5IHVA

Crystal structure of a beta-lactamase from burkholderia ambifaria
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
261
Chain Sequence
AELAALEKASNGRLGIAVLDTSNGTRIAHHARERFPLCGTYAVVAAAAILARGSLDASLLPRRILYRRYEVVAGSPVTESHVDTGMTIAQLCAAMLQSGDKGAGNLLMRVLGGPQAVTSFAHESGDTVFRLDRWEPELNLAAPGDERDTSTPVAMVDLLQQLLLGDTLREPQRAQLTEWMTGGARGATAIAAGVPPGWRVADKAGTGGYGTTTDVAVLWPPSRAPIVLAVSFTQPRADAAARADVVASAARIATGALTATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal structure of a beta-lactamase from Burkholderia ambifaria
rcsb
source organism Burkholderia ambifaria
total genus 83
structure length 261
sequence length 261
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5ihvA00
5GLBA 3SH9A 2A3UA 1ES3A 4P85A 2QPNA 3GV9A 1DJAA 4UHUA 2GDNA 4OQHA 2XFSA 1FCNA 4JF6A 4S2LA 3BEBA 1GA9A 4ID4A 4S2IA 2ZQCA 3FYZA 4DDYA 4OOLA 4FH4A 5EE8A 3VSKA 4XXRA 2HPBA 1IYQA 2QMIA 3VMAA 3MXRA 1HTZA 1WYBA 2EFXA 4E3MA 1K55A 1W5DA 4B4ZA 2WKEA 4LV2A 3OCNA 5EVID 2ZM8A 3BYDA 5HAIA 3SH7A 5JYPA 1FSYA 4BJPA 1IKGA 2DNSA 3PTEA 1ONHA 3A3IA 1PWGA 4R4SA 3CZDA 4JXGA 4OOMA 3LEZA 3NIAA 3ZCZA 2H0TA 1JTGA 4OONA 1QMEA 3FZCA 1K25A 3IHBA 5I94A 4JXSA 1YLYA 1I5QA 3IXHA 4BQMA 2B5RA 1VM1A 1K56D 3M2JA 2WKHA 4MBHA 3UY6A 3GR2A 4Y0UA 3BFEA 3EQVA 4UA7A 5A92A 4KZ9A 1NYYA 2WGWA 2I72A 4ZJ3A 4KZ8A 1N4OA 1K57C 1RP5A 4R0QA 4WEJA 4DKIA 2ZQDA 2Q9MA 3C4OA 3OPPA 5TFQA 3SS4A 3JYIA 3G31A 4WMCA 4BD0A 2Q9NA 1KE3A 2VGJA 2EXBA 4X55A 4WBGA 5HAPA 4K0XA 1O07A 1KE4A 4OPYA 1MWSA 2CC1A 4ZJ2A 3MBZA 1L0EA 1PZOA 2Y2HA 3G32A 5IHVA 5GHXA 3ZG8B 5FSRA 2XQZA 2E8IA 4KZ4A 4Y7PA 1RGZA 4OP8A 1TDLA 1LL5A 2ZQ7A 3LO7A 3ZG0A 1K6RA 4MEZA 3IHAA 1YT4A 3P98A 2X02A 5M1AA 2J8YA 3S22A 5JYOA 4DF6A 2V1ZA 4E6XA 3LY4A 1RCJA 2Y2QA 1K57A 5EUAA 2C6WB 3UN7A 4KQOA 2XK1A 1FCMA 2XR0A 5DVAA 3WS1A 3AGFA 4ZBEA 4UAAA 3HLEA 4KQRA 2ZC7A 2WGIA 3FV7A 1KGEA 1FSWA 5EVLA 4OPRA 5G18A 1GHPA 2WGVA 3HLWA 3WS5A 2OV5A 3IF5A 4KZ7A 3GVBA 5EECA 4U3TA 3WS4A 5F1FA 5HAQA 1CI9A 3ZGAB 4QJGA 4Y0TA 4LCMA 4A5RA 4FD8A 4GKUA 3V39A 2Y2LA 1MKIA 3G2ZA 4EBPA 1ERQA 3C4PA 4MBKA 1L2SA 1PZPA 5E2GA 2P74A 3VFHA 4N9KA 1SDEA 3TSGA 3FKWA 4IVIA 5CRFA 3HVFA 3V3SA 4WYYA 1H8YA 2H10A 3V3RA 2HP5A 4JXWA 4LV0A 4M3KA 5CXWA 1QMFA 3NY4A 4E3KA 3HL9A 1XP4A 3VP0A 1XGJA 4YFMA 1AXBA 1NRFA 2V20A 3VOZA 4LV1A 4UA6A 3S1YA 3SOIA 5L2FA 1KGGA 2EX6A 1YM1A 2J9OA 4HEFA 4E3LA 2ZMAA 1YMXA 2A49A 4OP5A 2OSUA 3C5AA 5DTKA 3N8SA 4OH0A 5FI7A 5EOOA 3W4OA 1LI9A 3P09A 2PU4A 2HDUA 5CHJA 3ZHHA 3IXGA 4D2OA 2Y2KA 1VQQA 1L0FA 5GLDA 3OZHA 4Q8IA 1K4EA 1ESUA 2R9WA 1PI5A 4RVAA 4PM5A 3MKFA 4QY5A 2JC7A 3CJMA 1WYCA 2EX8A 4JLFA 3MKEA 3PBOA 3Q07A 1GHMA 2FFYA 2Y2GA 4ZTKA 4KZAA 1SHVA 5HFOA 1YLTA 2X71A 1KVMA 2BG1A 1JWVA 3UDXA 2WK0A 4C3QA 3D4FA 4DE3A 4EV4A 3GQZA 5FQ9A 1XPBA 4K91A 5DTSA 5FQMA 2JBFA 1BLPA 3N8LA 4EUZA 1MWRA 5KZHA 3NC8A 4N1XA 4RYEA 1CK3A 3E2KA 1YLJA 1U60A 3C7VA 3FKVA 4KQQA 4L0LA 2RCXA 4UA9A 3IWOA 3RJUA 5CEBA 5EVIB 5HARA 3UPNA 2V2FF 1FQGA 3S4XA 4DXCA 1W79A 1TDGA 2WADA 1E3UA 1FCOA 3A3JA 4X53A 3RXXA 4HBTA 1K38A 3DW0A 3ZG5A 3ZFZA 4PMAA 4OOYA 4F94A 1BSGA 2Z2LB 1HZOA 3FWLA 1H5XA 2JCHA 5BOHA 4QHCA 5HL1A 2Y91A 3IXBA 2X01A 4FSFA 2WAFA 3PBSA 4N92A 4PPRA 4S2PA 3UDIA 3UO9A 4X69A 3TG9A 3DWKA 4JXVA 3IF6B 5E2FA 3HBRA 3M6HA 5DF7A 4KZ3A 4OQIA 5FQKA 3N4IA 4S2OA 3UE0A 4GNUA 3W4PA 1FR1A 1PI4A 3MZDA 3PBTA 1NZOA 4GD8A 4DE2A 1S6RA 4WZ5C 1ZKJA 3G2YA 3WS2A 1DJBA 3IXDA 2ZLYA 2Z2MB 5KSHA 4R3BA 3QNCA 4GDBA 3BLSA 4E3IA 5DF8A 1K4FA 4U0TA 4Y0OA 4XUXA 1BT5A 3EQUA 1GCEA 1PW8A 1K54C 5EVIC 3O3VA 2Y2JA 3PAEA 3BFFA 1YMSA 1IYSA 2Y4AA 4FH2A 1H8ZA 4P6BA 4X68A 3WRZA 1BUEA 1G6AA 1XXMA 4K0WA 3G4PA 4S2NC 3I7JA 2IWBA 3BFGA 3VP3A 1L0GA 3SS3A 1NYMA 3IT9A 3O86A 1MXOA 1XKZA 2IWCA 4NK3A 3SH8A 4OQ0A 2DCFA 2C5WB 2H5SA 3E2LA 3Q7ZA 1JVJA 4JBFA 1PYYA 4HESA 4WZ5A 2EFUA 4S2JA 3IF6C 2OLVA 1IELA 4IEDA 5KMWA 4PM9A 4JF4A 4MNRA 2XD1A 2HDQA 4JKTA 4RX2A 1L0DA 1K54A 5EVIA 1IYPA 3BECA 3PBQA 3UPOA 3OCLA 1ESIA 2EXAA 2WAEA 3UE3A 2R9XA 4GB7A 1MBLA 3IH8A 1LL9A 4S2NA 4LENA 1RGYA 3BFCA 1BLCA 2WKIA 3NBLA 1Z6FA 4OVDA 3G30A 3BRMA 1ZG6A 5FAPA 3Q7VB 3HUNA 5E2HA 5AQ9A 1SKFA 4S2MA 3GTCA 1K56A 1GA0A 1NXYA 4N9LA 4S2KA 3NCKA 3IF6A 4GOGA 5CTMA 4KG2A 5AQBA 2Y59A 4GN2A 4WMCD 4WELA 4X56A 1TVFA 2EX2A 4U0XA 4OLGA 5FATA 3IWQA 3VSLA 2H0YA 3HUOA 1MPLA 4P0MA 4X6TA 1HVBA 5GHYA 2ZJ9A 5CECA 1Q2QA 1NY0A 1IYOA 3MZFA 5FI6A 2Y2IA 1BLHA 5F1GA 4DXBA 5CGWA 1N9BA 3BFDA 1KVLA 1JWPA 1I2WA 1G68A 4EBLA 3GSGA 3WWXA 1FOFA 1MY8A 4B4XA 5GLCA 3HLDA 3RXWA 4O7DA 1EWZA 5E2EA 3HLFA 1CEFA 4HBUA 4JF5A 3VOYA 1SCWA 4IVKA 3A3FA 1XGIA 3BLMA 1W8QA 3C7UA 3GRJA 2UWXA 3M2KA 3PBNA 4IBRA 4KENB 2ZM0A 4C75A 2ZC6B 5D3OA 4BLMA 3V50A 4E3JA 4R3JA 1JTDA 3N6IA 1DJCA 1XX2A 5GHZA 3ZG9B 5A91A 3M6BA 2XDMA 4GZBA 4WEKA 4EBNA 5CGSA 3VFFA 4P87A 3WRTA 1Q2PA 3NDEA 1ZG4A 4BD1A 3NDGA 5DTTA 1ALQA 2G2UA 2WUQA 4LV3A 1I2SA 3O88A 3ZG7B 4NETA 5A93A 2HDSA 1PIOA 4LCLA 3IQAA 3SS5A 3W8KA 4KG5A 3UE1A 3CMZA 1OMEA 2XD5A 2ZC4B 2WYXA 1TEMA 4DE1A 4C6YA 4RX3A 5FQJA 3O87A 3B3XA 2RL3A 3G34A 1YLWA 1XA7A 3HLCA 3Q7VA 4FCFA 5F83A 5FI2A 4DE0A 3AGDA 3LCEA 4QU3A 3DTMA 2PU2A 5EOEA 4N1HA 1HD8A 3CG5A 1MWTA 1LLBA 4CPKA 3N7WA 4R4RA 2EX9A 2Y2NA 3QNBA 5F82A 1EI5A 4OPZA 1EROA 4GDNA 1KDSA 1NJ4A 4BL2A 1GHIA 5FAQA 4WM9A 2OLUA 3AGEA 4KZBA 4B88A 4BENA 3V5MA 4PM6A 4PM7A 4KG6A 1NZUA 1KE0A 3OC2A 2P9VB 2J7VA 5CHUA 4EWFA 5FQIA 3IH9A 1C3BA 3GMWA 4PM8A 2ZD8A 4OPQA 4Z9QA 2DRWA 2G2WA 3NI9A 1E4DA 1SDNA 1O7EA 2XEPA 5CERA 3DWZA 5FA7A 3UNWA 4CJNA 4R1GA 3MXSA 5FASA 2IWDA 2Y2MA 1M40A 4WZ4A 4KZ5A 5GLAA 1J9MA 1BZAA 2J9PA 3PBRA 4QB8A 1LHYA 2HDRA 4ZDXA 1ES4A 3ZVWA 4GD6A 5E43A 3LY3A 3OPRA 3WS0A 4OQGA 3ZNYA 1CI8A 4OLDA 4QD4A 4DDSA 1K6SA 1ES2A 3UPPA 3UDFA 3IWIA 4E3NA 1WE4A 3A3EA 5M18A 1CEGA 4JPMA 2WZZA 3HUMA 2Y55A 5A90A 2XH9A 3Q81A 4E6WA 2XGNA 1W8YA 5FQQA 5FAOA 3ZDJA 3QHYA 1JWZA 1PWDA 2WZXA 2XLNA 4KZ6A 1MWUA 3VP2A 5CTNA 1IEMA 4E3OA 4ZJ1A 3TOIA 2QZ6A 3HLGA 3ITBA 5DF9A 3N8RA 5HW3A 4MBFA 4EQIA 5AQAA 3ITAA 3ZVTA 1KGFA 3VP1A 5M19A 2ZC5B 1E3UD 1M6KA 3W4QA 2BLSA 3MZEA 1ZC2A 1YQSA 4MLLA 5AQ7A 3VP4A 1PW1A 3BM6A 5KSCA 2PBYA 5EPHA 5U47A 3OPLA 3OPHA 5GL9A 3Q1FA 3A3DA 4H8RA 4QY6A 1YLZA 1ERMA 4YINA 1FR6A 3ZNTA 4XUZA 5CGXA 4RA7A 1Y54A 2ZM2A 1E25A 2JE5A 3HLBA 4DRTA 4ZAMA 4BL3A 2WGWB 1LI0A 5TR7A 2XFTA 2ZQ9A 1BULA 2Y2PA 2P9VA 2ZQ8A 5CHMA 1PWCA 1ONGA 4IBXA 4OKPA 5J8XA 2XF3A 1ES5A 2HP6A 1YLPA 3ISGA 5HX9A 2HP9A 2FFFB 3HREA 1S0WA 3MFDA 1DY6A 1KDWA 2ZQAA 2ZC3B 5TGFA 1BTLA 2Y2OA 3G35A 2VGKA 1K55C 4R23A 1BLSA 1XA1A 3Q82A 5CEDA 3PAGA 5FDHA 1IKIA 1W7FA
chains in the Genus database with same CATH superfamily
1H3QA 3DAVA 3LIBA 2A3UA 4XT2B 4HJ6A 4P85A 3F1NA 3UB7A 3GV9A 4S2LA 4ID4A 2ZQCA 5DFYA 5EM0A 1IYQA 3MXRA 1WYBA 2VGLM 3IS2A 1K55A 4B4ZA 2WKEA 3MQOA 2JN7A 4F3LB 1FSYA 2V1AA 2PHYA 2DNSA 1ONHA 2VGLS 4OOMA 3LEZA 1JTGA 1K25A 3IHBA 3BY9A 2W1TA 5MC7A 1YLYA 1I5QA 1DP8A 2B5RA 1VM1A 4MBHA 3P7NA 1NYYA 2B18A 2VV7A 4KZ8A 5HPFA 4DKIA 3OPPA 2VGJA 1O07A 4OPYA 1MWSA 2CC1A 3CLOA 4Q0JA 3BW6A 3SZTA 5IHVA 4BWIA 1TDLA 2J3TC 4MEZA 4XT2A 4B9OA 2J8YA 3T4QA 2O9CA 3T4SA 2Y2QA 5EUAA 3PYPA 2C6WB 1XFNA 2VX8A 5DVAA 3AGFA 4ZBEA 3HLEA 3PXPA 4PAUA 4OPRA 5G18A 3KSGA 4F3LA 3WS4A 3E4OA 1W63Q 1CI9A 4WF0A 2WKQA 3C4PA 5E2GA 3QP4A 1SDEA 3FKWA 5CRFA 3V3RA 4JXWA 1WA9A 4E3KA 1XP4A 1T19A 2V20A 4UA6A 2G7UA 4GW9A 4GS9B 2Y79A 2PR5A 3N8SA 3S7NA 3W4OA 3ICYA 1ZTUA 5F6AA 4NXBA 1PI5A 4QY5A 3KSHA 4JLFA 3Q07A 1GHMA 1AWIA 1JWVA 2WKRA 3UDXA 3LEQA 4EV4A 3IX8A 1MWRA 4EQ1A 3RTYA 4LRZE 4Q0HA 3C7VA 3QP6A 4UA9A 5CEBA 3UPNA 4EUVA 1UGUA 4HIAA 2QKPA 1TDGA 3RXXA 4BBVA 5DJTA 3ZG5A 4OOYA 4F94A 3UB8A 3FWLA 2J3WA 1J3WA 4FSFA 4N92A 1OJGA 2J80A 4S2PA 3UDIA 4X69A 4GS9A 4GNUA 2JKTM 2JKRM 4GD8A 3TJZC 1ZKJA 3G2YA 3WS2A 2ZLYA 3BQAA 4I3JA 3BLSA 5DF8A 4G3KA 4K08A 3LR0A 1GCEA 1K54C 1XJ2A 5EVEA 3PAEA 5F68A 4HJ3A 2Y4AA 4FH2A 5HDCA 4X68A 3WRZA 1G6AA 1V9ZA 4RQ9A 4Q0IA 3I7JA 2QWSA 3KX0X 3UMEA 3IT9A 4NK3A 2C5WB 3E2LA 1KOUA 1L0DA 1K54A 5K5BA 2R9XA 2W27A 3C38A 1BLCA 3G30A 3HUNA 5AQ9A 4S2MA 4YWZA 1N9NA 3F1PB 4GOGA 3H7WB 5FEFA 5AQBA 2JHEA 4QWOA 4OLGA 3VSLA 3CI6A 3NOPC 4Z1WA 4GJ4A 2HGVA 5F1GA 4JGRA 3BFDA 1KVLA 1I2WA 1T18A 4B4XA 3K3CA 4O7DA 1EWZA 4ZRRA 2H28A 4IVKA 3A3FA 4HP4A 1W8QA 2W3GA 3DBAA 3PBNA 4KENB 4Y17A 2ZC6B 4BLMA 1IOUA 3B47A 5GHZA 3UB9A 1JNUA 2O99A 3VFFA 4JGQA 2VV8A 1ZG4A 5DTTA 2G2UA 4LV3A 2WUQA 3O88A 4R6LA 5I5LA 5J7EA 4LCLA 2HJ9C 3IQAA 5C5KA 4KG5A 1OMEA 3R7WB 3GECA 3HCYA 4I5SA 1XJ4A 4C6YA 5FQJA 5FI2A 4DE0A 3AGDA 4QU3A 2PU2A 1HD8A 3F1PA 1OTBA 1SKOB 3H7WA 2Y2NA 1EROA 4BL2A 4NXFA 3AGEA 4BENA 5IS1A 1NZUA 4Y15A 3UB5P 2P9VB 5HD5A 1BYWA 5HDDA 2ZD8A 3T1QB 4OPQA 2G2WA 2Q0OA 1E4DA 4G3VA 5CERA 3T1XA 1CQAA 1TS7A 4WZ4A 1J9MA 2J9PA 4QB8A 1LHYA 1K6SA 3F1OB 3UDFA 4E3NA 3A3EA 3CWFA 4JPMA 2NUPC 3K3DA 2XH9A 3L9KA 1W8YA 5FAOA 1TS0A 3BY8A 3ZDJA 1T1CA 1PWDA 2WZXA 4QPRA 5CTNA 5DF9A 5HW3A 3R7WA 3ITAA 3ZVTA 5M19A 5EFWA 2BLSA 1PW1A 2AVXA 3OPLA 1SKOA 2QJ7A 1FR6A 4Y3IA 5CGXA 3CITA 4RA7A 1E25A 2JE5A 2PDRA 1OTDA 5KIZA 1K0KA 2ZQ9A 2Y2PA 2P9VA 4OKPA 1A0KA 4IBXA 4NKPA 1ES5A 5HX9A 2FFFB 1S0WA 1DY6A 2ZQAA 3KYEA 1XA1A 1S67L 5CEDA 3OOVA 3PAGA 5DJUA 5FDHA 3LR4A 5GLBA 3SH9A 4BBTA 3F1OA 2XFSA 4MN6A 4XXRA 2HPBA 5J4EA 3VMAA 1HTZA 2ZBBA 3DTKA 1P9WA 3NECA 3NOTC 3T4OA 2V0WA 4LV2A 5HAIA 3SW1A 4EEUA 4BJPA 1IKGA 4NEED 3PTEA 2OAP1 2OAQ1 4HH3A 3LFVA 1UWNX 4OONA 1QMEA 4JXSA 4BMWA 4BQMA 2PRFA 2WKHA 4I39A 4Y0UA 3EQVA 4ZJ3A 4WEJA 1N4OA 1K57C 3HJIA 3C4OA 3EWKA 3GDIA 3JYIA 3SS4A 4BD0A 2EXBA 4Y5FA 2UV0E 5HAPA 4K0XA 3TW8A 1KE4A 3FPWA 4PKYG 1L0EA 1PZOA 2ZOIA 5GHXA 5FSRA 2E8IA 1GSXA 4KZ4A 1RGZA 4OP8A 2ZQ7A 3LO7A 1LL8A 5M1AA 2V1ZA 1K57A 1OT6A 3T4JA 4FOFA 3KSIA 2XR0A 3WS1A 2VZWA 4UAAA 4ETXA 2ZC7A 2WGIA 4MCWA 4DJ3A 3T4LA 3WS5A 2OV5A 3IF5A 5EECA 5F1FA 1EW0A 5L10A 5HAQA 4HI4A 4QJGA 4LCMA 1S1ZA 4FD8A 5G4YA 3V39A 3G2ZA 4EBPA 3TSGA 3HVFA 3V3SA 4WYYA 2H10A 4EXOA 4LV0A 5CXWA 2V8CA 4YFMA 1AXBA 1FILA 3C5AA 5FI7A 1LI9A 3P09A 2OOLA 3IXGA 2Y2KA 1T1BA 3OZHA 4Q8IA 2R9WA 4PM5A 2JC7A 1WYCA 3EGDC 1OTEA 2Y2GA 4ZTKA 4KZAA 1SHVA 1PNEA 4EEPA 1KVMA 2WK0A 4C3QA 1F2KA 3D4FA 4DE3A 3O5YA 3PHYA 1XPBA 5DTSA 3LIFA 4O8GA 5KZHA 3NC8A 4N1XA 4RYEA 3FKVA 1YLJA 1U60A 4KQQA 3IX4A 3C30A 5HARA 2FH5A 2V2FF 3MMHA 1W79A 4MN5A 2WADA 3L7HA 1D7EA 3A3JA 4PMAA 1N9OA 2Z2LB 1HZOA 1H5XA 4IUHA 2Y91A 2WAFA 3S7OA 4JXVA 5DF7A 2EWVA 4OQIA 5HDSA 3PBTA 4LGWA 1NZOA 4ME4A 3NOUC 2Z2MB 5KSHA 4R3BA 3QNCA 2QJ5A 3D3OA 1K4FA 3BQ8A 1BT5A 4UQIM 1YMSA 4P6BA 4LLOB 2IWBA 4MN7A 3VP3A 4UQIS 1NYMA 3O86A 4G3WA 1XKZA 2IWCA 3SH8A 3U2AA 1PYYA 4HESA 1S4RA 2OLVA 4IUKA 4IEDA 3LR3A 4PM9A 1S66L 2XD1A 2ACGA 4JKTA 4RX2A 1F9IA 2O9BA 1IYPA 3OCLA 1FIKA 2EXAA 2WAEA 3IH8A 4LENA 3BFCA 2HJEA 3EEHA 3Q7VB 5E2HA 1K56A 3NCKA 3MS6A 3E4QA 5L07A 4GN2A 3RH8B 1TVFA 4U0XA 2H0YA 1MPLA 5AVFA 4X6TA 2ZJ9A 1W63M 3MZFA 2WKPA 5CGWA 1N9BA 1STZA 3FG8A 2I9VA 4B93A 4EBLA 1MY8A 3HLDA 5E2EA 3HLFA 4HBUA 4JF5A 1SCWA 2PT7A 3M2KA 4IBRA 3MF0A 4C75A 3ULFA 5D3OA 5FEGA 3ZG9B 5A91A 4R3AA 4IHQA 5CGSA 3WRTA 4YNRA 4BD1A 1I2SA 5A93A 1LSWA 3SS5A 2XD5A 2HF6A 4CQHA 2WYXA 4PHTA 4CLCC 2RL3A 3Q7VA 4FCFA 3JVVA 5HD3A 5EOEA 3CG5A 3JPUA 2GX5A 3E0YA 2Z6DA 1KDSA 1NJ4A 2OLUA 3U4LP 3V5MA 2VEAA 4KG6A 5CHUA 3QP2A 2L4RA 3GMWA 4PM8A 4Z9QA 3NI9A 1SDNA 3A0SA 1O7EA 3UNWA 4R1GA 2IWDA 4DJ2A 5GLAA 1BZAA 3PBRA 4ZDXA 1ES4A 3OPRA 4X1MA 3WS0A 4OQGA 1CI8A 4DDSA 5M18A 1CEGA 3BJNA 1D1JA 2KDKA 3Q81A 3HJKA 3CUEC 1MWUA 3VP2A 4ZJ1A 4MBFA 2ZC5B 3W4QA 3MZEA 1ZC2A 4MLLA 5AQ7A 3BM6A 5HWWA 1YLZA 1ERMA 4YINA 2PD7A 2KOIA 4NXGA 1Y54A 4PKYA 4EW7A 4Y13A 3B42A 2ZQ8A 1PWCA 2HP6A 3NULA 3ISGA 2HP9A 5DFXA 1TS6A 1VB6A 2MJ6A 2Y2OA 3KSFA 4UEYA 3Q82A 2XROA 1ES3A 1DJAA 4OQHA 1FCNA 3BEBA 1GA9A 4S2IA 3FYZA 4GCZA 4OOLA 5DKLA 3VSKA 2QMIA 2VA0A 2J3TD 3VE4A 2EFXA 3OCNA 5JYPA 3A3IA 1S4SA 4MDZA 2H0TA 3FZCA 5I94A 1K56D 3M2JA 4HQAA 3UY6A 4UA7A 1H0MA 1MKMA 2I72A 3S7PA 1RP5A 4R0QA 2Q9MA 5TFQA 2INWA 3G31A 4WMCA 4WBGA 1MC0A 4ZJ2A 3MR0A 2Y2HA 4Y7PA 2V9AA 1LL5A 3IX3A 2X02A 3S22A 5JYOA 4DF6A 4E6XA 5HPIA 3TRCA 1RCJA 1OTIA 3VE3A 1DP9A 2XK1A 1FCMA 3QP1A 4KQDA 3FV7A 1KGEA 1FSWA 3DTEA 5EVLA 2KLIA 3HLWA 4KZ7A 3C8CA 3GVBA 2GZAA 1XJ3A 3T4TA 4Y0TA 1TD5A 2Y2LA 1MKIA 3UB6A 1L2SA 4N9KA 1XJ6A 4IVIA 3LIEA 1H8YA 2EA9A 3VP0A 3OLOA 1XGJA 5HSQA 4LPZA 1NRFA 3VOZA 3S1YA 1KGGA 2EX6A 1NWZA 1V9YA 1YMXA 2A49A 4I38A 2OSUA 5DTKA 5EOOA 2HDUA 4EESA 1L0FA 5GLDA 1K4EA 4AFIA 4RVAA 1VEUB 3MKFA 3CJMA 4BBUA 3MKEA 3PBOA 5TBMB 2K31A 1DP6A 2BG1A 3E4PA 1XFQA 5FQ9A 2OWJA 4K91A 5FQMA 1BLPA 3N8LA 4EUZA 3NHQA 3VOLA 1Z09A 1CK3A 3E2KA 4L0LA 2RCXA 3IWOA 3RJUA 5EVIB 2P08A 1FQGA 4DXCA 2P04A 4HBTA 1K38A 4R38A 4FTXA 3DW0A 3ZFZA 1CJFA 5HL1A 3PBSA 4IJGA 3TG9A 3DWKA 5E2FA 3IF6B 4KZ3A 3N4IA 4S2OA 1PI4A 3MZDA 4WZ5C 2OWHA 4HP9A 1LSXA 3IXDA 1MZUA 4GDBA 4E3IA 1PW8A 1VEUA 5EVIC 3O3VA 1NLZA 2PYPA 5TBMA 2PR6A 2HV1A 1XXMA 4S2NC 4GHIB 3BFGA 3BWLA 1L0GA 3SS3A 2R78A 1MXOA 2H5SA 4WZ5A 3IF6C 2YKHA 1IELA 1OT9A 5KMWA 3EEAA 5EVIA 3BECA 4O0PA 1H8MA 3UE6A 3LI9A 2NUTC 5CX7A 3UE3A 2ZOHA 4S2NA 3QP5A 1RGYA 2B02A 1LT0A 3BRMA 1ZG6A 3FPVA 1SKFA 4N9LA 5HL6A 5FDSA 3IF6A 4KG2A 2Y59A 1W7FA 4WMCD 4WELA 2PYRA 2EX2A 4MMNA 5FATA 3IWQA 3CPTB 4P0MA 4ETZA 4FUWA 5GHYA 1NY0A 1X0OA 5FI6A 2Y2IA 4L9FA 1OTAA 1BLHA 2B95A 4O01A 1T1AA 4GHIA 3VOYA 1XGIA 3GRJA 3C7UA 2ZM0A 2VV6A 1SZVA 4WL9A 3V50A 3A0RA 1JTDA 3FC7A 1DJCA 1XX2A 3M6BA 4P87A 3NDEA 4II7A 3V67A 3NDGA 1ALQA 3OBFA 3LICA 1S1YA 3W8KA 2ZC4B 5HWVA 1YSQA 4RX3A 3O87A 2GJ3A 3G34A 1XA7A 4KUOA 3HLCA 5F83A 2V8FA 3EOIA 3LCEA 2QHKA 1MWTA 2L1MA 4CPKA 4R4RA 2EX9A 5F82A 1EI5A 4GDNA 2M7VA 1GHIA 3CPTA 4KZBA 3LI8A 2J7VA 5FQIA 3IH9A 1C3BA 2DRWA 2BASA 5FASA 1M40A 3LGOA 2HDRA 3B33A 3P01A 4GD6A 5E43A 4OLDA 4QD4A 3UPPA 3IWIA 1WE4A 2LB9A 2WZZA 3D72A 3HUMA 2Y55A 5A90A 1PFLA 1JWZA 4KZ6A 4E3OA 2QZ6A 5TJJA 5AQAA 1M6KA 2K7SA 3K2NA 1YQSA 5DKKA 3VP4A 2O9AA 4HNBA 2E8JA 3OPHA 5GL9A 3NJAA 3Q1FA 3A3DA 4H8RA 4QY6A 1ACFA 3ZNTA 5HZHA 4ZAMA 4BL3A 2WGWB 1LI0A 5EV0A 5J8XA 5CHMA 2XF3A 3LUQA 1YLPA 2K2NA 4CLCB 1KDWA 2ZC3B 5TGFA 3G35A 4R23A 1BLSA 2QPNA 2W1RA 4LRYC 4ARZB 4UHUA 2GDNA 4JF6A 4DDYA 4FH4A 5EE8A 4E04A 3S7QA 1TF1A 2JKFA 4E3MA 1W5DA 3T4KA 5EVID 2ZM8A 3BYDA 3SH7A 3T12B 3IBRA 3T1SA 1PWGA 4R4SA 3CZDA 4JXGA 3A0VA 3NIAA 1Y4OA 3KYZA 3ZCZA 2ZMVA 4EETB 3IXHA 4HJ4A 3GR2A 4DMZA 2W3DA 3BFEA 5A92A 4KZ9A 2WGWA 2ZQDA 4GLQA 2Q9NA 1KE3A 4X55A 1PRQA 1L3LA 4CLCA 2YKFA 1GSVA 3MBZA 3G32A 3ZG8B 2XQZA 2V1BA 3ZG0A 1P9RA 3KYQA 1K6RA 3IHAA 1YT4A 3P98A 2L0WA 3QP8A 4KUKA 3LY4A 1OJ5A 4ARZA 1YKDA 2JKTI 2JKRI 3UN7A 4KQOA 5EM1A 2EWWA 4KQRA 2GNXA 2VKSA 1G28A 2Y8HA 1YAXA 3IBJA 1GHPA 4YOFA 2WGVA 4U3TA 1G5UA 3ZGAB 4A5RA 2BTFP 4GKUA 4JGPA 1ERQA 4MBKA 5IU1A 1PZPA 2P74A 3VFHA 1UWPX 1TS8A 1NRJA 3KO6A 2HP5A 4M3KA 3CUEA 1QMFA 3NY4A 3HL9A 2XSSA 5J3WA 2DMWA 3TE8A 4LV1A 1P97A 3SOIA 5L2FA 1F98A 1YM1A 2J9OA 4HEFA 4E3LA 2ZMAA 4OP5A 1VETB 1Y28A 3G6OA 4OH0A 2PU4A 5CHJA 3ZQ5A 3ZHHA 1N9LA 4D2OA 1VQQA 1OPXA 2VJWA 1ESUA 4I3AA 2EX8A 2W3FA 2FFYA 5HFOA 3MQ0A 5F69A 1YLTA 2X71A 4R70A 2FZ0A 1F5MA 3GQZA 3ZYTA 2JBFA 1NLYA 4L9EA 3S4XA 3RFBA 1E3UA 1FCOA 4LRXC 4X53A 3EGXC 3E98A 1BSGA 3MXQA 5BOHA 5IT5A 2JCHA 4QHCA 2ZL1B 3IXBA 3LYXA 2X01A 4PPRA 3UO9A 3HBRA 3M6HA 4X25A 1VETA 5FQKA 3UE0A 2M1CA 3W4PA 1FR1A 4H6JB 1VHMA 3MSHA 4DE2A 1S6RA 1DJBA 4Y2FA 4U0TA 4Y0OA 4XUXA 3EQUA 2Y2JA 3BFFA 2PD8A 1IYSA 1H8ZA 1BUEA 4K0WA 3G4PA 3C2WA 3CAXA 2JKGA 1YPRA 4OQ0A 2O0YA 2DCFA 3Q7ZA 4JBFA 1JVJA 3MJQA 2EFUA 4S2JA 4JF4A 4MNRA 2HDQA 4WUJA 3MFXA 4I3IA 3PBQA 3UPOA 2VK3A 4L9GA 1ESIA 4GB7A 1MBLA 1LL9A 3T50A 5AVEA 1IFQA 2WKIA 3NBLA 1Z6FA 3H82B 4OVDA 2ZL1A 5FAPA 3GTCA 1GA0A 1NXYA 2W3HA 5F5YA 4S2KA 5CTMA 4X56A 4H6JA 4CLCD 5LBRA 3HUOA 1YSPA 1HVBA 5CECA 1DRMA 3LIDA 1Q2QA 3D9YA 1IYOA 5HWTA 4DXBA 4P6ZM 5L09A 1JWPA 1G68A 3GSGA 3WWXA 1FOFA 5AJGA 5GLCA 3RXWA 2D01A 1CEFA 1ODVA 3MQQA 4P6ZS 2P7JA 3BLMA 2UWXA 3PR6A 3UMDA 4E3JA 4R3JA 1P0ZA 3N6IA 5L8MA 4EBNA 2XDMA 4GZBA 4WEKA 2IA2A 4HH2A 1Q2PA 2VLGA 3ZG7B 2ZMFA 4NETA 2HDSA 4CLCE 1PIOA 3UE1A 3CHWP 3CMZA 3LR5A 1TEMA 4DE1A 1LSVA 3B3XA 2M7UA 3H82A 4X1LA 1YLWA 2PAVP 4NG2A 1G6OA 3DTMA 4N1HA 1LLBA 3N7WA 4ESPA 1GSWA 1HLUP 3QNBA 4OPZA 2A24B 5FAQA 4WM9A 4JGOA 4B88A 2LB5A 2A2LA 4PM6A 4PM7A 1KE0A 3OC2A 2CMNA 4EWFA 1D06A 2XEPA 4CJNA 3DWZA 5FA7A 3MXSA 2Y2MA 4KZ5A 5G4ZA 4HHDA 5FL3A 2HZ5A 3ZVWA 3LY3A 3ZNYA 1ES2A 3F1NB 3DTIA 2XRNA 4WN5A 2QYBA 3JVUA 4E6WA 2XGNA 2PBDP 1ZHHB 5FQQA 3QHYA 3W2ZA 4HOIA 2XLNA 1IEMA 3TOIA 2XA7M 3HLGA 3IS2B 3ITBA 3N8RA 4EQIA 3LIAA 1KGFA 3VP1A 1E3UD 3VV4A 5A8BA 2V0UA 5KSCA 2W3EA 2PBYA 3R4KA 5EPHA 2XA7S 5U47A 2D02A 2Z6CA 4WLAA 2W1TB 4XUZA 4EERA 2ZM2A 4EU0A 3HLBA 4DRTA 2A24A 2W0NA 5TR7A 2XFTA 4HY8A 1BULA 1ONGA 4LFUA 4DN0A 3HREA 3MFDA 4M4XA 3T1RA 1BTLA 2VGKA 1K55C 2KX6A 4D60A 1CF0A 3H9WA 1IKIA 4NXEA
chains in the Genus database with same CATH topology
5GLBA 3SH9A 2A3UA 1ES3A 4P85A 2QPNA 3GV9A 1DJAA 4UHUA 2GDNA 4OQHA 2XFSA 1FCNA 4JF6A 4S2LA 3BEBA 1GA9A 4ID4A 4S2IA 2ZQCA 3FYZA 4DDYA 4OOLA 4FH4A 5EE8A 3VSKA 4XXRA 2HPBA 1IYQA 2QMIA 3VMAA 3MXRA 1HTZA 1WYBA 2EFXA 4E3MA 1K55A 1W5DA 4B4ZA 2WKEA 4LV2A 3OCNA 5EVID 2ZM8A 3BYDA 5HAIA 3SH7A 5JYPA 1FSYA 4BJPA 1IKGA 2DNSA 3PTEA 1ONHA 3A3IA 1PWGA 4R4SA 3CZDA 4JXGA 4OOMA 3LEZA 3NIAA 3ZCZA 2H0TA 1JTGA 4OONA 1QMEA 3FZCA 1K25A 3IHBA 5I94A 4JXSA 1YLYA 1I5QA 3IXHA 4BQMA 2B5RA 1VM1A 1K56D 3M2JA 2WKHA 4MBHA 3UY6A 3GR2A 4Y0UA 3BFEA 3EQVA 4UA7A 5A92A 4KZ9A 1NYYA 2WGWA 2I72A 4ZJ3A 4KZ8A 1N4OA 1K57C 1RP5A 4R0QA 4WEJA 4DKIA 2ZQDA 2Q9MA 3C4OA 3OPPA 5TFQA 3SS4A 3JYIA 3G31A 4WMCA 4BD0A 2Q9NA 1KE3A 2VGJA 2EXBA 4X55A 4WBGA 5HAPA 4K0XA 1O07A 1KE4A 4OPYA 1MWSA 2CC1A 4ZJ2A 3MBZA 1L0EA 1PZOA 2Y2HA 3G32A 5IHVA 5GHXA 3ZG8B 5FSRA 2XQZA 2E8IA 4KZ4A 4Y7PA 1RGZA 4OP8A 1TDLA 1LL5A 2ZQ7A 3LO7A 3ZG0A 1K6RA 4MEZA 3IHAA 1YT4A 3P98A 2X02A 5M1AA 2J8YA 3S22A 5JYOA 4DF6A 2V1ZA 4E6XA 3LY4A 1RCJA 2Y2QA 1K57A 5EUAA 2C6WB 3UN7A 4KQOA 2XK1A 1FCMA 2XR0A 5DVAA 3WS1A 3AGFA 4ZBEA 4UAAA 3HLEA 4KQRA 2ZC7A 2WGIA 3FV7A 1KGEA 1FSWA 5EVLA 4OPRA 5G18A 1GHPA 2WGVA 3HLWA 3WS5A 2OV5A 3IF5A 4KZ7A 3GVBA 5EECA 4U3TA 3WS4A 5F1FA 5HAQA 1CI9A 3ZGAB 4QJGA 4Y0TA 4LCMA 4A5RA 4FD8A 4GKUA 3V39A 2Y2LA 1MKIA 3G2ZA 4EBPA 1ERQA 3C4PA 4MBKA 1L2SA 1PZPA 5E2GA 2P74A 3VFHA 4N9KA 1SDEA 3TSGA 3FKWA 4IVIA 5CRFA 3HVFA 3V3SA 4WYYA 1H8YA 2H10A 3V3RA 2HP5A 4JXWA 4LV0A 4M3KA 5CXWA 1QMFA 3NY4A 4E3KA 3HL9A 1XP4A 3VP0A 1XGJA 4YFMA 1AXBA 1NRFA 2V20A 3VOZA 4LV1A 4UA6A 3S1YA 3SOIA 5L2FA 1KGGA 2EX6A 1YM1A 2J9OA 4HEFA 4E3LA 2ZMAA 1YMXA 2A49A 4OP5A 2OSUA 3C5AA 5DTKA 3N8SA 4OH0A 5FI7A 5EOOA 3W4OA 1LI9A 3P09A 2PU4A 2HDUA 5CHJA 3ZHHA 3IXGA 4D2OA 2Y2KA 1VQQA 1L0FA 5GLDA 3OZHA 4Q8IA 1K4EA 1ESUA 2R9WA 1PI5A 4RVAA 4PM5A 3MKFA 4QY5A 2JC7A 3CJMA 1WYCA 2EX8A 4JLFA 3MKEA 3PBOA 3Q07A 1GHMA 2FFYA 2Y2GA 4ZTKA 4KZAA 1SHVA 5HFOA 1YLTA 2X71A 1KVMA 2BG1A 1JWVA 3UDXA 2WK0A 4C3QA 3D4FA 4DE3A 4EV4A 3GQZA 5FQ9A 1XPBA 4K91A 5DTSA 5FQMA 2JBFA 1BLPA 3N8LA 4EUZA 1MWRA 5KZHA 3NC8A 4N1XA 4RYEA 1CK3A 3E2KA 1YLJA 1U60A 3C7VA 3FKVA 4KQQA 4L0LA 2RCXA 4UA9A 3IWOA 3RJUA 5CEBA 5EVIB 5HARA 3UPNA 2V2FF 1FQGA 3S4XA 4DXCA 1W79A 1TDGA 2WADA 1E3UA 1FCOA 3A3JA 4X53A 3RXXA 4HBTA 1K38A 3DW0A 3ZG5A 3ZFZA 4PMAA 4OOYA 4F94A 1BSGA 2Z2LB 1HZOA 3FWLA 1H5XA 2JCHA 5BOHA 4QHCA 5HL1A 2Y91A 3IXBA 2X01A 4FSFA 2WAFA 3PBSA 4N92A 4PPRA 4S2PA 3UDIA 3UO9A 4X69A 3TG9A 3DWKA 4JXVA 3IF6B 5E2FA 3HBRA 3M6HA 5DF7A 4KZ3A 4OQIA 5FQKA 3N4IA 4S2OA 3UE0A 4GNUA 3W4PA 1FR1A 1PI4A 3MZDA 3PBTA 1NZOA 4GD8A 4DE2A 1S6RA 4WZ5C 1ZKJA 3G2YA 3WS2A 1DJBA 3IXDA 2ZLYA 2Z2MB 5KSHA 4R3BA 3QNCA 4GDBA 3BLSA 4E3IA 5DF8A 1K4FA 4U0TA 4Y0OA 4XUXA 1BT5A 3EQUA 1GCEA 1PW8A 1K54C 5EVIC 3O3VA 2Y2JA 3PAEA 3BFFA 1YMSA 1IYSA 2Y4AA 4FH2A 1H8ZA 4P6BA 4X68A 3WRZA 1BUEA 1G6AA 1XXMA 4K0WA 3G4PA 4S2NC 3I7JA 2IWBA 3BFGA 3VP3A 1L0GA 3SS3A 1NYMA 3IT9A 3O86A 1MXOA 1XKZA 2IWCA 4NK3A 3SH8A 4OQ0A 2DCFA 2C5WB 2H5SA 3E2LA 3Q7ZA 1JVJA 4JBFA 1PYYA 4HESA 4WZ5A 2EFUA 4S2JA 3IF6C 2OLVA 1IELA 4IEDA 5KMWA 4PM9A 4JF4A 4MNRA 2XD1A 2HDQA 4JKTA 4RX2A 1L0DA 1K54A 5EVIA 1IYPA 3BECA 3PBQA 3UPOA 3OCLA 1ESIA 2EXAA 2WAEA 3UE3A 2R9XA 4GB7A 1MBLA 3IH8A 1LL9A 4S2NA 4LENA 1RGYA 3BFCA 1BLCA 2WKIA 3NBLA 1Z6FA 4OVDA 3G30A 3BRMA 1ZG6A 5FAPA 3Q7VB 3HUNA 5E2HA 5AQ9A 1SKFA 4S2MA 3GTCA 1K56A 1GA0A 1NXYA 4N9LA 4S2KA 3NCKA 3IF6A 4GOGA 5CTMA 4KG2A 5AQBA 2Y59A 4GN2A 4WMCD 4WELA 4X56A 1TVFA 2EX2A 4U0XA 4OLGA 5FATA 3IWQA 3VSLA 2H0YA 3HUOA 1MPLA 4P0MA 4X6TA 1HVBA 5GHYA 2ZJ9A 5CECA 1Q2QA 1NY0A 1IYOA 3MZFA 5FI6A 2Y2IA 1BLHA 5F1GA 4DXBA 5CGWA 1N9BA 3BFDA 1KVLA 1JWPA 1I2WA 1G68A 4EBLA 3GSGA 3WWXA 1FOFA 1MY8A 4B4XA 5GLCA 3HLDA 3RXWA 4O7DA 1EWZA 5E2EA 3HLFA 1CEFA 4HBUA 4JF5A 3VOYA 1SCWA 4IVKA 3A3FA 1XGIA 3BLMA 1W8QA 3C7UA 3GRJA 2UWXA 3M2KA 3PBNA 4IBRA 4KENB 2ZM0A 4C75A 2ZC6B 5D3OA 4BLMA 3V50A 4E3JA 4R3JA 1JTDA 3N6IA 1DJCA 1XX2A 5GHZA 3ZG9B 5A91A 3M6BA 2XDMA 4GZBA 4WEKA 4EBNA 5CGSA 3VFFA 4P87A 3WRTA 1Q2PA 3NDEA 1ZG4A 4BD1A 3NDGA 5DTTA 1ALQA 2G2UA 2WUQA 4LV3A 1I2SA 3O88A 3ZG7B 4NETA 5A93A 2HDSA 1PIOA 4LCLA 3IQAA 3SS5A 3W8KA 4KG5A 3UE1A 3CMZA 1OMEA 2XD5A 2ZC4B 2WYXA 1TEMA 4DE1A 4C6YA 4RX3A 5FQJA 3O87A 3B3XA 2RL3A 3G34A 1YLWA 1XA7A 3HLCA 3Q7VA 4FCFA 5F83A 5FI2A 4DE0A 3AGDA 3LCEA 4QU3A 3DTMA 2PU2A 5EOEA 4N1HA 1HD8A 3CG5A 1MWTA 1LLBA 4CPKA 3N7WA 4R4RA 2EX9A 2Y2NA 3QNBA 5F82A 1EI5A 4OPZA 1EROA 4GDNA 1KDSA 1NJ4A 4BL2A 1GHIA 5FAQA 4WM9A 2OLUA 3AGEA 4KZBA 4B88A 4BENA 3V5MA 4PM6A 4PM7A 4KG6A 1NZUA 1KE0A 3OC2A 2P9VB 2J7VA 5CHUA 4EWFA 5FQIA 3IH9A 1C3BA 3GMWA 4PM8A 2ZD8A 4OPQA 4Z9QA 2DRWA 2G2WA 3NI9A 1E4DA 1SDNA 1O7EA 2XEPA 5CERA 3DWZA 5FA7A 3UNWA 4CJNA 4R1GA 3MXSA 5FASA 2IWDA 2Y2MA 1M40A 4WZ4A 4KZ5A 5GLAA 1J9MA 1BZAA 2J9PA 3PBRA 4QB8A 1LHYA 2HDRA 4ZDXA 1ES4A 3ZVWA 4GD6A 5E43A 3LY3A 3OPRA 3WS0A 4OQGA 3ZNYA 1CI8A 4OLDA 4QD4A 4DDSA 1K6SA 1ES2A 3UPPA 3UDFA 3IWIA 4E3NA 1WE4A 3A3EA 5M18A 1CEGA 4JPMA 2WZZA 3HUMA 2Y55A 5A90A 2XH9A 3Q81A 4E6WA 2XGNA 1W8YA 5FQQA 5FAOA 3ZDJA 3QHYA 1JWZA 1PWDA 2WZXA 2XLNA 4KZ6A 1MWUA 3VP2A 5CTNA 1IEMA 4E3OA 4ZJ1A 3TOIA 2QZ6A 3HLGA 3ITBA 5DF9A 3N8RA 5HW3A 4MBFA 4EQIA 5AQAA 3ITAA 3ZVTA 1KGFA 3VP1A 5M19A 2ZC5B 1E3UD 1M6KA 3W4QA 2BLSA 3MZEA 1ZC2A 1YQSA 4MLLA 5AQ7A 3VP4A 1PW1A 3BM6A 5KSCA 2PBYA 5EPHA 5U47A 3OPLA 3OPHA 5GL9A 3Q1FA 3A3DA 4H8RA 4QY6A 1YLZA 1ERMA 4YINA 1FR6A 3ZNTA 4XUZA 5CGXA 4RA7A 1Y54A 2ZM2A 1E25A 2JE5A 3HLBA 4DRTA 4ZAMA 4BL3A 2WGWB 1LI0A 5TR7A 2XFTA 2ZQ9A 1BULA 2Y2PA 2P9VA 2ZQ8A 5CHMA 1PWCA 1ONGA 4IBXA 4OKPA 5J8XA 2XF3A 1ES5A 2HP6A 1YLPA 3ISGA 5HX9A 2HP9A 2FFFB 3HREA 1S0WA 3MFDA 1DY6A 1KDWA 2ZQAA 2ZC3B 5TGFA 1BTLA 2Y2OA 3G35A 2VGKA 1K55C 4R23A 1BLSA 1XA1A 3Q82A 5CEDA 3PAGA 5FDHA 1IKIA 1W7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GLB A;  3SH9 A;  2A3U A;  1ES3 A;  4P85 A;  2QPN A;  3GV9 A;  1DJA A;  4UHU A;  2GDN A;  4OQH A;  2XFS A;  1FCN A;  4JF6 A;  4S2L A;  3BEB A;  1GA9 A;  4ID4 A;  4S2I A;  2ZQC A;  3FYZ A;  4DDY A;  4OOL A;  4FH4 A;  5EE8 A;  3VSK A;  4XXR A;  2HPB A;  1IYQ A;  2QMI A;  3VMA A;  3MXR A;  1HTZ A;  1WYB A;  2EFX A;  4E3M A;  1K55 A;  1W5D A;  4B4Z A;  2WKE A;  4LV2 A;  3OCN A;  5EVI D;  2ZM8 A;  3BYD A;  5HAI A;  3SH7 A;  5JYP A;  1FSY A;  4BJP A;  1IKG A;  2DNS A;  3PTE A;  1ONH A;  3A3I A;  1PWG A;  4R4S A;  3CZD A;  4JXG A;  4OOM A;  3LEZ A;  3NIA A;  3ZCZ A;  2H0T A;  1JTG A;  4OON A;  1QME A;  3FZC A;  1K25 A;  3IHB A;  5I94 A;  4JXS A;  1YLY A;  1I5Q A;  3IXH A;  4BQM A;  2B5R A;  1VM1 A;  1K56 D;  3M2J A;  2WKH A;  4MBH A;  3UY6 A;  3GR2 A;  4Y0U A;  3BFE A;  3EQV A;  4UA7 A;  5A92 A;  4KZ9 A;  1NYY A;  2WGW A;  2I72 A;  4ZJ3 A;  4KZ8 A;  1N4O A;  1K57 C;  1RP5 A;  4R0Q A;  4WEJ A;  4DKI A;  2ZQD A;  2Q9M A;  3C4O A;  3OPP A;  5TFQ A;  3SS4 A;  3JYI A;  3G31 A;  4WMC A;  4BD0 A;  2Q9N A;  1KE3 A;  2VGJ A;  2EXB A;  4X55 A;  4WBG A;  5HAP A;  4K0X A;  1O07 A;  1KE4 A;  4OPY A;  1MWS A;  2CC1 A;  4ZJ2 A;  3MBZ A;  1L0E A;  1PZO A;  2Y2H A;  3G32 A;  5IHV A;  5GHX A;  3ZG8 B;  5FSR A;  2XQZ A;  2E8I A;  4KZ4 A;  4Y7P A;  1RGZ A;  4OP8 A;  1TDL A;  1LL5 A;  2ZQ7 A;  3LO7 A;  3ZG0 A;  1K6R A;  4MEZ A;  3IHA A;  1YT4 A;  3P98 A;  2X02 A;  5M1A A;  2J8Y A;  3S22 A;  5JYO A;  4DF6 A;  2V1Z A;  4E6X A;  3LY4 A;  1RCJ A;  2Y2Q A;  1K57 A;  5EUA A;  2C6W B;  3UN7 A;  4KQO A;  2XK1 A;  1FCM A;  2XR0 A;  5DVA A;  3WS1 A;  3AGF A;  4ZBE A;  4UAA A;  3HLE A;  4KQR A;  2ZC7 A;  2WGI A;  3FV7 A;  1KGE A;  1FSW A;  5EVL A;  4OPR A;  5G18 A;  1GHP A;  2WGV A;  3HLW A;  3WS5 A;  2OV5 A;  3IF5 A;  4KZ7 A;  3GVB A;  5EEC A;  4U3T A;  3WS4 A;  5F1F A;  5HAQ A;  1CI9 A;  3ZGA B;  4QJG A;  4Y0T A;  4LCM A;  4A5R A;  4FD8 A;  4GKU A;  3V39 A;  2Y2L A;  1MKI A;  3G2Z A;  4EBP A;  1ERQ A;  3C4P A;  4MBK A;  1L2S A;  1PZP A;  5E2G A;  2P74 A;  3VFH A;  4N9K A;  1SDE A;  3TSG A;  3FKW A;  4IVI A;  5CRF A;  3HVF A;  3V3S A;  4WYY A;  1H8Y A;  2H10 A;  3V3R A;  2HP5 A;  4JXW A;  4LV0 A;  4M3K A;  5CXW A;  1QMF A;  3NY4 A;  4E3K A;  3HL9 A;  1XP4 A;  3VP0 A;  1XGJ A;  4YFM A;  1AXB A;  1NRF A;  2V20 A;  3VOZ A;  4LV1 A;  4UA6 A;  3S1Y A;  3SOI A;  5L2F A;  1KGG A;  2EX6 A;  1YM1 A;  2J9O A;  4HEF A;  4E3L A;  2ZMA A;  1YMX A;  2A49 A;  4OP5 A;  2OSU A;  3C5A A;  5DTK A;  3N8S A;  4OH0 A;  5FI7 A;  5EOO A;  3W4O A;  1LI9 A;  3P09 A;  2PU4 A;  2HDU A;  5CHJ A;  3ZHH A;  3IXG A;  4D2O A;  2Y2K A;  1VQQ A;  1L0F A;  5GLD A;  3OZH A;  4Q8I A;  1K4E A;  1ESU A;  2R9W A;  1PI5 A;  4RVA A;  4PM5 A;  3MKF A;  4QY5 A;  2JC7 A;  3CJM A;  1WYC A;  2EX8 A;  4JLF A;  3MKE A;  3PBO A;  3Q07 A;  1GHM A;  2FFY A;  2Y2G A;  4ZTK A;  4KZA A;  1SHV A;  5HFO A;  1YLT A;  2X71 A;  1KVM A;  2BG1 A;  1JWV A;  3UDX A;  2WK0 A;  4C3Q A;  3D4F A;  4DE3 A;  4EV4 A;  3GQZ A;  5FQ9 A;  1XPB A;  4K91 A;  5DTS A;  5FQM A;  2JBF A;  1BLP A;  3N8L A;  4EUZ A;  1MWR A;  5KZH A;  3NC8 A;  4N1X A;  4RYE A;  1CK3 A;  3E2K A;  1YLJ A;  1U60 A;  3C7V A;  3FKV A;  4KQQ A;  4L0L A;  2RCX A;  4UA9 A;  3IWO A;  3RJU A;  5CEB A;  5EVI B;  5HAR A;  3UPN A;  2V2F F;  1FQG A;  3S4X A;  4DXC A;  1W79 A;  1TDG A;  2WAD A;  1E3U A;  1FCO A;  3A3J A;  4X53 A;  3RXX A;  4HBT A;  1K38 A;  3DW0 A;  3ZG5 A;  3ZFZ A;  4PMA A;  4OOY A;  4F94 A;  1BSG A;  2Z2L B;  1HZO A;  3FWL A;  1H5X A;  2JCH A;  5BOH A;  4QHC A;  5HL1 A;  2Y91 A;  3IXB A;  2X01 A;  4FSF A;  2WAF A;  3PBS A;  4N92 A;  4PPR A;  4S2P A;  3UDI A;  3UO9 A;  4X69 A;  3TG9 A;  3DWK A;  4JXV A;  3IF6 B;  5E2F A;  3HBR A;  3M6H A;  5DF7 A;  4KZ3 A;  4OQI A;  5FQK A;  3N4I A;  4S2O A;  3UE0 A;  4GNU A;  3W4P A;  1FR1 A;  1PI4 A;  3MZD A;  3PBT A;  1NZO A;  4GD8 A;  4DE2 A;  1S6R A;  4WZ5 C;  1ZKJ A;  3G2Y A;  3WS2 A;  1DJB A;  3IXD A;  2ZLY A;  2Z2M B;  5KSH A;  4R3B A;  3QNC A;  4GDB A;  3BLS A;  4E3I A;  5DF8 A;  1K4F A;  4U0T A;  4Y0O A;  4XUX A;  1BT5 A;  3EQU A;  1GCE A;  1PW8 A;  1K54 C;  5EVI C;  3O3V A;  2Y2J A;  3PAE A;  3BFF A;  1YMS A;  1IYS A;  2Y4A A;  4FH2 A;  1H8Z A;  4P6B A;  4X68 A;  3WRZ A;  1BUE A;  1G6A A;  1XXM A;  4K0W A;  3G4P A;  4S2N C;  3I7J A;  2IWB A;  3BFG A;  3VP3 A;  1L0G A;  3SS3 A;  1NYM A;  3IT9 A;  3O86 A;  1MXO A;  1XKZ A;  2IWC A;  4NK3 A;  3SH8 A;  4OQ0 A;  2DCF A;  2C5W B;  2H5S A;  3E2L A;  3Q7Z A;  1JVJ A;  4JBF A;  1PYY A;  4HES A;  4WZ5 A;  2EFU A;  4S2J A;  3IF6 C;  2OLV A;  1IEL A;  4IED A;  5KMW A;  4PM9 A;  4JF4 A;  4MNR A;  2XD1 A;  2HDQ A;  4JKT A;  4RX2 A;  1L0D A;  1K54 A;  5EVI A;  1IYP A;  3BEC A;  3PBQ A;  3UPO A;  3OCL A;  1ESI A;  2EXA A;  2WAE A;  3UE3 A;  2R9X A;  4GB7 A;  1MBL A;  3IH8 A;  1LL9 A;  4S2N A;  4LEN A;  1RGY A;  3BFC A;  1BLC A;  2WKI A;  3NBL A;  1Z6F A;  4OVD A;  3G30 A;  3BRM A;  1ZG6 A;  5FAP A;  3Q7V B;  3HUN A;  5E2H A;  5AQ9 A;  1SKF A;  4S2M A;  3GTC A;  1K56 A;  1GA0 A;  1NXY A;  4N9L A;  4S2K A;  3NCK A;  3IF6 A;  4GOG A;  5CTM A;  4KG2 A;  5AQB A;  2Y59 A;  4GN2 A;  4WMC D;  4WEL A;  4X56 A;  1TVF A;  2EX2 A;  4U0X A;  4OLG A;  5FAT A;  3IWQ A;  3VSL A;  2H0Y A;  3HUO A;  1MPL A;  4P0M A;  4X6T A;  1HVB A;  5GHY A;  2ZJ9 A;  5CEC A;  1Q2Q A;  1NY0 A;  1IYO A;  3MZF A;  5FI6 A;  2Y2I A;  1BLH A;  5F1G A;  4DXB A;  5CGW A;  1N9B A;  3BFD A;  1KVL A;  1JWP A;  1I2W A;  1G68 A;  4EBL A;  3GSG A;  3WWX A;  1FOF A;  1MY8 A;  4B4X A;  5GLC A;  3HLD A;  3RXW A;  4O7D A;  1EWZ A;  5E2E A;  3HLF A;  1CEF A;  4HBU A;  4JF5 A;  3VOY A;  1SCW A;  4IVK A;  3A3F A;  1XGI A;  3BLM A;  1W8Q A;  3C7U A;  3GRJ A;  2UWX A;  3M2K A;  3PBN A;  4IBR A;  4KEN B;  2ZM0 A;  4C75 A;  2ZC6 B;  5D3O A;  4BLM A;  3V50 A;  4E3J A;  4R3J A;  1JTD A;  3N6I A;  1DJC A;  1XX2 A;  5GHZ A;  3ZG9 B;  5A91 A;  3M6B A;  2XDM A;  4GZB A;  4WEK A;  4EBN A;  5CGS A;  3VFF A;  4P87 A;  3WRT A;  1Q2P A;  3NDE A;  1ZG4 A;  4BD1 A;  3NDG A;  5DTT A;  1ALQ A;  2G2U A;  2WUQ A;  4LV3 A;  1I2S A;  3O88 A;  3ZG7 B;  4NET A;  5A93 A;  2HDS A;  1PIO A;  4LCL A;  3IQA A;  3SS5 A;  3W8K A;  4KG5 A;  3UE1 A;  3CMZ A;  1OME A;  2XD5 A;  2ZC4 B;  2WYX A;  1TEM A;  4DE1 A;  4C6Y A;  4RX3 A;  5FQJ A;  3O87 A;  3B3X A;  2RL3 A;  3G34 A;  1YLW A;  1XA7 A;  3HLC A;  3Q7V A;  4FCF A;  5F83 A;  5FI2 A;  4DE0 A;  3AGD A;  3LCE A;  4QU3 A;  3DTM A;  2PU2 A;  5EOE A;  4N1H A;  1HD8 A;  3CG5 A;  1MWT A;  1LLB A;  4CPK A;  3N7W A;  4R4R A;  2EX9 A;  2Y2N A;  3QNB A;  5F82 A;  1EI5 A;  4OPZ A;  1ERO A;  4GDN A;  1KDS A;  1NJ4 A;  4BL2 A;  1GHI A;  5FAQ A;  4WM9 A;  2OLU A;  3AGE A;  4KZB A;  4B88 A;  4BEN A;  3V5M A;  4PM6 A;  4PM7 A;  4KG6 A;  1NZU A;  1KE0 A;  3OC2 A;  2P9V B;  2J7V A;  5CHU A;  4EWF A;  5FQI A;  3IH9 A;  1C3B A;  3GMW A;  4PM8 A;  2ZD8 A;  4OPQ A;  4Z9Q A;  2DRW A;  2G2W A;  3NI9 A;  1E4D A;  1SDN A;  1O7E A;  2XEP A;  5CER A;  3DWZ A;  5FA7 A;  3UNW A;  4CJN A;  4R1G A;  3MXS A;  5FAS A;  2IWD A;  2Y2M A;  1M40 A;  4WZ4 A;  4KZ5 A;  5GLA A;  1J9M A;  1BZA A;  2J9P A;  3PBR A;  4QB8 A;  1LHY A;  2HDR A;  4ZDX A;  1ES4 A;  3ZVW A;  4GD6 A;  5E43 A;  3LY3 A;  3OPR A;  3WS0 A;  4OQG A;  3ZNY A;  1CI8 A;  4OLD A;  4QD4 A;  4DDS A;  1K6S A;  1ES2 A;  3UPP A;  3UDF A;  3IWI A;  4E3N A;  1WE4 A;  3A3E A;  5M18 A;  1CEG A;  4JPM A;  2WZZ A;  3HUM A;  2Y55 A;  5A90 A;  2XH9 A;  3Q81 A;  4E6W A;  2XGN A;  1W8Y A;  5FQQ A;  5FAO A;  3ZDJ A;  3QHY A;  1JWZ A;  1PWD A;  2WZX A;  2XLN A;  4KZ6 A;  1MWU A;  3VP2 A;  5CTN A;  1IEM A;  4E3O A;  4ZJ1 A;  3TOI A;  2QZ6 A;  3HLG A;  3ITB A;  5DF9 A;  3N8R A;  5HW3 A;  4MBF A;  4EQI A;  5AQA A;  3ITA A;  3ZVT A;  1KGF A;  3VP1 A;  5M19 A;  2ZC5 B;  1E3U D;  1M6K A;  3W4Q A;  2BLS A;  3MZE A;  1ZC2 A;  1YQS A;  4MLL A;  5AQ7 A;  3VP4 A;  1PW1 A;  3BM6 A;  5KSC A;  2PBY A;  5EPH A;  5U47 A;  3OPL A;  3OPH A;  5GL9 A;  3Q1F A;  3A3D A;  4H8R A;  4QY6 A;  1YLZ A;  1ERM A;  4YIN A;  1FR6 A;  3ZNT A;  4XUZ A;  5CGX A;  4RA7 A;  1Y54 A;  2ZM2 A;  1E25 A;  2JE5 A;  3HLB A;  4DRT A;  4ZAM A;  4BL3 A;  2WGW B;  1LI0 A;  5TR7 A;  2XFT A;  2ZQ9 A;  1BUL A;  2Y2P A;  2P9V A;  2ZQ8 A;  5CHM A;  1PWC A;  1ONG A;  4IBX A;  4OKP A;  5J8X A;  2XF3 A;  1ES5 A;  2HP6 A;  1YLP A;  3ISG A;  5HX9 A;  2HP9 A;  2FFF B;  3HRE A;  1S0W A;  3MFD A;  1DY6 A;  1KDW A;  2ZQA A;  2ZC3 B;  5TGF A;  1BTL A;  2Y2O A;  3G35 A;  2VGK A;  1K55 C;  4R23 A;  1BLS A;  1XA1 A;  3Q82 A;  5CED A;  3PAG A;  5FDH A;  1IKI A;  1W7F A; 
#chains in the Genus database with same CATH topology
 1H3Q A;  3DAV A;  3LIB A;  2A3U A;  4XT2 B;  4HJ6 A;  4P85 A;  3F1N A;  3UB7 A;  3GV9 A;  4S2L A;  4ID4 A;  2ZQC A;  5DFY A;  5EM0 A;  1IYQ A;  3MXR A;  1WYB A;  2VGL M;  3IS2 A;  1K55 A;  4B4Z A;  2WKE A;  3MQO A;  2JN7 A;  4F3L B;  1FSY A;  2V1A A;  2PHY A;  2DNS A;  1ONH A;  2VGL S;  4OOM A;  3LEZ A;  1JTG A;  1K25 A;  3IHB A;  3BY9 A;  2W1T A;  5MC7 A;  1YLY A;  1I5Q A;  1DP8 A;  2B5R A;  1VM1 A;  4MBH A;  3P7N A;  1NYY A;  2B18 A;  2VV7 A;  4KZ8 A;  5HPF A;  4DKI A;  3OPP A;  2VGJ A;  1O07 A;  4OPY A;  1MWS A;  2CC1 A;  3CLO A;  4Q0J A;  3BW6 A;  3SZT A;  5IHV A;  4BWI A;  1TDL A;  2J3T C;  4MEZ A;  4XT2 A;  4B9O A;  2J8Y A;  3T4Q A;  2O9C A;  3T4S A;  2Y2Q A;  5EUA A;  3PYP A;  2C6W B;  1XFN A;  2VX8 A;  5DVA A;  3AGF A;  4ZBE A;  3HLE A;  3PXP A;  4PAU A;  4OPR A;  5G18 A;  3KSG A;  4F3L A;  3WS4 A;  3E4O A;  1W63 Q;  1CI9 A;  4WF0 A;  2WKQ A;  3C4P A;  5E2G A;  3QP4 A;  1SDE A;  3FKW A;  5CRF A;  3V3R A;  4JXW A;  1WA9 A;  4E3K A;  1XP4 A;  1T19 A;  2V20 A;  4UA6 A;  2G7U A;  4GW9 A;  4GS9 B;  2Y79 A;  2PR5 A;  3N8S A;  3S7N A;  3W4O A;  3ICY A;  1ZTU A;  5F6A A;  4NXB A;  1PI5 A;  4QY5 A;  3KSH A;  4JLF A;  3Q07 A;  1GHM A;  1AWI A;  1JWV A;  2WKR A;  3UDX A;  3LEQ A;  4EV4 A;  3IX8 A;  1MWR A;  4EQ1 A;  3RTY A;  4LRZ E;  4Q0H A;  3C7V A;  3QP6 A;  4UA9 A;  5CEB A;  3UPN A;  4EUV A;  1UGU A;  4HIA A;  2QKP A;  1TDG A;  3RXX A;  4BBV A;  5DJT A;  3ZG5 A;  4OOY A;  4F94 A;  3UB8 A;  3FWL A;  2J3W A;  1J3W A;  4FSF A;  4N92 A;  1OJG A;  2J80 A;  4S2P A;  3UDI A;  4X69 A;  4GS9 A;  4GNU A;  2JKT M;  2JKR M;  4GD8 A;  3TJZ C;  1ZKJ A;  3G2Y A;  3WS2 A;  2ZLY A;  3BQA A;  4I3J A;  3BLS A;  5DF8 A;  4G3K A;  4K08 A;  3LR0 A;  1GCE A;  1K54 C;  1XJ2 A;  5EVE A;  3PAE A;  5F68 A;  4HJ3 A;  2Y4A A;  4FH2 A;  5HDC A;  4X68 A;  3WRZ A;  1G6A A;  1V9Z A;  4RQ9 A;  4Q0I A;  3I7J A;  2QWS A;  3KX0 X;  3UME A;  3IT9 A;  4NK3 A;  2C5W B;  3E2L A;  1KOU A;  1L0D A;  1K54 A;  5K5B A;  2R9X A;  2W27 A;  3C38 A;  1BLC A;  3G30 A;  3HUN A;  5AQ9 A;  4S2M A;  4YWZ A;  1N9N A;  3F1P B;  4GOG A;  3H7W B;  5FEF A;  5AQB A;  2JHE A;  4QWO A;  4OLG A;  3VSL A;  3CI6 A;  3NOP C;  4Z1W A;  4GJ4 A;  2HGV A;  5F1G A;  4JGR A;  3BFD A;  1KVL A;  1I2W A;  1T18 A;  4B4X A;  3K3C A;  4O7D A;  1EWZ A;  4ZRR A;  2H28 A;  4IVK A;  3A3F A;  4HP4 A;  1W8Q A;  2W3G A;  3DBA A;  3PBN A;  4KEN B;  4Y17 A;  2ZC6 B;  4BLM A;  1IOU A;  3B47 A;  5GHZ A;  3UB9 A;  1JNU A;  2O99 A;  3VFF A;  4JGQ A;  2VV8 A;  1ZG4 A;  5DTT A;  2G2U A;  4LV3 A;  2WUQ A;  3O88 A;  4R6L A;  5I5L A;  5J7E A;  4LCL A;  2HJ9 C;  3IQA A;  5C5K A;  4KG5 A;  1OME A;  3R7W B;  3GEC A;  3HCY A;  4I5S A;  1XJ4 A;  4C6Y A;  5FQJ A;  5FI2 A;  4DE0 A;  3AGD A;  4QU3 A;  2PU2 A;  1HD8 A;  3F1P A;  1OTB A;  1SKO B;  3H7W A;  2Y2N A;  1ERO A;  4BL2 A;  4NXF A;  3AGE A;  4BEN A;  5IS1 A;  1NZU A;  4Y15 A;  3UB5 P;  2P9V B;  5HD5 A;  1BYW A;  5HDD A;  2ZD8 A;  3T1Q B;  4OPQ A;  2G2W A;  2Q0O A;  1E4D A;  4G3V A;  5CER A;  3T1X A;  1CQA A;  1TS7 A;  4WZ4 A;  1J9M A;  2J9P A;  4QB8 A;  1LHY A;  1K6S A;  3F1O B;  3UDF A;  4E3N A;  3A3E A;  3CWF A;  4JPM A;  2NUP C;  3K3D A;  2XH9 A;  3L9K A;  1W8Y A;  5FAO A;  1TS0 A;  3BY8 A;  3ZDJ A;  1T1C A;  1PWD A;  2WZX A;  4QPR A;  5CTN A;  5DF9 A;  5HW3 A;  3R7W A;  3ITA A;  3ZVT A;  5M19 A;  5EFW A;  2BLS A;  1PW1 A;  2AVX A;  3OPL A;  1SKO A;  2QJ7 A;  1FR6 A;  4Y3I A;  5CGX A;  3CIT A;  4RA7 A;  1E25 A;  2JE5 A;  2PDR A;  1OTD A;  5KIZ A;  1K0K A;  2ZQ9 A;  2Y2P A;  2P9V A;  4OKP A;  1A0K A;  4IBX A;  4NKP A;  1ES5 A;  5HX9 A;  2FFF B;  1S0W A;  1DY6 A;  2ZQA A;  3KYE A;  1XA1 A;  1S67 L;  5CED A;  3OOV A;  3PAG A;  5DJU A;  5FDH A;  3LR4 A;  5GLB A;  3SH9 A;  4BBT A;  3F1O A;  2XFS A;  4MN6 A;  4XXR A;  2HPB A;  5J4E A;  3VMA A;  1HTZ A;  2ZBB A;  3DTK A;  1P9W A;  3NEC A;  3NOT C;  3T4O A;  2V0W A;  4LV2 A;  5HAI A;  3SW1 A;  4EEU A;  4BJP A;  1IKG A;  4NEE D;  3PTE A;  2OAP 1;  2OAQ 1;  4HH3 A;  3LFV A;  1UWN X;  4OON A;  1QME A;  4JXS A;  4BMW A;  4BQM A;  2PRF A;  2WKH A;  4I39 A;  4Y0U A;  3EQV A;  4ZJ3 A;  4WEJ A;  1N4O A;  1K57 C;  3HJI A;  3C4O A;  3EWK A;  3GDI A;  3JYI A;  3SS4 A;  4BD0 A;  2EXB A;  4Y5F A;  2UV0 E;  5HAP A;  4K0X A;  3TW8 A;  1KE4 A;  3FPW A;  4PKY G;  1L0E A;  1PZO A;  2ZOI A;  5GHX A;  5FSR A;  2E8I A;  1GSX A;  4KZ4 A;  1RGZ A;  4OP8 A;  2ZQ7 A;  3LO7 A;  1LL8 A;  5M1A A;  2V1Z A;  1K57 A;  1OT6 A;  3T4J A;  4FOF A;  3KSI A;  2XR0 A;  3WS1 A;  2VZW A;  4UAA A;  4ETX A;  2ZC7 A;  2WGI A;  4MCW A;  4DJ3 A;  3T4L A;  3WS5 A;  2OV5 A;  3IF5 A;  5EEC A;  5F1F A;  1EW0 A;  5L10 A;  5HAQ A;  4HI4 A;  4QJG A;  4LCM A;  1S1Z A;  4FD8 A;  5G4Y A;  3V39 A;  3G2Z A;  4EBP A;  3TSG A;  3HVF A;  3V3S A;  4WYY A;  2H10 A;  4EXO A;  4LV0 A;  5CXW A;  2V8C A;  4YFM A;  1AXB A;  1FIL A;  3C5A A;  5FI7 A;  1LI9 A;  3P09 A;  2OOL A;  3IXG A;  2Y2K A;  1T1B A;  3OZH A;  4Q8I A;  2R9W A;  4PM5 A;  2JC7 A;  1WYC A;  3EGD C;  1OTE A;  2Y2G A;  4ZTK A;  4KZA A;  1SHV A;  1PNE A;  4EEP A;  1KVM A;  2WK0 A;  4C3Q A;  1F2K A;  3D4F A;  4DE3 A;  3O5Y A;  3PHY A;  1XPB A;  5DTS A;  3LIF A;  4O8G A;  5KZH A;  3NC8 A;  4N1X A;  4RYE A;  3FKV A;  1YLJ A;  1U60 A;  4KQQ A;  3IX4 A;  3C30 A;  5HAR A;  2FH5 A;  2V2F F;  3MMH A;  1W79 A;  4MN5 A;  2WAD A;  3L7H A;  1D7E A;  3A3J A;  4PMA A;  1N9O A;  2Z2L B;  1HZO A;  1H5X A;  4IUH A;  2Y91 A;  2WAF A;  3S7O A;  4JXV A;  5DF7 A;  2EWV A;  4OQI A;  5HDS A;  3PBT A;  4LGW A;  1NZO A;  4ME4 A;  3NOU C;  2Z2M B;  5KSH A;  4R3B A;  3QNC A;  2QJ5 A;  3D3O A;  1K4F A;  3BQ8 A;  1BT5 A;  4UQI M;  1YMS A;  4P6B A;  4LLO B;  2IWB A;  4MN7 A;  3VP3 A;  4UQI S;  1NYM A;  3O86 A;  4G3W A;  1XKZ A;  2IWC A;  3SH8 A;  3U2A A;  1PYY A;  4HES A;  1S4R A;  2OLV A;  4IUK A;  4IED A;  3LR3 A;  4PM9 A;  1S66 L;  2XD1 A;  2ACG A;  4JKT A;  4RX2 A;  1F9I A;  2O9B A;  1IYP A;  3OCL A;  1FIK A;  2EXA A;  2WAE A;  3IH8 A;  4LEN A;  3BFC A;  2HJE A;  3EEH A;  3Q7V B;  5E2H A;  1K56 A;  3NCK A;  3MS6 A;  3E4Q A;  5L07 A;  4GN2 A;  3RH8 B;  1TVF A;  4U0X A;  2H0Y A;  1MPL A;  5AVF A;  4X6T A;  2ZJ9 A;  1W63 M;  3MZF A;  2WKP A;  5CGW A;  1N9B A;  1STZ A;  3FG8 A;  2I9V A;  4B93 A;  4EBL A;  1MY8 A;  3HLD A;  5E2E A;  3HLF A;  4HBU A;  4JF5 A;  1SCW A;  2PT7 A;  3M2K A;  4IBR A;  3MF0 A;  4C75 A;  3ULF A;  5D3O A;  5FEG A;  3ZG9 B;  5A91 A;  4R3A A;  4IHQ A;  5CGS A;  3WRT A;  4YNR A;  4BD1 A;  1I2S A;  5A93 A;  1LSW A;  3SS5 A;  2XD5 A;  2HF6 A;  4CQH A;  2WYX A;  4PHT A;  4CLC C;  2RL3 A;  3Q7V A;  4FCF A;  3JVV A;  5HD3 A;  5EOE A;  3CG5 A;  3JPU A;  2GX5 A;  3E0Y A;  2Z6D A;  1KDS A;  1NJ4 A;  2OLU A;  3U4L P;  3V5M A;  2VEA A;  4KG6 A;  5CHU A;  3QP2 A;  2L4R A;  3GMW A;  4PM8 A;  4Z9Q A;  3NI9 A;  1SDN A;  3A0S A;  1O7E A;  3UNW A;  4R1G A;  2IWD A;  4DJ2 A;  5GLA A;  1BZA A;  3PBR A;  4ZDX A;  1ES4 A;  3OPR A;  4X1M A;  3WS0 A;  4OQG A;  1CI8 A;  4DDS A;  5M18 A;  1CEG A;  3BJN A;  1D1J A;  2KDK A;  3Q81 A;  3HJK A;  3CUE C;  1MWU A;  3VP2 A;  4ZJ1 A;  4MBF A;  2ZC5 B;  3W4Q A;  3MZE A;  1ZC2 A;  4MLL A;  5AQ7 A;  3BM6 A;  5HWW A;  1YLZ A;  1ERM A;  4YIN A;  2PD7 A;  2KOI A;  4NXG A;  1Y54 A;  4PKY A;  4EW7 A;  4Y13 A;  3B42 A;  2ZQ8 A;  1PWC A;  2HP6 A;  3NUL A;  3ISG A;  2HP9 A;  5DFX A;  1TS6 A;  1VB6 A;  2MJ6 A;  2Y2O A;  3KSF A;  4UEY A;  3Q82 A;  2XRO A;  1ES3 A;  1DJA A;  4OQH A;  1FCN A;  3BEB A;  1GA9 A;  4S2I A;  3FYZ A;  4GCZ A;  4OOL A;  5DKL A;  3VSK A;  2QMI A;  2VA0 A;  2J3T D;  3VE4 A;  2EFX A;  3OCN A;  5JYP A;  3A3I A;  1S4S A;  4MDZ A;  2H0T A;  3FZC A;  5I94 A;  1K56 D;  3M2J A;  4HQA A;  3UY6 A;  4UA7 A;  1H0M A;  1MKM A;  2I72 A;  3S7P A;  1RP5 A;  4R0Q A;  2Q9M A;  5TFQ A;  2INW A;  3G31 A;  4WMC A;  4WBG A;  1MC0 A;  4ZJ2 A;  3MR0 A;  2Y2H A;  4Y7P A;  2V9A A;  1LL5 A;  3IX3 A;  2X02 A;  3S22 A;  5JYO A;  4DF6 A;  4E6X A;  5HPI A;  3TRC A;  1RCJ A;  1OTI A;  3VE3 A;  1DP9 A;  2XK1 A;  1FCM A;  3QP1 A;  4KQD A;  3FV7 A;  1KGE A;  1FSW A;  3DTE A;  5EVL A;  2KLI A;  3HLW A;  4KZ7 A;  3C8C A;  3GVB A;  2GZA A;  1XJ3 A;  3T4T A;  4Y0T A;  1TD5 A;  2Y2L A;  1MKI A;  3UB6 A;  1L2S A;  4N9K A;  1XJ6 A;  4IVI A;  3LIE A;  1H8Y A;  2EA9 A;  3VP0 A;  3OLO A;  1XGJ A;  5HSQ A;  4LPZ A;  1NRF A;  3VOZ A;  3S1Y A;  1KGG A;  2EX6 A;  1NWZ A;  1V9Y A;  1YMX A;  2A49 A;  4I38 A;  2OSU A;  5DTK A;  5EOO A;  2HDU A;  4EES A;  1L0F A;  5GLD A;  1K4E A;  4AFI A;  4RVA A;  1VEU B;  3MKF A;  3CJM A;  4BBU A;  3MKE A;  3PBO A;  5TBM B;  2K31 A;  1DP6 A;  2BG1 A;  3E4P A;  1XFQ A;  5FQ9 A;  2OWJ A;  4K91 A;  5FQM A;  1BLP A;  3N8L A;  4EUZ A;  3NHQ A;  3VOL A;  1Z09 A;  1CK3 A;  3E2K A;  4L0L A;  2RCX A;  3IWO A;  3RJU A;  5EVI B;  2P08 A;  1FQG A;  4DXC A;  2P04 A;  4HBT A;  1K38 A;  4R38 A;  4FTX A;  3DW0 A;  3ZFZ A;  1CJF A;  5HL1 A;  3PBS A;  4IJG A;  3TG9 A;  3DWK A;  5E2F A;  3IF6 B;  4KZ3 A;  3N4I A;  4S2O A;  1PI4 A;  3MZD A;  4WZ5 C;  2OWH A;  4HP9 A;  1LSX A;  3IXD A;  1MZU A;  4GDB A;  4E3I A;  1PW8 A;  1VEU A;  5EVI C;  3O3V A;  1NLZ A;  2PYP A;  5TBM A;  2PR6 A;  2HV1 A;  1XXM A;  4S2N C;  4GHI B;  3BFG A;  3BWL A;  1L0G A;  3SS3 A;  2R78 A;  1MXO A;  2H5S A;  4WZ5 A;  3IF6 C;  2YKH A;  1IEL A;  1OT9 A;  5KMW A;  3EEA A;  5EVI A;  3BEC A;  4O0P A;  1H8M A;  3UE6 A;  3LI9 A;  2NUT C;  5CX7 A;  3UE3 A;  2ZOH A;  4S2N A;  3QP5 A;  1RGY A;  2B02 A;  1LT0 A;  3BRM A;  1ZG6 A;  3FPV A;  1SKF A;  4N9L A;  5HL6 A;  5FDS A;  3IF6 A;  4KG2 A;  2Y59 A;  1W7F A;  4WMC D;  4WEL A;  2PYR A;  2EX2 A;  4MMN A;  5FAT A;  3IWQ A;  3CPT B;  4P0M A;  4ETZ A;  4FUW A;  5GHY A;  1NY0 A;  1X0O A;  5FI6 A;  2Y2I A;  4L9F A;  1OTA A;  1BLH A;  2B95 A;  4O01 A;  1T1A A;  4GHI A;  3VOY A;  1XGI A;  3GRJ A;  3C7U A;  2ZM0 A;  2VV6 A;  1SZV A;  4WL9 A;  3V50 A;  3A0R A;  1JTD A;  3FC7 A;  1DJC A;  1XX2 A;  3M6B A;  4P87 A;  3NDE A;  4II7 A;  3V67 A;  3NDG A;  1ALQ A;  3OBF A;  3LIC A;  1S1Y A;  3W8K A;  2ZC4 B;  5HWV A;  1YSQ A;  4RX3 A;  3O87 A;  2GJ3 A;  3G34 A;  1XA7 A;  4KUO A;  3HLC A;  5F83 A;  2V8F A;  3EOI A;  3LCE A;  2QHK A;  1MWT A;  2L1M A;  4CPK A;  4R4R A;  2EX9 A;  5F82 A;  1EI5 A;  4GDN A;  2M7V A;  1GHI A;  3CPT A;  4KZB A;  3LI8 A;  2J7V A;  5FQI A;  3IH9 A;  1C3B A;  2DRW A;  2BAS A;  5FAS A;  1M40 A;  3LGO A;  2HDR A;  3B33 A;  3P01 A;  4GD6 A;  5E43 A;  4OLD A;  4QD4 A;  3UPP A;  3IWI A;  1WE4 A;  2LB9 A;  2WZZ A;  3D72 A;  3HUM A;  2Y55 A;  5A90 A;  1PFL A;  1JWZ A;  4KZ6 A;  4E3O A;  2QZ6 A;  5TJJ A;  5AQA A;  1M6K A;  2K7S A;  3K2N A;  1YQS A;  5DKK A;  3VP4 A;  2O9A A;  4HNB A;  2E8J A;  3OPH A;  5GL9 A;  3NJA A;  3Q1F A;  3A3D A;  4H8R A;  4QY6 A;  1ACF A;  3ZNT A;  5HZH A;  4ZAM A;  4BL3 A;  2WGW B;  1LI0 A;  5EV0 A;  5J8X A;  5CHM A;  2XF3 A;  3LUQ A;  1YLP A;  2K2N A;  4CLC B;  1KDW A;  2ZC3 B;  5TGF A;  3G35 A;  4R23 A;  1BLS A;  2QPN A;  2W1R A;  4LRY C;  4ARZ B;  4UHU A;  2GDN A;  4JF6 A;  4DDY A;  4FH4 A;  5EE8 A;  4E04 A;  3S7Q A;  1TF1 A;  2JKF A;  4E3M A;  1W5D A;  3T4K A;  5EVI D;  2ZM8 A;  3BYD A;  3SH7 A;  3T12 B;  3IBR A;  3T1S A;  1PWG A;  4R4S A;  3CZD A;  4JXG A;  3A0V A;  3NIA A;  1Y4O A;  3KYZ A;  3ZCZ A;  2ZMV A;  4EET B;  3IXH A;  4HJ4 A;  3GR2 A;  4DMZ A;  2W3D A;  3BFE A;  5A92 A;  4KZ9 A;  2WGW A;  2ZQD A;  4GLQ A;  2Q9N A;  1KE3 A;  4X55 A;  1PRQ A;  1L3L A;  4CLC A;  2YKF A;  1GSV A;  3MBZ A;  3G32 A;  3ZG8 B;  2XQZ A;  2V1B A;  3ZG0 A;  1P9R A;  3KYQ A;  1K6R A;  3IHA A;  1YT4 A;  3P98 A;  2L0W A;  3QP8 A;  4KUK A;  3LY4 A;  1OJ5 A;  4ARZ A;  1YKD A;  2JKT I;  2JKR I;  3UN7 A;  4KQO A;  5EM1 A;  2EWW A;  4KQR A;  2GNX A;  2VKS A;  1G28 A;  2Y8H A;  1YAX A;  3IBJ A;  1GHP A;  4YOF A;  2WGV A;  4U3T A;  1G5U A;  3ZGA B;  4A5R A;  2BTF P;  4GKU A;  4JGP A;  1ERQ A;  4MBK A;  5IU1 A;  1PZP A;  2P74 A;  3VFH A;  1UWP X;  1TS8 A;  1NRJ A;  3KO6 A;  2HP5 A;  4M3K A;  3CUE A;  1QMF A;  3NY4 A;  3HL9 A;  2XSS A;  5J3W A;  2DMW A;  3TE8 A;  4LV1 A;  1P97 A;  3SOI A;  5L2F A;  1F98 A;  1YM1 A;  2J9O A;  4HEF A;  4E3L A;  2ZMA A;  4OP5 A;  1VET B;  1Y28 A;  3G6O A;  4OH0 A;  2PU4 A;  5CHJ A;  3ZQ5 A;  3ZHH A;  1N9L A;  4D2O A;  1VQQ A;  1OPX A;  2VJW A;  1ESU A;  4I3A A;  2EX8 A;  2W3F A;  2FFY A;  5HFO A;  3MQ0 A;  5F69 A;  1YLT A;  2X71 A;  4R70 A;  2FZ0 A;  1F5M A;  3GQZ A;  3ZYT A;  2JBF A;  1NLY A;  4L9E A;  3S4X A;  3RFB A;  1E3U A;  1FCO A;  4LRX C;  4X53 A;  3EGX C;  3E98 A;  1BSG A;  3MXQ A;  5BOH A;  5IT5 A;  2JCH A;  4QHC A;  2ZL1 B;  3IXB A;  3LYX A;  2X01 A;  4PPR A;  3UO9 A;  3HBR A;  3M6H A;  4X25 A;  1VET A;  5FQK A;  3UE0 A;  2M1C A;  3W4P A;  1FR1 A;  4H6J B;  1VHM A;  3MSH A;  4DE2 A;  1S6R A;  1DJB A;  4Y2F A;  4U0T A;  4Y0O A;  4XUX A;  3EQU A;  2Y2J A;  3BFF A;  2PD8 A;  1IYS A;  1H8Z A;  1BUE A;  4K0W A;  3G4P A;  3C2W A;  3CAX A;  2JKG A;  1YPR A;  4OQ0 A;  2O0Y A;  2DCF A;  3Q7Z A;  4JBF A;  1JVJ A;  3MJQ A;  2EFU A;  4S2J A;  4JF4 A;  4MNR A;  2HDQ A;  4WUJ A;  3MFX A;  4I3I A;  3PBQ A;  3UPO A;  2VK3 A;  4L9G A;  1ESI A;  4GB7 A;  1MBL A;  1LL9 A;  3T50 A;  5AVE A;  1IFQ A;  2WKI A;  3NBL A;  1Z6F A;  3H82 B;  4OVD A;  2ZL1 A;  5FAP A;  3GTC A;  1GA0 A;  1NXY A;  2W3H A;  5F5Y A;  4S2K A;  5CTM A;  4X56 A;  4H6J A;  4CLC D;  5LBR A;  3HUO A;  1YSP A;  1HVB A;  5CEC A;  1DRM A;  3LID A;  1Q2Q A;  3D9Y A;  1IYO A;  5HWT A;  4DXB A;  4P6Z M;  5L09 A;  1JWP A;  1G68 A;  3GSG A;  3WWX A;  1FOF A;  5AJG A;  5GLC A;  3RXW A;  2D01 A;  1CEF A;  1ODV A;  3MQQ A;  4P6Z S;  2P7J A;  3BLM A;  2UWX A;  3PR6 A;  3UMD A;  4E3J A;  4R3J A;  1P0Z A;  3N6I A;  5L8M A;  4EBN A;  2XDM A;  4GZB A;  4WEK A;  2IA2 A;  4HH2 A;  1Q2P A;  2VLG A;  3ZG7 B;  2ZMF A;  4NET A;  2HDS A;  4CLC E;  1PIO A;  3UE1 A;  3CHW P;  3CMZ A;  3LR5 A;  1TEM A;  4DE1 A;  1LSV A;  3B3X A;  2M7U A;  3H82 A;  4X1L A;  1YLW A;  2PAV P;  4NG2 A;  1G6O A;  3DTM A;  4N1H A;  1LLB A;  3N7W A;  4ESP A;  1GSW A;  1HLU P;  3QNB A;  4OPZ A;  2A24 B;  5FAQ A;  4WM9 A;  4JGO A;  4B88 A;  2LB5 A;  2A2L A;  4PM6 A;  4PM7 A;  1KE0 A;  3OC2 A;  2CMN A;  4EWF A;  1D06 A;  2XEP A;  4CJN A;  3DWZ A;  5FA7 A;  3MXS A;  2Y2M A;  4KZ5 A;  5G4Z A;  4HHD A;  5FL3 A;  2HZ5 A;  3ZVW A;  3LY3 A;  3ZNY A;  1ES2 A;  3F1N B;  3DTI A;  2XRN A;  4WN5 A;  2QYB A;  3JVU A;  4E6W A;  2XGN A;  2PBD P;  1ZHH B;  5FQQ A;  3QHY A;  3W2Z A;  4HOI A;  2XLN A;  1IEM A;  3TOI A;  2XA7 M;  3HLG A;  3IS2 B;  3ITB A;  3N8R A;  4EQI A;  3LIA A;  1KGF A;  3VP1 A;  1E3U D;  3VV4 A;  5A8B A;  2V0U A;  5KSC A;  2W3E A;  2PBY A;  3R4K A;  5EPH A;  2XA7 S;  5U47 A;  2D02 A;  2Z6C A;  4WLA A;  2W1T B;  4XUZ A;  4EER A;  2ZM2 A;  4EU0 A;  3HLB A;  4DRT A;  2A24 A;  2W0N A;  5TR7 A;  2XFT A;  4HY8 A;  1BUL A;  1ONG A;  4LFU A;  4DN0 A;  3HRE A;  3MFD A;  4M4X A;  3T1R A;  1BTL A;  2VGK A;  1K55 C;  2KX6 A;  4D60 A;  1CF0 A;  3H9W A;  1IKI A;  4NXE A; 
#chains in the Genus database with same CATH homology
 5GLB A;  3SH9 A;  2A3U A;  1ES3 A;  4P85 A;  2QPN A;  3GV9 A;  1DJA A;  4UHU A;  2GDN A;  4OQH A;  2XFS A;  1FCN A;  4JF6 A;  4S2L A;  3BEB A;  1GA9 A;  4ID4 A;  4S2I A;  2ZQC A;  3FYZ A;  4DDY A;  4OOL A;  4FH4 A;  5EE8 A;  3VSK A;  4XXR A;  2HPB A;  1IYQ A;  2QMI A;  3VMA A;  3MXR A;  1HTZ A;  1WYB A;  2EFX A;  4E3M A;  1K55 A;  1W5D A;  4B4Z A;  2WKE A;  4LV2 A;  3OCN A;  5EVI D;  2ZM8 A;  3BYD A;  5HAI A;  3SH7 A;  5JYP A;  1FSY A;  4BJP A;  1IKG A;  2DNS A;  3PTE A;  1ONH A;  3A3I A;  1PWG A;  4R4S A;  3CZD A;  4JXG A;  4OOM A;  3LEZ A;  3NIA A;  3ZCZ A;  2H0T A;  1JTG A;  4OON A;  1QME A;  3FZC A;  1K25 A;  3IHB A;  5I94 A;  4JXS A;  1YLY A;  1I5Q A;  3IXH A;  4BQM A;  2B5R A;  1VM1 A;  1K56 D;  3M2J A;  2WKH A;  4MBH A;  3UY6 A;  3GR2 A;  4Y0U A;  3BFE A;  3EQV A;  4UA7 A;  5A92 A;  4KZ9 A;  1NYY A;  2WGW A;  2I72 A;  4ZJ3 A;  4KZ8 A;  1N4O A;  1K57 C;  1RP5 A;  4R0Q A;  4WEJ A;  4DKI A;  2ZQD A;  2Q9M A;  3C4O A;  3OPP A;  5TFQ A;  3SS4 A;  3JYI A;  3G31 A;  4WMC A;  4BD0 A;  2Q9N A;  1KE3 A;  2VGJ A;  2EXB A;  4X55 A;  4WBG A;  5HAP A;  4K0X A;  1O07 A;  1KE4 A;  4OPY A;  1MWS A;  2CC1 A;  4ZJ2 A;  3MBZ A;  1L0E A;  1PZO A;  2Y2H A;  3G32 A;  5IHV A;  5GHX A;  3ZG8 B;  5FSR A;  2XQZ A;  2E8I A;  4KZ4 A;  4Y7P A;  1RGZ A;  4OP8 A;  1TDL A;  1LL5 A;  2ZQ7 A;  3LO7 A;  3ZG0 A;  1K6R A;  4MEZ A;  3IHA A;  1YT4 A;  3P98 A;  2X02 A;  5M1A A;  2J8Y A;  3S22 A;  5JYO A;  4DF6 A;  2V1Z A;  4E6X A;  3LY4 A;  1RCJ A;  2Y2Q A;  1K57 A;  5EUA A;  2C6W B;  3UN7 A;  4KQO A;  2XK1 A;  1FCM A;  2XR0 A;  5DVA A;  3WS1 A;  3AGF A;  4ZBE A;  4UAA A;  3HLE A;  4KQR A;  2ZC7 A;  2WGI A;  3FV7 A;  1KGE A;  1FSW A;  5EVL A;  4OPR A;  5G18 A;  1GHP A;  2WGV A;  3HLW A;  3WS5 A;  2OV5 A;  3IF5 A;  4KZ7 A;  3GVB A;  5EEC A;  4U3T A;  3WS4 A;  5F1F A;  5HAQ A;  1CI9 A;  3ZGA B;  4QJG A;  4Y0T A;  4LCM A;  4A5R A;  4FD8 A;  4GKU A;  3V39 A;  2Y2L A;  1MKI A;  3G2Z A;  4EBP A;  1ERQ A;  3C4P A;  4MBK A;  1L2S A;  1PZP A;  5E2G A;  2P74 A;  3VFH A;  4N9K A;  1SDE A;  3TSG A;  3FKW A;  4IVI A;  5CRF A;  3HVF A;  3V3S A;  4WYY A;  1H8Y A;  2H10 A;  3V3R A;  2HP5 A;  4JXW A;  4LV0 A;  4M3K A;  5CXW A;  1QMF A;  3NY4 A;  4E3K A;  3HL9 A;  1XP4 A;  3VP0 A;  1XGJ A;  4YFM A;  1AXB A;  1NRF A;  2V20 A;  3VOZ A;  4LV1 A;  4UA6 A;  3S1Y A;  3SOI A;  5L2F A;  1KGG A;  2EX6 A;  1YM1 A;  2J9O A;  4HEF A;  4E3L A;  2ZMA A;  1YMX A;  2A49 A;  4OP5 A;  2OSU A;  3C5A A;  5DTK A;  3N8S A;  4OH0 A;  5FI7 A;  5EOO A;  3W4O A;  1LI9 A;  3P09 A;  2PU4 A;  2HDU A;  5CHJ A;  3ZHH A;  3IXG A;  4D2O A;  2Y2K A;  1VQQ A;  1L0F A;  5GLD A;  3OZH A;  4Q8I A;  1K4E A;  1ESU A;  2R9W A;  1PI5 A;  4RVA A;  4PM5 A;  3MKF A;  4QY5 A;  2JC7 A;  3CJM A;  1WYC A;  2EX8 A;  4JLF A;  3MKE A;  3PBO A;  3Q07 A;  1GHM A;  2FFY A;  2Y2G A;  4ZTK A;  4KZA A;  1SHV A;  5HFO A;  1YLT A;  2X71 A;  1KVM A;  2BG1 A;  1JWV A;  3UDX A;  2WK0 A;  4C3Q A;  3D4F A;  4DE3 A;  4EV4 A;  3GQZ A;  5FQ9 A;  1XPB A;  4K91 A;  5DTS A;  5FQM A;  2JBF A;  1BLP A;  3N8L A;  4EUZ A;  1MWR A;  5KZH A;  3NC8 A;  4N1X A;  4RYE A;  1CK3 A;  3E2K A;  1YLJ A;  1U60 A;  3C7V A;  3FKV A;  4KQQ A;  4L0L A;  2RCX A;  4UA9 A;  3IWO A;  3RJU A;  5CEB A;  5EVI B;  5HAR A;  3UPN A;  2V2F F;  1FQG A;  3S4X A;  4DXC A;  1W79 A;  1TDG A;  2WAD A;  1E3U A;  1FCO A;  3A3J A;  4X53 A;  3RXX A;  4HBT A;  1K38 A;  3DW0 A;  3ZG5 A;  3ZFZ A;  4PMA A;  4OOY A;  4F94 A;  1BSG A;  2Z2L B;  1HZO A;  3FWL A;  1H5X A;  2JCH A;  5BOH A;  4QHC A;  5HL1 A;  2Y91 A;  3IXB A;  2X01 A;  4FSF A;  2WAF A;  3PBS A;  4N92 A;  4PPR A;  4S2P A;  3UDI A;  3UO9 A;  4X69 A;  3TG9 A;  3DWK A;  4JXV A;  3IF6 B;  5E2F A;  3HBR A;  3M6H A;  5DF7 A;  4KZ3 A;  4OQI A;  5FQK A;  3N4I A;  4S2O A;  3UE0 A;  4GNU A;  3W4P A;  1FR1 A;  1PI4 A;  3MZD A;  3PBT A;  1NZO A;  4GD8 A;  4DE2 A;  1S6R A;  4WZ5 C;  1ZKJ A;  3G2Y A;  3WS2 A;  1DJB A;  3IXD A;  2ZLY A;  2Z2M B;  5KSH A;  4R3B A;  3QNC A;  4GDB A;  3BLS A;  4E3I A;  5DF8 A;  1K4F A;  4U0T A;  4Y0O A;  4XUX A;  1BT5 A;  3EQU A;  1GCE A;  1PW8 A;  1K54 C;  5EVI C;  3O3V A;  2Y2J A;  3PAE A;  3BFF A;  1YMS A;  1IYS A;  2Y4A A;  4FH2 A;  1H8Z A;  4P6B A;  4X68 A;  3WRZ A;  1BUE A;  1G6A A;  1XXM A;  4K0W A;  3G4P A;  4S2N C;  3I7J A;  2IWB A;  3BFG A;  3VP3 A;  1L0G A;  3SS3 A;  1NYM A;  3IT9 A;  3O86 A;  1MXO A;  1XKZ A;  2IWC A;  4NK3 A;  3SH8 A;  4OQ0 A;  2DCF A;  2C5W B;  2H5S A;  3E2L A;  3Q7Z A;  1JVJ A;  4JBF A;  1PYY A;  4HES A;  4WZ5 A;  2EFU A;  4S2J A;  3IF6 C;  2OLV A;  1IEL A;  4IED A;  5KMW A;  4PM9 A;  4JF4 A;  4MNR A;  2XD1 A;  2HDQ A;  4JKT A;  4RX2 A;  1L0D A;  1K54 A;  5EVI A;  1IYP A;  3BEC A;  3PBQ A;  3UPO A;  3OCL A;  1ESI A;  2EXA A;  2WAE A;  3UE3 A;  2R9X A;  4GB7 A;  1MBL A;  3IH8 A;  1LL9 A;  4S2N A;  4LEN A;  1RGY A;  3BFC A;  1BLC A;  2WKI A;  3NBL A;  1Z6F A;  4OVD A;  3G30 A;  3BRM A;  1ZG6 A;  5FAP A;  3Q7V B;  3HUN A;  5E2H A;  5AQ9 A;  1SKF A;  4S2M A;  3GTC A;  1K56 A;  1GA0 A;  1NXY A;  4N9L A;  4S2K A;  3NCK A;  3IF6 A;  4GOG A;  5CTM A;  4KG2 A;  5AQB A;  2Y59 A;  4GN2 A;  4WMC D;  4WEL A;  4X56 A;  1TVF A;  2EX2 A;  4U0X A;  4OLG A;  5FAT A;  3IWQ A;  3VSL A;  2H0Y A;  3HUO A;  1MPL A;  4P0M A;  4X6T A;  1HVB A;  5GHY A;  2ZJ9 A;  5CEC A;  1Q2Q A;  1NY0 A;  1IYO A;  3MZF A;  5FI6 A;  2Y2I A;  1BLH A;  5F1G A;  4DXB A;  5CGW A;  1N9B A;  3BFD A;  1KVL A;  1JWP A;  1I2W A;  1G68 A;  4EBL A;  3GSG A;  3WWX A;  1FOF A;  1MY8 A;  4B4X A;  5GLC A;  3HLD A;  3RXW A;  4O7D A;  1EWZ A;  5E2E A;  3HLF A;  1CEF A;  4HBU A;  4JF5 A;  3VOY A;  1SCW A;  4IVK A;  3A3F A;  1XGI A;  3BLM A;  1W8Q A;  3C7U A;  3GRJ A;  2UWX A;  3M2K A;  3PBN A;  4IBR A;  4KEN B;  2ZM0 A;  4C75 A;  2ZC6 B;  5D3O A;  4BLM A;  3V50 A;  4E3J A;  4R3J A;  1JTD A;  3N6I A;  1DJC A;  1XX2 A;  5GHZ A;  3ZG9 B;  5A91 A;  3M6B A;  2XDM A;  4GZB A;  4WEK A;  4EBN A;  5CGS A;  3VFF A;  4P87 A;  3WRT A;  1Q2P A;  3NDE A;  1ZG4 A;  4BD1 A;  3NDG A;  5DTT A;  1ALQ A;  2G2U A;  2WUQ A;  4LV3 A;  1I2S A;  3O88 A;  3ZG7 B;  4NET A;  5A93 A;  2HDS A;  1PIO A;  4LCL A;  3IQA A;  3SS5 A;  3W8K A;  4KG5 A;  3UE1 A;  3CMZ A;  1OME A;  2XD5 A;  2ZC4 B;  2WYX A;  1TEM A;  4DE1 A;  4C6Y A;  4RX3 A;  5FQJ A;  3O87 A;  3B3X A;  2RL3 A;  3G34 A;  1YLW A;  1XA7 A;  3HLC A;  3Q7V A;  4FCF A;  5F83 A;  5FI2 A;  4DE0 A;  3AGD A;  3LCE A;  4QU3 A;  3DTM A;  2PU2 A;  5EOE A;  4N1H A;  1HD8 A;  3CG5 A;  1MWT A;  1LLB A;  4CPK A;  3N7W A;  4R4R A;  2EX9 A;  2Y2N A;  3QNB A;  5F82 A;  1EI5 A;  4OPZ A;  1ERO A;  4GDN A;  1KDS A;  1NJ4 A;  4BL2 A;  1GHI A;  5FAQ A;  4WM9 A;  2OLU A;  3AGE A;  4KZB A;  4B88 A;  4BEN A;  3V5M A;  4PM6 A;  4PM7 A;  4KG6 A;  1NZU A;  1KE0 A;  3OC2 A;  2P9V B;  2J7V A;  5CHU A;  4EWF A;  5FQI A;  3IH9 A;  1C3B A;  3GMW A;  4PM8 A;  2ZD8 A;  4OPQ A;  4Z9Q A;  2DRW A;  2G2W A;  3NI9 A;  1E4D A;  1SDN A;  1O7E A;  2XEP A;  5CER A;  3DWZ A;  5FA7 A;  3UNW A;  4CJN A;  4R1G A;  3MXS A;  5FAS A;  2IWD A;  2Y2M A;  1M40 A;  4WZ4 A;  4KZ5 A;  5GLA A;  1J9M A;  1BZA A;  2J9P A;  3PBR A;  4QB8 A;  1LHY A;  2HDR A;  4ZDX A;  1ES4 A;  3ZVW A;  4GD6 A;  5E43 A;  3LY3 A;  3OPR A;  3WS0 A;  4OQG A;  3ZNY A;  1CI8 A;  4OLD A;  4QD4 A;  4DDS A;  1K6S A;  1ES2 A;  3UPP A;  3UDF A;  3IWI A;  4E3N A;  1WE4 A;  3A3E A;  5M18 A;  1CEG A;  4JPM A;  2WZZ A;  3HUM A;  2Y55 A;  5A90 A;  2XH9 A;  3Q81 A;  4E6W A;  2XGN A;  1W8Y A;  5FQQ A;  5FAO A;  3ZDJ A;  3QHY A;  1JWZ A;  1PWD A;  2WZX A;  2XLN A;  4KZ6 A;  1MWU A;  3VP2 A;  5CTN A;  1IEM A;  4E3O A;  4ZJ1 A;  3TOI A;  2QZ6 A;  3HLG A;  3ITB A;  5DF9 A;  3N8R A;  5HW3 A;  4MBF A;  4EQI A;  5AQA A;  3ITA A;  3ZVT A;  1KGF A;  3VP1 A;  5M19 A;  2ZC5 B;  1E3U D;  1M6K A;  3W4Q A;  2BLS A;  3MZE A;  1ZC2 A;  1YQS A;  4MLL A;  5AQ7 A;  3VP4 A;  1PW1 A;  3BM6 A;  5KSC A;  2PBY A;  5EPH A;  5U47 A;  3OPL A;  3OPH A;  5GL9 A;  3Q1F A;  3A3D A;  4H8R A;  4QY6 A;  1YLZ A;  1ERM A;  4YIN A;  1FR6 A;  3ZNT A;  4XUZ A;  5CGX A;  4RA7 A;  1Y54 A;  2ZM2 A;  1E25 A;  2JE5 A;  3HLB A;  4DRT A;  4ZAM A;  4BL3 A;  2WGW B;  1LI0 A;  5TR7 A;  2XFT A;  2ZQ9 A;  1BUL A;  2Y2P A;  2P9V A;  2ZQ8 A;  5CHM A;  1PWC A;  1ONG A;  4IBX A;  4OKP A;  5J8X A;  2XF3 A;  1ES5 A;  2HP6 A;  1YLP A;  3ISG A;  5HX9 A;  2HP9 A;  2FFF B;  3HRE A;  1S0W A;  3MFD A;  1DY6 A;  1KDW A;  2ZQA A;  2ZC3 B;  5TGF A;  1BTL A;  2Y2O A;  3G35 A;  2VGK A;  1K55 C;  4R23 A;  1BLS A;  1XA1 A;  3Q82 A;  5CED A;  3PAG A;  5FDH A;  1IKI A;  1W7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...