5IHVA

Crystal structure of a beta-lactamase from burkholderia ambifaria
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
b'AELAALEKASNGRLGIAVLDTSNGTRIAHHARERFPLCGTYAVVAAAAILARGSLDASLLPRRILYRRYEVVAGSPVTESHVDTGMTIAQLCAAMLQSGDKGAGNLLMRVLGGPQAVTSFAHESGDTVFRLDRWEPELNLAAPGDERDTSTPVAMVDLLQQLLLGDTLREPQRAQLTEWMTGGARGATAIAAGVPPGWRVADKAGTGGYGTTTDVAVLWPPSRAPIVLAVSFTQPRADAAARADVVASAARIATGALTATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Crystal structure of a beta-lactamase from Burkholderia ambifaria
rcsb
source organism Burkholderia ambifaria
molecule tags Hydrolase
total genus 83
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ihvA00
3WRTA 1W7FA 4PM8A 4YFMA 2EFUA 2OLVA 4KENB 1EWZA 4P0MA 4S2NA 1K54C 3HLFA 2X71A 3Q07A 4OQHA 4X69A 3ZVWA 3GRJA 2WYXA 5FASA 3NBLA 5CERA 4DE1A 1MY8A 1M6KA 1W5DA 1XXMA 4FH2A 4JKTA 5FQIA 4WZ5A 5G18A 4N9KA 1KGGA 5AQAA 5DVAA 4E3IA 4R23A 3B3XA 2XD1A 4C6YA 1JTGA 4DE3A 4H8RA 4GB7A 3V3RA 3N6IA 1GHPA 1HTZA 1W8QA 2A49A 4LV0A 4OQGA 3IHAA 2Q9NA 5DF8A 3C7UA 3ZNTA 3E2KA 1IEMA 1EI5A 4HBTA 2OV5A 1BLHA 4F94A 3BFFA 3PBSA 4OLDA 4DE2A 1L0FA 1HZOA 1YLYA 1SDNA 2VGKA 4ZTKA 3GVBA 1FOFA 1K54A 3UNWA 2WADA 2EXAA 5TFQA 1O07A 3OPRA 4P6BA 4FSFA 5TR7A 3AGEA 5HAQA 3BFEA 3HREA 3EQUA 4GD6A 4KG2A 2XH9A 1KGFA 3VP0A 2Z2MB 5GLCA 5HAIA 2HDUA 1DJCA 5GLAA 3PAGA 4N9LA 2Y2GA 5FQQA 1BZAA 5DTTA 4QD4A 4R3JA 1FCMA 1I5QA 4DRTA 1H8YA 2ZD8A 3QNBA 4L0LA 5CHUA 1PW8A 4EQIA 4ZAMA 3HLEA 1MWRA 4WM9A 4OOMA 5GL9A 4BD0A 4WBGA 1K25A 3DWZA 4KZ8A 2QMIA 5FI6A 3IWIA 3SS3A 3EQVA 3UE1A 3HUNA 5BOHA 3ZGAB 3LY3A 1GCEA 3VFHA 4E6XA 3PBOA 1RP5A 2E8IA 5IHVA 2B5RA 5GHZA 3C4OA 3Q81A 3ZG0A 1JVJA 4MNRA 4E3NA 1NJ4A 3TOIA 1K56D 1IYSA 4U0TA 3UE3A 3ZVTA 5FAQA 3G32A 3V5MA 1SKFA 1JWPA 2H0TA 4B88A 3O87A 1PI5A 1L2SA 1K55A 3NDGA 4K0WA 2Y59A 1MWSA 1RCJA 2XGNA 3IH8A 1FR1A 4JBFA 1GHMA 4OOLA 3UPOA 3IHBA 4DXCA 2PBYA 3ZG5A 4OOYA 3BFGA 4WMCA 1PWDA 3FWLA 4S2OA 5I94A 2WZZA 5TGFA 5HAPA 2DNSA 1VQQA 4R3BA 4X6TA 1NXYA 5EVIA 2WKIA 2WGVA 4ZJ3A 1PWGA 2XQZA 1PYYA 5FDHA 1U60A 2OSUA 1BUEA 4C3QA 4MBKA 4RX2A 3CZDA 4ZJ2A 4DDYA 2ZQCA 2JBFA 1XA7A 3BM6A 3N8RA 4IEDA 1K4FA 2GDNA 5CRFA 4OP5A 5FATA 3IWOA 1KVMA 3NC8A 4QU3A 1KVLA 2ZQAA 5HL1A 4X53A 3VMAA 3NCKA 3M6BA 4NK3A 3HL9A 2HDQA 3GMWA 4ID4A 2X01A 3WS1A 4MLLA 4DKIA 2Y2OA 2FFYA 4KZ6A 5CHJA 5E2GA 4WELA 1IYQA 4KQRA 1K56A 3W4OA 3IH9A 1ONHA 3AGDA 3Q1FA 4EUZA 4DDSA 4S2PA 1RGZA 2Y2PA 2ZJ9A 1YQSA 2XFSA 3MXRA 2HP9A 2JE5A 5AQBA 2Y4AA 4EBNA 2WUQA 3ZDJA 2Z2LB 5D3OA 4P85A 3BRMA 3CMZA 4DF6A 4UHUA 3UDFA 5L2FA 3FV7A 3NI9A 1GA0A 3RXWA 2J7VA 3DW0A 1H5XA 2G2UA 2R9WA 4KZ5A 4GZBA 1I2WA 1KDSA 1JTDA 4DXBA 1YMXA 2V20A 1MKIA 1BLCA 1E4DA 3W4PA 2V2FF 5DF7A 4CPKA 3UDIA 4PM5A 1Z6FA 4BD1A 1CI8A 1YLWA 1RGYA 3LCEA 5FQ9A 2Y91A 1K6SA 3VSLA 3W8KA 4UA7A 1PIOA 1IELA 4MEZA 4U0XA 4N92A 3IF5A 4ZDXA 3ZFZA 2WGWA 3ZHHA 2XFTA 2HP6A 5CGSA 4LV3A 2Y2KA 2ZM8A 3IXDA 5CEBA 3MZEA 5F1FA 4KZ7A 5FSRA 3M6HA 3MKFA 3OCLA 4JXWA 3PBNA 4K0XA 1ESUA 2Y2QA 1YLJA 1G6AA 4GNUA 1BTLA 2EX9A 2H10A 5EOEA 5KSCA 4QHCA 3G34A 2ZC6B 5M19A 4UAAA 2A3UA 4R4SA 5M18A 1MWTA 1PW1A 3RXXA 2EX6A 4MBFA 1E3UD 1SHVA 4QY6A 1BSGA 3WRZA 3IF6B 2J9PA 1K57C 1XX2A 5A91A 5CTNA 4IBRA 1FCNA 3BEBA 3BYDA 4JF5A 3VOYA 2QPNA 3OZHA 1XPBA 1TVFA 1JWVA 3CJMA 2Y2HA 3ITAA 1SDEA 1FSWA 1KGEA 2JC7A 2C5WB 3HLCA 2PU4A 3UDXA 3IXHA 3MZDA 5FI7A 3ZNYA 4LV2A 2WZXA 1ZG4A 1MPLA 2ZQ7A 3NY4A 4GN2A 2EXBA 4K91A 4LV1A 3N7WA 5KZHA 4QJGA 3MZFA 4Y0OA 1IYPA 3A3IA 1FCOA 5DF9A 2IWDA 3IWQA 3SH7A 2WGIA 1FSYA 1K38A 3IF6C 5FI2A 3FKWA 1ZKJA 2P74A 3MBZA 4BL2A 3UY6A 5E2FA 1LL5A 2XEPA 2BG1A 1PWCA 5JYOA 1W8YA 3AGFA 3WS4A 3GSGA 3SS4A 4E3OA 3UPNA 5A93A 2P9VB 3C7VA 4O7DA 2EX2A 3Q7VA 4GKUA 3MFDA 3OPHA 4X56A 5EVLA 3PAEA 4ZBEA 1L0DA 1NZUA 3FYZA 5F82A 4E3MA 1LI9A 1GHIA 2C6WB 2J9OA 2WAFA 2ZQ8A 2ZC5B 5CTMA 3SH8A 3VFFA 4QY5A 1TDLA 3WS0A 4CJNA 3OPPA 4M3KA 1XGJA 4UA6A 2UWXA 3LEZA 4HBUA 4E3LA 1BLPA 3O86A 4JXVA 4Y7PA 3G35A 3PTEA 4XUXA 5E43A 3CG5A 4S2KA 1GA9A 4OQIA 3DTMA 4Z9QA 4ZJ1A 1CK3A 3UPPA 2XLNA 3O88A 1I2SA 1LHYA 4RA7A 2Y2LA 5EUAA 1YMSA 1W79A 3HUMA 4YINA 3P09A 3A3DA 5KSHA 4FH4A 1ESIA 2I72A 4D2OA 3WS2A 3FKVA 4BQMA 5GHYA 5DTSA 3BLSA 4S2IA 1KE4A 3E2LA 3GR2A 4QB8A 4RVAA 1C3BA 3OCNA 1N4OA 3V39A 3A3FA 1OMEA 4N1HA 5FQKA 4OP8A 1ONGA 1IKIA 4EBLA 3ITBA 1DJBA 2V1ZA 1KDWA 1QMFA 1NYMA 2ZC4B 4EWFA 1MWUA 5A92A 2X02A 1ALQA 4XUZA 5FAPA 4E3KA 1KE3A 3LO7A 4Y0UA 3V3SA 3Q82A 1WYCA 1BULA 4R0QA 3MKEA 1VM1A 4R1GA 3NIAA 2XK1A 4GOGA 5KMWA 4U3TA 1TDGA 4S2LA 2ZMAA 3D4FA 2RCXA 3ZCZA 4MBHA 1PI4A 3S1YA 2BLSA 4FD8A 3IXBA 1ES4A 1XP4A 1YLPA 4JF4A 1WE4A 5CGWA 1QMEA 4RX3A 5GLBA 2PU2A 4OPRA 4BJPA 3I7JA 3PBTA 4KQOA 3ISGA 2WKHA 3QHYA 5GHXA 3HLDA 3DWKA 1DY6A 5CHMA 5JYPA 2QZ6A 3C4PA 4JF6A 4OPYA 2IWBA 1CI9A 1CEGA 4KZ3A 3WWXA 5EPHA 5FA7A 1PZOA 2VGJA 4JXSA 4WZ4A 1Q2PA 1AXBA 2WAEA 4GDBA 4PPRA 3HBRA 4WEKA 2Q9MA 3SH9A 5DTKA 4PM7A 2H0YA 4KZBA 1NYYA 5CEDA 3IT9A 2ZM0A 1J9MA 1BLSA 4LENA 4OPZA 2Y2IA 4PM9A 1DJAA 4WYYA 1NY0A 4UA9A 1LLBA 1TEMA 2Y2NA 1IYOA 2ZLYA 3UO9A 5GLDA 3G2ZA 4S2JA 4Q8IA 1HVBA 1ERQA 1CEFA 5F83A 4OKPA 4E3JA 3Q7VB 3LY4A 5E2EA 3P98A 1Y54A 1ERMA 1XGIA 1YLTA 3C5AA 2DCFA 1BT5A 4BLMA 1ES3A 3O3VA 2EX8A 5AQ9A 4OH0A 4P87A 1YLZA 1Q2QA 1ZC2A 2Y55A 3BLMA 5EE8A 5CGXA 3UN7A 4WMCD 2R9XA 5EVIB 4JPMA 4OVDA 3Q7ZA 5CXWA 3GV9A 3RJUA 1S0WA 1XA1A 1XKZA 3QNCA 3S4XA 1K55C 4NETA 5J8XA 4EV4A 4LCMA 1E25A 5EVID 1MXOA 3A3JA 4DE0A 3M2KA 2J8YA 1K57A 4E6WA 3IQAA 3W4QA 3SOIA 1HD8A 4S2MA 4JXGA 4KZ4A 4GDNA 4GD8A 4X68A 3HLWA 5FQMA 4EBPA 1NRFA 2RL3A 5HX9A 4WEJA 3IXGA 3VP3A 2Y2MA 1S6RA 2WKEA 2HPBA 4OPQA 5FAOA 4IVKA 3MXSA 4OONA 5EVIC 4LCLA 4XXRA 1O7EA 1E3UA 3BFDA 2HP5A 3GQZA 3A3EA 4KZAA 3PBRA 3TG9A 2HDRA 3S22A 4BENA 3G31A 2XF3A 3ZG9B 4OLGA 3UE0A 5E2HA 3OPLA 5EOOA 1K4EA 3IF6A 3VSKA 2G2WA 1JWZA 3SS5A 1NZOA 2WK0A 3WS5A 1PZPA 4C75A 1YT4A 1EROA 1ZG6A 3ZG7B 2ZQ9A 3G4PA 1L0EA 3HVFA 4A5RA 1MBLA 3HUOA 4IVIA 4Y0TA 2CC1A 4R4RA 3VP1A 1K6RA 3HLBA 5M1AA 1L0GA 2EFXA 1N9BA 2WGWB 3VP4A 2HDSA 5HFOA 1G68A 2H5SA 3PBQA 1SCWA 5AQ7A 3VOZA 3BFCA 2ZC3B 4KG6A 3BECA 2XDMA 3HLGA 3M2JA 3NDEA 1FR6A 1ES5A 5FQJA 2IWCA 3N8SA 4PM6A 1LL9A 3GTCA 3N8LA 3V50A 5EECA 3OC2A 4HEFA 1H8ZA 2XD5A 4KG5A 5HARA 4PMAA 5A90A 1YM1A 2FFFB 4KZ9A 4HESA 4S2NC 3FZCA 1ES2A 2ZM2A 4RYEA 3TSGA 1IKGA 4KQQA 1WYBA 4N1XA 3JYIA 4BL3A 2XR0A 3ZG8B 5F1GA 2ZQDA 4WZ5C 2P9VA 4OQ0A 4IBXA 5HW3A 1KE0A 2Y2JA 3G2YA 1FQGA 1LI0A 2DRWA 2OLUA 4B4XA 4X55A 3G30A 4JLFA 4FCFA 3N4IA 3VP2A 5U47A 4B4ZA 1M40A 5CECA 2ZC7A 2JCHA
chains in the Genus database with same CATH superfamily
2JN7A 4M4XA 4PM8A 5HDDA 1K54C 4X69A 5FDSA 2WYXA 1MY8A 3E4PA 4JKTA 1ZTUA 4WZ5A 4N9KA 1KGGA 1OT9A 4C6YA 4DE3A 4H8RA 4GB7A 2A49A 4OQGA 3E2KA 4HJ3A 1LSVA 2VGKA 1G28A 3CI6A 2WADA 5TFQA 2HGVA 3OBFA 4GD6A 4KG2A 2K7SA 1DJCA 3PAGA 5FQQA 1VEUA 2Y2GA 3KSFA 4GS9A 2Y79A 2ZC7A 4L0LA 1PW8A 4ZAMA 5GL9A 4DJ3A 1K25A 4UEYA 3PXPA 2QMIA 5FI6A 3TJZC 5C5KA 2JKTM 3LY3A 1GCEA 4E6XA 1RP5A 2E8IA 3FPVA 4XT2B 2L4RA 3TOIA 2W1TA 3HJIA 3UE3A 3DTEA 2PAVP 3LIAA 3LGOA 3QP4A 1Y28A 2Y59A 4JBFA 1STZA 3UPOA 3IHBA 3LUQA 3BFGA 4S2OA 3ZQ5A 1HLUP 2B18A 1G5UA 3E0YA 1PYYA 4RX2A 4DDYA 2ZQCA 3N8RA 4OP5A 4H6JB 4QU3A 4NXGA 3CITA 4X53A 3NCKA 4QPRA 2QKPA 5HDSA 5IS1A 3LEQA 1DP6A 4IUHA 2Y2PA 3D72A 1YQSA 2XFSA 1XFNA 2Y4AA 1MZUA 4P85A 4DF6A 3P7NA 2J7VA 2R9WA 1ACFA 1IFQA 4KZ5A 1KDSA 1JTDA 2OWJA 1YMXA 5DF7A 1Z6FA 3LCEA 3VSLA 3W8KA 1K6SA 1VEUB 4UA7A 4U0XA 4GS9B 4LRXC 3T50A 4ZDXA 4UQIM 2WGWA 3CLOA 1T18A 2Y2KA 5L09A 2ZM8A 5FSRA 3OCLA 3S7QA 4K0XA 5EOEA 3G34A 2ZC6B 4MMNA 5M18A 3RXXA 2EX6A 4FUWA 2J9PA 1K57C 5A91A 5CTNA 3BEBA 1JWVA 3CJMA 4EQ1A 3FPWA 1FSWA 1KGEA 2C5WB 3HLCA 2PU4A 4PHTA 3IXHA 3MZDA 5FI7A 4DJ2A 3ZNYA 1F5MA 2WZXA 2H28A 1MPLA 3NY4A 4QJGA 4JGQA 2IWDA 1JNUA 4O0PA 5FI2A 3FKWA 3T4TA 4PKYG 2XEPA 2BG1A 1PWCA 5JYOA 3AGFA 3JPUA 3F1OA 3GSGA 3MFXA 5HWVA 3T4QA 4F3LA 1GSVA 3MFDA 5F68A 4MN5A 4E3MA 1PFLA 2W1RA 2ZQ8A 2C6WB 2WAFA 4CJNA 4M3KA 4EXOA 3NJAA 3T1QB 2UWXA 3O86A 3MQQA 4OQIA 1CJFA 4MN7A 2Z6DA 3P09A 4FH4A 1OT6A 1ESIA 2PDRA 3KSIA 2CMNA 3BLSA 4S2IA 2W3DA 1C3BA 3U4LP 3PYPA 4OP8A 2OAQ1 1DJBA 1QMFA 1MWUA 3NULA 4XUZA 4IHQA 3LO7A 3V3SA 4R1GA 2ZMAA 1PI4A 2BLSA 1ES4A 1XP4A 4JF4A 2HJ9C 3B33A 5CGWA 4RX3A 1ZHHB 3IBRA 3PBTA 4KQOA 1OTIA 3BY8A 3QHYA 5GHXA 3LFVA 5CHMA 3C4PA 4OPYA 3LI9A 1CEGA 4BBTA 1AXBA 2WAEA 3HBRA 2Q9MA 4PM7A 2H0YA 1NYYA 5CEDA 1G6OA 1J9MA 4LENA 4UA9A 2Y2NA 1H0MA 2JHEA 3PHYA 3G2ZA 3KYQA 4S2JA 4E3JA 4F3LB 1Y54A 1BT5A 2EX8A 5AQ9A 4P87A 4Z1WA 1ZC2A 3BLMA 4R3AA 3GV9A 4DN0A 1XA1A 2XA7S 5J8XA 4EV4A 4LCMA 1N9LA 1MXOA 4HNBA 4E6WA 4S2MA 5FEFA 2VLGA 3IBJA 5FQMA 4EBPA 3IXGA 2Y2MA 1S6RA 5DFYA 2W3GA 2WKEA 5FAOA 3MXSA 4XXRA 1E3UA 3A3EA 3PBRA 3S22A 4BENA 1D1JA 4E04A 1ODVA 1T1BA 2LB5A 2ZOIA 3OPLA 3IF6A 1JWZA 3EEHA 3ZG7B 3G4PA 4A5RA 3H82B 1MBLA 3HUOA 1K6RA 4BWIA 2JKTI 3NOTC 5HFOA 3DAVA 5AQ7A 3R4KA 4KG6A 1BYWA 1ES5A 5FQJA 3GTCA 3N8LA 3V50A 3OC2A 4YNRA 1H8ZA 4PMAA 1YM1A 2FFFB 4S2NC 3U2AA 2ZM2A 4RYEA 4ARZA 1WYBA 3FC7A 3JYIA 2ZQDA 2JKFA 3G2YA 2Y2JA 2KLIA 3CUEC 4FOFA 3G30A 5AVEA 1GSXA 1YPRA 5CECA 2KX6A 5EM1A 1S4SA 5TBMA 3L9KA 4II7A 2O0YA 2GZAA 2X71A 4G3WA 1UGUA 5FASA 5HWTA 4DE1A 1M6KA 4FH2A 2K31A 1SKOA 5DVAA 5L10A 3UB6A 4MDZA 1JTGA 3RFBA 3MJQA 1HTZA 3GECA 2XRNA 3IHAA 3C7UA 3R7WA 5EM0A 1IEMA 3BFFA 3C8CA 1HZOA 1SDNA 4ZTKA 1FOFA 1K54A 3UNWA 2EXAA 2QWSA 4FSFA 5EFWA 2PD8A 2XH9A 1DP8A 2Z2MB 5GLCA 5HAIA 2HDUA 1W63M 4MCWA 2ZMFA 4NG2A 2ZD8A 1OJ5A 3HLEA 1MWRA 3NOPC 2PT7A 5FEGA 3IWIA 5BOHA 3EQVA 3UE1A 3VFHA 2VX8A 3O5YA 1K0KA 2B5RA 4E3NA 4MNRA 3QP5A 1W63Q 2HJEA 4O8GA 3V5MA 2PYRA 4B88A 1PI5A 1K55A 3NDGA 4ARZB 3V67A 3B42A 5HSQA 1MKMA 4DXCA 4WMCA 1PWDA 3BQAA 3FWLA 2WZZA 5TGFA 3NECA 3E4QA 4Y5FA 1VB6A 4X6TA 1NXYA 4B93A 3BW6A 5EVIA 3K2NA 2WKIA 2WGVA 4ZJ3A 2XQZA 5FDHA 4MBKA 5TBMB 4ZJ2A 2D02A 4IEDA 5CRFA 4ESPA 1KVLA 2ZQAA 3KSGA 5HL1A 5HPFA 2E8JA 4NK3A 3HL9A 1SKOB 1KOUA 2UV0E 4MLLA 2FFYA 3P01A 5CHJA 5E2GA 1IYQA 4KQRA 2HV1A 1NWZA 1F2KA 3E98A 2W27A 3RTYA 3R7WB 3LYXA 5D3OA 4YOFA 1T19A 3B47A 1H5XA 1VHMA 1TS0A 4GZBA 3UB9A 2V20A 4PM5A 1BLCA 1E4DA 4CPKA 2V2FF 1YLWA 4HH2A 2Y91A 1OPXA 4MEZA 3C2WA 3IF5A 1XFQA 2ZL1A 3ZHHA 2WKQA 3IXDA 2ZOHA 5CEBA 4HQAA 3M6HA 1ESUA 3MMHA 4GNUA 1BTLA 2AVXA 1N9OA 5KSCA 3LIEA 2J80A 3JVUA 2ZMVA 3VOLA 4QY6A 2J3TD 3WRZA 4I3JA 3CPTA 1OTDA 2Y2HA 3W2ZA 3VE4A 1LT0A 1SDEA 4NKPA 2J3TC 4GN2A 4QWOA 2EXBA 4K91A 4Y0OA 1IYPA 3A3IA 1FCOA 5DF9A 2W3HA 1K38A 2P74A 3MBZA 5E2FA 1LL5A 4NXBA 4Y2FA 5A93A 2P9VB 4GKUA 3PAEA 3KSHA 1LI9A 2J9OA 3SH8A 2ZC5B 1PNEA 3WS0A 4HJ6A 1XGJA 4UA6A 4E3LA 3LR4A 5J4EA 4GJ4A 3G35A 3S7OA 4S2KA 5L07A 4ZJ1A 2L1MA 3T1SA 3HUMA 4YINA 5KSHA 3T1XA 2VJWA 3WS2A 4BQMA 5DTSA 1UWNX 3E2LA 2ZL1B 3KYEA 3V39A 1OMEA 1ONGA 3ITBA 2V1ZA 3OOVA 4EWFA 1NYMA 2W0NA 2A24A 2X02A 1ALQA 4E3KA 4EEUA 4Y0UA 3Q82A 1WYCA 1Z09A 2ZBBA 3MKEA 1VM1A 2O9BA 3EOIA 5KMWA 1TDGA 4S2LA 3D4FA 2YKFA 4MBHA 4EERA 1YLPA 5F5YA 4EW7A 1OTEA 1YKDA 2VZWA 2Z6CA 2WKHA 5EV0A 3DWKA 1DY6A 2EA9A 5JYPA 4JF6A 2W3EA 3WWXA 2QHKA 5FA7A 1PZOA 4JXSA 1Q2PA 2W1TB 4PPRA 3SH9A 4KZBA 1PRQA 2ZM0A 1BLSA 5I5LA 1IYOA 3UO9A 4Q8IA 1HVBA 3EWKA 2PBDP 4OKPA 5E2EA 3P98A 4LFUA 1XJ3A 1ERMA 1V9ZA 1DP9A 1YLTA 2DCFA 2Y55A 5EE8A 4CLCA 4JPMA 1YSQA 3NOUC 4OVDA 3Q7ZA 3RJUA 1S0WA 1XKZA 5EVEA 2XA7M 3A3JA 2VK3A 1TS8A 3LIFA 1MC0A 2BASA 4GDNA 3HLWA 1NRFA 5HX9A 3OLOA 4GCZA 2A24B 2HP5A 3TG9A 3G31A 2XF3A 2B95A 5MC7A 5E2HA 5EOOA 3VSKA 2G2WA 3SS5A 5G4YA 1PZPA 4C75A 1ZG6A 5DKKA 2FH5A 2V0UA 2CC1A 5M1AA 1L0GA 2EFXA 1N9BA 2WGWB 3VP4A 3VE3A 4CLCE 2H5SA 3PBQA 2XROA 3M2JA 4EESA 1FR6A 2IWCA 3N8SA 4PM6A 3RH8B 5EECA 2XD5A 3VV4A 4G3KA 5HARA 5A90A 1S1YA 1ES2A 4KQQA 1SZVA 3CHWP 2M7UA 3NHQA 4OQ0A 3UB8A 4HOIA 3N4IA 5U47A 1M40A 3TRCA 3C30A 2JCHA 4NEED 4YFMA 4CLCB 2EFUA 2OLVA 4KENB 4P0MA 4S2NA 1CF0A 3ZVWA 4OQHA 3GRJA 4I3IA 5CERA 2A2LA 1XXMA 1W5DA 4X1MA 5G18A 4O01A 1F9IA 5AQAA 2NUPC 2JKRM 4E3IA 5J3WA 2M7VA 3B3XA 2ACGA 3F1OB 3N6IA 1GHPA 4ZRRA 4LV0A 4MN6A 3ZNTA 4HBTA 2OV5A 1BLHA 4F94A 3PBSA 1YLYA 2NUTC 3GVBA 3OPRA 4P6BA 2KOIA 5TR7A 5HAQA 3BFEA 4L9FA 3HREA 3EQUA 4R38A 1BZAA 5DTTA 1FCMA 1I5QA 1H8YA 3QNBA 3BY9A 3T12B 4OOMA 4GHIA 2DMWA 4PAUA 3PBOA 2KDKA 5GHZA 3ZG0A 1JVJA 1K56D 1IYSA 1SKFA 2H0TA 3O87A 4K0WA 1MWSA 1RCJA 2VA0A 3SW1A 1GHMA 1S4RA 3ZG5A 2DNSA 4R3BA 2PR6A 1V9YA 4JGOA 1U60A 2OSUA 1BUEA 3CZDA 3BM6A 4DE2A 1K4FA 4NXEA 5FATA 3IWOA 3VMAA 3M6BA 4KQDA 2HDQA 4WN5A 3EEAA 4DKIA 4WELA 3T4OA 3IH9A 3AGDA 3Q1FA 4S2PA 1P9WA 3LR0A 3MXRA 2HP9A 5AQBA 3ZDJA 2I9VA 3BRMA 3UDFA 5L2FA 4PKYA 3FV7A 3NI9A 1GA0A 3RXWA 3H9WA 2G2UA 2QJ5A 3TW8A 2WKRA 4D60A 2L0WA 1MKIA 3G6OA 3UDIA 1J3WA 4BD1A 1CI8A 1P97A 1RGYA 4HH3A 1PIOA 2B02A 4BBVA 4WLAA 4I39A 3QP1A 4N92A 2D01A 3D9YA 1XJ2A 5CX7A 2HP6A 4JGPA 3ULFA 4LV3A 1N9NA 5F1FA 3T4SA 3MKFA 3PBNA 4LLOB 2EX9A 2H10A 4JGRA 1EW0A 5LBRA 5M19A 3LIDA 4UAAA 2M1CA 4GLQA 1E3UD 5F6AA 1BSGA 3IF6B 1TS7A 2QJ7A 4KUKA 1FCNA 4ETXA 2QPNA 1TVFA 4BBUA 2JC7A 4L9GA 3UDXA 3IS2A 3KO6A 2ZQ7A 4IUKA 4LV1A 3N7WA 3MZFA 3SH7A 3IF6C 1AWIA 4BL2A 2HZ5A 2V8FA 3E4OA 3SS4A 4E3OA 1YAXA 3S7PA 2Y8HA 3OPHA 4X56A 1L0DA 1NZUA 5F82A 2V1BA 1GHIA 3JVVA 1TS6A 1F98A 3VFFA 2P7JA 1TDLA 3LEZA 4HBUA 1BLPA 4JXVA 4Y7PA 4XUXA 5E43A 3CG5A 3DTMA 4Z9QA 4R70A 2XLNA 5EUAA 3F1PA 4RA7A 2Y2LA 1W79A 3A3DA 2PHYA 3FKVA 3A0SA 4QB8A 3GR2A 3A3FA 2LB9A 4EBLA 4ME4A 5A92A 5FAPA 1KE3A 1BULA 3K3CA 3LR3A 2J3WA 2XK1A 3MF0A 2OWHA 1S66L 2RCXA 3UB5P 4G3VA 4FD8A 4FTXA 3ZYTA 3CAXA 1WE4A 4OPRA 4BJPA 1D06A 3ISGA 3IS2B 3HLDA 3MSHA 4KZ3A 2WKPA 4X25A 2VGJA 4H6JA 3A0VA 4GDBA 2YKHA 5DTKA 1CQAA 3IT9A 1OTAA 2Y2IA 2MJ6A 4WYYA 5DJTA 1LLBA 1TEMA 5GLDA 1CEFA 1LSWA 5HL6A 5F83A 3LY4A 2O9CA 3UB7A 4BLMA 1ES3A 3O3VA 3LI8A 2V1AA 4WMCD 2R9XA 5EVIB 3FG8A 3S4XA 1K55C 5EVID 3F1PB 2J8YA 1K57A 2JKRI 1HD8A 4JXGA 4KZ4A 3PR6A 4GD8A 1LL8A 2VKSA 3VP3A 4OPQA 4I38A 4IVKA 5L8MA 4WF0A 4OONA 5EVIC 4LCLA 1XJ6A 3GQZA 4KZAA 3MQ0A 4OLGA 4Y13A 1LSXA 1K4EA 1NZOA 2WK0A 3WS5A 2PRFA 3HVFA 1A0KA 1YSPA 3KYZA 4IVIA 5AVFA 2VV8A 4R4RA 4I5SA 5HD5A 2EWVA 1G68A 4HHDA 2VV7A 2V9AA 3VOZA 1S1ZA 1S67L 4HEFA 3FZCA 3TSGA 1FILA 4N1XA 3EGXC 4BL3A 2XR0A 5HDCA 4WZ5C 2P08A 3CPTB 1KE0A 1LI0A 2DRWA 2P04A 4B4XA 1L3LA 3T4LA 4B4ZA 4B9OA 4AFIA 1Y4OA 3WRTA 1W7FA 4P6ZM 4EETB 3F1NA 1EWZA 3HLFA 3Q07A 3DBAA 3NBLA 4HJ4A 5FQIA 3LR5A 4R23A 2XD1A 4LPZA 3V3RA 1W8QA 2Q9NA 5DF8A 3BJNA 1EI5A 3A0RA 5HWWA 2O99A 3QP8A 1L0FA 4OLDA 1O07A 3AGEA 2G7UA 3VP0A 1KGFA 3MS6A 5K5BA 5GLAA 4N9LA 2INWA 4QD4A 4R3JA 3UMDA 4DRTA 4Q0IA 5CHUA 4EQIA 4WM9A 4BD0A 4WBGA 4Y3IA 3SS3A 3DWZA 3IX8A 4KZ8A 3HUNA 3ZGAB 3H7WA 3BQ8A 5IHVA 3MR0A 3C4OA 3Q81A 4LGWA 1NJ4A 4U0TA 3ZVTA 5FAQA 3G32A 1JWPA 3KX0X 1L2SA 2FZ0A 3LICA 4HY8A 2XGNA 4EUVA 3IH8A 2R78A 1FR1A 1NLYA 4HP9A 4OOLA 2PBYA 4OOYA 5I94A 2VV6A 2GJ3A 5HAPA 1VQQA 1TD5A 2VGLM 3T4KA 3T4JA 1GSWA 1NLZA 1PWGA 4X1LA 3DTKA 3F1NB 4C3QA 4WL9A 4YWZA 2JBFA 1XA7A 2GDNA 1KVMA 3NC8A 3C38A 4KUOA 3L7HA 3GMWA 4ID4A 2X01A 3WS1A 2Y2OA 4KZ6A 1K56A 1FIKA 3W4OA 1ONHA 4EUZA 4DDSA 1RGZA 3MXQA 2ZJ9A 2JE5A 1P9RA 4EBNA 2WUQA 2Z2LB 4Y15A 3CMZA 4UHUA 5IT5A 1T1CA 2W3FA 3DW0A 4DMZA 4P6ZS 1I2WA 4DXBA 3W4PA 4HP4A 3MQOA 5FQ9A 4CLCD 3H82A 4L9EA 1IELA 2OAP1 4UQIS 3ZFZA 2XFTA 5CGSA 3CUEA 3MZEA 2BTFP 2V0WA 3H7WB 4KZ7A 2O9AA 2EWWA 4JXWA 2Y2QA 1TF1A 1YLJA 1G6AA 4LRZE 4CLCC 1P0ZA 4QHCA 2K2NA 4HI4A 2A3UA 4R4SA 2PD7A 1MWTA 1PW1A 2PR5A 4MBFA 1SHVA 1XX2A 4IBRA 3BYDA 4JF5A 4R6LA 3VOYA 1NRJA 3OZHA 1XPBA 3HJKA 3ITAA 5G4ZA 1T1AA 3BWLA 2JKGA 4LV2A 3SZTA 1ZG4A 5KZHA 2PYPA 1IOUA 3IWQA 2WGIA 1FSYA 1ZKJA 3UY6A 1W8YA 1UWPX 3WS4A 3HCYA 3UPNA 3C7VA 4O7DA 5HZHA 2EX2A 3Q7VA 5EVLA 4ZBEA 3FYZA 3LIBA 5CTMA 2VGLS 4QY5A 4LRYC 3OPPA 2XSSA 3CWFA 3PTEA 1GA9A 4GW9A 1CK3A 3UPPA 3D3OA 1I2SA 1LHYA 3O88A 5AJGA 1YMSA 4D2OA 2I72A 5GHYA 1KE4A 4RVAA 3OCNA 1N4OA 4N1HA 5FQKA 1IKIA 2VEAA 2ZC4B 1KDWA 4I3AA 1OTBA 2IA2A 3GDIA 4R0QA 3NIAA 4GOGA 4U3TA 3ZCZA 3S1YA 4K08A 3IXBA 5DJUA 1H8MA 1QMEA 5GLBA 2PU2A 3I7JA 4RQ9A 4GHIB 2QZ6A 5FL3A 2IWBA 1CI9A 5EPHA 4WZ4A 3ICYA 5KIZA 3K3DA 4WEKA 2GNXA 4PM9A 4OPZA 1DJAA 4BMWA 1NY0A 5DFXA 1DRMA 2ZLYA 5HD3A 1ERQA 1VETA 1XJ4A 3Q7VB 1XGIA 4Q0JA 3C5AA 4OH0A 1YLZA 1Q2QA 3QP6A 5CGXA 3S7NA 3UN7A 2Q0OA 5CXWA 3QNCA 4NETA 2HF6A 1E25A 5HPIA 4DE0A 4NXFA 3M2KA 4WUJA 3IQAA 3W4QA 3SOIA 2GX5A 5J7EA 3DTIA 4X68A 3IX4A 2RL3A 4WEJA 3QP2A 5TJJA 2OOLA 5DKLA 2HPBA 1X0OA 1O7EA 3BFDA 2HDRA 3ZG9B 1H3QA 3UE0A 5F69A 1D7EA 4EEPA 4IJGA 1YT4A 1EROA 2ZQ9A 1L0EA 4CQHA 4Y0TA 3VP1A 3HLBA 3UMEA 5A8BA 3EGDC 2V8CA 2HDSA 1SCWA 3BFCA 2ZC3B 4XT2A 3BECA 2XDMA 3HLGA 3NDEA 1LL9A 3T1RA 3IX3A 4Q0HA 4KG5A 2QYBA 3TE8A 3UE6A 4KZ9A 4HESA 1WA9A 1IKGA 1OJGA 3ZG8B 5F1GA 2P9VA 4ETZA 4IBXA 5HW3A 1FQGA 1VETB 2OLUA 4X55A 4JLFA 3VP2A 4FCFA 4Y17A 5IU1A 4EU0A 4HIAA
chains in the Genus database with same CATH topology
3WRTA 1W7FA 4PM8A 4YFMA 2EFUA 2OLVA 4KENB 1EWZA 4P0MA 4S2NA 1K54C 3HLFA 2X71A 3Q07A 4OQHA 4X69A 3ZVWA 3GRJA 2WYXA 5FASA 3NBLA 5CERA 4DE1A 1MY8A 1M6KA 1W5DA 1XXMA 4FH2A 4JKTA 5FQIA 4WZ5A 5G18A 4N9KA 1KGGA 5AQAA 5DVAA 4E3IA 4R23A 3B3XA 2XD1A 4C6YA 1JTGA 4DE3A 4H8RA 4GB7A 3V3RA 3N6IA 1GHPA 1HTZA 1W8QA 2A49A 4LV0A 4OQGA 3IHAA 2Q9NA 5DF8A 3C7UA 3ZNTA 3E2KA 1IEMA 1EI5A 4HBTA 2OV5A 1BLHA 4F94A 3BFFA 3PBSA 4OLDA 4DE2A 1L0FA 1HZOA 1YLYA 1SDNA 2VGKA 4ZTKA 3GVBA 1FOFA 1K54A 3UNWA 2WADA 2EXAA 5TFQA 1O07A 3OPRA 4P6BA 4FSFA 5TR7A 3AGEA 5HAQA 3BFEA 3HREA 3EQUA 4GD6A 4KG2A 2XH9A 1KGFA 3VP0A 2Z2MB 5GLCA 5HAIA 2HDUA 1DJCA 5GLAA 3PAGA 4N9LA 2Y2GA 5FQQA 1BZAA 5DTTA 4QD4A 4R3JA 1FCMA 1I5QA 4DRTA 1H8YA 2ZD8A 3QNBA 4L0LA 5CHUA 1PW8A 4EQIA 4ZAMA 3HLEA 1MWRA 4WM9A 4OOMA 5GL9A 4BD0A 4WBGA 1K25A 3DWZA 4KZ8A 2QMIA 5FI6A 3IWIA 3SS3A 3EQVA 3UE1A 3HUNA 5BOHA 3ZGAB 3LY3A 1GCEA 3VFHA 4E6XA 3PBOA 1RP5A 2E8IA 5IHVA 2B5RA 5GHZA 3C4OA 3Q81A 3ZG0A 1JVJA 4MNRA 4E3NA 1NJ4A 3TOIA 1K56D 1IYSA 4U0TA 3UE3A 3ZVTA 5FAQA 3G32A 3V5MA 1SKFA 1JWPA 2H0TA 4B88A 3O87A 1PI5A 1L2SA 1K55A 3NDGA 4K0WA 2Y59A 1MWSA 1RCJA 2XGNA 3IH8A 1FR1A 4JBFA 1GHMA 4OOLA 3UPOA 3IHBA 4DXCA 2PBYA 3ZG5A 4OOYA 3BFGA 4WMCA 1PWDA 3FWLA 4S2OA 5I94A 2WZZA 5TGFA 5HAPA 2DNSA 1VQQA 4R3BA 4X6TA 1NXYA 5EVIA 2WKIA 2WGVA 4ZJ3A 1PWGA 2XQZA 1PYYA 5FDHA 1U60A 2OSUA 1BUEA 4C3QA 4MBKA 4RX2A 3CZDA 4ZJ2A 4DDYA 2ZQCA 2JBFA 1XA7A 3BM6A 3N8RA 4IEDA 1K4FA 2GDNA 5CRFA 4OP5A 5FATA 3IWOA 1KVMA 3NC8A 4QU3A 1KVLA 2ZQAA 5HL1A 4X53A 3VMAA 3NCKA 3M6BA 4NK3A 3HL9A 2HDQA 3GMWA 4ID4A 2X01A 3WS1A 4MLLA 4DKIA 2Y2OA 2FFYA 4KZ6A 5CHJA 5E2GA 4WELA 1IYQA 4KQRA 1K56A 3W4OA 3IH9A 1ONHA 3AGDA 3Q1FA 4EUZA 4DDSA 4S2PA 1RGZA 2Y2PA 2ZJ9A 1YQSA 2XFSA 3MXRA 2HP9A 2JE5A 5AQBA 2Y4AA 4EBNA 2WUQA 3ZDJA 2Z2LB 5D3OA 4P85A 3BRMA 3CMZA 4DF6A 4UHUA 3UDFA 5L2FA 3FV7A 3NI9A 1GA0A 3RXWA 2J7VA 3DW0A 1H5XA 2G2UA 2R9WA 4KZ5A 4GZBA 1I2WA 1KDSA 1JTDA 4DXBA 1YMXA 2V20A 1MKIA 1BLCA 1E4DA 3W4PA 2V2FF 5DF7A 4CPKA 3UDIA 4PM5A 1Z6FA 4BD1A 1CI8A 1YLWA 1RGYA 3LCEA 5FQ9A 2Y91A 1K6SA 3VSLA 3W8KA 4UA7A 1PIOA 1IELA 4MEZA 4U0XA 4N92A 3IF5A 4ZDXA 3ZFZA 2WGWA 3ZHHA 2XFTA 2HP6A 5CGSA 4LV3A 2Y2KA 2ZM8A 3IXDA 5CEBA 3MZEA 5F1FA 4KZ7A 5FSRA 3M6HA 3MKFA 3OCLA 4JXWA 3PBNA 4K0XA 1ESUA 2Y2QA 1YLJA 1G6AA 4GNUA 1BTLA 2EX9A 2H10A 5EOEA 5KSCA 4QHCA 3G34A 2ZC6B 5M19A 4UAAA 2A3UA 4R4SA 5M18A 1MWTA 1PW1A 3RXXA 2EX6A 4MBFA 1E3UD 1SHVA 4QY6A 1BSGA 3WRZA 3IF6B 2J9PA 1K57C 1XX2A 5A91A 5CTNA 4IBRA 1FCNA 3BEBA 3BYDA 4JF5A 3VOYA 2QPNA 3OZHA 1XPBA 1TVFA 1JWVA 3CJMA 2Y2HA 3ITAA 1SDEA 1FSWA 1KGEA 2JC7A 2C5WB 3HLCA 2PU4A 3UDXA 3IXHA 3MZDA 5FI7A 3ZNYA 4LV2A 2WZXA 1ZG4A 1MPLA 2ZQ7A 3NY4A 4GN2A 2EXBA 4K91A 4LV1A 3N7WA 5KZHA 4QJGA 3MZFA 4Y0OA 1IYPA 3A3IA 1FCOA 5DF9A 2IWDA 3IWQA 3SH7A 2WGIA 1FSYA 1K38A 3IF6C 5FI2A 3FKWA 1ZKJA 2P74A 3MBZA 4BL2A 3UY6A 5E2FA 1LL5A 2XEPA 2BG1A 1PWCA 5JYOA 1W8YA 3AGFA 3WS4A 3GSGA 3SS4A 4E3OA 3UPNA 5A93A 2P9VB 3C7VA 4O7DA 2EX2A 3Q7VA 4GKUA 3MFDA 3OPHA 4X56A 5EVLA 3PAEA 4ZBEA 1L0DA 1NZUA 3FYZA 5F82A 4E3MA 1LI9A 1GHIA 2C6WB 2J9OA 2WAFA 2ZQ8A 2ZC5B 5CTMA 3SH8A 3VFFA 4QY5A 1TDLA 3WS0A 4CJNA 3OPPA 4M3KA 1XGJA 4UA6A 2UWXA 3LEZA 4HBUA 4E3LA 1BLPA 3O86A 4JXVA 4Y7PA 3G35A 3PTEA 4XUXA 5E43A 3CG5A 4S2KA 1GA9A 4OQIA 3DTMA 4Z9QA 4ZJ1A 1CK3A 3UPPA 2XLNA 3O88A 1I2SA 1LHYA 4RA7A 2Y2LA 5EUAA 1YMSA 1W79A 3HUMA 4YINA 3P09A 3A3DA 5KSHA 4FH4A 1ESIA 2I72A 4D2OA 3WS2A 3FKVA 4BQMA 5GHYA 5DTSA 3BLSA 4S2IA 1KE4A 3E2LA 3GR2A 4QB8A 4RVAA 1C3BA 3OCNA 1N4OA 3V39A 3A3FA 1OMEA 4N1HA 5FQKA 4OP8A 1ONGA 1IKIA 4EBLA 3ITBA 1DJBA 2V1ZA 1KDWA 1QMFA 1NYMA 2ZC4B 4EWFA 1MWUA 5A92A 2X02A 1ALQA 4XUZA 5FAPA 4E3KA 1KE3A 3LO7A 4Y0UA 3V3SA 3Q82A 1WYCA 1BULA 4R0QA 3MKEA 1VM1A 4R1GA 3NIAA 2XK1A 4GOGA 5KMWA 4U3TA 1TDGA 4S2LA 2ZMAA 3D4FA 2RCXA 3ZCZA 4MBHA 1PI4A 3S1YA 2BLSA 4FD8A 3IXBA 1ES4A 1XP4A 1YLPA 4JF4A 1WE4A 5CGWA 1QMEA 4RX3A 5GLBA 2PU2A 4OPRA 4BJPA 3I7JA 3PBTA 4KQOA 3ISGA 2WKHA 3QHYA 5GHXA 3HLDA 3DWKA 1DY6A 5CHMA 5JYPA 2QZ6A 3C4PA 4JF6A 4OPYA 2IWBA 1CI9A 1CEGA 4KZ3A 3WWXA 5EPHA 5FA7A 1PZOA 2VGJA 4JXSA 4WZ4A 1Q2PA 1AXBA 2WAEA 4GDBA 4PPRA 3HBRA 4WEKA 2Q9MA 3SH9A 5DTKA 4PM7A 2H0YA 4KZBA 1NYYA 5CEDA 3IT9A 2ZM0A 1J9MA 1BLSA 4LENA 4OPZA 2Y2IA 4PM9A 1DJAA 4WYYA 1NY0A 4UA9A 1LLBA 1TEMA 2Y2NA 1IYOA 2ZLYA 3UO9A 5GLDA 3G2ZA 4S2JA 4Q8IA 1HVBA 1ERQA 1CEFA 5F83A 4OKPA 4E3JA 3Q7VB 3LY4A 5E2EA 3P98A 1Y54A 1ERMA 1XGIA 1YLTA 3C5AA 2DCFA 1BT5A 4BLMA 1ES3A 3O3VA 2EX8A 5AQ9A 4OH0A 4P87A 1YLZA 1Q2QA 1ZC2A 2Y55A 3BLMA 5EE8A 5CGXA 3UN7A 4WMCD 2R9XA 5EVIB 4JPMA 4OVDA 3Q7ZA 5CXWA 3GV9A 3RJUA 1S0WA 1XA1A 1XKZA 3QNCA 3S4XA 1K55C 4NETA 5J8XA 4EV4A 4LCMA 1E25A 5EVID 1MXOA 3A3JA 4DE0A 3M2KA 2J8YA 1K57A 4E6WA 3IQAA 3W4QA 3SOIA 1HD8A 4S2MA 4JXGA 4KZ4A 4GDNA 4GD8A 4X68A 3HLWA 5FQMA 4EBPA 1NRFA 2RL3A 5HX9A 4WEJA 3IXGA 3VP3A 2Y2MA 1S6RA 2WKEA 2HPBA 4OPQA 5FAOA 4IVKA 3MXSA 4OONA 5EVIC 4LCLA 4XXRA 1O7EA 1E3UA 3BFDA 2HP5A 3GQZA 3A3EA 4KZAA 3PBRA 3TG9A 2HDRA 3S22A 4BENA 3G31A 2XF3A 3ZG9B 4OLGA 3UE0A 5E2HA 3OPLA 5EOOA 1K4EA 3IF6A 3VSKA 2G2WA 1JWZA 3SS5A 1NZOA 2WK0A 3WS5A 1PZPA 4C75A 1YT4A 1EROA 1ZG6A 3ZG7B 2ZQ9A 3G4PA 1L0EA 3HVFA 4A5RA 1MBLA 3HUOA 4IVIA 4Y0TA 2CC1A 4R4RA 3VP1A 1K6RA 3HLBA 5M1AA 1L0GA 2EFXA 1N9BA 2WGWB 3VP4A 2HDSA 5HFOA 1G68A 2H5SA 3PBQA 1SCWA 5AQ7A 3VOZA 3BFCA 2ZC3B 4KG6A 3BECA 2XDMA 3HLGA 3M2JA 3NDEA 1FR6A 1ES5A 5FQJA 2IWCA 3N8SA 4PM6A 1LL9A 3GTCA 3N8LA 3V50A 5EECA 3OC2A 4HEFA 1H8ZA 2XD5A 4KG5A 5HARA 4PMAA 5A90A 1YM1A 2FFFB 4KZ9A 4HESA 4S2NC 3FZCA 1ES2A 2ZM2A 4RYEA 3TSGA 1IKGA 4KQQA 1WYBA 4N1XA 3JYIA 4BL3A 2XR0A 3ZG8B 5F1GA 2ZQDA 4WZ5C 2P9VA 4OQ0A 4IBXA 5HW3A 1KE0A 2Y2JA 3G2YA 1FQGA 1LI0A 2DRWA 2OLUA 4B4XA 4X55A 3G30A 4JLFA 4FCFA 3N4IA 3VP2A 5U47A 4B4ZA 1M40A 5CECA 2ZC7A 2JCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WRT A;  1W7F A;  4PM8 A;  4YFM A;  2EFU A;  2OLV A;  4KEN B;  1EWZ A;  4P0M A;  4S2N A;  1K54 C;  3HLF A;  2X71 A;  3Q07 A;  4OQH A;  4X69 A;  3ZVW A;  3GRJ A;  2WYX A;  5FAS A;  3NBL A;  5CER A;  4DE1 A;  1MY8 A;  1M6K A;  1W5D A;  1XXM A;  4FH2 A;  4JKT A;  5FQI A;  4WZ5 A;  5G18 A;  4N9K A;  1KGG A;  5AQA A;  5DVA A;  4E3I A;  4R23 A;  3B3X A;  2XD1 A;  4C6Y A;  1JTG A;  4DE3 A;  4H8R A;  4GB7 A;  3V3R A;  3N6I A;  1GHP A;  1HTZ A;  1W8Q A;  2A49 A;  4LV0 A;  4OQG A;  3IHA A;  2Q9N A;  5DF8 A;  3C7U A;  3ZNT A;  3E2K A;  1IEM A;  1EI5 A;  4HBT A;  2OV5 A;  1BLH A;  4F94 A;  3BFF A;  3PBS A;  4OLD A;  4DE2 A;  1L0F A;  1HZO A;  1YLY A;  1SDN A;  2VGK A;  4ZTK A;  3GVB A;  1FOF A;  1K54 A;  3UNW A;  2WAD A;  2EXA A;  5TFQ A;  1O07 A;  3OPR A;  4P6B A;  4FSF A;  5TR7 A;  3AGE A;  5HAQ A;  3BFE A;  3HRE A;  3EQU A;  4GD6 A;  4KG2 A;  2XH9 A;  1KGF A;  3VP0 A;  2Z2M B;  5GLC A;  5HAI A;  2HDU A;  1DJC A;  5GLA A;  3PAG A;  4N9L A;  2Y2G A;  5FQQ A;  1BZA A;  5DTT A;  4QD4 A;  4R3J A;  1FCM A;  1I5Q A;  4DRT A;  1H8Y A;  2ZD8 A;  3QNB A;  4L0L A;  5CHU A;  1PW8 A;  4EQI A;  4ZAM A;  3HLE A;  1MWR A;  4WM9 A;  4OOM A;  5GL9 A;  4BD0 A;  4WBG A;  1K25 A;  3DWZ A;  4KZ8 A;  2QMI A;  5FI6 A;  3IWI A;  3SS3 A;  3EQV A;  3UE1 A;  3HUN A;  5BOH A;  3ZGA B;  3LY3 A;  1GCE A;  3VFH A;  4E6X A;  3PBO A;  1RP5 A;  2E8I A;  5IHV A;  2B5R A;  5GHZ A;  3C4O A;  3Q81 A;  3ZG0 A;  1JVJ A;  4MNR A;  4E3N A;  1NJ4 A;  3TOI A;  1K56 D;  1IYS A;  4U0T A;  3UE3 A;  3ZVT A;  5FAQ A;  3G32 A;  3V5M A;  1SKF A;  1JWP A;  2H0T A;  4B88 A;  3O87 A;  1PI5 A;  1L2S A;  1K55 A;  3NDG A;  4K0W A;  2Y59 A;  1MWS A;  1RCJ A;  2XGN A;  3IH8 A;  1FR1 A;  4JBF A;  1GHM A;  4OOL A;  3UPO A;  3IHB A;  4DXC A;  2PBY A;  3ZG5 A;  4OOY A;  3BFG A;  4WMC A;  1PWD A;  3FWL A;  4S2O A;  5I94 A;  2WZZ A;  5TGF A;  5HAP A;  2DNS A;  1VQQ A;  4R3B A;  4X6T A;  1NXY A;  5EVI A;  2WKI A;  2WGV A;  4ZJ3 A;  1PWG A;  2XQZ A;  1PYY A;  5FDH A;  1U60 A;  2OSU A;  1BUE A;  4C3Q A;  4MBK A;  4RX2 A;  3CZD A;  4ZJ2 A;  4DDY A;  2ZQC A;  2JBF A;  1XA7 A;  3BM6 A;  3N8R A;  4IED A;  1K4F A;  2GDN A;  5CRF A;  4OP5 A;  5FAT A;  3IWO A;  1KVM A;  3NC8 A;  4QU3 A;  1KVL A;  2ZQA A;  5HL1 A;  4X53 A;  3VMA A;  3NCK A;  3M6B A;  4NK3 A;  3HL9 A;  2HDQ A;  3GMW A;  4ID4 A;  2X01 A;  3WS1 A;  4MLL A;  4DKI A;  2Y2O A;  2FFY A;  4KZ6 A;  5CHJ A;  5E2G A;  4WEL A;  1IYQ A;  4KQR A;  1K56 A;  3W4O A;  3IH9 A;  1ONH A;  3AGD A;  3Q1F A;  4EUZ A;  4DDS A;  4S2P A;  1RGZ A;  2Y2P A;  2ZJ9 A;  1YQS A;  2XFS A;  3MXR A;  2HP9 A;  2JE5 A;  5AQB A;  2Y4A A;  4EBN A;  2WUQ A;  3ZDJ A;  2Z2L B;  5D3O A;  4P85 A;  3BRM A;  3CMZ A;  4DF6 A;  4UHU A;  3UDF A;  5L2F A;  3FV7 A;  3NI9 A;  1GA0 A;  3RXW A;  2J7V A;  3DW0 A;  1H5X A;  2G2U A;  2R9W A;  4KZ5 A;  4GZB A;  1I2W A;  1KDS A;  1JTD A;  4DXB A;  1YMX A;  2V20 A;  1MKI A;  1BLC A;  1E4D A;  3W4P A;  2V2F F;  5DF7 A;  4CPK A;  3UDI A;  4PM5 A;  1Z6F A;  4BD1 A;  1CI8 A;  1YLW A;  1RGY A;  3LCE A;  5FQ9 A;  2Y91 A;  1K6S A;  3VSL A;  3W8K A;  4UA7 A;  1PIO A;  1IEL A;  4MEZ A;  4U0X A;  4N92 A;  3IF5 A;  4ZDX A;  3ZFZ A;  2WGW A;  3ZHH A;  2XFT A;  2HP6 A;  5CGS A;  4LV3 A;  2Y2K A;  2ZM8 A;  3IXD A;  5CEB A;  3MZE A;  5F1F A;  4KZ7 A;  5FSR A;  3M6H A;  3MKF A;  3OCL A;  4JXW A;  3PBN A;  4K0X A;  1ESU A;  2Y2Q A;  1YLJ A;  1G6A A;  4GNU A;  1BTL A;  2EX9 A;  2H10 A;  5EOE A;  5KSC A;  4QHC A;  3G34 A;  2ZC6 B;  5M19 A;  4UAA A;  2A3U A;  4R4S A;  5M18 A;  1MWT A;  1PW1 A;  3RXX A;  2EX6 A;  4MBF A;  1E3U D;  1SHV A;  4QY6 A;  1BSG A;  3WRZ A;  3IF6 B;  2J9P A;  1K57 C;  1XX2 A;  5A91 A;  5CTN A;  4IBR A;  1FCN A;  3BEB A;  3BYD A;  4JF5 A;  3VOY A;  2QPN A;  3OZH A;  1XPB A;  1TVF A;  1JWV A;  3CJM A;  2Y2H A;  3ITA A;  1SDE A;  1FSW A;  1KGE A;  2JC7 A;  2C5W B;  3HLC A;  2PU4 A;  3UDX A;  3IXH A;  3MZD A;  5FI7 A;  3ZNY A;  4LV2 A;  2WZX A;  1ZG4 A;  1MPL A;  2ZQ7 A;  3NY4 A;  4GN2 A;  2EXB A;  4K91 A;  4LV1 A;  3N7W A;  5KZH A;  4QJG A;  3MZF A;  4Y0O A;  1IYP A;  3A3I A;  1FCO A;  5DF9 A;  2IWD A;  3IWQ A;  3SH7 A;  2WGI A;  1FSY A;  1K38 A;  3IF6 C;  5FI2 A;  3FKW A;  1ZKJ A;  2P74 A;  3MBZ A;  4BL2 A;  3UY6 A;  5E2F A;  1LL5 A;  2XEP A;  2BG1 A;  1PWC A;  5JYO A;  1W8Y A;  3AGF A;  3WS4 A;  3GSG A;  3SS4 A;  4E3O A;  3UPN A;  5A93 A;  2P9V B;  3C7V A;  4O7D A;  2EX2 A;  3Q7V A;  4GKU A;  3MFD A;  3OPH A;  4X56 A;  5EVL A;  3PAE A;  4ZBE A;  1L0D A;  1NZU A;  3FYZ A;  5F82 A;  4E3M A;  1LI9 A;  1GHI A;  2C6W B;  2J9O A;  2WAF A;  2ZQ8 A;  2ZC5 B;  5CTM A;  3SH8 A;  3VFF A;  4QY5 A;  1TDL A;  3WS0 A;  4CJN A;  3OPP A;  4M3K A;  1XGJ A;  4UA6 A;  2UWX A;  3LEZ A;  4HBU A;  4E3L A;  1BLP A;  3O86 A;  4JXV A;  4Y7P A;  3G35 A;  3PTE A;  4XUX A;  5E43 A;  3CG5 A;  4S2K A;  1GA9 A;  4OQI A;  3DTM A;  4Z9Q A;  4ZJ1 A;  1CK3 A;  3UPP A;  2XLN A;  3O88 A;  1I2S A;  1LHY A;  4RA7 A;  2Y2L A;  5EUA A;  1YMS A;  1W79 A;  3HUM A;  4YIN A;  3P09 A;  3A3D A;  5KSH A;  4FH4 A;  1ESI A;  2I72 A;  4D2O A;  3WS2 A;  3FKV A;  4BQM A;  5GHY A;  5DTS A;  3BLS A;  4S2I A;  1KE4 A;  3E2L A;  3GR2 A;  4QB8 A;  4RVA A;  1C3B A;  3OCN A;  1N4O A;  3V39 A;  3A3F A;  1OME A;  4N1H A;  5FQK A;  4OP8 A;  1ONG A;  1IKI A;  4EBL A;  3ITB A;  1DJB A;  2V1Z A;  1KDW A;  1QMF A;  1NYM A;  2ZC4 B;  4EWF A;  1MWU A;  5A92 A;  2X02 A;  1ALQ A;  4XUZ A;  5FAP A;  4E3K A;  1KE3 A;  3LO7 A;  4Y0U A;  3V3S A;  3Q82 A;  1WYC A;  1BUL A;  4R0Q A;  3MKE A;  1VM1 A;  4R1G A;  3NIA A;  2XK1 A;  4GOG A;  5KMW A;  4U3T A;  1TDG A;  4S2L A;  2ZMA A;  3D4F A;  2RCX A;  3ZCZ A;  4MBH A;  1PI4 A;  3S1Y A;  2BLS A;  4FD8 A;  3IXB A;  1ES4 A;  1XP4 A;  1YLP A;  4JF4 A;  1WE4 A;  5CGW A;  1QME A;  4RX3 A;  5GLB A;  2PU2 A;  4OPR A;  4BJP A;  3I7J A;  3PBT A;  4KQO A;  3ISG A;  2WKH A;  3QHY A;  5GHX A;  3HLD A;  3DWK A;  1DY6 A;  5CHM A;  5JYP A;  2QZ6 A;  3C4P A;  4JF6 A;  4OPY A;  2IWB A;  1CI9 A;  1CEG A;  4KZ3 A;  3WWX A;  5EPH A;  5FA7 A;  1PZO A;  2VGJ A;  4JXS A;  4WZ4 A;  1Q2P A;  1AXB A;  2WAE A;  4GDB A;  4PPR A;  3HBR A;  4WEK A;  2Q9M A;  3SH9 A;  5DTK A;  4PM7 A;  2H0Y A;  4KZB A;  1NYY A;  5CED A;  3IT9 A;  2ZM0 A;  1J9M A;  1BLS A;  4LEN A;  4OPZ A;  2Y2I A;  4PM9 A;  1DJA A;  4WYY A;  1NY0 A;  4UA9 A;  1LLB A;  1TEM A;  2Y2N A;  1IYO A;  2ZLY A;  3UO9 A;  5GLD A;  3G2Z A;  4S2J A;  4Q8I A;  1HVB A;  1ERQ A;  1CEF A;  5F83 A;  4OKP A;  4E3J A;  3Q7V B;  3LY4 A;  5E2E A;  3P98 A;  1Y54 A;  1ERM A;  1XGI A;  1YLT A;  3C5A A;  2DCF A;  1BT5 A;  4BLM A;  1ES3 A;  3O3V A;  2EX8 A;  5AQ9 A;  4OH0 A;  4P87 A;  1YLZ A;  1Q2Q A;  1ZC2 A;  2Y55 A;  3BLM A;  5EE8 A;  5CGX A;  3UN7 A;  4WMC D;  2R9X A;  5EVI B;  4JPM A;  4OVD A;  3Q7Z A;  5CXW A;  3GV9 A;  3RJU A;  1S0W A;  1XA1 A;  1XKZ A;  3QNC A;  3S4X A;  1K55 C;  4NET A;  5J8X A;  4EV4 A;  4LCM A;  1E25 A;  5EVI D;  1MXO A;  3A3J A;  4DE0 A;  3M2K A;  2J8Y A;  1K57 A;  4E6W A;  3IQA A;  3W4Q A;  3SOI A;  1HD8 A;  4S2M A;  4JXG A;  4KZ4 A;  4GDN A;  4GD8 A;  4X68 A;  3HLW A;  5FQM A;  4EBP A;  1NRF A;  2RL3 A;  5HX9 A;  4WEJ A;  3IXG A;  3VP3 A;  2Y2M A;  1S6R A;  2WKE A;  2HPB A;  4OPQ A;  5FAO A;  4IVK A;  3MXS A;  4OON A;  5EVI C;  4LCL A;  4XXR A;  1O7E A;  1E3U A;  3BFD A;  2HP5 A;  3GQZ A;  3A3E A;  4KZA A;  3PBR A;  3TG9 A;  2HDR A;  3S22 A;  4BEN A;  3G31 A;  2XF3 A;  3ZG9 B;  4OLG A;  3UE0 A;  5E2H A;  3OPL A;  5EOO A;  1K4E A;  3IF6 A;  3VSK A;  2G2W A;  1JWZ A;  3SS5 A;  1NZO A;  2WK0 A;  3WS5 A;  1PZP A;  4C75 A;  1YT4 A;  1ERO A;  1ZG6 A;  3ZG7 B;  2ZQ9 A;  3G4P A;  1L0E A;  3HVF A;  4A5R A;  1MBL A;  3HUO A;  4IVI A;  4Y0T A;  2CC1 A;  4R4R A;  3VP1 A;  1K6R A;  3HLB A;  5M1A A;  1L0G A;  2EFX A;  1N9B A;  2WGW B;  3VP4 A;  2HDS A;  5HFO A;  1G68 A;  2H5S A;  3PBQ A;  1SCW A;  5AQ7 A;  3VOZ A;  3BFC A;  2ZC3 B;  4KG6 A;  3BEC A;  2XDM A;  3HLG A;  3M2J A;  3NDE A;  1FR6 A;  1ES5 A;  5FQJ A;  2IWC A;  3N8S A;  4PM6 A;  1LL9 A;  3GTC A;  3N8L A;  3V50 A;  5EEC A;  3OC2 A;  4HEF A;  1H8Z A;  2XD5 A;  4KG5 A;  5HAR A;  4PMA A;  5A90 A;  1YM1 A;  2FFF B;  4KZ9 A;  4HES A;  4S2N C;  3FZC A;  1ES2 A;  2ZM2 A;  4RYE A;  3TSG A;  1IKG A;  4KQQ A;  1WYB A;  4N1X A;  3JYI A;  4BL3 A;  2XR0 A;  3ZG8 B;  5F1G A;  2ZQD A;  4WZ5 C;  2P9V A;  4OQ0 A;  4IBX A;  5HW3 A;  1KE0 A;  2Y2J A;  3G2Y A;  1FQG A;  1LI0 A;  2DRW A;  2OLU A;  4B4X A;  4X55 A;  3G30 A;  4JLF A;  4FCF A;  3N4I A;  3VP2 A;  5U47 A;  4B4Z A;  1M40 A;  5CEC A;  2ZC7 A;  2JCH A; 
#chains in the Genus database with same CATH topology
 2JN7 A;  4M4X A;  4PM8 A;  5HDD A;  1K54 C;  4X69 A;  5FDS A;  2WYX A;  1MY8 A;  3E4P A;  4JKT A;  1ZTU A;  4WZ5 A;  4N9K A;  1KGG A;  1OT9 A;  4C6Y A;  4DE3 A;  4H8R A;  4GB7 A;  2A49 A;  4OQG A;  3E2K A;  4HJ3 A;  1LSV A;  2VGK A;  1G28 A;  3CI6 A;  2WAD A;  5TFQ A;  2HGV A;  3OBF A;  4GD6 A;  4KG2 A;  2K7S A;  1DJC A;  3PAG A;  5FQQ A;  1VEU A;  2Y2G A;  3KSF A;  4GS9 A;  2Y79 A;  2ZC7 A;  4L0L A;  1PW8 A;  4ZAM A;  5GL9 A;  4DJ3 A;  1K25 A;  4UEY A;  3PXP A;  2QMI A;  5FI6 A;  3TJZ C;  5C5K A;  2JKT M;  3LY3 A;  1GCE A;  4E6X A;  1RP5 A;  2E8I A;  3FPV A;  4XT2 B;  2L4R A;  3TOI A;  2W1T A;  3HJI A;  3UE3 A;  3DTE A;  2PAV P;  3LIA A;  3LGO A;  3QP4 A;  1Y28 A;  2Y59 A;  4JBF A;  1STZ A;  3UPO A;  3IHB A;  3LUQ A;  3BFG A;  4S2O A;  3ZQ5 A;  1HLU P;  2B18 A;  1G5U A;  3E0Y A;  1PYY A;  4RX2 A;  4DDY A;  2ZQC A;  3N8R A;  4OP5 A;  4H6J B;  4QU3 A;  4NXG A;  3CIT A;  4X53 A;  3NCK A;  4QPR A;  2QKP A;  5HDS A;  5IS1 A;  3LEQ A;  1DP6 A;  4IUH A;  2Y2P A;  3D72 A;  1YQS A;  2XFS A;  1XFN A;  2Y4A A;  1MZU A;  4P85 A;  4DF6 A;  3P7N A;  2J7V A;  2R9W A;  1ACF A;  1IFQ A;  4KZ5 A;  1KDS A;  1JTD A;  2OWJ A;  1YMX A;  5DF7 A;  1Z6F A;  3LCE A;  3VSL A;  3W8K A;  1K6S A;  1VEU B;  4UA7 A;  4U0X A;  4GS9 B;  4LRX C;  3T50 A;  4ZDX A;  4UQI M;  2WGW A;  3CLO A;  1T18 A;  2Y2K A;  5L09 A;  2ZM8 A;  5FSR A;  3OCL A;  3S7Q A;  4K0X A;  5EOE A;  3G34 A;  2ZC6 B;  4MMN A;  5M18 A;  3RXX A;  2EX6 A;  4FUW A;  2J9P A;  1K57 C;  5A91 A;  5CTN A;  3BEB A;  1JWV A;  3CJM A;  4EQ1 A;  3FPW A;  1FSW A;  1KGE A;  2C5W B;  3HLC A;  2PU4 A;  4PHT A;  3IXH A;  3MZD A;  5FI7 A;  4DJ2 A;  3ZNY A;  1F5M A;  2WZX A;  2H28 A;  1MPL A;  3NY4 A;  4QJG A;  4JGQ A;  2IWD A;  1JNU A;  4O0P A;  5FI2 A;  3FKW A;  3T4T A;  4PKY G;  2XEP A;  2BG1 A;  1PWC A;  5JYO A;  3AGF A;  3JPU A;  3F1O A;  3GSG A;  3MFX A;  5HWV A;  3T4Q A;  4F3L A;  1GSV A;  3MFD A;  5F68 A;  4MN5 A;  4E3M A;  1PFL A;  2W1R A;  2ZQ8 A;  2C6W B;  2WAF A;  4CJN A;  4M3K A;  4EXO A;  3NJA A;  3T1Q B;  2UWX A;  3O86 A;  3MQQ A;  4OQI A;  1CJF A;  4MN7 A;  2Z6D A;  3P09 A;  4FH4 A;  1OT6 A;  1ESI A;  2PDR A;  3KSI A;  2CMN A;  3BLS A;  4S2I A;  2W3D A;  1C3B A;  3U4L P;  3PYP A;  4OP8 A;  2OAQ 1;  1DJB A;  1QMF A;  1MWU A;  3NUL A;  4XUZ A;  4IHQ A;  3LO7 A;  3V3S A;  4R1G A;  2ZMA A;  1PI4 A;  2BLS A;  1ES4 A;  1XP4 A;  4JF4 A;  2HJ9 C;  3B33 A;  5CGW A;  4RX3 A;  1ZHH B;  3IBR A;  3PBT A;  4KQO A;  1OTI A;  3BY8 A;  3QHY A;  5GHX A;  3LFV A;  5CHM A;  3C4P A;  4OPY A;  3LI9 A;  1CEG A;  4BBT A;  1AXB A;  2WAE A;  3HBR A;  2Q9M A;  4PM7 A;  2H0Y A;  1NYY A;  5CED A;  1G6O A;  1J9M A;  4LEN A;  4UA9 A;  2Y2N A;  1H0M A;  2JHE A;  3PHY A;  3G2Z A;  3KYQ A;  4S2J A;  4E3J A;  4F3L B;  1Y54 A;  1BT5 A;  2EX8 A;  5AQ9 A;  4P87 A;  4Z1W A;  1ZC2 A;  3BLM A;  4R3A A;  3GV9 A;  4DN0 A;  1XA1 A;  2XA7 S;  5J8X A;  4EV4 A;  4LCM A;  1N9L A;  1MXO A;  4HNB A;  4E6W A;  4S2M A;  5FEF A;  2VLG A;  3IBJ A;  5FQM A;  4EBP A;  3IXG A;  2Y2M A;  1S6R A;  5DFY A;  2W3G A;  2WKE A;  5FAO A;  3MXS A;  4XXR A;  1E3U A;  3A3E A;  3PBR A;  3S22 A;  4BEN A;  1D1J A;  4E04 A;  1ODV A;  1T1B A;  2LB5 A;  2ZOI A;  3OPL A;  3IF6 A;  1JWZ A;  3EEH A;  3ZG7 B;  3G4P A;  4A5R A;  3H82 B;  1MBL A;  3HUO A;  1K6R A;  4BWI A;  2JKT I;  3NOT C;  5HFO A;  3DAV A;  5AQ7 A;  3R4K A;  4KG6 A;  1BYW A;  1ES5 A;  5FQJ A;  3GTC A;  3N8L A;  3V50 A;  3OC2 A;  4YNR A;  1H8Z A;  4PMA A;  1YM1 A;  2FFF B;  4S2N C;  3U2A A;  2ZM2 A;  4RYE A;  4ARZ A;  1WYB A;  3FC7 A;  3JYI A;  2ZQD A;  2JKF A;  3G2Y A;  2Y2J A;  2KLI A;  3CUE C;  4FOF A;  3G30 A;  5AVE A;  1GSX A;  1YPR A;  5CEC A;  2KX6 A;  5EM1 A;  1S4S A;  5TBM A;  3L9K A;  4II7 A;  2O0Y A;  2GZA A;  2X71 A;  4G3W A;  1UGU A;  5FAS A;  5HWT A;  4DE1 A;  1M6K A;  4FH2 A;  2K31 A;  1SKO A;  5DVA A;  5L10 A;  3UB6 A;  4MDZ A;  1JTG A;  3RFB A;  3MJQ A;  1HTZ A;  3GEC A;  2XRN A;  3IHA A;  3C7U A;  3R7W A;  5EM0 A;  1IEM A;  3BFF A;  3C8C A;  1HZO A;  1SDN A;  4ZTK A;  1FOF A;  1K54 A;  3UNW A;  2EXA A;  2QWS A;  4FSF A;  5EFW A;  2PD8 A;  2XH9 A;  1DP8 A;  2Z2M B;  5GLC A;  5HAI A;  2HDU A;  1W63 M;  4MCW A;  2ZMF A;  4NG2 A;  2ZD8 A;  1OJ5 A;  3HLE A;  1MWR A;  3NOP C;  2PT7 A;  5FEG A;  3IWI A;  5BOH A;  3EQV A;  3UE1 A;  3VFH A;  2VX8 A;  3O5Y A;  1K0K A;  2B5R A;  4E3N A;  4MNR A;  3QP5 A;  1W63 Q;  2HJE A;  4O8G A;  3V5M A;  2PYR A;  4B88 A;  1PI5 A;  1K55 A;  3NDG A;  4ARZ B;  3V67 A;  3B42 A;  5HSQ A;  1MKM A;  4DXC A;  4WMC A;  1PWD A;  3BQA A;  3FWL A;  2WZZ A;  5TGF A;  3NEC A;  3E4Q A;  4Y5F A;  1VB6 A;  4X6T A;  1NXY A;  4B93 A;  3BW6 A;  5EVI A;  3K2N A;  2WKI A;  2WGV A;  4ZJ3 A;  2XQZ A;  5FDH A;  4MBK A;  5TBM B;  4ZJ2 A;  2D02 A;  4IED A;  5CRF A;  4ESP A;  1KVL A;  2ZQA A;  3KSG A;  5HL1 A;  5HPF A;  2E8J A;  4NK3 A;  3HL9 A;  1SKO B;  1KOU A;  2UV0 E;  4MLL A;  2FFY A;  3P01 A;  5CHJ A;  5E2G A;  1IYQ A;  4KQR A;  2HV1 A;  1NWZ A;  1F2K A;  3E98 A;  2W27 A;  3RTY A;  3R7W B;  3LYX A;  5D3O A;  4YOF A;  1T19 A;  3B47 A;  1H5X A;  1VHM A;  1TS0 A;  4GZB A;  3UB9 A;  2V20 A;  4PM5 A;  1BLC A;  1E4D A;  4CPK A;  2V2F F;  1YLW A;  4HH2 A;  2Y91 A;  1OPX A;  4MEZ A;  3C2W A;  3IF5 A;  1XFQ A;  2ZL1 A;  3ZHH A;  2WKQ A;  3IXD A;  2ZOH A;  5CEB A;  4HQA A;  3M6H A;  1ESU A;  3MMH A;  4GNU A;  1BTL A;  2AVX A;  1N9O A;  5KSC A;  3LIE A;  2J80 A;  3JVU A;  2ZMV A;  3VOL A;  4QY6 A;  2J3T D;  3WRZ A;  4I3J A;  3CPT A;  1OTD A;  2Y2H A;  3W2Z A;  3VE4 A;  1LT0 A;  1SDE A;  4NKP A;  2J3T C;  4GN2 A;  4QWO A;  2EXB A;  4K91 A;  4Y0O A;  1IYP A;  3A3I A;  1FCO A;  5DF9 A;  2W3H A;  1K38 A;  2P74 A;  3MBZ A;  5E2F A;  1LL5 A;  4NXB A;  4Y2F A;  5A93 A;  2P9V B;  4GKU A;  3PAE A;  3KSH A;  1LI9 A;  2J9O A;  3SH8 A;  2ZC5 B;  1PNE A;  3WS0 A;  4HJ6 A;  1XGJ A;  4UA6 A;  4E3L A;  3LR4 A;  5J4E A;  4GJ4 A;  3G35 A;  3S7O A;  4S2K A;  5L07 A;  4ZJ1 A;  2L1M A;  3T1S A;  3HUM A;  4YIN A;  5KSH A;  3T1X A;  2VJW A;  3WS2 A;  4BQM A;  5DTS A;  1UWN X;  3E2L A;  2ZL1 B;  3KYE A;  3V39 A;  1OME A;  1ONG A;  3ITB A;  2V1Z A;  3OOV A;  4EWF A;  1NYM A;  2W0N A;  2A24 A;  2X02 A;  1ALQ A;  4E3K A;  4EEU A;  4Y0U A;  3Q82 A;  1WYC A;  1Z09 A;  2ZBB A;  3MKE A;  1VM1 A;  2O9B A;  3EOI A;  5KMW A;  1TDG A;  4S2L A;  3D4F A;  2YKF A;  4MBH A;  4EER A;  1YLP A;  5F5Y A;  4EW7 A;  1OTE A;  1YKD A;  2VZW A;  2Z6C A;  2WKH A;  5EV0 A;  3DWK A;  1DY6 A;  2EA9 A;  5JYP A;  4JF6 A;  2W3E A;  3WWX A;  2QHK A;  5FA7 A;  1PZO A;  4JXS A;  1Q2P A;  2W1T B;  4PPR A;  3SH9 A;  4KZB A;  1PRQ A;  2ZM0 A;  1BLS A;  5I5L A;  1IYO A;  3UO9 A;  4Q8I A;  1HVB A;  3EWK A;  2PBD P;  4OKP A;  5E2E A;  3P98 A;  4LFU A;  1XJ3 A;  1ERM A;  1V9Z A;  1DP9 A;  1YLT A;  2DCF A;  2Y55 A;  5EE8 A;  4CLC A;  4JPM A;  1YSQ A;  3NOU C;  4OVD A;  3Q7Z A;  3RJU A;  1S0W A;  1XKZ A;  5EVE A;  2XA7 M;  3A3J A;  2VK3 A;  1TS8 A;  3LIF A;  1MC0 A;  2BAS A;  4GDN A;  3HLW A;  1NRF A;  5HX9 A;  3OLO A;  4GCZ A;  2A24 B;  2HP5 A;  3TG9 A;  3G31 A;  2XF3 A;  2B95 A;  5MC7 A;  5E2H A;  5EOO A;  3VSK A;  2G2W A;  3SS5 A;  5G4Y A;  1PZP A;  4C75 A;  1ZG6 A;  5DKK A;  2FH5 A;  2V0U A;  2CC1 A;  5M1A A;  1L0G A;  2EFX A;  1N9B A;  2WGW B;  3VP4 A;  3VE3 A;  4CLC E;  2H5S A;  3PBQ A;  2XRO A;  3M2J A;  4EES A;  1FR6 A;  2IWC A;  3N8S A;  4PM6 A;  3RH8 B;  5EEC A;  2XD5 A;  3VV4 A;  4G3K A;  5HAR A;  5A90 A;  1S1Y A;  1ES2 A;  4KQQ A;  1SZV A;  3CHW P;  2M7U A;  3NHQ A;  4OQ0 A;  3UB8 A;  4HOI A;  3N4I A;  5U47 A;  1M40 A;  3TRC A;  3C30 A;  2JCH A;  4NEE D;  4YFM A;  4CLC B;  2EFU A;  2OLV A;  4KEN B;  4P0M A;  4S2N A;  1CF0 A;  3ZVW A;  4OQH A;  3GRJ A;  4I3I A;  5CER A;  2A2L A;  1XXM A;  1W5D A;  4X1M A;  5G18 A;  4O01 A;  1F9I A;  5AQA A;  2NUP C;  2JKR M;  4E3I A;  5J3W A;  2M7V A;  3B3X A;  2ACG A;  3F1O B;  3N6I A;  1GHP A;  4ZRR A;  4LV0 A;  4MN6 A;  3ZNT A;  4HBT A;  2OV5 A;  1BLH A;  4F94 A;  3PBS A;  1YLY A;  2NUT C;  3GVB A;  3OPR A;  4P6B A;  2KOI A;  5TR7 A;  5HAQ A;  3BFE A;  4L9F A;  3HRE A;  3EQU A;  4R38 A;  1BZA A;  5DTT A;  1FCM A;  1I5Q A;  1H8Y A;  3QNB A;  3BY9 A;  3T12 B;  4OOM A;  4GHI A;  2DMW A;  4PAU A;  3PBO A;  2KDK A;  5GHZ A;  3ZG0 A;  1JVJ A;  1K56 D;  1IYS A;  1SKF A;  2H0T A;  3O87 A;  4K0W A;  1MWS A;  1RCJ A;  2VA0 A;  3SW1 A;  1GHM A;  1S4R A;  3ZG5 A;  2DNS A;  4R3B A;  2PR6 A;  1V9Y A;  4JGO A;  1U60 A;  2OSU A;  1BUE A;  3CZD A;  3BM6 A;  4DE2 A;  1K4F A;  4NXE A;  5FAT A;  3IWO A;  3VMA A;  3M6B A;  4KQD A;  2HDQ A;  4WN5 A;  3EEA A;  4DKI A;  4WEL A;  3T4O A;  3IH9 A;  3AGD A;  3Q1F A;  4S2P A;  1P9W A;  3LR0 A;  3MXR A;  2HP9 A;  5AQB A;  3ZDJ A;  2I9V A;  3BRM A;  3UDF A;  5L2F A;  4PKY A;  3FV7 A;  3NI9 A;  1GA0 A;  3RXW A;  3H9W A;  2G2U A;  2QJ5 A;  3TW8 A;  2WKR A;  4D60 A;  2L0W A;  1MKI A;  3G6O A;  3UDI A;  1J3W A;  4BD1 A;  1CI8 A;  1P97 A;  1RGY A;  4HH3 A;  1PIO A;  2B02 A;  4BBV A;  4WLA A;  4I39 A;  3QP1 A;  4N92 A;  2D01 A;  3D9Y A;  1XJ2 A;  5CX7 A;  2HP6 A;  4JGP A;  3ULF A;  4LV3 A;  1N9N A;  5F1F A;  3T4S A;  3MKF A;  3PBN A;  4LLO B;  2EX9 A;  2H10 A;  4JGR A;  1EW0 A;  5LBR A;  5M19 A;  3LID A;  4UAA A;  2M1C A;  4GLQ A;  1E3U D;  5F6A A;  1BSG A;  3IF6 B;  1TS7 A;  2QJ7 A;  4KUK A;  1FCN A;  4ETX A;  2QPN A;  1TVF A;  4BBU A;  2JC7 A;  4L9G A;  3UDX A;  3IS2 A;  3KO6 A;  2ZQ7 A;  4IUK A;  4LV1 A;  3N7W A;  3MZF A;  3SH7 A;  3IF6 C;  1AWI A;  4BL2 A;  2HZ5 A;  2V8F A;  3E4O A;  3SS4 A;  4E3O A;  1YAX A;  3S7P A;  2Y8H A;  3OPH A;  4X56 A;  1L0D A;  1NZU A;  5F82 A;  2V1B A;  1GHI A;  3JVV A;  1TS6 A;  1F98 A;  3VFF A;  2P7J A;  1TDL A;  3LEZ A;  4HBU A;  1BLP A;  4JXV A;  4Y7P A;  4XUX A;  5E43 A;  3CG5 A;  3DTM A;  4Z9Q A;  4R70 A;  2XLN A;  5EUA A;  3F1P A;  4RA7 A;  2Y2L A;  1W79 A;  3A3D A;  2PHY A;  3FKV A;  3A0S A;  4QB8 A;  3GR2 A;  3A3F A;  2LB9 A;  4EBL A;  4ME4 A;  5A92 A;  5FAP A;  1KE3 A;  1BUL A;  3K3C A;  3LR3 A;  2J3W A;  2XK1 A;  3MF0 A;  2OWH A;  1S66 L;  2RCX A;  3UB5 P;  4G3V A;  4FD8 A;  4FTX A;  3ZYT A;  3CAX A;  1WE4 A;  4OPR A;  4BJP A;  1D06 A;  3ISG A;  3IS2 B;  3HLD A;  3MSH A;  4KZ3 A;  2WKP A;  4X25 A;  2VGJ A;  4H6J A;  3A0V A;  4GDB A;  2YKH A;  5DTK A;  1CQA A;  3IT9 A;  1OTA A;  2Y2I A;  2MJ6 A;  4WYY A;  5DJT A;  1LLB A;  1TEM A;  5GLD A;  1CEF A;  1LSW A;  5HL6 A;  5F83 A;  3LY4 A;  2O9C A;  3UB7 A;  4BLM A;  1ES3 A;  3O3V A;  3LI8 A;  2V1A A;  4WMC D;  2R9X A;  5EVI B;  3FG8 A;  3S4X A;  1K55 C;  5EVI D;  3F1P B;  2J8Y A;  1K57 A;  2JKR I;  1HD8 A;  4JXG A;  4KZ4 A;  3PR6 A;  4GD8 A;  1LL8 A;  2VKS A;  3VP3 A;  4OPQ A;  4I38 A;  4IVK A;  5L8M A;  4WF0 A;  4OON A;  5EVI C;  4LCL A;  1XJ6 A;  3GQZ A;  4KZA A;  3MQ0 A;  4OLG A;  4Y13 A;  1LSX A;  1K4E A;  1NZO A;  2WK0 A;  3WS5 A;  2PRF A;  3HVF A;  1A0K A;  1YSP A;  3KYZ A;  4IVI A;  5AVF A;  2VV8 A;  4R4R A;  4I5S A;  5HD5 A;  2EWV A;  1G68 A;  4HHD A;  2VV7 A;  2V9A A;  3VOZ A;  1S1Z A;  1S67 L;  4HEF A;  3FZC A;  3TSG A;  1FIL A;  4N1X A;  3EGX C;  4BL3 A;  2XR0 A;  5HDC A;  4WZ5 C;  2P08 A;  3CPT B;  1KE0 A;  1LI0 A;  2DRW A;  2P04 A;  4B4X A;  1L3L A;  3T4L A;  4B4Z A;  4B9O A;  4AFI A;  1Y4O A;  3WRT A;  1W7F A;  4P6Z M;  4EET B;  3F1N A;  1EWZ A;  3HLF A;  3Q07 A;  3DBA A;  3NBL A;  4HJ4 A;  5FQI A;  3LR5 A;  4R23 A;  2XD1 A;  4LPZ A;  3V3R A;  1W8Q A;  2Q9N A;  5DF8 A;  3BJN A;  1EI5 A;  3A0R A;  5HWW A;  2O99 A;  3QP8 A;  1L0F A;  4OLD A;  1O07 A;  3AGE A;  2G7U A;  3VP0 A;  1KGF A;  3MS6 A;  5K5B A;  5GLA A;  4N9L A;  2INW A;  4QD4 A;  4R3J A;  3UMD A;  4DRT A;  4Q0I A;  5CHU A;  4EQI A;  4WM9 A;  4BD0 A;  4WBG A;  4Y3I A;  3SS3 A;  3DWZ A;  3IX8 A;  4KZ8 A;  3HUN A;  3ZGA B;  3H7W A;  3BQ8 A;  5IHV A;  3MR0 A;  3C4O A;  3Q81 A;  4LGW A;  1NJ4 A;  4U0T A;  3ZVT A;  5FAQ A;  3G32 A;  1JWP A;  3KX0 X;  1L2S A;  2FZ0 A;  3LIC A;  4HY8 A;  2XGN A;  4EUV A;  3IH8 A;  2R78 A;  1FR1 A;  1NLY A;  4HP9 A;  4OOL A;  2PBY A;  4OOY A;  5I94 A;  2VV6 A;  2GJ3 A;  5HAP A;  1VQQ A;  1TD5 A;  2VGL M;  3T4K A;  3T4J A;  1GSW A;  1NLZ A;  1PWG A;  4X1L A;  3DTK A;  3F1N B;  4C3Q A;  4WL9 A;  4YWZ A;  2JBF A;  1XA7 A;  2GDN A;  1KVM A;  3NC8 A;  3C38 A;  4KUO A;  3L7H A;  3GMW A;  4ID4 A;  2X01 A;  3WS1 A;  2Y2O A;  4KZ6 A;  1K56 A;  1FIK A;  3W4O A;  1ONH A;  4EUZ A;  4DDS A;  1RGZ A;  3MXQ A;  2ZJ9 A;  2JE5 A;  1P9R A;  4EBN A;  2WUQ A;  2Z2L B;  4Y15 A;  3CMZ A;  4UHU A;  5IT5 A;  1T1C A;  2W3F A;  3DW0 A;  4DMZ A;  4P6Z S;  1I2W A;  4DXB A;  3W4P A;  4HP4 A;  3MQO A;  5FQ9 A;  4CLC D;  3H82 A;  4L9E A;  1IEL A;  2OAP 1;  4UQI S;  3ZFZ A;  2XFT A;  5CGS A;  3CUE A;  3MZE A;  2BTF P;  2V0W A;  3H7W B;  4KZ7 A;  2O9A A;  2EWW A;  4JXW A;  2Y2Q A;  1TF1 A;  1YLJ A;  1G6A A;  4LRZ E;  4CLC C;  1P0Z A;  4QHC A;  2K2N A;  4HI4 A;  2A3U A;  4R4S A;  2PD7 A;  1MWT A;  1PW1 A;  2PR5 A;  4MBF A;  1SHV A;  1XX2 A;  4IBR A;  3BYD A;  4JF5 A;  4R6L A;  3VOY A;  1NRJ A;  3OZH A;  1XPB A;  3HJK A;  3ITA A;  5G4Z A;  1T1A A;  3BWL A;  2JKG A;  4LV2 A;  3SZT A;  1ZG4 A;  5KZH A;  2PYP A;  1IOU A;  3IWQ A;  2WGI A;  1FSY A;  1ZKJ A;  3UY6 A;  1W8Y A;  1UWP X;  3WS4 A;  3HCY A;  3UPN A;  3C7V A;  4O7D A;  5HZH A;  2EX2 A;  3Q7V A;  5EVL A;  4ZBE A;  3FYZ A;  3LIB A;  5CTM A;  2VGL S;  4QY5 A;  4LRY C;  3OPP A;  2XSS A;  3CWF A;  3PTE A;  1GA9 A;  4GW9 A;  1CK3 A;  3UPP A;  3D3O A;  1I2S A;  1LHY A;  3O88 A;  5AJG A;  1YMS A;  4D2O A;  2I72 A;  5GHY A;  1KE4 A;  4RVA A;  3OCN A;  1N4O A;  4N1H A;  5FQK A;  1IKI A;  2VEA A;  2ZC4 B;  1KDW A;  4I3A A;  1OTB A;  2IA2 A;  3GDI A;  4R0Q A;  3NIA A;  4GOG A;  4U3T A;  3ZCZ A;  3S1Y A;  4K08 A;  3IXB A;  5DJU A;  1H8M A;  1QME A;  5GLB A;  2PU2 A;  3I7J A;  4RQ9 A;  4GHI B;  2QZ6 A;  5FL3 A;  2IWB A;  1CI9 A;  5EPH A;  4WZ4 A;  3ICY A;  5KIZ A;  3K3D A;  4WEK A;  2GNX A;  4PM9 A;  4OPZ A;  1DJA A;  4BMW A;  1NY0 A;  5DFX A;  1DRM A;  2ZLY A;  5HD3 A;  1ERQ A;  1VET A;  1XJ4 A;  3Q7V B;  1XGI A;  4Q0J A;  3C5A A;  4OH0 A;  1YLZ A;  1Q2Q A;  3QP6 A;  5CGX A;  3S7N A;  3UN7 A;  2Q0O A;  5CXW A;  3QNC A;  4NET A;  2HF6 A;  1E25 A;  5HPI A;  4DE0 A;  4NXF A;  3M2K A;  4WUJ A;  3IQA A;  3W4Q A;  3SOI A;  2GX5 A;  5J7E A;  3DTI A;  4X68 A;  3IX4 A;  2RL3 A;  4WEJ A;  3QP2 A;  5TJJ A;  2OOL A;  5DKL A;  2HPB A;  1X0O A;  1O7E A;  3BFD A;  2HDR A;  3ZG9 B;  1H3Q A;  3UE0 A;  5F69 A;  1D7E A;  4EEP A;  4IJG A;  1YT4 A;  1ERO A;  2ZQ9 A;  1L0E A;  4CQH A;  4Y0T A;  3VP1 A;  3HLB A;  3UME A;  5A8B A;  3EGD C;  2V8C A;  2HDS A;  1SCW A;  3BFC A;  2ZC3 B;  4XT2 A;  3BEC A;  2XDM A;  3HLG A;  3NDE A;  1LL9 A;  3T1R A;  3IX3 A;  4Q0H A;  4KG5 A;  2QYB A;  3TE8 A;  3UE6 A;  4KZ9 A;  4HES A;  1WA9 A;  1IKG A;  1OJG A;  3ZG8 B;  5F1G A;  2P9V A;  4ETZ A;  4IBX A;  5HW3 A;  1FQG A;  1VET B;  2OLU A;  4X55 A;  4JLF A;  3VP2 A;  4FCF A;  4Y17 A;  5IU1 A;  4EU0 A;  4HIA A; 
#chains in the Genus database with same CATH homology
 3WRT A;  1W7F A;  4PM8 A;  4YFM A;  2EFU A;  2OLV A;  4KEN B;  1EWZ A;  4P0M A;  4S2N A;  1K54 C;  3HLF A;  2X71 A;  3Q07 A;  4OQH A;  4X69 A;  3ZVW A;  3GRJ A;  2WYX A;  5FAS A;  3NBL A;  5CER A;  4DE1 A;  1MY8 A;  1M6K A;  1W5D A;  1XXM A;  4FH2 A;  4JKT A;  5FQI A;  4WZ5 A;  5G18 A;  4N9K A;  1KGG A;  5AQA A;  5DVA A;  4E3I A;  4R23 A;  3B3X A;  2XD1 A;  4C6Y A;  1JTG A;  4DE3 A;  4H8R A;  4GB7 A;  3V3R A;  3N6I A;  1GHP A;  1HTZ A;  1W8Q A;  2A49 A;  4LV0 A;  4OQG A;  3IHA A;  2Q9N A;  5DF8 A;  3C7U A;  3ZNT A;  3E2K A;  1IEM A;  1EI5 A;  4HBT A;  2OV5 A;  1BLH A;  4F94 A;  3BFF A;  3PBS A;  4OLD A;  4DE2 A;  1L0F A;  1HZO A;  1YLY A;  1SDN A;  2VGK A;  4ZTK A;  3GVB A;  1FOF A;  1K54 A;  3UNW A;  2WAD A;  2EXA A;  5TFQ A;  1O07 A;  3OPR A;  4P6B A;  4FSF A;  5TR7 A;  3AGE A;  5HAQ A;  3BFE A;  3HRE A;  3EQU A;  4GD6 A;  4KG2 A;  2XH9 A;  1KGF A;  3VP0 A;  2Z2M B;  5GLC A;  5HAI A;  2HDU A;  1DJC A;  5GLA A;  3PAG A;  4N9L A;  2Y2G A;  5FQQ A;  1BZA A;  5DTT A;  4QD4 A;  4R3J A;  1FCM A;  1I5Q A;  4DRT A;  1H8Y A;  2ZD8 A;  3QNB A;  4L0L A;  5CHU A;  1PW8 A;  4EQI A;  4ZAM A;  3HLE A;  1MWR A;  4WM9 A;  4OOM A;  5GL9 A;  4BD0 A;  4WBG A;  1K25 A;  3DWZ A;  4KZ8 A;  2QMI A;  5FI6 A;  3IWI A;  3SS3 A;  3EQV A;  3UE1 A;  3HUN A;  5BOH A;  3ZGA B;  3LY3 A;  1GCE A;  3VFH A;  4E6X A;  3PBO A;  1RP5 A;  2E8I A;  5IHV A;  2B5R A;  5GHZ A;  3C4O A;  3Q81 A;  3ZG0 A;  1JVJ A;  4MNR A;  4E3N A;  1NJ4 A;  3TOI A;  1K56 D;  1IYS A;  4U0T A;  3UE3 A;  3ZVT A;  5FAQ A;  3G32 A;  3V5M A;  1SKF A;  1JWP A;  2H0T A;  4B88 A;  3O87 A;  1PI5 A;  1L2S A;  1K55 A;  3NDG A;  4K0W A;  2Y59 A;  1MWS A;  1RCJ A;  2XGN A;  3IH8 A;  1FR1 A;  4JBF A;  1GHM A;  4OOL A;  3UPO A;  3IHB A;  4DXC A;  2PBY A;  3ZG5 A;  4OOY A;  3BFG A;  4WMC A;  1PWD A;  3FWL A;  4S2O A;  5I94 A;  2WZZ A;  5TGF A;  5HAP A;  2DNS A;  1VQQ A;  4R3B A;  4X6T A;  1NXY A;  5EVI A;  2WKI A;  2WGV A;  4ZJ3 A;  1PWG A;  2XQZ A;  1PYY A;  5FDH A;  1U60 A;  2OSU A;  1BUE A;  4C3Q A;  4MBK A;  4RX2 A;  3CZD A;  4ZJ2 A;  4DDY A;  2ZQC A;  2JBF A;  1XA7 A;  3BM6 A;  3N8R A;  4IED A;  1K4F A;  2GDN A;  5CRF A;  4OP5 A;  5FAT A;  3IWO A;  1KVM A;  3NC8 A;  4QU3 A;  1KVL A;  2ZQA A;  5HL1 A;  4X53 A;  3VMA A;  3NCK A;  3M6B A;  4NK3 A;  3HL9 A;  2HDQ A;  3GMW A;  4ID4 A;  2X01 A;  3WS1 A;  4MLL A;  4DKI A;  2Y2O A;  2FFY A;  4KZ6 A;  5CHJ A;  5E2G A;  4WEL A;  1IYQ A;  4KQR A;  1K56 A;  3W4O A;  3IH9 A;  1ONH A;  3AGD A;  3Q1F A;  4EUZ A;  4DDS A;  4S2P A;  1RGZ A;  2Y2P A;  2ZJ9 A;  1YQS A;  2XFS A;  3MXR A;  2HP9 A;  2JE5 A;  5AQB A;  2Y4A A;  4EBN A;  2WUQ A;  3ZDJ A;  2Z2L B;  5D3O A;  4P85 A;  3BRM A;  3CMZ A;  4DF6 A;  4UHU A;  3UDF A;  5L2F A;  3FV7 A;  3NI9 A;  1GA0 A;  3RXW A;  2J7V A;  3DW0 A;  1H5X A;  2G2U A;  2R9W A;  4KZ5 A;  4GZB A;  1I2W A;  1KDS A;  1JTD A;  4DXB A;  1YMX A;  2V20 A;  1MKI A;  1BLC A;  1E4D A;  3W4P A;  2V2F F;  5DF7 A;  4CPK A;  3UDI A;  4PM5 A;  1Z6F A;  4BD1 A;  1CI8 A;  1YLW A;  1RGY A;  3LCE A;  5FQ9 A;  2Y91 A;  1K6S A;  3VSL A;  3W8K A;  4UA7 A;  1PIO A;  1IEL A;  4MEZ A;  4U0X A;  4N92 A;  3IF5 A;  4ZDX A;  3ZFZ A;  2WGW A;  3ZHH A;  2XFT A;  2HP6 A;  5CGS A;  4LV3 A;  2Y2K A;  2ZM8 A;  3IXD A;  5CEB A;  3MZE A;  5F1F A;  4KZ7 A;  5FSR A;  3M6H A;  3MKF A;  3OCL A;  4JXW A;  3PBN A;  4K0X A;  1ESU A;  2Y2Q A;  1YLJ A;  1G6A A;  4GNU A;  1BTL A;  2EX9 A;  2H10 A;  5EOE A;  5KSC A;  4QHC A;  3G34 A;  2ZC6 B;  5M19 A;  4UAA A;  2A3U A;  4R4S A;  5M18 A;  1MWT A;  1PW1 A;  3RXX A;  2EX6 A;  4MBF A;  1E3U D;  1SHV A;  4QY6 A;  1BSG A;  3WRZ A;  3IF6 B;  2J9P A;  1K57 C;  1XX2 A;  5A91 A;  5CTN A;  4IBR A;  1FCN A;  3BEB A;  3BYD A;  4JF5 A;  3VOY A;  2QPN A;  3OZH A;  1XPB A;  1TVF A;  1JWV A;  3CJM A;  2Y2H A;  3ITA A;  1SDE A;  1FSW A;  1KGE A;  2JC7 A;  2C5W B;  3HLC A;  2PU4 A;  3UDX A;  3IXH A;  3MZD A;  5FI7 A;  3ZNY A;  4LV2 A;  2WZX A;  1ZG4 A;  1MPL A;  2ZQ7 A;  3NY4 A;  4GN2 A;  2EXB A;  4K91 A;  4LV1 A;  3N7W A;  5KZH A;  4QJG A;  3MZF A;  4Y0O A;  1IYP A;  3A3I A;  1FCO A;  5DF9 A;  2IWD A;  3IWQ A;  3SH7 A;  2WGI A;  1FSY A;  1K38 A;  3IF6 C;  5FI2 A;  3FKW A;  1ZKJ A;  2P74 A;  3MBZ A;  4BL2 A;  3UY6 A;  5E2F A;  1LL5 A;  2XEP A;  2BG1 A;  1PWC A;  5JYO A;  1W8Y A;  3AGF A;  3WS4 A;  3GSG A;  3SS4 A;  4E3O A;  3UPN A;  5A93 A;  2P9V B;  3C7V A;  4O7D A;  2EX2 A;  3Q7V A;  4GKU A;  3MFD A;  3OPH A;  4X56 A;  5EVL A;  3PAE A;  4ZBE A;  1L0D A;  1NZU A;  3FYZ A;  5F82 A;  4E3M A;  1LI9 A;  1GHI A;  2C6W B;  2J9O A;  2WAF A;  2ZQ8 A;  2ZC5 B;  5CTM A;  3SH8 A;  3VFF A;  4QY5 A;  1TDL A;  3WS0 A;  4CJN A;  3OPP A;  4M3K A;  1XGJ A;  4UA6 A;  2UWX A;  3LEZ A;  4HBU A;  4E3L A;  1BLP A;  3O86 A;  4JXV A;  4Y7P A;  3G35 A;  3PTE A;  4XUX A;  5E43 A;  3CG5 A;  4S2K A;  1GA9 A;  4OQI A;  3DTM A;  4Z9Q A;  4ZJ1 A;  1CK3 A;  3UPP A;  2XLN A;  3O88 A;  1I2S A;  1LHY A;  4RA7 A;  2Y2L A;  5EUA A;  1YMS A;  1W79 A;  3HUM A;  4YIN A;  3P09 A;  3A3D A;  5KSH A;  4FH4 A;  1ESI A;  2I72 A;  4D2O A;  3WS2 A;  3FKV A;  4BQM A;  5GHY A;  5DTS A;  3BLS A;  4S2I A;  1KE4 A;  3E2L A;  3GR2 A;  4QB8 A;  4RVA A;  1C3B A;  3OCN A;  1N4O A;  3V39 A;  3A3F A;  1OME A;  4N1H A;  5FQK A;  4OP8 A;  1ONG A;  1IKI A;  4EBL A;  3ITB A;  1DJB A;  2V1Z A;  1KDW A;  1QMF A;  1NYM A;  2ZC4 B;  4EWF A;  1MWU A;  5A92 A;  2X02 A;  1ALQ A;  4XUZ A;  5FAP A;  4E3K A;  1KE3 A;  3LO7 A;  4Y0U A;  3V3S A;  3Q82 A;  1WYC A;  1BUL A;  4R0Q A;  3MKE A;  1VM1 A;  4R1G A;  3NIA A;  2XK1 A;  4GOG A;  5KMW A;  4U3T A;  1TDG A;  4S2L A;  2ZMA A;  3D4F A;  2RCX A;  3ZCZ A;  4MBH A;  1PI4 A;  3S1Y A;  2BLS A;  4FD8 A;  3IXB A;  1ES4 A;  1XP4 A;  1YLP A;  4JF4 A;  1WE4 A;  5CGW A;  1QME A;  4RX3 A;  5GLB A;  2PU2 A;  4OPR A;  4BJP A;  3I7J A;  3PBT A;  4KQO A;  3ISG A;  2WKH A;  3QHY A;  5GHX A;  3HLD A;  3DWK A;  1DY6 A;  5CHM A;  5JYP A;  2QZ6 A;  3C4P A;  4JF6 A;  4OPY A;  2IWB A;  1CI9 A;  1CEG A;  4KZ3 A;  3WWX A;  5EPH A;  5FA7 A;  1PZO A;  2VGJ A;  4JXS A;  4WZ4 A;  1Q2P A;  1AXB A;  2WAE A;  4GDB A;  4PPR A;  3HBR A;  4WEK A;  2Q9M A;  3SH9 A;  5DTK A;  4PM7 A;  2H0Y A;  4KZB A;  1NYY A;  5CED A;  3IT9 A;  2ZM0 A;  1J9M A;  1BLS A;  4LEN A;  4OPZ A;  2Y2I A;  4PM9 A;  1DJA A;  4WYY A;  1NY0 A;  4UA9 A;  1LLB A;  1TEM A;  2Y2N A;  1IYO A;  2ZLY A;  3UO9 A;  5GLD A;  3G2Z A;  4S2J A;  4Q8I A;  1HVB A;  1ERQ A;  1CEF A;  5F83 A;  4OKP A;  4E3J A;  3Q7V B;  3LY4 A;  5E2E A;  3P98 A;  1Y54 A;  1ERM A;  1XGI A;  1YLT A;  3C5A A;  2DCF A;  1BT5 A;  4BLM A;  1ES3 A;  3O3V A;  2EX8 A;  5AQ9 A;  4OH0 A;  4P87 A;  1YLZ A;  1Q2Q A;  1ZC2 A;  2Y55 A;  3BLM A;  5EE8 A;  5CGX A;  3UN7 A;  4WMC D;  2R9X A;  5EVI B;  4JPM A;  4OVD A;  3Q7Z A;  5CXW A;  3GV9 A;  3RJU A;  1S0W A;  1XA1 A;  1XKZ A;  3QNC A;  3S4X A;  1K55 C;  4NET A;  5J8X A;  4EV4 A;  4LCM A;  1E25 A;  5EVI D;  1MXO A;  3A3J A;  4DE0 A;  3M2K A;  2J8Y A;  1K57 A;  4E6W A;  3IQA A;  3W4Q A;  3SOI A;  1HD8 A;  4S2M A;  4JXG A;  4KZ4 A;  4GDN A;  4GD8 A;  4X68 A;  3HLW A;  5FQM A;  4EBP A;  1NRF A;  2RL3 A;  5HX9 A;  4WEJ A;  3IXG A;  3VP3 A;  2Y2M A;  1S6R A;  2WKE A;  2HPB A;  4OPQ A;  5FAO A;  4IVK A;  3MXS A;  4OON A;  5EVI C;  4LCL A;  4XXR A;  1O7E A;  1E3U A;  3BFD A;  2HP5 A;  3GQZ A;  3A3E A;  4KZA A;  3PBR A;  3TG9 A;  2HDR A;  3S22 A;  4BEN A;  3G31 A;  2XF3 A;  3ZG9 B;  4OLG A;  3UE0 A;  5E2H A;  3OPL A;  5EOO A;  1K4E A;  3IF6 A;  3VSK A;  2G2W A;  1JWZ A;  3SS5 A;  1NZO A;  2WK0 A;  3WS5 A;  1PZP A;  4C75 A;  1YT4 A;  1ERO A;  1ZG6 A;  3ZG7 B;  2ZQ9 A;  3G4P A;  1L0E A;  3HVF A;  4A5R A;  1MBL A;  3HUO A;  4IVI A;  4Y0T A;  2CC1 A;  4R4R A;  3VP1 A;  1K6R A;  3HLB A;  5M1A A;  1L0G A;  2EFX A;  1N9B A;  2WGW B;  3VP4 A;  2HDS A;  5HFO A;  1G68 A;  2H5S A;  3PBQ A;  1SCW A;  5AQ7 A;  3VOZ A;  3BFC A;  2ZC3 B;  4KG6 A;  3BEC A;  2XDM A;  3HLG A;  3M2J A;  3NDE A;  1FR6 A;  1ES5 A;  5FQJ A;  2IWC A;  3N8S A;  4PM6 A;  1LL9 A;  3GTC A;  3N8L A;  3V50 A;  5EEC A;  3OC2 A;  4HEF A;  1H8Z A;  2XD5 A;  4KG5 A;  5HAR A;  4PMA A;  5A90 A;  1YM1 A;  2FFF B;  4KZ9 A;  4HES A;  4S2N C;  3FZC A;  1ES2 A;  2ZM2 A;  4RYE A;  3TSG A;  1IKG A;  4KQQ A;  1WYB A;  4N1X A;  3JYI A;  4BL3 A;  2XR0 A;  3ZG8 B;  5F1G A;  2ZQD A;  4WZ5 C;  2P9V A;  4OQ0 A;  4IBX A;  5HW3 A;  1KE0 A;  2Y2J A;  3G2Y A;  1FQG A;  1LI0 A;  2DRW A;  2OLU A;  4B4X A;  4X55 A;  3G30 A;  4JLF A;  4FCF A;  3N4I A;  3VP2 A;  5U47 A;  4B4Z A;  1M40 A;  5CEC A;  2ZC7 A;  2JCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...