5HWVA

Crystal structure of pas1 complexed with toluene
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
ALYEFVGLLDAHGNVLEVNQVALEGGGITMEEIRGKPFWKARWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGREVIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAMLALKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor histidine kinase TodS
publication title Molecular Insights into Toluene Sensing in the TodS/TodT Signal Transduction System.
pubmed doi rcsb
source organism Pseudomonas putida (strain f1 / atcc 700007)
total genus 36
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hwvA00
1F9IA 1LSWA 1T1BA 3FG8A 3LICA 4GS9A 5HSQA 5DKKA 2I9VA 2PD7A 4BBUA 3B33A 4BBVA 2ZOHA 5TBMA 3E4OA 1LSXA 2ZOIA 3MJQA 3NOPC 4HP4A 4XT2A 4LRYC 2L1MA 2Z6CA 2B02A 1N9OA 3CAXA 4HOIA 1LT0A 1GSVA 1XFQA 5HD5A 5AVFA 4L9FA 2WKQA 3LYXA 4I3AA 4K08A 1EW0A 4WF0A 4KUKA 3A0SA 1OTEA 4DJ2A 4HY8A 4L9EA 3BWLA 2PYRA 1G28A 2D01A 4GHIA 1DP8A 5G4ZA 2QJ7A 3F1OA 5EFWA 1T1CA 1S66L 5DKLA 2INWA 2PD8A 4L9GA 1F98A 2V0UA 2PDRA 4LPZA 1DP6A 2QKPA 2ZBBA 1T18A 2Z6DA 2OWHA 3HJKA 4MN6A 1OT9A 3F1PA 4EW7A 3VOLA 2PR5A 1OTBA 4EQ1A 1XJ3A 1Y28A 4HQAA 4MN5A 4WN5A 4EETB 3UB7A 2JHEA 3RH8B 5HWTA 3NHQA 1S1YA 1OT6A 5DJTA 3K3DA 1UGUA 3H82A 3MR0A 4RQ9A 4M4XA 3ZQ5A 4HIAA 3UMDA 4HJ4A 5HDDA 5J3WA 3F1NB 2HV1A 1T19A 2YKHA 3LI8A 3H7WB 2OOLA 2V9AA 3ICYA 2VV6A 4KUOA 1TS7A 2L4RA 5F6AA 4R3AA 3D72A 5KIZA 2VV8A 4I39A 5I5LA 2GJ3A 1V9ZA 1X0OA 3RTYA 1OJGA 3IBRA 1OJ5A 2OWJA 2KX6A 5HD3A 4GS9B 3H82B 4LRXC 2V1AA 2WKPA 4EEUA 1NWZA 1S67L 4I3JA 4NXGA 4I5SA 3HJIA 1UWNX 5F5YA 1OTDA 5TBMB 4F3LA 2CMNA 3LI9A 4H6JA 4HH2A 1XFNA 4XT2B 4EERA 3IS2A 4YWZA 4HI4A 1GSXA 1D7EA 1S4RA 4HNBA 1N9LA 2JN7A 1OTAA 5AVEA 4WLAA 4EEPA 2A24A 3LIDA 1DP9A 2PHYA 4EXOA 3E4QA 1LL8A 4HJ6A 5HDCA 3KX0X 4JGPA 3ULFA 3CLOA 3OLOA 1N9NA 2W27A 4GW9A 4F3LB 3C8CA 5IS1A 4R38A 1XJ6A 3UE6A 4NXEA 4LLOB 5A8BA 4JGRA 4GHIB 1MZUA 4PKYG 2V1BA 2BASA 2W0NA 3F1OB 4HHDA 4BBTA 1TS6A 2PR6A 3UB9A 4JGOA 4NXFA 2VV7A 2VLGA 4I3IA 4E04A 3LIEA 3SW1A 4KQDA 1S4SA 1TS0A 5HZHA 5F68A 1XJ2A 2YKFA 3F1PB 3NJAA 4HH3A 1JNUA 3VE3A 4R70A 3GECA 3P7NA 2QHKA 1P0ZA 3EWKA 3BY8A 1UWPX 3UB6A 1BYWA 3K3CA 1VB6A 2K7SA 3C2WA 3LIBA 2P7JA 2KDKA 2PYPA 3MFXA 3MQQA 1XJ4A 4PKYA 4R6LA 1LSVA 4NXBA 5HWVA 1GSWA 2EA9A 2QWSA 1KOUA 1D06A 2R78A 3PHYA 4JGQA 5G4YA 2VEAA 2M1CA 1ODVA 4EESA 2H28A 4LRZE 5F69A 1P97A 3LIFA 3A0RA 3EEHA 3MQOA 3NOUC 5HWWA 4HJ3A 3LIAA 5IU1A 1V9YA 3A0VA 4I38A 1S1ZA 4GCZA 3UB8A 1DRMA 3H9WA 3FC7A 4DJ3A 5J7EA 1WA9A 3LUQA 5DJUA 1T1AA 3E4PA 3BY9A 4H6JB 2L0WA 3IS2B 4B9OA 1TS8A 3UMEA 4WUJA 3NOTC 5HDSA 2QJ5A 3PYPA 3CWFA 3F1NA 3VE4A 3H7WA 2D02A 3G6OA 2A24B 2WKRA 3GDIA 3T50A 2J80A 4WL9A 1OTIA 5J4EA 3MXQA 4HP9A 2V0WA
chains in the Genus database with same CATH superfamily
1F9IA 3ZGAB 2J9PA 3PBOA 3LICA 3HLDA 1CI8A 3KYZA 2Y55A 3NCKA 4FUWA 2ZOHA 1YLWA 2FZ0A 3E4OA 2Y2LA 2IWDA 2ZOIA 4RYEA 4U0TA 5A93A 5GHXA 3IHAA 3TOIA 1EROA 1MKIA 4K0XA 2XH9A 4HESA 3ZG5A 4WZ5C 1U60A 5EPHA 2HDRA 1KGEA 4EBPA 4OQIA 2Y2GA 3QP4A 5GLAA 2J3WA 4S2LA 4E3LA 4KZ9A 3FPWA 1YLZA 3KYEA 4K08A 4IHQA 1EW0A 2PBYA 1VETB 4L0LA 4WF0A 3U4LP 5EE8A 2JKTI 1I5QA 4RA7A 2ZM2A 4LENA 4BJPA 4DJ2A 4Q8IA 1G28A 2D01A 1H3QA 1E3UA 1LL5A 1H8MA 5HPFA 2ZM8A 3WRTA 4GHIA 3DTKA 1W5DA 2JCHA 2H0YA 4JF6A 5CHMA 1NJ4A 3G2YA 2ZC7A 4JXWA 2IA2A 4PMAA 1L0GA 4E3MA 1T1CA 3AGFA 4L9GA 1O7EA 5FAPA 2PDRA 3VOZA 3HLFA 1DJCA 2ZC6B 3BJNA 1T18A 3HUOA 3VP0A 1JTDA 4HEFA 3F1PA 5CGWA 3IF5A 1G6OA 5FQ9A 2WGWB 3UY6A 1PIOA 1C3BA 1L3LA 1Y28A 4H8RA 3D9YA 4WN5A 3LCEA 2JHEA 3RH8B 2A49A 1PRQA 3FYZA 1S1YA 3IF6B 3H82A 4RQ9A 4ZJ1A 4LV0A 4Y5FA 5L09A 4IUHA 3T4OA 4GKUA 2RL3A 5J3WA 3F1NB 2YKHA 3CI6A 3E2KA 1F5MA 2V9AA 3UE0A 2VV6A 5DTKA 1TS7A 1ES2A 3M6BA 3GMWA 3LR0A 3JVVA 2UV0E 2WYXA 4ARZA 2P74A 2B5RA 3TE8A 1X0OA 3IBRA 1NYYA 3LR5A 2ZL1A 5DF8A 3ZYTA 1BLPA 3W8KA 1GHPA 1CQAA 4II7A 1K55C 4I3JA 3OPLA 1BLSA 4OPZA 2PAVP 3FV7A 1XXMA 3C7UA 3V5MA 2VZWA 1DJBA 1OTDA 1MXOA 3O88A 2OLUA 4WBGA 5TR7A 2Q0OA 2Y2JA 1K6SA 3PXPA 4HH2A 3UDFA 3M6HA 4YWZA 4Y0OA 5J8XA 1GSXA 1MBLA 1PW1A 4BD0A 3CUEA 4HNBA 4XUXA 3NIAA 2JN7A 1LHYA 3T4TA 5FSRA 1BT5A 5IHVA 4EEPA 2A24A 3LIDA 2BG1A 5AQ9A 5EV0A 2HDSA 4P87A 4QPRA 2W3EA 3Q07A 5HDCA 1YLYA 3MZFA 2JKTM 3ULFA 4QWOA 2A2LA 3OLOA 2R9WA 4OVDA 3QP8A 4KG6A 2QYBA 5E2GA 3P98A 1A0KA 4R0QA 4E6XA 2XK1A 4GHIB 1LI9A 3G4PA 3HCYA 1K56A 4S2OA 3HLBA 4HHDA 4PM9A 5L07A 1TS6A 3EEAA 1IKIA 4JXGA 4Z9QA 1MWUA 3G30A 2O0YA 1NRJA 5G18A 4WEKA 3G31A 1CK3A 2YKFA 3F1PB 1IYQA 1TEMA 1ERMA 1PWCA 4CJNA 1IOUA 5FA7A 4N1XA 4CLCC 4R23A 1HVBA 3VE3A 3S1YA 1G6AA 4Q0HA 5FEFA 1BYWA 2XFTA 4LV2A 4B4ZA 4JF4A 2GZAA 2WK0A 1HD8A 1GA0A 2K7SA 4PHTA 3LIBA 4OOLA 4P0MA 3PR6A 1YKDA 1GHIA 2HPBA 3MQQA 1XJ4A 3EGDC 5BOHA 4NXBA 3W4QA 1GSWA 1PNEA 2QWSA 2Y2OA 3MZDA 4JBFA 5DVAA 2P9VA 4S2PA 3GTCA 2R78A 5DFXA 5EOEA 3PHYA 1YSPA 2Y91A 5G4YA 2J8YA 2M1CA 4O0PA 2HP5A 3B47A 3IWOA 3WS4A 4ARZB 3T1SA 5F69A 2OAP1 2ZL1B 3EEHA 3LFVA 2P04A 1YLPA 3LIAA 3SZTA 2FFYA 3Q82A 5HL6A 3WWXA 1L0FA 5IU1A 3JVUA 2V20A 1IYOA 4DDSA 3S7PA 3UN7A 3FC7A 1K57C 5FATA 3R4KA 4GDNA 4KZ8A 5J7EA 1WA9A 3LUQA 4E6WA 5CHJA 1T1AA 1PI5A 1SDEA 3KYQA 3I7JA 4B9OA 5GHYA 3UMEA 3TJZC 3PYPA 2WKIA 2V1ZA 3CWFA 2DNSA 3A3EA 5HARA 1ALQA 2W1RA 4ZJ3A 3QNCA 3H7WA 4P6BA 1CEFA 2A24B 2WKRA 1NLZA 1Z6FA 4WL9A 5GLDA 3MXQA 3QHYA 2Y79A 1J9MA 2ZQCA 2XA7S 1ES4A 1BLHA 2B95A 4KZ6A 4XUZA 4DXBA 3IQAA 3IX8A 4G3VA 3N8RA 4YINA 5HSQA 4OP8A 2J9OA 1DY6A 2I9VA 3PBRA 4LCLA 2PD7A 4BBUA 4ME4A 5HX9A 1ESUA 3KSIA 3BFCA 5TBMA 1XP4A 4KZAA 4S2KA 1OMEA 1KE0A 3MJQA 3O86A 2HP9A 3IH8A 3ZVWA 3NOPC 3IT9A 5CX7A 2Z6CA 2Z2LB 2B02A 5JYPA 4G3WA 4HOIA 2WADA 2XR0A 1Y54A 1XFQA 4K0WA 4KZBA 2BLSA 1LI0A 3B3XA 4L9FA 4X68A 1L2SA 3C30A 4I3AA 1FCOA 1ZHHB 3MQ0A 4R4RA 1JWZA 4BWIA 1W8QA 3GVBA 3A0SA 5CTMA 4KZ3A 2H10A 5DF9A 4HY8A 4X53A 1G5UA 3EGXC 1K4FA 2ZQ7A 1MPLA 3JPUA 2ZQAA 4GD8A 4M3KA 3F1OA 1SHVA 2MJ6A 3TG9A 4BLMA 3Q1FA 2LB5A 3HVFA 5DKLA 2INWA 3O87A 2PD8A 2VA0A 4ETZA 3ITAA 3MXRA 2EX9A 2PBDP 1D1JA 5CGSA 2QKPA 3CPTA 2Z6DA 4UEYA 3HJKA 4MN6A 4IEDA 4S2NA 5GLCA 2J3TD 3VP1A 4EW7A 3VOLA 4NK3A 2V8FA 4KG5A 2ZMFA 4NKPA 1XJ3A 1WE4A 3MBZA 2G7UA 4CLCA 4LV3A 3QP5A 3GQZA 4N9LA 3ZG8B 4MMNA 1H5XA 3JYIA 4QB8A 1ONGA 1MC0A 1KDSA 4UAAA 3SH7A 1T19A 4FH4A 4OOYA 3EOIA 5HL1A 3LI8A 3H7WB 4QD4A 2OOLA 1KDWA 3K2NA 2E8IA 2HP6A 4OOMA 3OOVA 5EVIC 4R3AA 3D72A 4EUVA 3WS0A 1V9ZA 1S6RA 4WEJA 4UQIM 3WS1A 1NYMA 2KOIA 2Y2HA 1Q2PA 4NEED 2Y2NA 5L10A 4WYYA 2X71A 4HBTA 5FQKA 2V1AA 5TGFA 4EEUA 1J3WA 3SS4A 3KSFA 1ES5A 4MLLA 4NXGA 4BMWA 3MKEA 4JXSA 3HJIA 2Y2MA 3DTIA 2Z2MB 1K38A 5TBMB 4IUKA 3BFGA 1HTZA 3NC8A 2CMNA 3CHWP 4KQQA 1KGFA 2HDUA 4EUZA 1KE3A 4HI4A 1JVJA 1D7EA 1SZVA 1S4RA 1M6KA 1XGIA 3ZVTA 1N9LA 5CEBA 2EFXA 2IWCA 3R7WA 2Y2QA 3C7VA 4WLAA 5LBRA 5A91A 4X1MA 5M18A 1XKZA 1K54C 4P6ZM 1FCNA 3OC2A 1LL8A 3IWQA 3VOYA 4OKPA 1NZUA 4GNUA 1MWSA 4Y2FA 4JGPA 1W63Q 1PFLA 3CLOA 4EQIA 1N9NA 2W27A 4F3LB 4E3IA 4K91A 4WMCA 3IXDA 5U47A 4R38A 2ZC5B 1L0EA 3VFFA 1W79A 3ZG0A 5IT5A 4ZJ2A 4AFIA 4O8GA 2BASA 1L0DA 3F1OB 3S7NA 2JKRI 4BBTA 4C3QA 1EWZA 1WYCA 3UDIA 2VV7A 4O7DA 5AQBA 5FQQA 4E3JA 2QPNA 4RX2A 5KZHA 3CPTB 4X69A 4BD1A 4RVAA 4UQIS 3NJAA 4HH3A 5EUAA 4ESPA 4DE0A 4DE3A 5F1FA 3LEQA 2EWVA 2V8CA 5CHUA 4R70A 3GECA 3BFFA 4CLCB 1PWGA 3EWKA 1UWPX 2XLNA 3ZNYA 2HF6A 3K3CA 3PBSA 5DFYA 1VB6A 4OPQA 4WELA 1FOFA 2W3GA 3FWLA 4QY5A 1AWIA 5E2EA 4YNRA 5FI2A 2KDKA 2PYPA 3MFXA 4MBFA 4PKYA 4R6LA 2VGLM 2EA9A 3CMZA 3T4JA 3OPRA 3M2KA 4ZDXA 3S7OA 2K2NA 4PM7A 3CJMA 5FL3A 1GA9A 3TW8A 4S2MA 1K6RA 4P6ZS 1BSGA 2WAFA 3C4PA 4Q0JA 4X1LA 4QJGA 1XA7A 3A0RA 5EVID 1AXBA 5GLBA 3ISGA 1K56D 2XD1A 4HJ3A 1ZTUA 2Y4AA 4R3BA 3T4KA 4FD8A 4DDYA 4PPRA 4DKIA 3E98A 4I38A 1S1ZA 3V3RA 3H9WA 4B88A 3SH8A 2DMWA 4IVKA 3BY9A 1G68A 3PBQA 1XPBA 1TS8A 1TD5A 4WUJA 3NOTC 3UNWA 1ACFA 5FQIA 5FI6A 1PWDA 1W63M 2IWBA 3R7WB 4MNRA 2EFUA 2BTFP 3Q81A 4PAUA 3GDIA 3T50A 3BM6A 3LGOA 4HP9A 3HL9A 4YOFA 1KVLA 2I72A 5CRFA 4Y3IA 3BLMA 4OQHA 2ZJ9A 5FEGA 3NBLA 3FG8A 1TVFA 2XSSA 4WZ5A 3E2LA 4GS9A 4E3KA 3UPNA 1TDLA 1YLJA 4JXVA 2JKRM 4KZ5A 3Q7VA 3LY4A 5E2HA 5GHZA 1LSXA 5A90A 3W2ZA 1WYBA 5D3OA 5EVEA 3IXBA 4LRYC 2OAQ1 2L1MA 5C5KA 4DF6A 1PYYA 1N9OA 5AQAA 4DMZA 1LLBA 1P9RA 3CAXA 3MZEA 1YPRA 1GSVA 5HD5A 5AVFA 2J3TC 3A3DA 1SKOA 1PZOA 3NI9A 4X25A 2OLVA 5E2FA 1IKGA 1K54A 4JKTA 1DJAA 4KUKA 3OPPA 2E8JA 1OTEA 3TRCA 3BWLA 2PYRA 3NDGA 1FR6A 2VK3A 3U2AA 1YMSA 3O3VA 4F94A 4OP5A 3RJUA 3T4QA 3QP2A 2XF3A 3BW6A 1S66L 4LV1A 2X01A 2V0UA 1DP6A 2ZBBA 2OWHA 3NDEA 2VX8A 2Q9MA 1OTBA 4EQ1A 3G34A 2PU4A 1P9WA 5TFQA 4Y0UA 2XFSA 5AJGA 2O9AA 3CZDA 2J7VA 4HQAA 4FTXA 1NXYA 4IBRA 4EBLA 3D3OA 3VSLA 5FASA 4KENB 1OT6A 2W3HA 1JWVA 3K3DA 1UGUA 1BULA 3BFEA 4M4XA 4HIAA 4HJ4A 3T4SA 2JC7A 2HV1A 4JLFA 1K55A 3GR2A 3OCLA 5DF7A 3ICYA 2ZC3B 4KUOA 5FDHA 3UE1A 5KIZA 4CPKA 2EX2A 2GX5A 4I39A 5K5BA 3HLGA 2GJ3A 3PBTA 3D4FA 4OLGA 4KZ4A 4GLQA 1OJGA 5FDSA 2Y2PA 3UDXA 1OJ5A 2RCXA 5HAPA 5HPIA 3DTMA 4GS9B 3FPVA 3P01A 4LRXC 4KZ7A 2WKPA 1IEMA 3SH9A 1NWZA 2O99A 3OCNA 1S67L 3PTEA 1CJFA 4I5SA 1FSYA 3UO9A 2WUQA 1ONHA 1XX2A 1UWNX 3Q7VB 1NZOA 4F3LA 5I94A 1YLTA 2WGVA 4Y13A 4H6JA 4LFUA 3IS2A 3VP4A 4X55A 4D60A 3SOIA 3MKFA 3UPOA 5AVEA 3HBRA 3RXWA 3N7WA 1S0WA 3ZG7B 1SKFA 3W4PA 2PHYA 1SKOB 5M1AA 4EXOA 2EWWA 3E4QA 1SCWA 2Y59A 4ZTKA 5KSHA 3KO6A 2JKGA 3WS2A 3KX0X 4N9KA 1N9BA 3C8CA 3HUNA 4NXEA 2B18A 5A8BA 3IH9A 4U3TA 3QNBA 3BRMA 1MZUA 4PKYG 3IHBA 2ZQ8A 2EX6A 3T1XA 2VKSA 2M7VA 3UB9A 4N92A 4NXFA 4ID4A 2A3UA 3G35A 2VLGA 3AGEA 4I3IA 4E04A 3DTEA 1QMFA 4BENA 4OH0A 1M40A 3N6IA 4GDBA 4KQRA 1TS0A 4MCWA 4ZAMA 5HAQA 4Y0TA 5HZHA 5F1GA 2ZMAA 5F68A 1IYSA 3C38A 4ZBEA 4C6YA 2EXAA 2W3DA 3DBAA 5CXWA 1F2KA 3GSGA 2P08A 1BTLA 3RFBA 1I2WA 1STZA 2ACGA 2EXBA 3UB6A 1RCJA 3VMAA 2JE5A 3WRZA 1E3UD 3FZCA 4UHUA 4JF5A 1VQQA 1YMXA 5HW3A 4FCFA 1E25A 4E3NA 1LSVA 4YFMA 3G32A 3IX4A 1KOUA 1YQSA 1IELA 4G3KA 4FSFA 4XXRA 3DW0A 1LL9A 3UB5P 3BQ8A 1K57A 5L8MA 5L2FA 2VEAA 4HBUA 1ODVA 4GN2A 4EESA 3PAEA 5EM1A 3PAGA 4WMCD 2H28A 4LRZE 3HLWA 4UA9A 2XQZA 2DRWA 3LIFA 3G2ZA 3MQOA 5HWWA 5CEDA 4OPYA 4MEZA 2DCFA 2VJWA 3T12B 3IBJA 2C6WB 4GD6A 1V9YA 3A0VA 3C5AA 3FKVA 1HZOA 1CF0A 4GCZA 1MWTA 4DJ3A 3VSKA 4X6TA 2ZLYA 3E4PA 1I2SA 2X02A 4Q0IA 4H6JB 1BLCA 3IS2B 1XGJA 5HDSA 2QJ5A 3DWZA 3AGDA 4EV4A 3MMHA 1PW8A 3FKWA 3VE4A 5CECA 2D02A 2Y2KA 3B42A 2LB9A 3ZCZA 5F82A 1RGYA 2J80A 1TF1A 4DE2A 1EI5A 3NY4A 4P85A 1GHMA 4GOGA 3UPPA 3VV4A 2WZXA 3OPHA 2EX8A 4UA6A 3MF0A 1LSWA 1T1BA 4GB7A 3S7QA 4GZBA 4U0XA 2QMIA 4A5RA 3L9KA 5DKKA 2XROA 3BYDA 5CTNA 4B4XA 4LCMA 3B33A 3DWKA 4BBVA 3V3SA 5FQMA 2G2WA 1TDGA 4O01A 2H5SA 3RXXA 4MBHA 3IXGA 4R1GA 4HP4A 4XT2A 5DTTA 4IJGA 2VGJA 4PM6A 1VEUA 2ZQ9A 5E43A 1K25A 1LT0A 4R3JA 3MXSA 1IYPA 1K4EA 3ITBA 1E4DA 2ZQDA 1Q2QA 4EBNA 2WKQA 3BEBA 3LR4A 4EU0A 3KSGA 3LYXA 2O9CA 4X56A 4IBXA 2WGIA 4LGWA 1OPXA 2HZ5A 3N8LA 1SDNA 4OPRA 4L9EA 5AQ7A 2NUTC 2ZD8A 1DP8A 2PT7A 5G4ZA 3T4LA 2WKHA 3E0YA 2QJ7A 1GCEA 5EFWA 4FOFA 1MY8A 3CITA 4BL2A 1W7FA 3BQAA 1F98A 4LPZA 2XDMA 5TJJA 1KVMA 4CLCE 4DXCA 1RGZA 1YM1A 3SS3A 2XRNA 3VP2A 3V39A 5EVLA 1OT9A 2OSUA 2PR5A 4OLDA 4E3OA 2V2FF 1HLUP 3LY3A 4KG2A 3NULA 5EVIA 3MS6A 3TSGA 1IFQA 4MN5A 4EETB 3IF6C 3UB7A 5EM0A 5HWTA 3NHQA 2PRFA 3S22A 1ZKJA 5DJTA 1YAXA 3M2JA 5HFOA 3MR0A 4N1HA 3IWIA 3IX3A 3ZQ5A 4DE1A 3UMDA 3LR3A 3OBFA 2GNXA 5HDDA 4S2NC 3HLEA 5FAOA 4WZ4A 1FILA 3L7HA 2ZMVA 2VGLS 4BL3A 3S4XA 3HUMA 3VP3A 3C4OA 1K0KA 2L4RA 5F6AA 3V67A 2NUPC 1QMEA 2M7UA 4PM8A 2VV8A 2XA7M 3UE3A 5I5LA 2UWXA 1VHMA 3RTYA 3BLSA 1KGGA 1VM1A 2OWJA 2FFFB 2KX6A 5HD3A 1H8YA 3H82B 4QY6A 4PM5A 1YT4A 4C75A 5F83A 4GJ4A 5F5YA 2AVXA 4MDZA 2HJEA 5FQJA 4DN0A 3LI9A 3T1RA 1XFNA 3VFHA 4KQOA 4XT2B 4EERA 1JWPA 4FH2A 3LEZA 5KSCA 1VEUB 4CQHA 2WZZA 1FSWA 3KSHA 2Y8HA 1PI4A 3A3IA 2Q9NA 1OTAA 3A3FA 3HREA 1ES3A 1DP9A 4MBKA 2XEPA 4MN7A 2W1TA 3DAVA 2JBFA 4HJ6A 4OQGA 3N8SA 5EOOA 1KE4A 2CC1A 1BZAA 4BQMA 2R9XA 3ZHHA 4GW9A 3QP6A 2H0TA 1NLYA 3QP1A 4NETA 4NG2A 5IS1A 1XJ6A 2O9BA 3UE6A 3GRJA 4LLOB 5CGXA 3CG5A 4JGRA 5M19A 2V1BA 4ZRRA 4OONA 2Y2IA 2W0NA 4ETXA 3IXHA 3EQUA 5KMWA 1FCMA 2HGVA 2PR6A 5MC7A 4JGOA 3HLCA 3LIEA 1NRFA 3SW1A 4KQDA 1S4SA 1BUEA 5FAQA 3ZNTA 1XJ2A 2G2UA 4Y17A 2JKFA 4R4SA 4S2IA 1H8ZA 1PZPA 1JNUA 5JYOA 3PBNA 2HDQA 5A92A 1XA1A 3O5YA 3P7NA 2W3FA 3ZG9B 2QHKA 5EVIB 1P0ZA 3BY8A 1VETA 1NY0A 1MKMA 3ZDJA 3P09A 2OV5A 1FIKA 4D2OA 3C2WA 4Y15A 4B93A 2P7JA 4EWFA 4S2JA 2ZM0A 4JPMA 1CEGA 1ZG4A 5HWVA 2FH5A 1ZC2A 1N4OA 1D06A 1CI9A 4DRTA 3W4OA 4JGQA 3BECA 3EQVA 5HAIA 1JTGA 4WM9A 2HJ9C 2WKEA 3GV9A 2ZC4B 1P97A 1YSQA 5GL9A 4RX3A 3BFDA 4CLCD 4QU3A 1FQGA 3NOUC 3Q7ZA 1FR1A 2WGWA 2GDNA 1ERQA 3LO7A 1ZG6A 3MSHA 5FI7A 3N4IA 3MFDA 3UB8A 4UA7A 1DRMA 1W8YA 1RP5A 2P9VB 3SS5A 3IF6A 5DJUA 1MWRA 1Z09A 2L0WA 4Y7PA 1ESIA 3CUEC 3ZFZA 1H0MA 3F1NA 3WS5A 2C5WB 2WAEA 1Y4OA 4IVIA 2KLIA 5DTSA 3G6OA 2K31A 2XD5A 3OZHA 4Z1WA 1O07A 3V50A 1OTIA 5J4EA 3T1QB 2W1TB 2XGNA 3NECA 2VGKA 5CERA 2PU2A 4QHCA 2V0WA 2QZ6A 3A3JA 4OQ0A 5EECA
chains in the Genus database with same CATH topology
1F9IA 3MF0A 1LSWA 1T1BA 3FG8A 3S7QA 2XSSA 3LICA 3PBOA 4GS9A 4G3VA 5HSQA 5DKKA 2XROA 2I9VA 3PBRA 3KYZA 2PD7A 4BBUA 4ME4A 3B33A 4BBVA 2JKRM 2ZOHA 3KSIA 2FZ0A 4O01A 3E4OA 5TBMA 1LSXA 2ZOIA 3W2ZA 3MJQA 3NOPC 4HP4A 4XT2A 4IJGA 4LRYC 5CX7A 2OAQ1 2L1MA 2Z6CA 5C5KA 2B02A 1N9OA 4G3WA 4DMZA 1P9RA 3CAXA 4HOIA 1LT0A 1GSVA 1XFQA 5HD5A 5AVFA 2J3TC 2J3WA 2WKQA 3FPWA 4L9FA 3LR4A 4EU0A 3KSGA 3C30A 3LYXA 2O9CA 4I3AA 4K08A 1ZHHB 4IHQA 1EW0A 4L0LA 4WF0A 3MQ0A 1OPXA 2JKTI 4BWIA 4KUKA 3A0SA 1OTEA 5DF9A 4BJPA 4DJ2A 4HY8A 3TRCA 4L9EA 3BWLA 2PYRA 1G28A 2D01A 1H3QA 2NUTC 3U2AA 1H8MA 5HPFA 4GHIA 1DP8A 2PT7A 5G4ZA 3T4LA 3EGXC 3E0YA 2QJ7A 3T4QA 3F1OA 2MJ6A 5EFWA 2IA2A 4FOFA 3CITA 1T1CA 3BW6A 1S66L 2LB5A 5DKLA 2INWA 2PD8A 2VA0A 3BQAA 4L9GA 4ETZA 1F98A 2V0UA 2PDRA 4LPZA 1DP6A 5TJJA 3BJNA 4CLCE 2QKPA 2ZBBA 1T18A 2XRNA 2Z6DA 4UEYA 2OWHA 3HJKA 4MN6A 2VX8A 1OT9A 3F1PA 2J3TD 4EW7A 3VOLA 2PR5A 1OTBA 4EQ1A 2ZMFA 4NKPA 1P9WA 1G6OA 1XJ3A 2G7UA 5AJGA 4CLCA 2O9AA 1Y28A 1IFQA 4HQAA 4MN5A 4MMNA 4WN5A 4EETB 3UB7A 2JHEA 3RH8B 3D3OA 5HWTA 3NHQA 1S1YA 1OT6A 2W3HA 5DJTA 3K3DA 1YAXA 1UGUA 3H82A 3MR0A 4RQ9A 4M4XA 1MC0A 3ZQ5A 4HIAA 3UMDA 3LR3A 4Y5FA 3OBFA 2GNXA 4HJ4A 3T4SA 4IUHA 3T4OA 5HDDA 5J3WA 2ZMVA 3F1NB 2HV1A 1T19A 2YKHA 3OCLA 2VGLS 3EOIA 3CI6A 3LI8A 3H7WB 1F5MA 2OOLA 2V9AA 3ICYA 3K2NA 2VV6A 4OOMA 4KUOA 3OOVA 1TS7A 2L4RA 5F6AA 3V67A 4R3AA 3LR0A 3D72A 2NUPC 5KIZA 3JVVA 2M7UA 2GX5A 2VV8A 2XA7M 4I39A 3UE3A 4EUVA 5K5BA 5I5LA 2GJ3A 1V9ZA 4WEJA 4UQIM 4ARZA 3PBTA 1VHMA 3TE8A 1X0OA 4GLQA 3RTYA 1OJGA 3IBRA 2KOIA 3LR5A 1OJ5A 2OWJA 3ZYTA 2KX6A 5HPIA 5HD3A 4GS9B 3FPVA 3P01A 3H82B 4LRXC 4NEED 2V1AA 2WKPA 4EEUA 4II7A 1NWZA 3KSFA 2O99A 3OCNA 1S67L 4I3JA 4NXGA 4I5SA 4BMWA 3HJIA 4GJ4A 1UWNX 2VZWA 5F5YA 1OTDA 5TBMB 4IUKA 4MDZA 4F3LA 2HJEA 3PXPA 2CMNA 4DN0A 3LI9A 4H6JA 4HH2A 1XFNA 4KQOA 4XT2B 4EERA 3IS2A 4YWZA 4HI4A 1GSXA 1D7EA 1S4RA 3CUEA 4CQHA 4HNBA 3KSHA 2Y8HA 1N9LA 2JN7A 3R7WA 1OTAA 3T4TA 5AVEA 4WLAA 4EEPA 2A24A 3LIDA 5LBRA 1DP9A 4MN7A 2PHYA 4EXOA 2EWWA 4P6ZM 3E4QA 3OC2A 1LL8A 2W1TA 5KSHA 4QPRA 2W3EA 4HJ6A 5HDCA 3KO6A 4Y2FA 3KX0X 4JGPA 1W63Q 2JKTM 3ULFA 3CLOA 2A2LA 3OLOA 1N9NA 2W27A 4GW9A 4F3LB 1NLYA 3C8CA 5IS1A 4R38A 1XJ6A 2O9BA 3UE6A 4NXEA 4LLOB 2QYBA 2B18A 5A8BA 4JGRA 4GHIB 3HCYA 1MZUA 4PKYG 5IT5A 2V1BA 4ZRRA 4AFIA 4O8GA 2BASA 2W0NA 3F1OB 4HHDA 3S7NA 2JKRI 4BBTA 4ETXA 1TS6A 3EEAA 3EQUA 5MC7A 2PR6A 2HGVA 2VKSA 2M7VA 3UB9A 4JGOA 4NXFA 2VV7A 2O0YA 1NRJA 2VLGA 4I3IA 4E04A 4WEKA 3LIEA 3SW1A 4KQDA 1S4SA 1TS0A 4MCWA 5HZHA 5F68A 1XJ2A 2YKFA 3F1PB 4UQIS 3C38A 3NJAA 4HH3A 2W3DA 1IOUA 3DBAA 1JNUA 4CLCC 2EWVA 3VE3A 4R70A 3GECA 3PBNA 2P08A 3O5YA 3P7NA 2W3FA 3RFBA 2QHKA 4Q0HA 4CLCB 3EWKA 1P0ZA 3BY8A 1UWPX 1STZA 1MKMA 3UB6A 1BYWA 2HF6A 3K3CA 3PBSA 5DFYA 1VB6A 2GZAA 2K7SA 3C2WA 3LIBA 4PHTA 4WELA 4OOLA 4B93A 2P7JA 2W3GA 1YKDA 3PR6A 4YNRA 2KDKA 2PYPA 3MFXA 3MQQA 1XJ4A 3EGDC 4PKYA 4R6LA 2VGLM 1LSVA 4NXBA 5HWVA 1GSWA 2EA9A 2FH5A 2QWSA 3T4JA 1KOUA 1D06A 3S7OA 4G3KA 2K2NA 4FSFA 2R78A 5FL3A 5DFXA 3PHYA 4JGQA 1YSPA 3BQ8A 5G4YA 5L8MA 2VEAA 3EQVA 3TW8A 2M1CA 4O0PA 2HJ9C 1ODVA 3B47A 4EESA 4P6ZS 2H28A 4LRZE 4ARZB 4Q0JA 5F69A 1P97A 1YSQA 3LIFA 2OAP1 3A0RA 4CLCD 3EEHA 3LFVA 3MQOA 2P04A 3NOUC 5HWWA 4HJ3A 1ZTUA 3LIAA 2VJWA 5HL6A 3IBJA 3T4KA 5IU1A 1V9YA 3A0VA 3JVUA 3E98A 4I38A 1S1ZA 4GCZA 3S7PA 3UB8A 1DRMA 3H9WA 3FC7A 3R4KA 4DJ3A 5J7EA 1WA9A 2DMWA 3LUQA 5DJUA 1T1AA 3E4PA 4Q0IA 3BY9A 3KYQA 4H6JB 2L0WA 3PBQA 3CUEC 3IS2B 4B9OA 1TS8A 3UMEA 1TD5A 3TJZC 4WUJA 3NOTC 5HDSA 2QJ5A 3PYPA 3CWFA 3F1NA 3MMHA 1W63M 3VE4A 2W1RA 2KLIA 3H7WA 3R7WB 2D02A 3B42A 3G6OA 2K31A 2LB9A 2A24B 2WKRA 1NLZA 4PAUA 4Z1WA 3GDIA 3T50A 2J80A 4WL9A 1OTIA 5J4EA 3MXQA 1TF1A 2W1TB 4HP9A 4YOFA 2Y79A 2V0WA 2XA7S 4Y3IA 3VV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9I A;  1LSW A;  1T1B A;  3FG8 A;  3LIC A;  4GS9 A;  5HSQ A;  5DKK A;  2I9V A;  2PD7 A;  4BBU A;  3B33 A;  4BBV A;  2ZOH A;  5TBM A;  3E4O A;  1LSX A;  2ZOI A;  3MJQ A;  3NOP C;  4HP4 A;  4XT2 A;  4LRY C;  2L1M A;  2Z6C A;  2B02 A;  1N9O A;  3CAX A;  4HOI A;  1LT0 A;  1GSV A;  1XFQ A;  5HD5 A;  5AVF A;  4L9F A;  2WKQ A;  3LYX A;  4I3A A;  4K08 A;  1EW0 A;  4WF0 A;  4KUK A;  3A0S A;  1OTE A;  4DJ2 A;  4HY8 A;  4L9E A;  3BWL A;  2PYR A;  1G28 A;  2D01 A;  4GHI A;  1DP8 A;  5G4Z A;  2QJ7 A;  3F1O A;  5EFW A;  1T1C A;  1S66 L;  5DKL A;  2INW A;  2PD8 A;  4L9G A;  1F98 A;  2V0U A;  2PDR A;  4LPZ A;  1DP6 A;  2QKP A;  2ZBB A;  1T18 A;  2Z6D A;  2OWH A;  3HJK A;  4MN6 A;  1OT9 A;  3F1P A;  4EW7 A;  3VOL A;  2PR5 A;  1OTB A;  4EQ1 A;  1XJ3 A;  1Y28 A;  4HQA A;  4MN5 A;  4WN5 A;  4EET B;  3UB7 A;  2JHE A;  3RH8 B;  5HWT A;  3NHQ A;  1S1Y A;  1OT6 A;  5DJT A;  3K3D A;  1UGU A;  3H82 A;  3MR0 A;  4RQ9 A;  4M4X A;  3ZQ5 A;  4HIA A;  3UMD A;  4HJ4 A;  5HDD A;  5J3W A;  3F1N B;  2HV1 A;  1T19 A;  2YKH A;  3LI8 A;  3H7W B;  2OOL A;  2V9A A;  3ICY A;  2VV6 A;  4KUO A;  1TS7 A;  2L4R A;  5F6A A;  4R3A A;  3D72 A;  5KIZ A;  2VV8 A;  4I39 A;  5I5L A;  2GJ3 A;  1V9Z A;  1X0O A;  3RTY A;  1OJG A;  3IBR A;  1OJ5 A;  2OWJ A;  2KX6 A;  5HD3 A;  4GS9 B;  3H82 B;  4LRX C;  2V1A A;  2WKP A;  4EEU A;  1NWZ A;  1S67 L;  4I3J A;  4NXG A;  4I5S A;  3HJI A;  1UWN X;  5F5Y A;  1OTD A;  5TBM B;  4F3L A;  2CMN A;  3LI9 A;  4H6J A;  4HH2 A;  1XFN A;  4XT2 B;  4EER A;  3IS2 A;  4YWZ A;  4HI4 A;  1GSX A;  1D7E A;  1S4R A;  4HNB A;  1N9L A;  2JN7 A;  1OTA A;  5AVE A;  4WLA A;  4EEP A;  2A24 A;  3LID A;  1DP9 A;  2PHY A;  4EXO A;  3E4Q A;  1LL8 A;  4HJ6 A;  5HDC A;  3KX0 X;  4JGP A;  3ULF A;  3CLO A;  3OLO A;  1N9N A;  2W27 A;  4GW9 A;  4F3L B;  3C8C A;  5IS1 A;  4R38 A;  1XJ6 A;  3UE6 A;  4NXE A;  4LLO B;  5A8B A;  4JGR A;  4GHI B;  1MZU A;  4PKY G;  2V1B A;  2BAS A;  2W0N A;  3F1O B;  4HHD A;  4BBT A;  1TS6 A;  2PR6 A;  3UB9 A;  4JGO A;  4NXF A;  2VV7 A;  2VLG A;  4I3I A;  4E04 A;  3LIE A;  3SW1 A;  4KQD A;  1S4S A;  1TS0 A;  5HZH A;  5F68 A;  1XJ2 A;  2YKF A;  3F1P B;  3NJA A;  4HH3 A;  1JNU A;  3VE3 A;  4R70 A;  3GEC A;  3P7N A;  2QHK A;  1P0Z A;  3EWK A;  3BY8 A;  1UWP X;  3UB6 A;  1BYW A;  3K3C A;  1VB6 A;  2K7S A;  3C2W A;  3LIB A;  2P7J A;  2KDK A;  2PYP A;  3MFX A;  3MQQ A;  1XJ4 A;  4PKY A;  4R6L A;  1LSV A;  4NXB A;  5HWV A;  1GSW A;  2EA9 A;  2QWS A;  1KOU A;  1D06 A;  2R78 A;  3PHY A;  4JGQ A;  5G4Y A;  2VEA A;  2M1C A;  1ODV A;  4EES A;  2H28 A;  4LRZ E;  5F69 A;  1P97 A;  3LIF A;  3A0R A;  3EEH A;  3MQO A;  3NOU C;  5HWW A;  4HJ3 A;  3LIA A;  5IU1 A;  1V9Y A;  3A0V A;  4I38 A;  1S1Z A;  4GCZ A;  3UB8 A;  1DRM A;  3H9W A;  3FC7 A;  4DJ3 A;  5J7E A;  1WA9 A;  3LUQ A;  5DJU A;  1T1A A;  3E4P A;  3BY9 A;  4H6J B;  2L0W A;  3IS2 B;  4B9O A;  1TS8 A;  3UME A;  4WUJ A;  3NOT C;  5HDS A;  2QJ5 A;  3PYP A;  3CWF A;  3F1N A;  3VE4 A;  3H7W A;  2D02 A;  3G6O A;  2A24 B;  2WKR A;  3GDI A;  3T50 A;  2J80 A;  4WL9 A;  1OTI A;  5J4E A;  3MXQ A;  4HP9 A;  2V0W A; 
#chains in the Genus database with same CATH topology
 1F9I A;  3ZGA B;  2J9P A;  3PBO A;  3LIC A;  3HLD A;  1CI8 A;  3KYZ A;  2Y55 A;  3NCK A;  4FUW A;  2ZOH A;  1YLW A;  2FZ0 A;  3E4O A;  2Y2L A;  2IWD A;  2ZOI A;  4RYE A;  4U0T A;  5A93 A;  5GHX A;  3IHA A;  3TOI A;  1ERO A;  1MKI A;  4K0X A;  2XH9 A;  4HES A;  3ZG5 A;  4WZ5 C;  1U60 A;  5EPH A;  2HDR A;  1KGE A;  4EBP A;  4OQI A;  2Y2G A;  3QP4 A;  5GLA A;  2J3W A;  4S2L A;  4E3L A;  4KZ9 A;  3FPW A;  1YLZ A;  3KYE A;  4K08 A;  4IHQ A;  1EW0 A;  2PBY A;  1VET B;  4L0L A;  4WF0 A;  3U4L P;  5EE8 A;  2JKT I;  1I5Q A;  4RA7 A;  2ZM2 A;  4LEN A;  4BJP A;  4DJ2 A;  4Q8I A;  1G28 A;  2D01 A;  1H3Q A;  1E3U A;  1LL5 A;  1H8M A;  5HPF A;  2ZM8 A;  3WRT A;  4GHI A;  3DTK A;  1W5D A;  2JCH A;  2H0Y A;  4JF6 A;  5CHM A;  1NJ4 A;  3G2Y A;  2ZC7 A;  4JXW A;  2IA2 A;  4PMA A;  1L0G A;  4E3M A;  1T1C A;  3AGF A;  4L9G A;  1O7E A;  5FAP A;  2PDR A;  3VOZ A;  3HLF A;  1DJC A;  2ZC6 B;  3BJN A;  1T18 A;  3HUO A;  3VP0 A;  1JTD A;  4HEF A;  3F1P A;  5CGW A;  3IF5 A;  1G6O A;  5FQ9 A;  2WGW B;  3UY6 A;  1PIO A;  1C3B A;  1L3L A;  1Y28 A;  4H8R A;  3D9Y A;  4WN5 A;  3LCE A;  2JHE A;  3RH8 B;  2A49 A;  1PRQ A;  3FYZ A;  1S1Y A;  3IF6 B;  3H82 A;  4RQ9 A;  4ZJ1 A;  4LV0 A;  4Y5F A;  5L09 A;  4IUH A;  3T4O A;  4GKU A;  2RL3 A;  5J3W A;  3F1N B;  2YKH A;  3CI6 A;  3E2K A;  1F5M A;  2V9A A;  3UE0 A;  2VV6 A;  5DTK A;  1TS7 A;  1ES2 A;  3M6B A;  3GMW A;  3LR0 A;  3JVV A;  2UV0 E;  2WYX A;  4ARZ A;  2P74 A;  2B5R A;  3TE8 A;  1X0O A;  3IBR A;  1NYY A;  3LR5 A;  2ZL1 A;  5DF8 A;  3ZYT A;  1BLP A;  3W8K A;  1GHP A;  1CQA A;  4II7 A;  1K55 C;  4I3J A;  3OPL A;  1BLS A;  4OPZ A;  2PAV P;  3FV7 A;  1XXM A;  3C7U A;  3V5M A;  2VZW A;  1DJB A;  1OTD A;  1MXO A;  3O88 A;  2OLU A;  4WBG A;  5TR7 A;  2Q0O A;  2Y2J A;  1K6S A;  3PXP A;  4HH2 A;  3UDF A;  3M6H A;  4YWZ A;  4Y0O A;  5J8X A;  1GSX A;  1MBL A;  1PW1 A;  4BD0 A;  3CUE A;  4HNB A;  4XUX A;  3NIA A;  2JN7 A;  1LHY A;  3T4T A;  5FSR A;  1BT5 A;  5IHV A;  4EEP A;  2A24 A;  3LID A;  2BG1 A;  5AQ9 A;  5EV0 A;  2HDS A;  4P87 A;  4QPR A;  2W3E A;  3Q07 A;  5HDC A;  1YLY A;  3MZF A;  2JKT M;  3ULF A;  4QWO A;  2A2L A;  3OLO A;  2R9W A;  4OVD A;  3QP8 A;  4KG6 A;  2QYB A;  5E2G A;  3P98 A;  1A0K A;  4R0Q A;  4E6X A;  2XK1 A;  4GHI B;  1LI9 A;  3G4P A;  3HCY A;  1K56 A;  4S2O A;  3HLB A;  4HHD A;  4PM9 A;  5L07 A;  1TS6 A;  3EEA A;  1IKI A;  4JXG A;  4Z9Q A;  1MWU A;  3G30 A;  2O0Y A;  1NRJ A;  5G18 A;  4WEK A;  3G31 A;  1CK3 A;  2YKF A;  3F1P B;  1IYQ A;  1TEM A;  1ERM A;  1PWC A;  4CJN A;  1IOU A;  5FA7 A;  4N1X A;  4CLC C;  4R23 A;  1HVB A;  3VE3 A;  3S1Y A;  1G6A A;  4Q0H A;  5FEF A;  1BYW A;  2XFT A;  4LV2 A;  4B4Z A;  4JF4 A;  2GZA A;  2WK0 A;  1HD8 A;  1GA0 A;  2K7S A;  4PHT A;  3LIB A;  4OOL A;  4P0M A;  3PR6 A;  1YKD A;  1GHI A;  2HPB A;  3MQQ A;  1XJ4 A;  3EGD C;  5BOH A;  4NXB A;  3W4Q A;  1GSW A;  1PNE A;  2QWS A;  2Y2O A;  3MZD A;  4JBF A;  5DVA A;  2P9V A;  4S2P A;  3GTC A;  2R78 A;  5DFX A;  5EOE A;  3PHY A;  1YSP A;  2Y91 A;  5G4Y A;  2J8Y A;  2M1C A;  4O0P A;  2HP5 A;  3B47 A;  3IWO A;  3WS4 A;  4ARZ B;  3T1S A;  5F69 A;  2OAP 1;  2ZL1 B;  3EEH A;  3LFV A;  2P04 A;  1YLP A;  3LIA A;  3SZT A;  2FFY A;  3Q82 A;  5HL6 A;  3WWX A;  1L0F A;  5IU1 A;  3JVU A;  2V20 A;  1IYO A;  4DDS A;  3S7P A;  3UN7 A;  3FC7 A;  1K57 C;  5FAT A;  3R4K A;  4GDN A;  4KZ8 A;  5J7E A;  1WA9 A;  3LUQ A;  4E6W A;  5CHJ A;  1T1A A;  1PI5 A;  1SDE A;  3KYQ A;  3I7J A;  4B9O A;  5GHY A;  3UME A;  3TJZ C;  3PYP A;  2WKI A;  2V1Z A;  3CWF A;  2DNS A;  3A3E A;  5HAR A;  1ALQ A;  2W1R A;  4ZJ3 A;  3QNC A;  3H7W A;  4P6B A;  1CEF A;  2A24 B;  2WKR A;  1NLZ A;  1Z6F A;  4WL9 A;  5GLD A;  3MXQ A;  3QHY A;  2Y79 A;  1J9M A;  2ZQC A;  2XA7 S;  1ES4 A;  1BLH A;  2B95 A;  4KZ6 A;  4XUZ A;  4DXB A;  3IQA A;  3IX8 A;  4G3V A;  3N8R A;  4YIN A;  5HSQ A;  4OP8 A;  2J9O A;  1DY6 A;  2I9V A;  3PBR A;  4LCL A;  2PD7 A;  4BBU A;  4ME4 A;  5HX9 A;  1ESU A;  3KSI A;  3BFC A;  5TBM A;  1XP4 A;  4KZA A;  4S2K A;  1OME A;  1KE0 A;  3MJQ A;  3O86 A;  2HP9 A;  3IH8 A;  3ZVW A;  3NOP C;  3IT9 A;  5CX7 A;  2Z6C A;  2Z2L B;  2B02 A;  5JYP A;  4G3W A;  4HOI A;  2WAD A;  2XR0 A;  1Y54 A;  1XFQ A;  4K0W A;  4KZB A;  2BLS A;  1LI0 A;  3B3X A;  4L9F A;  4X68 A;  1L2S A;  3C30 A;  4I3A A;  1FCO A;  1ZHH B;  3MQ0 A;  4R4R A;  1JWZ A;  4BWI A;  1W8Q A;  3GVB A;  3A0S A;  5CTM A;  4KZ3 A;  2H10 A;  5DF9 A;  4HY8 A;  4X53 A;  1G5U A;  3EGX C;  1K4F A;  2ZQ7 A;  1MPL A;  3JPU A;  2ZQA A;  4GD8 A;  4M3K A;  3F1O A;  1SHV A;  2MJ6 A;  3TG9 A;  4BLM A;  3Q1F A;  2LB5 A;  3HVF A;  5DKL A;  2INW A;  3O87 A;  2PD8 A;  2VA0 A;  4ETZ A;  3ITA A;  3MXR A;  2EX9 A;  2PBD P;  1D1J A;  5CGS A;  2QKP A;  3CPT A;  2Z6D A;  4UEY A;  3HJK A;  4MN6 A;  4IED A;  4S2N A;  5GLC A;  2J3T D;  3VP1 A;  4EW7 A;  3VOL A;  4NK3 A;  2V8F A;  4KG5 A;  2ZMF A;  4NKP A;  1XJ3 A;  1WE4 A;  3MBZ A;  2G7U A;  4CLC A;  4LV3 A;  3QP5 A;  3GQZ A;  4N9L A;  3ZG8 B;  4MMN A;  1H5X A;  3JYI A;  4QB8 A;  1ONG A;  1MC0 A;  1KDS A;  4UAA A;  3SH7 A;  1T19 A;  4FH4 A;  4OOY A;  3EOI A;  5HL1 A;  3LI8 A;  3H7W B;  4QD4 A;  2OOL A;  1KDW A;  3K2N A;  2E8I A;  2HP6 A;  4OOM A;  3OOV A;  5EVI C;  4R3A A;  3D72 A;  4EUV A;  3WS0 A;  1V9Z A;  1S6R A;  4WEJ A;  4UQI M;  3WS1 A;  1NYM A;  2KOI A;  2Y2H A;  1Q2P A;  4NEE D;  2Y2N A;  5L10 A;  4WYY A;  2X71 A;  4HBT A;  5FQK A;  2V1A A;  5TGF A;  4EEU A;  1J3W A;  3SS4 A;  3KSF A;  1ES5 A;  4MLL A;  4NXG A;  4BMW A;  3MKE A;  4JXS A;  3HJI A;  2Y2M A;  3DTI A;  2Z2M B;  1K38 A;  5TBM B;  4IUK A;  3BFG A;  1HTZ A;  3NC8 A;  2CMN A;  3CHW P;  4KQQ A;  1KGF A;  2HDU A;  4EUZ A;  1KE3 A;  4HI4 A;  1JVJ A;  1D7E A;  1SZV A;  1S4R A;  1M6K A;  1XGI A;  3ZVT A;  1N9L A;  5CEB A;  2EFX A;  2IWC A;  3R7W A;  2Y2Q A;  3C7V A;  4WLA A;  5LBR A;  5A91 A;  4X1M A;  5M18 A;  1XKZ A;  1K54 C;  4P6Z M;  1FCN A;  3OC2 A;  1LL8 A;  3IWQ A;  3VOY A;  4OKP A;  1NZU A;  4GNU A;  1MWS A;  4Y2F A;  4JGP A;  1W63 Q;  1PFL A;  3CLO A;  4EQI A;  1N9N A;  2W27 A;  4F3L B;  4E3I A;  4K91 A;  4WMC A;  3IXD A;  5U47 A;  4R38 A;  2ZC5 B;  1L0E A;  3VFF A;  1W79 A;  3ZG0 A;  5IT5 A;  4ZJ2 A;  4AFI A;  4O8G A;  2BAS A;  1L0D A;  3F1O B;  3S7N A;  2JKR I;  4BBT A;  4C3Q A;  1EWZ A;  1WYC A;  3UDI A;  2VV7 A;  4O7D A;  5AQB A;  5FQQ A;  4E3J A;  2QPN A;  4RX2 A;  5KZH A;  3CPT B;  4X69 A;  4BD1 A;  4RVA A;  4UQI S;  3NJA A;  4HH3 A;  5EUA A;  4ESP A;  4DE0 A;  4DE3 A;  5F1F A;  3LEQ A;  2EWV A;  2V8C A;  5CHU A;  4R70 A;  3GEC A;  3BFF A;  4CLC B;  1PWG A;  3EWK A;  1UWP X;  2XLN A;  3ZNY A;  2HF6 A;  3K3C A;  3PBS A;  5DFY A;  1VB6 A;  4OPQ A;  4WEL A;  1FOF A;  2W3G A;  3FWL A;  4QY5 A;  1AWI A;  5E2E A;  4YNR A;  5FI2 A;  2KDK A;  2PYP A;  3MFX A;  4MBF A;  4PKY A;  4R6L A;  2VGL M;  2EA9 A;  3CMZ A;  3T4J A;  3OPR A;  3M2K A;  4ZDX A;  3S7O A;  2K2N A;  4PM7 A;  3CJM A;  5FL3 A;  1GA9 A;  3TW8 A;  4S2M A;  1K6R A;  4P6Z S;  1BSG A;  2WAF A;  3C4P A;  4Q0J A;  4X1L A;  4QJG A;  1XA7 A;  3A0R A;  5EVI D;  1AXB A;  5GLB A;  3ISG A;  1K56 D;  2XD1 A;  4HJ3 A;  1ZTU A;  2Y4A A;  4R3B A;  3T4K A;  4FD8 A;  4DDY A;  4PPR A;  4DKI A;  3E98 A;  4I38 A;  1S1Z A;  3V3R A;  3H9W A;  4B88 A;  3SH8 A;  2DMW A;  4IVK A;  3BY9 A;  1G68 A;  3PBQ A;  1XPB A;  1TS8 A;  1TD5 A;  4WUJ A;  3NOT C;  3UNW A;  1ACF A;  5FQI A;  5FI6 A;  1PWD A;  1W63 M;  2IWB A;  3R7W B;  4MNR A;  2EFU A;  2BTF P;  3Q81 A;  4PAU A;  3GDI A;  3T50 A;  3BM6 A;  3LGO A;  4HP9 A;  3HL9 A;  4YOF A;  1KVL A;  2I72 A;  5CRF A;  4Y3I A;  3BLM A;  4OQH A;  2ZJ9 A;  5FEG A;  3NBL A;  3FG8 A;  1TVF A;  2XSS A;  4WZ5 A;  3E2L A;  4GS9 A;  4E3K A;  3UPN A;  1TDL A;  1YLJ A;  4JXV A;  2JKR M;  4KZ5 A;  3Q7V A;  3LY4 A;  5E2H A;  5GHZ A;  1LSX A;  5A90 A;  3W2Z A;  1WYB A;  5D3O A;  5EVE A;  3IXB A;  4LRY C;  2OAQ 1;  2L1M A;  5C5K A;  4DF6 A;  1PYY A;  1N9O A;  5AQA A;  4DMZ A;  1LLB A;  1P9R A;  3CAX A;  3MZE A;  1YPR A;  1GSV A;  5HD5 A;  5AVF A;  2J3T C;  3A3D A;  1SKO A;  1PZO A;  3NI9 A;  4X25 A;  2OLV A;  5E2F A;  1IKG A;  1K54 A;  4JKT A;  1DJA A;  4KUK A;  3OPP A;  2E8J A;  1OTE A;  3TRC A;  3BWL A;  2PYR A;  3NDG A;  1FR6 A;  2VK3 A;  3U2A A;  1YMS A;  3O3V A;  4F94 A;  4OP5 A;  3RJU A;  3T4Q A;  3QP2 A;  2XF3 A;  3BW6 A;  1S66 L;  4LV1 A;  2X01 A;  2V0U A;  1DP6 A;  2ZBB A;  2OWH A;  3NDE A;  2VX8 A;  2Q9M A;  1OTB A;  4EQ1 A;  3G34 A;  2PU4 A;  1P9W A;  5TFQ A;  4Y0U A;  2XFS A;  5AJG A;  2O9A A;  3CZD A;  2J7V A;  4HQA A;  4FTX A;  1NXY A;  4IBR A;  4EBL A;  3D3O A;  3VSL A;  5FAS A;  4KEN B;  1OT6 A;  2W3H A;  1JWV A;  3K3D A;  1UGU A;  1BUL A;  3BFE A;  4M4X A;  4HIA A;  4HJ4 A;  3T4S A;  2JC7 A;  2HV1 A;  4JLF A;  1K55 A;  3GR2 A;  3OCL A;  5DF7 A;  3ICY A;  2ZC3 B;  4KUO A;  5FDH A;  3UE1 A;  5KIZ A;  4CPK A;  2EX2 A;  2GX5 A;  4I39 A;  5K5B A;  3HLG A;  2GJ3 A;  3PBT A;  3D4F A;  4OLG A;  4KZ4 A;  4GLQ A;  1OJG A;  5FDS A;  2Y2P A;  3UDX A;  1OJ5 A;  2RCX A;  5HAP A;  5HPI A;  3DTM A;  4GS9 B;  3FPV A;  3P01 A;  4LRX C;  4KZ7 A;  2WKP A;  1IEM A;  3SH9 A;  1NWZ A;  2O99 A;  3OCN A;  1S67 L;  3PTE A;  1CJF A;  4I5S A;  1FSY A;  3UO9 A;  2WUQ A;  1ONH A;  1XX2 A;  1UWN X;  3Q7V B;  1NZO A;  4F3L A;  5I94 A;  1YLT A;  2WGV A;  4Y13 A;  4H6J A;  4LFU A;  3IS2 A;  3VP4 A;  4X55 A;  4D60 A;  3SOI A;  3MKF A;  3UPO A;  5AVE A;  3HBR A;  3RXW A;  3N7W A;  1S0W A;  3ZG7 B;  1SKF A;  3W4P A;  2PHY A;  1SKO B;  5M1A A;  4EXO A;  2EWW A;  3E4Q A;  1SCW A;  2Y59 A;  4ZTK A;  5KSH A;  3KO6 A;  2JKG A;  3WS2 A;  3KX0 X;  4N9K A;  1N9B A;  3C8C A;  3HUN A;  4NXE A;  2B18 A;  5A8B A;  3IH9 A;  4U3T A;  3QNB A;  3BRM A;  1MZU A;  4PKY G;  3IHB A;  2ZQ8 A;  2EX6 A;  3T1X A;  2VKS A;  2M7V A;  3UB9 A;  4N92 A;  4NXF A;  4ID4 A;  2A3U A;  3G35 A;  2VLG A;  3AGE A;  4I3I A;  4E04 A;  3DTE A;  1QMF A;  4BEN A;  4OH0 A;  1M40 A;  3N6I A;  4GDB A;  4KQR A;  1TS0 A;  4MCW A;  4ZAM A;  5HAQ A;  4Y0T A;  5HZH A;  5F1G A;  2ZMA A;  5F68 A;  1IYS A;  3C38 A;  4ZBE A;  4C6Y A;  2EXA A;  2W3D A;  3DBA A;  5CXW A;  1F2K A;  3GSG A;  2P08 A;  1BTL A;  3RFB A;  1I2W A;  1STZ A;  2ACG A;  2EXB A;  3UB6 A;  1RCJ A;  3VMA A;  2JE5 A;  3WRZ A;  1E3U D;  3FZC A;  4UHU A;  4JF5 A;  1VQQ A;  1YMX A;  5HW3 A;  4FCF A;  1E25 A;  4E3N A;  1LSV A;  4YFM A;  3G32 A;  3IX4 A;  1KOU A;  1YQS A;  1IEL A;  4G3K A;  4FSF A;  4XXR A;  3DW0 A;  1LL9 A;  3UB5 P;  3BQ8 A;  1K57 A;  5L8M A;  5L2F A;  2VEA A;  4HBU A;  1ODV A;  4GN2 A;  4EES A;  3PAE A;  5EM1 A;  3PAG A;  4WMC D;  2H28 A;  4LRZ E;  3HLW A;  4UA9 A;  2XQZ A;  2DRW A;  3LIF A;  3G2Z A;  3MQO A;  5HWW A;  5CED A;  4OPY A;  4MEZ A;  2DCF A;  2VJW A;  3T12 B;  3IBJ A;  2C6W B;  4GD6 A;  1V9Y A;  3A0V A;  3C5A A;  3FKV A;  1HZO A;  1CF0 A;  4GCZ A;  1MWT A;  4DJ3 A;  3VSK A;  4X6T A;  2ZLY A;  3E4P A;  1I2S A;  2X02 A;  4Q0I A;  4H6J B;  1BLC A;  3IS2 B;  1XGJ A;  5HDS A;  2QJ5 A;  3DWZ A;  3AGD A;  4EV4 A;  3MMH A;  1PW8 A;  3FKW A;  3VE4 A;  5CEC A;  2D02 A;  2Y2K A;  3B42 A;  2LB9 A;  3ZCZ A;  5F82 A;  1RGY A;  2J80 A;  1TF1 A;  4DE2 A;  1EI5 A;  3NY4 A;  4P85 A;  1GHM A;  4GOG A;  3UPP A;  3VV4 A;  2WZX A;  3OPH A;  2EX8 A;  4UA6 A;  3MF0 A;  1LSW A;  1T1B A;  4GB7 A;  3S7Q A;  4GZB A;  4U0X A;  2QMI A;  4A5R A;  3L9K A;  5DKK A;  2XRO A;  3BYD A;  5CTN A;  4B4X A;  4LCM A;  3B33 A;  3DWK A;  4BBV A;  3V3S A;  5FQM A;  2G2W A;  1TDG A;  4O01 A;  2H5S A;  3RXX A;  4MBH A;  3IXG A;  4R1G A;  4HP4 A;  4XT2 A;  5DTT A;  4IJG A;  2VGJ A;  4PM6 A;  1VEU A;  2ZQ9 A;  5E43 A;  1K25 A;  1LT0 A;  4R3J A;  3MXS A;  1IYP A;  1K4E A;  3ITB A;  1E4D A;  2ZQD A;  1Q2Q A;  4EBN A;  2WKQ A;  3BEB A;  3LR4 A;  4EU0 A;  3KSG A;  3LYX A;  2O9C A;  4X56 A;  4IBX A;  2WGI A;  4LGW A;  1OPX A;  2HZ5 A;  3N8L A;  1SDN A;  4OPR A;  4L9E A;  5AQ7 A;  2NUT C;  2ZD8 A;  1DP8 A;  2PT7 A;  5G4Z A;  3T4L A;  2WKH A;  3E0Y A;  2QJ7 A;  1GCE A;  5EFW A;  4FOF A;  1MY8 A;  3CIT A;  4BL2 A;  1W7F A;  3BQA A;  1F98 A;  4LPZ A;  2XDM A;  5TJJ A;  1KVM A;  4CLC E;  4DXC A;  1RGZ A;  1YM1 A;  3SS3 A;  2XRN A;  3VP2 A;  3V39 A;  5EVL A;  1OT9 A;  2OSU A;  2PR5 A;  4OLD A;  4E3O A;  2V2F F;  1HLU P;  3LY3 A;  4KG2 A;  3NUL A;  5EVI A;  3MS6 A;  3TSG A;  1IFQ A;  4MN5 A;  4EET B;  3IF6 C;  3UB7 A;  5EM0 A;  5HWT A;  3NHQ A;  2PRF A;  3S22 A;  1ZKJ A;  5DJT A;  1YAX A;  3M2J A;  5HFO A;  3MR0 A;  4N1H A;  3IWI A;  3IX3 A;  3ZQ5 A;  4DE1 A;  3UMD A;  3LR3 A;  3OBF A;  2GNX A;  5HDD A;  4S2N C;  3HLE A;  5FAO A;  4WZ4 A;  1FIL A;  3L7H A;  2ZMV A;  2VGL S;  4BL3 A;  3S4X A;  3HUM A;  3VP3 A;  3C4O A;  1K0K A;  2L4R A;  5F6A A;  3V67 A;  2NUP C;  1QME A;  2M7U A;  4PM8 A;  2VV8 A;  2XA7 M;  3UE3 A;  5I5L A;  2UWX A;  1VHM A;  3RTY A;  3BLS A;  1KGG A;  1VM1 A;  2OWJ A;  2FFF B;  2KX6 A;  5HD3 A;  1H8Y A;  3H82 B;  4QY6 A;  4PM5 A;  1YT4 A;  4C75 A;  5F83 A;  4GJ4 A;  5F5Y A;  2AVX A;  4MDZ A;  2HJE A;  5FQJ A;  4DN0 A;  3LI9 A;  3T1R A;  1XFN A;  3VFH A;  4KQO A;  4XT2 B;  4EER A;  1JWP A;  4FH2 A;  3LEZ A;  5KSC A;  1VEU B;  4CQH A;  2WZZ A;  1FSW A;  3KSH A;  2Y8H A;  1PI4 A;  3A3I A;  2Q9N A;  1OTA A;  3A3F A;  3HRE A;  1ES3 A;  1DP9 A;  4MBK A;  2XEP A;  4MN7 A;  2W1T A;  3DAV A;  2JBF A;  4HJ6 A;  4OQG A;  3N8S A;  5EOO A;  1KE4 A;  2CC1 A;  1BZA A;  4BQM A;  2R9X A;  3ZHH A;  4GW9 A;  3QP6 A;  2H0T A;  1NLY A;  3QP1 A;  4NET A;  4NG2 A;  5IS1 A;  1XJ6 A;  2O9B A;  3UE6 A;  3GRJ A;  4LLO B;  5CGX A;  3CG5 A;  4JGR A;  5M19 A;  2V1B A;  4ZRR A;  4OON A;  2Y2I A;  2W0N A;  4ETX A;  3IXH A;  3EQU A;  5KMW A;  1FCM A;  2HGV A;  2PR6 A;  5MC7 A;  4JGO A;  3HLC A;  3LIE A;  1NRF A;  3SW1 A;  4KQD A;  1S4S A;  1BUE A;  5FAQ A;  3ZNT A;  1XJ2 A;  2G2U A;  4Y17 A;  2JKF A;  4R4S A;  4S2I A;  1H8Z A;  1PZP A;  1JNU A;  5JYO A;  3PBN A;  2HDQ A;  5A92 A;  1XA1 A;  3O5Y A;  3P7N A;  2W3F A;  3ZG9 B;  2QHK A;  5EVI B;  1P0Z A;  3BY8 A;  1VET A;  1NY0 A;  1MKM A;  3ZDJ A;  3P09 A;  2OV5 A;  1FIK A;  4D2O A;  3C2W A;  4Y15 A;  4B93 A;  2P7J A;  4EWF A;  4S2J A;  2ZM0 A;  4JPM A;  1CEG A;  1ZG4 A;  5HWV A;  2FH5 A;  1ZC2 A;  1N4O A;  1D06 A;  1CI9 A;  4DRT A;  3W4O A;  4JGQ A;  3BEC A;  3EQV A;  5HAI A;  1JTG A;  4WM9 A;  2HJ9 C;  2WKE A;  3GV9 A;  2ZC4 B;  1P97 A;  1YSQ A;  5GL9 A;  4RX3 A;  3BFD A;  4CLC D;  4QU3 A;  1FQG A;  3NOU C;  3Q7Z A;  1FR1 A;  2WGW A;  2GDN A;  1ERQ A;  3LO7 A;  1ZG6 A;  3MSH A;  5FI7 A;  3N4I A;  3MFD A;  3UB8 A;  4UA7 A;  1DRM A;  1W8Y A;  1RP5 A;  2P9V B;  3SS5 A;  3IF6 A;  5DJU A;  1MWR A;  1Z09 A;  2L0W A;  4Y7P A;  1ESI A;  3CUE C;  3ZFZ A;  1H0M A;  3F1N A;  3WS5 A;  2C5W B;  2WAE A;  1Y4O A;  4IVI A;  2KLI A;  5DTS A;  3G6O A;  2K31 A;  2XD5 A;  3OZH A;  4Z1W A;  1O07 A;  3V50 A;  1OTI A;  5J4E A;  3T1Q B;  2W1T B;  2XGN A;  3NEC A;  2VGK A;  5CER A;  2PU2 A;  4QHC A;  2V0W A;  2QZ6 A;  3A3J A;  4OQ0 A;  5EEC A; 
#chains in the Genus database with same CATH homology
 1F9I A;  3MF0 A;  1LSW A;  1T1B A;  3FG8 A;  3S7Q A;  2XSS A;  3LIC A;  3PBO A;  4GS9 A;  4G3V A;  5HSQ A;  5DKK A;  2XRO A;  2I9V A;  3PBR A;  3KYZ A;  2PD7 A;  4BBU A;  4ME4 A;  3B33 A;  4BBV A;  2JKR M;  2ZOH A;  3KSI A;  2FZ0 A;  4O01 A;  3E4O A;  5TBM A;  1LSX A;  2ZOI A;  3W2Z A;  3MJQ A;  3NOP C;  4HP4 A;  4XT2 A;  4IJG A;  4LRY C;  5CX7 A;  2OAQ 1;  2L1M A;  2Z6C A;  5C5K A;  2B02 A;  1N9O A;  4G3W A;  4DMZ A;  1P9R A;  3CAX A;  4HOI A;  1LT0 A;  1GSV A;  1XFQ A;  5HD5 A;  5AVF A;  2J3T C;  2J3W A;  2WKQ A;  3FPW A;  4L9F A;  3LR4 A;  4EU0 A;  3KSG A;  3C30 A;  3LYX A;  2O9C A;  4I3A A;  4K08 A;  1ZHH B;  4IHQ A;  1EW0 A;  4L0L A;  4WF0 A;  3MQ0 A;  1OPX A;  2JKT I;  4BWI A;  4KUK A;  3A0S A;  1OTE A;  5DF9 A;  4BJP A;  4DJ2 A;  4HY8 A;  3TRC A;  4L9E A;  3BWL A;  2PYR A;  1G28 A;  2D01 A;  1H3Q A;  2NUT C;  3U2A A;  1H8M A;  5HPF A;  4GHI A;  1DP8 A;  2PT7 A;  5G4Z A;  3T4L A;  3EGX C;  3E0Y A;  2QJ7 A;  3T4Q A;  3F1O A;  2MJ6 A;  5EFW A;  2IA2 A;  4FOF A;  3CIT A;  1T1C A;  3BW6 A;  1S66 L;  2LB5 A;  5DKL A;  2INW A;  2PD8 A;  2VA0 A;  3BQA A;  4L9G A;  4ETZ A;  1F98 A;  2V0U A;  2PDR A;  4LPZ A;  1DP6 A;  5TJJ A;  3BJN A;  4CLC E;  2QKP A;  2ZBB A;  1T18 A;  2XRN A;  2Z6D A;  4UEY A;  2OWH A;  3HJK A;  4MN6 A;  2VX8 A;  1OT9 A;  3F1P A;  2J3T D;  4EW7 A;  3VOL A;  2PR5 A;  1OTB A;  4EQ1 A;  2ZMF A;  4NKP A;  1P9W A;  1G6O A;  1XJ3 A;  2G7U A;  5AJG A;  4CLC A;  2O9A A;  1Y28 A;  1IFQ A;  4HQA A;  4MN5 A;  4MMN A;  4WN5 A;  4EET B;  3UB7 A;  2JHE A;  3RH8 B;  3D3O A;  5HWT A;  3NHQ A;  1S1Y A;  1OT6 A;  2W3H A;  5DJT A;  3K3D A;  1YAX A;  1UGU A;  3H82 A;  3MR0 A;  4RQ9 A;  4M4X A;  1MC0 A;  3ZQ5 A;  4HIA A;  3UMD A;  3LR3 A;  4Y5F A;  3OBF A;  2GNX A;  4HJ4 A;  3T4S A;  4IUH A;  3T4O A;  5HDD A;  5J3W A;  2ZMV A;  3F1N B;  2HV1 A;  1T19 A;  2YKH A;  3OCL A;  2VGL S;  3EOI A;  3CI6 A;  3LI8 A;  3H7W B;  1F5M A;  2OOL A;  2V9A A;  3ICY A;  3K2N A;  2VV6 A;  4OOM A;  4KUO A;  3OOV A;  1TS7 A;  2L4R A;  5F6A A;  3V67 A;  4R3A A;  3LR0 A;  3D72 A;  2NUP C;  5KIZ A;  3JVV A;  2M7U A;  2GX5 A;  2VV8 A;  2XA7 M;  4I39 A;  3UE3 A;  4EUV A;  5K5B A;  5I5L A;  2GJ3 A;  1V9Z A;  4WEJ A;  4UQI M;  4ARZ A;  3PBT A;  1VHM A;  3TE8 A;  1X0O A;  4GLQ A;  3RTY A;  1OJG A;  3IBR A;  2KOI A;  3LR5 A;  1OJ5 A;  2OWJ A;  3ZYT A;  2KX6 A;  5HPI A;  5HD3 A;  4GS9 B;  3FPV A;  3P01 A;  3H82 B;  4LRX C;  4NEE D;  2V1A A;  2WKP A;  4EEU A;  4II7 A;  1NWZ A;  3KSF A;  2O99 A;  3OCN A;  1S67 L;  4I3J A;  4NXG A;  4I5S A;  4BMW A;  3HJI A;  4GJ4 A;  1UWN X;  2VZW A;  5F5Y A;  1OTD A;  5TBM B;  4IUK A;  4MDZ A;  4F3L A;  2HJE A;  3PXP A;  2CMN A;  4DN0 A;  3LI9 A;  4H6J A;  4HH2 A;  1XFN A;  4KQO A;  4XT2 B;  4EER A;  3IS2 A;  4YWZ A;  4HI4 A;  1GSX A;  1D7E A;  1S4R A;  3CUE A;  4CQH A;  4HNB A;  3KSH A;  2Y8H A;  1N9L A;  2JN7 A;  3R7W A;  1OTA A;  3T4T A;  5AVE A;  4WLA A;  4EEP A;  2A24 A;  3LID A;  5LBR A;  1DP9 A;  4MN7 A;  2PHY A;  4EXO A;  2EWW A;  4P6Z M;  3E4Q A;  3OC2 A;  1LL8 A;  2W1T A;  5KSH A;  4QPR A;  2W3E A;  4HJ6 A;  5HDC A;  3KO6 A;  4Y2F A;  3KX0 X;  4JGP A;  1W63 Q;  2JKT M;  3ULF A;  3CLO A;  2A2L A;  3OLO A;  1N9N A;  2W27 A;  4GW9 A;  4F3L B;  1NLY A;  3C8C A;  5IS1 A;  4R38 A;  1XJ6 A;  2O9B A;  3UE6 A;  4NXE A;  4LLO B;  2QYB A;  2B18 A;  5A8B A;  4JGR A;  4GHI B;  3HCY A;  1MZU A;  4PKY G;  5IT5 A;  2V1B A;  4ZRR A;  4AFI A;  4O8G A;  2BAS A;  2W0N A;  3F1O B;  4HHD A;  3S7N A;  2JKR I;  4BBT A;  4ETX A;  1TS6 A;  3EEA A;  3EQU A;  5MC7 A;  2PR6 A;  2HGV A;  2VKS A;  2M7V A;  3UB9 A;  4JGO A;  4NXF A;  2VV7 A;  2O0Y A;  1NRJ A;  2VLG A;  4I3I A;  4E04 A;  4WEK A;  3LIE A;  3SW1 A;  4KQD A;  1S4S A;  1TS0 A;  4MCW A;  5HZH A;  5F68 A;  1XJ2 A;  2YKF A;  3F1P B;  4UQI S;  3C38 A;  3NJA A;  4HH3 A;  2W3D A;  1IOU A;  3DBA A;  1JNU A;  4CLC C;  2EWV A;  3VE3 A;  4R70 A;  3GEC A;  3PBN A;  2P08 A;  3O5Y A;  3P7N A;  2W3F A;  3RFB A;  2QHK A;  4Q0H A;  4CLC B;  3EWK A;  1P0Z A;  3BY8 A;  1UWP X;  1STZ A;  1MKM A;  3UB6 A;  1BYW A;  2HF6 A;  3K3C A;  3PBS A;  5DFY A;  1VB6 A;  2GZA A;  2K7S A;  3C2W A;  3LIB A;  4PHT A;  4WEL A;  4OOL A;  4B93 A;  2P7J A;  2W3G A;  1YKD A;  3PR6 A;  4YNR A;  2KDK A;  2PYP A;  3MFX A;  3MQQ A;  1XJ4 A;  3EGD C;  4PKY A;  4R6L A;  2VGL M;  1LSV A;  4NXB A;  5HWV A;  1GSW A;  2EA9 A;  2FH5 A;  2QWS A;  3T4J A;  1KOU A;  1D06 A;  3S7O A;  4G3K A;  2K2N A;  4FSF A;  2R78 A;  5FL3 A;  5DFX A;  3PHY A;  4JGQ A;  1YSP A;  3BQ8 A;  5G4Y A;  5L8M A;  2VEA A;  3EQV A;  3TW8 A;  2M1C A;  4O0P A;  2HJ9 C;  1ODV A;  3B47 A;  4EES A;  4P6Z S;  2H28 A;  4LRZ E;  4ARZ B;  4Q0J A;  5F69 A;  1P97 A;  1YSQ A;  3LIF A;  2OAP 1;  3A0R A;  4CLC D;  3EEH A;  3LFV A;  3MQO A;  2P04 A;  3NOU C;  5HWW A;  4HJ3 A;  1ZTU A;  3LIA A;  2VJW A;  5HL6 A;  3IBJ A;  3T4K A;  5IU1 A;  1V9Y A;  3A0V A;  3JVU A;  3E98 A;  4I38 A;  1S1Z A;  4GCZ A;  3S7P A;  3UB8 A;  1DRM A;  3H9W A;  3FC7 A;  3R4K A;  4DJ3 A;  5J7E A;  1WA9 A;  2DMW A;  3LUQ A;  5DJU A;  1T1A A;  3E4P A;  4Q0I A;  3BY9 A;  3KYQ A;  4H6J B;  2L0W A;  3PBQ A;  3CUE C;  3IS2 B;  4B9O A;  1TS8 A;  3UME A;  1TD5 A;  3TJZ C;  4WUJ A;  3NOT C;  5HDS A;  2QJ5 A;  3PYP A;  3CWF A;  3F1N A;  3MMH A;  1W63 M;  3VE4 A;  2W1R A;  2KLI A;  3H7W A;  3R7W B;  2D02 A;  3B42 A;  3G6O A;  2K31 A;  2LB9 A;  2A24 B;  2WKR A;  1NLZ A;  4PAU A;  4Z1W A;  3GDI A;  3T50 A;  2J80 A;  4WL9 A;  1OTI A;  5J4E A;  3MXQ A;  1TF1 A;  2W1T B;  4HP9 A;  4YOF A;  2Y79 A;  2V0W A;  2XA7 S;  4Y3I A;  3VV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...