  2WZZ A;  5HAI A;  5AQ7 A;  3C4O A;  3VFH A;  4R23 A;  4X68 A;  1NYY A;  1YLY A;  1W5D A;  2B5R A;  1PWG A;  1FOF A;  4KZ7 A;  1K56 D;  4WMC D;  4P87 A;  3AGD A;  4FD8 A;  4Z9Q A;  3TOI A;  3JYI A;  1IYO A;  3BFC A;  4OP8 A;  5CXW A;  3G30 A;  3OPR A;  5U47 A;  3BLS A;  5CTN A;  1H5X A;  4A5R A;  3GV9 A;  4OON A;  4DKI A;  1G68 A;  2ZM2 A;  4R3B A;  2Q9M A;  5CEB A;  1M40 A;  2Y2H A;  4RX2 A;  5CHJ A;  4C75 A;  1WE4 A;  1E3U A;  3ZCZ A;  1K6S A;  4DE1 A;  5KMW A;  4OQI A;  1BLP A;  1W79 A;  3CJM A;  1ES4 A;  1TVF A;  5A93 A;  1KDW A;  1CEG A;  1NXY A;  1XP4 A;  5DF9 A;  3FKV A;  5F82 A;  5HW3 A;  4IBX A;  1BTL A;  1FR6 A;  3IWI A;  1BUE A;  4JLF A;  3VSK A;  3M6B A;  3HLW A;  1ES5 A;  1NRF A;  2EFU A;  2J9O A;  4ZDX A;  2HP6 A;  3E2L A;  3BFD A;  4KG2 A;  1QME A;  5I94 A;  4S2I A;  3IXH A;  2EX6 A;  3DWZ A;  3CZD A;  3G35 A;  5FQK A;  1DY6 A;  2ZD8 A;  1PZP A;  2E8I A;  2OLV A;  2X01 A;  5FAT A;  4QD4 A;  2V1Z A;  1BLH A;  1SCW A;  3Q7V B;  3SH8 A;  4BL2 A;  2HDR A;  4WEL A;  1Y54 A;  3N8R A;  3UPO A;  3IWO A;  3GTC A;  1PIO A;  1YLJ A;  1ZG6 A;  2FFY A;  4HEF A;  3UPN A;  3S22 A;  3BRM A;  1GA0 A;  4N9L A;  4KZ3 A;  3HLE A;  2DCF A;  4OPZ A;  4RX3 A;  3NY4 A;  4IBR A;  4OP5 A;  5DTT A;  3VP1 A;  2ZC7 A;  2WGW B;  5FQ9 A;  1QMF A;  3IXD A;  4GDN A;  2ZMA A;  3WS5 A;  3D4F A;  3VOY A;  4IED A;  1K38 A;  1O7E A;  1PI4 A;  3HLC A;  2H5S A;  2XH9 A;  3O88 A;  1KGF A;  2XQZ A;  3RXW A;  5HFO A;  1TEM A;  4S2L A;  1JWZ A;  1ERO A;  5A92 A;  1NJ4 A;  4E3I A;  5HL1 A;  1CK3 A;  2QPN A;  4LV2 A;  3GR2 A;  1ZC2 A;  3WS2 A;  2C5W B;  5IHV A;  4Q8I A;  5AQ9 A;  2IWD A;  3SH9 A;  5AQB A;  4QY6 A;  3HVF A;  5E2H A;  1KE4 A;  3AGE A;  2WAE A;  1GHM A;  4HBT A;  3PBN A;  1I2W A;  2PBY A;  3CG5 A;  3Q81 A;  3Q82 A;  5HX9 A;  3VMA A;  1ERQ A;  4LEN A;  3IF6 B;  4N9K A;  4R4S A;  4E6W A;  3HL9 A;  2DRW A;  2XGN A;  4QB8 A;  3BEB A;  1ES3 A;  3ZGA B;  5L2F A;  4KQR A;  2QMI A;  3UE0 A;  1XX2 A;  1JWP A;  3MZE A;  4U0T A;  4S2J A;  2ZJ9 A;  5EOO A;  1ZG4 A;  2V2F F;  2V20 A;  5DTK A;  2UWX A;  3W8K A;  3ZDJ A;  1ONG A;  1XGJ A;  2QZ6 A;  4CPK A;  2FFF B;  3FWL A;  1L0D A;  3NDG A;  1XKZ A;  1K4E A;  1YT4 A;  1FR1 A;  1IYQ A;  4ZJ1 A;  1YMS A;  3IHA A;  5GHY A;  5FAP A;  2EX9 A;  1K55 A;  1ALQ A;  1JVJ A;  2WK0 A;  4PM8 A;  1ZKJ A;  4QY5 A;  4KZA A;  1YM1 A;  4DF6 A;  1K57 C;  2A3U A;  4EQI A;  1YQS A;  1VQQ A;  4M3K A;  1GCE A;  3P09 A;  3BFF A;  3I7J A;  4QHC A;  5E2E A;  3V3R A;  1BSG A;  1KGG A;  1GA9 A;  2ZM0 A;  3CMZ A;  3E2K A;  2CC1 A;  3GSG A;  4DXB A;  2JCH A;  4CJN A;  4UA9 A;  3SH7 A;  3W4Q A;  2XR0 A;  1VM1 A;  1NY0 A;  1DJB A;  1WYB A;  3B3X A;  4WMC A;  4DXC A;  4E3L A;  3ZNT A;  3BFE A;  2HDS A;  3PBT A;  1MBL A;  3M6H A;  3W4O A;  1LHY A;  2Z2M B;  4QU3 A;  5GHZ A;  4BJP A;  1IKG A;  5CGX A;  4R3J A;  4ZJ2 A;  1E3U D;  3LO7 A;  2EX8 A;  5JYP A;  1J9M A;  4OLG A;  3PAG A;  4GDB A;  2ZQ7 A;  2WKH A;  4GD6 A;  4KZ5 A;  3VFF A;  4JPM A;  4DRT A;  4DE2 A;  4N92 A;  1W8Q A;  3OPL A;  3UE3 A;  4OH0 A;  3HUO A;  4JF6 A;  4X69 A;  4DDS A;  2XLN A;  4KG6 A;  5FI6 A;  4R4R A;  1MWS A;  3ZNY A;  3NI9 A;  1YLZ A;  1IEM A;  5HAR A;  5FDH A;  5FA7 A;  4KQO A;  1K54 C;  2JBF A;  4BD1 A;  3M2K A;  3FZC A;  1JTG A;  2JE5 A;  2XFS A;  3VP0 A;  3QNC A;  1SHV A;  1HD8 A;  1I2S A;  3QHY A;  4UA6 A;  4HBU A;  4RYE A;  2HPB A;  4OVD A;  3ZG7 B;  2ZM8 A;  1PYY A;  4E3M A;  3WS4 A;  3NIA A;  3IH8 A;  2XD5 A;  3GQZ A;  1H8Y A;  2BG1 A;  4WBG A;  4OPQ A;  4PM7 A;  3MKE A;  1M6K A;  4LV0 A;  2XEP A;  3BYD A;  1E25 A;  3G32 A;  1K56 A;  4RVA A;  3ZG5 A;  1KE3 A;  1NZU A;  3IT9 A;  4ZAM A;  4GN2 A;  5E2F A;  3LEZ A;  5GLA A;  1YLT A;  3N4I A;  4FH4 A;  4WZ5 C;  3IXG A;  1CI8 A;  2WYX A;  3IXB A;  2P74 A;  2WKE A;  4GNU A;  4EV4 A;  2WGV A;  2J9P A;  2P9V B;  5A91 A;  2EXA A;  3DWK A;  3N8L A;  5F1G A;  5FQQ A;  1XXM A;  5TR7 A;  5FAS A;  1C3B A;  1RGY A;  4OOM A;  2Y2N A;  3A3D A;  3OC2 A;  1N4O A;  5FQJ A;  3TG9 A;  4UHU A;  5M18 A;  3HBR A;  4YIN A;  3AGF A;  3V39 A;  3SS4 A;  1MKI A;  1KDS A;  5CGS A;  5EVI A;  3UO9 A;  5TFQ A;  1KVM A;  1JTD A;  1JWV A;  2H10 A;  4IVK A;  5CED A;  2EX2 A;  3HUN A;  3VP2 A;  4KG5 A;  3ZG8 B;  4KZ9 A;  3PBQ A;  2ZC6 B;  5J8X A;  1PW1 A;  4Y0O A;  4N1X A;  5FQI A;  1S0W A;  4WM9 A;  1LI9 A;  2HDQ A;  3UY6 A;  1KVL A;  5HAQ A;  5GL9 A;  2Q9N A;  1W7F A;  2ZQC A;  4BLM A;  3V5M A;  4N1H A;  5KZH A;  2X71 A;  5CEC A;  2Y2G A;  5D3O A;  3A3J A;  1MWU A;  1IKI A;  5E2G A;  5DF8 A;  3MFD A;  3TSG A;  4KZB A;  1U60 A;  4HES A;  2WAF A;  3WS0 A;  3IQA A;  3FYZ A;  2Y2P A;  4MBF A;  4X53 A;  4EWF A;  3WWX A;  4L0L A;  4BL3 A;  5M1A A;  3RXX A;  2ZC5 B;  1K54 A;  3ZG0 A;  1PW8 A;  3SS5 A;  5KSC A;  1IYP A;  2VGK A;  5AQA A;  5HAP A;  4KZ4 A;  3HLG A;  1K25 A;  3WRZ A;  3BM6 A;  4S2O A;  1SDE A;  3MKF A;  1HVB A;  1XGI A;  3MZD A;  4E3N A;  1NYM A;  1EWZ A;  3IF5 A;  4X6T A;  3EQU A;  4GD8 A;  3OPP A;  2OSU A;  1L0E A;  1MXO A;  4JF4 A;  3OCL A;  4P6B A;  1YLW A;  3HRE A;  5EOE A;  4Y7P A;  3VP3 A;  1E4D A;  5FAQ A;  3VP4 A;  5F83 A;  1FCO A;  4WEJ A;  3ZG9 B;  4MBH A;  3PBO A;  5M19 A;  4OQG A;  4PM9 A;  2WUQ A;  1I5Q A;  1GHP A;  2Y2M A;  1GHI A;  4S2K A;  5GLD A;  2PU4 A;  2Y2O A;  3LY4 A;  4O7D A;  2JC7 A;  3Q7V A;  4U3T A;  4E3J A;  4Y0U A;  2XFT A;  3IWQ A;  3ZVT A;  5GLB A;  1K6R A;  4DDY A;  4EBN A;  2XK1 A;  3A3F A;  2ZC4 B;  4JBF A;  3UDI A;  3HUM A;  4KZ6 A;  1XA7 A;  4NK3 A;  3Q7Z A;  2WKI A;  2Y2K A;  4ID4 A;  3DTM A;  4MBK A;  1XPB A;  4UA7 A;  5FAO A;  3NBL A;  3Q1F A;  3S4X A;  2H0T A;  2RL3 A;  3G31 A;  2RCX A;  2Y4A A;  3PAE A;  4LV3 A;  2WGW A;  2XF3 A;  1RGZ A;  1FSY A;  4JKT A;  3UE1 A;  4E6X A;  1EI5 A;  4OQH A;  4IVI A;  3SOI A;  3DW0 A;  4OOL A;  1LLB A;  1PWD A;  1XA1 A;  4FCF A;  5CRF A;  1IEL A;  4B4X A;  3OCN A;  4RA7 A;  1Z6F A;  4BEN A;  1RCJ A;  1K55 C;  5GHX A;  1BLS A;  2A49 A;  1KGE A;  1ES2 A;  5EUA A;  2Y59 A;  3N7W A;  1OME A;  5FI2 A;  2XDM A;  1Q2Q A;  4ZTK A;  2ZQ8 A;  2G2W A;  1MWR A;  4GKU A;  5CTM A;  4MEZ A;  3G34 A;  1DJC A;  5JYO A;  1WYC A;  2Y2L A;  4GB7 A;  4JXG A;  4NET A;  4OKP A;  4P0M A;  3MXR A;  4X56 A;  5EVL A;  2GDN A;  3UPP A;  3N8S A;  3ZFZ A;  1CEF A;  4OPY A;  4MLL A;  3IF6 A;  2ZQ9 A;  4K0X A;  4UAA A;  3G4P A;  5E43 A;  5DTS A;  1TDG A;  5EVI C;  2BLS A;  1LL5 A;  5A90 A;  1O07 A;  5TGF A;  3A3I A;  4BD0 A;  3O86 A;  1KE0 A;  2Y91 A;  1K4F A;  3P98 A;  4KQQ A;  1FSW A;  3UDF A;  3A3E A;  4OPR A;  3O87 A;  4XUZ A;  2H0Y A;  4U0X A;  1BUL A;  4C3Q A;  4R0Q A;  5CER A;  3MZF A;  5EE8 A;  2VGJ A;  4WZ5 A;  3ISG A;  3OZH A;  3Q07 A;  1H8Z A;  3HLD A;  3ZHH A;  2C6W B;  2ZQD A;  4E3O A;  4XXR A;  1W8Y A;  1G6A A;  3N6I A;  3ZVW A;  3ITA A;  5CGW A;  4WEK A;  3C7U A;  2ZLY A;  2IWB A;  5FQM A;  2Y2I A;  4R1G A;  3ITB A;  4DE0 A;  1HTZ A;  3FV7 A;  1HZO A;  4LCM A;  4K91 A;  4XUX A;  1YLP A;  3VOZ A;  4Y0T A;  1PWC A;  1LI0 A;  3PBS A;  2WGI A;  5FI7 A;  4YFM A;  4EBP A;  2G2U A;  3G2Z A;  1SKF A;  4QJG A;  1PZO A;  3IHB A;  4PMA A;  3V50 A;  4JF5 A;  4OQ0 A;  1RP5 A;  4FSF A;  4JXS A;  2J7V A;  3VSL A;  5DF7 A;  1BLC A;  4B88 A;  3SS3 A;  4BQM A;  2EFX A;  1Q2P A;  2R9W A;  1PI5 A;  2HDU A;  2HP5 A;  4PM6 A;  3GVB A;  3WS1 A;  4DE3 A;  5CHM A;  1K57 A;  1L0F A;  4KEN B;  3NDE A;  3C4P A;  1BT5 A;  4H8R A;  3BLM A;  1AXB A;  3HLF A;  1S6R A;  5CHU A;  5FSR A;  3FKW A;  2HP9 A;  3LCE A;  1NZO A;  4GOG A;  4X55 A;  2ZC3 B;  3V3S A;  1FQG A;  3HLB A;  1L2S A;  2Z2L B;  5EEC A;  3PBR A;  1SDN A;  4FH2 A;  5KSH A;  4B4Z A;  1BZA A;  4JXW A;  1FCN A;  2EXB A;  4JXV A;  4LV1 A;  1N9B A;  3C7V A;  4S2M A;  4P85 A;  3RJU A;  4WZ4 A;  5EPH A;  4E3K A;  3GRJ A;  1CI9 A;  2Y2Q A;  2Y2J A;  5GLC A;  3BEC A;  1ERM A;  4GZB A;  4K0W A;  4F94 A;  2J8Y A;  4PM5 A;  4S2N A;  1ESU A;  2I72 A;  2R9X A;  1TDL A;  3QNB A;  1FCM A;  1LL9 A;  4OLD A;  2Y55 A;  2WZX A;  1ESI A;  4EBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...