4R4RA

Crystal structure of chimeric beta-lactamase ctem-19m at 1.2 angstrom resolution
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPLTSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTDFLRQIGDKETRLDRIEPDLNEGKLGDLRDTTTPKAIASTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM,Beta-lactamase PSE-4
publication title Crystal structures of chimeric beta-lactamase cTEM-19m
rcsb
source organism Escherichia coli
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4r4rA00
2X01A 3W4OA 2ZQ7A 4DDSA 5KMWA 1KGGA 3OPPA 2RCXA 1XXMA 1GCEA 2HDUA 1K38A 4CJNA 2Y59A 1LHYA 3HREA 5EE8A 3PTEA 5TGFA 1PI4A 2QMIA 2WKHA 1CK3A 4S2NA 1O07A 3M6HA 1FQGA 4OPRA 4JXGA 3QNBA 4Z9QA 1I2WA 3M2JA 4FH2A 2OSUA 1QMFA 5GLAA 3UO9A 5GHYA 5GLBA 3FYZA 4LENA 3S4XA 3OPRA 1NXYA 4EV4A 1S0WA 1IKIA 3ZG0A 1ALQA 4HESA 2ZQ8A 4GB7A 1KDSA 5FI2A 2XFSA 4DDYA 3FZCA 4OONA 1YQSA 1BLHA 2WGVA 2ZLYA 4ID4A 5GL9A 2E8IA 3A3EA 4K0XA 4E3JA 5E2FA 1K4FA 4JF5A 3UDXA 2WZZA 2XF3A 1PIOA 1IELA 1PW8A 3NIAA 4GDNA 4S2PA 2PU2A 3G30A 3UNWA 3O88A 4OLGA 3UN7A 2WKEA 3VP4A 5U47A 3UE0A 3WWXA 1YLWA 3DTMA 3HBRA 2EFUA 2X02A 5HW3A 5F1GA 1ES2A 3S1YA 4R3BA 2DNSA 3O87A 3NDEA 2B5RA 4BENA 1MWUA 2VGJA 3CJMA 3MKFA 3DW0A 3OCNA 4IVKA 4S2IA 2ZC6B 4Y7PA 4R23A 2Y4AA 4ZBEA 3BLMA 1K55C 4C6YA 5D3OA 2HPBA 4Q8IA 3V5MA 1PYYA 2Y2KA 3NDGA 4ZTKA 3HLCA 5BOHA 2Y2OA 5HAPA 1PZOA 4P85A 2H5SA 1HTZA 4WM9A 4RVAA 4BJPA 1K54C 5FQ9A 5E43A 4QHCA 3MXRA 4EBLA 1JTDA 4UA6A 3FKVA 1N4OA 1GA0A 4CPKA 3ZG9B 4E3LA 4GZBA 3GVBA 3Q07A 2Y2IA 3TOIA 4LV0A 3SS5A 2V1ZA 3IF6C 5M18A 3IH9A 3G31A 4OQIA 3HLGA 4YFMA 4A5RA 5DF7A 3P98A 4P0MA 3ITBA 5EOEA 5FDHA 4QB8A 4K91A 5CHUA 5F83A 3IH8A 3UY6A 1I5QA 3I7JA 5TFQA 3SS3A 3E2LA 2Y2MA 5J8XA 2ZMAA 2JBFA 1W8YA 4P87A 1K55A 3EQVA 3P09A 2C6WB 5CHJA 5AQBA 5FAPA 3V3RA 3BFEA 2VGKA 3OPLA 2QZ6A 1NRFA 2C5WB 3FWLA 4RX3A 4DRTA 5FI7A 3PAGA 3VP3A 1JVJA 1BLSA 1E3UA 4OLDA 3VP1A 3IHAA 3NC8A 1ESIA 1FR6A 2CC1A 1YT4A 3GSGA 4U3TA 2HP6A 4E3OA 2WYXA 2XDMA 1ES4A 4H8RA 1BUEA 3Q7VB 5EUAA 1H8ZA 3TG9A 1HZOA 4PM9A 1MWRA 2QPNA 4S2NC 3SH8A 2ZC5B 5G18A 3IXBA 4KZ8A 3BFDA 1JWZA 1BTLA 3D4FA 3BLSA 1FCNA 1K4EA 2IWDA 2J7VA 4OOYA 5DTKA 4UA9A 2ZQAA 5M19A 5GLDA 1NJ4A 4JPMA 4QU3A 1H5XA 1QMEA 1KGFA 3HLFA 2ZJ9A 4GOGA 4YINA 3ZNYA 4KQOA 1XA7A 4OVDA 2Q9MA 2ZM8A 3CG5A 1BT5A 4JXVA 3IWIA 4HEFA 3WS5A 2WKIA 3V50A 3UE1A 4MEZA 1ZKJA 4S2OA 3NY4A 4KQRA 3TSGA 3GV9A 1MBLA 2EX2A 2J9OA 5FSRA 1KDWA 1BSGA 3ZGAB 1FOFA 3A3DA 5FAQA 2Y2GA 4O7DA 1KVLA 4X68A 2XQZA 3HLEA 1E3UD 3GR2A 4GD8A 3PBRA 3BFGA 3NI9A 3GQZA 4EWFA 1VQQA 4X53A 4MBHA 3G35A 2ZD8A 4OP8A 1IEMA 4R4SA 5DTTA 1PWGA 1NY0A 1ZG4A 4DE3A 4FSFA 1DJCA 1XGJA 5JYOA 1ZC2A 2IWCA 3Q1FA 1OMEA 4KZAA 1KVMA 2Y2QA 5FA7A 1BLCA 1HVBA 1PI5A 1C3BA 4C3QA 1LL9A 4RYEA 2H0YA 1JTGA 5HARA 3VMAA 3W4PA 3WS2A 1MWTA 5E2HA 3HUMA 3QHYA 3IF5A 1L0EA 3HLBA 3IHBA 2PBYA 3V39A 3WRZA 4BLMA 1K6RA 3B3XA 2ZQ9A 4IEDA 4L0LA 2DRWA 4KG6A 5FQKA 4R3JA 3UE3A 5AQAA 3WS1A 3LO7A 2V2FF 5KSCA 1WE4A 3MBZA 4S2KA 4DE2A 3S22A 1W5DA 4KZ7A 4IVIA 4BQMA 4WMCD 5HFOA 4E3IA 1IKGA 1SDEA 5JYPA 3UPOA 3CMZA 1YLTA 2Z2MB 3PBQA 4PM7A 4Y0OA 4WELA 3Q7VA 1RGZA 3IWOA 4PM8A 3SOIA 4EBNA 5FATA 3N6IA 1XKZA 3HVFA 3C4PA 4EQIA 4F94A 5EVID 2WUQA 2I72A 4ZJ3A 1WYBA 2H0TA 4XXRA 1GA9A 1ONGA 1MWSA 4JBFA 1BZAA 1G6AA 1W8QA 4B88A 5L2FA 1YLZA 4GNUA 5A91A 4BD0A 4R0QA 4RX2A 2Z2LB 1DY6A 2Y2HA 3LY4A 4PPRA 5EVIB 1GHIA 4PM6A 2EXAA 3N4IA 1TDLA 2Y2NA 1SCWA 2XD5A 4GN2A 2G2UA 4OQGA 4B4ZA 4Y0TA 1N9BA 2PU4A 1W79A 3M2KA 2EFXA 5EECA 5A93A 2JE5A 3C7UA 4IBXA 1LI0A 3SH9A 5DF8A 2J9PA 3LY3A 4NK3A 1GHPA 2WGWA 3IWQA 4UA7A 5CGWA 1TVFA 5F1FA 1MXOA 1CEGA 1RCJA 2Y55A 3VSKA 2WK0A 1MY8A 1SHVA 3JYIA 4GDBA 1G68A 2X71A 1MKIA 2H10A 3HL9A 4N1XA 3VSLA 1NZOA 5FQJA 3RJUA 1I2SA 2EX8A 3IT9A 2R9WA 5CRFA 1K57C 1XA1A 2J8YA 1L0DA 3O3VA 3UPPA 5CTNA 3VOZA 5FQQA 5CERA 1KGEA 4KZ3A 1S6RA 5CTMA 3WS4A 4X55A 4ZJ2A 5I94A 3LCEA 4FCFA 2ZM2A 1IYQA 1RP5A 3VOYA 2HDQA 2Y2LA 2ZC4B 4E3MA 3W4QA 4LV2A 4KG2A 4MBKA 4S2LA 4DXBA 5FASA 3Q7ZA 4KENB 3G34A 3OPHA 5EVIC 3OZHA 3GTCA 3GMWA 1L2SA 3VP2A 1LI9A 4WEJA 4KQQA 3HUNA 3Q82A 4S2JA 1IYPA 1SKFA 5GHZA 4WZ5C 3IXDA 2IWBA 1KE0A 1W7FA 2WADA 3C5AA 4EBPA 1K57A 3VP0A 1HD8A 4OP5A 3ZHHA 4U0TA 3G2YA 4X6TA 1YM1A 4FH4A 2JC7A 4IBRA 4OKPA 3OCLA 4XUXA 5AQ9A 4N9LA 1IYOA 1PWCA 2WAEA 4OPQA 4WMCA 5DTSA 3VFFA 1ZG6A 4ZAMA 3AGDA 1K6SA 3AGFA 4KZ9A 2WGWB 2Y2JA 3UDIA 3IQAA 5FQMA 2ZM0A 2HP5A 3IXGA 5DVAA 5EVIA 3G32A 4KZBA 4DE1A 2JCHA 3A3JA 4GD6A 3ZNTA 1ES3A 2RL3A 1YLYA 2A49A 3BFFA 3ZDJA 1JWVA 3VFHA 5CECA 4WZ5A 4DF6A 1EROA 4D2OA 1M40A 1YLPA 1NYYA 3OC2A 4JXSA 4Y0UA 1DJAA 4B4XA 2XH9A 4U0XA 5HX9A 4KZ4A 1Q2PA 1ERMA 4E6XA 2BLSA 3ZCZA 5A92A 1DJBA 3BYDA 5GHXA 4DE0A 3A3FA 4JF4A 4M3KA 2V20A 5M1AA 1EI5A 1KE4A 2EX6A 3AGEA 1ES5A 1XX2A 5E2GA 2ZC7A 5CGSA 4JXWA 4BD1A 2G2WA 2XR0A 4ZJ1A 5KSHA 1XPBA 4ZDXA 4KG5A 4R1GA 2ZC3B 1EWZA 1ESUA 3FV7A 4N92A 3WRTA 1IYSA 1K56A 3RXWA 3ZVWA 1XP4A 2FFFB 1E4DA 1U60A 1H8YA 5IHVA 3BFCA 3NCKA 1ONHA 4N9KA 4BL3A 2ZQDA 3IXHA 1E25A 1LLBA 3BRMA 3MZEA 3O86A 1BULA 3V3SA 1VM1A 1O7EA 4PM5A 1YMXA 1SDNA 2HDRA 4P6BA 5EOOA 1RGYA 3ZG7B 4OOMA 1YLJA 4QJGA 3UDFA 3HUOA 3IF6B 3WS0A 5HAQA 2UWXA 2P9VB 3C4OA 2BG1A 4OQ0A 1L0FA 3QNCA 5EPHA 4QY6A 4LV1A 4N1HA 3N8LA 4JF6A 3M6BA 2ZQCA 1PWDA 3DWKA 1XGIA 1Q2QA 4OPYA 4RA7A 2XGNA 4X56A 4MBFA 2XK1A 1K25A 3MKEA 5CEDA 2EX9A 5CHMA 3HLWA 4BL2A 2XD1A 5AQ7A 3PBSA 3PBNA 5E2EA 2A3UA 2OLVA 3LEZA 4HBUA 4DKIA 2FFYA 4S2MA 1GHMA 2HP9A 4LCLA 5FI6A 3BM6A 5FQIA 4JLFA 3ZG8B 1Y54A 3PAEA 4MLLA 3EQUA 3C7VA 4HBTA 1K56D 1NYMA 4E3KA 1M6KA 3G4PA 2P74A 4KZ5A 4JKTA 1YMSA 1LL5A 3UPNA 3ISGA 3FKWA 4OH0A 5CXWA 3NBLA 1FSWA 1FSYA 1MPLA 2R9XA 2Y91A 3N7WA 4QY5A 2OV5A 2DCFA 4OOLA 3MFDA 2WGIA 1WYCA 4K0WA 3ZFZA 4PMAA 3N8SA 2XLNA 3BECA 3MXSA 1J9MA 1TDGA 3MZDA 4XUZA 4R4RA 1CI8A 4DXCA 3HLDA 4QD4A 2OLUA 3ITAA 4GKUA 3E2KA 5DF9A 4E6WA 1L0GA 1AXBA 1NZUA 3SH7A 3ZVTA 4C75A 1Z6FA 4LV3A 1PZPA 4FD8A 2EXBA 5CEBA 4OPZA 4KZ6A 4X69A 5FAOA 4E3NA 3PBTA 1K54A 1CEFA 3DWZA 4UHUA 4WBGA 3N8RA 3Q81A 4WZ4A 4OQHA 3G2ZA 3ZG5A 2XFTA 5TR7A 5HL1A 3IF6A 1PW1A 2GDNA 5KZHA 1FR1A 2P9VA 1BLPA 2HDSA 2Y2PA 1FCMA 3SS4A 2Q9NA 5CGXA 3PBOA 4MNRA 4LCMA 3W8KA 4EUZA 5EVLA 4NETA 1JWPA 5F82A 3RXXA 4UAAA 1CI9A 2WAFA 3BEBA 4WEKA 1ERQA 5GLCA 2WZXA 1KE3A 1TEMA 4WYYA 3GRJA 5HAIA 3MZFA 2XEPA 3CZDA 1FCOA 5A90A 3A3IA
chains in the Genus database with same CATH superfamily
3W4OA 2ZQ7A 3U2AA 4G3KA 2M7UA 2IA2A 3LEQA 1KGGA 1GCEA 2ZMVA 2Y59A 2XRNA 5EE8A 1CK3A 3H82B 5GLAA 1WA9A 3OPRA 5EM1A 4WF0A 1IKIA 3B42A 2W3DA 1UGUA 1KDSA 3CPTB 4GS9A 5DKLA 4WN5A 2JKGA 4EXOA 3D9YA 4OONA 4YNRA 1BLHA 2ZLYA 4K0XA 1K4FA 3UB9A 4S2PA 3T4LA 1AWIA 4OLGA 3UN7A 2INWA 2V0UA 3HBRA 3CI6A 3DTMA 1ES2A 1A0KA 2DNSA 3O87A 4BENA 3LIEA 5J3WA 3DW0A 1XJ6A 5HD3A 3CUEC 3OCNA 4S2IA 4Y7PA 4R23A 2K2NA 1K55C 4Q8IA 3EOIA 4ZTKA 3NDGA 1Y4OA 3OOVA 5FQ9A 5E43A 1JTDA 4UA6A 1N4OA 3ZG9B 3Q07A 1L3LA 3IH9A 3HLGA 4NXFA 3P98A 2VLGA 3ITBA 4K91A 3UY6A 5HWTA 3I7JA 2ACGA 3SS3A 3E2LA 2ZMAA 5HDSA 3P09A 4NKPA 2VGLM 1NRFA 3FWLA 5J7EA 3VP3A 4OLDA 4U3TA 1N9NA 2JN7A 3IBRA 3TW8A 1ES4A 2JKRM 4DJ3A 1HZOA 1MWRA 3BFDA 1BTLA 1XJ3A 1K4EA 2J7VA 5DTKA 1N9LA 4CLCC 4O01A 4Y5FA 4YINA 5IS1A 3TSGA 1SKOA 2J9OA 3A3DA 2Y2GA 4GD8A 3GQZA 4UEYA 4EWFA 4KUKA 4OP8A 1IEMA 2R78A 3MF0A 5DTTA 1XFNA 1NY0A 1ZG4A 4DE3A 1DJCA 1ZC2A 1LSWA 3VMAA 2DMWA 1MWTA 1L0EA 2PBYA 3V39A 4BLMA 4IEDA 4L0LA 3JPUA 5FQKA 4HY8A 3V67A 3HCYA 2V2FF 3FG8A 5A8BA 3S22A 4I3JA 1YLTA 3PBQA 2D01A 3Q7VA 3IWOA 4PM8A 3N6IA 4F94A 3HVFA 5EVID 2ZL1B 4JGRA 3CLOA 4XXRA 1GA9A 1ONGA 4JBFA 1BZAA 2ZOHA 1W8QA 4B88A 1J3WA 1OT9A 1DY6A 3LY4A 5EVIB 4HP9A 2EXAA 3N4IA 3PHYA 4LRYC 1LSXA 2XD5A 2HZ5A 1N9BA 2PU4A 5A93A 4EQ1A 2JE5A 1LI0A 4UA7A 5F1FA 1TVFA 2B02A 2WK0A 3LICA 4GDBA 2X71A 1LSVA 1MKIA 3HL9A 1GSWA 1I2SA 2EX8A 2HJ9C 3JVVA 5CRFA 2J8YA 3MJQA 5CTNA 5CERA 1YAXA 4KZ3A 1S6RA 2PHYA 4X55A 3W4QA 3R4KA 4MBKA 5FASA 3Q7ZA 4KENB 3OZHA 2PYPA 2O9BA 2GZAA 4KQQA 3HUNA 1XJ2A 3MS6A 3CITA 1W7FA 1YSQA 1K57A 1HD8A 3F1NB 2J3TC 4FH4A 2JC7A 4IBRA 4HI4A 3OCLA 4XUXA 1IYOA 2OAQ1 4OPQA 4ZAMA 1K6SA 3KX0X 5FQMA 2HP5A 3DTKA 3TRCA 3T1RA 1IOUA 2A49A 3BFFA 3VFHA 4WZ5A 2KOIA 3KYQA 4JXSA 4B4XA 5HX9A 2PAVP 3ZCZA 3BYDA 2HGVA 2EX6A 2ZC7A 2JKRI 4BD1A 4PHTA 1XPBA 3S7NA 1ESUA 4NXGA 4LLOB 1E4DA 3E4OA 3BFCA 2ZQDA 3IXHA 1LLBA 3V3SA 1BULA 1VM1A 5EOOA 4OOMA 4GLQA 3MFXA 5HAQA 2UWXA 5EPHA 4QY6A 4LV1A 4JF6A 3DWKA 4RA7A 3GDIA 5E2EA 2PR5A 2FFYA 4UQIS 1GHMA 2HP9A 2K7SA 3BM6A 3ZG8B 3LI9A 3C7VA 1ACFA 4FOFA 4E3KA 1LL5A 3UPNA 1VEUA 1FILA 3A0SA 1FSYA 3NBLA 2CMNA 2O99A 1K0KA 2OV5A 2AVXA 1DP9A 1WYCA 1J9MA 4XUZA 5HPFA 2NUPC 3HLDA 3E2KA 5F69A 5L8MA 4C75A 3ZVTA 1P97A 1Z6FA 3F1OB 4FD8A 5HD5A 1CEFA 4AFIA 2W0NA 3QP8A 3Q81A 2ZMFA 2XFTA 4P6ZM 3IF6A 1PW1A 1FR1A 3H7WB 3PBOA 3G6OA 1F98A 4NETA 1JWPA 5F82A 2PRFA 3BEBA 5GLCA 4I5SA 4WYYA 3GRJA 3PXPA 3CZDA 2VV8A 5A90A 3A3IA 4Y13A 4M4XA 2NUTC 5KMWA 2RCXA 2HDUA 1K38A 4ESPA 5TGFA 3D3OA 1UWPX 2W1TB 2WKHA 3KYZA 4HH2A 1QMFA 1NXYA 2A24B 4EV4A 2WKQA 4EW7A 1YKDA 1Z09A 4KQDA 2PR6A 2W3EA 5GL9A 3A3EA 2XF3A 4MN7A 1PW8A 2B18A 3UNWA 3RFBA 4XT2B 2WKEA 2OWJA 4Z1WA 2X02A 5F1GA 1UWNX 1PNEA 2KX6A 1MWUA 3CJMA 2HV1A 2ZC6B 5IU1A 3BLMA 2HPBA 1PYYA 2Y2KA 3R7WB 5BOHA 4CLCD 5HAPA 1PZOA 1HTZA 4RVAA 4BJPA 4R3AA 3MXRA 3TE8A 2HF6A 4CPKA 4E3LA 4GZBA 3GVBA 2Y2IA 4CLCB 3KO6A 4OQIA 1OJGA 4YFMA 4A5RA 5DF7A 5EOEA 4QB8A 5F83A 2M7VA 1I5QA 2V0WA 3CAXA 4I39A 1W63M 4LGWA 3EQVA 3OPLA 4RX3A 3PAGA 3VP1A 1ESIA 2WYXA 2XDMA 1OT6A 4LFUA 3E4QA 4H8RA 1BUEA 5EUAA 4PM9A 4B93A 4S2NC 3UB5P 2ZC5B 3IXBA 4KZ8A 1JWZA 1NJ4A 1H5XA 3T50A 3HLFA 3ZNYA 1OTAA 4KQOA 4OVDA 3IWIA 4HEFA 3WS5A 4WL9A 3V50A 2FZ0A 3PR6A 3NY4A 1OJ5A 2EX2A 3S7QA 1KDWA 1FOFA 2VK3A 1KVLA 4L9EA 2WKRA 4X68A 4GCZA 2XQZA 3HLEA 3BWLA 3BFGA 2O9AA 1VQQA 4X53A 4MBHA 2ZD8A 4R4SA 1PWGA 4FSFA 4C3QA 1LL9A 3QHYA 2J3WA 3IF5A 5AVEA 3WRZA 4HQAA 2ZQ9A 4R3JA 3UE3A 2XA7S 5AQAA 1F9IA 3WS1A 3LO7A 4DE2A 3KSGA 4IVIA 4E3IA 5JYPA 3UPOA 4PM7A 2VV7A 5HZHA 4EBNA 4DJ2A 3C4PA 1F2KA 2OWHA 1WYBA 2H0TA 4CQHA 5L2FA 4GNUA 5A91A 2K31A 4Q0HA 2Y2HA 1GHIA 4PM6A 3PYPA 2J3TD 1SCWA 2J80A 2G2UA 4B4ZA 2EFXA 2OAP1 4IBXA 3SH9A 3IX3A 3DAVA 3GECA 2ZBBA 3VSKA 1MY8A 4MN5A 1TS0A 4N1XA 4PAUA 1NZOA 4F3LA 5FQJA 1DRMA 3CWFA 4QPRA 1S4SA 1K57C 1XA1A 1L0DA 1P9RA 1HLUP 3WS4A 3T4KA 4LRXC 5I94A 2ZM2A 1VB6A 3LI8A 4LV2A 4KG2A 4S2LA 4DXBA 3GTCA 3GMWA 3QP6A 4BBVA 4WZ5C 1FIKA 4B9OA 3DBAA 3C5AA 4OP5A 3ZHHA 3BW6A 4OKPA 2OOLA 5AQ9A 1PWCA 4WMCA 5DTSA 3AGDA 3AGFA 2WGWB 3IQAA 2YKFA 2ZM0A 3G32A 2JCHA 4GD6A 3ZDJA 1T19A 4DF6A 1M40A 1YLPA 3OC2A 2XH9A 4E6XA 5A92A 5GHXA 2GJ3A 4M3KA 2V20A 5M1AA 3AGEA 3LR4A 2Y79A 5CGSA 1OTDA 4R1GA 2ZC3B 3FV7A 3EGDC 3BQAA 3ZVWA 1U60A 1ONHA 4N9KA 1E25A 4PM5A 4GHIB 1YMXA 3ZG7B 1G28A 1YLJA 3F1OA 3ULFA 4QJGA 2PT7A 3WS0A 3BJNA 3T1QB 2JHEA 1PFLA 2GX5A 4EERA 3T4SA 2A3UA 2OLVA 4HBUA 5HWVA 2MJ6A 3KSHA 5FQIA 1Y54A 1LT0A 1NYMA 3G4PA 2P74A 3FKWA 4OH0A 4YWZA 1H0MA 3MMHA 2DCFA 3KYEA 4OOLA 4K0WA 4PMAA 3BECA 3MXSA 3LGOA 4GS9B 3CUEA 2OLUA 4GKUA 4Y3IA 1AXBA 1H3QA 1PZPA 4ARZA 3MR0A 4HP4A 5AVFA 1KOUA 3MXQA 5DFXA 1N9OA 3DWZA 1F5MA 3IX4A 4Y15A 2QYBA 4IJGA 3ZG5A 2EWVA 2GDNA 5KZHA 2P9VA 4EESA 4MNRA 3W8KA 2BASA 4EEUA 2W3FA 3IS2B 4EUZA 3P01A 2V1BA 1CI9A 2WAFA 1VETB 1ERQA 1KE3A 1TEMA 3MZFA 1FCOA 1V9ZA 4DDSA 1NLYA 4MN6A 1XFQA 3T1SA 3LUQA 4HJ6A 4CJNA 3VE4A 3HREA 3PTEA 3F1PB 1O07A 3M6HA 2VX8A 4OPRA 4JXGA 4ZRRA 3QNBA 4Z9QA 1I2WA 4FH2A 2OSUA 1DP8A 5GHYA 3FYZA 4LENA 3S4XA 1ALQA 4HESA 1T1CA 3NJAA 4DDYA 3FZCA 2WGVA 4ID4A 3VOLA 4E3JA 3UDXA 1PIOA 3NIAA 4GDNA 2V8FA 2PU2A 3BQ8A 3G30A 3O88A 1IFQA 4EEPA 5U47A 3WWXA 1ZTUA 1OTEA 2HJEA 1G5UA 1YSPA 3NDEA 2B5RA 3KSIA 3RTYA 1W63Q 3E4PA 2VV6A 5F5YA 5D3OA 1EW0A 3HLCA 3HJIA 3NHQA 3KSFA 2H5SA 1K54C 3E0YA 4QHCA 4EBLA 3FKVA 1GA0A 4LV0A 3SS5A 2V1ZA 5M18A 2PBDP 3G31A 4P0MA 5TBMB 3EGXC 5CHUA 4O8GA 4WUJA 4UQIM 2V1AA 1TS7A 5GLDA 2JBFA 5AQBA 2C6WB 3V3RA 1STZA 3BFEA 3H82A 2QZ6A 3TJZC 5FI7A 2Y8HA 1JVJA 1BLSA 1T18A 3CPTA 3IHAA 3NC8A 1FR6A 2CC1A 1YT4A 3GSGA 5KIZA 5HWWA 4L9GA 3Q7VB 3TG9A 1H8ZA 4LPZA 1OTIA 3UB6A 2QPNA 3QP2A 5G18A 3D4FA 3BLSA 1FCNA 2KLIA 4UA9A 1NRJA 1S67L 4JPMA 2ZJ9A 4GOGA 3L9KA 2V9AA 3T12B 5AJGA 3MQQA 2ZM8A 1BT5A 1H8MA 3O5YA 3UE1A 1S1ZA 1ZKJA 4S2OA 4G3WA 4KQRA 3GV9A 5FSRA 3ZGAB 1MKMA 4PKYG 1E3UD 3GR2A 2JKFA 3PBRA 4JGOA 3G35A 1G6OA 1XGJA 1PRQA 2IWCA 4HJ3A 1KVMA 2Y2QA 5FA7A 1BLCA 1HVBA 1PI5A 3LR5A 4H6JB 5HARA 3HLBA 3IHBA 1P0ZA 5EM0A 5IT5A 3B3XA 4O0PA 4KG6A 5KSCA 3MBZA 4I38A 2UV0E 5HFOA 1SDEA 2VZWA 3CMZA 2Z2MB 4Y0OA 1RGZA 3SOIA 5FATA 1XKZA 5DFYA 4EQIA 2E8JA 3EWKA 2I72A 1S66L 3K3CA 2EA9A 1MWSA 1G6AA 2QJ7A 4II7A 4BD0A 2Z6CA 4R0QA 4RX2A 1TDLA 2Y2NA 4Y17A 4GN2A 2KDKA 4OQGA 4Y0TA 1W79A 3M2KA 5EECA 3C7UA 3NOPC 4NXBA 2J9PA 5CGWA 2WGWA 3IWQA 1MXOA 1RCJA 2Y55A 3K3DA 3UB8A 1SHVA 1GSXA 3VSLA 5HL6A 5L09A 3IT9A 2R9WA 4D60A 4I3IA 4FUWA 2P08A 3O3VA 3UPPA 5FEGA 3VOZA 1KGEA 5CTMA 3A0VA 4ZJ2A 3LCEA 4GW9A 1IYQA 1RP5A 2Y2LA 2ZC4B 3C2WA 5MC7A 2PD7A 1T1AA 2B95A 4LRZE 1L2SA 1D06A 1LI9A 2GNXA 4WEJA 3Q82A 1IYPA 1SKFA 5GHZA 3IXDA 1KE0A 2PDRA 2WADA 4EBPA 1T1BA 3G2YA 4X6TA 2ZL1A 1ZG6A 2Y2JA 3B33A 3UDIA 3IXGA 5DVAA 1S4RA 5EVIA 3LFVA 1D7EA 4DE1A 2O0YA 3A3JA 3H9WA 3ZNTA 1ES3A 2RL3A 2VKSA 5EVEA 1VEUB 5CECA 4X1MA 1EROA 4D2OA 1NYYA 3BY9A 4U0XA 4Q0JA 1Q2PA 2BLSA 2D02A 4DE0A 2VJWA 1EI5A 1KE4A 4X1LA 2XR0A 5KSHA 4ZDXA 3DTIA 1EWZA 1MZUA 1D1JA 4N92A 3WRTA 1IYSA 3RXWA 5IHVA 5DKKA 3NCKA 3MZEA 3W2ZA 1O7EA 2HDRA 1SDNA 4GJ4A 2WKPA 4P6BA 1TF1A 3FPVA 3IF6B 3MSHA 3C4OA 4PKYA 4OQ0A 1L0FA 3QNCA 3U4LP 4N1HA 2O9CA 3N8LA 3M6BA 3JVUA 1Q2QA 2XGNA 5FDSA 3S7PA 3F1NA 4MBFA 2XA7M 3IBJA 1K25A 2EWWA 3MKEA 5CEDA 2EX9A 5CHMA 3VE3A 4BL2A 4DKIA 3IS2A 3ICYA 4JLFA 3PAEA 1MC0A 1VETA 1X0OA 4MLLA 3EQUA 2VGLS 4HBTA 1K56D 1M6KA 4JKTA 2P7JA 3N7WA 1S1YA 4KUOA 3MFDA 3N8SA 2XLNA 1TDGA 3UB7A 3F1PA 5FL3A 1NWZA 3C30A 3SH7A 2EXBA 5CEBA 4OPZA 4KZ6A 3UMDA 3LR0A 2G7UA 4UHUA 5HDDA 4G3VA 4BBUA 3N8RA 1CJFA 4OQHA 3G2ZA 5TR7A 3QP1A 1FCMA 3SS4A 2Q9NA 5CGXA 3LIAA 3FPWA 4HHDA 2FH5A 2XEPA 2X01A 1V9YA 2A2LA 3OPPA 1XXMA 3ZYTA 4CLCE 4E04A 1LHYA 2W3GA 2XSSA 1PI4A 2QMIA 4S2NA 1FQGA 5F68A 5LBRA 4EETB 3M2JA 3QP5A 3UO9A 5GLBA 3L7HA 5DJUA 2PYRA 5TBMA 1S0WA 3ZG0A 2ZQ8A 4GB7A 5G4YA 3A0RA 5FI2A 2XFSA 1YQSA 2P04A 2E8IA 2V8CA 5E2FA 4JF5A 2WZZA 4DN0A 1IELA 3VP4A 3UE0A 2VEAA 1YLWA 5HW3A 2EFUA 3S1YA 4R3BA 3VV4A 2VGJA 3H7WA 3MKFA 4IVKA 4ZBEA 2Y4AA 4K08A 4C6YA 3V5MA 2Y2OA 1JNUA 4P85A 4WM9A 4R38A 3E98A 3NECA 4IUHA 3FC7A 3S7OA 3TOIA 4EU0A 3IF6C 5FDHA 2W1TA 3IH8A 4Y2FA 5TFQA 4BWIA 4NEED 2Y2MA 5J8XA 4P87A 1W8YA 5CHJA 1K55A 5FAPA 2W1RA 5I5LA 2VGKA 2C5WB 4DRTA 2A24A 1E3UA 4H6JA 2H28A 2HP6A 4E3OA 2QJ5A 2Q0OA 2L4RA 3IX8A 4MMNA 3SH8A 4OOYA 2IWDA 4XT2A 2ZQAA 5M19A 3QP4A 4QU3A 1QMEA 2BTFP 1KGFA 5L10A 5L07A 3T4JA 1XA7A 2Q9MA 3CG5A 4JXVA 2JKTM 2WKIA 4MEZA 5EV0A 3R7WA 1MBLA 5HDCA 1BSGA 5FAQA 4O7DA 2W3HA 3NI9A 4F3LB 1SZVA 2Z6DA 3D72A 2M1CA 4CLCA 5JYOA 3Q1FA 1OMEA 4KZAA 1C3BA 1OPXA 2L1MA 4RYEA 1ODVA 1JTGA 2H0YA 3W4PA 3WS2A 5E2HA 3HUMA 4R6LA 1K6RA 4I3AA 1NLZA 2DRWA 3SZTA 2L0WA 2QKPA 3OBFA 1WE4A 4S2KA 1W5DA 4KZ7A 4WLAA 4BQMA 5HSQA 2LB9A 4WMCD 1IKGA 2VA0A 4WELA 3SW1A 3B47A 2WUQA 4ZJ3A 5F6AA 1ZHHB 5K5BA 1SKOB 3LIBA 3T4OA 1YLZA 3HJKA 1OTBA 2Z2LB 3C8CA 4PPRA 2QWSA 4X25A 4HH3A 1CQAA 4L9FA 4BBTA 5DF8A 3LY3A 4NK3A 1GHPA 1CEGA 3OLOA 2YKHA 3JYIA 1G68A 2H10A 1GSVA 3RJUA 3UE6A 1CF0A 4NXEA 4FTXA 5FQQA 4P6ZS 4FCFA 3VOYA 2HDQA 4E3MA 3G34A 3OPHA 5EVIC 3VP2A 4S2JA 4EUVA 2IWBA 4R70A 3NOTC 3VP0A 1XJ4A 4U0TA 3MQOA 1YM1A 3MQ0A 4MCWA 4N9LA 1LL8A 2WAEA 4BMWA 3VFFA 2LB5A 4KZ9A 1Y28A 4KZBA 4ETZA 3LYXA 5G4ZA 1YLYA 1JWVA 5C5KA 4Y0UA 1DJAA 3UMEA 4KZ4A 5TJJA 1ERMA 1DJBA 3P7NA 1TS6A 3A3FA 4JF4A 5DJTA 4HOIA 1ES5A 1XX2A 5E2GA 4JXWA 1BYWA 2G2WA 4ZJ1A 4KG5A 4HNBA 4ARZB 1K56A 4HIAA 1XP4A 2FFFB 1H8YA 3LIDA 4IHQA 4BL3A 3O86A 3BRMA 2I9VA 4IUKA 1RGYA 2ZOIA 3T1XA 3EEHA 3HUOA 2JKTI 3UDFA 4HJ4A 2P9VB 2BG1A 3C38A 4ME4A 2ZQCA 1PWDA 1XGIA 4OPYA 4X56A 2XK1A 5FEFA 3NULA 3HLWA 3RH8B 2XD1A 5CX7A 5AQ7A 4MDZA 3PBSA 3LIFA 3EEAA 3PBNA 2QHKA 3LEZA 3T4TA 4S2MA 4JGPA 4LCLA 5FI6A 2XROA 5EFWA 4KZ5A 1P9WA 1YMSA 4YOFA 3ISGA 5CXWA 1FSWA 1MPLA 2R9XA 2Y91A 4QY5A 4RQ9A 2WGIA 3ZFZA 4ETXA 3CHWP 3MZDA 4R4RA 1CI8A 4DXCA 3K2NA 4QD4A 3ITAA 5DF9A 4E6WA 1L0GA 1NZUA 4LV3A 4X69A 5FAOA 3ZQ5A 4E3NA 3PBTA 1K54A 4WBGA 3T4QA 4Q0IA 4GHIA 4WZ4A 3NOUC 5HL1A 4NG2A 3LR3A 2PD8A 1BLPA 2HDSA 3DTEA 2Y2PA 1YPRA 4JGQA 5HPIA 5J4EA 4LCMA 1TS8A 1DP6A 5EVLA 3RXXA 4UAAA 2W27A 1TD5A 4WEKA 2WZXA 3BY8A 5HAIA 4QWOA 1VHMA 4DMZA
chains in the Genus database with same CATH topology
2X01A 3W4OA 2ZQ7A 4DDSA 5KMWA 1KGGA 3OPPA 2RCXA 1XXMA 1GCEA 2HDUA 1K38A 4CJNA 2Y59A 1LHYA 3HREA 5EE8A 3PTEA 5TGFA 1PI4A 2QMIA 2WKHA 1CK3A 4S2NA 1O07A 3M6HA 1FQGA 4OPRA 4JXGA 3QNBA 4Z9QA 1I2WA 3M2JA 4FH2A 2OSUA 1QMFA 5GLAA 3UO9A 5GHYA 5GLBA 3FYZA 4LENA 3S4XA 3OPRA 1NXYA 4EV4A 1S0WA 1IKIA 3ZG0A 1ALQA 4HESA 2ZQ8A 4GB7A 1KDSA 5FI2A 2XFSA 4DDYA 3FZCA 4OONA 1YQSA 1BLHA 2WGVA 2ZLYA 4ID4A 5GL9A 2E8IA 3A3EA 4K0XA 4E3JA 5E2FA 1K4FA 4JF5A 3UDXA 2WZZA 2XF3A 1PIOA 1IELA 1PW8A 3NIAA 4GDNA 4S2PA 2PU2A 3G30A 3UNWA 3O88A 4OLGA 3UN7A 2WKEA 3VP4A 5U47A 3UE0A 3WWXA 1YLWA 3DTMA 3HBRA 2EFUA 2X02A 5HW3A 5F1GA 1ES2A 3S1YA 4R3BA 2DNSA 3O87A 3NDEA 2B5RA 4BENA 1MWUA 2VGJA 3CJMA 3MKFA 3DW0A 3OCNA 4IVKA 4S2IA 2ZC6B 4Y7PA 4R23A 2Y4AA 4ZBEA 3BLMA 1K55C 4C6YA 5D3OA 2HPBA 4Q8IA 3V5MA 1PYYA 2Y2KA 3NDGA 4ZTKA 3HLCA 5BOHA 2Y2OA 5HAPA 1PZOA 4P85A 2H5SA 1HTZA 4WM9A 4RVAA 4BJPA 1K54C 5FQ9A 5E43A 4QHCA 3MXRA 4EBLA 1JTDA 4UA6A 3FKVA 1N4OA 1GA0A 4CPKA 3ZG9B 4E3LA 4GZBA 3GVBA 3Q07A 2Y2IA 3TOIA 4LV0A 3SS5A 2V1ZA 3IF6C 5M18A 3IH9A 3G31A 4OQIA 3HLGA 4YFMA 4A5RA 5DF7A 3P98A 4P0MA 3ITBA 5EOEA 5FDHA 4QB8A 4K91A 5CHUA 5F83A 3IH8A 3UY6A 1I5QA 3I7JA 5TFQA 3SS3A 3E2LA 2Y2MA 5J8XA 2ZMAA 2JBFA 1W8YA 4P87A 1K55A 3EQVA 3P09A 2C6WB 5CHJA 5AQBA 5FAPA 3V3RA 3BFEA 2VGKA 3OPLA 2QZ6A 1NRFA 2C5WB 3FWLA 4RX3A 4DRTA 5FI7A 3PAGA 3VP3A 1JVJA 1BLSA 1E3UA 4OLDA 3VP1A 3IHAA 3NC8A 1ESIA 1FR6A 2CC1A 1YT4A 3GSGA 4U3TA 2HP6A 4E3OA 2WYXA 2XDMA 1ES4A 4H8RA 1BUEA 3Q7VB 5EUAA 1H8ZA 3TG9A 1HZOA 4PM9A 1MWRA 2QPNA 4S2NC 3SH8A 2ZC5B 5G18A 3IXBA 4KZ8A 3BFDA 1JWZA 1BTLA 3D4FA 3BLSA 1FCNA 1K4EA 2IWDA 2J7VA 4OOYA 5DTKA 4UA9A 2ZQAA 5M19A 5GLDA 1NJ4A 4JPMA 4QU3A 1H5XA 1QMEA 1KGFA 3HLFA 2ZJ9A 4GOGA 4YINA 3ZNYA 4KQOA 1XA7A 4OVDA 2Q9MA 2ZM8A 3CG5A 1BT5A 4JXVA 3IWIA 4HEFA 3WS5A 2WKIA 3V50A 3UE1A 4MEZA 1ZKJA 4S2OA 3NY4A 4KQRA 3TSGA 3GV9A 1MBLA 2EX2A 2J9OA 5FSRA 1KDWA 1BSGA 3ZGAB 1FOFA 3A3DA 5FAQA 2Y2GA 4O7DA 1KVLA 4X68A 2XQZA 3HLEA 1E3UD 3GR2A 4GD8A 3PBRA 3BFGA 3NI9A 3GQZA 4EWFA 1VQQA 4X53A 4MBHA 3G35A 2ZD8A 4OP8A 1IEMA 4R4SA 5DTTA 1PWGA 1NY0A 1ZG4A 4DE3A 4FSFA 1DJCA 1XGJA 5JYOA 1ZC2A 2IWCA 3Q1FA 1OMEA 4KZAA 1KVMA 2Y2QA 5FA7A 1BLCA 1HVBA 1PI5A 1C3BA 4C3QA 1LL9A 4RYEA 2H0YA 1JTGA 5HARA 3VMAA 3W4PA 3WS2A 1MWTA 5E2HA 3HUMA 3QHYA 3IF5A 1L0EA 3HLBA 3IHBA 2PBYA 3V39A 3WRZA 4BLMA 1K6RA 3B3XA 2ZQ9A 4IEDA 4L0LA 2DRWA 4KG6A 5FQKA 4R3JA 3UE3A 5AQAA 3WS1A 3LO7A 2V2FF 5KSCA 1WE4A 3MBZA 4S2KA 4DE2A 3S22A 1W5DA 4KZ7A 4IVIA 4BQMA 4WMCD 5HFOA 4E3IA 1IKGA 1SDEA 5JYPA 3UPOA 3CMZA 1YLTA 2Z2MB 3PBQA 4PM7A 4Y0OA 4WELA 3Q7VA 1RGZA 3IWOA 4PM8A 3SOIA 4EBNA 5FATA 3N6IA 1XKZA 3HVFA 3C4PA 4EQIA 4F94A 5EVID 2WUQA 2I72A 4ZJ3A 1WYBA 2H0TA 4XXRA 1GA9A 1ONGA 1MWSA 4JBFA 1BZAA 1G6AA 1W8QA 4B88A 5L2FA 1YLZA 4GNUA 5A91A 4BD0A 4R0QA 4RX2A 2Z2LB 1DY6A 2Y2HA 3LY4A 4PPRA 5EVIB 1GHIA 4PM6A 2EXAA 3N4IA 1TDLA 2Y2NA 1SCWA 2XD5A 4GN2A 2G2UA 4OQGA 4B4ZA 4Y0TA 1N9BA 2PU4A 1W79A 3M2KA 2EFXA 5EECA 5A93A 2JE5A 3C7UA 4IBXA 1LI0A 3SH9A 5DF8A 2J9PA 3LY3A 4NK3A 1GHPA 2WGWA 3IWQA 4UA7A 5CGWA 1TVFA 5F1FA 1MXOA 1CEGA 1RCJA 2Y55A 3VSKA 2WK0A 1MY8A 1SHVA 3JYIA 4GDBA 1G68A 2X71A 1MKIA 2H10A 3HL9A 4N1XA 3VSLA 1NZOA 5FQJA 3RJUA 1I2SA 2EX8A 3IT9A 2R9WA 5CRFA 1K57C 1XA1A 2J8YA 1L0DA 3O3VA 3UPPA 5CTNA 3VOZA 5FQQA 5CERA 1KGEA 4KZ3A 1S6RA 5CTMA 3WS4A 4X55A 4ZJ2A 5I94A 3LCEA 4FCFA 2ZM2A 1IYQA 1RP5A 3VOYA 2HDQA 2Y2LA 2ZC4B 4E3MA 3W4QA 4LV2A 4KG2A 4MBKA 4S2LA 4DXBA 5FASA 3Q7ZA 4KENB 3G34A 3OPHA 5EVIC 3OZHA 3GTCA 3GMWA 1L2SA 3VP2A 1LI9A 4WEJA 4KQQA 3HUNA 3Q82A 4S2JA 1IYPA 1SKFA 5GHZA 4WZ5C 3IXDA 2IWBA 1KE0A 1W7FA 2WADA 3C5AA 4EBPA 1K57A 3VP0A 1HD8A 4OP5A 3ZHHA 4U0TA 3G2YA 4X6TA 1YM1A 4FH4A 2JC7A 4IBRA 4OKPA 3OCLA 4XUXA 5AQ9A 4N9LA 1IYOA 1PWCA 2WAEA 4OPQA 4WMCA 5DTSA 3VFFA 1ZG6A 4ZAMA 3AGDA 1K6SA 3AGFA 4KZ9A 2WGWB 2Y2JA 3UDIA 3IQAA 5FQMA 2ZM0A 2HP5A 3IXGA 5DVAA 5EVIA 3G32A 4KZBA 4DE1A 2JCHA 3A3JA 4GD6A 3ZNTA 1ES3A 2RL3A 1YLYA 2A49A 3BFFA 3ZDJA 1JWVA 3VFHA 5CECA 4WZ5A 4DF6A 1EROA 4D2OA 1M40A 1YLPA 1NYYA 3OC2A 4JXSA 4Y0UA 1DJAA 4B4XA 2XH9A 4U0XA 5HX9A 4KZ4A 1Q2PA 1ERMA 4E6XA 2BLSA 3ZCZA 5A92A 1DJBA 3BYDA 5GHXA 4DE0A 3A3FA 4JF4A 4M3KA 2V20A 5M1AA 1EI5A 1KE4A 2EX6A 3AGEA 1ES5A 1XX2A 5E2GA 2ZC7A 5CGSA 4JXWA 4BD1A 2G2WA 2XR0A 4ZJ1A 5KSHA 1XPBA 4ZDXA 4KG5A 4R1GA 2ZC3B 1EWZA 1ESUA 3FV7A 4N92A 3WRTA 1IYSA 1K56A 3RXWA 3ZVWA 1XP4A 2FFFB 1E4DA 1U60A 1H8YA 5IHVA 3BFCA 3NCKA 1ONHA 4N9KA 4BL3A 2ZQDA 3IXHA 1E25A 1LLBA 3BRMA 3MZEA 3O86A 1BULA 3V3SA 1VM1A 1O7EA 4PM5A 1YMXA 1SDNA 2HDRA 4P6BA 5EOOA 1RGYA 3ZG7B 4OOMA 1YLJA 4QJGA 3UDFA 3HUOA 3IF6B 3WS0A 5HAQA 2UWXA 2P9VB 3C4OA 2BG1A 4OQ0A 1L0FA 3QNCA 5EPHA 4QY6A 4LV1A 4N1HA 3N8LA 4JF6A 3M6BA 2ZQCA 1PWDA 3DWKA 1XGIA 1Q2QA 4OPYA 4RA7A 2XGNA 4X56A 4MBFA 2XK1A 1K25A 3MKEA 5CEDA 2EX9A 5CHMA 3HLWA 4BL2A 2XD1A 5AQ7A 3PBSA 3PBNA 5E2EA 2A3UA 2OLVA 3LEZA 4HBUA 4DKIA 2FFYA 4S2MA 1GHMA 2HP9A 4LCLA 5FI6A 3BM6A 5FQIA 4JLFA 3ZG8B 1Y54A 3PAEA 4MLLA 3EQUA 3C7VA 4HBTA 1K56D 1NYMA 4E3KA 1M6KA 3G4PA 2P74A 4KZ5A 4JKTA 1YMSA 1LL5A 3UPNA 3ISGA 3FKWA 4OH0A 5CXWA 3NBLA 1FSWA 1FSYA 1MPLA 2R9XA 2Y91A 3N7WA 4QY5A 2OV5A 2DCFA 4OOLA 3MFDA 2WGIA 1WYCA 4K0WA 3ZFZA 4PMAA 3N8SA 2XLNA 3BECA 3MXSA 1J9MA 1TDGA 3MZDA 4XUZA 4R4RA 1CI8A 4DXCA 3HLDA 4QD4A 2OLUA 3ITAA 4GKUA 3E2KA 5DF9A 4E6WA 1L0GA 1AXBA 1NZUA 3SH7A 3ZVTA 4C75A 1Z6FA 4LV3A 1PZPA 4FD8A 2EXBA 5CEBA 4OPZA 4KZ6A 4X69A 5FAOA 4E3NA 3PBTA 1K54A 1CEFA 3DWZA 4UHUA 4WBGA 3N8RA 3Q81A 4WZ4A 4OQHA 3G2ZA 3ZG5A 2XFTA 5TR7A 5HL1A 3IF6A 1PW1A 2GDNA 5KZHA 1FR1A 2P9VA 1BLPA 2HDSA 2Y2PA 1FCMA 3SS4A 2Q9NA 5CGXA 3PBOA 4MNRA 4LCMA 3W8KA 4EUZA 5EVLA 4NETA 1JWPA 5F82A 3RXXA 4UAAA 1CI9A 2WAFA 3BEBA 4WEKA 1ERQA 5GLCA 2WZXA 1KE3A 1TEMA 4WYYA 3GRJA 5HAIA 3MZFA 2XEPA 3CZDA 1FCOA 5A90A 3A3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X01 A;  3W4O A;  2ZQ7 A;  4DDS A;  5KMW A;  1KGG A;  3OPP A;  2RCX A;  1XXM A;  1GCE A;  2HDU A;  1K38 A;  4CJN A;  2Y59 A;  1LHY A;  3HRE A;  5EE8 A;  3PTE A;  5TGF A;  1PI4 A;  2QMI A;  2WKH A;  1CK3 A;  4S2N A;  1O07 A;  3M6H A;  1FQG A;  4OPR A;  4JXG A;  3QNB A;  4Z9Q A;  1I2W A;  3M2J A;  4FH2 A;  2OSU A;  1QMF A;  5GLA A;  3UO9 A;  5GHY A;  5GLB A;  3FYZ A;  4LEN A;  3S4X A;  3OPR A;  1NXY A;  4EV4 A;  1S0W A;  1IKI A;  3ZG0 A;  1ALQ A;  4HES A;  2ZQ8 A;  4GB7 A;  1KDS A;  5FI2 A;  2XFS A;  4DDY A;  3FZC A;  4OON A;  1YQS A;  1BLH A;  2WGV A;  2ZLY A;  4ID4 A;  5GL9 A;  2E8I A;  3A3E A;  4K0X A;  4E3J A;  5E2F A;  1K4F A;  4JF5 A;  3UDX A;  2WZZ A;  2XF3 A;  1PIO A;  1IEL A;  1PW8 A;  3NIA A;  4GDN A;  4S2P A;  2PU2 A;  3G30 A;  3UNW A;  3O88 A;  4OLG A;  3UN7 A;  2WKE A;  3VP4 A;  5U47 A;  3UE0 A;  3WWX A;  1YLW A;  3DTM A;  3HBR A;  2EFU A;  2X02 A;  5HW3 A;  5F1G A;  1ES2 A;  3S1Y A;  4R3B A;  2DNS A;  3O87 A;  3NDE A;  2B5R A;  4BEN A;  1MWU A;  2VGJ A;  3CJM A;  3MKF A;  3DW0 A;  3OCN A;  4IVK A;  4S2I A;  2ZC6 B;  4Y7P A;  4R23 A;  2Y4A A;  4ZBE A;  3BLM A;  1K55 C;  4C6Y A;  5D3O A;  2HPB A;  4Q8I A;  3V5M A;  1PYY A;  2Y2K A;  3NDG A;  4ZTK A;  3HLC A;  5BOH A;  2Y2O A;  5HAP A;  1PZO A;  4P85 A;  2H5S A;  1HTZ A;  4WM9 A;  4RVA A;  4BJP A;  1K54 C;  5FQ9 A;  5E43 A;  4QHC A;  3MXR A;  4EBL A;  1JTD A;  4UA6 A;  3FKV A;  1N4O A;  1GA0 A;  4CPK A;  3ZG9 B;  4E3L A;  4GZB A;  3GVB A;  3Q07 A;  2Y2I A;  3TOI A;  4LV0 A;  3SS5 A;  2V1Z A;  3IF6 C;  5M18 A;  3IH9 A;  3G31 A;  4OQI A;  3HLG A;  4YFM A;  4A5R A;  5DF7 A;  3P98 A;  4P0M A;  3ITB A;  5EOE A;  5FDH A;  4QB8 A;  4K91 A;  5CHU A;  5F83 A;  3IH8 A;  3UY6 A;  1I5Q A;  3I7J A;  5TFQ A;  3SS3 A;  3E2L A;  2Y2M A;  5J8X A;  2ZMA A;  2JBF A;  1W8Y A;  4P87 A;  1K55 A;  3EQV A;  3P09 A;  2C6W B;  5CHJ A;  5AQB A;  5FAP A;  3V3R A;  3BFE A;  2VGK A;  3OPL A;  2QZ6 A;  1NRF A;  2C5W B;  3FWL A;  4RX3 A;  4DRT A;  5FI7 A;  3PAG A;  3VP3 A;  1JVJ A;  1BLS A;  1E3U A;  4OLD A;  3VP1 A;  3IHA A;  3NC8 A;  1ESI A;  1FR6 A;  2CC1 A;  1YT4 A;  3GSG A;  4U3T A;  2HP6 A;  4E3O A;  2WYX A;  2XDM A;  1ES4 A;  4H8R A;  1BUE A;  3Q7V B;  5EUA A;  1H8Z A;  3TG9 A;  1HZO A;  4PM9 A;  1MWR A;  2QPN A;  4S2N C;  3SH8 A;  2ZC5 B;  5G18 A;  3IXB A;  4KZ8 A;  3BFD A;  1JWZ A;  1BTL A;  3D4F A;  3BLS A;  1FCN A;  1K4E A;  2IWD A;  2J7V A;  4OOY A;  5DTK A;  4UA9 A;  2ZQA A;  5M19 A;  5GLD A;  1NJ4 A;  4JPM A;  4QU3 A;  1H5X A;  1QME A;  1KGF A;  3HLF A;  2ZJ9 A;  4GOG A;  4YIN A;  3ZNY A;  4KQO A;  1XA7 A;  4OVD A;  2Q9M A;  2ZM8 A;  3CG5 A;  1BT5 A;  4JXV A;  3IWI A;  4HEF A;  3WS5 A;  2WKI A;  3V50 A;  3UE1 A;  4MEZ A;  1ZKJ A;  4S2O A;  3NY4 A;  4KQR A;  3TSG A;  3GV9 A;  1MBL A;  2EX2 A;  2J9O A;  5FSR A;  1KDW A;  1BSG A;  3ZGA B;  1FOF A;  3A3D A;  5FAQ A;  2Y2G A;  4O7D A;  1KVL A;  4X68 A;  2XQZ A;  3HLE A;  1E3U D;  3GR2 A;  4GD8 A;  3PBR A;  3BFG A;  3NI9 A;  3GQZ A;  4EWF A;  1VQQ A;  4X53 A;  4MBH A;  3G35 A;  2ZD8 A;  4OP8 A;  1IEM A;  4R4S A;  5DTT A;  1PWG A;  1NY0 A;  1ZG4 A;  4DE3 A;  4FSF A;  1DJC A;  1XGJ A;  5JYO A;  1ZC2 A;  2IWC A;  3Q1F A;  1OME A;  4KZA A;  1KVM A;  2Y2Q A;  5FA7 A;  1BLC A;  1HVB A;  1PI5 A;  1C3B A;  4C3Q A;  1LL9 A;  4RYE A;  2H0Y A;  1JTG A;  5HAR A;  3VMA A;  3W4P A;  3WS2 A;  1MWT A;  5E2H A;  3HUM A;  3QHY A;  3IF5 A;  1L0E A;  3HLB A;  3IHB A;  2PBY A;  3V39 A;  3WRZ A;  4BLM A;  1K6R A;  3B3X A;  2ZQ9 A;  4IED A;  4L0L A;  2DRW A;  4KG6 A;  5FQK A;  4R3J A;  3UE3 A;  5AQA A;  3WS1 A;  3LO7 A;  2V2F F;  5KSC A;  1WE4 A;  3MBZ A;  4S2K A;  4DE2 A;  3S22 A;  1W5D A;  4KZ7 A;  4IVI A;  4BQM A;  4WMC D;  5HFO A;  4E3I A;  1IKG A;  1SDE A;  5JYP A;  3UPO A;  3CMZ A;  1YLT A;  2Z2M B;  3PBQ A;  4PM7 A;  4Y0O A;  4WEL A;  3Q7V A;  1RGZ A;  3IWO A;  4PM8 A;  3SOI A;  4EBN A;  5FAT A;  3N6I A;  1XKZ A;  3HVF A;  3C4P A;  4EQI A;  4F94 A;  5EVI D;  2WUQ A;  2I72 A;  4ZJ3 A;  1WYB A;  2H0T A;  4XXR A;  1GA9 A;  1ONG A;  1MWS A;  4JBF A;  1BZA A;  1G6A A;  1W8Q A;  4B88 A;  5L2F A;  1YLZ A;  4GNU A;  5A91 A;  4BD0 A;  4R0Q A;  4RX2 A;  2Z2L B;  1DY6 A;  2Y2H A;  3LY4 A;  4PPR A;  5EVI B;  1GHI A;  4PM6 A;  2EXA A;  3N4I A;  1TDL A;  2Y2N A;  1SCW A;  2XD5 A;  4GN2 A;  2G2U A;  4OQG A;  4B4Z A;  4Y0T A;  1N9B A;  2PU4 A;  1W79 A;  3M2K A;  2EFX A;  5EEC A;  5A93 A;  2JE5 A;  3C7U A;  4IBX A;  1LI0 A;  3SH9 A;  5DF8 A;  2J9P A;  3LY3 A;  4NK3 A;  1GHP A;  2WGW A;  3IWQ A;  4UA7 A;  5CGW A;  1TVF A;  5F1F A;  1MXO A;  1CEG A;  1RCJ A;  2Y55 A;  3VSK A;  2WK0 A;  1MY8 A;  1SHV A;  3JYI A;  4GDB A;  1G68 A;  2X71 A;  1MKI A;  2H10 A;  3HL9 A;  4N1X A;  3VSL A;  1NZO A;  5FQJ A;  3RJU A;  1I2S A;  2EX8 A;  3IT9 A;  2R9W A;  5CRF A;  1K57 C;  1XA1 A;  2J8Y A;  1L0D A;  3O3V A;  3UPP A;  5CTN A;  3VOZ A;  5FQQ A;  5CER A;  1KGE A;  4KZ3 A;  1S6R A;  5CTM A;  3WS4 A;  4X55 A;  4ZJ2 A;  5I94 A;  3LCE A;  4FCF A;  2ZM2 A;  1IYQ A;  1RP5 A;  3VOY A;  2HDQ A;  2Y2L A;  2ZC4 B;  4E3M A;  3W4Q A;  4LV2 A;  4KG2 A;  4MBK A;  4S2L A;  4DXB A;  5FAS A;  3Q7Z A;  4KEN B;  3G34 A;  3OPH A;  5EVI C;  3OZH A;  3GTC A;  3GMW A;  1L2S A;  3VP2 A;  1LI9 A;  4WEJ A;  4KQQ A;  3HUN A;  3Q82 A;  4S2J A;  1IYP A;  1SKF A;  5GHZ A;  4WZ5 C;  3IXD A;  2IWB A;  1KE0 A;  1W7F A;  2WAD A;  3C5A A;  4EBP A;  1K57 A;  3VP0 A;  1HD8 A;  4OP5 A;  3ZHH A;  4U0T A;  3G2Y A;  4X6T A;  1YM1 A;  4FH4 A;  2JC7 A;  4IBR A;  4OKP A;  3OCL A;  4XUX A;  5AQ9 A;  4N9L A;  1IYO A;  1PWC A;  2WAE A;  4OPQ A;  4WMC A;  5DTS A;  3VFF A;  1ZG6 A;  4ZAM A;  3AGD A;  1K6S A;  3AGF A;  4KZ9 A;  2WGW B;  2Y2J A;  3UDI A;  3IQA A;  5FQM A;  2ZM0 A;  2HP5 A;  3IXG A;  5DVA A;  5EVI A;  3G32 A;  4KZB A;  4DE1 A;  2JCH A;  3A3J A;  4GD6 A;  3ZNT A;  1ES3 A;  2RL3 A;  1YLY A;  2A49 A;  3BFF A;  3ZDJ A;  1JWV A;  3VFH A;  5CEC A;  4WZ5 A;  4DF6 A;  1ERO A;  4D2O A;  1M40 A;  1YLP A;  1NYY A;  3OC2 A;  4JXS A;  4Y0U A;  1DJA A;  4B4X A;  2XH9 A;  4U0X A;  5HX9 A;  4KZ4 A;  1Q2P A;  1ERM A;  4E6X A;  2BLS A;  3ZCZ A;  5A92 A;  1DJB A;  3BYD A;  5GHX A;  4DE0 A;  3A3F A;  4JF4 A;  4M3K A;  2V20 A;  5M1A A;  1EI5 A;  1KE4 A;  2EX6 A;  3AGE A;  1ES5 A;  1XX2 A;  5E2G A;  2ZC7 A;  5CGS A;  4JXW A;  4BD1 A;  2G2W A;  2XR0 A;  4ZJ1 A;  5KSH A;  1XPB A;  4ZDX A;  4KG5 A;  4R1G A;  2ZC3 B;  1EWZ A;  1ESU A;  3FV7 A;  4N92 A;  3WRT A;  1IYS A;  1K56 A;  3RXW A;  3ZVW A;  1XP4 A;  2FFF B;  1E4D A;  1U60 A;  1H8Y A;  5IHV A;  3BFC A;  3NCK A;  1ONH A;  4N9K A;  4BL3 A;  2ZQD A;  3IXH A;  1E25 A;  1LLB A;  3BRM A;  3MZE A;  3O86 A;  1BUL A;  3V3S A;  1VM1 A;  1O7E A;  4PM5 A;  1YMX A;  1SDN A;  2HDR A;  4P6B A;  5EOO A;  1RGY A;  3ZG7 B;  4OOM A;  1YLJ A;  4QJG A;  3UDF A;  3HUO A;  3IF6 B;  3WS0 A;  5HAQ A;  2UWX A;  2P9V B;  3C4O A;  2BG1 A;  4OQ0 A;  1L0F A;  3QNC A;  5EPH A;  4QY6 A;  4LV1 A;  4N1H A;  3N8L A;  4JF6 A;  3M6B A;  2ZQC A;  1PWD A;  3DWK A;  1XGI A;  1Q2Q A;  4OPY A;  4RA7 A;  2XGN A;  4X56 A;  4MBF A;  2XK1 A;  1K25 A;  3MKE A;  5CED A;  2EX9 A;  5CHM A;  3HLW A;  4BL2 A;  2XD1 A;  5AQ7 A;  3PBS A;  3PBN A;  5E2E A;  2A3U A;  2OLV A;  3LEZ A;  4HBU A;  4DKI A;  2FFY A;  4S2M A;  1GHM A;  2HP9 A;  4LCL A;  5FI6 A;  3BM6 A;  5FQI A;  4JLF A;  3ZG8 B;  1Y54 A;  3PAE A;  4MLL A;  3EQU A;  3C7V A;  4HBT A;  1K56 D;  1NYM A;  4E3K A;  1M6K A;  3G4P A;  2P74 A;  4KZ5 A;  4JKT A;  1YMS A;  1LL5 A;  3UPN A;  3ISG A;  3FKW A;  4OH0 A;  5CXW A;  3NBL A;  1FSW A;  1FSY A;  1MPL A;  2R9X A;  2Y91 A;  3N7W A;  4QY5 A;  2OV5 A;  2DCF A;  4OOL A;  3MFD A;  2WGI A;  1WYC A;  4K0W A;  3ZFZ A;  4PMA A;  3N8S A;  2XLN A;  3BEC A;  3MXS A;  1J9M A;  1TDG A;  3MZD A;  4XUZ A;  4R4R A;  1CI8 A;  4DXC A;  3HLD A;  4QD4 A;  2OLU A;  3ITA A;  4GKU A;  3E2K A;  5DF9 A;  4E6W A;  1L0G A;  1AXB A;  1NZU A;  3SH7 A;  3ZVT A;  4C75 A;  1Z6F A;  4LV3 A;  1PZP A;  4FD8 A;  2EXB A;  5CEB A;  4OPZ A;  4KZ6 A;  4X69 A;  5FAO A;  4E3N A;  3PBT A;  1K54 A;  1CEF A;  3DWZ A;  4UHU A;  4WBG A;  3N8R A;  3Q81 A;  4WZ4 A;  4OQH A;  3G2Z A;  3ZG5 A;  2XFT A;  5TR7 A;  5HL1 A;  3IF6 A;  1PW1 A;  2GDN A;  5KZH A;  1FR1 A;  2P9V A;  1BLP A;  2HDS A;  2Y2P A;  1FCM A;  3SS4 A;  2Q9N A;  5CGX A;  3PBO A;  4MNR A;  4LCM A;  3W8K A;  4EUZ A;  5EVL A;  4NET A;  1JWP A;  5F82 A;  3RXX A;  4UAA A;  1CI9 A;  2WAF A;  3BEB A;  4WEK A;  1ERQ A;  5GLC A;  2WZX A;  1KE3 A;  1TEM A;  4WYY A;  3GRJ A;  5HAI A;  3MZF A;  2XEP A;  3CZD A;  1FCO A;  5A90 A;  3A3I A; 
#chains in the Genus database with same CATH topology
 3W4O A;  2ZQ7 A;  3U2A A;  4G3K A;  2M7U A;  2IA2 A;  3LEQ A;  1KGG A;  1GCE A;  2ZMV A;  2Y59 A;  2XRN A;  5EE8 A;  1CK3 A;  3H82 B;  5GLA A;  1WA9 A;  3OPR A;  5EM1 A;  4WF0 A;  1IKI A;  3B42 A;  2W3D A;  1UGU A;  1KDS A;  3CPT B;  4GS9 A;  5DKL A;  4WN5 A;  2JKG A;  4EXO A;  3D9Y A;  4OON A;  4YNR A;  1BLH A;  2ZLY A;  4K0X A;  1K4F A;  3UB9 A;  4S2P A;  3T4L A;  1AWI A;  4OLG A;  3UN7 A;  2INW A;  2V0U A;  3HBR A;  3CI6 A;  3DTM A;  1ES2 A;  1A0K A;  2DNS A;  3O87 A;  4BEN A;  3LIE A;  5J3W A;  3DW0 A;  1XJ6 A;  5HD3 A;  3CUE C;  3OCN A;  4S2I A;  4Y7P A;  4R23 A;  2K2N A;  1K55 C;  4Q8I A;  3EOI A;  4ZTK A;  3NDG A;  1Y4O A;  3OOV A;  5FQ9 A;  5E43 A;  1JTD A;  4UA6 A;  1N4O A;  3ZG9 B;  3Q07 A;  1L3L A;  3IH9 A;  3HLG A;  4NXF A;  3P98 A;  2VLG A;  3ITB A;  4K91 A;  3UY6 A;  5HWT A;  3I7J A;  2ACG A;  3SS3 A;  3E2L A;  2ZMA A;  5HDS A;  3P09 A;  4NKP A;  2VGL M;  1NRF A;  3FWL A;  5J7E A;  3VP3 A;  4OLD A;  4U3T A;  1N9N A;  2JN7 A;  3IBR A;  3TW8 A;  1ES4 A;  2JKR M;  4DJ3 A;  1HZO A;  1MWR A;  3BFD A;  1BTL A;  1XJ3 A;  1K4E A;  2J7V A;  5DTK A;  1N9L A;  4CLC C;  4O01 A;  4Y5F A;  4YIN A;  5IS1 A;  3TSG A;  1SKO A;  2J9O A;  3A3D A;  2Y2G A;  4GD8 A;  3GQZ A;  4UEY A;  4EWF A;  4KUK A;  4OP8 A;  1IEM A;  2R78 A;  3MF0 A;  5DTT A;  1XFN A;  1NY0 A;  1ZG4 A;  4DE3 A;  1DJC A;  1ZC2 A;  1LSW A;  3VMA A;  2DMW A;  1MWT A;  1L0E A;  2PBY A;  3V39 A;  4BLM A;  4IED A;  4L0L A;  3JPU A;  5FQK A;  4HY8 A;  3V67 A;  3HCY A;  2V2F F;  3FG8 A;  5A8B A;  3S22 A;  4I3J A;  1YLT A;  3PBQ A;  2D01 A;  3Q7V A;  3IWO A;  4PM8 A;  3N6I A;  4F94 A;  3HVF A;  5EVI D;  2ZL1 B;  4JGR A;  3CLO A;  4XXR A;  1GA9 A;  1ONG A;  4JBF A;  1BZA A;  2ZOH A;  1W8Q A;  4B88 A;  1J3W A;  1OT9 A;  1DY6 A;  3LY4 A;  5EVI B;  4HP9 A;  2EXA A;  3N4I A;  3PHY A;  4LRY C;  1LSX A;  2XD5 A;  2HZ5 A;  1N9B A;  2PU4 A;  5A93 A;  4EQ1 A;  2JE5 A;  1LI0 A;  4UA7 A;  5F1F A;  1TVF A;  2B02 A;  2WK0 A;  3LIC A;  4GDB A;  2X71 A;  1LSV A;  1MKI A;  3HL9 A;  1GSW A;  1I2S A;  2EX8 A;  2HJ9 C;  3JVV A;  5CRF A;  2J8Y A;  3MJQ A;  5CTN A;  5CER A;  1YAX A;  4KZ3 A;  1S6R A;  2PHY A;  4X55 A;  3W4Q A;  3R4K A;  4MBK A;  5FAS A;  3Q7Z A;  4KEN B;  3OZH A;  2PYP A;  2O9B A;  2GZA A;  4KQQ A;  3HUN A;  1XJ2 A;  3MS6 A;  3CIT A;  1W7F A;  1YSQ A;  1K57 A;  1HD8 A;  3F1N B;  2J3T C;  4FH4 A;  2JC7 A;  4IBR A;  4HI4 A;  3OCL A;  4XUX A;  1IYO A;  2OAQ 1;  4OPQ A;  4ZAM A;  1K6S A;  3KX0 X;  5FQM A;  2HP5 A;  3DTK A;  3TRC A;  3T1R A;  1IOU A;  2A49 A;  3BFF A;  3VFH A;  4WZ5 A;  2KOI A;  3KYQ A;  4JXS A;  4B4X A;  5HX9 A;  2PAV P;  3ZCZ A;  3BYD A;  2HGV A;  2EX6 A;  2ZC7 A;  2JKR I;  4BD1 A;  4PHT A;  1XPB A;  3S7N A;  1ESU A;  4NXG A;  4LLO B;  1E4D A;  3E4O A;  3BFC A;  2ZQD A;  3IXH A;  1LLB A;  3V3S A;  1BUL A;  1VM1 A;  5EOO A;  4OOM A;  4GLQ A;  3MFX A;  5HAQ A;  2UWX A;  5EPH A;  4QY6 A;  4LV1 A;  4JF6 A;  3DWK A;  4RA7 A;  3GDI A;  5E2E A;  2PR5 A;  2FFY A;  4UQI S;  1GHM A;  2HP9 A;  2K7S A;  3BM6 A;  3ZG8 B;  3LI9 A;  3C7V A;  1ACF A;  4FOF A;  4E3K A;  1LL5 A;  3UPN A;  1VEU A;  1FIL A;  3A0S A;  1FSY A;  3NBL A;  2CMN A;  2O99 A;  1K0K A;  2OV5 A;  2AVX A;  1DP9 A;  1WYC A;  1J9M A;  4XUZ A;  5HPF A;  2NUP C;  3HLD A;  3E2K A;  5F69 A;  5L8M A;  4C75 A;  3ZVT A;  1P97 A;  1Z6F A;  3F1O B;  4FD8 A;  5HD5 A;  1CEF A;  4AFI A;  2W0N A;  3QP8 A;  3Q81 A;  2ZMF A;  2XFT A;  4P6Z M;  3IF6 A;  1PW1 A;  1FR1 A;  3H7W B;  3PBO A;  3G6O A;  1F98 A;  4NET A;  1JWP A;  5F82 A;  2PRF A;  3BEB A;  5GLC A;  4I5S A;  4WYY A;  3GRJ A;  3PXP A;  3CZD A;  2VV8 A;  5A90 A;  3A3I A;  4Y13 A;  4M4X A;  2NUT C;  5KMW A;  2RCX A;  2HDU A;  1K38 A;  4ESP A;  5TGF A;  3D3O A;  1UWP X;  2W1T B;  2WKH A;  3KYZ A;  4HH2 A;  1QMF A;  1NXY A;  2A24 B;  4EV4 A;  2WKQ A;  4EW7 A;  1YKD A;  1Z09 A;  4KQD A;  2PR6 A;  2W3E A;  5GL9 A;  3A3E A;  2XF3 A;  4MN7 A;  1PW8 A;  2B18 A;  3UNW A;  3RFB A;  4XT2 B;  2WKE A;  2OWJ A;  4Z1W A;  2X02 A;  5F1G A;  1UWN X;  1PNE A;  2KX6 A;  1MWU A;  3CJM A;  2HV1 A;  2ZC6 B;  5IU1 A;  3BLM A;  2HPB A;  1PYY A;  2Y2K A;  3R7W B;  5BOH A;  4CLC D;  5HAP A;  1PZO A;  1HTZ A;  4RVA A;  4BJP A;  4R3A A;  3MXR A;  3TE8 A;  2HF6 A;  4CPK A;  4E3L A;  4GZB A;  3GVB A;  2Y2I A;  4CLC B;  3KO6 A;  4OQI A;  1OJG A;  4YFM A;  4A5R A;  5DF7 A;  5EOE A;  4QB8 A;  5F83 A;  2M7V A;  1I5Q A;  2V0W A;  3CAX A;  4I39 A;  1W63 M;  4LGW A;  3EQV A;  3OPL A;  4RX3 A;  3PAG A;  3VP1 A;  1ESI A;  2WYX A;  2XDM A;  1OT6 A;  4LFU A;  3E4Q A;  4H8R A;  1BUE A;  5EUA A;  4PM9 A;  4B93 A;  4S2N C;  3UB5 P;  2ZC5 B;  3IXB A;  4KZ8 A;  1JWZ A;  1NJ4 A;  1H5X A;  3T50 A;  3HLF A;  3ZNY A;  1OTA A;  4KQO A;  4OVD A;  3IWI A;  4HEF A;  3WS5 A;  4WL9 A;  3V50 A;  2FZ0 A;  3PR6 A;  3NY4 A;  1OJ5 A;  2EX2 A;  3S7Q A;  1KDW A;  1FOF A;  2VK3 A;  1KVL A;  4L9E A;  2WKR A;  4X68 A;  4GCZ A;  2XQZ A;  3HLE A;  3BWL A;  3BFG A;  2O9A A;  1VQQ A;  4X53 A;  4MBH A;  2ZD8 A;  4R4S A;  1PWG A;  4FSF A;  4C3Q A;  1LL9 A;  3QHY A;  2J3W A;  3IF5 A;  5AVE A;  3WRZ A;  4HQA A;  2ZQ9 A;  4R3J A;  3UE3 A;  2XA7 S;  5AQA A;  1F9I A;  3WS1 A;  3LO7 A;  4DE2 A;  3KSG A;  4IVI A;  4E3I A;  5JYP A;  3UPO A;  4PM7 A;  2VV7 A;  5HZH A;  4EBN A;  4DJ2 A;  3C4P A;  1F2K A;  2OWH A;  1WYB A;  2H0T A;  4CQH A;  5L2F A;  4GNU A;  5A91 A;  2K31 A;  4Q0H A;  2Y2H A;  1GHI A;  4PM6 A;  3PYP A;  2J3T D;  1SCW A;  2J80 A;  2G2U A;  4B4Z A;  2EFX A;  2OAP 1;  4IBX A;  3SH9 A;  3IX3 A;  3DAV A;  3GEC A;  2ZBB A;  3VSK A;  1MY8 A;  4MN5 A;  1TS0 A;  4N1X A;  4PAU A;  1NZO A;  4F3L A;  5FQJ A;  1DRM A;  3CWF A;  4QPR A;  1S4S A;  1K57 C;  1XA1 A;  1L0D A;  1P9R A;  1HLU P;  3WS4 A;  3T4K A;  4LRX C;  5I94 A;  2ZM2 A;  1VB6 A;  3LI8 A;  4LV2 A;  4KG2 A;  4S2L A;  4DXB A;  3GTC A;  3GMW A;  3QP6 A;  4BBV A;  4WZ5 C;  1FIK A;  4B9O A;  3DBA A;  3C5A A;  4OP5 A;  3ZHH A;  3BW6 A;  4OKP A;  2OOL A;  5AQ9 A;  1PWC A;  4WMC A;  5DTS A;  3AGD A;  3AGF A;  2WGW B;  3IQA A;  2YKF A;  2ZM0 A;  3G32 A;  2JCH A;  4GD6 A;  3ZDJ A;  1T19 A;  4DF6 A;  1M40 A;  1YLP A;  3OC2 A;  2XH9 A;  4E6X A;  5A92 A;  5GHX A;  2GJ3 A;  4M3K A;  2V20 A;  5M1A A;  3AGE A;  3LR4 A;  2Y79 A;  5CGS A;  1OTD A;  4R1G A;  2ZC3 B;  3FV7 A;  3EGD C;  3BQA A;  3ZVW A;  1U60 A;  1ONH A;  4N9K A;  1E25 A;  4PM5 A;  4GHI B;  1YMX A;  3ZG7 B;  1G28 A;  1YLJ A;  3F1O A;  3ULF A;  4QJG A;  2PT7 A;  3WS0 A;  3BJN A;  3T1Q B;  2JHE A;  1PFL A;  2GX5 A;  4EER A;  3T4S A;  2A3U A;  2OLV A;  4HBU A;  5HWV A;  2MJ6 A;  3KSH A;  5FQI A;  1Y54 A;  1LT0 A;  1NYM A;  3G4P A;  2P74 A;  3FKW A;  4OH0 A;  4YWZ A;  1H0M A;  3MMH A;  2DCF A;  3KYE A;  4OOL A;  4K0W A;  4PMA A;  3BEC A;  3MXS A;  3LGO A;  4GS9 B;  3CUE A;  2OLU A;  4GKU A;  4Y3I A;  1AXB A;  1H3Q A;  1PZP A;  4ARZ A;  3MR0 A;  4HP4 A;  5AVF A;  1KOU A;  3MXQ A;  5DFX A;  1N9O A;  3DWZ A;  1F5M A;  3IX4 A;  4Y15 A;  2QYB A;  4IJG A;  3ZG5 A;  2EWV A;  2GDN A;  5KZH A;  2P9V A;  4EES A;  4MNR A;  3W8K A;  2BAS A;  4EEU A;  2W3F A;  3IS2 B;  4EUZ A;  3P01 A;  2V1B A;  1CI9 A;  2WAF A;  1VET B;  1ERQ A;  1KE3 A;  1TEM A;  3MZF A;  1FCO A;  1V9Z A;  4DDS A;  1NLY A;  4MN6 A;  1XFQ A;  3T1S A;  3LUQ A;  4HJ6 A;  4CJN A;  3VE4 A;  3HRE A;  3PTE A;  3F1P B;  1O07 A;  3M6H A;  2VX8 A;  4OPR A;  4JXG A;  4ZRR A;  3QNB A;  4Z9Q A;  1I2W A;  4FH2 A;  2OSU A;  1DP8 A;  5GHY A;  3FYZ A;  4LEN A;  3S4X A;  1ALQ A;  4HES A;  1T1C A;  3NJA A;  4DDY A;  3FZC A;  2WGV A;  4ID4 A;  3VOL A;  4E3J A;  3UDX A;  1PIO A;  3NIA A;  4GDN A;  2V8F A;  2PU2 A;  3BQ8 A;  3G30 A;  3O88 A;  1IFQ A;  4EEP A;  5U47 A;  3WWX A;  1ZTU A;  1OTE A;  2HJE A;  1G5U A;  1YSP A;  3NDE A;  2B5R A;  3KSI A;  3RTY A;  1W63 Q;  3E4P A;  2VV6 A;  5F5Y A;  5D3O A;  1EW0 A;  3HLC A;  3HJI A;  3NHQ A;  3KSF A;  2H5S A;  1K54 C;  3E0Y A;  4QHC A;  4EBL A;  3FKV A;  1GA0 A;  4LV0 A;  3SS5 A;  2V1Z A;  5M18 A;  2PBD P;  3G31 A;  4P0M A;  5TBM B;  3EGX C;  5CHU A;  4O8G A;  4WUJ A;  4UQI M;  2V1A A;  1TS7 A;  5GLD A;  2JBF A;  5AQB A;  2C6W B;  3V3R A;  1STZ A;  3BFE A;  3H82 A;  2QZ6 A;  3TJZ C;  5FI7 A;  2Y8H A;  1JVJ A;  1BLS A;  1T18 A;  3CPT A;  3IHA A;  3NC8 A;  1FR6 A;  2CC1 A;  1YT4 A;  3GSG A;  5KIZ A;  5HWW A;  4L9G A;  3Q7V B;  3TG9 A;  1H8Z A;  4LPZ A;  1OTI A;  3UB6 A;  2QPN A;  3QP2 A;  5G18 A;  3D4F A;  3BLS A;  1FCN A;  2KLI A;  4UA9 A;  1NRJ A;  1S67 L;  4JPM A;  2ZJ9 A;  4GOG A;  3L9K A;  2V9A A;  3T12 B;  5AJG A;  3MQQ A;  2ZM8 A;  1BT5 A;  1H8M A;  3O5Y A;  3UE1 A;  1S1Z A;  1ZKJ A;  4S2O A;  4G3W A;  4KQR A;  3GV9 A;  5FSR A;  3ZGA B;  1MKM A;  4PKY G;  1E3U D;  3GR2 A;  2JKF A;  3PBR A;  4JGO A;  3G35 A;  1G6O A;  1XGJ A;  1PRQ A;  2IWC A;  4HJ3 A;  1KVM A;  2Y2Q A;  5FA7 A;  1BLC A;  1HVB A;  1PI5 A;  3LR5 A;  4H6J B;  5HAR A;  3HLB A;  3IHB A;  1P0Z A;  5EM0 A;  5IT5 A;  3B3X A;  4O0P A;  4KG6 A;  5KSC A;  3MBZ A;  4I38 A;  2UV0 E;  5HFO A;  1SDE A;  2VZW A;  3CMZ A;  2Z2M B;  4Y0O A;  1RGZ A;  3SOI A;  5FAT A;  1XKZ A;  5DFY A;  4EQI A;  2E8J A;  3EWK A;  2I72 A;  1S66 L;  3K3C A;  2EA9 A;  1MWS A;  1G6A A;  2QJ7 A;  4II7 A;  4BD0 A;  2Z6C A;  4R0Q A;  4RX2 A;  1TDL A;  2Y2N A;  4Y17 A;  4GN2 A;  2KDK A;  4OQG A;  4Y0T A;  1W79 A;  3M2K A;  5EEC A;  3C7U A;  3NOP C;  4NXB A;  2J9P A;  5CGW A;  2WGW A;  3IWQ A;  1MXO A;  1RCJ A;  2Y55 A;  3K3D A;  3UB8 A;  1SHV A;  1GSX A;  3VSL A;  5HL6 A;  5L09 A;  3IT9 A;  2R9W A;  4D60 A;  4I3I A;  4FUW A;  2P08 A;  3O3V A;  3UPP A;  5FEG A;  3VOZ A;  1KGE A;  5CTM A;  3A0V A;  4ZJ2 A;  3LCE A;  4GW9 A;  1IYQ A;  1RP5 A;  2Y2L A;  2ZC4 B;  3C2W A;  5MC7 A;  2PD7 A;  1T1A A;  2B95 A;  4LRZ E;  1L2S A;  1D06 A;  1LI9 A;  2GNX A;  4WEJ A;  3Q82 A;  1IYP A;  1SKF A;  5GHZ A;  3IXD A;  1KE0 A;  2PDR A;  2WAD A;  4EBP A;  1T1B A;  3G2Y A;  4X6T A;  2ZL1 A;  1ZG6 A;  2Y2J A;  3B33 A;  3UDI A;  3IXG A;  5DVA A;  1S4R A;  5EVI A;  3LFV A;  1D7E A;  4DE1 A;  2O0Y A;  3A3J A;  3H9W A;  3ZNT A;  1ES3 A;  2RL3 A;  2VKS A;  5EVE A;  1VEU B;  5CEC A;  4X1M A;  1ERO A;  4D2O A;  1NYY A;  3BY9 A;  4U0X A;  4Q0J A;  1Q2P A;  2BLS A;  2D02 A;  4DE0 A;  2VJW A;  1EI5 A;  1KE4 A;  4X1L A;  2XR0 A;  5KSH A;  4ZDX A;  3DTI A;  1EWZ A;  1MZU A;  1D1J A;  4N92 A;  3WRT A;  1IYS A;  3RXW A;  5IHV A;  5DKK A;  3NCK A;  3MZE A;  3W2Z A;  1O7E A;  2HDR A;  1SDN A;  4GJ4 A;  2WKP A;  4P6B A;  1TF1 A;  3FPV A;  3IF6 B;  3MSH A;  3C4O A;  4PKY A;  4OQ0 A;  1L0F A;  3QNC A;  3U4L P;  4N1H A;  2O9C A;  3N8L A;  3M6B A;  3JVU A;  1Q2Q A;  2XGN A;  5FDS A;  3S7P A;  3F1N A;  4MBF A;  2XA7 M;  3IBJ A;  1K25 A;  2EWW A;  3MKE A;  5CED A;  2EX9 A;  5CHM A;  3VE3 A;  4BL2 A;  4DKI A;  3IS2 A;  3ICY A;  4JLF A;  3PAE A;  1MC0 A;  1VET A;  1X0O A;  4MLL A;  3EQU A;  2VGL S;  4HBT A;  1K56 D;  1M6K A;  4JKT A;  2P7J A;  3N7W A;  1S1Y A;  4KUO A;  3MFD A;  3N8S A;  2XLN A;  1TDG A;  3UB7 A;  3F1P A;  5FL3 A;  1NWZ A;  3C30 A;  3SH7 A;  2EXB A;  5CEB A;  4OPZ A;  4KZ6 A;  3UMD A;  3LR0 A;  2G7U A;  4UHU A;  5HDD A;  4G3V A;  4BBU A;  3N8R A;  1CJF A;  4OQH A;  3G2Z A;  5TR7 A;  3QP1 A;  1FCM A;  3SS4 A;  2Q9N A;  5CGX A;  3LIA A;  3FPW A;  4HHD A;  2FH5 A;  2XEP A;  2X01 A;  1V9Y A;  2A2L A;  3OPP A;  1XXM A;  3ZYT A;  4CLC E;  4E04 A;  1LHY A;  2W3G A;  2XSS A;  1PI4 A;  2QMI A;  4S2N A;  1FQG A;  5F68 A;  5LBR A;  4EET B;  3M2J A;  3QP5 A;  3UO9 A;  5GLB A;  3L7H A;  5DJU A;  2PYR A;  5TBM A;  1S0W A;  3ZG0 A;  2ZQ8 A;  4GB7 A;  5G4Y A;  3A0R A;  5FI2 A;  2XFS A;  1YQS A;  2P04 A;  2E8I A;  2V8C A;  5E2F A;  4JF5 A;  2WZZ A;  4DN0 A;  1IEL A;  3VP4 A;  3UE0 A;  2VEA A;  1YLW A;  5HW3 A;  2EFU A;  3S1Y A;  4R3B A;  3VV4 A;  2VGJ A;  3H7W A;  3MKF A;  4IVK A;  4ZBE A;  2Y4A A;  4K08 A;  4C6Y A;  3V5M A;  2Y2O A;  1JNU A;  4P85 A;  4WM9 A;  4R38 A;  3E98 A;  3NEC A;  4IUH A;  3FC7 A;  3S7O A;  3TOI A;  4EU0 A;  3IF6 C;  5FDH A;  2W1T A;  3IH8 A;  4Y2F A;  5TFQ A;  4BWI A;  4NEE D;  2Y2M A;  5J8X A;  4P87 A;  1W8Y A;  5CHJ A;  1K55 A;  5FAP A;  2W1R A;  5I5L A;  2VGK A;  2C5W B;  4DRT A;  2A24 A;  1E3U A;  4H6J A;  2H28 A;  2HP6 A;  4E3O A;  2QJ5 A;  2Q0O A;  2L4R A;  3IX8 A;  4MMN A;  3SH8 A;  4OOY A;  2IWD A;  4XT2 A;  2ZQA A;  5M19 A;  3QP4 A;  4QU3 A;  1QME A;  2BTF P;  1KGF A;  5L10 A;  5L07 A;  3T4J A;  1XA7 A;  2Q9M A;  3CG5 A;  4JXV A;  2JKT M;  2WKI A;  4MEZ A;  5EV0 A;  3R7W A;  1MBL A;  5HDC A;  1BSG A;  5FAQ A;  4O7D A;  2W3H A;  3NI9 A;  4F3L B;  1SZV A;  2Z6D A;  3D72 A;  2M1C A;  4CLC A;  5JYO A;  3Q1F A;  1OME A;  4KZA A;  1C3B A;  1OPX A;  2L1M A;  4RYE A;  1ODV A;  1JTG A;  2H0Y A;  3W4P A;  3WS2 A;  5E2H A;  3HUM A;  4R6L A;  1K6R A;  4I3A A;  1NLZ A;  2DRW A;  3SZT A;  2L0W A;  2QKP A;  3OBF A;  1WE4 A;  4S2K A;  1W5D A;  4KZ7 A;  4WLA A;  4BQM A;  5HSQ A;  2LB9 A;  4WMC D;  1IKG A;  2VA0 A;  4WEL A;  3SW1 A;  3B47 A;  2WUQ A;  4ZJ3 A;  5F6A A;  1ZHH B;  5K5B A;  1SKO B;  3LIB A;  3T4O A;  1YLZ A;  3HJK A;  1OTB A;  2Z2L B;  3C8C A;  4PPR A;  2QWS A;  4X25 A;  4HH3 A;  1CQA A;  4L9F A;  4BBT A;  5DF8 A;  3LY3 A;  4NK3 A;  1GHP A;  1CEG A;  3OLO A;  2YKH A;  3JYI A;  1G68 A;  2H10 A;  1GSV A;  3RJU A;  3UE6 A;  1CF0 A;  4NXE A;  4FTX A;  5FQQ A;  4P6Z S;  4FCF A;  3VOY A;  2HDQ A;  4E3M A;  3G34 A;  3OPH A;  5EVI C;  3VP2 A;  4S2J A;  4EUV A;  2IWB A;  4R70 A;  3NOT C;  3VP0 A;  1XJ4 A;  4U0T A;  3MQO A;  1YM1 A;  3MQ0 A;  4MCW A;  4N9L A;  1LL8 A;  2WAE A;  4BMW A;  3VFF A;  2LB5 A;  4KZ9 A;  1Y28 A;  4KZB A;  4ETZ A;  3LYX A;  5G4Z A;  1YLY A;  1JWV A;  5C5K A;  4Y0U A;  1DJA A;  3UME A;  4KZ4 A;  5TJJ A;  1ERM A;  1DJB A;  3P7N A;  1TS6 A;  3A3F A;  4JF4 A;  5DJT A;  4HOI A;  1ES5 A;  1XX2 A;  5E2G A;  4JXW A;  1BYW A;  2G2W A;  4ZJ1 A;  4KG5 A;  4HNB A;  4ARZ B;  1K56 A;  4HIA A;  1XP4 A;  2FFF B;  1H8Y A;  3LID A;  4IHQ A;  4BL3 A;  3O86 A;  3BRM A;  2I9V A;  4IUK A;  1RGY A;  2ZOI A;  3T1X A;  3EEH A;  3HUO A;  2JKT I;  3UDF A;  4HJ4 A;  2P9V B;  2BG1 A;  3C38 A;  4ME4 A;  2ZQC A;  1PWD A;  1XGI A;  4OPY A;  4X56 A;  2XK1 A;  5FEF A;  3NUL A;  3HLW A;  3RH8 B;  2XD1 A;  5CX7 A;  5AQ7 A;  4MDZ A;  3PBS A;  3LIF A;  3EEA A;  3PBN A;  2QHK A;  3LEZ A;  3T4T A;  4S2M A;  4JGP A;  4LCL A;  5FI6 A;  2XRO A;  5EFW A;  4KZ5 A;  1P9W A;  1YMS A;  4YOF A;  3ISG A;  5CXW A;  1FSW A;  1MPL A;  2R9X A;  2Y91 A;  4QY5 A;  4RQ9 A;  2WGI A;  3ZFZ A;  4ETX A;  3CHW P;  3MZD A;  4R4R A;  1CI8 A;  4DXC A;  3K2N A;  4QD4 A;  3ITA A;  5DF9 A;  4E6W A;  1L0G A;  1NZU A;  4LV3 A;  4X69 A;  5FAO A;  3ZQ5 A;  4E3N A;  3PBT A;  1K54 A;  4WBG A;  3T4Q A;  4Q0I A;  4GHI A;  4WZ4 A;  3NOU C;  5HL1 A;  4NG2 A;  3LR3 A;  2PD8 A;  1BLP A;  2HDS A;  3DTE A;  2Y2P A;  1YPR A;  4JGQ A;  5HPI A;  5J4E A;  4LCM A;  1TS8 A;  1DP6 A;  5EVL A;  3RXX A;  4UAA A;  2W27 A;  1TD5 A;  4WEK A;  2WZX A;  3BY8 A;  5HAI A;  4QWO A;  1VHM A;  4DMZ A; 
#chains in the Genus database with same CATH homology
 2X01 A;  3W4O A;  2ZQ7 A;  4DDS A;  5KMW A;  1KGG A;  3OPP A;  2RCX A;  1XXM A;  1GCE A;  2HDU A;  1K38 A;  4CJN A;  2Y59 A;  1LHY A;  3HRE A;  5EE8 A;  3PTE A;  5TGF A;  1PI4 A;  2QMI A;  2WKH A;  1CK3 A;  4S2N A;  1O07 A;  3M6H A;  1FQG A;  4OPR A;  4JXG A;  3QNB A;  4Z9Q A;  1I2W A;  3M2J A;  4FH2 A;  2OSU A;  1QMF A;  5GLA A;  3UO9 A;  5GHY A;  5GLB A;  3FYZ A;  4LEN A;  3S4X A;  3OPR A;  1NXY A;  4EV4 A;  1S0W A;  1IKI A;  3ZG0 A;  1ALQ A;  4HES A;  2ZQ8 A;  4GB7 A;  1KDS A;  5FI2 A;  2XFS A;  4DDY A;  3FZC A;  4OON A;  1YQS A;  1BLH A;  2WGV A;  2ZLY A;  4ID4 A;  5GL9 A;  2E8I A;  3A3E A;  4K0X A;  4E3J A;  5E2F A;  1K4F A;  4JF5 A;  3UDX A;  2WZZ A;  2XF3 A;  1PIO A;  1IEL A;  1PW8 A;  3NIA A;  4GDN A;  4S2P A;  2PU2 A;  3G30 A;  3UNW A;  3O88 A;  4OLG A;  3UN7 A;  2WKE A;  3VP4 A;  5U47 A;  3UE0 A;  3WWX A;  1YLW A;  3DTM A;  3HBR A;  2EFU A;  2X02 A;  5HW3 A;  5F1G A;  1ES2 A;  3S1Y A;  4R3B A;  2DNS A;  3O87 A;  3NDE A;  2B5R A;  4BEN A;  1MWU A;  2VGJ A;  3CJM A;  3MKF A;  3DW0 A;  3OCN A;  4IVK A;  4S2I A;  2ZC6 B;  4Y7P A;  4R23 A;  2Y4A A;  4ZBE A;  3BLM A;  1K55 C;  4C6Y A;  5D3O A;  2HPB A;  4Q8I A;  3V5M A;  1PYY A;  2Y2K A;  3NDG A;  4ZTK A;  3HLC A;  5BOH A;  2Y2O A;  5HAP A;  1PZO A;  4P85 A;  2H5S A;  1HTZ A;  4WM9 A;  4RVA A;  4BJP A;  1K54 C;  5FQ9 A;  5E43 A;  4QHC A;  3MXR A;  4EBL A;  1JTD A;  4UA6 A;  3FKV A;  1N4O A;  1GA0 A;  4CPK A;  3ZG9 B;  4E3L A;  4GZB A;  3GVB A;  3Q07 A;  2Y2I A;  3TOI A;  4LV0 A;  3SS5 A;  2V1Z A;  3IF6 C;  5M18 A;  3IH9 A;  3G31 A;  4OQI A;  3HLG A;  4YFM A;  4A5R A;  5DF7 A;  3P98 A;  4P0M A;  3ITB A;  5EOE A;  5FDH A;  4QB8 A;  4K91 A;  5CHU A;  5F83 A;  3IH8 A;  3UY6 A;  1I5Q A;  3I7J A;  5TFQ A;  3SS3 A;  3E2L A;  2Y2M A;  5J8X A;  2ZMA A;  2JBF A;  1W8Y A;  4P87 A;  1K55 A;  3EQV A;  3P09 A;  2C6W B;  5CHJ A;  5AQB A;  5FAP A;  3V3R A;  3BFE A;  2VGK A;  3OPL A;  2QZ6 A;  1NRF A;  2C5W B;  3FWL A;  4RX3 A;  4DRT A;  5FI7 A;  3PAG A;  3VP3 A;  1JVJ A;  1BLS A;  1E3U A;  4OLD A;  3VP1 A;  3IHA A;  3NC8 A;  1ESI A;  1FR6 A;  2CC1 A;  1YT4 A;  3GSG A;  4U3T A;  2HP6 A;  4E3O A;  2WYX A;  2XDM A;  1ES4 A;  4H8R A;  1BUE A;  3Q7V B;  5EUA A;  1H8Z A;  3TG9 A;  1HZO A;  4PM9 A;  1MWR A;  2QPN A;  4S2N C;  3SH8 A;  2ZC5 B;  5G18 A;  3IXB A;  4KZ8 A;  3BFD A;  1JWZ A;  1BTL A;  3D4F A;  3BLS A;  1FCN A;  1K4E A;  2IWD A;  2J7V A;  4OOY A;  5DTK A;  4UA9 A;  2ZQA A;  5M19 A;  5GLD A;  1NJ4 A;  4JPM A;  4QU3 A;  1H5X A;  1QME A;  1KGF A;  3HLF A;  2ZJ9 A;  4GOG A;  4YIN A;  3ZNY A;  4KQO A;  1XA7 A;  4OVD A;  2Q9M A;  2ZM8 A;  3CG5 A;  1BT5 A;  4JXV A;  3IWI A;  4HEF A;  3WS5 A;  2WKI A;  3V50 A;  3UE1 A;  4MEZ A;  1ZKJ A;  4S2O A;  3NY4 A;  4KQR A;  3TSG A;  3GV9 A;  1MBL A;  2EX2 A;  2J9O A;  5FSR A;  1KDW A;  1BSG A;  3ZGA B;  1FOF A;  3A3D A;  5FAQ A;  2Y2G A;  4O7D A;  1KVL A;  4X68 A;  2XQZ A;  3HLE A;  1E3U D;  3GR2 A;  4GD8 A;  3PBR A;  3BFG A;  3NI9 A;  3GQZ A;  4EWF A;  1VQQ A;  4X53 A;  4MBH A;  3G35 A;  2ZD8 A;  4OP8 A;  1IEM A;  4R4S A;  5DTT A;  1PWG A;  1NY0 A;  1ZG4 A;  4DE3 A;  4FSF A;  1DJC A;  1XGJ A;  5JYO A;  1ZC2 A;  2IWC A;  3Q1F A;  1OME A;  4KZA A;  1KVM A;  2Y2Q A;  5FA7 A;  1BLC A;  1HVB A;  1PI5 A;  1C3B A;  4C3Q A;  1LL9 A;  4RYE A;  2H0Y A;  1JTG A;  5HAR A;  3VMA A;  3W4P A;  3WS2 A;  1MWT A;  5E2H A;  3HUM A;  3QHY A;  3IF5 A;  1L0E A;  3HLB A;  3IHB A;  2PBY A;  3V39 A;  3WRZ A;  4BLM A;  1K6R A;  3B3X A;  2ZQ9 A;  4IED A;  4L0L A;  2DRW A;  4KG6 A;  5FQK A;  4R3J A;  3UE3 A;  5AQA A;  3WS1 A;  3LO7 A;  2V2F F;  5KSC A;  1WE4 A;  3MBZ A;  4S2K A;  4DE2 A;  3S22 A;  1W5D A;  4KZ7 A;  4IVI A;  4BQM A;  4WMC D;  5HFO A;  4E3I A;  1IKG A;  1SDE A;  5JYP A;  3UPO A;  3CMZ A;  1YLT A;  2Z2M B;  3PBQ A;  4PM7 A;  4Y0O A;  4WEL A;  3Q7V A;  1RGZ A;  3IWO A;  4PM8 A;  3SOI A;  4EBN A;  5FAT A;  3N6I A;  1XKZ A;  3HVF A;  3C4P A;  4EQI A;  4F94 A;  5EVI D;  2WUQ A;  2I72 A;  4ZJ3 A;  1WYB A;  2H0T A;  4XXR A;  1GA9 A;  1ONG A;  1MWS A;  4JBF A;  1BZA A;  1G6A A;  1W8Q A;  4B88 A;  5L2F A;  1YLZ A;  4GNU A;  5A91 A;  4BD0 A;  4R0Q A;  4RX2 A;  2Z2L B;  1DY6 A;  2Y2H A;  3LY4 A;  4PPR A;  5EVI B;  1GHI A;  4PM6 A;  2EXA A;  3N4I A;  1TDL A;  2Y2N A;  1SCW A;  2XD5 A;  4GN2 A;  2G2U A;  4OQG A;  4B4Z A;  4Y0T A;  1N9B A;  2PU4 A;  1W79 A;  3M2K A;  2EFX A;  5EEC A;  5A93 A;  2JE5 A;  3C7U A;  4IBX A;  1LI0 A;  3SH9 A;  5DF8 A;  2J9P A;  3LY3 A;  4NK3 A;  1GHP A;  2WGW A;  3IWQ A;  4UA7 A;  5CGW A;  1TVF A;  5F1F A;  1MXO A;  1CEG A;  1RCJ A;  2Y55 A;  3VSK A;  2WK0 A;  1MY8 A;  1SHV A;  3JYI A;  4GDB A;  1G68 A;  2X71 A;  1MKI A;  2H10 A;  3HL9 A;  4N1X A;  3VSL A;  1NZO A;  5FQJ A;  3RJU A;  1I2S A;  2EX8 A;  3IT9 A;  2R9W A;  5CRF A;  1K57 C;  1XA1 A;  2J8Y A;  1L0D A;  3O3V A;  3UPP A;  5CTN A;  3VOZ A;  5FQQ A;  5CER A;  1KGE A;  4KZ3 A;  1S6R A;  5CTM A;  3WS4 A;  4X55 A;  4ZJ2 A;  5I94 A;  3LCE A;  4FCF A;  2ZM2 A;  1IYQ A;  1RP5 A;  3VOY A;  2HDQ A;  2Y2L A;  2ZC4 B;  4E3M A;  3W4Q A;  4LV2 A;  4KG2 A;  4MBK A;  4S2L A;  4DXB A;  5FAS A;  3Q7Z A;  4KEN B;  3G34 A;  3OPH A;  5EVI C;  3OZH A;  3GTC A;  3GMW A;  1L2S A;  3VP2 A;  1LI9 A;  4WEJ A;  4KQQ A;  3HUN A;  3Q82 A;  4S2J A;  1IYP A;  1SKF A;  5GHZ A;  4WZ5 C;  3IXD A;  2IWB A;  1KE0 A;  1W7F A;  2WAD A;  3C5A A;  4EBP A;  1K57 A;  3VP0 A;  1HD8 A;  4OP5 A;  3ZHH A;  4U0T A;  3G2Y A;  4X6T A;  1YM1 A;  4FH4 A;  2JC7 A;  4IBR A;  4OKP A;  3OCL A;  4XUX A;  5AQ9 A;  4N9L A;  1IYO A;  1PWC A;  2WAE A;  4OPQ A;  4WMC A;  5DTS A;  3VFF A;  1ZG6 A;  4ZAM A;  3AGD A;  1K6S A;  3AGF A;  4KZ9 A;  2WGW B;  2Y2J A;  3UDI A;  3IQA A;  5FQM A;  2ZM0 A;  2HP5 A;  3IXG A;  5DVA A;  5EVI A;  3G32 A;  4KZB A;  4DE1 A;  2JCH A;  3A3J A;  4GD6 A;  3ZNT A;  1ES3 A;  2RL3 A;  1YLY A;  2A49 A;  3BFF A;  3ZDJ A;  1JWV A;  3VFH A;  5CEC A;  4WZ5 A;  4DF6 A;  1ERO A;  4D2O A;  1M40 A;  1YLP A;  1NYY A;  3OC2 A;  4JXS A;  4Y0U A;  1DJA A;  4B4X A;  2XH9 A;  4U0X A;  5HX9 A;  4KZ4 A;  1Q2P A;  1ERM A;  4E6X A;  2BLS A;  3ZCZ A;  5A92 A;  1DJB A;  3BYD A;  5GHX A;  4DE0 A;  3A3F A;  4JF4 A;  4M3K A;  2V20 A;  5M1A A;  1EI5 A;  1KE4 A;  2EX6 A;  3AGE A;  1ES5 A;  1XX2 A;  5E2G A;  2ZC7 A;  5CGS A;  4JXW A;  4BD1 A;  2G2W A;  2XR0 A;  4ZJ1 A;  5KSH A;  1XPB A;  4ZDX A;  4KG5 A;  4R1G A;  2ZC3 B;  1EWZ A;  1ESU A;  3FV7 A;  4N92 A;  3WRT A;  1IYS A;  1K56 A;  3RXW A;  3ZVW A;  1XP4 A;  2FFF B;  1E4D A;  1U60 A;  1H8Y A;  5IHV A;  3BFC A;  3NCK A;  1ONH A;  4N9K A;  4BL3 A;  2ZQD A;  3IXH A;  1E25 A;  1LLB A;  3BRM A;  3MZE A;  3O86 A;  1BUL A;  3V3S A;  1VM1 A;  1O7E A;  4PM5 A;  1YMX A;  1SDN A;  2HDR A;  4P6B A;  5EOO A;  1RGY A;  3ZG7 B;  4OOM A;  1YLJ A;  4QJG A;  3UDF A;  3HUO A;  3IF6 B;  3WS0 A;  5HAQ A;  2UWX A;  2P9V B;  3C4O A;  2BG1 A;  4OQ0 A;  1L0F A;  3QNC A;  5EPH A;  4QY6 A;  4LV1 A;  4N1H A;  3N8L A;  4JF6 A;  3M6B A;  2ZQC A;  1PWD A;  3DWK A;  1XGI A;  1Q2Q A;  4OPY A;  4RA7 A;  2XGN A;  4X56 A;  4MBF A;  2XK1 A;  1K25 A;  3MKE A;  5CED A;  2EX9 A;  5CHM A;  3HLW A;  4BL2 A;  2XD1 A;  5AQ7 A;  3PBS A;  3PBN A;  5E2E A;  2A3U A;  2OLV A;  3LEZ A;  4HBU A;  4DKI A;  2FFY A;  4S2M A;  1GHM A;  2HP9 A;  4LCL A;  5FI6 A;  3BM6 A;  5FQI A;  4JLF A;  3ZG8 B;  1Y54 A;  3PAE A;  4MLL A;  3EQU A;  3C7V A;  4HBT A;  1K56 D;  1NYM A;  4E3K A;  1M6K A;  3G4P A;  2P74 A;  4KZ5 A;  4JKT A;  1YMS A;  1LL5 A;  3UPN A;  3ISG A;  3FKW A;  4OH0 A;  5CXW A;  3NBL A;  1FSW A;  1FSY A;  1MPL A;  2R9X A;  2Y91 A;  3N7W A;  4QY5 A;  2OV5 A;  2DCF A;  4OOL A;  3MFD A;  2WGI A;  1WYC A;  4K0W A;  3ZFZ A;  4PMA A;  3N8S A;  2XLN A;  3BEC A;  3MXS A;  1J9M A;  1TDG A;  3MZD A;  4XUZ A;  4R4R A;  1CI8 A;  4DXC A;  3HLD A;  4QD4 A;  2OLU A;  3ITA A;  4GKU A;  3E2K A;  5DF9 A;  4E6W A;  1L0G A;  1AXB A;  1NZU A;  3SH7 A;  3ZVT A;  4C75 A;  1Z6F A;  4LV3 A;  1PZP A;  4FD8 A;  2EXB A;  5CEB A;  4OPZ A;  4KZ6 A;  4X69 A;  5FAO A;  4E3N A;  3PBT A;  1K54 A;  1CEF A;  3DWZ A;  4UHU A;  4WBG A;  3N8R A;  3Q81 A;  4WZ4 A;  4OQH A;  3G2Z A;  3ZG5 A;  2XFT A;  5TR7 A;  5HL1 A;  3IF6 A;  1PW1 A;  2GDN A;  5KZH A;  1FR1 A;  2P9V A;  1BLP A;  2HDS A;  2Y2P A;  1FCM A;  3SS4 A;  2Q9N A;  5CGX A;  3PBO A;  4MNR A;  4LCM A;  3W8K A;  4EUZ A;  5EVL A;  4NET A;  1JWP A;  5F82 A;  3RXX A;  4UAA A;  1CI9 A;  2WAF A;  3BEB A;  4WEK A;  1ERQ A;  5GLC A;  2WZX A;  1KE3 A;  1TEM A;  4WYY A;  3GRJ A;  5HAI A;  3MZF A;  2XEP A;  3CZD A;  1FCO A;  5A90 A;  3A3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...