5HWVA

Crystal structure of pas1 complexed with toluene
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
124
structure length
124
Chain Sequence
ALYEFVGLLDAHGNVLEVNQVALEGGGITMEEIRGKPFWKARWWQISKKTEATQKRLVETASSGEFVRCDVEILGKSGGREVIAVDFSLLPICNEEGSIVYLLAEGRNITDKKKAEAMLALKNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase TodS
publication title Molecular Insights into Toluene Sensing in the TodS/TodT Signal Transduction System.
pubmed doi rcsb
source organism Pseudomonas putida (strain f1 / atcc 700007)
molecule tags Transferase
total genus 36
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 5hwvA00
4MN5A 3PYPA 1OTEA 4NXFA 3VE4A 5G4YA 1Y28A 1VB6A 5TBMA 2L0WA 2D01A 4HH3A 3UMDA 3SW1A 3FG8A 2JHEA 1D7EA 1OJ5A 2H28A 2EA9A 3F1NA 4HJ3A 4HI4A 2YKHA 1LL8A 2A24A 2WKPA 3VOLA 4H6JB 5AVEA 1T1CA 4L9GA 5HWWA 5J7EA 2WKQA 4F3LB 3HJIA 4EETB 1D06A 3MFXA 2W0NA 5J4EA 5HDDA 4L9FA 5AVFA 5HWTA 4HY8A 1F98A 2QJ5A 3C2WA 4GW9A 2PYRA 4XT2B 4EESA 2OWHA 1GSWA 4JGQA 1XJ4A 3GDIA 3MQOA 1EW0A 4WUJA 3H7WB 4GHIA 5F69A 1TS8A 1OT9A 1S1YA 1DRMA 3C8CA 3MXQA 4DJ3A 3LIBA 4EEUA 5DJTA 3NOUC 4PKYG 1P0ZA 4R38A 3UB7A 1JNUA 4GS9B 4WL9A 1V9YA 4WN5A 1F9IA 4R6LA 3UB6A 3ZQ5A 2YKFA 4HJ4A 3OLOA 5DKLA 1S4RA 5J3WA 1T1BA 2OOLA 2PD8A 3NOPC 2PD7A 4BBUA 4LRZE 1UWNX 4GCZA 2K7SA 3LYXA 1N9OA 2I9VA 1LSXA 1OTIA 4I3IA 3F1OB 4I38A 2J80A 1MZUA 1LT0A 5EFWA 3E4PA 5HDCA 2VV6A 4HP9A 1GSXA 1T19A 2VV8A 3KX0X 4HP4A 4LRYC 3FC7A 1T1AA 1N9NA 2PR5A 3G6OA 1XJ3A 3F1PB 1UWPX 1T18A 4M4XA 5IS1A 4H6JA 2L4RA 4LRXC 4YWZA 3BY8A 3LICA 2M1CA 4R3AA 3CLOA 3RTYA 3MJQA 4EW7A 4F3LA 1TS7A 2ZOIA 3ULFA 1S66L 4NXBA 2INWA 3E4QA 3LIDA 1XJ2A 5HZHA 1TS6A 3P7NA 1KOUA 4XT2A 4KQDA 4KUKA 2QKPA 4PKYA 4LLOB 3NJAA 4DJ2A 2PYPA 1DP8A 5F68A 3H82B 2PDRA 3H9WA 3IS2B 3BY9A 3T50A 2V0UA 2Z6CA 3A0RA 3LI8A 3H7WA 3NHQA 1S67L 2ZOHA 5G4ZA 2W27A 5DJUA 5HD3A 2CMNA 2OWJA 1LSVA 1XJ6A 1X0OA 1GSVA 4HH2A 2ZBBA 3EEHA 4HOIA 1LSWA 4WLAA 4GS9A 2QJ7A 5I5LA 1DP6A 2BASA 2D02A 5F6AA 4HHDA 5HSQA 4MN6A 3CWFA 4EQ1A 4RQ9A 2PR6A 3UB9A 2VLGA 3LI9A 4I3JA 4NXEA 3EWKA 1WA9A 3BWLA 4L9EA 2WKRA 3NOTC 4HQAA 5IU1A 3F1OA 2B02A 5TBMB 3UMEA 3K3CA 2P7JA 3LIEA 3VE3A 5HD5A 1S1ZA 4K08A 5HDSA 4JGPA 2PHYA 5DKKA 3F1NB 3MR0A 2JN7A 1ODVA 4HIAA 2A24B 1OTDA 1XFQA 3F1PA 5F5YA 1OJGA 2L1MA 5HWVA 4EXOA 2V1BA 3UB8A 4HJ6A 4LPZA 3K3DA 1OT6A 1S4SA 3B33A 4B9OA 3RH8B 3GECA 1NWZA 1DP9A 1UGUA 4I5SA 4BBVA 4KUOA 3D72A 4EEPA 1OTBA 2QWSA 1BYWA 3PHYA 2HV1A 2V9AA 3HJKA 2VV7A 3LUQA 3MQQA 3H82A 3IS2A 2GJ3A 4GHIB 4EERA 2R78A 2V1AA 4HNBA 1TS0A 1V9ZA 3LIAA 1OTAA 3A0SA 4BBTA 2VEAA 1XFNA 3A0VA 3LIFA 2QHKA 3ICYA 5A8BA 1G28A 2V0WA 3E4OA 1N9LA 1P97A 3CAXA 5KIZA 4E04A 4R70A 2KX6A 4JGRA 2KDKA 3UE6A 4NXGA 4JGOA 4WF0A 3IBRA 2Z6DA 4I3AA 4I39A
chains in the Genus database with same CATH superfamily
2PBDP 5FAPA 4LCLA 1XA1A 4KZAA 3FZCA 4ETZA 2JE5A 3SH9A 2WGWB 2DNSA 4GDBA 4HJ3A 4HI4A 3DTIA 4BD1A 3E2LA 3T4QA 1XX2A 3MBZA 1K55A 1P9WA 5AVEA 3MZEA 3MXRA 2OLUA 4YFMA 1LL9A 3ZVTA 4L9GA 5J7EA 4GLQA 4JF4A 4UA9A 1J3WA 2UWXA 4WMCA 3UPOA 2LB9A 3Q7VA 4F3LB 4PM7A 4Q8IA 1D06A 3MFXA 4MMNA 1HVBA 5FQ9A 4K0WA 5HDDA 3LEZA 3KYQA 1MWRA 4FTXA 4CQHA 1LLBA 4GZBA 4GJ4A 1KVLA 3C2WA 4GW9A 4IBXA 2VJWA 4C3QA 4S2NA 5K5BA 4JF6A 5E2FA 1XJ4A 3BQAA 5CGWA 2X71A 3W4OA 1VQQA 2HDUA 1TDGA 2P08A 4B4XA 5F69A 4IUKA 1OT9A 1Q2PA 1S1YA 3VP0A 4G3KA 4S2KA 4E3MA 3MXQA 4DJ3A 4JLFA 2WK0A 3N4IA 2P9VA 2BG1A 4DF6A 5KSHA 4BJPA 1P0ZA 3E98A 5HPFA 1YPRA 2H0TA 3HLBA 4WL9A 4R6LA 5CTNA 3UB6A 3UN7A 1NLYA 1GA0A 5J8XA 1S4RA 1T1BA 2PD8A 3V3SA 4GKUA 4BBUA 2WZXA 1Y4OA 2K7SA 2NUPC 1OMEA 1CK3A 5BOHA 3T4SA 1G5UA 4MLLA 3G30A 1JWPA 3F1OB 5AQ9A 4DE2A 5AQAA 1YLJA 3OPRA 3E4PA 3UE1A 5C5KA 4DE0A 2EX2A 1T19A 4QY5A 3KX0X 4LRYC 2WAFA 3HLWA 1T1AA 1QMEA 1IYSA 1FR6A 5DF9A 3G6OA 3O87A 5EM1A 5IS1A 4H6JA 5DTSA 4DE3A 1W8QA 2PT7A 1FCOA 5FQMA 1WE4A 3MMHA 4FSFA 5FL3A 1RCJA 1E3UA 3N8SA 5LBRA 3JVVA 3R7WA 4EUZA 4EU0A 3RXXA 1GHIA 3WS5A 4X25A 2WKIA 2ZM2A 1TS7A 4FOFA 4DN0A 3ULFA 4NXBA 4ETXA 3BYDA 2INWA 2W1TA 1PI4A 3CI6A 3QP2A 3VFHA 1TS6A 1N4OA 1IYPA 2QKPA 1Z09A 4LLOB 4DJ2A 1DP8A 3CJMA 1CF0A 3L7HA 2JKTM 4JF5A 3NULA 1YLZA 1S67L 4ARZB 1YT4A 5FAOA 4XXRA 3FPWA 3CHWP 2Y2HA 3WS4A 3NDGA 1MWSA 3V67A 3GR2A 1LSVA 5EVIC 4BL2A 2Y55A 1GSVA 4ZBEA 5EVIB 3NY4A 3HVFA 1LSWA 4R1GA 1YLYA 2ZMFA 5KZHA 2A3UA 3BFFA 2D02A 4IEDA 4OLGA 1K54C 4HHDA 1MY8A 1TEMA 5CECA 2E8JA 4WZ5A 2ZQCA 1RGYA 2QYBA 1K38A 1A0KA 2PR6A 3UB9A 2X02A 1STZA 4NXEA 3EWKA 3TE8A 1WA9A 2WKRA 2B5RA 3NOTC 4BD0A 4IVIA 5DTKA 3SH8A 3NBLA 3RJUA 4KZ9A 3K3CA 5CGSA 3S4XA 2P7JA 3BJNA 4RVAA 1TDLA 1IYQA 5FEFA 4K08A 1NLZA 4S2PA 5DKKA 4WEKA 2JN7A 1I2WA 3I7JA 4HIAA 3HREA 1K55C 3IH9A 1XFQA 4RYEA 1SKOA 3AGFA 3F1PA 2HGVA 3QP8A 4DKIA 1K0KA 4WYYA 4FH2A 1LL5A 5TGFA 3UE0A 1H8YA 3T4TA 5HWVA 2W3DA 4NKPA 1YSPA 3T1RA 2HPBA 3PAEA 3VP3A 4HJ6A 4PPRA 1K57A 3Q7VB 4Z1WA 2EWWA 4M3KA 4II7A 4OQGA 2E8IA 1S4SA 5E43A 4D60A 3B33A 2FH5A 1ZG4A 3RH8B 3HLFA 4KQOA 3V3RA 1DP9A 4K91A 1SDEA 4I5SA 3ZNYA 4GN2A 4S2NC 4QY6A 5EPHA 4EUVA 1VHMA 5GLCA 4OKPA 3NCKA 3BECA 1BYWA 4N9LA 3H82A 3IS2A 3P01A 4YINA 2ZMAA 2R78A 2WZZA 2WUQA 3IXHA 1V9ZA 2EXAA 3VMAA 4Y13A 1XGJA 1OTAA 2ZD8A 2P9VB 1BZAA 4OPZA 3NIAA 5FAQA 3ZNTA 4S2OA 1ALQA 3VSLA 4QU3A 4WMCD 3M2JA 3ICYA 4P6BA 2W3HA 4LCMA 1G28A 3BM6A 5EUAA 1FCMA 3E4OA 2XFTA 3NI9A 2XA7M 5FDSA 1MWTA 3LR4A 4E04A 3RXWA 2XR0A 3HLCA 2QPNA 3MS6A 1BLCA 2KDKA 4QPRA 3UE6A 4MCWA 1IKIA 5TR7A 2Y79A 3PYPA 2HDQA 5G4YA 1Y28A 1VB6A 2L0WA 4UHUA 3V50A 4HH3A 3HLDA 5GL9A 4MDZA 4O0PA 2EA9A 3F1NA 4JKTA 1PZOA 2WKPA 2XSSA 4EQIA 4X56A 4H6JB 1NJ4A 3T1SA 2A49A 2EFXA 2ZC3B 3KYZA 3R7WB 2WKQA 3UE3A 2JKFA 5EV0A 4B88A 3VV4A 3HJIA 4EETB 1KGEA 1Y54A 2IWCA 2W1TB 4KZ6A 4OVDA 3QNBA 1GHMA 2HDSA 3DWKA 5CERA 1F98A 3QP1A 2V8FA 2PYRA 3R4KA 3C7UA 4RX2A 3G34A 1HTZA 3E0YA 3T1XA 2OWHA 4UA7A 4PAUA 3T1QB 2J3TC 1SZVA 4NETA 4PM8A 2B18A 2K2NA 3SS3A 4WUJA 2PRFA 4ZTKA 3IWQA 3C7VA 4NG2A 4NEED 5F1FA 5A92A 2B95A 2V20A 2XFSA 3IXBA 1J9MA 2DRWA 4E3JA 3UDXA 1CQAA 5CX7A 1E3UD 3BFCA 1CI9A 4ZRRA 4DXBA 5EVIA 2Q0OA 3BFDA 3P09A 1H8ZA 2VK3A 2VA0A 5GHYA 3IWIA 1BSGA 3EOIA 1GA9A 1KDSA 3G35A 1RP5A 5AQ7A 3ZQ5A 5DKLA 5J3WA 3O88A 3U4LP 1K4FA 4IVKA 1UWNX 1W79A 2O9BA 5FSRA 3M6BA 2JCHA 5KMWA 1FSYA 2I9VA 4X55A 1LSXA 2XK1A 3HUNA 1OTIA 1EI5A 3LEQA 4I3IA 3W4PA 2HP6A 2J3TD 2J80A 3IF6A 1XKZA 4RA7A 3MSHA 3GV9A 1L3LA 1M40A 3JYIA 1GHPA 4A5RA 2GNXA 2ZQ8A 4HP4A 3IXGA 4Y2FA 3JPUA 1N9NA 4DE1A 3ISGA 5EECA 4E3OA 1SKOB 1MBLA 3F1PB 4CLCA 4Y7PA 5M1AA 4M4XA 2ZM8A 2FFYA 5DTTA 2L4RA 3PBNA 4YWZA 5FI6A 4P0MA 1PIOA 3LICA 1K57C 4Q0HA 4JXWA 4R4SA 4R3AA 3BFEA 3RTYA 1CI8A 3MJQA 4HBTA 2Y2KA 3VSKA 5I94A 1S66L 1ZC2A 3N6IA 3GQZA 3EQUA 4GDNA 3VP2A 3KSHA 3KSFA 1DY6A 4GD6A 3ZFZA 3N8LA 4WEJA 2RL3A 3FKWA 3NJAA 3LCEA 5F68A 3H82B 1F5MA 3H9WA 3IS2B 5GLDA 5HAPA 2ACGA 1PW1A 2V0UA 3S7NA 4FD8A 4X1LA 4PM9A 3LI8A 2JKGA 1I2SA 3NHQA 3L9KA 4E3NA 5CHMA 3LO7A 4Y0UA 4PM5A 1NYMA 3UNWA 2P04A 3HUOA 5M18A 3GTCA 4ZJ2A 3T4KA 4QB8A 5HD3A 2OWJA 2KLIA 4WM9A 1IYOA 1X0OA 4O8GA 2JKRI 3SOIA 4GS9A 1XP4A 1K25A 1PYYA 3PBTA 2BASA 4KZ3A 5HSQA 5E2EA 5FQJA 1JTGA 5EE8A 5EOOA 3W4QA 4I3JA 2R9XA 3QP4A 5F82A 1AWIA 2Y4AA 2XH9A 4OONA 1DJBA 1Q2QA 3S7PA 4IBRA 1K6RA 3UPNA 1XPBA 1XXMA 5HDSA 4JGPA 2PHYA 3F1NB 4OQHA 1G6AA 1ODVA 5F1GA 3FKVA 4BL3A 2RCXA 2XD1A 1OTDA 4R3JA 4HBUA 2V1ZA 3T4OA 1BTLA 5F5YA 3WWXA 4PMAA 1NRFA 1PNEA 5CHJA 3O5YA 5FI2A 2HP5A 2IWBA 3ZG7B 4PM6A 5HW3A 4QD4A 1FCNA 4R4RA 3HLEA 4B9OA 4E3LA 2XF3A 1NWZA 2PBYA 1UGUA 4JXVA 2Q9MA 5D3OA 2M7VA 1CJFA 4KUOA 1XGIA 2Y2OA 3LY4A 4OPQA 1K56A 1LI0A 2OAP1 2EX6A 3JVUA 5AJGA 1ESIA 2H0YA 3MQQA 3SS4A 4U0XA 1KDWA 4LV3A 3DBAA 2UV0E 3W8KA 2NUTC 3OPHA 3Q07A 2K31A 1ERQA 4S2JA 1YKDA 3FPVA 2BTFP 3LIAA 1YMXA 3A0SA 2XEPA 3EQVA 4E6WA 3EGDC 5L8MA 3K2NA 2VGKA 4B4ZA 1BLSA 3LIFA 5L2FA 5A8BA 1ZHHB 4Y17A 1VETA 1IELA 5U47A 3PAGA 1W7FA 2Y59A 4EBLA 4R70A 2KX6A 2J9PA 5FEGA 4LENA 1YSQA 4JGOA 4WF0A 3IF6C 2Z6DA 4I3AA 4S2MA 4X6TA 2OAQ1 4I39A 3IF6B 1OTEA 4NXFA 4MBHA 3IHBA 5JYPA 1P9RA 2QMIA 2D01A 1H0MA 4KZ5A 3UMDA 3SW1A 3FG8A 2JHEA 1JWVA 1D7EA 1OJ5A 2H28A 4HEFA 4OP5A 3IHAA 4CLCC 2YKHA 4CLCB 1G6OA 1LL8A 1ZKJA 3VOLA 4LV2A 1T1CA 5EVID 4HESA 2JKRM 3MFDA 5GHZA 1BLPA 3NC8A 4IJGA 2WKHA 3A3FA 3N8RA 3D9YA 4E3IA 5FI7A 3UY6A 1EROA 1I5QA 3D3OA 3V5MA 3TRCA 5J4EA 4L9FA 2O9AA 5HL1A 4S2IA 4Y3IA 1L0FA 4P87A 3CG5A 2XDMA 3BRMA 2QJ5A 3OBFA 4B93A 3MKFA 3ZG5A 1GSWA 2OLVA 4JGQA 1O7EA 3GDIA 2LB5A 1W5DA 1EW0A 4DDSA 4BLMA 1BUEA 2AVXA 3WRTA 2QZ6A 2WYXA 4CLCD 1MPLA 5F83A 3C4PA 2XA7S 1DRMA 1U60A 3IF5A 1G68A 4OQIA 3LIBA 2Y91A 2M7UA 2ZC7A 5CEBA 2ZL1A 3BLSA 3UB7A 1FOFA 2FFFB 4GS9B 1V9YA 4WN5A 1F9IA 4XUXA 3DTEA 1BT5A 4K0XA 5HX9A 1MKIA 2ZC5B 4MEZA 2P74A 4O7DA 1H5XA 2Y2IA 1W8YA 2ZC6B 2PD7A 4LRZE 1PI5A 1NXYA 1MXOA 3KSGA 4WZ4A 1JWZA 1ES4A 1F2KA 1PWDA 4I38A 1MZUA 1PWGA 3TW8A 2VV6A 3PXPA 3CMZA 5DFXA 1VM1A 3C4OA 1ESUA 3FC7A 3G31A 2Y8HA 1UWPX 1T18A 2VKSA 3GVBA 5GLAA 3BY8A 1PWCA 2M1CA 5HAQA 3CLOA 2KOIA 3ZGAB 5CEDA 5DF8A 4ME4A 2O0YA 5CHUA 2XROA 3C38A 1XJ2A 2R9WA 3O3VA 1S6RA 1ES3A 4MBFA 3BQ8A 2VX8A 5CRFA 4LGWA 4XT2A 4ESPA 1KVMA 2W3EA 3A3IA 1TD5A 5CXWA 3UB5P 3HLGA 3IX8A 4DRTA 1ONHA 3BY9A 3T50A 3A3DA 3A0RA 3ITBA 3H7WA 2VGLS 5HFOA 4UEYA 4ZJ3A 5G4ZA 2W27A 1PFLA 5DJUA 2V2FF 3FYZA 2CMNA 4RX3A 1XJ6A 3MKEA 4HH2A 4WLAA 1VETB 1KGFA 2HJ9C 4P85A 2VGLM 3ZVWA 4BMWA 1NYYA 3ZG8B 5I5LA 5DF7A 1IFQA 1H3QA 1L0GA 3CWFA 3Q7ZA 3WS2A 2MJ6A 2VLGA 3HBRA 4OQ0A 2ZQDA 1KE3A 2EX9A 1K56D 1NY0A 1FILA 4HQAA 4UA6A 3VP1A 1YQSA 3UPPA 1M6KA 4YNRA 2PAVP 2Y2MA 4GB7A 3MF0A 3UO9A 2FZ0A 1IOUA 1O07A 5CTMA 3T12B 1PZPA 1DJAA 5HD5A 2Y2QA 3TJZC 1N9BA 2G2WA 3PBSA 1EWZA 5TJJA 4F94A 4KENB 4N9KA 2Q9NA 4AFIA 3LR3A 1MKMA 2JKTI 4KG2A 1OJGA 3LR0A 4YOFA 3CITA 2ZLYA 2L1MA 2IA2A 3G32A 1SDNA 3UB8A 4LPZA 3K3DA 3SS5A 1SKFA 1YMSA 3GSGA 2EXBA 4X53A 4MN7A 4Q0IA 1HD8A 4BBVA 2WGIA 3D72A 4EEPA 2WADA 1OTBA 3AGEA 4BENA 1LI9A 2J9OA 1XA7A 2GDNA 2QWSA 2XD5A 3MXSA 3HJKA 1YM1A 3M6HA 4N1XA 3OC2A 1TVFA 3S1YA 3CUEA 3Q82A 4EWFA 2GJ3A 2A2LA 4DMZA 4EERA 2V1AA 4JXGA 3S7QA 1TS0A 3PBOA 5DVAA 4OPYA 3BFGA 2OV5A 1XFNA 1E25A 5IHVA 2ZL1B 2ZM0A 2WKEA 2GX5A 3ZG0A 2GZAA 4LV1A 1SCWA 3HL9A 2V0WA 1PW8A 4H8RA 1N9LA 1P97A 2Y2GA 4KZBA 1SHVA 4C75A 3ZG9B 3T4LA 3C5AA 1KGGA 4JGRA 4KG6A 2ZQ9A 4EBPA 4BQMA 4GD8A 1BULA 2G2UA 4OPRA 3VFFA 1NRJA 4ZAMA 3B3XA 5TFQA 3CPTA 4MN5A 2ZQAA 3VE4A 3QP5A 3WS0A 5TBMA 4G3WA 4ZJ1A 3M2KA 3TOIA 3QHYA 1ONGA 3OCLA 4OOLA 2W3FA 1L0DA 2A24A 3NDEA 3DTKA 4Y15A 1WYCA 4OOYA 2EX8A 5HL6A 3HCYA 3IT9A 2C6WB 2J8YA 4LV0A 3U2AA 5EVEA 5HWWA 3KSIA 2Y2LA 1ES2A 4IUHA 4E3KA 1FIKA 2ZJ9A 1C3BA 2VGJA 4ID4A 2W1RA 2IWDA 3WRZA 3OZHA 3IQAA 2W0NA 3A3JA 3FWLA 3PTEA 5AVFA 2HDRA 5HWTA 4HY8A 1BLHA 1FSWA 4XT2B 4EESA 2JBFA 3OPPA 2DMWA 5EOEA 3OPLA 5FQIA 5L07A 4OH0A 3LY3A 1VEUA 4FCFA 3PR6A 2X01A 3ZHHA 3MQOA 2OSUA 3H7WB 2XRNA 4GHIA 3Q81A 1TS8A 4KZ7A 1Z6FA 5A93A 3G2YA 3C8CA 5HARA 5JYOA 2C5WB 4KQRA 3FV7A 4Z9QA 2Y2NA 3LFVA 2J3WA 4EEUA 5DJTA 3NOUC 4PKYG 4R3BA 4KQQA 4R38A 2Y2JA 1JNUA 3SZTA 4U3TA 5FA7A 4C6YA 2CC1A 4OOMA 5E2HA 2YKFA 1QMFA 5KSCA 4WELA 4DDYA 4HJ4A 3OLOA 4WBGA 3ZDJA 2OOLA 1YLPA 2PU2A 3NOPC 1D1JA 1LHYA 4GCZA 2H10A 3GMWA 3LYXA 1ZTUA 2J7VA 4JPMA 4QHCA 3QP6A 1N9OA 4GNUA 1NZUA 2VZWA 1CEFA 4N92A 3ITAA 1LT0A 3P98A 3Q1FA 4NK3A 5EFWA 4JXSA 5HDCA 1TF1A 2DCFA 3MZDA 4HP9A 3IX3A 1GSXA 2WGWA 4R0QA 3SH7A 2VV8A 3E2KA 4DXCA 2ZMVA 2HJEA 2PR5A 3GRJA 4E6XA 4QJGA 4N1HA 1XJ3A 2I72A 1IKGA 4IHQA 3VOYA 3DAVA 4LRXC 4X1MA 4Y5FA 3O86A 2Z2LB 4JBFA 5GLBA 2XLNA 4BWIA 1IEMA 5FQKA 4X68A 5A90A 4EW7A 1AXBA 4F3LA 3EEAA 2W3GA 4CPKA 2ZOIA 5FATA 2Y2PA 3D4FA 3E4QA 3LIDA 5EVLA 4EV4A 5M19A 4PHTA 5HZHA 3P7NA 3ZYTA 1KOUA 3DW0A 1JVJA 1RGZA 3MQ0A 4KQDA 3HUMA 4KUKA 1ACFA 4PKYA 3LGOA 1JTDA 3BW6A 2HZ5A 5G18A 3CUEC 1GCEA 2PYPA 5L10A 2PDRA 5FASA 3KO6A 3ZCZA 2Z6CA 5AQBA 4Y0TA 5IT5A 4LFUA 1L2SA 3UDIA 4KZ8A 5GHXA 2G7UA 3VP4A 4L0LA 2ZOHA 1DJCA 1MC0A 3TG9A 3B42A 1CEGA 5EM0A 4Y0OA 5MC7A 3IWOA 1HLUP 1OPXA 2ZBBA 2WAEA 3EEHA 3C30A 4HOIA 1KE0A 3OOVA 3UDFA 5HPIA 3V39A 4CLCE 2QJ7A 3MZFA 4X69A 4R23A 1DP6A 4KZ4A 3KYEA 4D2OA 5F6AA 4MN6A 4EQ1A 2H5SA 4FH4A 4RQ9A 2XGNA 4S2LA 5E2GA 1W63M 1FR1A 3B47A 3LI9A 1PRQA 3BWLA 4OP8A 3BLMA 4L9EA 1WYBA 3CPTB 4QWOA 3QNCA 5IU1A 4G3VA 3F1OA 2B02A 5TBMB 3UMEA 1ZG6A 1YLTA 2Z2MB 3LIEA 3VE3A 3IX4A 3TSGA 1S0WA 5A91A 1S1ZA 3NECA 4P6ZS 5FQQA 3IBJA 3MR0A 3S7OA 1W63Q 4UQIS 2A24B 3PBQA 5FDHA 2O99A 4OLDA 3CZDA 2O9CA 1K4EA 4EBNA 1K6SA 1H8MA 4P6ZM 2EWVA 2ZC4B 4EXOA 2V1BA 4UAAA 4UQIM 4Q0JA 2PU4A 1E4DA 1L0EA 3BEBA 1ERMA 4CJNA 1OT6A 4ZDXA 5DFYA 3IXDA 2XQZA 3N7WA 3GECA 1KE4A 2HP9A 3G4PA 2EFUA 3VOZA 4FUWA 3WS1A 4GOGA 4MBKA 1VEUB 3PHYA 2HV1A 2V9AA 3EGXC 4O01A 2VV7A 3LUQA 3OCNA 2ZQ7A 3LR5A 2BLSA 3AGDA 1YAXA 3IH8A 4GHIB 5CGXA 2WGVA 1ES5A 4HNBA 3T4JA 4ARZA 4BBTA 2VEAA 1HZOA 3S22A 3A0VA 4KG5A 3DTMA 5HAIA 2QHKA 2JC7A 4U0TA 2HF6A 3PBRA 2V8CA 3A3EA 1MWUA 3G2ZA 3CAXA 1FQGA 5KIZA 3DWZA 1K54A 3W2ZA 4WZ5C 5L09A 1NZOA 4XUZA 4NXGA 3RFBA 4MNRA 3IBRA 1YLWA
chains in the Genus database with same CATH topology
2Y79A 4MN5A 3PYPA 1OTEA 4NXFA 3VE4A 5G4YA 1Y28A 1P9RA 1VB6A 5TBMA 4G3WA 2L0WA 2D01A 4HH3A 4ETZA 3UMDA 3SW1A 3FG8A 2JHEA 1D7EA 1OJ5A 2H28A 4MDZA 4O0PA 2EA9A 3OCLA 3F1NA 4HJ3A 4HI4A 4CLCC 4OOLA 2W3FA 2YKHA 4CLCB 1G6OA 1LL8A 2A24A 2WKPA 2XSSA 3T4QA 3VOLA 4H6JB 1P9WA 5AVEA 1T1CA 5HL6A 3HCYA 4L9GA 3U2AA 5HWWA 3KYZA 3R7WB 2JKRM 3KSIA 5J7EA 4GLQA 4IUHA 2WKQA 3UE3A 4IJGA 2LB9A 3VV4A 4F3LB 3HJIA 4EETB 1D06A 3D3OA 3MFXA 4MMNA 2W1RA 3TRCA 2W0NA 5J4EA 5HDDA 4L9FA 2O9AA 5AVFA 2W1TB 4Y3IA 3KYQA 5HWTA 4HY8A 4CQHA 1F98A 4GJ4A 2QJ5A 3C2WA 4GW9A 2PYRA 3R4KA 3OBFA 4XT2B 4EESA 2VJWA 2DMWA 3E0YA 4B93A 2OWHA 4PAUA 2J3TC 1GSWA 2B18A 5K5BA 4JGQA 1XJ4A 3BQAA 3PR6A 2K2NA 2LB5A 3GDIA 3MQOA 1EW0A 4WUJA 2P08A 3H7WB 2XRNA 4GHIA 5F69A 1TS8A 4IUKA 4CLCD 1OT9A 1S1YA 4NEED 4G3KA 2XA7S 1DRMA 3C8CA 3MXQA 4DJ3A 3LIBA 5CX7A 5KSHA 3LFVA 4ZRRA 2M7UA 2J3WA 4EEUA 5DJTA 3NOUC 4PKYG 4BJPA 3E98A 1P0ZA 5HPFA 4R38A 2VA0A 3UB7A 3EOIA 1JNUA 4GS9B 4WL9A 1V9YA 4R6LA 1F9IA 4WN5A 3UB6A 4OOMA 1NLYA 3ZQ5A 2YKFA 4WELA 4HJ4A 3OLOA 5DKLA 1S4RA 5J3WA 1T1BA 2OOLA 2PD8A 3NOPC 2PD7A 4BBUA 4LRZE 1UWNX 2O9BA 4GCZA 2K7SA 2NUPC 3KSGA 3LYXA 1ZTUA 3T4SA 1N9OA 2I9VA 1LSXA 1OTIA 4I3IA 3F1OB 2VZWA 4I38A 2J3TD 2J80A 1MZUA 1LT0A 5EFWA 3E4PA 5HDCA 1TF1A 3TW8A 2VV6A 5C5KA 3PXPA 4HP9A 1GSXA 1T19A 5DFXA 2VV8A 2GNXA 3KX0X 4HP4A 4LRYC 4Y2FA 3FC7A 1T1AA 2ZMVA 1N9NA 2HJEA 2PR5A 5DF9A 2Y8HA 3G6OA 1XJ3A 3F1PB 4CLCA 1UWPX 1T18A 4M4XA 2VKSA 5IS1A 4H6JA 4IHQA 2PT7A 2L4RA 3PBNA 4LRXC 3MMHA 4FSFA 4Y5FA 4YWZA 5FL3A 3BY8A 3LICA 2M1CA 5LBRA 3JVVA 4Q0HA 3R7WA 4BWIA 4EU0A 4R3AA 3CLOA 3RTYA 2KOIA 3MJQA 4EW7A 4F3LA 3EEAA 1TS7A 2W3GA 4FOFA 2ZOIA 4DN0A 3ULFA 1S66L 4NXBA 4ME4A 4ETXA 2O0YA 2XROA 2INWA 3C38A 3E4QA 2W1TA 3LIDA 1XJ2A 3EQUA 3KSHA 3CI6A 4PHTA 5HZHA 1TS6A 3P7NA 3BQ8A 2VX8A 3KSFA 1KOUA 3ZYTA 4XT2A 3MQ0A 4KQDA 4KUKA 2W3EA 2QKPA 4PKYA 1TD5A 4LLOB 3BW6A 4WEJA 3NJAA 4DJ2A 3CUEC 2PYPA 1DP8A 5F68A 3H82B 1F5MA 2PDRA 3H9WA 3IS2B 3BY9A 3KO6A 3T50A 2V0UA 3S7NA 2Z6CA 2JKTM 3A0RA 3LI8A 5IT5A 3H7WA 3NHQA 2G7UA 1S67L 4L0LA 4ARZB 2ZOHA 2VGLS 1MC0A 3B42A 4UEYA 2P04A 3FPWA 5G4ZA 2W27A 5DJUA 5MC7A 3T4KA 3V67A 5HD3A 2CMNA 2OWJA 2KLIA 1LSVA 1OPXA 1XJ6A 1X0OA 1GSVA 4HH2A 2ZBBA 3EEHA 4O8GA 3C30A 4HOIA 1LSWA 4WLAA 2JKRI 3OOVA 2HJ9C 5HPIA 4GS9A 2VGLM 2ZMFA 4CLCE 2QJ7A 4BMWA 3PBTA 5I5LA 1DP6A 2BASA 2D02A 5F6AA 4HHDA 5HSQA 1IFQA 4MN6A 1H3QA 3CWFA 4EQ1A 4RQ9A 2MJ6A 2QYBA 2PR6A 3UB9A 2VLGA 1W63M 3LI9A 3B47A 4I3JA 1STZA 4NXEA 3EWKA 3TE8A 1WA9A 3BWLA 4L9EA 2WKRA 3NOTC 4HQAA 5IU1A 4G3VA 3F1OA 4YNRA 2B02A 5TBMB 3UMEA 3K3CA 3MF0A 2FZ0A 2P7JA 3BJNA 1IOUA 3S7PA 3LIEA 3VE3A 5HD5A 1S1ZA 4K08A 5HDSA 3TJZC 1NLZA 4JGPA 3PBSA 2PHYA 4P6ZS 3IBJA 5DKKA 3F1NB 3MR0A 2JN7A 1W63Q 4WEKA 1ODVA 3S7OA 4HIAA 5TJJA 4UQIS 2A24B 3PBQA 2O99A 4AFIA 1OTDA 3LR3A 1XFQA 3F1PA 1MKMA 2HGVA 2JKTI 2O9CA 3T4OA 5F5YA 1OJGA 3LR0A 4YOFA 3CITA 1H8MA 4P6ZM 2EWVA 2L1MA 3T4TA 2IA2A 5HWVA 2W3DA 4NKPA 4EXOA 1YSPA 2V1BA 4UQIM 4Q0JA 3UB8A 3O5YA 4HJ6A 4LPZA 3K3DA 4Z1WA 2EWWA 4II7A 1OT6A 1S4SA 5DFYA 3B33A 2FH5A 4B9OA 3RH8B 4KQOA 4MN7A 3GECA 1NWZA 1DP9A 4Q0IA 1UGUA 4I5SA 2M7VA 4BBVA 4KUOA 3D72A 4EEPA 4EUVA 1OTBA 1VHMA 2OAP1 2QWSA 1BYWA 3PHYA 3JVUA 5AJGA 2HV1A 2V9AA 3EGXC 3HJKA 4O01A 2VV7A 3LUQA 3OCNA 3LR5A 3MQQA 3OC2A 3H82A 3IS2A 3CUEA 3P01A 2GJ3A 1YAXA 2A2LA 3DBAA 2NUTC 4GHIB 4DMZA 4EERA 2R78A 2K31A 2V1AA 4HNBA 3S7QA 1TS0A 1YKDA 1V9ZA 3FPVA 3LIAA 3T4JA 3PBOA 4ARZA 1OTAA 3A0SA 4BBTA 3EQVA 2VEAA 3EGDC 5L8MA 3K2NA 1XFNA 3A0VA 3LIFA 2QHKA 2GX5A 3ICYA 5A8BA 1ZHHB 2GZAA 2W3HA 1G28A 2V0WA 3E4OA 2HF6A 1N9LA 3PBRA 2XA7M 1P97A 3CAXA 5KIZA 3LR4A 4E04A 4R70A 3T4LA 2KX6A 3W2ZA 4JGRA 2KDKA 1YSQA 4QPRA 3UE6A 4NXGA 4JGOA 3RFBA 4WF0A 1NRJA 3IBRA 4MCWA 2Z6DA 4I3AA 2OAQ1 4I39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN5 A;  3PYP A;  1OTE A;  4NXF A;  3VE4 A;  5G4Y A;  1Y28 A;  1VB6 A;  5TBM A;  2L0W A;  2D01 A;  4HH3 A;  3UMD A;  3SW1 A;  3FG8 A;  2JHE A;  1D7E A;  1OJ5 A;  2H28 A;  2EA9 A;  3F1N A;  4HJ3 A;  4HI4 A;  2YKH A;  1LL8 A;  2A24 A;  2WKP A;  3VOL A;  4H6J B;  5AVE A;  1T1C A;  4L9G A;  5HWW A;  5J7E A;  2WKQ A;  4F3L B;  3HJI A;  4EET B;  1D06 A;  3MFX A;  2W0N A;  5J4E A;  5HDD A;  4L9F A;  5AVF A;  5HWT A;  4HY8 A;  1F98 A;  2QJ5 A;  3C2W A;  4GW9 A;  2PYR A;  4XT2 B;  4EES A;  2OWH A;  1GSW A;  4JGQ A;  1XJ4 A;  3GDI A;  3MQO A;  1EW0 A;  4WUJ A;  3H7W B;  4GHI A;  5F69 A;  1TS8 A;  1OT9 A;  1S1Y A;  1DRM A;  3C8C A;  3MXQ A;  4DJ3 A;  3LIB A;  4EEU A;  5DJT A;  3NOU C;  4PKY G;  1P0Z A;  4R38 A;  3UB7 A;  1JNU A;  4GS9 B;  4WL9 A;  1V9Y A;  4WN5 A;  1F9I A;  4R6L A;  3UB6 A;  3ZQ5 A;  2YKF A;  4HJ4 A;  3OLO A;  5DKL A;  1S4R A;  5J3W A;  1T1B A;  2OOL A;  2PD8 A;  3NOP C;  2PD7 A;  4BBU A;  4LRZ E;  1UWN X;  4GCZ A;  2K7S A;  3LYX A;  1N9O A;  2I9V A;  1LSX A;  1OTI A;  4I3I A;  3F1O B;  4I38 A;  2J80 A;  1MZU A;  1LT0 A;  5EFW A;  3E4P A;  5HDC A;  2VV6 A;  4HP9 A;  1GSX A;  1T19 A;  2VV8 A;  3KX0 X;  4HP4 A;  4LRY C;  3FC7 A;  1T1A A;  1N9N A;  2PR5 A;  3G6O A;  1XJ3 A;  3F1P B;  1UWP X;  1T18 A;  4M4X A;  5IS1 A;  4H6J A;  2L4R A;  4LRX C;  4YWZ A;  3BY8 A;  3LIC A;  2M1C A;  4R3A A;  3CLO A;  3RTY A;  3MJQ A;  4EW7 A;  4F3L A;  1TS7 A;  2ZOI A;  3ULF A;  1S66 L;  4NXB A;  2INW A;  3E4Q A;  3LID A;  1XJ2 A;  5HZH A;  1TS6 A;  3P7N A;  1KOU A;  4XT2 A;  4KQD A;  4KUK A;  2QKP A;  4PKY A;  4LLO B;  3NJA A;  4DJ2 A;  2PYP A;  1DP8 A;  5F68 A;  3H82 B;  2PDR A;  3H9W A;  3IS2 B;  3BY9 A;  3T50 A;  2V0U A;  2Z6C A;  3A0R A;  3LI8 A;  3H7W A;  3NHQ A;  1S67 L;  2ZOH A;  5G4Z A;  2W27 A;  5DJU A;  5HD3 A;  2CMN A;  2OWJ A;  1LSV A;  1XJ6 A;  1X0O A;  1GSV A;  4HH2 A;  2ZBB A;  3EEH A;  4HOI A;  1LSW A;  4WLA A;  4GS9 A;  2QJ7 A;  5I5L A;  1DP6 A;  2BAS A;  2D02 A;  5F6A A;  4HHD A;  5HSQ A;  4MN6 A;  3CWF A;  4EQ1 A;  4RQ9 A;  2PR6 A;  3UB9 A;  2VLG A;  3LI9 A;  4I3J A;  4NXE A;  3EWK A;  1WA9 A;  3BWL A;  4L9E A;  2WKR A;  3NOT C;  4HQA A;  5IU1 A;  3F1O A;  2B02 A;  5TBM B;  3UME A;  3K3C A;  2P7J A;  3LIE A;  3VE3 A;  5HD5 A;  1S1Z A;  4K08 A;  5HDS A;  4JGP A;  2PHY A;  5DKK A;  3F1N B;  3MR0 A;  2JN7 A;  1ODV A;  4HIA A;  2A24 B;  1OTD A;  1XFQ A;  3F1P A;  5F5Y A;  1OJG A;  2L1M A;  5HWV A;  4EXO A;  2V1B A;  3UB8 A;  4HJ6 A;  4LPZ A;  3K3D A;  1OT6 A;  1S4S A;  3B33 A;  4B9O A;  3RH8 B;  3GEC A;  1NWZ A;  1DP9 A;  1UGU A;  4I5S A;  4BBV A;  4KUO A;  3D72 A;  4EEP A;  1OTB A;  2QWS A;  1BYW A;  3PHY A;  2HV1 A;  2V9A A;  3HJK A;  2VV7 A;  3LUQ A;  3MQQ A;  3H82 A;  3IS2 A;  2GJ3 A;  4GHI B;  4EER A;  2R78 A;  2V1A A;  4HNB A;  1TS0 A;  1V9Z A;  3LIA A;  1OTA A;  3A0S A;  4BBT A;  2VEA A;  1XFN A;  3A0V A;  3LIF A;  2QHK A;  3ICY A;  5A8B A;  1G28 A;  2V0W A;  3E4O A;  1N9L A;  1P97 A;  3CAX A;  5KIZ A;  4E04 A;  4R70 A;  2KX6 A;  4JGR A;  2KDK A;  3UE6 A;  4NXG A;  4JGO A;  4WF0 A;  3IBR A;  2Z6D A;  4I3A A;  4I39 A; 
#chains in the Genus database with same CATH topology
 2PBD P;  5FAP A;  4LCL A;  1XA1 A;  4KZA A;  3FZC A;  4ETZ A;  2JE5 A;  3SH9 A;  2WGW B;  2DNS A;  4GDB A;  4HJ3 A;  4HI4 A;  3DTI A;  4BD1 A;  3E2L A;  3T4Q A;  1XX2 A;  3MBZ A;  1K55 A;  1P9W A;  5AVE A;  3MZE A;  3MXR A;  2OLU A;  4YFM A;  1LL9 A;  3ZVT A;  4L9G A;  5J7E A;  4GLQ A;  4JF4 A;  4UA9 A;  1J3W A;  2UWX A;  4WMC A;  3UPO A;  2LB9 A;  3Q7V A;  4F3L B;  4PM7 A;  4Q8I A;  1D06 A;  3MFX A;  4MMN A;  1HVB A;  5FQ9 A;  4K0W A;  5HDD A;  3LEZ A;  3KYQ A;  1MWR A;  4FTX A;  4CQH A;  1LLB A;  4GZB A;  4GJ4 A;  1KVL A;  3C2W A;  4GW9 A;  4IBX A;  2VJW A;  4C3Q A;  4S2N A;  5K5B A;  4JF6 A;  5E2F A;  1XJ4 A;  3BQA A;  5CGW A;  2X71 A;  3W4O A;  1VQQ A;  2HDU A;  1TDG A;  2P08 A;  4B4X A;  5F69 A;  4IUK A;  1OT9 A;  1Q2P A;  1S1Y A;  3VP0 A;  4G3K A;  4S2K A;  4E3M A;  3MXQ A;  4DJ3 A;  4JLF A;  2WK0 A;  3N4I A;  2P9V A;  2BG1 A;  4DF6 A;  5KSH A;  4BJP A;  1P0Z A;  3E98 A;  5HPF A;  1YPR A;  2H0T A;  3HLB A;  4WL9 A;  4R6L A;  5CTN A;  3UB6 A;  3UN7 A;  1NLY A;  1GA0 A;  5J8X A;  1S4R A;  1T1B A;  2PD8 A;  3V3S A;  4GKU A;  4BBU A;  2WZX A;  1Y4O A;  2K7S A;  2NUP C;  1OME A;  1CK3 A;  5BOH A;  3T4S A;  1G5U A;  4MLL A;  3G30 A;  1JWP A;  3F1O B;  5AQ9 A;  4DE2 A;  5AQA A;  1YLJ A;  3OPR A;  3E4P A;  3UE1 A;  5C5K A;  4DE0 A;  2EX2 A;  1T19 A;  4QY5 A;  3KX0 X;  4LRY C;  2WAF A;  3HLW A;  1T1A A;  1QME A;  1IYS A;  1FR6 A;  5DF9 A;  3G6O A;  3O87 A;  5EM1 A;  5IS1 A;  4H6J A;  5DTS A;  4DE3 A;  1W8Q A;  2PT7 A;  1FCO A;  5FQM A;  1WE4 A;  3MMH A;  4FSF A;  5FL3 A;  1RCJ A;  1E3U A;  3N8S A;  5LBR A;  3JVV A;  3R7W A;  4EUZ A;  4EU0 A;  3RXX A;  1GHI A;  3WS5 A;  4X25 A;  2WKI A;  2ZM2 A;  1TS7 A;  4FOF A;  4DN0 A;  3ULF A;  4NXB A;  4ETX A;  3BYD A;  2INW A;  2W1T A;  1PI4 A;  3CI6 A;  3QP2 A;  3VFH A;  1TS6 A;  1N4O A;  1IYP A;  2QKP A;  1Z09 A;  4LLO B;  4DJ2 A;  1DP8 A;  3CJM A;  1CF0 A;  3L7H A;  2JKT M;  4JF5 A;  3NUL A;  1YLZ A;  1S67 L;  4ARZ B;  1YT4 A;  5FAO A;  4XXR A;  3FPW A;  3CHW P;  2Y2H A;  3WS4 A;  3NDG A;  1MWS A;  3V67 A;  3GR2 A;  1LSV A;  5EVI C;  4BL2 A;  2Y55 A;  1GSV A;  4ZBE A;  5EVI B;  3NY4 A;  3HVF A;  1LSW A;  4R1G A;  1YLY A;  2ZMF A;  5KZH A;  2A3U A;  3BFF A;  2D02 A;  4IED A;  4OLG A;  1K54 C;  4HHD A;  1MY8 A;  1TEM A;  5CEC A;  2E8J A;  4WZ5 A;  2ZQC A;  1RGY A;  2QYB A;  1K38 A;  1A0K A;  2PR6 A;  3UB9 A;  2X02 A;  1STZ A;  4NXE A;  3EWK A;  3TE8 A;  1WA9 A;  2WKR A;  2B5R A;  3NOT C;  4BD0 A;  4IVI A;  5DTK A;  3SH8 A;  3NBL A;  3RJU A;  4KZ9 A;  3K3C A;  5CGS A;  3S4X A;  2P7J A;  3BJN A;  4RVA A;  1TDL A;  1IYQ A;  5FEF A;  4K08 A;  1NLZ A;  4S2P A;  5DKK A;  4WEK A;  2JN7 A;  1I2W A;  3I7J A;  4HIA A;  3HRE A;  1K55 C;  3IH9 A;  1XFQ A;  4RYE A;  1SKO A;  3AGF A;  3F1P A;  2HGV A;  3QP8 A;  4DKI A;  1K0K A;  4WYY A;  4FH2 A;  1LL5 A;  5TGF A;  3UE0 A;  1H8Y A;  3T4T A;  5HWV A;  2W3D A;  4NKP A;  1YSP A;  3T1R A;  2HPB A;  3PAE A;  3VP3 A;  4HJ6 A;  4PPR A;  1K57 A;  3Q7V B;  4Z1W A;  2EWW A;  4M3K A;  4II7 A;  4OQG A;  2E8I A;  1S4S A;  5E43 A;  4D60 A;  3B33 A;  2FH5 A;  1ZG4 A;  3RH8 B;  3HLF A;  4KQO A;  3V3R A;  1DP9 A;  4K91 A;  1SDE A;  4I5S A;  3ZNY A;  4GN2 A;  4S2N C;  4QY6 A;  5EPH A;  4EUV A;  1VHM A;  5GLC A;  4OKP A;  3NCK A;  3BEC A;  1BYW A;  4N9L A;  3H82 A;  3IS2 A;  3P01 A;  4YIN A;  2ZMA A;  2R78 A;  2WZZ A;  2WUQ A;  3IXH A;  1V9Z A;  2EXA A;  3VMA A;  4Y13 A;  1XGJ A;  1OTA A;  2ZD8 A;  2P9V B;  1BZA A;  4OPZ A;  3NIA A;  5FAQ A;  3ZNT A;  4S2O A;  1ALQ A;  3VSL A;  4QU3 A;  4WMC D;  3M2J A;  3ICY A;  4P6B A;  2W3H A;  4LCM A;  1G28 A;  3BM6 A;  5EUA A;  1FCM A;  3E4O A;  2XFT A;  3NI9 A;  2XA7 M;  5FDS A;  1MWT A;  3LR4 A;  4E04 A;  3RXW A;  2XR0 A;  3HLC A;  2QPN A;  3MS6 A;  1BLC A;  2KDK A;  4QPR A;  3UE6 A;  4MCW A;  1IKI A;  5TR7 A;  2Y79 A;  3PYP A;  2HDQ A;  5G4Y A;  1Y28 A;  1VB6 A;  2L0W A;  4UHU A;  3V50 A;  4HH3 A;  3HLD A;  5GL9 A;  4MDZ A;  4O0P A;  2EA9 A;  3F1N A;  4JKT A;  1PZO A;  2WKP A;  2XSS A;  4EQI A;  4X56 A;  4H6J B;  1NJ4 A;  3T1S A;  2A49 A;  2EFX A;  2ZC3 B;  3KYZ A;  3R7W B;  2WKQ A;  3UE3 A;  2JKF A;  5EV0 A;  4B88 A;  3VV4 A;  3HJI A;  4EET B;  1KGE A;  1Y54 A;  2IWC A;  2W1T B;  4KZ6 A;  4OVD A;  3QNB A;  1GHM A;  2HDS A;  3DWK A;  5CER A;  1F98 A;  3QP1 A;  2V8F A;  2PYR A;  3R4K A;  3C7U A;  4RX2 A;  3G34 A;  1HTZ A;  3E0Y A;  3T1X A;  2OWH A;  4UA7 A;  4PAU A;  3T1Q B;  2J3T C;  1SZV A;  4NET A;  4PM8 A;  2B18 A;  2K2N A;  3SS3 A;  4WUJ A;  2PRF A;  4ZTK A;  3IWQ A;  3C7V A;  4NG2 A;  4NEE D;  5F1F A;  5A92 A;  2B95 A;  2V20 A;  2XFS A;  3IXB A;  1J9M A;  2DRW A;  4E3J A;  3UDX A;  1CQA A;  5CX7 A;  1E3U D;  3BFC A;  1CI9 A;  4ZRR A;  4DXB A;  5EVI A;  2Q0O A;  3BFD A;  3P09 A;  1H8Z A;  2VK3 A;  2VA0 A;  5GHY A;  3IWI A;  1BSG A;  3EOI A;  1GA9 A;  1KDS A;  3G35 A;  1RP5 A;  5AQ7 A;  3ZQ5 A;  5DKL A;  5J3W A;  3O88 A;  3U4L P;  1K4F A;  4IVK A;  1UWN X;  1W79 A;  2O9B A;  5FSR A;  3M6B A;  2JCH A;  5KMW A;  1FSY A;  2I9V A;  4X55 A;  1LSX A;  2XK1 A;  3HUN A;  1OTI A;  1EI5 A;  3LEQ A;  4I3I A;  3W4P A;  2HP6 A;  2J3T D;  2J80 A;  3IF6 A;  1XKZ A;  4RA7 A;  3MSH A;  3GV9 A;  1L3L A;  1M40 A;  3JYI A;  1GHP A;  4A5R A;  2GNX A;  2ZQ8 A;  4HP4 A;  3IXG A;  4Y2F A;  3JPU A;  1N9N A;  4DE1 A;  3ISG A;  5EEC A;  4E3O A;  1SKO B;  1MBL A;  3F1P B;  4CLC A;  4Y7P A;  5M1A A;  4M4X A;  2ZM8 A;  2FFY A;  5DTT A;  2L4R A;  3PBN A;  4YWZ A;  5FI6 A;  4P0M A;  1PIO A;  3LIC A;  1K57 C;  4Q0H A;  4JXW A;  4R4S A;  4R3A A;  3BFE A;  3RTY A;  1CI8 A;  3MJQ A;  4HBT A;  2Y2K A;  3VSK A;  5I94 A;  1S66 L;  1ZC2 A;  3N6I A;  3GQZ A;  3EQU A;  4GDN A;  3VP2 A;  3KSH A;  3KSF A;  1DY6 A;  4GD6 A;  3ZFZ A;  3N8L A;  4WEJ A;  2RL3 A;  3FKW A;  3NJA A;  3LCE A;  5F68 A;  3H82 B;  1F5M A;  3H9W A;  3IS2 B;  5GLD A;  5HAP A;  2ACG A;  1PW1 A;  2V0U A;  3S7N A;  4FD8 A;  4X1L A;  4PM9 A;  3LI8 A;  2JKG A;  1I2S A;  3NHQ A;  3L9K A;  4E3N A;  5CHM A;  3LO7 A;  4Y0U A;  4PM5 A;  1NYM A;  3UNW A;  2P04 A;  3HUO A;  5M18 A;  3GTC A;  4ZJ2 A;  3T4K A;  4QB8 A;  5HD3 A;  2OWJ A;  2KLI A;  4WM9 A;  1IYO A;  1X0O A;  4O8G A;  2JKR I;  3SOI A;  4GS9 A;  1XP4 A;  1K25 A;  1PYY A;  3PBT A;  2BAS A;  4KZ3 A;  5HSQ A;  5E2E A;  5FQJ A;  1JTG A;  5EE8 A;  5EOO A;  3W4Q A;  4I3J A;  2R9X A;  3QP4 A;  5F82 A;  1AWI A;  2Y4A A;  2XH9 A;  4OON A;  1DJB A;  1Q2Q A;  3S7P A;  4IBR A;  1K6R A;  3UPN A;  1XPB A;  1XXM A;  5HDS A;  4JGP A;  2PHY A;  3F1N B;  4OQH A;  1G6A A;  1ODV A;  5F1G A;  3FKV A;  4BL3 A;  2RCX A;  2XD1 A;  1OTD A;  4R3J A;  4HBU A;  2V1Z A;  3T4O A;  1BTL A;  5F5Y A;  3WWX A;  4PMA A;  1NRF A;  1PNE A;  5CHJ A;  3O5Y A;  5FI2 A;  2HP5 A;  2IWB A;  3ZG7 B;  4PM6 A;  5HW3 A;  4QD4 A;  1FCN A;  4R4R A;  3HLE A;  4B9O A;  4E3L A;  2XF3 A;  1NWZ A;  2PBY A;  1UGU A;  4JXV A;  2Q9M A;  5D3O A;  2M7V A;  1CJF A;  4KUO A;  1XGI A;  2Y2O A;  3LY4 A;  4OPQ A;  1K56 A;  1LI0 A;  2OAP 1;  2EX6 A;  3JVU A;  5AJG A;  1ESI A;  2H0Y A;  3MQQ A;  3SS4 A;  4U0X A;  1KDW A;  4LV3 A;  3DBA A;  2UV0 E;  3W8K A;  2NUT C;  3OPH A;  3Q07 A;  2K31 A;  1ERQ A;  4S2J A;  1YKD A;  3FPV A;  2BTF P;  3LIA A;  1YMX A;  3A0S A;  2XEP A;  3EQV A;  4E6W A;  3EGD C;  5L8M A;  3K2N A;  2VGK A;  4B4Z A;  1BLS A;  3LIF A;  5L2F A;  5A8B A;  1ZHH B;  4Y17 A;  1VET A;  1IEL A;  5U47 A;  3PAG A;  1W7F A;  2Y59 A;  4EBL A;  4R70 A;  2KX6 A;  2J9P A;  5FEG A;  4LEN A;  1YSQ A;  4JGO A;  4WF0 A;  3IF6 C;  2Z6D A;  4I3A A;  4S2M A;  4X6T A;  2OAQ 1;  4I39 A;  3IF6 B;  1OTE A;  4NXF A;  4MBH A;  3IHB A;  5JYP A;  1P9R A;  2QMI A;  2D01 A;  1H0M A;  4KZ5 A;  3UMD A;  3SW1 A;  3FG8 A;  2JHE A;  1JWV A;  1D7E A;  1OJ5 A;  2H28 A;  4HEF A;  4OP5 A;  3IHA A;  4CLC C;  2YKH A;  4CLC B;  1G6O A;  1LL8 A;  1ZKJ A;  3VOL A;  4LV2 A;  1T1C A;  5EVI D;  4HES A;  2JKR M;  3MFD A;  5GHZ A;  1BLP A;  3NC8 A;  4IJG A;  2WKH A;  3A3F A;  3N8R A;  3D9Y A;  4E3I A;  5FI7 A;  3UY6 A;  1ERO A;  1I5Q A;  3D3O A;  3V5M A;  3TRC A;  5J4E A;  4L9F A;  2O9A A;  5HL1 A;  4S2I A;  4Y3I A;  1L0F A;  4P87 A;  3CG5 A;  2XDM A;  3BRM A;  2QJ5 A;  3OBF A;  4B93 A;  3MKF A;  3ZG5 A;  1GSW A;  2OLV A;  4JGQ A;  1O7E A;  3GDI A;  2LB5 A;  1W5D A;  1EW0 A;  4DDS A;  4BLM A;  1BUE A;  2AVX A;  3WRT A;  2QZ6 A;  2WYX A;  4CLC D;  1MPL A;  5F83 A;  3C4P A;  2XA7 S;  1DRM A;  1U60 A;  3IF5 A;  1G68 A;  4OQI A;  3LIB A;  2Y91 A;  2M7U A;  2ZC7 A;  5CEB A;  2ZL1 A;  3BLS A;  3UB7 A;  1FOF A;  2FFF B;  4GS9 B;  1V9Y A;  4WN5 A;  1F9I A;  4XUX A;  3DTE A;  1BT5 A;  4K0X A;  5HX9 A;  1MKI A;  2ZC5 B;  4MEZ A;  2P74 A;  4O7D A;  1H5X A;  2Y2I A;  1W8Y A;  2ZC6 B;  2PD7 A;  4LRZ E;  1PI5 A;  1NXY A;  1MXO A;  3KSG A;  4WZ4 A;  1JWZ A;  1ES4 A;  1F2K A;  1PWD A;  4I38 A;  1MZU A;  1PWG A;  3TW8 A;  2VV6 A;  3PXP A;  3CMZ A;  5DFX A;  1VM1 A;  3C4O A;  1ESU A;  3FC7 A;  3G31 A;  2Y8H A;  1UWP X;  1T18 A;  2VKS A;  3GVB A;  5GLA A;  3BY8 A;  1PWC A;  2M1C A;  5HAQ A;  3CLO A;  2KOI A;  3ZGA B;  5CED A;  5DF8 A;  4ME4 A;  2O0Y A;  5CHU A;  2XRO A;  3C38 A;  1XJ2 A;  2R9W A;  3O3V A;  1S6R A;  1ES3 A;  4MBF A;  3BQ8 A;  2VX8 A;  5CRF A;  4LGW A;  4XT2 A;  4ESP A;  1KVM A;  2W3E A;  3A3I A;  1TD5 A;  5CXW A;  3UB5 P;  3HLG A;  3IX8 A;  4DRT A;  1ONH A;  3BY9 A;  3T50 A;  3A3D A;  3A0R A;  3ITB A;  3H7W A;  2VGL S;  5HFO A;  4UEY A;  4ZJ3 A;  5G4Z A;  2W27 A;  1PFL A;  5DJU A;  2V2F F;  3FYZ A;  2CMN A;  4RX3 A;  1XJ6 A;  3MKE A;  4HH2 A;  4WLA A;  1VET B;  1KGF A;  2HJ9 C;  4P85 A;  2VGL M;  3ZVW A;  4BMW A;  1NYY A;  3ZG8 B;  5I5L A;  5DF7 A;  1IFQ A;  1H3Q A;  1L0G A;  3CWF A;  3Q7Z A;  3WS2 A;  2MJ6 A;  2VLG A;  3HBR A;  4OQ0 A;  2ZQD A;  1KE3 A;  2EX9 A;  1K56 D;  1NY0 A;  1FIL A;  4HQA A;  4UA6 A;  3VP1 A;  1YQS A;  3UPP A;  1M6K A;  4YNR A;  2PAV P;  2Y2M A;  4GB7 A;  3MF0 A;  3UO9 A;  2FZ0 A;  1IOU A;  1O07 A;  5CTM A;  3T12 B;  1PZP A;  1DJA A;  5HD5 A;  2Y2Q A;  3TJZ C;  1N9B A;  2G2W A;  3PBS A;  1EWZ A;  5TJJ A;  4F94 A;  4KEN B;  4N9K A;  2Q9N A;  4AFI A;  3LR3 A;  1MKM A;  2JKT I;  4KG2 A;  1OJG A;  3LR0 A;  4YOF A;  3CIT A;  2ZLY A;  2L1M A;  2IA2 A;  3G32 A;  1SDN A;  3UB8 A;  4LPZ A;  3K3D A;  3SS5 A;  1SKF A;  1YMS A;  3GSG A;  2EXB A;  4X53 A;  4MN7 A;  4Q0I A;  1HD8 A;  4BBV A;  2WGI A;  3D72 A;  4EEP A;  2WAD A;  1OTB A;  3AGE A;  4BEN A;  1LI9 A;  2J9O A;  1XA7 A;  2GDN A;  2QWS A;  2XD5 A;  3MXS A;  3HJK A;  1YM1 A;  3M6H A;  4N1X A;  3OC2 A;  1TVF A;  3S1Y A;  3CUE A;  3Q82 A;  4EWF A;  2GJ3 A;  2A2L A;  4DMZ A;  4EER A;  2V1A A;  4JXG A;  3S7Q A;  1TS0 A;  3PBO A;  5DVA A;  4OPY A;  3BFG A;  2OV5 A;  1XFN A;  1E25 A;  5IHV A;  2ZL1 B;  2ZM0 A;  2WKE A;  2GX5 A;  3ZG0 A;  2GZA A;  4LV1 A;  1SCW A;  3HL9 A;  2V0W A;  1PW8 A;  4H8R A;  1N9L A;  1P97 A;  2Y2G A;  4KZB A;  1SHV A;  4C75 A;  3ZG9 B;  3T4L A;  3C5A A;  1KGG A;  4JGR A;  4KG6 A;  2ZQ9 A;  4EBP A;  4BQM A;  4GD8 A;  1BUL A;  2G2U A;  4OPR A;  3VFF A;  1NRJ A;  4ZAM A;  3B3X A;  5TFQ A;  3CPT A;  4MN5 A;  2ZQA A;  3VE4 A;  3QP5 A;  3WS0 A;  5TBM A;  4G3W A;  4ZJ1 A;  3M2K A;  3TOI A;  3QHY A;  1ONG A;  3OCL A;  4OOL A;  2W3F A;  1L0D A;  2A24 A;  3NDE A;  3DTK A;  4Y15 A;  1WYC A;  4OOY A;  2EX8 A;  5HL6 A;  3HCY A;  3IT9 A;  2C6W B;  2J8Y A;  4LV0 A;  3U2A A;  5EVE A;  5HWW A;  3KSI A;  2Y2L A;  1ES2 A;  4IUH A;  4E3K A;  1FIK A;  2ZJ9 A;  1C3B A;  2VGJ A;  4ID4 A;  2W1R A;  2IWD A;  3WRZ A;  3OZH A;  3IQA A;  2W0N A;  3A3J A;  3FWL A;  3PTE A;  5AVF A;  2HDR A;  5HWT A;  4HY8 A;  1BLH A;  1FSW A;  4XT2 B;  4EES A;  2JBF A;  3OPP A;  2DMW A;  5EOE A;  3OPL A;  5FQI A;  5L07 A;  4OH0 A;  3LY3 A;  1VEU A;  4FCF A;  3PR6 A;  2X01 A;  3ZHH A;  3MQO A;  2OSU A;  3H7W B;  2XRN A;  4GHI A;  3Q81 A;  1TS8 A;  4KZ7 A;  1Z6F A;  5A93 A;  3G2Y A;  3C8C A;  5HAR A;  5JYO A;  2C5W B;  4KQR A;  3FV7 A;  4Z9Q A;  2Y2N A;  3LFV A;  2J3W A;  4EEU A;  5DJT A;  3NOU C;  4PKY G;  4R3B A;  4KQQ A;  4R38 A;  2Y2J A;  1JNU A;  3SZT A;  4U3T A;  5FA7 A;  4C6Y A;  2CC1 A;  4OOM A;  5E2H A;  2YKF A;  1QMF A;  5KSC A;  4WEL A;  4DDY A;  4HJ4 A;  3OLO A;  4WBG A;  3ZDJ A;  2OOL A;  1YLP A;  2PU2 A;  3NOP C;  1D1J A;  1LHY A;  4GCZ A;  2H10 A;  3GMW A;  3LYX A;  1ZTU A;  2J7V A;  4JPM A;  4QHC A;  3QP6 A;  1N9O A;  4GNU A;  1NZU A;  2VZW A;  1CEF A;  4N92 A;  3ITA A;  1LT0 A;  3P98 A;  3Q1F A;  4NK3 A;  5EFW A;  4JXS A;  5HDC A;  1TF1 A;  2DCF A;  3MZD A;  4HP9 A;  3IX3 A;  1GSX A;  2WGW A;  4R0Q A;  3SH7 A;  2VV8 A;  3E2K A;  4DXC A;  2ZMV A;  2HJE A;  2PR5 A;  3GRJ A;  4E6X A;  4QJG A;  4N1H A;  1XJ3 A;  2I72 A;  1IKG A;  4IHQ A;  3VOY A;  3DAV A;  4LRX C;  4X1M A;  4Y5F A;  3O86 A;  2Z2L B;  4JBF A;  5GLB A;  2XLN A;  4BWI A;  1IEM A;  5FQK A;  4X68 A;  5A90 A;  4EW7 A;  1AXB A;  4F3L A;  3EEA A;  2W3G A;  4CPK A;  2ZOI A;  5FAT A;  2Y2P A;  3D4F A;  3E4Q A;  3LID A;  5EVL A;  4EV4 A;  5M19 A;  4PHT A;  5HZH A;  3P7N A;  3ZYT A;  1KOU A;  3DW0 A;  1JVJ A;  1RGZ A;  3MQ0 A;  4KQD A;  3HUM A;  4KUK A;  1ACF A;  4PKY A;  3LGO A;  1JTD A;  3BW6 A;  2HZ5 A;  5G18 A;  3CUE C;  1GCE A;  2PYP A;  5L10 A;  2PDR A;  5FAS A;  3KO6 A;  3ZCZ A;  2Z6C A;  5AQB A;  4Y0T A;  5IT5 A;  4LFU A;  1L2S A;  3UDI A;  4KZ8 A;  5GHX A;  2G7U A;  3VP4 A;  4L0L A;  2ZOH A;  1DJC A;  1MC0 A;  3TG9 A;  3B42 A;  1CEG A;  5EM0 A;  4Y0O A;  5MC7 A;  3IWO A;  1HLU P;  1OPX A;  2ZBB A;  2WAE A;  3EEH A;  3C30 A;  4HOI A;  1KE0 A;  3OOV A;  3UDF A;  5HPI A;  3V39 A;  4CLC E;  2QJ7 A;  3MZF A;  4X69 A;  4R23 A;  1DP6 A;  4KZ4 A;  3KYE A;  4D2O A;  5F6A A;  4MN6 A;  4EQ1 A;  2H5S A;  4FH4 A;  4RQ9 A;  2XGN A;  4S2L A;  5E2G A;  1W63 M;  1FR1 A;  3B47 A;  3LI9 A;  1PRQ A;  3BWL A;  4OP8 A;  3BLM A;  4L9E A;  1WYB A;  3CPT B;  4QWO A;  3QNC A;  5IU1 A;  4G3V A;  3F1O A;  2B02 A;  5TBM B;  3UME A;  1ZG6 A;  1YLT A;  2Z2M B;  3LIE A;  3VE3 A;  3IX4 A;  3TSG A;  1S0W A;  5A91 A;  1S1Z A;  3NEC A;  4P6Z S;  5FQQ A;  3IBJ A;  3MR0 A;  3S7O A;  1W63 Q;  4UQI S;  2A24 B;  3PBQ A;  5FDH A;  2O99 A;  4OLD A;  3CZD A;  2O9C A;  1K4E A;  4EBN A;  1K6S A;  1H8M A;  4P6Z M;  2EWV A;  2ZC4 B;  4EXO A;  2V1B A;  4UAA A;  4UQI M;  4Q0J A;  2PU4 A;  1E4D A;  1L0E A;  3BEB A;  1ERM A;  4CJN A;  1OT6 A;  4ZDX A;  5DFY A;  3IXD A;  2XQZ A;  3N7W A;  3GEC A;  1KE4 A;  2HP9 A;  3G4P A;  2EFU A;  3VOZ A;  4FUW A;  3WS1 A;  4GOG A;  4MBK A;  1VEU B;  3PHY A;  2HV1 A;  2V9A A;  3EGX C;  4O01 A;  2VV7 A;  3LUQ A;  3OCN A;  2ZQ7 A;  3LR5 A;  2BLS A;  3AGD A;  1YAX A;  3IH8 A;  4GHI B;  5CGX A;  2WGV A;  1ES5 A;  4HNB A;  3T4J A;  4ARZ A;  4BBT A;  2VEA A;  1HZO A;  3S22 A;  3A0V A;  4KG5 A;  3DTM A;  5HAI A;  2QHK A;  2JC7 A;  4U0T A;  2HF6 A;  3PBR A;  2V8C A;  3A3E A;  1MWU A;  3G2Z A;  3CAX A;  1FQG A;  5KIZ A;  3DWZ A;  1K54 A;  3W2Z A;  4WZ5 C;  5L09 A;  1NZO A;  4XUZ A;  4NXG A;  3RFB A;  4MNR A;  3IBR A;  1YLW A; 
#chains in the Genus database with same CATH homology
 2Y79 A;  4MN5 A;  3PYP A;  1OTE A;  4NXF A;  3VE4 A;  5G4Y A;  1Y28 A;  1P9R A;  1VB6 A;  5TBM A;  4G3W A;  2L0W A;  2D01 A;  4HH3 A;  4ETZ A;  3UMD A;  3SW1 A;  3FG8 A;  2JHE A;  1D7E A;  1OJ5 A;  2H28 A;  4MDZ A;  4O0P A;  2EA9 A;  3OCL A;  3F1N A;  4HJ3 A;  4HI4 A;  4CLC C;  4OOL A;  2W3F A;  2YKH A;  4CLC B;  1G6O A;  1LL8 A;  2A24 A;  2WKP A;  2XSS A;  3T4Q A;  3VOL A;  4H6J B;  1P9W A;  5AVE A;  1T1C A;  5HL6 A;  3HCY A;  4L9G A;  3U2A A;  5HWW A;  3KYZ A;  3R7W B;  2JKR M;  3KSI A;  5J7E A;  4GLQ A;  4IUH A;  2WKQ A;  3UE3 A;  4IJG A;  2LB9 A;  3VV4 A;  4F3L B;  3HJI A;  4EET B;  1D06 A;  3D3O A;  3MFX A;  4MMN A;  2W1R A;  3TRC A;  2W0N A;  5J4E A;  5HDD A;  4L9F A;  2O9A A;  5AVF A;  2W1T B;  4Y3I A;  3KYQ A;  5HWT A;  4HY8 A;  4CQH A;  1F98 A;  4GJ4 A;  2QJ5 A;  3C2W A;  4GW9 A;  2PYR A;  3R4K A;  3OBF A;  4XT2 B;  4EES A;  2VJW A;  2DMW A;  3E0Y A;  4B93 A;  2OWH A;  4PAU A;  2J3T C;  1GSW A;  2B18 A;  5K5B A;  4JGQ A;  1XJ4 A;  3BQA A;  3PR6 A;  2K2N A;  2LB5 A;  3GDI A;  3MQO A;  1EW0 A;  4WUJ A;  2P08 A;  3H7W B;  2XRN A;  4GHI A;  5F69 A;  1TS8 A;  4IUK A;  4CLC D;  1OT9 A;  1S1Y A;  4NEE D;  4G3K A;  2XA7 S;  1DRM A;  3C8C A;  3MXQ A;  4DJ3 A;  3LIB A;  5CX7 A;  5KSH A;  3LFV A;  4ZRR A;  2M7U A;  2J3W A;  4EEU A;  5DJT A;  3NOU C;  4PKY G;  4BJP A;  3E98 A;  1P0Z A;  5HPF A;  4R38 A;  2VA0 A;  3UB7 A;  3EOI A;  1JNU A;  4GS9 B;  4WL9 A;  1V9Y A;  4R6L A;  1F9I A;  4WN5 A;  3UB6 A;  4OOM A;  1NLY A;  3ZQ5 A;  2YKF A;  4WEL A;  4HJ4 A;  3OLO A;  5DKL A;  1S4R A;  5J3W A;  1T1B A;  2OOL A;  2PD8 A;  3NOP C;  2PD7 A;  4BBU A;  4LRZ E;  1UWN X;  2O9B A;  4GCZ A;  2K7S A;  2NUP C;  3KSG A;  3LYX A;  1ZTU A;  3T4S A;  1N9O A;  2I9V A;  1LSX A;  1OTI A;  4I3I A;  3F1O B;  2VZW A;  4I38 A;  2J3T D;  2J80 A;  1MZU A;  1LT0 A;  5EFW A;  3E4P A;  5HDC A;  1TF1 A;  3TW8 A;  2VV6 A;  5C5K A;  3PXP A;  4HP9 A;  1GSX A;  1T19 A;  5DFX A;  2VV8 A;  2GNX A;  3KX0 X;  4HP4 A;  4LRY C;  4Y2F A;  3FC7 A;  1T1A A;  2ZMV A;  1N9N A;  2HJE A;  2PR5 A;  5DF9 A;  2Y8H A;  3G6O A;  1XJ3 A;  3F1P B;  4CLC A;  1UWP X;  1T18 A;  4M4X A;  2VKS A;  5IS1 A;  4H6J A;  4IHQ A;  2PT7 A;  2L4R A;  3PBN A;  4LRX C;  3MMH A;  4FSF A;  4Y5F A;  4YWZ A;  5FL3 A;  3BY8 A;  3LIC A;  2M1C A;  5LBR A;  3JVV A;  4Q0H A;  3R7W A;  4BWI A;  4EU0 A;  4R3A A;  3CLO A;  3RTY A;  2KOI A;  3MJQ A;  4EW7 A;  4F3L A;  3EEA A;  1TS7 A;  2W3G A;  4FOF A;  2ZOI A;  4DN0 A;  3ULF A;  1S66 L;  4NXB A;  4ME4 A;  4ETX A;  2O0Y A;  2XRO A;  2INW A;  3C38 A;  3E4Q A;  2W1T A;  3LID A;  1XJ2 A;  3EQU A;  3KSH A;  3CI6 A;  4PHT A;  5HZH A;  1TS6 A;  3P7N A;  3BQ8 A;  2VX8 A;  3KSF A;  1KOU A;  3ZYT A;  4XT2 A;  3MQ0 A;  4KQD A;  4KUK A;  2W3E A;  2QKP A;  4PKY A;  1TD5 A;  4LLO B;  3BW6 A;  4WEJ A;  3NJA A;  4DJ2 A;  3CUE C;  2PYP A;  1DP8 A;  5F68 A;  3H82 B;  1F5M A;  2PDR A;  3H9W A;  3IS2 B;  3BY9 A;  3KO6 A;  3T50 A;  2V0U A;  3S7N A;  2Z6C A;  2JKT M;  3A0R A;  3LI8 A;  5IT5 A;  3H7W A;  3NHQ A;  2G7U A;  1S67 L;  4L0L A;  4ARZ B;  2ZOH A;  2VGL S;  1MC0 A;  3B42 A;  4UEY A;  2P04 A;  3FPW A;  5G4Z A;  2W27 A;  5DJU A;  5MC7 A;  3T4K A;  3V67 A;  5HD3 A;  2CMN A;  2OWJ A;  2KLI A;  1LSV A;  1OPX A;  1XJ6 A;  1X0O A;  1GSV A;  4HH2 A;  2ZBB A;  3EEH A;  4O8G A;  3C30 A;  4HOI A;  1LSW A;  4WLA A;  2JKR I;  3OOV A;  2HJ9 C;  5HPI A;  4GS9 A;  2VGL M;  2ZMF A;  4CLC E;  2QJ7 A;  4BMW A;  3PBT A;  5I5L A;  1DP6 A;  2BAS A;  2D02 A;  5F6A A;  4HHD A;  5HSQ A;  1IFQ A;  4MN6 A;  1H3Q A;  3CWF A;  4EQ1 A;  4RQ9 A;  2MJ6 A;  2QYB A;  2PR6 A;  3UB9 A;  2VLG A;  1W63 M;  3LI9 A;  3B47 A;  4I3J A;  1STZ A;  4NXE A;  3EWK A;  3TE8 A;  1WA9 A;  3BWL A;  4L9E A;  2WKR A;  3NOT C;  4HQA A;  5IU1 A;  4G3V A;  3F1O A;  4YNR A;  2B02 A;  5TBM B;  3UME A;  3K3C A;  3MF0 A;  2FZ0 A;  2P7J A;  3BJN A;  1IOU A;  3S7P A;  3LIE A;  3VE3 A;  5HD5 A;  1S1Z A;  4K08 A;  5HDS A;  3TJZ C;  1NLZ A;  4JGP A;  3PBS A;  2PHY A;  4P6Z S;  3IBJ A;  5DKK A;  3F1N B;  3MR0 A;  2JN7 A;  1W63 Q;  4WEK A;  1ODV A;  3S7O A;  4HIA A;  5TJJ A;  4UQI S;  2A24 B;  3PBQ A;  2O99 A;  4AFI A;  1OTD A;  3LR3 A;  1XFQ A;  3F1P A;  1MKM A;  2HGV A;  2JKT I;  2O9C A;  3T4O A;  5F5Y A;  1OJG A;  3LR0 A;  4YOF A;  3CIT A;  1H8M A;  4P6Z M;  2EWV A;  2L1M A;  3T4T A;  2IA2 A;  5HWV A;  2W3D A;  4NKP A;  4EXO A;  1YSP A;  2V1B A;  4UQI M;  4Q0J A;  3UB8 A;  3O5Y A;  4HJ6 A;  4LPZ A;  3K3D A;  4Z1W A;  2EWW A;  4II7 A;  1OT6 A;  1S4S A;  5DFY A;  3B33 A;  2FH5 A;  4B9O A;  3RH8 B;  4KQO A;  4MN7 A;  3GEC A;  1NWZ A;  1DP9 A;  4Q0I A;  1UGU A;  4I5S A;  2M7V A;  4BBV A;  4KUO A;  3D72 A;  4EEP A;  4EUV A;  1OTB A;  1VHM A;  2OAP 1;  2QWS A;  1BYW A;  3PHY A;  3JVU A;  5AJG A;  2HV1 A;  2V9A A;  3EGX C;  3HJK A;  4O01 A;  2VV7 A;  3LUQ A;  3OCN A;  3LR5 A;  3MQQ A;  3OC2 A;  3H82 A;  3IS2 A;  3CUE A;  3P01 A;  2GJ3 A;  1YAX A;  2A2L A;  3DBA A;  2NUT C;  4GHI B;  4DMZ A;  4EER A;  2R78 A;  2K31 A;  2V1A A;  4HNB A;  3S7Q A;  1TS0 A;  1YKD A;  1V9Z A;  3FPV A;  3LIA A;  3T4J A;  3PBO A;  4ARZ A;  1OTA A;  3A0S A;  4BBT A;  3EQV A;  2VEA A;  3EGD C;  5L8M A;  3K2N A;  1XFN A;  3A0V A;  3LIF A;  2QHK A;  2GX5 A;  3ICY A;  5A8B A;  1ZHH B;  2GZA A;  2W3H A;  1G28 A;  2V0W A;  3E4O A;  2HF6 A;  1N9L A;  3PBR A;  2XA7 M;  1P97 A;  3CAX A;  5KIZ A;  3LR4 A;  4E04 A;  4R70 A;  3T4L A;  2KX6 A;  3W2Z A;  4JGR A;  2KDK A;  1YSQ A;  4QPR A;  3UE6 A;  4NXG A;  4JGO A;  3RFB A;  4WF0 A;  1NRJ A;  3IBR A;  4MCW A;  2Z6D A;  4I3A A;  2OAQ 1;  4I39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...