5E2EA

Crystal structure of beta-lactamase precursor blaa from yersinia enterocolitica
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
260
structure length
260
Chain Sequence
SLDKQLAALEHSANGRLGIAMINSGAGTKILYRGAQRFPFCSTFKFMLAAAVLDQSQSQPNLLNKHINYHESDLLSYAPITRKNLACGMTVSELCAATIQYSDNTAANLLIKELGGLAAVNQFARSIGDQMFRLDRWEPDLNTALPNDPRDTTTPAAMAASMNKLVLGDALRPAQRSQLAAWLKGNTTGDATIRAGAPTDWIVGDKTGSGDYGTTNDIAVLWPTKGAPIVLVVYFTQREKDAKPRRDVLASATQIILSQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Crystal Structure of Beta-lactamase Precursor BlaA from Yersinia enterocolitica
rcsb
source organism Yersinia enterocolitica serotype o:8 / biotype 1b (strain nctc 13174 / 8081)
total genus 84
structure length 260
sequence length 260
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5e2eA00
2BLSA 4DE0A 4PMAA 1PI5A 5DF9A 4E3OA 5HAQA 1XKZA 4QY5A 4DF6A 1AXBA 3W4PA 1IKGA 4WM9A 3IWIA 1Y54A 2XDMA 3UNWA 3S4XA 1C3BA 4WBGA 1GA9A 2ZM2A 2WKHA 4ZDXA 5EVIB 1GHIA 1N9BA 5HAIA 2WADA 2WGWB 3HUNA 5CEDA 2XF3A 2ZQCA 1K56A 3MZEA 4KZ9A 3UPPA 4JXVA 1XGJA 5M1AA 2ZD8A 2ZC5B 3IXHA 4LCMA 4S2LA 1L0EA 4RA7A 2DRWA 3HLEA 5IHVA 2H0YA 3Q82A 4UA7A 3FWLA 2C5WB 1M40A 4L0LA 5FQJA 1SDEA 1XPBA 1K55C 2B5RA 4R0QA 3IHAA 1BLPA 3VOZA 3IH9A 5AQBA 4BENA 1CI8A 4JF4A 1ERMA 1NJ4A 1J9MA 5D3OA 1YM1A 3AGEA 3PBOA 5EVLA 4Y0OA 1ES3A 1I5QA 4FH4A 5M18A 3ZVTA 1IYSA 3FYZA 3N6IA 4RYEA 4OONA 4KZ7A 1NYMA 1XA1A 5CHUA 2OLUA 2X02A 4JKTA 4RX3A 2XD5A 1H8ZA 5E2HA 3NCKA 5F1FA 3SOIA 2DNSA 4JF6A 1HD8A 3EQUA 3VP4A 5J8XA 1XX2A 3MXSA 4E3KA 4C6YA 1NYYA 4KG2A 2J7VA 1FSYA 3NI9A 4E6XA 4EBNA 1Q2PA 2JE5A 2HP6A 3E2LA 5CTMA 3RXXA 1BZAA 5E2EA 1PYYA 3MZFA 5FQMA 3GSGA 4WZ4A 3G35A 4ZJ1A 1JTDA 1KGEA 3PBNA 3V3SA 3LCEA 4FCFA 3VOYA 4OQIA 1FCNA 4CJNA 5CEBA 3N7WA 2Y2IA 1G6AA 1M6KA 1XGIA 2XLNA 5CRFA 3GQZA 3HUOA 1RP5A 5JYOA 3W8KA 2Q9MA 4OP5A 1PIOA 1K55A 2WK0A 2ZC4B 3BEBA 4GN2A 2XFSA 3OPLA 1LI0A 3HLFA 2Y2OA 4DE2A 5DTKA 4OH0A 1NZUA 3SS3A 3UY6A 3V50A 3CG5A 3VSLA 3A3JA 4DXCA 4C75A 3A3EA 3IF6C 4EQIA 3ZDJA 2Y2PA 4KG5A 1PW1A 4KENB 4R4RA 4DE3A 4OVDA 4DXBA 4KZAA 5AQ7A 2XK1A 4EUZA 1NZOA 2IWDA 4P6BA 2Y2NA 2J9OA 2H10A 1MWTA 1LL5A 2HPBA 1NXYA 2EXBA 2Y2MA 5CGWA 4MLLA 3ZGAB 3MFDA 3WS5A 5KMWA 1BLSA 2Y4AA 1CEFA 1KDSA 2V2FF 5F83A 3W4QA 2ZM0A 5KSHA 4IBXA 1K25A 3G4PA 5DTTA 1YT4A 1DY6A 4JXSA 1YQSA 1YLPA 4U0TA 3NY4A 2ZC7A 5EECA 4WYYA 3TG9A 2XD1A 1L0GA 2ZQ9A 2P74A 1ZC2A 2QZ6A 2C6WB 1SKFA 5U47A 1W7FA 1BULA 2Y2HA 2OV5A 3WRZA 3FKVA 2CC1A 1TDLA 1WYBA 4N1XA 4OQHA 4X6TA 4XUZA 5HAPA 1PWCA 4KG6A 4Y0TA 1FQGA 4PM9A 1YLYA 2Y59A 1HVBA 4DDYA 4M3KA 4S2NC 4X68A 3BFFA 5I94A 5DF8A 4K0WA 3BM6A 5EOEA 5FQQA 2WAFA 4QB8A 2WZZA 3W4OA 4LV1A 3IF6B 4C3QA 1O7EA 4WEKA 4PM6A 4X55A 2JCHA 2OLVA 3A3IA 3QNCA 5JYPA 3C4OA 3VP2A 4KQOA 1O07A 2Y2LA 4DKIA 5GHXA 3DWZA 1NRFA 4K91A 5EVIA 3NBLA 2WGWA 3NC8A 5CGXA 1WE4A 4IVIA 4OPQA 3BLSA 1RCJA 3ZVWA 3IT9A 1ESIA 1E3UA 5CGSA 1IYQA 2P9VB 5AQAA 3TOIA 3IXDA 4ZAMA 3ISGA 1DJBA 3VFFA 3RJUA 1MWSA 3QNBA 3VFHA 5DF7A 3HREA 3PAGA 4MNRA 1I2SA 2WGVA 1QMEA 5EUAA 3G34A 1K56D 1MWRA 4ZTKA 2JC7A 3LO7A 1GHPA 3G31A 2H0TA 4WMCA 3SS5A 1GHMA 5HW3A 1YMSA 3GV9A 3IXGA 4PM7A 1MWUA 4JLFA 1PWGA 3P98A 4KZ5A 3O3VA 1SCWA 3MXRA 4N9LA 5TGFA 3UO9A 1LLBA 3SS4A 1TDGA 2ZM8A 4GB7A 4P0MA 4X53A 5CHJA 5AQ9A 3V39A 1FCOA 2EX6A 4S2NA 5GLDA 3ITBA 4DRTA 4HBUA 4Y0UA 5E2FA 2EFXA 4LV3A 2EX2A 1L0DA 2A3UA 4HEFA 2VGKA 1BT5A 3AGDA 1K4FA 2XQZA 4QJGA 4WZ5C 5FI7A 1Z6FA 5GLAA 4JBFA 4KQQA 2ZQAA 4X56A 3OCNA 3BFCA 3OC2A 4KQRA 4R23A 3OPPA 5EE8A 1JVJA 2EX9A 5FSRA 2XEPA 3M2KA 2IWCA 2XGNA 4GDBA 4FSFA 4RVAA 4PPRA 2EXAA 1KVLA 5FQIA 1H5XA 1RGZA 3C5AA 1ES4A 5A91A 3QHYA 4PM5A 1KE3A 4K0XA 4ZBEA 3S1YA 1IYOA 3SH7A 3SH9A 4GOGA 4OPZA 5A92A 3HLCA 1MBLA 4XXRA 1EI5A 2R9WA 1FR1A 4MBFA 2ZC6B 1K57C 3HL9A 3S22A 1FCMA 1W5DA 1VQQA 2WUQA 2Y2QA 1IEMA 2V20A 3GTCA 3PBRA 4LENA 4OOLA 3M6BA 5FQ9A 5BOHA 2WZXA 2Z2MB 1IYPA 2A49A 5FI6A 4KZBA 4OOYA 5CHMA 4BLMA 3NIAA 1QMFA 1BUEA 2WAEA 3IF5A 5A90A 1OMEA 3Q7ZA 5HARA 4E3JA 2FFYA 4OLGA 3CZDA 5TR7A 2IWBA 3LY3A 4OQ0A 5F1GA 1TVFA 5E43A 1FOFA 3N8SA 2GDNA 4NETA 1KE4A 3MKEA 4E6WA 2R9XA 3BLMA 3Q7VB 4PM8A 1YLZA 3ZG9B 1DJCA 4OQGA 3IWQA 3PAEA 4WZ5A 1MPLA 3M2JA 5HFOA 4WELA 4YFMA 5CERA 2HDSA 2WKIA 1YMXA 3Q7VA 1KVMA 3ITAA 3LEZA 3VP1A 2ZQDA 3BFDA 4FH2A 3BFEA 1RGYA 2EFUA 5KSCA 4U0XA 4GD6A 3O86A 4QU3A 3JYIA 3WRTA 2Y2JA 3FKWA 3I7JA 3PTEA 3VSKA 1G68A 3GRJA 4KZ3A 5HL1A 4E3LA 3GVBA 1NY0A 2WGIA 4U3TA 1Q2QA 1ES5A 2G2WA 2ZC3B 3NDGA 4UAAA 1K57A 3C7UA 1MXOA 1ZKJA 3BECA 3IWOA 4DDSA 2ZMAA 4CPKA 4ZJ2A 4OKPA 4QHCA 2Y91A 1HZOA 4JF5A 2XFTA 5CTNA 3IF6A 4WEJA 3C4PA 2V1ZA 1HTZA 1JWZA 3HLBA 5HX9A 4S2JA 2J9PA 5FDHA 4YINA 1K6SA 3WWXA 1W8QA 4S2PA 4Y7PA 3V5MA 4DE1A 4O7DA 2X71A 4E3NA 1EROA 2X01A 4HBTA 5FQKA 1YLWA 2ZQ7A 3IH8A 4RX2A 1S6RA 5GHZA 1IELA 2PU4A 4OP8A 2FFFB 4EBPA 2G2UA 1ONHA 2HP9A 2P9VA 1XP4A 3E2KA 2EX8A 1K38A 3P09A 4R3JA 1CK3A 4Q8IA 2PBYA 1BSGA 1KDWA 1KGFA 4A5RA 2HDUA 3O88A 1KGGA 5EVID 1BLHA 2PU2A 4IBRA 4JPMA 4MBHA 4B4ZA 2BG1A 3HLWA 3IXBA 1E3UD 1W79A 3GR2A 1KE0A 3ZCZA 4BD1A 1XA7A 5KZHA 1L2SA 2Y55A 5GLCA 3N8LA 3OCLA 3BFGA 1SDNA 5E2GA 5GHYA 5M19A 2E8IA 1K54C 3FV7A 4H8RA 4N92A 3VP3A 3GMWA 4R4SA 1N4OA 4P87A 1CI9A 3MZDA 2ZQ8A 4KZ6A 3OPHA 5DVAA 3CMZA 1IKIA 3CJMA 3IQAA 1DJAA 2WKEA 3WS0A 2VGJA 4EWFA 3OPRA 4UA9A 3UE0A 3MBZA 1PZPA 5DTSA 2JBFA 4WMCD 1GCEA 3G32A 2RCXA 3UDXA 3TSGA 5CXWA 4IEDA 4JXWA 1W8YA 1K4EA 2Z2LB 2ZLYA 4JXGA 3VP0A 4OLDA 5FAOA 2QPNA 2Q9NA 3AGFA 3EQVA 4UA6A 3UDIA 2ZJ9A 4KZ4A 3UDFA 1XXMA 5CECA 2RL3A 4ID4A 4EV4A 4N9KA 3ZHHA 1LI9A 3HVFA 3VMAA 1ERQA 3BRMA 4Z9QA 4S2MA 4UHUA 3IHBA 1VM1A 3PBTA 3OZHA 4X69A 1ESUA 1ZG4A 3HLDA 4GDNA 1S0WA 4XUXA 1JWVA 3DTMA 1MKIA 3UN7A 1JWPA 2HP5A 4BD0A 4GZBA 4S2KA 4BJPA 5FAQA 1PWDA 1I2WA 3N8RA 5EOOA 5F82A 4LV2A 4E3MA 4ZJ3A 2Y2GA 2I72A 5FI2A 5G18A 3Q07A 4QY6A 3HBRA 1CEGA 1ZG6A 3LY4A 2OSUA 4EBLA 5FASA 4R1GA 4B88A 2H5SA 4S2IA 1K54A 2UWXA 1PI4A 3A3FA 4LCLA 4OOMA 1WYCA 3HLGA 5A93A 1PZOA 3B3XA 3C7VA 1ALQA 2DCFA 1U60A 4S2OA 5GL9A 3UPOA 5EPHA 1YLTA 2WYXA 4D2OA 3D4FA 3WS1A 3UE3A 4IVKA 3BYDA 4BL2A 3HUMA 1LHYA 4GKUA 4MBKA 4BL3A 4F94A 4P85A 4GNUA 5FATA 3DWKA 5FA7A 1TEMA 1YLJA 2HDRA 4OPYA 5L2FA 1LL9A 1ONGA 3O87A 5EVIC 3ZG8B 3UPNA 4QD4A 4FD8A 1E4DA 3NDEA 1FR6A 4B4XA 1L0FA 3PBSA 3N4IA 1K6RA 3G2YA 3RXWA 3WS2A 5TFQA 4LV0A 1ES2A 2XR0A 2QMIA 1GA0A 3UE1A 3ZG7B 1SHVA 1E25A 1FSWA 4NK3A 1BLCA 4HESA 3WS4A 3PBQA 3Q1FA 1MY8A 3DW0A 4GD8A 1PW8A 1BTLA 3G2ZA 2HDQA 2XH9A 3FZCA 4OPRA 3ZNTA 3M6HA 4KZ8A 4BQMA 2Y2KA 3G30A 4R3BA 1EWZA 3ZG5A 3ZFZA 4N1HA 1H8YA 4MEZA 5GLBA 3SH8A 4E3IA 2J8YA 3A3DA 1JTGA 3V3RA 3MKFA 3ZG0A 3ZNYA 5FAPA 3Q81A
chains in the Genus database with same CATH superfamily
4DE0A 4PMAA 5DF9A 4E3OA 4QY5A 1Y54A 2XDMA 4WBGA 1GA9A 3EOIA 4XT2B 4ZDXA 5HPFA 2O99A 3S7QA 5CEDA 1T19A 5F68A 1K56A 4KZ9A 2BASA 5M1AA 2ZD8A 4S2LA 3HLEA 1CQAA 3FWLA 1M40A 4IJGA 1K55C 3IHAA 4QPRA 3VOZA 1CI8A 3MF0A 4MCWA 3CPTA 2AVXA 4Y0OA 2QWSA 4FH4A 3NOTC 3N6IA 1XA1A 2OLUA 4JKTA 4JGOA 3UB7A 2DNSA 4JF6A 1Y4OA 3VP4A 5J8XA 1NYYA 2J7VA 3MZFA 1JTDA 3F1PB 4OQIA 1FCNA 1XGIA 4HNBA 5CRFA 3BQ8A 2Q9MA 1K55A 2WK0A 4GN2A 2QJ5A 3FC7A 1H0MA 1OTAA 3OBFA 4NKPA 4D60A 4C75A 1S4SA 2V9AA 4FTXA 3LYXA 3L9KA 4R4RA 2XK1A 1NZOA 4P6BA 2J9OA 3KSIA 4MLLA 5KMWA 2Y4AA 3W4QA 5F83A 2UV0E 5KSHA 3G4PA 5DTTA 5HPIA 2G7UA 3T4SA 1YQSA 1YLPA 3C38A 3TG9A 2XD1A 1L0GA 2ZQ9A 2A24A 1T1BA 5U47A 1BULA 1TS6A 2OV5A 1LSXA 1WYBA 4OQHA 4KG6A 4O01A 4Q0IA 5HWTA 3LIDA 5DF8A 4LV1A 4BWIA 4X55A 2OLVA 3MR0A 1T1CA 1UGUA 3C4OA 4KQOA 3VP2A 4DKIA 1NRFA 5HDCA 2WGWA 5CGXA 3F1NB 1WE4A 3BLSA 4GS9A 1E3UA 2M7UA 4KQDA 5AQAA 3IXDA 4Z1WA 3H7WB 1D06A 1MWSA 5DF7A 2WGVA 4KUOA 3G34A 3BWLA 5HWWA 1GHPA 1YMSA 1NLYA 3KSGA 4DJ2A 1SCWA 3MXRA 3QP6A 3UO9A 1TDGA 4P0MA 3V39A 3ITBA 4WF0A 4HEFA 2KOIA 1Y28A 4JBFA 2ZQAA 3BFCA 3OPPA 1OT6A 1YAXA 3NULA 3M2KA 2XGNA 4RVAA 2EXAA 4WN5A 5A91A 2M7VA 1KE3A 3SH7A 4I3JA 5A92A 3MJQA 1EI5A 2R9WA 4MBFA 2ZC6B 1N9LA 1W5DA 3PBRA 1IEMA 5FQ9A 2WZXA 2Z2MB 3RTYA 1DRMA 5CHMA 1QMFA 5HARA 4Y5FA 5F1GA 1TVFA 5E43A 3KYEA 2IA2A 1KE4A 3BLMA 4OQGA 3IWQA 3ICYA 4YFMA 2HDSA 1KVMA 2ZQDA 4FH2A 2EFUA 3QP1A 3O86A 3LIBA 5HL1A 4KZ3A 4E3LA 5EM1A 1X0OA 2ZC3B 3NDGA 2PD8A 3IWOA 4CPKA 2K2NA 4OKPA 2Y91A 1IOUA 5CTNA 3IF6A 3C4PA 3HLBA 1MC0A 4S2JA 2CMNA 5FDHA 4Y3IA 3L7HA 3V5MA 2X71A 5AVFA 2X01A 4HBTA 1YLWA 3IH8A 5HDDA 1XJ6A 3ULFA 4GHIA 2EX8A 4R3JA 1CK3A 4Q8IA 1BSGA 1KDWA 2ZMFA 2J3TC 1ZTUA 2PYPA 1OTEA 2PU2A 3VE4A 1W79A 1KE0A 1W63Q 2E8JA 3N8LA 3BFGA 1T1AA 2Q0OA 1N4OA 3OPHA 5DJUA 1DJAA 3WS0A 4EWFA 1PZPA 5CXWA 3OOVA 1K4EA 2V1AA 5F6AA 2ZLYA 4JXGA 1DP8A 3SZTA 3UDIA 3UDFA 4MN5A 5CECA 4ME4A 4EV4A 3E4QA 3HVFA 4F3LB 1SKOA 4X69A 4I5SA 2GJ3A 4S2KA 4WUJA 1S1ZA 4BJPA 2VV8A 3TE8A 1PWDA 4CLCC 3KYZA 2M1CA 1PRQA 3HBRA 3PYPA 4EBLA 4R1GA 3B33A 4OOMA 1PZOA 3C7VA 2DCFA 4S2OA 5EPHA 2ZOIA 2WYXA 3WS1A 3BYDA 1LHYA 4MBKA 4P85A 5FATA 1P9WA 2HDRA 5HSQA 2PYRA 1LL9A 5EVIC 4FD8A 2P04A 2W1TB 3WS2A 5TFQA 1VEUB 4LV0A 3DAVA 4HH3A 3LR4A 4HP4A 3UB9A 1BLCA 4HESA 3Q1FA 1MY8A 3G2ZA 2XH9A 4CLCA 4OPRA 3D9YA 4KZ8A 4R3BA 3ZFZA 4N1HA 2ZBBA 3SH8A 4BMWA 2VA0A 3MKFA 4L9GA 2PDRA 4UQIM 3EWKA 4DF6A 1AXBA 3DTEA 4Q0HA 3A0RA 3KYQA 2P7JA 5EVIB 1N9BA 3HUNA 2XF3A 3KSFA 4JXVA 2ZC5B 1L0EA 2DRWA 2H0YA 3Q82A 4L0LA 1SDEA 2B5RA 4R0QA 3EGDC 4BENA 1J9MA 3T4QA 1S4RA 3AGEA 4EEUA 1I5QA 4KZ7A 1NYMA 4RX3A 1H8ZA 3SOIA 2J80A 3T50A 1OJGA 4E3KA 4C6YA 1TF1A 4KG2A 1P97A 4EBNA 2JE5A 2HP6A 3RXXA 3T1RA 2PT7A 4P6ZS 3GSGA 5HDSA 3EEHA 4WZ4A 3G35A 1KGEA 3S7OA 5CEBA 2Y2IA 1M6KA 2VEAA 3HUOA 5JYOA 2A2LA 3W8KA 5J4EA 2ZC4B 2W3DA 5G4ZA 1LI0A 2Y2OA 4DE2A 3T4LA 3CG5A 3A3JA 4DXCA 1P9RA 5LBRA 4EQIA 3ZDJA 1PW1A 4KENB 4DE3A 4DXBA 2IWDA 3MFXA 2Y2NA 2XRNA 3UMEA 2H10A 3ZGAB 1KDSA 1LSWA 2ZMVA 4IBXA 1K25A 3UE6A 4EQ1A 4JXSA 5EECA 3NY4A 5J7EA 2P74A 2O9AA 1ZC2A 4GCZA 1SKFA 2Y2HA 3NHQA 2CC1A 4N1XA 5HAPA 4DDYA 4M3KA 4X68A 2Y79A 5FQQA 3W4OA 4DJ3A 2GZAA 3UB6A 1O7EA 4NXBA 2JCHA 1H3QA 1O07A 4XT2A 3LEQA 3DWZA 1RCJA 3IT9A 2GNXA 1OTDA 3TOIA 4ZAMA 4EEPA 1DJBA 1J3WA 3VFHA 5L09A 2JKRI 3D72A 1K56D 1FIKA 2O9CA 3DTIA 3A0SA 3JPUA 4HIAA 1MWUA 2FH5A 2W1RA 2ZM8A 1LL8A 5GLDA 4K08A 5FDSA 4DRTA 3NECA 4LV3A 1F2KA 1BT5A 2XQZA 4QJGA 5FI7A 4X56A 3OCNA 4R23A 4LRYC 3UB8A 3P7NA 5FQIA 1KVLA 1RGZA 3F1PA 3QHYA 4K0XA 3S1YA 4GOGA 4EUVA 3HLCA 1K57C 3HL9A 1VQQA 3E4OA 4LENA 5G4YA 5BOHA 3T1SA 1IYPA 2A49A 3EEAA 5FI6A 4IUKA 4KZBA 4JGRA 2VK3A 2WAEA 1OMEA 4E3JA 2FFYA 4OLGA 3CZDA 5TR7A 2IWBA 3FG8A 1FOFA 3N8SA 4G3WA 5HZHA 1UWNX 3MKEA 4E6WA 2R9XA 3Q7VB 4PM8A 3M2JA 3Q7VA 2WKIA 2WKPA 3VP1A 3D3OA 3BFEA 4U0XA 3BW6A 4GD6A 3B42A 3JYIA 2Y2JA 5HD5A 3I7JA 3PTEA 1G68A 3GRJA 1NY0A 2WGIA 2V8FA 1ES5A 1K57A 1MXOA 1G5UA 1OJ5A 2PR6A 1HZOA 3CUEC 1OTBA 1YSPA 2V1ZA 2Y8HA 1JWZA 1VETB 4YINA 1K6SA 4DE1A 3T4TA 1S6RA 2VJWA 3F1NA 4YWZA 1IELA 4EBPA 2HP9A 2JKTI 3LFVA 3P09A 5TBMB 3H7WA 3IS2B 2HDUA 5DFYA 4JPMA 2ZL1B 2MJ6A 4EXOA 3IS2A 3IXBA 1E3UD 3LGOA 4BD1A 3ZCZA 1XA7A 4PKYG 1L2SA 5GLCA 2ZL1A 5E2GA 5M19A 5IS1A 4N92A 4P87A 5DVAA 1AWIA 4ZRRA 2WKEA 1L3LA 3OPRA 4UA9A 3UE0A 3UDXA 1WA9A 3CUEA 2WKRA 3UMDA 1W8YA 1V9ZA 4G3KA 4BBTA 2V8CA 4OLDA 5FAOA 3EQVA 4UA6A 2DMWA 2KLIA 1CF0A 4ID4A 3ZHHA 3BRMA 4CLCE 4UHUA 3IHBA 1VM1A 4B93A 1ESUA 2V0WA 2L4RA 1JWVA 3DTMA 4Y15A 5L07A 5L8MA 2W0NA 3SW1A 1PNEA 3H82B 1I2WA 5F82A 4LV2A 5EVEA 2OAQ1 3NOUC 3Q07A 3R7WB 4UEYA 3LY4A 1PI4A 1P0ZA 4Q0JA 4BL2A 4GKUA 4F94A 4EESA 5FA7A 4GNUA 4LRZE 3V67A 5K5BA 4QD4A 4B4XA 1L0FA 3N4IA 5EV0A 4BBVA 4MN6A 2QMIA 3UE1A 1SHVA 4NK3A 1NLZA 3WS4A 4ARZB 3PBQA 4X25A 4BQMA 2Y2KA 1EWZA 2JKGA 4EERA 4EW7A 1MZUA 3VV4A 3ZNYA 3MXQA 2Z6DA 3Q81A 4EU0A 2BLSA 4HJ6A 3A0VA 4HP9A 5HAQA 3QP2A 1XKZA 3LICA 3FPWA 4WM9A 5EM0A 3IWIA 2ZM2A 2WKHA 1GHIA 1HLUP 5HAIA 2WADA 1PFLA 3MZEA 3UPPA 3IXHA 1XJ4A 4RA7A 5IHVA 5FQJA 3B47A 2D01A 4LFUA 1ERMA 1NJ4A 5HD3A 3T4OA 5FEGA 1S1YA 1ACFA 4HH2A 1YM1A 4QWOA 4LRXC 4HQAA 1ES3A 5M18A 1IYSA 4RYEA 4HOIA 4OONA 4GW9A 4G3VA 4CQHA 5CHUA 2XD5A 1G28A 2LB9A 3EQUA 1XX2A 3MXSA 1GSVA 4F3LA 1FSYA 2HZ5A 3NI9A 4E6XA 2QJ7A 1Q2PA 5HL6A 3E2LA 5CTMA 1BZAA 5E2EA 1PYYA 5FQMA 1GSWA 3PBNA 1SZVA 3V3SA 3LCEA 4FCFA 3VOYA 4CJNA 4R3AA 3N7WA 3RFBA 1G6AA 1RP5A 2PRFA 4OP5A 1PIOA 2XFSA 3OPLA 2HV1A 4OH0A 1NZUA 3ZQ5A 1YKDA 3UY6A 5KIZA 4KG5A 4OVDA 1XJ3A 5AQ7A 3C8CA 3HJKA 3MQ0A 1LL5A 2HPBA 1NXYA 2EXBA 5CGWA 2W1TA 4UQIS 4IUHA 1DY6A 1VEUA 3CWFA 2ZC7A 4WYYA 2QZ6A 2C6WB 1W7FA 3WRZA 3DBAA 3QP8A 4NXFA 1TDLA 4X6TA 4XUZA 4Y0TA 2B18A 2Y59A 4ETZA 1HVBA 3IX4A 3BFFA 3BY8A 4QB8A 2WZZA 5MC7A 2VV7A 4AFIA 5I5LA 2QKPA 4CLCD 3A3IA 2HF6A 5JYPA 2Y2LA 1TS8A 2XA7M 5GHXA 4K91A 5EVIA 4ETXA 3NBLA 3NC8A 4OPQA 5CGSA 1IYQA 2P9VB 3HCYA 3IX3A 3RJUA 2P08A 3QNBA 2HJEA 3PAGA 1IFQA 3O5YA 5EUAA 1MWRA 4ZTKA 3G31A 4WMCA 1GHMA 3GV9A 3IXGA 4PM7A 4IHQA 3P98A 1LLBA 4GB7A 5C5KA 4X53A 5CHJA 1FCOA 5J3WA 2JKFA 3GDIA 4HBUA 4Y0UA 5E2FA 3E0YA 2A3UA 3MSHA 3AGDA 1K4FA 1FILA 2R78A 4WZ5C 1F98A 1Z6FA 4KQQA 5EE8A 1JVJA 5FEFA 3G6OA 2XEPA 4FSFA 3CHWP 1H5XA 2GX5A 2VGLM 2PD7A 1IYOA 2YKFA 4MMNA 1MBLA 4H6JB 4XXRA 1FR1A 1FCMA 4OOLA 3GTCA 4NG2A 3M6BA 2VKSA 2VZWA 4OOYA 3U2AA 1BUEA 5A90A 5IT5A 2FZ0A 2QHKA 3T4JA 3LY3A 4OQ0A 3JVUA 4ESPA 1YLZA 3ZG9B 1DJCA 4WZ5A 1MPLA 3S7PA 5HFOA 4WELA 5CERA 1YMXA 4JGPA 4DN0A 3BFDA 5KSCA 1EW0A 4R70A 1D1JA 3KO6A 3ZYTA 3WRTA 5DKLA 4U3TA 1Q2QA 4UAAA 3C7UA 3KSHA 5L10A 3BECA 2OWHA 2ZMAA 2PBDP 2EWWA 4QHCA 3H9WA 2LB5A 2XFTA 4WEJA 1HTZA 2EA9A 5HX9A 2W3FA 5DFXA 4WL9A 3WWXA 1KOUA 1G6OA 2OWJA 3K2NA 2WKQA 2ZQ7A 3W2ZA 2W3GA 5GHZA 1VHMA 4FUWA 3BJNA 2G2UA 1ONHA 4RQ9A 2VLGA 3E2KA 3FPVA 1K38A 1CJFA 3MMHA 4HI4A 1N9OA 3LI8A 4IBRA 4B4ZA 3LR5A 1SDNA 5GHYA 2E8IA 3FV7A 4H8RA 3GMWA 3CPTB 4R4SA 1CI9A 2ZQ8A 4KZ6A 3CMZA 1GSXA 3IQAA 1LSVA 1A0KA 2HGVA 3MBZA 4O8GA 2RCXA 4PAUA 3TSGA 4IEDA 3VE3A 3NJAA 3VP0A 2QPNA 4X1LA 2ZJ9A 4PHTA 1XXMA 2RL3A 4N9KA 1LI9A 4MDZA 4MN7A 1ERQA 4S2MA 3TJZC 3PBTA 3OZHA 4XUXA 1MKIA 1XFNA 3PR6A 1S67L 3BQAA 4GZBA 5EOOA 2Y2GA 5G18A 1CEGA 1ZG6A 5FASA 3LIAA 4NEED 4S2IA 4LCLA 3LUQA 5A93A 1WYCA 5GL9A 1Z09A 1YLTA 5IU1A 4D2OA 3UE3A 3HUMA 4HJ3A 4O0PA 2NUPC 4OPYA 4YOFA 5L2FA 4R38A 3ZG8B 2NUTC 3NDEA 4X1MA 3G2YA 3RXWA 4Y17A 1ES2A 2XR0A 3ZG7B 2A24B 2PAVP 1PW8A 1BTLA 2JKTM 2HDQA 3FZCA 4E3IA 2J8YA 1VETA 3V3RA 5FAPA 4I38A 1PI5A 5DJTA 3F1OB 3W4PA 1IKGA 4M4XA 3UNWA 3S4XA 1C3BA 3F1OA 2WGWB 2ZQCA 3P01A 4GS9B 1TS7A 5TBMA 1XGJA 4LCMA 4UA7A 4WLAA 2C5WB 3E4PA 1XPBA 2KDKA 1BLPA 5TJJA 3IH9A 2BTFP 5AQBA 4JF4A 4HJ4A 5D3OA 4L9EA 3CAXA 3PBOA 5EVLA 2QYBA 3ZVTA 3FYZA 3MQQA 2H28A 2X02A 5E2HA 3NCKA 2XSSA 5F1FA 3U4LP 1HD8A 2EWVA 3CI6A 3PXPA 3R4KA 3RH8B 2VV6A 4ZJ1A 2I9VA 3HJIA 4JGQA 2VX8A 2XLNA 3GQZA 3H82A 1OTIA 2KX6A 3MS6A 3BEBA 3NOPC 5EFWA 3R7WA 1F9IA 3HLFA 5DTKA 3SS3A 3V50A 3VSLA 2O0YA 1T18A 3A3EA 3IF6C 2Y2PA 4KZAA 4EUZA 3E98A 3BY9A 4BBUA 1MWTA 1ODVA 2Y2MA 3LR0A 3MFDA 3WS5A 1BLSA 1CEFA 2V2FF 1F5MA 2ZM0A 2O9BA 1YT4A 4U0TA 1H8MA 3C2WA 1TS0A 4ARZA 2B02A 5HWVA 5F5YA 3FKVA 4KUKA 1PWCA 2K7SA 1FQGA 1DP9A 1YLYA 4PM9A 4S2NC 1W63M 5I94A 4K0WA 1K0KA 3BM6A 5EOEA 2WAFA 3IF6B 4C3QA 3TRCA 2V0UA 4WEKA 4PM6A 2OOLA 3QNCA 4R6LA 5F69A 1XJ2A 1NWZA 4IVIA 3ZVWA 1ESIA 4LGWA 5AJGA 4GHIB 3ISGA 3LI9A 3VFFA 3HREA 4YNRA 4MNRA 1I2SA 3T12B 1QMEA 2JHEA 2JC7A 3LO7A 3SS5A 2H0TA 5HW3A 4JLFA 1PWGA 4KZ5A 3O3VA 4NXGA 4N9LA 5TGFA 3SS4A 5AQ9A 2EX6A 4S2NA 5AVEA 2L0WA 1MKMA 2W3EA 2B95A 2EFXA 2EX2A 1L0DA 2VGKA 3K3CA 5GLAA 3IBJA 3LR3A 3OC2A 4KQRA 2EX9A 5FSRA 3JVVA 1SKOB 2IWCA 4GDBA 4PPRA 3C5AA 1ES4A 2W3HA 4PM5A 1N9NA 4ZBEA 3SH9A 3QP5A 4OPZA 4NXEA 1ZHHB 3S22A 2WUQA 2Y2QA 2V20A 2J3TD 1YPRA 1XFQA 4LLOB 4BLMA 3NIAA 3IF5A 4HY8A 1D7EA 3Q7ZA 4EETB 3CLOA 3TW8A 5CX7A 2GDNA 4NETA 4L9FA 1V9YA 3C30A 3MQOA 5A8BA 3LIFA 4GLQA 3PAEA 3OLOA 3VOLA 3ITAA 3LEZA 1RGYA 2XA7S 3T1QB 4QU3A 4PKYA 3FKWA 3LIEA 1YSQA 1VB6A 3VSKA 3GVBA 2G2WA 1ZKJA 2PR5A 4CLCB 4DDSA 3IX8A 3QP4A 4ZJ2A 1STZA 4JF5A 3CITA 4Y2FA 4LPZA 2J9PA 2K31A 3UB5P 1W8QA 4S2PA 4Y7PA 4O7DA 1DP6A 4E3NA 1EROA 5FQKA 4RX2A 2PU4A 4OP8A 2FFFB 2P9VA 1XP4A 2ACGA 2YKHA 2PBYA 4FOFA 1KGFA 4A5RA 3DTKA 3O88A 1KGGA 2JN7A 5EVID 1BLHA 4MBHA 2BG1A 3HLWA 4E04A 3GR2A 4Y13A 5KZHA 2Z6CA 2Y55A 1NRJA 2HJ9C 3OCLA 4HHDA 1OPXA 1K54C 5FL3A 3VP3A 3MZDA 2VGLS 1IKIA 3CJMA 2VGJA 5DTSA 2PHYA 1BYWA 2W27A 2JBFA 4WMCD 1GCEA 3G32A 2INWA 4JXWA 1S66L 1JNUA 2Z2LB 2OAP1 3AGFA 2Q9NA 2XROA 3KX0X 4KZ4A 2L1MA 3VMAA 4B9OA 4Z9QA 3GECA 1ZG4A 3HLDA 4GDNA 1S0WA 3UN7A 1JWPA 4H6JA 2HP5A 4BD0A 1TD5A 5FAQA 4DMZA 3N8RA 4E3MA 4ZJ3A 2I72A 5FI2A 4QY6A 2OSUA 4I39A 4B88A 2H5SA 3PHYA 1K54A 4GJ4A 2UWXA 3A3FA 3EGXC 3HLGA 3B3XA 1ALQA 1U60A 3UPOA 3D4FA 4IVKA 2J3WA 3K3DA 4BL3A 4P6ZM 3DWKA 4I3AA 1TEMA 1YLJA 3T1XA 1ONGA 1OT9A 3O87A 3UPNA 3S7NA 1E4DA 1FR6A 3PBSA 1K6RA 4II7A 2V1BA 1GA0A 2D02A 1E25A 1FSWA 2ZOHA 4I3IA 1UWPX 3DW0A 4GD8A 3T4KA 3ZNTA 3M6HA 2JKRM 3G30A 3ZG5A 1H8YA 4MEZA 5GLBA 3A3DA 1JTGA 3ZG0A 1LT0A 5DKKA 3IBRA
chains in the Genus database with same CATH topology
2BLSA 4DE0A 4PMAA 1PI5A 5DF9A 4E3OA 5HAQA 1XKZA 4QY5A 4DF6A 1AXBA 3W4PA 1IKGA 4WM9A 3IWIA 1Y54A 2XDMA 3UNWA 3S4XA 1C3BA 4WBGA 1GA9A 2ZM2A 2WKHA 4ZDXA 5EVIB 1GHIA 1N9BA 5HAIA 2WADA 2WGWB 3HUNA 5CEDA 2XF3A 2ZQCA 1K56A 3MZEA 4KZ9A 3UPPA 4JXVA 1XGJA 5M1AA 2ZD8A 2ZC5B 3IXHA 4LCMA 4S2LA 1L0EA 4RA7A 2DRWA 3HLEA 5IHVA 2H0YA 3Q82A 4UA7A 3FWLA 2C5WB 1M40A 4L0LA 5FQJA 1SDEA 1XPBA 1K55C 2B5RA 4R0QA 3IHAA 1BLPA 3VOZA 3IH9A 5AQBA 4BENA 1CI8A 4JF4A 1ERMA 1NJ4A 1J9MA 5D3OA 1YM1A 3AGEA 3PBOA 5EVLA 4Y0OA 1ES3A 1I5QA 4FH4A 5M18A 3ZVTA 1IYSA 3FYZA 3N6IA 4RYEA 4OONA 4KZ7A 1NYMA 1XA1A 5CHUA 2OLUA 2X02A 4JKTA 4RX3A 2XD5A 1H8ZA 5E2HA 3NCKA 5F1FA 3SOIA 2DNSA 4JF6A 1HD8A 3EQUA 3VP4A 5J8XA 1XX2A 3MXSA 4E3KA 4C6YA 1NYYA 4KG2A 2J7VA 1FSYA 3NI9A 4E6XA 4EBNA 1Q2PA 2JE5A 2HP6A 3E2LA 5CTMA 3RXXA 1BZAA 5E2EA 1PYYA 3MZFA 5FQMA 3GSGA 4WZ4A 3G35A 4ZJ1A 1JTDA 1KGEA 3PBNA 3V3SA 3LCEA 4FCFA 3VOYA 4OQIA 1FCNA 4CJNA 5CEBA 3N7WA 2Y2IA 1G6AA 1M6KA 1XGIA 2XLNA 5CRFA 3GQZA 3HUOA 1RP5A 5JYOA 3W8KA 2Q9MA 4OP5A 1PIOA 1K55A 2WK0A 2ZC4B 3BEBA 4GN2A 2XFSA 3OPLA 1LI0A 3HLFA 2Y2OA 4DE2A 5DTKA 4OH0A 1NZUA 3SS3A 3UY6A 3V50A 3CG5A 3VSLA 3A3JA 4DXCA 4C75A 3A3EA 3IF6C 4EQIA 3ZDJA 2Y2PA 4KG5A 1PW1A 4KENB 4R4RA 4DE3A 4OVDA 4DXBA 4KZAA 5AQ7A 2XK1A 4EUZA 1NZOA 2IWDA 4P6BA 2Y2NA 2J9OA 2H10A 1MWTA 1LL5A 2HPBA 1NXYA 2EXBA 2Y2MA 5CGWA 4MLLA 3ZGAB 3MFDA 3WS5A 5KMWA 1BLSA 2Y4AA 1CEFA 1KDSA 2V2FF 5F83A 3W4QA 2ZM0A 5KSHA 4IBXA 1K25A 3G4PA 5DTTA 1YT4A 1DY6A 4JXSA 1YQSA 1YLPA 4U0TA 3NY4A 2ZC7A 5EECA 4WYYA 3TG9A 2XD1A 1L0GA 2ZQ9A 2P74A 1ZC2A 2QZ6A 2C6WB 1SKFA 5U47A 1W7FA 1BULA 2Y2HA 2OV5A 3WRZA 3FKVA 2CC1A 1TDLA 1WYBA 4N1XA 4OQHA 4X6TA 4XUZA 5HAPA 1PWCA 4KG6A 4Y0TA 1FQGA 4PM9A 1YLYA 2Y59A 1HVBA 4DDYA 4M3KA 4S2NC 4X68A 3BFFA 5I94A 5DF8A 4K0WA 3BM6A 5EOEA 5FQQA 2WAFA 4QB8A 2WZZA 3W4OA 4LV1A 3IF6B 4C3QA 1O7EA 4WEKA 4PM6A 4X55A 2JCHA 2OLVA 3A3IA 3QNCA 5JYPA 3C4OA 3VP2A 4KQOA 1O07A 2Y2LA 4DKIA 5GHXA 3DWZA 1NRFA 4K91A 5EVIA 3NBLA 2WGWA 3NC8A 5CGXA 1WE4A 4IVIA 4OPQA 3BLSA 1RCJA 3ZVWA 3IT9A 1ESIA 1E3UA 5CGSA 1IYQA 2P9VB 5AQAA 3TOIA 3IXDA 4ZAMA 3ISGA 1DJBA 3VFFA 3RJUA 1MWSA 3QNBA 3VFHA 5DF7A 3HREA 3PAGA 4MNRA 1I2SA 2WGVA 1QMEA 5EUAA 3G34A 1K56D 1MWRA 4ZTKA 2JC7A 3LO7A 1GHPA 3G31A 2H0TA 4WMCA 3SS5A 1GHMA 5HW3A 1YMSA 3GV9A 3IXGA 4PM7A 1MWUA 4JLFA 1PWGA 3P98A 4KZ5A 3O3VA 1SCWA 3MXRA 4N9LA 5TGFA 3UO9A 1LLBA 3SS4A 1TDGA 2ZM8A 4GB7A 4P0MA 4X53A 5CHJA 5AQ9A 3V39A 1FCOA 2EX6A 4S2NA 5GLDA 3ITBA 4DRTA 4HBUA 4Y0UA 5E2FA 2EFXA 4LV3A 2EX2A 1L0DA 2A3UA 4HEFA 2VGKA 1BT5A 3AGDA 1K4FA 2XQZA 4QJGA 4WZ5C 5FI7A 1Z6FA 5GLAA 4JBFA 4KQQA 2ZQAA 4X56A 3OCNA 3BFCA 3OC2A 4KQRA 4R23A 3OPPA 5EE8A 1JVJA 2EX9A 5FSRA 2XEPA 3M2KA 2IWCA 2XGNA 4GDBA 4FSFA 4RVAA 4PPRA 2EXAA 1KVLA 5FQIA 1H5XA 1RGZA 3C5AA 1ES4A 5A91A 3QHYA 4PM5A 1KE3A 4K0XA 4ZBEA 3S1YA 1IYOA 3SH7A 3SH9A 4GOGA 4OPZA 5A92A 3HLCA 1MBLA 4XXRA 1EI5A 2R9WA 1FR1A 4MBFA 2ZC6B 1K57C 3HL9A 3S22A 1FCMA 1W5DA 1VQQA 2WUQA 2Y2QA 1IEMA 2V20A 3GTCA 3PBRA 4LENA 4OOLA 3M6BA 5FQ9A 5BOHA 2WZXA 2Z2MB 1IYPA 2A49A 5FI6A 4KZBA 4OOYA 5CHMA 4BLMA 3NIAA 1QMFA 1BUEA 2WAEA 3IF5A 5A90A 1OMEA 3Q7ZA 5HARA 4E3JA 2FFYA 4OLGA 3CZDA 5TR7A 2IWBA 3LY3A 4OQ0A 5F1GA 1TVFA 5E43A 1FOFA 3N8SA 2GDNA 4NETA 1KE4A 3MKEA 4E6WA 2R9XA 3BLMA 3Q7VB 4PM8A 1YLZA 3ZG9B 1DJCA 4OQGA 3IWQA 3PAEA 4WZ5A 1MPLA 3M2JA 5HFOA 4WELA 4YFMA 5CERA 2HDSA 2WKIA 1YMXA 3Q7VA 1KVMA 3ITAA 3LEZA 3VP1A 2ZQDA 3BFDA 4FH2A 3BFEA 1RGYA 2EFUA 5KSCA 4U0XA 4GD6A 3O86A 4QU3A 3JYIA 3WRTA 2Y2JA 3FKWA 3I7JA 3PTEA 3VSKA 1G68A 3GRJA 4KZ3A 5HL1A 4E3LA 3GVBA 1NY0A 2WGIA 4U3TA 1Q2QA 1ES5A 2G2WA 2ZC3B 3NDGA 4UAAA 1K57A 3C7UA 1MXOA 1ZKJA 3BECA 3IWOA 4DDSA 2ZMAA 4CPKA 4ZJ2A 4OKPA 4QHCA 2Y91A 1HZOA 4JF5A 2XFTA 5CTNA 3IF6A 4WEJA 3C4PA 2V1ZA 1HTZA 1JWZA 3HLBA 5HX9A 4S2JA 2J9PA 5FDHA 4YINA 1K6SA 3WWXA 1W8QA 4S2PA 4Y7PA 3V5MA 4DE1A 4O7DA 2X71A 4E3NA 1EROA 2X01A 4HBTA 5FQKA 1YLWA 2ZQ7A 3IH8A 4RX2A 1S6RA 5GHZA 1IELA 2PU4A 4OP8A 2FFFB 4EBPA 2G2UA 1ONHA 2HP9A 2P9VA 1XP4A 3E2KA 2EX8A 1K38A 3P09A 4R3JA 1CK3A 4Q8IA 2PBYA 1BSGA 1KDWA 1KGFA 4A5RA 2HDUA 3O88A 1KGGA 5EVID 1BLHA 2PU2A 4IBRA 4JPMA 4MBHA 4B4ZA 2BG1A 3HLWA 3IXBA 1E3UD 1W79A 3GR2A 1KE0A 3ZCZA 4BD1A 1XA7A 5KZHA 1L2SA 2Y55A 5GLCA 3N8LA 3OCLA 3BFGA 1SDNA 5E2GA 5GHYA 5M19A 2E8IA 1K54C 3FV7A 4H8RA 4N92A 3VP3A 3GMWA 4R4SA 1N4OA 4P87A 1CI9A 3MZDA 2ZQ8A 4KZ6A 3OPHA 5DVAA 3CMZA 1IKIA 3CJMA 3IQAA 1DJAA 2WKEA 3WS0A 2VGJA 4EWFA 3OPRA 4UA9A 3UE0A 3MBZA 1PZPA 5DTSA 2JBFA 4WMCD 1GCEA 3G32A 2RCXA 3UDXA 3TSGA 5CXWA 4IEDA 4JXWA 1W8YA 1K4EA 2Z2LB 2ZLYA 4JXGA 3VP0A 4OLDA 5FAOA 2QPNA 2Q9NA 3AGFA 3EQVA 4UA6A 3UDIA 2ZJ9A 4KZ4A 3UDFA 1XXMA 5CECA 2RL3A 4ID4A 4EV4A 4N9KA 3ZHHA 1LI9A 3HVFA 3VMAA 1ERQA 3BRMA 4Z9QA 4S2MA 4UHUA 3IHBA 1VM1A 3PBTA 3OZHA 4X69A 1ESUA 1ZG4A 3HLDA 4GDNA 1S0WA 4XUXA 1JWVA 3DTMA 1MKIA 3UN7A 1JWPA 2HP5A 4BD0A 4GZBA 4S2KA 4BJPA 5FAQA 1PWDA 1I2WA 3N8RA 5EOOA 5F82A 4LV2A 4E3MA 4ZJ3A 2Y2GA 2I72A 5FI2A 5G18A 3Q07A 4QY6A 3HBRA 1CEGA 1ZG6A 3LY4A 2OSUA 4EBLA 5FASA 4R1GA 4B88A 2H5SA 4S2IA 1K54A 2UWXA 1PI4A 3A3FA 4LCLA 4OOMA 1WYCA 3HLGA 5A93A 1PZOA 3B3XA 3C7VA 1ALQA 2DCFA 1U60A 4S2OA 5GL9A 3UPOA 5EPHA 1YLTA 2WYXA 4D2OA 3D4FA 3WS1A 3UE3A 4IVKA 3BYDA 4BL2A 3HUMA 1LHYA 4GKUA 4MBKA 4BL3A 4F94A 4P85A 4GNUA 5FATA 3DWKA 5FA7A 1TEMA 1YLJA 2HDRA 4OPYA 5L2FA 1LL9A 1ONGA 3O87A 5EVIC 3ZG8B 3UPNA 4QD4A 4FD8A 1E4DA 3NDEA 1FR6A 4B4XA 1L0FA 3PBSA 3N4IA 1K6RA 3G2YA 3RXWA 3WS2A 5TFQA 4LV0A 1ES2A 2XR0A 2QMIA 1GA0A 3UE1A 3ZG7B 1SHVA 1E25A 1FSWA 4NK3A 1BLCA 4HESA 3WS4A 3PBQA 3Q1FA 1MY8A 3DW0A 4GD8A 1PW8A 1BTLA 3G2ZA 2HDQA 2XH9A 3FZCA 4OPRA 3ZNTA 3M6HA 4KZ8A 4BQMA 2Y2KA 3G30A 4R3BA 1EWZA 3ZG5A 3ZFZA 4N1HA 1H8YA 4MEZA 5GLBA 3SH8A 4E3IA 2J8YA 3A3DA 1JTGA 3V3RA 3MKFA 3ZG0A 3ZNYA 5FAPA 3Q81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BLS A;  4DE0 A;  4PMA A;  1PI5 A;  5DF9 A;  4E3O A;  5HAQ A;  1XKZ A;  4QY5 A;  4DF6 A;  1AXB A;  3W4P A;  1IKG A;  4WM9 A;  3IWI A;  1Y54 A;  2XDM A;  3UNW A;  3S4X A;  1C3B A;  4WBG A;  1GA9 A;  2ZM2 A;  2WKH A;  4ZDX A;  5EVI B;  1GHI A;  1N9B A;  5HAI A;  2WAD A;  2WGW B;  3HUN A;  5CED A;  2XF3 A;  2ZQC A;  1K56 A;  3MZE A;  4KZ9 A;  3UPP A;  4JXV A;  1XGJ A;  5M1A A;  2ZD8 A;  2ZC5 B;  3IXH A;  4LCM A;  4S2L A;  1L0E A;  4RA7 A;  2DRW A;  3HLE A;  5IHV A;  2H0Y A;  3Q82 A;  4UA7 A;  3FWL A;  2C5W B;  1M40 A;  4L0L A;  5FQJ A;  1SDE A;  1XPB A;  1K55 C;  2B5R A;  4R0Q A;  3IHA A;  1BLP A;  3VOZ A;  3IH9 A;  5AQB A;  4BEN A;  1CI8 A;  4JF4 A;  1ERM A;  1NJ4 A;  1J9M A;  5D3O A;  1YM1 A;  3AGE A;  3PBO A;  5EVL A;  4Y0O A;  1ES3 A;  1I5Q A;  4FH4 A;  5M18 A;  3ZVT A;  1IYS A;  3FYZ A;  3N6I A;  4RYE A;  4OON A;  4KZ7 A;  1NYM A;  1XA1 A;  5CHU A;  2OLU A;  2X02 A;  4JKT A;  4RX3 A;  2XD5 A;  1H8Z A;  5E2H A;  3NCK A;  5F1F A;  3SOI A;  2DNS A;  4JF6 A;  1HD8 A;  3EQU A;  3VP4 A;  5J8X A;  1XX2 A;  3MXS A;  4E3K A;  4C6Y A;  1NYY A;  4KG2 A;  2J7V A;  1FSY A;  3NI9 A;  4E6X A;  4EBN A;  1Q2P A;  2JE5 A;  2HP6 A;  3E2L A;  5CTM A;  3RXX A;  1BZA A;  5E2E A;  1PYY A;  3MZF A;  5FQM A;  3GSG A;  4WZ4 A;  3G35 A;  4ZJ1 A;  1JTD A;  1KGE A;  3PBN A;  3V3S A;  3LCE A;  4FCF A;  3VOY A;  4OQI A;  1FCN A;  4CJN A;  5CEB A;  3N7W A;  2Y2I A;  1G6A A;  1M6K A;  1XGI A;  2XLN A;  5CRF A;  3GQZ A;  3HUO A;  1RP5 A;  5JYO A;  3W8K A;  2Q9M A;  4OP5 A;  1PIO A;  1K55 A;  2WK0 A;  2ZC4 B;  3BEB A;  4GN2 A;  2XFS A;  3OPL A;  1LI0 A;  3HLF A;  2Y2O A;  4DE2 A;  5DTK A;  4OH0 A;  1NZU A;  3SS3 A;  3UY6 A;  3V50 A;  3CG5 A;  3VSL A;  3A3J A;  4DXC A;  4C75 A;  3A3E A;  3IF6 C;  4EQI A;  3ZDJ A;  2Y2P A;  4KG5 A;  1PW1 A;  4KEN B;  4R4R A;  4DE3 A;  4OVD A;  4DXB A;  4KZA A;  5AQ7 A;  2XK1 A;  4EUZ A;  1NZO A;  2IWD A;  4P6B A;  2Y2N A;  2J9O A;  2H10 A;  1MWT A;  1LL5 A;  2HPB A;  1NXY A;  2EXB A;  2Y2M A;  5CGW A;  4MLL A;  3ZGA B;  3MFD A;  3WS5 A;  5KMW A;  1BLS A;  2Y4A A;  1CEF A;  1KDS A;  2V2F F;  5F83 A;  3W4Q A;  2ZM0 A;  5KSH A;  4IBX A;  1K25 A;  3G4P A;  5DTT A;  1YT4 A;  1DY6 A;  4JXS A;  1YQS A;  1YLP A;  4U0T A;  3NY4 A;  2ZC7 A;  5EEC A;  4WYY A;  3TG9 A;  2XD1 A;  1L0G A;  2ZQ9 A;  2P74 A;  1ZC2 A;  2QZ6 A;  2C6W B;  1SKF A;  5U47 A;  1W7F A;  1BUL A;  2Y2H A;  2OV5 A;  3WRZ A;  3FKV A;  2CC1 A;  1TDL A;  1WYB A;  4N1X A;  4OQH A;  4X6T A;  4XUZ A;  5HAP A;  1PWC A;  4KG6 A;  4Y0T A;  1FQG A;  4PM9 A;  1YLY A;  2Y59 A;  1HVB A;  4DDY A;  4M3K A;  4S2N C;  4X68 A;  3BFF A;  5I94 A;  5DF8 A;  4K0W A;  3BM6 A;  5EOE A;  5FQQ A;  2WAF A;  4QB8 A;  2WZZ A;  3W4O A;  4LV1 A;  3IF6 B;  4C3Q A;  1O7E A;  4WEK A;  4PM6 A;  4X55 A;  2JCH A;  2OLV A;  3A3I A;  3QNC A;  5JYP A;  3C4O A;  3VP2 A;  4KQO A;  1O07 A;  2Y2L A;  4DKI A;  5GHX A;  3DWZ A;  1NRF A;  4K91 A;  5EVI A;  3NBL A;  2WGW A;  3NC8 A;  5CGX A;  1WE4 A;  4IVI A;  4OPQ A;  3BLS A;  1RCJ A;  3ZVW A;  3IT9 A;  1ESI A;  1E3U A;  5CGS A;  1IYQ A;  2P9V B;  5AQA A;  3TOI A;  3IXD A;  4ZAM A;  3ISG A;  1DJB A;  3VFF A;  3RJU A;  1MWS A;  3QNB A;  3VFH A;  5DF7 A;  3HRE A;  3PAG A;  4MNR A;  1I2S A;  2WGV A;  1QME A;  5EUA A;  3G34 A;  1K56 D;  1MWR A;  4ZTK A;  2JC7 A;  3LO7 A;  1GHP A;  3G31 A;  2H0T A;  4WMC A;  3SS5 A;  1GHM A;  5HW3 A;  1YMS A;  3GV9 A;  3IXG A;  4PM7 A;  1MWU A;  4JLF A;  1PWG A;  3P98 A;  4KZ5 A;  3O3V A;  1SCW A;  3MXR A;  4N9L A;  5TGF A;  3UO9 A;  1LLB A;  3SS4 A;  1TDG A;  2ZM8 A;  4GB7 A;  4P0M A;  4X53 A;  5CHJ A;  5AQ9 A;  3V39 A;  1FCO A;  2EX6 A;  4S2N A;  5GLD A;  3ITB A;  4DRT A;  4HBU A;  4Y0U A;  5E2F A;  2EFX A;  4LV3 A;  2EX2 A;  1L0D A;  2A3U A;  4HEF A;  2VGK A;  1BT5 A;  3AGD A;  1K4F A;  2XQZ A;  4QJG A;  4WZ5 C;  5FI7 A;  1Z6F A;  5GLA A;  4JBF A;  4KQQ A;  2ZQA A;  4X56 A;  3OCN A;  3BFC A;  3OC2 A;  4KQR A;  4R23 A;  3OPP A;  5EE8 A;  1JVJ A;  2EX9 A;  5FSR A;  2XEP A;  3M2K A;  2IWC A;  2XGN A;  4GDB A;  4FSF A;  4RVA A;  4PPR A;  2EXA A;  1KVL A;  5FQI A;  1H5X A;  1RGZ A;  3C5A A;  1ES4 A;  5A91 A;  3QHY A;  4PM5 A;  1KE3 A;  4K0X A;  4ZBE A;  3S1Y A;  1IYO A;  3SH7 A;  3SH9 A;  4GOG A;  4OPZ A;  5A92 A;  3HLC A;  1MBL A;  4XXR A;  1EI5 A;  2R9W A;  1FR1 A;  4MBF A;  2ZC6 B;  1K57 C;  3HL9 A;  3S22 A;  1FCM A;  1W5D A;  1VQQ A;  2WUQ A;  2Y2Q A;  1IEM A;  2V20 A;  3GTC A;  3PBR A;  4LEN A;  4OOL A;  3M6B A;  5FQ9 A;  5BOH A;  2WZX A;  2Z2M B;  1IYP A;  2A49 A;  5FI6 A;  4KZB A;  4OOY A;  5CHM A;  4BLM A;  3NIA A;  1QMF A;  1BUE A;  2WAE A;  3IF5 A;  5A90 A;  1OME A;  3Q7Z A;  5HAR A;  4E3J A;  2FFY A;  4OLG A;  3CZD A;  5TR7 A;  2IWB A;  3LY3 A;  4OQ0 A;  5F1G A;  1TVF A;  5E43 A;  1FOF A;  3N8S A;  2GDN A;  4NET A;  1KE4 A;  3MKE A;  4E6W A;  2R9X A;  3BLM A;  3Q7V B;  4PM8 A;  1YLZ A;  3ZG9 B;  1DJC A;  4OQG A;  3IWQ A;  3PAE A;  4WZ5 A;  1MPL A;  3M2J A;  5HFO A;  4WEL A;  4YFM A;  5CER A;  2HDS A;  2WKI A;  1YMX A;  3Q7V A;  1KVM A;  3ITA A;  3LEZ A;  3VP1 A;  2ZQD A;  3BFD A;  4FH2 A;  3BFE A;  1RGY A;  2EFU A;  5KSC A;  4U0X A;  4GD6 A;  3O86 A;  4QU3 A;  3JYI A;  3WRT A;  2Y2J A;  3FKW A;  3I7J A;  3PTE A;  3VSK A;  1G68 A;  3GRJ A;  4KZ3 A;  5HL1 A;  4E3L A;  3GVB A;  1NY0 A;  2WGI A;  4U3T A;  1Q2Q A;  1ES5 A;  2G2W A;  2ZC3 B;  3NDG A;  4UAA A;  1K57 A;  3C7U A;  1MXO A;  1ZKJ A;  3BEC A;  3IWO A;  4DDS A;  2ZMA A;  4CPK A;  4ZJ2 A;  4OKP A;  4QHC A;  2Y91 A;  1HZO A;  4JF5 A;  2XFT A;  5CTN A;  3IF6 A;  4WEJ A;  3C4P A;  2V1Z A;  1HTZ A;  1JWZ A;  3HLB A;  5HX9 A;  4S2J A;  2J9P A;  5FDH A;  4YIN A;  1K6S A;  3WWX A;  1W8Q A;  4S2P A;  4Y7P A;  3V5M A;  4DE1 A;  4O7D A;  2X71 A;  4E3N A;  1ERO A;  2X01 A;  4HBT A;  5FQK A;  1YLW A;  2ZQ7 A;  3IH8 A;  4RX2 A;  1S6R A;  5GHZ A;  1IEL A;  2PU4 A;  4OP8 A;  2FFF B;  4EBP A;  2G2U A;  1ONH A;  2HP9 A;  2P9V A;  1XP4 A;  3E2K A;  2EX8 A;  1K38 A;  3P09 A;  4R3J A;  1CK3 A;  4Q8I A;  2PBY A;  1BSG A;  1KDW A;  1KGF A;  4A5R A;  2HDU A;  3O88 A;  1KGG A;  5EVI D;  1BLH A;  2PU2 A;  4IBR A;  4JPM A;  4MBH A;  4B4Z A;  2BG1 A;  3HLW A;  3IXB A;  1E3U D;  1W79 A;  3GR2 A;  1KE0 A;  3ZCZ A;  4BD1 A;  1XA7 A;  5KZH A;  1L2S A;  2Y55 A;  5GLC A;  3N8L A;  3OCL A;  3BFG A;  1SDN A;  5E2G A;  5GHY A;  5M19 A;  2E8I A;  1K54 C;  3FV7 A;  4H8R A;  4N92 A;  3VP3 A;  3GMW A;  4R4S A;  1N4O A;  4P87 A;  1CI9 A;  3MZD A;  2ZQ8 A;  4KZ6 A;  3OPH A;  5DVA A;  3CMZ A;  1IKI A;  3CJM A;  3IQA A;  1DJA A;  2WKE A;  3WS0 A;  2VGJ A;  4EWF A;  3OPR A;  4UA9 A;  3UE0 A;  3MBZ A;  1PZP A;  5DTS A;  2JBF A;  4WMC D;  1GCE A;  3G32 A;  2RCX A;  3UDX A;  3TSG A;  5CXW A;  4IED A;  4JXW A;  1W8Y A;  1K4E A;  2Z2L B;  2ZLY A;  4JXG A;  3VP0 A;  4OLD A;  5FAO A;  2QPN A;  2Q9N A;  3AGF A;  3EQV A;  4UA6 A;  3UDI A;  2ZJ9 A;  4KZ4 A;  3UDF A;  1XXM A;  5CEC A;  2RL3 A;  4ID4 A;  4EV4 A;  4N9K A;  3ZHH A;  1LI9 A;  3HVF A;  3VMA A;  1ERQ A;  3BRM A;  4Z9Q A;  4S2M A;  4UHU A;  3IHB A;  1VM1 A;  3PBT A;  3OZH A;  4X69 A;  1ESU A;  1ZG4 A;  3HLD A;  4GDN A;  1S0W A;  4XUX A;  1JWV A;  3DTM A;  1MKI A;  3UN7 A;  1JWP A;  2HP5 A;  4BD0 A;  4GZB A;  4S2K A;  4BJP A;  5FAQ A;  1PWD A;  1I2W A;  3N8R A;  5EOO A;  5F82 A;  4LV2 A;  4E3M A;  4ZJ3 A;  2Y2G A;  2I72 A;  5FI2 A;  5G18 A;  3Q07 A;  4QY6 A;  3HBR A;  1CEG A;  1ZG6 A;  3LY4 A;  2OSU A;  4EBL A;  5FAS A;  4R1G A;  4B88 A;  2H5S A;  4S2I A;  1K54 A;  2UWX A;  1PI4 A;  3A3F A;  4LCL A;  4OOM A;  1WYC A;  3HLG A;  5A93 A;  1PZO A;  3B3X A;  3C7V A;  1ALQ A;  2DCF A;  1U60 A;  4S2O A;  5GL9 A;  3UPO A;  5EPH A;  1YLT A;  2WYX A;  4D2O A;  3D4F A;  3WS1 A;  3UE3 A;  4IVK A;  3BYD A;  4BL2 A;  3HUM A;  1LHY A;  4GKU A;  4MBK A;  4BL3 A;  4F94 A;  4P85 A;  4GNU A;  5FAT A;  3DWK A;  5FA7 A;  1TEM A;  1YLJ A;  2HDR A;  4OPY A;  5L2F A;  1LL9 A;  1ONG A;  3O87 A;  5EVI C;  3ZG8 B;  3UPN A;  4QD4 A;  4FD8 A;  1E4D A;  3NDE A;  1FR6 A;  4B4X A;  1L0F A;  3PBS A;  3N4I A;  1K6R A;  3G2Y A;  3RXW A;  3WS2 A;  5TFQ A;  4LV0 A;  1ES2 A;  2XR0 A;  2QMI A;  1GA0 A;  3UE1 A;  3ZG7 B;  1SHV A;  1E25 A;  1FSW A;  4NK3 A;  1BLC A;  4HES A;  3WS4 A;  3PBQ A;  3Q1F A;  1MY8 A;  3DW0 A;  4GD8 A;  1PW8 A;  1BTL A;  3G2Z A;  2HDQ A;  2XH9 A;  3FZC A;  4OPR A;  3ZNT A;  3M6H A;  4KZ8 A;  4BQM A;  2Y2K A;  3G30 A;  4R3B A;  1EWZ A;  3ZG5 A;  3ZFZ A;  4N1H A;  1H8Y A;  4MEZ A;  5GLB A;  3SH8 A;  4E3I A;  2J8Y A;  3A3D A;  1JTG A;  3V3R A;  3MKF A;  3ZG0 A;  3ZNY A;  5FAP A;  3Q81 A; 
#chains in the Genus database with same CATH topology
 4DE0 A;  4PMA A;  5DF9 A;  4E3O A;  4QY5 A;  1Y54 A;  2XDM A;  4WBG A;  1GA9 A;  3EOI A;  4XT2 B;  4ZDX A;  5HPF A;  2O99 A;  3S7Q A;  5CED A;  1T19 A;  5F68 A;  1K56 A;  4KZ9 A;  2BAS A;  5M1A A;  2ZD8 A;  4S2L A;  3HLE A;  1CQA A;  3FWL A;  1M40 A;  4IJG A;  1K55 C;  3IHA A;  4QPR A;  3VOZ A;  1CI8 A;  3MF0 A;  4MCW A;  3CPT A;  2AVX A;  4Y0O A;  2QWS A;  4FH4 A;  3NOT C;  3N6I A;  1XA1 A;  2OLU A;  4JKT A;  4JGO A;  3UB7 A;  2DNS A;  4JF6 A;  1Y4O A;  3VP4 A;  5J8X A;  1NYY A;  2J7V A;  3MZF A;  1JTD A;  3F1P B;  4OQI A;  1FCN A;  1XGI A;  4HNB A;  5CRF A;  3BQ8 A;  2Q9M A;  1K55 A;  2WK0 A;  4GN2 A;  2QJ5 A;  3FC7 A;  1H0M A;  1OTA A;  3OBF A;  4NKP A;  4D60 A;  4C75 A;  1S4S A;  2V9A A;  4FTX A;  3LYX A;  3L9K A;  4R4R A;  2XK1 A;  1NZO A;  4P6B A;  2J9O A;  3KSI A;  4MLL A;  5KMW A;  2Y4A A;  3W4Q A;  5F83 A;  2UV0 E;  5KSH A;  3G4P A;  5DTT A;  5HPI A;  2G7U A;  3T4S A;  1YQS A;  1YLP A;  3C38 A;  3TG9 A;  2XD1 A;  1L0G A;  2ZQ9 A;  2A24 A;  1T1B A;  5U47 A;  1BUL A;  1TS6 A;  2OV5 A;  1LSX A;  1WYB A;  4OQH A;  4KG6 A;  4O01 A;  4Q0I A;  5HWT A;  3LID A;  5DF8 A;  4LV1 A;  4BWI A;  4X55 A;  2OLV A;  3MR0 A;  1T1C A;  1UGU A;  3C4O A;  4KQO A;  3VP2 A;  4DKI A;  1NRF A;  5HDC A;  2WGW A;  5CGX A;  3F1N B;  1WE4 A;  3BLS A;  4GS9 A;  1E3U A;  2M7U A;  4KQD A;  5AQA A;  3IXD A;  4Z1W A;  3H7W B;  1D06 A;  1MWS A;  5DF7 A;  2WGV A;  4KUO A;  3G34 A;  3BWL A;  5HWW A;  1GHP A;  1YMS A;  1NLY A;  3KSG A;  4DJ2 A;  1SCW A;  3MXR A;  3QP6 A;  3UO9 A;  1TDG A;  4P0M A;  3V39 A;  3ITB A;  4WF0 A;  4HEF A;  2KOI A;  1Y28 A;  4JBF A;  2ZQA A;  3BFC A;  3OPP A;  1OT6 A;  1YAX A;  3NUL A;  3M2K A;  2XGN A;  4RVA A;  2EXA A;  4WN5 A;  5A91 A;  2M7V A;  1KE3 A;  3SH7 A;  4I3J A;  5A92 A;  3MJQ A;  1EI5 A;  2R9W A;  4MBF A;  2ZC6 B;  1N9L A;  1W5D A;  3PBR A;  1IEM A;  5FQ9 A;  2WZX A;  2Z2M B;  3RTY A;  1DRM A;  5CHM A;  1QMF A;  5HAR A;  4Y5F A;  5F1G A;  1TVF A;  5E43 A;  3KYE A;  2IA2 A;  1KE4 A;  3BLM A;  4OQG A;  3IWQ A;  3ICY A;  4YFM A;  2HDS A;  1KVM A;  2ZQD A;  4FH2 A;  2EFU A;  3QP1 A;  3O86 A;  3LIB A;  5HL1 A;  4KZ3 A;  4E3L A;  5EM1 A;  1X0O A;  2ZC3 B;  3NDG A;  2PD8 A;  3IWO A;  4CPK A;  2K2N A;  4OKP A;  2Y91 A;  1IOU A;  5CTN A;  3IF6 A;  3C4P A;  3HLB A;  1MC0 A;  4S2J A;  2CMN A;  5FDH A;  4Y3I A;  3L7H A;  3V5M A;  2X71 A;  5AVF A;  2X01 A;  4HBT A;  1YLW A;  3IH8 A;  5HDD A;  1XJ6 A;  3ULF A;  4GHI A;  2EX8 A;  4R3J A;  1CK3 A;  4Q8I A;  1BSG A;  1KDW A;  2ZMF A;  2J3T C;  1ZTU A;  2PYP A;  1OTE A;  2PU2 A;  3VE4 A;  1W79 A;  1KE0 A;  1W63 Q;  2E8J A;  3N8L A;  3BFG A;  1T1A A;  2Q0O A;  1N4O A;  3OPH A;  5DJU A;  1DJA A;  3WS0 A;  4EWF A;  1PZP A;  5CXW A;  3OOV A;  1K4E A;  2V1A A;  5F6A A;  2ZLY A;  4JXG A;  1DP8 A;  3SZT A;  3UDI A;  3UDF A;  4MN5 A;  5CEC A;  4ME4 A;  4EV4 A;  3E4Q A;  3HVF A;  4F3L B;  1SKO A;  4X69 A;  4I5S A;  2GJ3 A;  4S2K A;  4WUJ A;  1S1Z A;  4BJP A;  2VV8 A;  3TE8 A;  1PWD A;  4CLC C;  3KYZ A;  2M1C A;  1PRQ A;  3HBR A;  3PYP A;  4EBL A;  4R1G A;  3B33 A;  4OOM A;  1PZO A;  3C7V A;  2DCF A;  4S2O A;  5EPH A;  2ZOI A;  2WYX A;  3WS1 A;  3BYD A;  1LHY A;  4MBK A;  4P85 A;  5FAT A;  1P9W A;  2HDR A;  5HSQ A;  2PYR A;  1LL9 A;  5EVI C;  4FD8 A;  2P04 A;  2W1T B;  3WS2 A;  5TFQ A;  1VEU B;  4LV0 A;  3DAV A;  4HH3 A;  3LR4 A;  4HP4 A;  3UB9 A;  1BLC A;  4HES A;  3Q1F A;  1MY8 A;  3G2Z A;  2XH9 A;  4CLC A;  4OPR A;  3D9Y A;  4KZ8 A;  4R3B A;  3ZFZ A;  4N1H A;  2ZBB A;  3SH8 A;  4BMW A;  2VA0 A;  3MKF A;  4L9G A;  2PDR A;  4UQI M;  3EWK A;  4DF6 A;  1AXB A;  3DTE A;  4Q0H A;  3A0R A;  3KYQ A;  2P7J A;  5EVI B;  1N9B A;  3HUN A;  2XF3 A;  3KSF A;  4JXV A;  2ZC5 B;  1L0E A;  2DRW A;  2H0Y A;  3Q82 A;  4L0L A;  1SDE A;  2B5R A;  4R0Q A;  3EGD C;  4BEN A;  1J9M A;  3T4Q A;  1S4R A;  3AGE A;  4EEU A;  1I5Q A;  4KZ7 A;  1NYM A;  4RX3 A;  1H8Z A;  3SOI A;  2J80 A;  3T50 A;  1OJG A;  4E3K A;  4C6Y A;  1TF1 A;  4KG2 A;  1P97 A;  4EBN A;  2JE5 A;  2HP6 A;  3RXX A;  3T1R A;  2PT7 A;  4P6Z S;  3GSG A;  5HDS A;  3EEH A;  4WZ4 A;  3G35 A;  1KGE A;  3S7O A;  5CEB A;  2Y2I A;  1M6K A;  2VEA A;  3HUO A;  5JYO A;  2A2L A;  3W8K A;  5J4E A;  2ZC4 B;  2W3D A;  5G4Z A;  1LI0 A;  2Y2O A;  4DE2 A;  3T4L A;  3CG5 A;  3A3J A;  4DXC A;  1P9R A;  5LBR A;  4EQI A;  3ZDJ A;  1PW1 A;  4KEN B;  4DE3 A;  4DXB A;  2IWD A;  3MFX A;  2Y2N A;  2XRN A;  3UME A;  2H10 A;  3ZGA B;  1KDS A;  1LSW A;  2ZMV A;  4IBX A;  1K25 A;  3UE6 A;  4EQ1 A;  4JXS A;  5EEC A;  3NY4 A;  5J7E A;  2P74 A;  2O9A A;  1ZC2 A;  4GCZ A;  1SKF A;  2Y2H A;  3NHQ A;  2CC1 A;  4N1X A;  5HAP A;  4DDY A;  4M3K A;  4X68 A;  2Y79 A;  5FQQ A;  3W4O A;  4DJ3 A;  2GZA A;  3UB6 A;  1O7E A;  4NXB A;  2JCH A;  1H3Q A;  1O07 A;  4XT2 A;  3LEQ A;  3DWZ A;  1RCJ A;  3IT9 A;  2GNX A;  1OTD A;  3TOI A;  4ZAM A;  4EEP A;  1DJB A;  1J3W A;  3VFH A;  5L09 A;  2JKR I;  3D72 A;  1K56 D;  1FIK A;  2O9C A;  3DTI A;  3A0S A;  3JPU A;  4HIA A;  1MWU A;  2FH5 A;  2W1R A;  2ZM8 A;  1LL8 A;  5GLD A;  4K08 A;  5FDS A;  4DRT A;  3NEC A;  4LV3 A;  1F2K A;  1BT5 A;  2XQZ A;  4QJG A;  5FI7 A;  4X56 A;  3OCN A;  4R23 A;  4LRY C;  3UB8 A;  3P7N A;  5FQI A;  1KVL A;  1RGZ A;  3F1P A;  3QHY A;  4K0X A;  3S1Y A;  4GOG A;  4EUV A;  3HLC A;  1K57 C;  3HL9 A;  1VQQ A;  3E4O A;  4LEN A;  5G4Y A;  5BOH A;  3T1S A;  1IYP A;  2A49 A;  3EEA A;  5FI6 A;  4IUK A;  4KZB A;  4JGR A;  2VK3 A;  2WAE A;  1OME A;  4E3J A;  2FFY A;  4OLG A;  3CZD A;  5TR7 A;  2IWB A;  3FG8 A;  1FOF A;  3N8S A;  4G3W A;  5HZH A;  1UWN X;  3MKE A;  4E6W A;  2R9X A;  3Q7V B;  4PM8 A;  3M2J A;  3Q7V A;  2WKI A;  2WKP A;  3VP1 A;  3D3O A;  3BFE A;  4U0X A;  3BW6 A;  4GD6 A;  3B42 A;  3JYI A;  2Y2J A;  5HD5 A;  3I7J A;  3PTE A;  1G68 A;  3GRJ A;  1NY0 A;  2WGI A;  2V8F A;  1ES5 A;  1K57 A;  1MXO A;  1G5U A;  1OJ5 A;  2PR6 A;  1HZO A;  3CUE C;  1OTB A;  1YSP A;  2V1Z A;  2Y8H A;  1JWZ A;  1VET B;  4YIN A;  1K6S A;  4DE1 A;  3T4T A;  1S6R A;  2VJW A;  3F1N A;  4YWZ A;  1IEL A;  4EBP A;  2HP9 A;  2JKT I;  3LFV A;  3P09 A;  5TBM B;  3H7W A;  3IS2 B;  2HDU A;  5DFY A;  4JPM A;  2ZL1 B;  2MJ6 A;  4EXO A;  3IS2 A;  3IXB A;  1E3U D;  3LGO A;  4BD1 A;  3ZCZ A;  1XA7 A;  4PKY G;  1L2S A;  5GLC A;  2ZL1 A;  5E2G A;  5M19 A;  5IS1 A;  4N92 A;  4P87 A;  5DVA A;  1AWI A;  4ZRR A;  2WKE A;  1L3L A;  3OPR A;  4UA9 A;  3UE0 A;  3UDX A;  1WA9 A;  3CUE A;  2WKR A;  3UMD A;  1W8Y A;  1V9Z A;  4G3K A;  4BBT A;  2V8C A;  4OLD A;  5FAO A;  3EQV A;  4UA6 A;  2DMW A;  2KLI A;  1CF0 A;  4ID4 A;  3ZHH A;  3BRM A;  4CLC E;  4UHU A;  3IHB A;  1VM1 A;  4B93 A;  1ESU A;  2V0W A;  2L4R A;  1JWV A;  3DTM A;  4Y15 A;  5L07 A;  5L8M A;  2W0N A;  3SW1 A;  1PNE A;  3H82 B;  1I2W A;  5F82 A;  4LV2 A;  5EVE A;  2OAQ 1;  3NOU C;  3Q07 A;  3R7W B;  4UEY A;  3LY4 A;  1PI4 A;  1P0Z A;  4Q0J A;  4BL2 A;  4GKU A;  4F94 A;  4EES A;  5FA7 A;  4GNU A;  4LRZ E;  3V67 A;  5K5B A;  4QD4 A;  4B4X A;  1L0F A;  3N4I A;  5EV0 A;  4BBV A;  4MN6 A;  2QMI A;  3UE1 A;  1SHV A;  4NK3 A;  1NLZ A;  3WS4 A;  4ARZ B;  3PBQ A;  4X25 A;  4BQM A;  2Y2K A;  1EWZ A;  2JKG A;  4EER A;  4EW7 A;  1MZU A;  3VV4 A;  3ZNY A;  3MXQ A;  2Z6D A;  3Q81 A;  4EU0 A;  2BLS A;  4HJ6 A;  3A0V A;  4HP9 A;  5HAQ A;  3QP2 A;  1XKZ A;  3LIC A;  3FPW A;  4WM9 A;  5EM0 A;  3IWI A;  2ZM2 A;  2WKH A;  1GHI A;  1HLU P;  5HAI A;  2WAD A;  1PFL A;  3MZE A;  3UPP A;  3IXH A;  1XJ4 A;  4RA7 A;  5IHV A;  5FQJ A;  3B47 A;  2D01 A;  4LFU A;  1ERM A;  1NJ4 A;  5HD3 A;  3T4O A;  5FEG A;  1S1Y A;  1ACF A;  4HH2 A;  1YM1 A;  4QWO A;  4LRX C;  4HQA A;  1ES3 A;  5M18 A;  1IYS A;  4RYE A;  4HOI A;  4OON A;  4GW9 A;  4G3V A;  4CQH A;  5CHU A;  2XD5 A;  1G28 A;  2LB9 A;  3EQU A;  1XX2 A;  3MXS A;  1GSV A;  4F3L A;  1FSY A;  2HZ5 A;  3NI9 A;  4E6X A;  2QJ7 A;  1Q2P A;  5HL6 A;  3E2L A;  5CTM A;  1BZA A;  5E2E A;  1PYY A;  5FQM A;  1GSW A;  3PBN A;  1SZV A;  3V3S A;  3LCE A;  4FCF A;  3VOY A;  4CJN A;  4R3A A;  3N7W A;  3RFB A;  1G6A A;  1RP5 A;  2PRF A;  4OP5 A;  1PIO A;  2XFS A;  3OPL A;  2HV1 A;  4OH0 A;  1NZU A;  3ZQ5 A;  1YKD A;  3UY6 A;  5KIZ A;  4KG5 A;  4OVD A;  1XJ3 A;  5AQ7 A;  3C8C A;  3HJK A;  3MQ0 A;  1LL5 A;  2HPB A;  1NXY A;  2EXB A;  5CGW A;  2W1T A;  4UQI S;  4IUH A;  1DY6 A;  1VEU A;  3CWF A;  2ZC7 A;  4WYY A;  2QZ6 A;  2C6W B;  1W7F A;  3WRZ A;  3DBA A;  3QP8 A;  4NXF A;  1TDL A;  4X6T A;  4XUZ A;  4Y0T A;  2B18 A;  2Y59 A;  4ETZ A;  1HVB A;  3IX4 A;  3BFF A;  3BY8 A;  4QB8 A;  2WZZ A;  5MC7 A;  2VV7 A;  4AFI A;  5I5L A;  2QKP A;  4CLC D;  3A3I A;  2HF6 A;  5JYP A;  2Y2L A;  1TS8 A;  2XA7 M;  5GHX A;  4K91 A;  5EVI A;  4ETX A;  3NBL A;  3NC8 A;  4OPQ A;  5CGS A;  1IYQ A;  2P9V B;  3HCY A;  3IX3 A;  3RJU A;  2P08 A;  3QNB A;  2HJE A;  3PAG A;  1IFQ A;  3O5Y A;  5EUA A;  1MWR A;  4ZTK A;  3G31 A;  4WMC A;  1GHM A;  3GV9 A;  3IXG A;  4PM7 A;  4IHQ A;  3P98 A;  1LLB A;  4GB7 A;  5C5K A;  4X53 A;  5CHJ A;  1FCO A;  5J3W A;  2JKF A;  3GDI A;  4HBU A;  4Y0U A;  5E2F A;  3E0Y A;  2A3U A;  3MSH A;  3AGD A;  1K4F A;  1FIL A;  2R78 A;  4WZ5 C;  1F98 A;  1Z6F A;  4KQQ A;  5EE8 A;  1JVJ A;  5FEF A;  3G6O A;  2XEP A;  4FSF A;  3CHW P;  1H5X A;  2GX5 A;  2VGL M;  2PD7 A;  1IYO A;  2YKF A;  4MMN A;  1MBL A;  4H6J B;  4XXR A;  1FR1 A;  1FCM A;  4OOL A;  3GTC A;  4NG2 A;  3M6B A;  2VKS A;  2VZW A;  4OOY A;  3U2A A;  1BUE A;  5A90 A;  5IT5 A;  2FZ0 A;  2QHK A;  3T4J A;  3LY3 A;  4OQ0 A;  3JVU A;  4ESP A;  1YLZ A;  3ZG9 B;  1DJC A;  4WZ5 A;  1MPL A;  3S7P A;  5HFO A;  4WEL A;  5CER A;  1YMX A;  4JGP A;  4DN0 A;  3BFD A;  5KSC A;  1EW0 A;  4R70 A;  1D1J A;  3KO6 A;  3ZYT A;  3WRT A;  5DKL A;  4U3T A;  1Q2Q A;  4UAA A;  3C7U A;  3KSH A;  5L10 A;  3BEC A;  2OWH A;  2ZMA A;  2PBD P;  2EWW A;  4QHC A;  3H9W A;  2LB5 A;  2XFT A;  4WEJ A;  1HTZ A;  2EA9 A;  5HX9 A;  2W3F A;  5DFX A;  4WL9 A;  3WWX A;  1KOU A;  1G6O A;  2OWJ A;  3K2N A;  2WKQ A;  2ZQ7 A;  3W2Z A;  2W3G A;  5GHZ A;  1VHM A;  4FUW A;  3BJN A;  2G2U A;  1ONH A;  4RQ9 A;  2VLG A;  3E2K A;  3FPV A;  1K38 A;  1CJF A;  3MMH A;  4HI4 A;  1N9O A;  3LI8 A;  4IBR A;  4B4Z A;  3LR5 A;  1SDN A;  5GHY A;  2E8I A;  3FV7 A;  4H8R A;  3GMW A;  3CPT B;  4R4S A;  1CI9 A;  2ZQ8 A;  4KZ6 A;  3CMZ A;  1GSX A;  3IQA A;  1LSV A;  1A0K A;  2HGV A;  3MBZ A;  4O8G A;  2RCX A;  4PAU A;  3TSG A;  4IED A;  3VE3 A;  3NJA A;  3VP0 A;  2QPN A;  4X1L A;  2ZJ9 A;  4PHT A;  1XXM A;  2RL3 A;  4N9K A;  1LI9 A;  4MDZ A;  4MN7 A;  1ERQ A;  4S2M A;  3TJZ C;  3PBT A;  3OZH A;  4XUX A;  1MKI A;  1XFN A;  3PR6 A;  1S67 L;  3BQA A;  4GZB A;  5EOO A;  2Y2G A;  5G18 A;  1CEG A;  1ZG6 A;  5FAS A;  3LIA A;  4NEE D;  4S2I A;  4LCL A;  3LUQ A;  5A93 A;  1WYC A;  5GL9 A;  1Z09 A;  1YLT A;  5IU1 A;  4D2O A;  3UE3 A;  3HUM A;  4HJ3 A;  4O0P A;  2NUP C;  4OPY A;  4YOF A;  5L2F A;  4R38 A;  3ZG8 B;  2NUT C;  3NDE A;  4X1M A;  3G2Y A;  3RXW A;  4Y17 A;  1ES2 A;  2XR0 A;  3ZG7 B;  2A24 B;  2PAV P;  1PW8 A;  1BTL A;  2JKT M;  2HDQ A;  3FZC A;  4E3I A;  2J8Y A;  1VET A;  3V3R A;  5FAP A;  4I38 A;  1PI5 A;  5DJT A;  3F1O B;  3W4P A;  1IKG A;  4M4X A;  3UNW A;  3S4X A;  1C3B A;  3F1O A;  2WGW B;  2ZQC A;  3P01 A;  4GS9 B;  1TS7 A;  5TBM A;  1XGJ A;  4LCM A;  4UA7 A;  4WLA A;  2C5W B;  3E4P A;  1XPB A;  2KDK A;  1BLP A;  5TJJ A;  3IH9 A;  2BTF P;  5AQB A;  4JF4 A;  4HJ4 A;  5D3O A;  4L9E A;  3CAX A;  3PBO A;  5EVL A;  2QYB A;  3ZVT A;  3FYZ A;  3MQQ A;  2H28 A;  2X02 A;  5E2H A;  3NCK A;  2XSS A;  5F1F A;  3U4L P;  1HD8 A;  2EWV A;  3CI6 A;  3PXP A;  3R4K A;  3RH8 B;  2VV6 A;  4ZJ1 A;  2I9V A;  3HJI A;  4JGQ A;  2VX8 A;  2XLN A;  3GQZ A;  3H82 A;  1OTI A;  2KX6 A;  3MS6 A;  3BEB A;  3NOP C;  5EFW A;  3R7W A;  1F9I A;  3HLF A;  5DTK A;  3SS3 A;  3V50 A;  3VSL A;  2O0Y A;  1T18 A;  3A3E A;  3IF6 C;  2Y2P A;  4KZA A;  4EUZ A;  3E98 A;  3BY9 A;  4BBU A;  1MWT A;  1ODV A;  2Y2M A;  3LR0 A;  3MFD A;  3WS5 A;  1BLS A;  1CEF A;  2V2F F;  1F5M A;  2ZM0 A;  2O9B A;  1YT4 A;  4U0T A;  1H8M A;  3C2W A;  1TS0 A;  4ARZ A;  2B02 A;  5HWV A;  5F5Y A;  3FKV A;  4KUK A;  1PWC A;  2K7S A;  1FQG A;  1DP9 A;  1YLY A;  4PM9 A;  4S2N C;  1W63 M;  5I94 A;  4K0W A;  1K0K A;  3BM6 A;  5EOE A;  2WAF A;  3IF6 B;  4C3Q A;  3TRC A;  2V0U A;  4WEK A;  4PM6 A;  2OOL A;  3QNC A;  4R6L A;  5F69 A;  1XJ2 A;  1NWZ A;  4IVI A;  3ZVW A;  1ESI A;  4LGW A;  5AJG A;  4GHI B;  3ISG A;  3LI9 A;  3VFF A;  3HRE A;  4YNR A;  4MNR A;  1I2S A;  3T12 B;  1QME A;  2JHE A;  2JC7 A;  3LO7 A;  3SS5 A;  2H0T A;  5HW3 A;  4JLF A;  1PWG A;  4KZ5 A;  3O3V A;  4NXG A;  4N9L A;  5TGF A;  3SS4 A;  5AQ9 A;  2EX6 A;  4S2N A;  5AVE A;  2L0W A;  1MKM A;  2W3E A;  2B95 A;  2EFX A;  2EX2 A;  1L0D A;  2VGK A;  3K3C A;  5GLA A;  3IBJ A;  3LR3 A;  3OC2 A;  4KQR A;  2EX9 A;  5FSR A;  3JVV A;  1SKO B;  2IWC A;  4GDB A;  4PPR A;  3C5A A;  1ES4 A;  2W3H A;  4PM5 A;  1N9N A;  4ZBE A;  3SH9 A;  3QP5 A;  4OPZ A;  4NXE A;  1ZHH B;  3S22 A;  2WUQ A;  2Y2Q A;  2V20 A;  2J3T D;  1YPR A;  1XFQ A;  4LLO B;  4BLM A;  3NIA A;  3IF5 A;  4HY8 A;  1D7E A;  3Q7Z A;  4EET B;  3CLO A;  3TW8 A;  5CX7 A;  2GDN A;  4NET A;  4L9F A;  1V9Y A;  3C30 A;  3MQO A;  5A8B A;  3LIF A;  4GLQ A;  3PAE A;  3OLO A;  3VOL A;  3ITA A;  3LEZ A;  1RGY A;  2XA7 S;  3T1Q B;  4QU3 A;  4PKY A;  3FKW A;  3LIE A;  1YSQ A;  1VB6 A;  3VSK A;  3GVB A;  2G2W A;  1ZKJ A;  2PR5 A;  4CLC B;  4DDS A;  3IX8 A;  3QP4 A;  4ZJ2 A;  1STZ A;  4JF5 A;  3CIT A;  4Y2F A;  4LPZ A;  2J9P A;  2K31 A;  3UB5 P;  1W8Q A;  4S2P A;  4Y7P A;  4O7D A;  1DP6 A;  4E3N A;  1ERO A;  5FQK A;  4RX2 A;  2PU4 A;  4OP8 A;  2FFF B;  2P9V A;  1XP4 A;  2ACG A;  2YKH A;  2PBY A;  4FOF A;  1KGF A;  4A5R A;  3DTK A;  3O88 A;  1KGG A;  2JN7 A;  5EVI D;  1BLH A;  4MBH A;  2BG1 A;  3HLW A;  4E04 A;  3GR2 A;  4Y13 A;  5KZH A;  2Z6C A;  2Y55 A;  1NRJ A;  2HJ9 C;  3OCL A;  4HHD A;  1OPX A;  1K54 C;  5FL3 A;  3VP3 A;  3MZD A;  2VGL S;  1IKI A;  3CJM A;  2VGJ A;  5DTS A;  2PHY A;  1BYW A;  2W27 A;  2JBF A;  4WMC D;  1GCE A;  3G32 A;  2INW A;  4JXW A;  1S66 L;  1JNU A;  2Z2L B;  2OAP 1;  3AGF A;  2Q9N A;  2XRO A;  3KX0 X;  4KZ4 A;  2L1M A;  3VMA A;  4B9O A;  4Z9Q A;  3GEC A;  1ZG4 A;  3HLD A;  4GDN A;  1S0W A;  3UN7 A;  1JWP A;  4H6J A;  2HP5 A;  4BD0 A;  1TD5 A;  5FAQ A;  4DMZ A;  3N8R A;  4E3M A;  4ZJ3 A;  2I72 A;  5FI2 A;  4QY6 A;  2OSU A;  4I39 A;  4B88 A;  2H5S A;  3PHY A;  1K54 A;  4GJ4 A;  2UWX A;  3A3F A;  3EGX C;  3HLG A;  3B3X A;  1ALQ A;  1U60 A;  3UPO A;  3D4F A;  4IVK A;  2J3W A;  3K3D A;  4BL3 A;  4P6Z M;  3DWK A;  4I3A A;  1TEM A;  1YLJ A;  3T1X A;  1ONG A;  1OT9 A;  3O87 A;  3UPN A;  3S7N A;  1E4D A;  1FR6 A;  3PBS A;  1K6R A;  4II7 A;  2V1B A;  1GA0 A;  2D02 A;  1E25 A;  1FSW A;  2ZOH A;  4I3I A;  1UWP X;  3DW0 A;  4GD8 A;  3T4K A;  3ZNT A;  3M6H A;  2JKR M;  3G30 A;  3ZG5 A;  1H8Y A;  4MEZ A;  5GLB A;  3A3D A;  1JTG A;  3ZG0 A;  1LT0 A;  5DKK A;  3IBR A; 
#chains in the Genus database with same CATH homology
 2BLS A;  4DE0 A;  4PMA A;  1PI5 A;  5DF9 A;  4E3O A;  5HAQ A;  1XKZ A;  4QY5 A;  4DF6 A;  1AXB A;  3W4P A;  1IKG A;  4WM9 A;  3IWI A;  1Y54 A;  2XDM A;  3UNW A;  3S4X A;  1C3B A;  4WBG A;  1GA9 A;  2ZM2 A;  2WKH A;  4ZDX A;  5EVI B;  1GHI A;  1N9B A;  5HAI A;  2WAD A;  2WGW B;  3HUN A;  5CED A;  2XF3 A;  2ZQC A;  1K56 A;  3MZE A;  4KZ9 A;  3UPP A;  4JXV A;  1XGJ A;  5M1A A;  2ZD8 A;  2ZC5 B;  3IXH A;  4LCM A;  4S2L A;  1L0E A;  4RA7 A;  2DRW A;  3HLE A;  5IHV A;  2H0Y A;  3Q82 A;  4UA7 A;  3FWL A;  2C5W B;  1M40 A;  4L0L A;  5FQJ A;  1SDE A;  1XPB A;  1K55 C;  2B5R A;  4R0Q A;  3IHA A;  1BLP A;  3VOZ A;  3IH9 A;  5AQB A;  4BEN A;  1CI8 A;  4JF4 A;  1ERM A;  1NJ4 A;  1J9M A;  5D3O A;  1YM1 A;  3AGE A;  3PBO A;  5EVL A;  4Y0O A;  1ES3 A;  1I5Q A;  4FH4 A;  5M18 A;  3ZVT A;  1IYS A;  3FYZ A;  3N6I A;  4RYE A;  4OON A;  4KZ7 A;  1NYM A;  1XA1 A;  5CHU A;  2OLU A;  2X02 A;  4JKT A;  4RX3 A;  2XD5 A;  1H8Z A;  5E2H A;  3NCK A;  5F1F A;  3SOI A;  2DNS A;  4JF6 A;  1HD8 A;  3EQU A;  3VP4 A;  5J8X A;  1XX2 A;  3MXS A;  4E3K A;  4C6Y A;  1NYY A;  4KG2 A;  2J7V A;  1FSY A;  3NI9 A;  4E6X A;  4EBN A;  1Q2P A;  2JE5 A;  2HP6 A;  3E2L A;  5CTM A;  3RXX A;  1BZA A;  5E2E A;  1PYY A;  3MZF A;  5FQM A;  3GSG A;  4WZ4 A;  3G35 A;  4ZJ1 A;  1JTD A;  1KGE A;  3PBN A;  3V3S A;  3LCE A;  4FCF A;  3VOY A;  4OQI A;  1FCN A;  4CJN A;  5CEB A;  3N7W A;  2Y2I A;  1G6A A;  1M6K A;  1XGI A;  2XLN A;  5CRF A;  3GQZ A;  3HUO A;  1RP5 A;  5JYO A;  3W8K A;  2Q9M A;  4OP5 A;  1PIO A;  1K55 A;  2WK0 A;  2ZC4 B;  3BEB A;  4GN2 A;  2XFS A;  3OPL A;  1LI0 A;  3HLF A;  2Y2O A;  4DE2 A;  5DTK A;  4OH0 A;  1NZU A;  3SS3 A;  3UY6 A;  3V50 A;  3CG5 A;  3VSL A;  3A3J A;  4DXC A;  4C75 A;  3A3E A;  3IF6 C;  4EQI A;  3ZDJ A;  2Y2P A;  4KG5 A;  1PW1 A;  4KEN B;  4R4R A;  4DE3 A;  4OVD A;  4DXB A;  4KZA A;  5AQ7 A;  2XK1 A;  4EUZ A;  1NZO A;  2IWD A;  4P6B A;  2Y2N A;  2J9O A;  2H10 A;  1MWT A;  1LL5 A;  2HPB A;  1NXY A;  2EXB A;  2Y2M A;  5CGW A;  4MLL A;  3ZGA B;  3MFD A;  3WS5 A;  5KMW A;  1BLS A;  2Y4A A;  1CEF A;  1KDS A;  2V2F F;  5F83 A;  3W4Q A;  2ZM0 A;  5KSH A;  4IBX A;  1K25 A;  3G4P A;  5DTT A;  1YT4 A;  1DY6 A;  4JXS A;  1YQS A;  1YLP A;  4U0T A;  3NY4 A;  2ZC7 A;  5EEC A;  4WYY A;  3TG9 A;  2XD1 A;  1L0G A;  2ZQ9 A;  2P74 A;  1ZC2 A;  2QZ6 A;  2C6W B;  1SKF A;  5U47 A;  1W7F A;  1BUL A;  2Y2H A;  2OV5 A;  3WRZ A;  3FKV A;  2CC1 A;  1TDL A;  1WYB A;  4N1X A;  4OQH A;  4X6T A;  4XUZ A;  5HAP A;  1PWC A;  4KG6 A;  4Y0T A;  1FQG A;  4PM9 A;  1YLY A;  2Y59 A;  1HVB A;  4DDY A;  4M3K A;  4S2N C;  4X68 A;  3BFF A;  5I94 A;  5DF8 A;  4K0W A;  3BM6 A;  5EOE A;  5FQQ A;  2WAF A;  4QB8 A;  2WZZ A;  3W4O A;  4LV1 A;  3IF6 B;  4C3Q A;  1O7E A;  4WEK A;  4PM6 A;  4X55 A;  2JCH A;  2OLV A;  3A3I A;  3QNC A;  5JYP A;  3C4O A;  3VP2 A;  4KQO A;  1O07 A;  2Y2L A;  4DKI A;  5GHX A;  3DWZ A;  1NRF A;  4K91 A;  5EVI A;  3NBL A;  2WGW A;  3NC8 A;  5CGX A;  1WE4 A;  4IVI A;  4OPQ A;  3BLS A;  1RCJ A;  3ZVW A;  3IT9 A;  1ESI A;  1E3U A;  5CGS A;  1IYQ A;  2P9V B;  5AQA A;  3TOI A;  3IXD A;  4ZAM A;  3ISG A;  1DJB A;  3VFF A;  3RJU A;  1MWS A;  3QNB A;  3VFH A;  5DF7 A;  3HRE A;  3PAG A;  4MNR A;  1I2S A;  2WGV A;  1QME A;  5EUA A;  3G34 A;  1K56 D;  1MWR A;  4ZTK A;  2JC7 A;  3LO7 A;  1GHP A;  3G31 A;  2H0T A;  4WMC A;  3SS5 A;  1GHM A;  5HW3 A;  1YMS A;  3GV9 A;  3IXG A;  4PM7 A;  1MWU A;  4JLF A;  1PWG A;  3P98 A;  4KZ5 A;  3O3V A;  1SCW A;  3MXR A;  4N9L A;  5TGF A;  3UO9 A;  1LLB A;  3SS4 A;  1TDG A;  2ZM8 A;  4GB7 A;  4P0M A;  4X53 A;  5CHJ A;  5AQ9 A;  3V39 A;  1FCO A;  2EX6 A;  4S2N A;  5GLD A;  3ITB A;  4DRT A;  4HBU A;  4Y0U A;  5E2F A;  2EFX A;  4LV3 A;  2EX2 A;  1L0D A;  2A3U A;  4HEF A;  2VGK A;  1BT5 A;  3AGD A;  1K4F A;  2XQZ A;  4QJG A;  4WZ5 C;  5FI7 A;  1Z6F A;  5GLA A;  4JBF A;  4KQQ A;  2ZQA A;  4X56 A;  3OCN A;  3BFC A;  3OC2 A;  4KQR A;  4R23 A;  3OPP A;  5EE8 A;  1JVJ A;  2EX9 A;  5FSR A;  2XEP A;  3M2K A;  2IWC A;  2XGN A;  4GDB A;  4FSF A;  4RVA A;  4PPR A;  2EXA A;  1KVL A;  5FQI A;  1H5X A;  1RGZ A;  3C5A A;  1ES4 A;  5A91 A;  3QHY A;  4PM5 A;  1KE3 A;  4K0X A;  4ZBE A;  3S1Y A;  1IYO A;  3SH7 A;  3SH9 A;  4GOG A;  4OPZ A;  5A92 A;  3HLC A;  1MBL A;  4XXR A;  1EI5 A;  2R9W A;  1FR1 A;  4MBF A;  2ZC6 B;  1K57 C;  3HL9 A;  3S22 A;  1FCM A;  1W5D A;  1VQQ A;  2WUQ A;  2Y2Q A;  1IEM A;  2V20 A;  3GTC A;  3PBR A;  4LEN A;  4OOL A;  3M6B A;  5FQ9 A;  5BOH A;  2WZX A;  2Z2M B;  1IYP A;  2A49 A;  5FI6 A;  4KZB A;  4OOY A;  5CHM A;  4BLM A;  3NIA A;  1QMF A;  1BUE A;  2WAE A;  3IF5 A;  5A90 A;  1OME A;  3Q7Z A;  5HAR A;  4E3J A;  2FFY A;  4OLG A;  3CZD A;  5TR7 A;  2IWB A;  3LY3 A;  4OQ0 A;  5F1G A;  1TVF A;  5E43 A;  1FOF A;  3N8S A;  2GDN A;  4NET A;  1KE4 A;  3MKE A;  4E6W A;  2R9X A;  3BLM A;  3Q7V B;  4PM8 A;  1YLZ A;  3ZG9 B;  1DJC A;  4OQG A;  3IWQ A;  3PAE A;  4WZ5 A;  1MPL A;  3M2J A;  5HFO A;  4WEL A;  4YFM A;  5CER A;  2HDS A;  2WKI A;  1YMX A;  3Q7V A;  1KVM A;  3ITA A;  3LEZ A;  3VP1 A;  2ZQD A;  3BFD A;  4FH2 A;  3BFE A;  1RGY A;  2EFU A;  5KSC A;  4U0X A;  4GD6 A;  3O86 A;  4QU3 A;  3JYI A;  3WRT A;  2Y2J A;  3FKW A;  3I7J A;  3PTE A;  3VSK A;  1G68 A;  3GRJ A;  4KZ3 A;  5HL1 A;  4E3L A;  3GVB A;  1NY0 A;  2WGI A;  4U3T A;  1Q2Q A;  1ES5 A;  2G2W A;  2ZC3 B;  3NDG A;  4UAA A;  1K57 A;  3C7U A;  1MXO A;  1ZKJ A;  3BEC A;  3IWO A;  4DDS A;  2ZMA A;  4CPK A;  4ZJ2 A;  4OKP A;  4QHC A;  2Y91 A;  1HZO A;  4JF5 A;  2XFT A;  5CTN A;  3IF6 A;  4WEJ A;  3C4P A;  2V1Z A;  1HTZ A;  1JWZ A;  3HLB A;  5HX9 A;  4S2J A;  2J9P A;  5FDH A;  4YIN A;  1K6S A;  3WWX A;  1W8Q A;  4S2P A;  4Y7P A;  3V5M A;  4DE1 A;  4O7D A;  2X71 A;  4E3N A;  1ERO A;  2X01 A;  4HBT A;  5FQK A;  1YLW A;  2ZQ7 A;  3IH8 A;  4RX2 A;  1S6R A;  5GHZ A;  1IEL A;  2PU4 A;  4OP8 A;  2FFF B;  4EBP A;  2G2U A;  1ONH A;  2HP9 A;  2P9V A;  1XP4 A;  3E2K A;  2EX8 A;  1K38 A;  3P09 A;  4R3J A;  1CK3 A;  4Q8I A;  2PBY A;  1BSG A;  1KDW A;  1KGF A;  4A5R A;  2HDU A;  3O88 A;  1KGG A;  5EVI D;  1BLH A;  2PU2 A;  4IBR A;  4JPM A;  4MBH A;  4B4Z A;  2BG1 A;  3HLW A;  3IXB A;  1E3U D;  1W79 A;  3GR2 A;  1KE0 A;  3ZCZ A;  4BD1 A;  1XA7 A;  5KZH A;  1L2S A;  2Y55 A;  5GLC A;  3N8L A;  3OCL A;  3BFG A;  1SDN A;  5E2G A;  5GHY A;  5M19 A;  2E8I A;  1K54 C;  3FV7 A;  4H8R A;  4N92 A;  3VP3 A;  3GMW A;  4R4S A;  1N4O A;  4P87 A;  1CI9 A;  3MZD A;  2ZQ8 A;  4KZ6 A;  3OPH A;  5DVA A;  3CMZ A;  1IKI A;  3CJM A;  3IQA A;  1DJA A;  2WKE A;  3WS0 A;  2VGJ A;  4EWF A;  3OPR A;  4UA9 A;  3UE0 A;  3MBZ A;  1PZP A;  5DTS A;  2JBF A;  4WMC D;  1GCE A;  3G32 A;  2RCX A;  3UDX A;  3TSG A;  5CXW A;  4IED A;  4JXW A;  1W8Y A;  1K4E A;  2Z2L B;  2ZLY A;  4JXG A;  3VP0 A;  4OLD A;  5FAO A;  2QPN A;  2Q9N A;  3AGF A;  3EQV A;  4UA6 A;  3UDI A;  2ZJ9 A;  4KZ4 A;  3UDF A;  1XXM A;  5CEC A;  2RL3 A;  4ID4 A;  4EV4 A;  4N9K A;  3ZHH A;  1LI9 A;  3HVF A;  3VMA A;  1ERQ A;  3BRM A;  4Z9Q A;  4S2M A;  4UHU A;  3IHB A;  1VM1 A;  3PBT A;  3OZH A;  4X69 A;  1ESU A;  1ZG4 A;  3HLD A;  4GDN A;  1S0W A;  4XUX A;  1JWV A;  3DTM A;  1MKI A;  3UN7 A;  1JWP A;  2HP5 A;  4BD0 A;  4GZB A;  4S2K A;  4BJP A;  5FAQ A;  1PWD A;  1I2W A;  3N8R A;  5EOO A;  5F82 A;  4LV2 A;  4E3M A;  4ZJ3 A;  2Y2G A;  2I72 A;  5FI2 A;  5G18 A;  3Q07 A;  4QY6 A;  3HBR A;  1CEG A;  1ZG6 A;  3LY4 A;  2OSU A;  4EBL A;  5FAS A;  4R1G A;  4B88 A;  2H5S A;  4S2I A;  1K54 A;  2UWX A;  1PI4 A;  3A3F A;  4LCL A;  4OOM A;  1WYC A;  3HLG A;  5A93 A;  1PZO A;  3B3X A;  3C7V A;  1ALQ A;  2DCF A;  1U60 A;  4S2O A;  5GL9 A;  3UPO A;  5EPH A;  1YLT A;  2WYX A;  4D2O A;  3D4F A;  3WS1 A;  3UE3 A;  4IVK A;  3BYD A;  4BL2 A;  3HUM A;  1LHY A;  4GKU A;  4MBK A;  4BL3 A;  4F94 A;  4P85 A;  4GNU A;  5FAT A;  3DWK A;  5FA7 A;  1TEM A;  1YLJ A;  2HDR A;  4OPY A;  5L2F A;  1LL9 A;  1ONG A;  3O87 A;  5EVI C;  3ZG8 B;  3UPN A;  4QD4 A;  4FD8 A;  1E4D A;  3NDE A;  1FR6 A;  4B4X A;  1L0F A;  3PBS A;  3N4I A;  1K6R A;  3G2Y A;  3RXW A;  3WS2 A;  5TFQ A;  4LV0 A;  1ES2 A;  2XR0 A;  2QMI A;  1GA0 A;  3UE1 A;  3ZG7 B;  1SHV A;  1E25 A;  1FSW A;  4NK3 A;  1BLC A;  4HES A;  3WS4 A;  3PBQ A;  3Q1F A;  1MY8 A;  3DW0 A;  4GD8 A;  1PW8 A;  1BTL A;  3G2Z A;  2HDQ A;  2XH9 A;  3FZC A;  4OPR A;  3ZNT A;  3M6H A;  4KZ8 A;  4BQM A;  2Y2K A;  3G30 A;  4R3B A;  1EWZ A;  3ZG5 A;  3ZFZ A;  4N1H A;  1H8Y A;  4MEZ A;  5GLB A;  3SH8 A;  4E3I A;  2J8Y A;  3A3D A;  1JTG A;  3V3R A;  3MKF A;  3ZG0 A;  3ZNY A;  5FAP A;  3Q81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...