5HWVA

Crystal structure of pas1 complexed with toluene
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
ALYEFVGLLDAHGNVLEVNQVALEGGGITMEEIRGKPFWKARWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGREVIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAMLALKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase TodS
publication title Molecular Insights into Toluene Sensing in the TodS/TodT Signal Transduction System.
pubmed doi rcsb
source organism Pseudomonas putida (strain f1 / atcc 700007)
molecule tags Transferase
total genus 36
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hwvA00
2WKQA 2QWSA 2JN7A 2YKFA 4KUKA 3F1OB 3UE6A 1OTEA 1V9ZA 2PYRA 4BBUA 2QJ7A 5HSQA 3ZQ5A 2QJ5A 1UGUA 3G6OA 4HJ3A 3LIBA 4I3AA 2M1CA 4LLOB 1G28A 2ZBBA 1OTBA 4HNBA 4I38A 1T1AA 2BASA 3LIAA 2ZOHA 1T1CA 2VLGA 5F68A 2KX6A 1XFNA 2W27A 4EQ1A 4PKYA 1XJ3A 5J7EA 3VE4A 4EEPA 4HH3A 4L9EA 1OTAA 1S4SA 1S4RA 1OJGA 3IS2B 4LRYC 5KIZA 3UMDA 4YWZA 1P97A 4LPZA 2QKPA 4HQAA 4KQDA 1MZUA 5HWWA 3LICA 3D72A 1N9OA 4EETB 3NHQA 4DJ3A 2D02A 3F1NB 1D06A 3H9WA 4GHIA 3SW1A 2ZOIA 4L9FA 1LSWA 4WLAA 4MN5A 5G4YA 2WKRA 4I39A 3VOLA 2Z6DA 5F69A 3MQOA 1DP8A 4HHDA 2YKHA 5HWVA 2EA9A 1ODVA 3HJIA 4BBVA 4HP4A 3LIFA 3MXQA 4K08A 1GSWA 1S66L 3H7WB 5J3WA 4WN5A 1BYWA 1N9LA 1OTDA 4KUOA 4MN6A 2L0WA 1GSVA 1DP9A 4XT2B 1XJ4A 2K7SA 4WUJA 2B02A 1JNUA 1TS6A 3K3CA 3PYPA 4JGRA 3FG8A 3H7WA 5HZHA 1D7EA 2OOLA 3KX0X 4HP9A 1XJ2A 4L9GA 3UB6A 4I3IA 2INWA 3UMEA 5DKLA 2HV1A 2CMNA 2R78A 1NWZA 3E4PA 2L1MA 3UB9A 3A0SA 3F1PA 3MJQA 4EXOA 4GHIB 3BWLA 3LUQA 2QHKA 2A24A 1X0OA 2KDKA 4XT2A 5HDDA 4DJ2A 1S1ZA 2L4RA 2PR5A 5DKKA 3MQQA 3LI8A 5F5YA 4F3LA 3EEHA 1EW0A 1OTIA 1T1BA 1LSVA 5F6AA 2I9VA 1GSXA 3UB7A 1WA9A 2D01A 1OT6A 2V0UA 4H6JA 5TBMA 5AVEA 3HJKA 4BBTA 3A0RA 4NXBA 2V1AA 1N9NA 3RH8B 2OWHA 1Y28A 2Z6CA 3B33A 4NXGA 3CLOA 1TS0A 5HDCA 5DJTA 5A8BA 3LYXA 5J4EA 5HDSA 4GW9A 5IS1A 4HY8A 4R6LA 1UWPX 4NXEA 3IBRA 1TS7A 1S67L 3VE3A 4R38A 2PYPA 4RQ9A 3NOUC 3F1PB 3MFXA 4I5SA 4M4XA 4HIAA 2VV6A 2A24B 1T19A 3LIDA 4EESA 1LL8A 4EW7A 3LI9A 3T50A 3BY9A 1OJ5A 2GJ3A 1LT0A 2PHYA 4JGQA 4F3LB 4JGPA 1UWNX 4WF0A 4R70A 1DRMA 4HH2A 5IU1A 1F98A 4LRZE 5HD5A 5I5LA 3A0VA 3C8CA 3BY8A 4EERA 4R3AA 4H6JB 5TBMB 4GS9A 2J80A 4NXFA 5G4ZA 3MR0A 1P0ZA 3NOPC 1V9YA 2WKPA 4HJ6A 1TS8A 3FC7A 3GDIA 3CWFA 4WL9A 5AVFA 5DJUA 3NJAA 2OWJA 3F1OA 1KOUA 4E04A 1T18A 2PD7A 4I3JA 2W0NA 5HWTA 2H28A 4HI4A 3RTYA 2VEAA 1VB6A 2PDRA 1OT9A 1LSXA 4PKYG 4HJ4A 2VV8A 3NOTC 3PHYA 3H82B 4EEUA 4B9OA 1F9IA 3OLOA 2PD8A 2P7JA 1DP6A 3K3DA 2VV7A 4JGOA 2JHEA 3GECA 1XFQA 2PR6A 3E4QA 5EFWA 3IS2A 4GCZA 2V1BA 3C2WA 4GS9B 2V9AA 3ULFA 3LIEA 3H82A 1S1YA 3CAXA 3F1NA 1XJ6A 4LRXC 3ICYA 3P7NA 5HD3A 3UB8A 3EWKA 3E4OA 2V0WA 4HOIA
chains in the Genus database with same CATH superfamily
4WBGA 3LY4A 1BLHA 1G6OA 3BM6A 2VA0A 1FCMA 5FQKA 3JYIA 3WS2A 1STZA 5GHXA 4BBUA 3CHWP 2ZMFA 4WMCA 3HREA 1KVLA 2W1TA 3IH9A 5HSQA 3N8LA 4OKPA 2QJ5A 4HBTA 4HJ3A 4KZ6A 2M1CA 3BFCA 1G28A 1GHMA 2ZBBA 2JKRM 1L0FA 2WZXA 1ACFA 1NLZA 1YMSA 2BASA 4X53A 2ZOHA 1T1CA 2VLGA 2W27A 4EQ1A 2G2UA 4MLLA 2JKFA 3A3EA 4EEPA 2LB9A 4KZBA 1ZKJA 1MKMA 4JXWA 3BYDA 1OTAA 2P74A 1P9WA 4G3KA 2QMIA 4BJPA 4CLCB 4WM9A 1W8QA 2X71A 1G68A 4LRYC 2V2FF 3G4PA 1MY8A 4LPZA 1I2WA 4EETB 3NHQA 1W79A 4DJ3A 3W4PA 1MC0A 2OV5A 4GHIA 1NRJA 3S7PA 1YM1A 2ZD8A 2FFFB 3MSHA 3HCYA 4UHUA 4OQIA 3MZEA 4I39A 3T4JA 1Z09A 2Z6DA 1SHVA 2ZQDA 3LEZA 3MQOA 1DP8A 1ZG6A 1BT5A 3EGDC 3BRMA 5HWVA 1WYCA 1NYMA 1ODVA 4FUWA 2IWCA 5JYOA 4HP4A 1FCNA 3NDGA 5J3WA 3GV9A 2P9VA 3A3DA 1PRQA 1GHPA 3CG5A 2EXAA 3VP1A 1IYQA 4EQIA 3OCNA 1N4OA 3W4QA 1ALQA 2X02A 4S2LA 2Y2NA 3N4IA 2XA7S 4EWFA 3M2KA 1J9MA 5HW3A 4DE2A 5F83A 4HESA 4AFIA 3C4PA 3KSGA 5FASA 1OMEA 1PWCA 1FIKA 4E3MA 5E2EA 4NK3A 5HZHA 4OOMA 4HP9A 1NLYA 4YINA 5FEFA 2CC1A 3UB6A 2INWA 4P87A 5DKLA 3SH8A 3MXSA 1MWTA 2L1MA 1Q2QA 3MJQA 1JWVA 3BWLA 4GOGA 2QHKA 2W3GA 2A24A 2IWBA 1MXOA 2RL3A 3T4QA 2H0TA 2JKTM 2NUPC 2Q9NA 2G7UA 4DJ2A 2WUQA 1S1ZA 2A49A 2L4RA 4ZRRA 3O3VA 3V39A 4G3WA 1BTLA 1OTIA 3R4KA 4X56A 3UDFA 1W63Q 3B3XA 4CLCD 3OZHA 3UB7A 3CPTA 1WA9A 2Y55A 3Q1FA 2D01A 2J3WA 3Q07A 2JKTI 4IBRA 2W1RA 3A0RA 5CTMA 3ZG7B 2J7VA 3RH8B 3BECA 3QP5A 5FQQA 5KSHA 1FR6A 3IH8A 2W3FA 1M6KA 4NXGA 1KGEA 1SDEA 3CLOA 1TS0A 5FAQA 5A8BA 3BFDA 3AGFA 1BLSA 2ZM2A 5EOOA 2G2WA 1SKOB 3G2YA 2VKSA 4S2NC 1KE0A 3N8SA 4GW9A 4JKTA 3WS5A 2WKHA 4HY8A 3TW8A 4DXCA 3CITA 4WYYA 2XEPA 3GVBA 3IBRA 5EM1A 5CERA 3VE3A 4HBUA 2ZC7A 3F1PB 3OPHA 4M4XA 4HIAA 3V5MA 3RJUA 4PPRA 5GHYA 4Y7PA 1LL8A 5I94A 2Y2IA 1GCEA 4R3JA 2GJ3A 1FOFA 1S6RA 4L0LA 1CEGA 2J9OA 2PHYA 4JGQA 4Z1WA 4QY6A 5L10A 2PRFA 3MZDA 1XA1A 1PNEA 3FZCA 5CRFA 1DRMA 1F98A 3DWKA 5I5LA 5GLDA 1I2SA 3C8CA 2XK1A 4II7A 5TBMB 4GS9A 4P6BA 1P0ZA 5TJJA 3BLSA 3NOPC 4KZ9A 3R7WB 2Y2QA 1TDLA 4UA7A 4HJ6A 1ZC2A 1VM1A 4WELA 4WL9A 5DJUA 1K4FA 1RP5A 3MZFA 3P01A 1JTGA 4GLQA 4OPYA 5A90A 3NULA 2OWJA 5MC7A 4D60A 4B4ZA 3NC8A 1CK3A 1CF0A 5E43A 1K6RA 3PBNA 1M40A 3RTYA 1K6SA 2VK3A 1G6AA 1VB6A 4R23A 2J3TC 2V20A 1BZAA 1U60A 3ITAA 2HDSA 3A3FA 4OOLA 2ZC3B 4HJ4A 3NOTC 4B9OA 3O87A 5TFQA 5CECA 2WAFA 2Z2LB 3S7QA 2PBYA 2BLSA 3Q7VB 4XUZA 4KZAA 3SOIA 3GECA 1EI5A 4DDYA 1K56A 5HX9A 1L0GA 2HDRA 4RYEA 3RXWA 3C2WA 1S0WA 4GJ4A 5U47A 3N6IA 1AWIA 3S7OA 1PWDA 1VEUA 4KQOA 4Q0HA 2H5SA 2WAEA 4PM8A 5CXWA 1VQQA 1YLTA 2EX8A 3E4OA 2V0WA 3CZDA 5L8MA 4E3JA 5FQIA 1ONHA 4KUKA 4K0XA 4U0XA 3UE6A 1ESIA 3AGDA 4RX2A 1OTEA 2PYRA 2QJ7A 3OPRA 4Y3IA 1YT4A 4Q0JA 1PIOA 3G6OA 3LIBA 4LLOB 3T1QB 3O5YA 4E3OA 4JF4A 5HFOA 4KENB 2Y2OA 1ESUA 3GTCA 4BL2A 2ZQ8A 4C3QA 1MKIA 4QY5A 2R9XA 1XFNA 3NCKA 4P85A 1PI4A 3L7HA 2EX2A 2Y2HA 3IF6A 3FPVA 4S2NA 5F82A 3UO9A 1S4SA 3SZTA 1S4RA 5KSCA 3EGXC 5FAOA 3UMDA 3WRTA 4YWZA 4KQDA 1MZUA 5EECA 2V1ZA 3IWOA 3ZG9B 2D02A 1YSPA 2C6WB 2HJEA 4BENA 1IKGA 4E6WA 3KYQA 4DXBA 4NEED 1XX2A 4EUVA 1DJCA 4WLAA 2PU2A 4Y13A 1KE3A 4ESPA 1O07A 5EVLA 4BD0A 5EVEA 3U2AA 4HHDA 1Y54A 3UY6A 2LB5A 3ZG0A 2W1TB 2YKHA 2JE5A 5F1GA 1K54C 3MXQA 3BEBA 3G30A 1MBLA 3HLDA 4XUXA 1GHIA 1ZHHB 2EXBA 4IBXA 1N9LA 2O0YA 2XF3A 2Y2KA 4MEZA 4LCLA 2WGWA 2ZC4B 4FH2A 5E2HA 2XFTA 4UAAA 4C75A 5CEDA 2FH5A 3SH7A 1DP9A 4Y0OA 4KG5A 4KZ7A 3C7VA 3IX3A 3CJMA 5AQ7A 4GDNA 2ZQ7A 1KDSA 2ZMVA 1E3UD 3K3CA 4QPRA 2GNXA 1XJ2A 4I3IA 3TSGA 2VGKA 3S7NA 3T4LA 2BG1A 1YMXA 3UB9A 4GNUA 5FDSA 3U4LP 5BOHA 4GHIB 3NIAA 2DNSA 1SDNA 3IX8A 2MJ6A 5FA7A 4QU3A 3FKWA 3HLCA 4OH0A 4ETXA 2AVXA 4KZ3A 5HAQA 5DKKA 1IOUA 3MQQA 2OLVA 2Z2MB 3LY3A 4F3LA 5FQJA 3EEHA 3S4XA 1EW0A 3C7UA 3IXBA 1GSXA 2IWDA 2WADA 3QNCA 1LL9A 2P9VB 3TE8A 3M6BA 3WRZA 1IELA 3L9KA 3HL9A 1VHMA 4Y0UA 3ZCZA 1MWUA 2V1AA 4ID4A 4A5RA 3Q7ZA 1KGFA 4LENA 1ES5A 4Y0TA 5L2FA 2OWHA 3JVVA 3PAEA 3KSIA 3V67A 3BLMA 4LV0A 5GL9A 3MQ0A 5DJTA 3I7JA 3D3OA 1BLPA 5J8XA 5FAPA 1FSWA 2ZLYA 1LL5A 3BJNA 4KZ4A 5FDHA 4R6LA 4U3TA 4WMCD 2EFXA 2EWWA 4NXEA 1ES4A 4MCWA 5L09A 3E0YA 4N9LA 2J3TD 3EQUA 1YAXA 5DF7A 2C5WB 1NZUA 5FI2A 3ZG5A 1XPBA 1K38A 2A24B 1T19A 1SKFA 3M6HA 1XGIA 3CUEA 2XD5A 2HPBA 4R4SA 4R3BA 3HLGA 3LI9A 3T50A 1OJ5A 3WS1A 4P6ZM 2Y2LA 4FD8A 4MDZA 1HLUP 4R70A 2DMWA 2BTFP 3LFVA 2GZAA 4LRZE 1W63M 2JCHA 3CPTB 2KLIA 3WWXA 4BQMA 5HL6A 5CHUA 4R3AA 5C5KA 4DE1A 5IHVA 3KYZA 4QB8A 5EVIA 5G4ZA 3MR0A 3K2NA 4JBFA 4IUKA 4PMAA 3UDIA 2H0YA 3LEQA 5DFYA 1TS8A 4C6YA 1BUEA 2VJWA 1BSGA 3UDXA 1K4EA 3SS3A 3FV7A 5HAIA 4PAUA 3F1OA 2JC7A 2ZJ9A 4GN2A 2P08A 4I3JA 2H10A 1K54A 4JF5A 4WZ4A 2H28A 4PM7A 2ZQ9A 3VSKA 1TD5A 3S1YA 1ES3A 1O7EA 3VP2A 2A2LA 1LSXA 2E8IA 5DFXA 2VV8A 1IEMA 3LCEA 4OONA 2P04A 2Q0OA 4HEFA 3IT9A 2VGJA 4IJGA 1SCWA 2Y2JA 2P7JA 1DP6A 5K5BA 4Q8IA 3ITBA 4EBLA 3A3JA 3IF6C 4JGOA 2JHEA 4WZ5A 1IFQA 2ZC6B 3EOIA 4N1HA 2J9PA 1YLZA 2PR6A 1W7FA 3T1SA 5A93A 4NG2A 1K55A 3IS2A 4GCZA 3ZG8B 3UPPA 1RGZA 5CGXA 4GS9B 3V50A 2V9AA 3UE3A 3MKFA 4E3LA 5KZHA 3ISGA 4Z9QA 4R1GA 3F1NA 2WZZA 1XJ6A 4LV2A 5HD3A 3SH9A 3Q81A 2ZMAA 3EWKA 3QP6A 4S2MA 3T4KA 2DCFA 5EE8A 3GRJA 2JN7A 3IWIA 4QD4A 2K2NA 3UPNA 3MS6A 1V9ZA 3B42A 4JPMA 3VP3A 4KZ8A 1LLBA 1MWSA 4X1LA 2O9CA 1UGUA 3O88A 4I3AA 3ZVWA 4OPQA 2XD1A 1OTBA 4JXSA 4HNBA 4ZTKA 1E4DA 4R0QA 1T1AA 4ARZA 4MN7A 1SZVA 5E2GA 3UN7A 4X69A 3IHAA 4P6ZS 2KX6A 1YKDA 1XJ3A 1ONGA 3VE4A 4HH3A 4QHCA 4NETA 2GX5A 3OPLA 4ZJ2A 4DRTA 4L9EA 2EX6A 1DY6A 4X6TA 5FEGA 4IEDA 2QKPA 4HQAA 5A92A 3VP4A 5HWWA 3LICA 3D72A 4DF6A 1N9OA 1VEUB 3HLEA 4EBPA 1CEFA 5EV0A 3C38A 1H8YA 3PBQA 3SW1A 4L9FA 3VMAA 2ZL1A 1XA7A 2WK0A 1ZTUA 4LGWA 4Y17A 3AGEA 4MN5A 5G4YA 2HDQA 2W3HA 2ZQAA 4B88A 1PWGA 1KVMA 3WS4A 3IQAA 1KGGA 4B93A 1QMEA 4IUHA 4OLGA 3FPWA 4BBVA 3LIFA 4PM6A 4X25A 4DN0A 3H7WB 3HUMA 4OQGA 3SS4A 3QP8A 4E6XA 1H8MA 5HPFA 2O9BA 4KUOA 5DF9A 1K25A 1BULA 4Q0IA 4LV3A 5HARA 3P98A 1QMFA 3OCLA 1GSVA 3IF6B 3OPPA 5GLCA 3WS0A 1L2SA 1IYPA 1JWPA 1XJ4A 3MKEA 2K7SA 1K57A 2XLNA 2UWXA 5M1AA 4OPRA 1PZPA 2B02A 1JNUA 3SS5A 2V8FA 1TS6A 3DAVA 4JGRA 3H7WA 4E3KA 1D7EA 3VFFA 3KX0X 4G3VA 3E98A 4ME4A 2HP5A 2Y59A 5CHJA 1FSYA 2R78A 4WEJA 4E3NA 3GMWA 3A0SA 1PW1A 4EXOA 4EUZA 4FCFA 3HUNA 4UEYA 3HLBA 1FILA 3LUQA 4XXRA 5FL3A 3TG9A 1BLCA 2W3DA 3BQ8A 3CUEC 1X0OA 2KDKA 5HDDA 2DRWA 3UE1A 1IYOA 5M18A 4ZAMA 3O86A 2R9WA 3IF5A 5CHMA 1DJBA 4KG6A 4ZJ3A 3LI8A 3VV4A 4M3KA 3NBLA 3QNBA 1LSVA 3N7WA 1K56D 4H6JA 3G32A 5EVIC 2Y79A 2WGWB 4BBTA 4BMWA 3IX4A 4X68A 1N9NA 3A3IA 2HP6A 3QHYA 1TDGA 4UA6A 3ZGAB 4LCMA 4E3IA 3MXRA 3ZYTA 4O01A 5HDCA 3RXXA 3E2LA 5J4EA 3NI9A 2Y2PA 2OSUA 3OC2A 3BFFA 1RCJA 4GKUA 2PU4A 3VP0A 5IS1A 1UWPX 1YLWA 2HP9A 1E25A 2XQZA 1TF1A 4KQQA 2QPNA 3CI6A 4R38A 1PYYA 2PAVP 5TGFA 3HVFA 2PYPA 4RQ9A 3LR3A 3MFXA 4I5SA 4FTXA 1XP4A 3LIDA 1CI9A 4K0WA 4EW7A 2HDUA 3BY9A 1ERMA 3ZNYA 4IVKA 3DW0A 4MBHA 4F3LB 3PBTA 4WZ5C 3PAGA 4JGPA 5DTKA 1I5QA 4HH2A 3B47A 4GDBA 3BFGA 5IU1A 4JLFA 4N92A 3ZVTA 1K55C 1PZOA 3BY8A 5LBRA 5EOEA 2J80A 4NXFA 1YQSA 2Y2GA 5CGWA 1V9YA 1FR1A 3ZFZA 2EFUA 3FC7A 3GDIA 3CWFA 4S2OA 4GD8A 3QP2A 4QWOA 5EUAA 2QYBA 3TRCA 3DTMA 1TEMA 4E04A 1FQGA 1T18A 1XXMA 5DF8A 4HI4A 4RVAA 1GA9A 1J3WA 2OLUA 2QZ6A 2JKRI 3FKVA 3G35A 4KQRA 2XROA 4ZDXA 4BD1A 4DDSA 2VGLM 3BW6A 2HF6A 2WKIA 1OT9A 2JKGA 4PKYG 1YLPA 3NECA 3LR4A 3PBRA 3PHYA 3IWQA 1YLYA 5HL1A 3MMHA 3OLOA 3LGOA 2PD8A 3QP1A 3OOVA 3K3DA 4ZBEA 5AJGA 2FZ0A 5TR7A 1CJFA 4CPKA 4CLCA 1XFQA 3E4QA 4OP8A 3IXGA 3EQVA 4JXGA 2HZ5A 4CQHA 4S2IA 2V1BA 4DE3A 4PM5A 2O99A 1IKIA 5AQAA 3ULFA 5EVIB 3LIEA 4IVIA 4X1MA 2M7VA 3CAXA 3RFBA 3LO7A 3ICYA 3P7NA 1EWZA 5F1FA 2K31A 3NDEA 4GD6A 4UA9A 2WKQA 2QWSA 1H8ZA 1CQAA 2YKFA 3F1OB 1H5XA 3NY4A 3D9YA 5FSRA 3TJZC 1ERQA 2VX8A 2EWVA 2V8CA 5EM0A 3ZQ5A 4FSFA 3N8RA 4EBNA 4I38A 3T4TA 1Z6FA 3LIAA 3UNWA 5F68A 2WKEA 4YFMA 3E2KA 4N1XA 4PKYA 2JBFA 2A3UA 5J7EA 1NYYA 4S2PA 3C5AA 2X01A 4BLMA 2I72A 1WE4A 3D4FA 3GQZA 1LHYA 1K57C 3ZNTA 1XGJA 1OJGA 3IS2B 3KSHA 5KIZA 3P09A 1P97A 2XFSA 1OPXA 1F2KA 4IHQA 4Y2FA 2WYXA 2UV0E 4PHTA 5E2FA 3T1RA 3F1NB 1D06A 1VETB 1RGYA 4F94A 2WGVA 4MMNA 3H9WA 2ZOIA 3Q82A 2W3EA 1LSWA 1NZOA 5G18A 4O7DA 3T4SA 1N9BA 3MFDA 2WKRA 1Q2PA 2XRNA 3HUOA 4DMZA 3VOLA 2Y8HA 5F69A 1XKZA 2VGLS 5GHZA 2FFYA 3ZHHA 2EA9A 3HJIA 4KG2A 3DTEA 1HTZA 5HPIA 3HBRA 4K08A 1GSWA 1S66L 1D1JA 4WN5A 2ZM8A 4WEKA 2XSSA 1PFLA 1BYWA 1VETA 1OTDA 4ARZB 5FI7A 4EU0A 3DBAA 1WYBA 2Q9MA 5EVID 4MN6A 4O8GA 2L0WA 4OOYA 4JF6A 3VSLA 2J8YA 4K91A 1L3LA 1ES2A 3FWLA 4P0MA 4XT2B 1F5MA 5DTTA 3PTEA 1MWRA 2O9AA 1MPLA 2XGNA 1SKOA 4WUJA 3UPOA 5AQ9A 3PBOA 3PYPA 4B4XA 4CJNA 3FG8A 4CLCE 2OOLA 3C30A 1GA0A 1AXBA 4L9GA 4D2OA 2EX9A 2B18A 3UMEA 2HV1A 1Y4OA 2CMNA 1NWZA 3E4PA 4MBKA 4S2KA 3LR5A 1ZG4A 3F1PA 3M2JA 4BL3A 2VZWA 5HAPA 4Y5FA 3W4OA 4DKIA 5GLAA 3S22A 4FOFA 2ZL1B 4XT2A 1JWZA 3G2ZA 3VOZA 4NKPA 2PR5A 3DWZA 3KO6A 5F5YA 4H8RA 4UQIM 3T12B 5CTNA 1HZOA 1T1BA 4YOFA 5F6AA 2I9VA 5EPHA 2NUTC 1DJAA 4MBFA 2B95A 1A0KA 1OT6A 2V0UA 5TBMA 5AVEA 1JTDA 3HJKA 4RA7A 4NXBA 3R7WA 4OQ0A 1KDWA 1LI9A 1K0KA 4OLDA 2Y91A 1Y28A 5L07A 2Z6CA 3B33A 1H3QA 2PBDP 5AQBA 2ACGA 3CMZA 3EEAA 1NXYA 3VOYA 1HVBA 5FI6A 2PT7A 3PBSA 2HGVA 5JYPA 1L0DA 3LYXA 5HDSA 4FH4A 3VFHA 4O0PA 5D3OA 4S2JA 4R4RA 3T4OA 4BWIA 3ZDJA 3G34A 4DE0A 3IBJA 5CGSA 2IA2A 1L0EA 1NRFA 2XH9A 5A91A 1TS7A 1S67L 4N9KA 4OVDA 1W5DA 1CI8A 5CEBA 3NOUC 3GR2A 1HD8A 3BQAA 2VV6A 3JPUA 1H0MA 4EESA 5KMWA 3Q7VA 3W2ZA 1LT0A 5DVAA 2KOIA 2M7UA 1UWNX 4WF0A 3UE0A 4JXVA 2RCXA 4CLCC 3V3RA 1P9RA 2XR0A 3LR0A 2ZQCA 5HD5A 1FCOA 4OQHA 3A0VA 4PM9A 2OAQ1 2ZM0A 2GDNA 4EERA 4H6JB 3GSGA 3QP4A 3IXHA 1W8YA 3OBFA 1C3BA 4Y15A 3UB5P 2WKPA 1YPRA 2HJ9C 5FQ9A 1KE4A 5AVFA 1IYSA 5CX7A 3NJAA 5IT5A 3IXDA 4ZJ1A 2B5RA 4MNRA 3DTIA 1TVFA 1YSQA 4LFUA 3V3SA 1E3UA 1KOUA 2PD7A 2W0NA 5HWTA 3PXPA 5GLBA 4LV1A 2VEAA 2OAP1 1NJ4A 3BFEA 2PDRA 4OPZA 5FATA 4X55A 1EROA 1PI5A 3H82B 3HLFA 4EEUA 4RX3A 3KYEA 1F9IA 3DTKA 4ETZA 2E8JA 4UQIS 2WGIA 3JVUA 2VV7A 4U0TA 4QJGA 4OP5A 4EV4A 3KSFA 5FQMA 2XA7M 1PW8A 2Y4AA 2XDMA 2ZC5B 1YLJA 3W8KA 1JVJA 5EFWA 3MF0A 3C4OA 1LI0A 5DTSA 1NY0A 4YNRA 3FYZA 3PR6A 4KZ5A 3T1XA 3MBZA 3H82A 1G5UA 1S1YA 3IHBA 3TOIA 4GZBA 4LRXC 2Y2MA 3UB8A 5M19A 3G31A 4GB7A 3HLWA 4HOIA
chains in the Genus database with same CATH topology
2WKQA 2QWSA 2JN7A 2YKFA 4KUKA 3F1OB 2K2NA 3UE6A 1G6OA 2VA0A 1OTEA 3TJZC 2VX8A 1V9ZA 1STZA 2PYRA 3B42A 4BBUA 2QJ7A 2ZMFA 2EWVA 2W1TA 5HSQA 3ZQ5A 2QJ5A 4Y3IA 4Q0JA 2O9CA 1UGUA 3G6OA 4HJ3A 3LIBA 4I3AA 2M1CA 4FSFA 4LLOB 3O5YA 1G28A 2ZBBA 2JKRM 1OTBA 4HNBA 4I38A 3T4TA 1T1AA 1NLZA 4ARZA 2BASA 3LIAA 4MN7A 2ZOHA 1T1CA 2VLGA 5F68A 4P6ZS 2KX6A 1XFNA 1YKDA 2W27A 4EQ1A 4PKYA 1XJ3A 5J7EA 3VE4A 4EEPA 2LB9A 4HH3A 3FPVA 2GX5A 4L9EA 1MKMA 1OTAA 1S4SA 1P9WA 4G3KA 4BJPA 4CLCB 1S4RA 1OJGA 3EGXC 3IS2B 4LRYC 3KSHA 5KIZA 3UMDA 4YWZA 1P97A 4LPZA 2QKPA 4HQAA 4KQDA 1MZUA 5HWWA 3LICA 3D72A 1OPXA 1N9OA 4EETB 3NHQA 4DJ3A 4IHQA 4Y2FA 2D02A 4PHTA 3C38A 3F1NB 1YSPA 1D06A 1MC0A 2HJEA 4MMNA 3H9WA 4GHIA 3KYQA 3PBQA 3SW1A 1NRJA 4NEED 2ZOIA 4L9FA 2W3EA 4EUVA 3S7PA 1LSWA 4WLAA 1ZTUA 4MN5A 3HCYA 5G4YA 3T4SA 2WKRA 2XRNA 2W3HA 4I39A 4DMZA 3VOLA 3T4JA 2Z6DA 2Y8HA 5F69A 3MQOA 1DP8A 4HHDA 3U2AA 2LB5A 2W1TB 2YKHA 3EGDC 2VGLS 5HWVA 2EA9A 4B93A 1ODVA 3HJIA 4IUHA 3FPWA 4BBVA 5HPIA 4HP4A 3LIFA 3MXQA 4DN0A 4K08A 1GSWA 1S66L 3H7WB 5J3WA 4WN5A 1ZHHB 4WEKA 1H8MA 2XSSA 1BYWA 1N9LA 2O0YA 5HPFA 2O9BA 1OTDA 4ARZB 4KUOA 4EU0A 3OCNA 3DBAA 5DF9A 4MN6A 4O8GA 2L0WA 4Q0IA 2XA7S 3OCLA 2FH5A 1GSVA 1DP9A 4XT2B 1F5MA 4AFIA 3KSGA 1XJ4A 2K7SA 2O9AA 4WUJA 2ZMVA 2B02A 1JNUA 3PBOA 1TS6A 3K3CA 3PYPA 4JGRA 3FG8A 3H7WA 4CLCE 5HZHA 4QPRA 1D7EA 2OOLA 3KX0X 4G3VA 2GNXA 1NLYA 3C30A 3E98A 4HP9A 4OOMA 1XJ2A 4L9GA 3UB6A 4ME4A 4I3IA 2INWA 2B18A 3UMEA 5DKLA 2HV1A 2CMNA 2R78A 1NWZA 3E4PA 3S7NA 4WEJA 3T4LA 2L1MA 3LR5A 3UB9A 3A0SA 3F1PA 3MJQA 4EXOA 2VZWA 4GHIB 3BWLA 4UEYA 4Y5FA 3LUQA 2QHKA 2W3GA 2A24A 5FL3A 2W3DA 4FOFA 2MJ6A 3BQ8A 3CUEC 1X0OA 2KDKA 4XT2A 3T4QA 5HDDA 2JKTM 2NUPC 2G7UA 4DJ2A 1S1ZA 2L4RA 4NKPA 4ZRRA 4ETXA 2PR5A 5DKKA 1IOUA 3MQQA 3KO6A 3LI8A 5F5YA 3VV4A 3EEHA 4F3LA 4UQIM 4G3WA 1EW0A 1OTIA 3R4KA 1T1BA 4YOFA 1W63Q 1LSVA 5F6AA 2I9VA 4CLCD 1GSXA 3UB7A 1WA9A 2NUTC 2D01A 1OT6A 2V0UA 3TE8A 4H6JA 5TBMA 5AVEA 2J3WA 2JKTI 1VHMA 3HJKA 2W1RA 2Y79A 4BBTA 3A0RA 4NXBA 2V1AA 4BMWA 3R7WA 1N9NA 3RH8B 3JVVA 2OWHA 1Y28A 5KSHA 2Z6CA 3B33A 3KSIA 1H3QA 2W3FA 3ZYTA 4NXGA 3V67A 4O01A 3EEAA 3MQ0A 3CLOA 1TS0A 5HDCA 5DJTA 2PT7A 3PBSA 2HGVA 5A8BA 3D3OA 3LYXA 5J4EA 5HDSA 3OC2A 2VKSA 4GW9A 4O0PA 4BWIA 3BJNA 3T4OA 5IS1A 4HY8A 3TW8A 3IBJA 4R6LA 2IA2A 1UWPX 3CITA 4NXEA 2EWWA 4MCWA 1TF1A 3E0YA 3IBRA 2J3TD 1TS7A 1S67L 1YAXA 3CI6A 3EQUA 3VE3A 4R38A 2PYPA 4RQ9A 3NOUC 3F1PB 3LR3A 3MFXA 4I5SA 4M4XA 4HIAA 3BQAA 2VV6A 2A24B 1T19A 3CUEA 3LIDA 4EESA 1LL8A 4EW7A 3LI9A 3W2ZA 3BY9A 1OJ5A 3T50A 4P6ZM 2GJ3A 1LT0A 2PHYA 4JGQA 4L0LA 4Z1WA 4MDZA 2KOIA 4F3LB 3PBTA 4JGPA 2M7UA 1UWNX 4WF0A 4R70A 2DMWA 1DRMA 4HH2A 3B47A 4CLCC 1P9RA 5IU1A 1F98A 3LFVA 2GZAA 4LRZE 3LR0A 5HD5A 5I5LA 1W63M 3A0VA 3C8CA 2OAQ1 2KLIA 4II7A 3BY8A 5HL6A 5LBRA 4EERA 4R3AA 5C5KA 4H6JB 5TBMB 3KYZA 4GS9A 2J80A 4NXFA 3OBFA 5G4ZA 3MR0A 3K2NA 4IUKA 1P0ZA 5TJJA 3NOPC 1V9YA 3R7WB 2WKPA 4HJ6A 2HJ9C 5DFYA 1TS8A 3FC7A 4WELA 3GDIA 3CWFA 4WL9A 5AVFA 2VJWA 5DJUA 5CX7A 3NJAA 5IT5A 3P01A 4GLQA 2QYBA 3TRCA 1YSQA 2OWJA 4PAUA 3F1OA 5MC7A 1KOUA 4E04A 1T18A 2PD7A 2P08A 4I3JA 2W0NA 5HWTA 3PXPA 2H28A 4HI4A 3PBNA 3RTYA 2VEAA 2JKRI 2OAP1 1VB6A 2PDRA 2XROA 1TD5A 2J3TC 4OOLA 2VGLM 3BW6A 2HF6A 1OT9A 2A2LA 1LSXA 5DFXA 4PKYG 4HJ4A 2VV8A 3NOTC 3LR4A 3PBRA 3PHYA 2P04A 3H82B 4EEUA 4B9OA 4IJGA 3MMHA 1F9IA 3OLOA 2PD8A 4ETZA 2P7JA 1DP6A 3OOVA 5K5BA 3K3DA 3S7QA 4UQIS 3JVUA 5AJGA 2VV7A 2FZ0A 4JGOA 3KSFA 2JHEA 1IFQA 3GECA 2XA7M 3EOIA 4CLCA 1XFQA 2PR6A 3E4QA 5EFWA 3EQVA 3IS2A 4GCZA 3MF0A 4CQHA 2V1BA 3C2WA 4YNRA 4GJ4A 2O99A 3PR6A 4GS9B 2V9AA 3UE3A 3ULFA 3S7OA 3LIEA 4KQOA 4Q0HA 2M7VA 3H82A 1S1YA 3CAXA 3F1NA 3RFBA 1XJ6A 4LRXC 3ICYA 3P7NA 5HD3A 3UB8A 3EWKA 3E4OA 3T4KA 2K31A 2V0WA 5L8MA 4HOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKQ A;  2QWS A;  2JN7 A;  2YKF A;  4KUK A;  3F1O B;  3UE6 A;  1OTE A;  1V9Z A;  2PYR A;  4BBU A;  2QJ7 A;  5HSQ A;  3ZQ5 A;  2QJ5 A;  1UGU A;  3G6O A;  4HJ3 A;  3LIB A;  4I3A A;  2M1C A;  4LLO B;  1G28 A;  2ZBB A;  1OTB A;  4HNB A;  4I38 A;  1T1A A;  2BAS A;  3LIA A;  2ZOH A;  1T1C A;  2VLG A;  5F68 A;  2KX6 A;  1XFN A;  2W27 A;  4EQ1 A;  4PKY A;  1XJ3 A;  5J7E A;  3VE4 A;  4EEP A;  4HH3 A;  4L9E A;  1OTA A;  1S4S A;  1S4R A;  1OJG A;  3IS2 B;  4LRY C;  5KIZ A;  3UMD A;  4YWZ A;  1P97 A;  4LPZ A;  2QKP A;  4HQA A;  4KQD A;  1MZU A;  5HWW A;  3LIC A;  3D72 A;  1N9O A;  4EET B;  3NHQ A;  4DJ3 A;  2D02 A;  3F1N B;  1D06 A;  3H9W A;  4GHI A;  3SW1 A;  2ZOI A;  4L9F A;  1LSW A;  4WLA A;  4MN5 A;  5G4Y A;  2WKR A;  4I39 A;  3VOL A;  2Z6D A;  5F69 A;  3MQO A;  1DP8 A;  4HHD A;  2YKH A;  5HWV A;  2EA9 A;  1ODV A;  3HJI A;  4BBV A;  4HP4 A;  3LIF A;  3MXQ A;  4K08 A;  1GSW A;  1S66 L;  3H7W B;  5J3W A;  4WN5 A;  1BYW A;  1N9L A;  1OTD A;  4KUO A;  4MN6 A;  2L0W A;  1GSV A;  1DP9 A;  4XT2 B;  1XJ4 A;  2K7S A;  4WUJ A;  2B02 A;  1JNU A;  1TS6 A;  3K3C A;  3PYP A;  4JGR A;  3FG8 A;  3H7W A;  5HZH A;  1D7E A;  2OOL A;  3KX0 X;  4HP9 A;  1XJ2 A;  4L9G A;  3UB6 A;  4I3I A;  2INW A;  3UME A;  5DKL A;  2HV1 A;  2CMN A;  2R78 A;  1NWZ A;  3E4P A;  2L1M A;  3UB9 A;  3A0S A;  3F1P A;  3MJQ A;  4EXO A;  4GHI B;  3BWL A;  3LUQ A;  2QHK A;  2A24 A;  1X0O A;  2KDK A;  4XT2 A;  5HDD A;  4DJ2 A;  1S1Z A;  2L4R A;  2PR5 A;  5DKK A;  3MQQ A;  3LI8 A;  5F5Y A;  4F3L A;  3EEH A;  1EW0 A;  1OTI A;  1T1B A;  1LSV A;  5F6A A;  2I9V A;  1GSX A;  3UB7 A;  1WA9 A;  2D01 A;  1OT6 A;  2V0U A;  4H6J A;  5TBM A;  5AVE A;  3HJK A;  4BBT A;  3A0R A;  4NXB A;  2V1A A;  1N9N A;  3RH8 B;  2OWH A;  1Y28 A;  2Z6C A;  3B33 A;  4NXG A;  3CLO A;  1TS0 A;  5HDC A;  5DJT A;  5A8B A;  3LYX A;  5J4E A;  5HDS A;  4GW9 A;  5IS1 A;  4HY8 A;  4R6L A;  1UWP X;  4NXE A;  3IBR A;  1TS7 A;  1S67 L;  3VE3 A;  4R38 A;  2PYP A;  4RQ9 A;  3NOU C;  3F1P B;  3MFX A;  4I5S A;  4M4X A;  4HIA A;  2VV6 A;  2A24 B;  1T19 A;  3LID A;  4EES A;  1LL8 A;  4EW7 A;  3LI9 A;  3T50 A;  3BY9 A;  1OJ5 A;  2GJ3 A;  1LT0 A;  2PHY A;  4JGQ A;  4F3L B;  4JGP A;  1UWN X;  4WF0 A;  4R70 A;  1DRM A;  4HH2 A;  5IU1 A;  1F98 A;  4LRZ E;  5HD5 A;  5I5L A;  3A0V A;  3C8C A;  3BY8 A;  4EER A;  4R3A A;  4H6J B;  5TBM B;  4GS9 A;  2J80 A;  4NXF A;  5G4Z A;  3MR0 A;  1P0Z A;  3NOP C;  1V9Y A;  2WKP A;  4HJ6 A;  1TS8 A;  3FC7 A;  3GDI A;  3CWF A;  4WL9 A;  5AVF A;  5DJU A;  3NJA A;  2OWJ A;  3F1O A;  1KOU A;  4E04 A;  1T18 A;  2PD7 A;  4I3J A;  2W0N A;  5HWT A;  2H28 A;  4HI4 A;  3RTY A;  2VEA A;  1VB6 A;  2PDR A;  1OT9 A;  1LSX A;  4PKY G;  4HJ4 A;  2VV8 A;  3NOT C;  3PHY A;  3H82 B;  4EEU A;  4B9O A;  1F9I A;  3OLO A;  2PD8 A;  2P7J A;  1DP6 A;  3K3D A;  2VV7 A;  4JGO A;  2JHE A;  3GEC A;  1XFQ A;  2PR6 A;  3E4Q A;  5EFW A;  3IS2 A;  4GCZ A;  2V1B A;  3C2W A;  4GS9 B;  2V9A A;  3ULF A;  3LIE A;  3H82 A;  1S1Y A;  3CAX A;  3F1N A;  1XJ6 A;  4LRX C;  3ICY A;  3P7N A;  5HD3 A;  3UB8 A;  3EWK A;  3E4O A;  2V0W A;  4HOI A; 
#chains in the Genus database with same CATH topology
 4WBG A;  3LY4 A;  1BLH A;  1G6O A;  3BM6 A;  2VA0 A;  1FCM A;  5FQK A;  3JYI A;  3WS2 A;  1STZ A;  5GHX A;  4BBU A;  3CHW P;  2ZMF A;  4WMC A;  3HRE A;  1KVL A;  2W1T A;  3IH9 A;  5HSQ A;  3N8L A;  4OKP A;  2QJ5 A;  4HBT A;  4HJ3 A;  4KZ6 A;  2M1C A;  3BFC A;  1G28 A;  1GHM A;  2ZBB A;  2JKR M;  1L0F A;  2WZX A;  1ACF A;  1NLZ A;  1YMS A;  2BAS A;  4X53 A;  2ZOH A;  1T1C A;  2VLG A;  2W27 A;  4EQ1 A;  2G2U A;  4MLL A;  2JKF A;  3A3E A;  4EEP A;  2LB9 A;  4KZB A;  1ZKJ A;  1MKM A;  4JXW A;  3BYD A;  1OTA A;  2P74 A;  1P9W A;  4G3K A;  2QMI A;  4BJP A;  4CLC B;  4WM9 A;  1W8Q A;  2X71 A;  1G68 A;  4LRY C;  2V2F F;  3G4P A;  1MY8 A;  4LPZ A;  1I2W A;  4EET B;  3NHQ A;  1W79 A;  4DJ3 A;  3W4P A;  1MC0 A;  2OV5 A;  4GHI A;  1NRJ A;  3S7P A;  1YM1 A;  2ZD8 A;  2FFF B;  3MSH A;  3HCY A;  4UHU A;  4OQI A;  3MZE A;  4I39 A;  3T4J A;  1Z09 A;  2Z6D A;  1SHV A;  2ZQD A;  3LEZ A;  3MQO A;  1DP8 A;  1ZG6 A;  1BT5 A;  3EGD C;  3BRM A;  5HWV A;  1WYC A;  1NYM A;  1ODV A;  4FUW A;  2IWC A;  5JYO A;  4HP4 A;  1FCN A;  3NDG A;  5J3W A;  3GV9 A;  2P9V A;  3A3D A;  1PRQ A;  1GHP A;  3CG5 A;  2EXA A;  3VP1 A;  1IYQ A;  4EQI A;  3OCN A;  1N4O A;  3W4Q A;  1ALQ A;  2X02 A;  4S2L A;  2Y2N A;  3N4I A;  2XA7 S;  4EWF A;  3M2K A;  1J9M A;  5HW3 A;  4DE2 A;  5F83 A;  4HES A;  4AFI A;  3C4P A;  3KSG A;  5FAS A;  1OME A;  1PWC A;  1FIK A;  4E3M A;  5E2E A;  4NK3 A;  5HZH A;  4OOM A;  4HP9 A;  1NLY A;  4YIN A;  5FEF A;  2CC1 A;  3UB6 A;  2INW A;  4P87 A;  5DKL A;  3SH8 A;  3MXS A;  1MWT A;  2L1M A;  1Q2Q A;  3MJQ A;  1JWV A;  3BWL A;  4GOG A;  2QHK A;  2W3G A;  2A24 A;  2IWB A;  1MXO A;  2RL3 A;  3T4Q A;  2H0T A;  2JKT M;  2NUP C;  2Q9N A;  2G7U A;  4DJ2 A;  2WUQ A;  1S1Z A;  2A49 A;  2L4R A;  4ZRR A;  3O3V A;  3V39 A;  4G3W A;  1BTL A;  1OTI A;  3R4K A;  4X56 A;  3UDF A;  1W63 Q;  3B3X A;  4CLC D;  3OZH A;  3UB7 A;  3CPT A;  1WA9 A;  2Y55 A;  3Q1F A;  2D01 A;  2J3W A;  3Q07 A;  2JKT I;  4IBR A;  2W1R A;  3A0R A;  5CTM A;  3ZG7 B;  2J7V A;  3RH8 B;  3BEC A;  3QP5 A;  5FQQ A;  5KSH A;  1FR6 A;  3IH8 A;  2W3F A;  1M6K A;  4NXG A;  1KGE A;  1SDE A;  3CLO A;  1TS0 A;  5FAQ A;  5A8B A;  3BFD A;  3AGF A;  1BLS A;  2ZM2 A;  5EOO A;  2G2W A;  1SKO B;  3G2Y A;  2VKS A;  4S2N C;  1KE0 A;  3N8S A;  4GW9 A;  4JKT A;  3WS5 A;  2WKH A;  4HY8 A;  3TW8 A;  4DXC A;  3CIT A;  4WYY A;  2XEP A;  3GVB A;  3IBR A;  5EM1 A;  5CER A;  3VE3 A;  4HBU A;  2ZC7 A;  3F1P B;  3OPH A;  4M4X A;  4HIA A;  3V5M A;  3RJU A;  4PPR A;  5GHY A;  4Y7P A;  1LL8 A;  5I94 A;  2Y2I A;  1GCE A;  4R3J A;  2GJ3 A;  1FOF A;  1S6R A;  4L0L A;  1CEG A;  2J9O A;  2PHY A;  4JGQ A;  4Z1W A;  4QY6 A;  5L10 A;  2PRF A;  3MZD A;  1XA1 A;  1PNE A;  3FZC A;  5CRF A;  1DRM A;  1F98 A;  3DWK A;  5I5L A;  5GLD A;  1I2S A;  3C8C A;  2XK1 A;  4II7 A;  5TBM B;  4GS9 A;  4P6B A;  1P0Z A;  5TJJ A;  3BLS A;  3NOP C;  4KZ9 A;  3R7W B;  2Y2Q A;  1TDL A;  4UA7 A;  4HJ6 A;  1ZC2 A;  1VM1 A;  4WEL A;  4WL9 A;  5DJU A;  1K4F A;  1RP5 A;  3MZF A;  3P01 A;  1JTG A;  4GLQ A;  4OPY A;  5A90 A;  3NUL A;  2OWJ A;  5MC7 A;  4D60 A;  4B4Z A;  3NC8 A;  1CK3 A;  1CF0 A;  5E43 A;  1K6R A;  3PBN A;  1M40 A;  3RTY A;  1K6S A;  2VK3 A;  1G6A A;  1VB6 A;  4R23 A;  2J3T C;  2V20 A;  1BZA A;  1U60 A;  3ITA A;  2HDS A;  3A3F A;  4OOL A;  2ZC3 B;  4HJ4 A;  3NOT C;  4B9O A;  3O87 A;  5TFQ A;  5CEC A;  2WAF A;  2Z2L B;  3S7Q A;  2PBY A;  2BLS A;  3Q7V B;  4XUZ A;  4KZA A;  3SOI A;  3GEC A;  1EI5 A;  4DDY A;  1K56 A;  5HX9 A;  1L0G A;  2HDR A;  4RYE A;  3RXW A;  3C2W A;  1S0W A;  4GJ4 A;  5U47 A;  3N6I A;  1AWI A;  3S7O A;  1PWD A;  1VEU A;  4KQO A;  4Q0H A;  2H5S A;  2WAE A;  4PM8 A;  5CXW A;  1VQQ A;  1YLT A;  2EX8 A;  3E4O A;  2V0W A;  3CZD A;  5L8M A;  4E3J A;  5FQI A;  1ONH A;  4KUK A;  4K0X A;  4U0X A;  3UE6 A;  1ESI A;  3AGD A;  4RX2 A;  1OTE A;  2PYR A;  2QJ7 A;  3OPR A;  4Y3I A;  1YT4 A;  4Q0J A;  1PIO A;  3G6O A;  3LIB A;  4LLO B;  3T1Q B;  3O5Y A;  4E3O A;  4JF4 A;  5HFO A;  4KEN B;  2Y2O A;  1ESU A;  3GTC A;  4BL2 A;  2ZQ8 A;  4C3Q A;  1MKI A;  4QY5 A;  2R9X A;  1XFN A;  3NCK A;  4P85 A;  1PI4 A;  3L7H A;  2EX2 A;  2Y2H A;  3IF6 A;  3FPV A;  4S2N A;  5F82 A;  3UO9 A;  1S4S A;  3SZT A;  1S4R A;  5KSC A;  3EGX C;  5FAO A;  3UMD A;  3WRT A;  4YWZ A;  4KQD A;  1MZU A;  5EEC A;  2V1Z A;  3IWO A;  3ZG9 B;  2D02 A;  1YSP A;  2C6W B;  2HJE A;  4BEN A;  1IKG A;  4E6W A;  3KYQ A;  4DXB A;  4NEE D;  1XX2 A;  4EUV A;  1DJC A;  4WLA A;  2PU2 A;  4Y13 A;  1KE3 A;  4ESP A;  1O07 A;  5EVL A;  4BD0 A;  5EVE A;  3U2A A;  4HHD A;  1Y54 A;  3UY6 A;  2LB5 A;  3ZG0 A;  2W1T B;  2YKH A;  2JE5 A;  5F1G A;  1K54 C;  3MXQ A;  3BEB A;  3G30 A;  1MBL A;  3HLD A;  4XUX A;  1GHI A;  1ZHH B;  2EXB A;  4IBX A;  1N9L A;  2O0Y A;  2XF3 A;  2Y2K A;  4MEZ A;  4LCL A;  2WGW A;  2ZC4 B;  4FH2 A;  5E2H A;  2XFT A;  4UAA A;  4C75 A;  5CED A;  2FH5 A;  3SH7 A;  1DP9 A;  4Y0O A;  4KG5 A;  4KZ7 A;  3C7V A;  3IX3 A;  3CJM A;  5AQ7 A;  4GDN A;  2ZQ7 A;  1KDS A;  2ZMV A;  1E3U D;  3K3C A;  4QPR A;  2GNX A;  1XJ2 A;  4I3I A;  3TSG A;  2VGK A;  3S7N A;  3T4L A;  2BG1 A;  1YMX A;  3UB9 A;  4GNU A;  5FDS A;  3U4L P;  5BOH A;  4GHI B;  3NIA A;  2DNS A;  1SDN A;  3IX8 A;  2MJ6 A;  5FA7 A;  4QU3 A;  3FKW A;  3HLC A;  4OH0 A;  4ETX A;  2AVX A;  4KZ3 A;  5HAQ A;  5DKK A;  1IOU A;  3MQQ A;  2OLV A;  2Z2M B;  3LY3 A;  4F3L A;  5FQJ A;  3EEH A;  3S4X A;  1EW0 A;  3C7U A;  3IXB A;  1GSX A;  2IWD A;  2WAD A;  3QNC A;  1LL9 A;  2P9V B;  3TE8 A;  3M6B A;  3WRZ A;  1IEL A;  3L9K A;  3HL9 A;  1VHM A;  4Y0U A;  3ZCZ A;  1MWU A;  2V1A A;  4ID4 A;  4A5R A;  3Q7Z A;  1KGF A;  4LEN A;  1ES5 A;  4Y0T A;  5L2F A;  2OWH A;  3JVV A;  3PAE A;  3KSI A;  3V67 A;  3BLM A;  4LV0 A;  5GL9 A;  3MQ0 A;  5DJT A;  3I7J A;  3D3O A;  1BLP A;  5J8X A;  5FAP A;  1FSW A;  2ZLY A;  1LL5 A;  3BJN A;  4KZ4 A;  5FDH A;  4R6L A;  4U3T A;  4WMC D;  2EFX A;  2EWW A;  4NXE A;  1ES4 A;  4MCW A;  5L09 A;  3E0Y A;  4N9L A;  2J3T D;  3EQU A;  1YAX A;  5DF7 A;  2C5W B;  1NZU A;  5FI2 A;  3ZG5 A;  1XPB A;  1K38 A;  2A24 B;  1T19 A;  1SKF A;  3M6H A;  1XGI A;  3CUE A;  2XD5 A;  2HPB A;  4R4S A;  4R3B A;  3HLG A;  3LI9 A;  3T50 A;  1OJ5 A;  3WS1 A;  4P6Z M;  2Y2L A;  4FD8 A;  4MDZ A;  1HLU P;  4R70 A;  2DMW A;  2BTF P;  3LFV A;  2GZA A;  4LRZ E;  1W63 M;  2JCH A;  3CPT B;  2KLI A;  3WWX A;  4BQM A;  5HL6 A;  5CHU A;  4R3A A;  5C5K A;  4DE1 A;  5IHV A;  3KYZ A;  4QB8 A;  5EVI A;  5G4Z A;  3MR0 A;  3K2N A;  4JBF A;  4IUK A;  4PMA A;  3UDI A;  2H0Y A;  3LEQ A;  5DFY A;  1TS8 A;  4C6Y A;  1BUE A;  2VJW A;  1BSG A;  3UDX A;  1K4E A;  3SS3 A;  3FV7 A;  5HAI A;  4PAU A;  3F1O A;  2JC7 A;  2ZJ9 A;  4GN2 A;  2P08 A;  4I3J A;  2H10 A;  1K54 A;  4JF5 A;  4WZ4 A;  2H28 A;  4PM7 A;  2ZQ9 A;  3VSK A;  1TD5 A;  3S1Y A;  1ES3 A;  1O7E A;  3VP2 A;  2A2L A;  1LSX A;  2E8I A;  5DFX A;  2VV8 A;  1IEM A;  3LCE A;  4OON A;  2P04 A;  2Q0O A;  4HEF A;  3IT9 A;  2VGJ A;  4IJG A;  1SCW A;  2Y2J A;  2P7J A;  1DP6 A;  5K5B A;  4Q8I A;  3ITB A;  4EBL A;  3A3J A;  3IF6 C;  4JGO A;  2JHE A;  4WZ5 A;  1IFQ A;  2ZC6 B;  3EOI A;  4N1H A;  2J9P A;  1YLZ A;  2PR6 A;  1W7F A;  3T1S A;  5A93 A;  4NG2 A;  1K55 A;  3IS2 A;  4GCZ A;  3ZG8 B;  3UPP A;  1RGZ A;  5CGX A;  4GS9 B;  3V50 A;  2V9A A;  3UE3 A;  3MKF A;  4E3L A;  5KZH A;  3ISG A;  4Z9Q A;  4R1G A;  3F1N A;  2WZZ A;  1XJ6 A;  4LV2 A;  5HD3 A;  3SH9 A;  3Q81 A;  2ZMA A;  3EWK A;  3QP6 A;  4S2M A;  3T4K A;  2DCF A;  5EE8 A;  3GRJ A;  2JN7 A;  3IWI A;  4QD4 A;  2K2N A;  3UPN A;  3MS6 A;  1V9Z A;  3B42 A;  4JPM A;  3VP3 A;  4KZ8 A;  1LLB A;  1MWS A;  4X1L A;  2O9C A;  1UGU A;  3O88 A;  4I3A A;  3ZVW A;  4OPQ A;  2XD1 A;  1OTB A;  4JXS A;  4HNB A;  4ZTK A;  1E4D A;  4R0Q A;  1T1A A;  4ARZ A;  4MN7 A;  1SZV A;  5E2G A;  3UN7 A;  4X69 A;  3IHA A;  4P6Z S;  2KX6 A;  1YKD A;  1XJ3 A;  1ONG A;  3VE4 A;  4HH3 A;  4QHC A;  4NET A;  2GX5 A;  3OPL A;  4ZJ2 A;  4DRT A;  4L9E A;  2EX6 A;  1DY6 A;  4X6T A;  5FEG A;  4IED A;  2QKP A;  4HQA A;  5A92 A;  3VP4 A;  5HWW A;  3LIC A;  3D72 A;  4DF6 A;  1N9O A;  1VEU B;  3HLE A;  4EBP A;  1CEF A;  5EV0 A;  3C38 A;  1H8Y A;  3PBQ A;  3SW1 A;  4L9F A;  3VMA A;  2ZL1 A;  1XA7 A;  2WK0 A;  1ZTU A;  4LGW A;  4Y17 A;  3AGE A;  4MN5 A;  5G4Y A;  2HDQ A;  2W3H A;  2ZQA A;  4B88 A;  1PWG A;  1KVM A;  3WS4 A;  3IQA A;  1KGG A;  4B93 A;  1QME A;  4IUH A;  4OLG A;  3FPW A;  4BBV A;  3LIF A;  4PM6 A;  4X25 A;  4DN0 A;  3H7W B;  3HUM A;  4OQG A;  3SS4 A;  3QP8 A;  4E6X A;  1H8M A;  5HPF A;  2O9B A;  4KUO A;  5DF9 A;  1K25 A;  1BUL A;  4Q0I A;  4LV3 A;  5HAR A;  3P98 A;  1QMF A;  3OCL A;  1GSV A;  3IF6 B;  3OPP A;  5GLC A;  3WS0 A;  1L2S A;  1IYP A;  1JWP A;  1XJ4 A;  3MKE A;  2K7S A;  1K57 A;  2XLN A;  2UWX A;  5M1A A;  4OPR A;  1PZP A;  2B02 A;  1JNU A;  3SS5 A;  2V8F A;  1TS6 A;  3DAV A;  4JGR A;  3H7W A;  4E3K A;  1D7E A;  3VFF A;  3KX0 X;  4G3V A;  3E98 A;  4ME4 A;  2HP5 A;  2Y59 A;  5CHJ A;  1FSY A;  2R78 A;  4WEJ A;  4E3N A;  3GMW A;  3A0S A;  1PW1 A;  4EXO A;  4EUZ A;  4FCF A;  3HUN A;  4UEY A;  3HLB A;  1FIL A;  3LUQ A;  4XXR A;  5FL3 A;  3TG9 A;  1BLC A;  2W3D A;  3BQ8 A;  3CUE C;  1X0O A;  2KDK A;  5HDD A;  2DRW A;  3UE1 A;  1IYO A;  5M18 A;  4ZAM A;  3O86 A;  2R9W A;  3IF5 A;  5CHM A;  1DJB A;  4KG6 A;  4ZJ3 A;  3LI8 A;  3VV4 A;  4M3K A;  3NBL A;  3QNB A;  1LSV A;  3N7W A;  1K56 D;  4H6J A;  3G32 A;  5EVI C;  2Y79 A;  2WGW B;  4BBT A;  4BMW A;  3IX4 A;  4X68 A;  1N9N A;  3A3I A;  2HP6 A;  3QHY A;  1TDG A;  4UA6 A;  3ZGA B;  4LCM A;  4E3I A;  3MXR A;  3ZYT A;  4O01 A;  5HDC A;  3RXX A;  3E2L A;  5J4E A;  3NI9 A;  2Y2P A;  2OSU A;  3OC2 A;  3BFF A;  1RCJ A;  4GKU A;  2PU4 A;  3VP0 A;  5IS1 A;  1UWP X;  1YLW A;  2HP9 A;  1E25 A;  2XQZ A;  1TF1 A;  4KQQ A;  2QPN A;  3CI6 A;  4R38 A;  1PYY A;  2PAV P;  5TGF A;  3HVF A;  2PYP A;  4RQ9 A;  3LR3 A;  3MFX A;  4I5S A;  4FTX A;  1XP4 A;  3LID A;  1CI9 A;  4K0W A;  4EW7 A;  2HDU A;  3BY9 A;  1ERM A;  3ZNY A;  4IVK A;  3DW0 A;  4MBH A;  4F3L B;  3PBT A;  4WZ5 C;  3PAG A;  4JGP A;  5DTK A;  1I5Q A;  4HH2 A;  3B47 A;  4GDB A;  3BFG A;  5IU1 A;  4JLF A;  4N92 A;  3ZVT A;  1K55 C;  1PZO A;  3BY8 A;  5LBR A;  5EOE A;  2J80 A;  4NXF A;  1YQS A;  2Y2G A;  5CGW A;  1V9Y A;  1FR1 A;  3ZFZ A;  2EFU A;  3FC7 A;  3GDI A;  3CWF A;  4S2O A;  4GD8 A;  3QP2 A;  4QWO A;  5EUA A;  2QYB A;  3TRC A;  3DTM A;  1TEM A;  4E04 A;  1FQG A;  1T18 A;  1XXM A;  5DF8 A;  4HI4 A;  4RVA A;  1GA9 A;  1J3W A;  2OLU A;  2QZ6 A;  2JKR I;  3FKV A;  3G35 A;  4KQR A;  2XRO A;  4ZDX A;  4BD1 A;  4DDS A;  2VGL M;  3BW6 A;  2HF6 A;  2WKI A;  1OT9 A;  2JKG A;  4PKY G;  1YLP A;  3NEC A;  3LR4 A;  3PBR A;  3PHY A;  3IWQ A;  1YLY A;  5HL1 A;  3MMH A;  3OLO A;  3LGO A;  2PD8 A;  3QP1 A;  3OOV A;  3K3D A;  4ZBE A;  5AJG A;  2FZ0 A;  5TR7 A;  1CJF A;  4CPK A;  4CLC A;  1XFQ A;  3E4Q A;  4OP8 A;  3IXG A;  3EQV A;  4JXG A;  2HZ5 A;  4CQH A;  4S2I A;  2V1B A;  4DE3 A;  4PM5 A;  2O99 A;  1IKI A;  5AQA A;  3ULF A;  5EVI B;  3LIE A;  4IVI A;  4X1M A;  2M7V A;  3CAX A;  3RFB A;  3LO7 A;  3ICY A;  3P7N A;  1EWZ A;  5F1F A;  2K31 A;  3NDE A;  4GD6 A;  4UA9 A;  2WKQ A;  2QWS A;  1H8Z A;  1CQA A;  2YKF A;  3F1O B;  1H5X A;  3NY4 A;  3D9Y A;  5FSR A;  3TJZ C;  1ERQ A;  2VX8 A;  2EWV A;  2V8C A;  5EM0 A;  3ZQ5 A;  4FSF A;  3N8R A;  4EBN A;  4I38 A;  3T4T A;  1Z6F A;  3LIA A;  3UNW A;  5F68 A;  2WKE A;  4YFM A;  3E2K A;  4N1X A;  4PKY A;  2JBF A;  2A3U A;  5J7E A;  1NYY A;  4S2P A;  3C5A A;  2X01 A;  4BLM A;  2I72 A;  1WE4 A;  3D4F A;  3GQZ A;  1LHY A;  1K57 C;  3ZNT A;  1XGJ A;  1OJG A;  3IS2 B;  3KSH A;  5KIZ A;  3P09 A;  1P97 A;  2XFS A;  1OPX A;  1F2K A;  4IHQ A;  4Y2F A;  2WYX A;  2UV0 E;  4PHT A;  5E2F A;  3T1R A;  3F1N B;  1D06 A;  1VET B;  1RGY A;  4F94 A;  2WGV A;  4MMN A;  3H9W A;  2ZOI A;  3Q82 A;  2W3E A;  1LSW A;  1NZO A;  5G18 A;  4O7D A;  3T4S A;  1N9B A;  3MFD A;  2WKR A;  1Q2P A;  2XRN A;  3HUO A;  4DMZ A;  3VOL A;  2Y8H A;  5F69 A;  1XKZ A;  2VGL S;  5GHZ A;  2FFY A;  3ZHH A;  2EA9 A;  3HJI A;  4KG2 A;  3DTE A;  1HTZ A;  5HPI A;  3HBR A;  4K08 A;  1GSW A;  1S66 L;  1D1J A;  4WN5 A;  2ZM8 A;  4WEK A;  2XSS A;  1PFL A;  1BYW A;  1VET A;  1OTD A;  4ARZ B;  5FI7 A;  4EU0 A;  3DBA A;  1WYB A;  2Q9M A;  5EVI D;  4MN6 A;  4O8G A;  2L0W A;  4OOY A;  4JF6 A;  3VSL A;  2J8Y A;  4K91 A;  1L3L A;  1ES2 A;  3FWL A;  4P0M A;  4XT2 B;  1F5M A;  5DTT A;  3PTE A;  1MWR A;  2O9A A;  1MPL A;  2XGN A;  1SKO A;  4WUJ A;  3UPO A;  5AQ9 A;  3PBO A;  3PYP A;  4B4X A;  4CJN A;  3FG8 A;  4CLC E;  2OOL A;  3C30 A;  1GA0 A;  1AXB A;  4L9G A;  4D2O A;  2EX9 A;  2B18 A;  3UME A;  2HV1 A;  1Y4O A;  2CMN A;  1NWZ A;  3E4P A;  4MBK A;  4S2K A;  3LR5 A;  1ZG4 A;  3F1P A;  3M2J A;  4BL3 A;  2VZW A;  5HAP A;  4Y5F A;  3W4O A;  4DKI A;  5GLA A;  3S22 A;  4FOF A;  2ZL1 B;  4XT2 A;  1JWZ A;  3G2Z A;  3VOZ A;  4NKP A;  2PR5 A;  3DWZ A;  3KO6 A;  5F5Y A;  4H8R A;  4UQI M;  3T12 B;  5CTN A;  1HZO A;  1T1B A;  4YOF A;  5F6A A;  2I9V A;  5EPH A;  2NUT C;  1DJA A;  4MBF A;  2B95 A;  1A0K A;  1OT6 A;  2V0U A;  5TBM A;  5AVE A;  1JTD A;  3HJK A;  4RA7 A;  4NXB A;  3R7W A;  4OQ0 A;  1KDW A;  1LI9 A;  1K0K A;  4OLD A;  2Y91 A;  1Y28 A;  5L07 A;  2Z6C A;  3B33 A;  1H3Q A;  2PBD P;  5AQB A;  2ACG A;  3CMZ A;  3EEA A;  1NXY A;  3VOY A;  1HVB A;  5FI6 A;  2PT7 A;  3PBS A;  2HGV A;  5JYP A;  1L0D A;  3LYX A;  5HDS A;  4FH4 A;  3VFH A;  4O0P A;  5D3O A;  4S2J A;  4R4R A;  3T4O A;  4BWI A;  3ZDJ A;  3G34 A;  4DE0 A;  3IBJ A;  5CGS A;  2IA2 A;  1L0E A;  1NRF A;  2XH9 A;  5A91 A;  1TS7 A;  1S67 L;  4N9K A;  4OVD A;  1W5D A;  1CI8 A;  5CEB A;  3NOU C;  3GR2 A;  1HD8 A;  3BQA A;  2VV6 A;  3JPU A;  1H0M A;  4EES A;  5KMW A;  3Q7V A;  3W2Z A;  1LT0 A;  5DVA A;  2KOI A;  2M7U A;  1UWN X;  4WF0 A;  3UE0 A;  4JXV A;  2RCX A;  4CLC C;  3V3R A;  1P9R A;  2XR0 A;  3LR0 A;  2ZQC A;  5HD5 A;  1FCO A;  4OQH A;  3A0V A;  4PM9 A;  2OAQ 1;  2ZM0 A;  2GDN A;  4EER A;  4H6J B;  3GSG A;  3QP4 A;  3IXH A;  1W8Y A;  3OBF A;  1C3B A;  4Y15 A;  3UB5 P;  2WKP A;  1YPR A;  2HJ9 C;  5FQ9 A;  1KE4 A;  5AVF A;  1IYS A;  5CX7 A;  3NJA A;  5IT5 A;  3IXD A;  4ZJ1 A;  2B5R A;  4MNR A;  3DTI A;  1TVF A;  1YSQ A;  4LFU A;  3V3S A;  1E3U A;  1KOU A;  2PD7 A;  2W0N A;  5HWT A;  3PXP A;  5GLB A;  4LV1 A;  2VEA A;  2OAP 1;  1NJ4 A;  3BFE A;  2PDR A;  4OPZ A;  5FAT A;  4X55 A;  1ERO A;  1PI5 A;  3H82 B;  3HLF A;  4EEU A;  4RX3 A;  3KYE A;  1F9I A;  3DTK A;  4ETZ A;  2E8J A;  4UQI S;  2WGI A;  3JVU A;  2VV7 A;  4U0T A;  4QJG A;  4OP5 A;  4EV4 A;  3KSF A;  5FQM A;  2XA7 M;  1PW8 A;  2Y4A A;  2XDM A;  2ZC5 B;  1YLJ A;  3W8K A;  1JVJ A;  5EFW A;  3MF0 A;  3C4O A;  1LI0 A;  5DTS A;  1NY0 A;  4YNR A;  3FYZ A;  3PR6 A;  4KZ5 A;  3T1X A;  3MBZ A;  3H82 A;  1G5U A;  1S1Y A;  3IHB A;  3TOI A;  4GZB A;  4LRX C;  2Y2M A;  3UB8 A;  5M19 A;  3G31 A;  4GB7 A;  3HLW A;  4HOI A; 
#chains in the Genus database with same CATH homology
 2WKQ A;  2QWS A;  2JN7 A;  2YKF A;  4KUK A;  3F1O B;  2K2N A;  3UE6 A;  1G6O A;  2VA0 A;  1OTE A;  3TJZ C;  2VX8 A;  1V9Z A;  1STZ A;  2PYR A;  3B42 A;  4BBU A;  2QJ7 A;  2ZMF A;  2EWV A;  2W1T A;  5HSQ A;  3ZQ5 A;  2QJ5 A;  4Y3I A;  4Q0J A;  2O9C A;  1UGU A;  3G6O A;  4HJ3 A;  3LIB A;  4I3A A;  2M1C A;  4FSF A;  4LLO B;  3O5Y A;  1G28 A;  2ZBB A;  2JKR M;  1OTB A;  4HNB A;  4I38 A;  3T4T A;  1T1A A;  1NLZ A;  4ARZ A;  2BAS A;  3LIA A;  4MN7 A;  2ZOH A;  1T1C A;  2VLG A;  5F68 A;  4P6Z S;  2KX6 A;  1XFN A;  1YKD A;  2W27 A;  4EQ1 A;  4PKY A;  1XJ3 A;  5J7E A;  3VE4 A;  4EEP A;  2LB9 A;  4HH3 A;  3FPV A;  2GX5 A;  4L9E A;  1MKM A;  1OTA A;  1S4S A;  1P9W A;  4G3K A;  4BJP A;  4CLC B;  1S4R A;  1OJG A;  3EGX C;  3IS2 B;  4LRY C;  3KSH A;  5KIZ A;  3UMD A;  4YWZ A;  1P97 A;  4LPZ A;  2QKP A;  4HQA A;  4KQD A;  1MZU A;  5HWW A;  3LIC A;  3D72 A;  1OPX A;  1N9O A;  4EET B;  3NHQ A;  4DJ3 A;  4IHQ A;  4Y2F A;  2D02 A;  4PHT A;  3C38 A;  3F1N B;  1YSP A;  1D06 A;  1MC0 A;  2HJE A;  4MMN A;  3H9W A;  4GHI A;  3KYQ A;  3PBQ A;  3SW1 A;  1NRJ A;  4NEE D;  2ZOI A;  4L9F A;  2W3E A;  4EUV A;  3S7P A;  1LSW A;  4WLA A;  1ZTU A;  4MN5 A;  3HCY A;  5G4Y A;  3T4S A;  2WKR A;  2XRN A;  2W3H A;  4I39 A;  4DMZ A;  3VOL A;  3T4J A;  2Z6D A;  2Y8H A;  5F69 A;  3MQO A;  1DP8 A;  4HHD A;  3U2A A;  2LB5 A;  2W1T B;  2YKH A;  3EGD C;  2VGL S;  5HWV A;  2EA9 A;  4B93 A;  1ODV A;  3HJI A;  4IUH A;  3FPW A;  4BBV A;  5HPI A;  4HP4 A;  3LIF A;  3MXQ A;  4DN0 A;  4K08 A;  1GSW A;  1S66 L;  3H7W B;  5J3W A;  4WN5 A;  1ZHH B;  4WEK A;  1H8M A;  2XSS A;  1BYW A;  1N9L A;  2O0Y A;  5HPF A;  2O9B A;  1OTD A;  4ARZ B;  4KUO A;  4EU0 A;  3OCN A;  3DBA A;  5DF9 A;  4MN6 A;  4O8G A;  2L0W A;  4Q0I A;  2XA7 S;  3OCL A;  2FH5 A;  1GSV A;  1DP9 A;  4XT2 B;  1F5M A;  4AFI A;  3KSG A;  1XJ4 A;  2K7S A;  2O9A A;  4WUJ A;  2ZMV A;  2B02 A;  1JNU A;  3PBO A;  1TS6 A;  3K3C A;  3PYP A;  4JGR A;  3FG8 A;  3H7W A;  4CLC E;  5HZH A;  4QPR A;  1D7E A;  2OOL A;  3KX0 X;  4G3V A;  2GNX A;  1NLY A;  3C30 A;  3E98 A;  4HP9 A;  4OOM A;  1XJ2 A;  4L9G A;  3UB6 A;  4ME4 A;  4I3I A;  2INW A;  2B18 A;  3UME A;  5DKL A;  2HV1 A;  2CMN A;  2R78 A;  1NWZ A;  3E4P A;  3S7N A;  4WEJ A;  3T4L A;  2L1M A;  3LR5 A;  3UB9 A;  3A0S A;  3F1P A;  3MJQ A;  4EXO A;  2VZW A;  4GHI B;  3BWL A;  4UEY A;  4Y5F A;  3LUQ A;  2QHK A;  2W3G A;  2A24 A;  5FL3 A;  2W3D A;  4FOF A;  2MJ6 A;  3BQ8 A;  3CUE C;  1X0O A;  2KDK A;  4XT2 A;  3T4Q A;  5HDD A;  2JKT M;  2NUP C;  2G7U A;  4DJ2 A;  1S1Z A;  2L4R A;  4NKP A;  4ZRR A;  4ETX A;  2PR5 A;  5DKK A;  1IOU A;  3MQQ A;  3KO6 A;  3LI8 A;  5F5Y A;  3VV4 A;  3EEH A;  4F3L A;  4UQI M;  4G3W A;  1EW0 A;  1OTI A;  3R4K A;  1T1B A;  4YOF A;  1W63 Q;  1LSV A;  5F6A A;  2I9V A;  4CLC D;  1GSX A;  3UB7 A;  1WA9 A;  2NUT C;  2D01 A;  1OT6 A;  2V0U A;  3TE8 A;  4H6J A;  5TBM A;  5AVE A;  2J3W A;  2JKT I;  1VHM A;  3HJK A;  2W1R A;  2Y79 A;  4BBT A;  3A0R A;  4NXB A;  2V1A A;  4BMW A;  3R7W A;  1N9N A;  3RH8 B;  3JVV A;  2OWH A;  1Y28 A;  5KSH A;  2Z6C A;  3B33 A;  3KSI A;  1H3Q A;  2W3F A;  3ZYT A;  4NXG A;  3V67 A;  4O01 A;  3EEA A;  3MQ0 A;  3CLO A;  1TS0 A;  5HDC A;  5DJT A;  2PT7 A;  3PBS A;  2HGV A;  5A8B A;  3D3O A;  3LYX A;  5J4E A;  5HDS A;  3OC2 A;  2VKS A;  4GW9 A;  4O0P A;  4BWI A;  3BJN A;  3T4O A;  5IS1 A;  4HY8 A;  3TW8 A;  3IBJ A;  4R6L A;  2IA2 A;  1UWP X;  3CIT A;  4NXE A;  2EWW A;  4MCW A;  1TF1 A;  3E0Y A;  3IBR A;  2J3T D;  1TS7 A;  1S67 L;  1YAX A;  3CI6 A;  3EQU A;  3VE3 A;  4R38 A;  2PYP A;  4RQ9 A;  3NOU C;  3F1P B;  3LR3 A;  3MFX A;  4I5S A;  4M4X A;  4HIA A;  3BQA A;  2VV6 A;  2A24 B;  1T19 A;  3CUE A;  3LID A;  4EES A;  1LL8 A;  4EW7 A;  3LI9 A;  3W2Z A;  3BY9 A;  1OJ5 A;  3T50 A;  4P6Z M;  2GJ3 A;  1LT0 A;  2PHY A;  4JGQ A;  4L0L A;  4Z1W A;  4MDZ A;  2KOI A;  4F3L B;  3PBT A;  4JGP A;  2M7U A;  1UWN X;  4WF0 A;  4R70 A;  2DMW A;  1DRM A;  4HH2 A;  3B47 A;  4CLC C;  1P9R A;  5IU1 A;  1F98 A;  3LFV A;  2GZA A;  4LRZ E;  3LR0 A;  5HD5 A;  5I5L A;  1W63 M;  3A0V A;  3C8C A;  2OAQ 1;  2KLI A;  4II7 A;  3BY8 A;  5HL6 A;  5LBR A;  4EER A;  4R3A A;  5C5K A;  4H6J B;  5TBM B;  3KYZ A;  4GS9 A;  2J80 A;  4NXF A;  3OBF A;  5G4Z A;  3MR0 A;  3K2N A;  4IUK A;  1P0Z A;  5TJJ A;  3NOP C;  1V9Y A;  3R7W B;  2WKP A;  4HJ6 A;  2HJ9 C;  5DFY A;  1TS8 A;  3FC7 A;  4WEL A;  3GDI A;  3CWF A;  4WL9 A;  5AVF A;  2VJW A;  5DJU A;  5CX7 A;  3NJA A;  5IT5 A;  3P01 A;  4GLQ A;  2QYB A;  3TRC A;  1YSQ A;  2OWJ A;  4PAU A;  3F1O A;  5MC7 A;  1KOU A;  4E04 A;  1T18 A;  2PD7 A;  2P08 A;  4I3J A;  2W0N A;  5HWT A;  3PXP A;  2H28 A;  4HI4 A;  3PBN A;  3RTY A;  2VEA A;  2JKR I;  2OAP 1;  1VB6 A;  2PDR A;  2XRO A;  1TD5 A;  2J3T C;  4OOL A;  2VGL M;  3BW6 A;  2HF6 A;  1OT9 A;  2A2L A;  1LSX A;  5DFX A;  4PKY G;  4HJ4 A;  2VV8 A;  3NOT C;  3LR4 A;  3PBR A;  3PHY A;  2P04 A;  3H82 B;  4EEU A;  4B9O A;  4IJG A;  3MMH A;  1F9I A;  3OLO A;  2PD8 A;  4ETZ A;  2P7J A;  1DP6 A;  3OOV A;  5K5B A;  3K3D A;  3S7Q A;  4UQI S;  3JVU A;  5AJG A;  2VV7 A;  2FZ0 A;  4JGO A;  3KSF A;  2JHE A;  1IFQ A;  3GEC A;  2XA7 M;  3EOI A;  4CLC A;  1XFQ A;  2PR6 A;  3E4Q A;  5EFW A;  3EQV A;  3IS2 A;  4GCZ A;  3MF0 A;  4CQH A;  2V1B A;  3C2W A;  4YNR A;  4GJ4 A;  2O99 A;  3PR6 A;  4GS9 B;  2V9A A;  3UE3 A;  3ULF A;  3S7O A;  3LIE A;  4KQO A;  4Q0H A;  2M7V A;  3H82 A;  1S1Y A;  3CAX A;  3F1N A;  3RFB A;  1XJ6 A;  4LRX C;  3ICY A;  3P7N A;  5HD3 A;  3UB8 A;  3EWK A;  3E4O A;  3T4K A;  2K31 A;  2V0W A;  5L8M A;  4HOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...