2WZXA

Amp-c beta-lactamase (pseudomonas aeruginosa)in complex with compound m-02
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
362
structure length
362
Chain Sequence
EAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
publication title Side Chain Sar of Bicyclic Beta-Lactamase Inhibitors (Blis). 1. Discovery of a Class C Bli for Combination with Imipinem.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 121
structure length 362
sequence length 362
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2wzxA00
4DF6A 2R9XA 3PBQA 4OVDA 1XP4A 4D2OA 4BL2A 2ZQ8A 1RGZA 1NXYA 4DDSA 4WM9A 1JVJA 1IYOA 2HDSA 4R3JA 3ITAA 5GLCA 2EFUA 1JWPA 1WYBA 4L0LA 4NK3A 1FOFA 4S2IA 2X01A 3RJUA 1FSWA 4R4SA 1TEMA 3IT9A 3UNWA 2DNSA 3PBTA 1PW1A 3W4PA 1FCOA 3V3RA 3E2LA 5A90A 2QZ6A 5M19A 2HP5A 3HUOA 1GCEA 1W8QA 3N8LA 2WZXA 1EWZA 3IXDA 4JXVA 2H0TA 5FQKA 4LV0A 4DE3A 4JF4A 4KQOA 3MKFA 4KZ4A 4PM6A 3RXXA 1HD8A 3MZDA 4PMAA 2EX2A 3V39A 4EBLA 3A3EA 1MWTA 4JF6A 2ZJ9A 4QU3A 4Y0OA 4R23A 1H8YA 4RA7A 4ZJ1A 2Z2LB 3ZG9B 3SH8A 3VFFA 1K38A 3VMAA 5A91A 3UE3A 1C3BA 3HLWA 4GZBA 3VOYA 3G30A 3Q07A 2PU4A 4IBXA 2XLNA 2WKHA 1YLYA 1XA1A 3BEBA 4ZTKA 3AGDA 1KVMA 2HDQA 1Q2QA 1ONHA 1CI8A 3JYIA 3PBNA 3HLEA 4JXSA 2Y2JA 4Q8IA 1ZG6A 1Q2PA 2Y59A 5KZHA 3VOZA 1NYMA 3M2JA 1L0GA 1S6RA 3UDXA 3GR2A 4GNUA 4ZDXA 3ZVTA 5HAPA 3ISGA 5FDHA 4PM7A 3AGFA 5GL9A 2FFFB 3ZG0A 1W7FA 3Q7ZA 1KGEA 1K54A 2EXBA 3D4FA 1FCNA 3ZG7B 1GHPA 4QHCA 3UDIA 2FFYA 5KMWA 2HPBA 3MZEA 4EBPA 1XKZA 3G4PA 4MBHA 1BUEA 4GOGA 1ZG4A 4OPZA 3N8SA 3C7VA 2G2UA 3Q7VB 2ZM8A 3SH7A 4YFMA 3Q81A 3DTMA 3LEZA 1K54C 1MWRA 4N9KA 3SS4A 2Y2MA 1CK3A 2C6WB 2QMIA 2RCXA 4WYYA 2XH9A 1W79A 4FCFA 4UA7A 4OPQA 3GMWA 1GA9A 1ES4A 2Q9NA 3IQAA 3UE0A 4A5RA 5BOHA 1GA0A 5HW3A 1JWZA 2P9VB 3NDEA 1H8ZA 3HVFA 1BZAA 3A3DA 1L0EA 4OPYA 3UE1A 5A92A 3QNBA 3VSLA 1TDLA 1J9MA 5F1GA 3AGEA 4Y7PA 5FATA 5FI2A 1VM1A 4OLGA 4JLFA 2JBFA 3O88A 4ZJ2A 1YQSA 2V20A 3NI9A 5DF9A 4N1XA 1PI5A 2WAFA 2WGVA 2PBYA 3O3VA 1FSYA 4WZ4A 4KQQA 5HL1A 4NETA 3IWQA 3OPRA 3M6HA 4OONA 4KZ5A 1G6AA 2HP6A 1PIOA 1QMEA 1BSGA 4JBFA 1LL9A 2ZC7A 1SCWA 1O07A 4BD0A 4EV4A 3SH9A 1ES3A 4DE2A 4CPKA 3HLDA 4E3MA 1YM1A 4K91A 3CG5A 4DE1A 5CGXA 4OQ0A 1E3UA 2ZC5B 5EVID 5CEDA 4U0TA 3HREA 2H10A 2WZZA 3PAGA 4OQGA 1K4FA 2Y2NA 1YLTA 2ZQAA 4BL3A 5FASA 4IBRA 2XQZA 1HTZA 1K6SA 2Y2QA 4KZ9A 1ERQA 3N7WA 4U0XA 1PZOA 2XD5A 5KSHA 5E2HA 3FYZA 5FSRA 4S2LA 4E3IA 1EROA 2BLSA 5CEBA 3P09A 4IVKA 1XPBA 5E43A 3ZDJA 1I2SA 3FKVA 4K0XA 3WS5A 1NYYA 4JKTA 1KGFA 2J9PA 4DKIA 4OOMA 5EVLA 1BULA 1ESIA 5DTKA 2XEPA 4PM5A 1VQQA 3DWZA 3BECA 4S2OA 4YINA 3CJMA 3WRZA 5EVIB 4X68A 1M40A 5AQBA 3B3XA 3IXHA 4CJNA 1NZUA 4RYEA 2Y2KA 4MBFA 3M2KA 1GHIA 1GHMA 2XF3A 5GLBA 1K25A 3NY4A 4KZ3A 5FI7A 3WS4A 4BD1A 3G32A 1PWCA 5F83A 1L0FA 5HFOA 3M6BA 1HZOA 1BLHA 4R4RA 5CHUA 1KE0A 1YMXA 4B88A 3G31A 1NY0A 2XDMA 3BM6A 4DRTA 4KG5A 5HAIA 1PI4A 3W8KA 3NDGA 4N92A 5CHJA 2IWBA 5DTSA 4IEDA 2WYXA 5HAQA 5FAOA 3N4IA 2E8IA 2JCHA 3QNCA 3GVBA 2Q9MA 3EQUA 3LY4A 4S2MA 4EWFA 5U47A 1BT5A 3UPOA 2G2WA 2ZQCA 3ZVWA 1IKIA 3MXRA 3HBRA 4GN2A 3S4XA 4DXCA 1U60A 5CTMA 5L2FA 4E3JA 1XXMA 3OCLA 5TR7A 4K0WA 2XD1A 3UDFA 4X53A 4X69A 5DVAA 3LCEA 3ZNYA 4MLLA 3OZHA 4GD8A 4M3KA 5J8XA 1NZOA 5FAPA 1N4OA 5CGSA 2EXAA 1OMEA 3A3IA 3IWOA 1WYCA 4JXWA 3C4OA 1XX2A 5FAQA 4WMCD 1ES2A 3W4OA 3BLSA 3FKWA 2J8YA 1O7EA 3WS1A 1K4EA 3ZG8B 2A49A 3IF6A 3A3FA 3NC8A 1YLPA 1K56D 3C4PA 4X55A 5EE8A 4E3NA 4RX2A 1HVBA 4N9LA 3UN7A 5CRFA 1YLZA 4JF5A 1ONGA 1W5DA 4KZAA 3BFEA 4WELA 2Y2HA 4LENA 1MBLA 2JE5A 3S22A 3EQVA 3TG9A 4E3OA 2EX8A 5FQMA 5EPHA 1ES5A 2WGWB 3C5AA 3IF6C 3C7UA 2Y2IA 1LLBA 3OCNA 1RGYA 2EFXA 3Q1FA 2H5SA 5HX9A 4E6XA 1YLJA 3WRTA 1LL5A 4UAAA 1E4DA 3RXWA 2ZM0A 2XFSA 3MFDA 5EECA 2HDUA 3W4QA 1QMFA 4KZ8A 4MEZA 4GDBA 2Y4AA 4QY6A 5E2GA 3S1YA 3UO9A 4B4XA 3GQZA 4LCLA 5D3OA 4ZBEA 1KDWA 4LCMA 1MXOA 4OQIA 4RX3A 5CXWA 1FR6A 4BENA 3A3JA 5GLDA 5CHMA 3HUNA 3NIAA 1IEMA 2DRWA 2VGKA 2OLUA 2DCFA 3BFGA 4S2NA 3WS2A 4P0MA 3IH8A 2P9VA 5FQIA 2VGJA 1CEGA 1MWSA 4QJGA 3ZCZA 5EOEA 5FQ9A 4P6BA 5TGFA 3BRMA 4PM8A 1WE4A 1ESUA 1IKGA 3BFCA 2WKEA 1SHVA 3CMZA 3IXBA 5FQJA 1PWDA 4FD8A 4U3TA 2X71A 1G68A 4QD4A 2XFTA 4ZAMA 3ZGAB 4LV3A 5FQQA 2B5RA 4S2NC 2BG1A 2Y2OA 3OPPA 2RL3A 4HEFA 3IHAA 5GHXA 5G18A 3HLCA 3UY6A 1AXBA 5EOOA 1FQGA 4BJPA 2QPNA 4X56A 5EUAA 3ZNTA 2ZMAA 2UWXA 3MBZA 3G34A 2WUQA 2WKIA 3I7JA 4OKPA 3FV7A 4OP8A 3VSKA 3LY3A 5DTTA 2XK1A 3WWXA 3OPHA 3UPNA 3MKEA 1KGGA 5IHVA 2JC7A 5KSCA 3GSGA 1K55A 1XA7A 4FSFA 2PU2A 3V5MA 4C75A 1K57A 4LV2A 1MPLA 5GHYA 3UPPA 3VFHA 5F1FA 4PPRA 3BFDA 3DW0A 1Y54A 5AQ7A 2X02A 1BLCA 4B4ZA 3PBSA 4UA9A 2J7VA 2H0YA 4R0QA 3V50A 5AQAA 1LI0A 4OQHA 3IXGA 4E3KA 1I5QA 2ZM2A 4KQRA 4R3BA 2ZQ7A 1I2WA 4S2KA 1KE3A 1IYPA 1JTGA 1K55C 3HL9A 1K57C 2Y2PA 1XGJA 1TVFA 4JPMA 4MBKA 4WEJA 3TSGA 3V3SA 3Q82A 1PW8A 2ZD8A 1RCJA 2OV5A 3WS0A 1KE4A 4E6WA 4O7DA 3ZHHA 1ZC2A 4S2JA 2Y2GA 4E3LA 3BFFA 3VP0A 2IWCA 4DDYA 3MXSA 5EVIA 4DE0A 2R9WA 1IELA 3N8RA 4QY5A 5CTNA 1BLSA 2HP9A 2Y55A 1PZPA 1ERMA 4UA6A 1NJ4A 1CI9A 5TFQA 3DWKA 1H5XA 3VP1A 3LO7A 5E2EA 3IH9A 2C5WB 2HDRA 4N1HA 4OLDA 4WEKA 4HESA 5JYPA 3QHYA 4ID4A 3IF6B 5CERA 4GKUA 4XXRA 1DY6A 3O86A 5EVIC 1K6RA 2Y2LA 4Z9QA 1BLPA 1MY8A 4C6YA 1XGIA 3ZG5A 2ZQ9A 3IHBA 1SKFA 3GTCA 2P74A 4H8RA 2CC1A 5DF7A 2V1ZA 4BQMA 2ZC4B 3IF5A 5FI6A 3NBLA 1PWGA 4OOLA 1JWVA 3CZDA 3GV9A 3NCKA 4KZ7A 3HLFA 1PYYA 4XUZA 5AQ9A 2XR0A 1E3UD 1SDNA 1FR1A 3G35A 2WADA 2WK0A 3BLMA 4KG2A 4P87A 5FA7A 1M6KA 4KZBA 3IWIA 5DF8A 4EBNA 4P85A 4OP5A 4FH2A 1DJAA 3SS3A 1N9BA 2J9OA 4BLMA 2I72A 2Y91A 5HARA 5I94A 2WGIA 1MWUA 1Z6FA 3HLGA 1BTLA 1L2SA 5A93A 1EI5A 2ZLYA 4X6TA 1CEFA 3SOIA 1KDSA 2EX6A 3FZCA 3MZFA 3Q7VA 3VP2A 4C3QA 5GHZA 4F94A 4EQIA 1YT4A 5CGWA 4GDNA 1KVLA 3PTEA 3HUMA 3ITBA 4KENB 1SDEA 1FCMA 4HBUA 3PAEA 5JYOA 4QB8A 4Y0UA 1NRFA 2GDNA 4IVIA 5M18A 3VP4A 5GLAA 4OOYA 1MKIA 2A3UA 1YLWA 1L0DA 1DJBA 4R1GA 5E2FA 1ZKJA 3E2KA 2XGNA 1RP5A 4UHUA 1ALQA 1LI9A 1E25A 4OPRA 4EUZA 3VP3A 3BYDA 4DXBA 2ZC6B 3OC2A 3PBOA 2ZC3B 4KZ6A 1DJCA 2IWDA 4GD6A 1TDGA 2OSUA 2WGWA 3G2ZA 3G2YA 3N6IA 2ZQDA 3FWLA 4FH4A 2EX9A 4WZ5A 4RVAA 3TOIA 5CECA 4KG6A 5M1AA 4XUXA 3O87A 1JTDA 4Y0TA 3ZFZA 3GRJA 2OLVA 3P98A 4WMCA 1W8YA 4MNRA 3SS5A 4GB7A 4OH0A 4WBGA 4S2PA 3HLBA 4PM9A 2V2FF 2WAEA 3OPLA 4HBTA 4LV1A 5F82A 4JXGA 1IYQA 1K56A 2Z2MB 1IYSA 3PBRA 4WZ5C 1LHYA 1YMSA 1S0WA 4ZJ3A
chains in the Genus database with same CATH superfamily
1XP4A 2R78A 1N9LA 3B42A 2YKFA 4GS9A 4L9EA 4WM9A 1JVJA 2HDSA 3OBFA 3VP2A 2EFUA 4S2IA 1FSWA 4R4SA 4P6ZS 3PBTA 1PW1A 3W4PA 2AVXA 5A90A 2QZ6A 3IX3A 2HP5A 1K0KA 2WZXA 5FQKA 1S67L 4H6JB 3CUEA 3A3EA 4EEUA 5L8MA 3LICA 4ME4A 4ZJ1A 2VJWA 3ZG9B 3LI8A 3UE3A 3VOYA 1LSVA 1SZVA 3G30A 3Q07A 3BWLA 5HDSA 1YSQA 3R7WB 1Q2QA 1CI8A 3ICYA 3JYIA 3NHQA 4Q8IA 1ZG6A 4IUHA 2Y59A 1LL8A 3VOZA 4ZDXA 4MMNA 4KQDA 2JKFA 2KX6A 1AWIA 1W7FA 2EXBA 1FCNA 2V9AA 2GNXA 1XKZA 4HQAA 4OPZA 1Z09A 3Q7VB 2G2UA 1UWNX 1G28A 3DTMA 3LEZA 4N9KA 2C6WB 4ESPA 4WYYA 4FCFA 3GMWA 1GA9A 3UE0A 1MZUA 1GA0A 2P9VB 3EEAA 1F5MA 4L9FA 2M7UA 4OPYA 1TDLA 4Y7PA 5FATA 4EETB 1YQSA 4N1XA 3NECA 1UGUA 1FSYA 2OOLA 1ZHHB 2XA7S 3IWQA 1STZA 3A0SA 2Y79A 4KZ5A 5IU1A 1PIOA 2ZC7A 2VK3A 4NEED 3LIBA 4E3MA 2WKQA 4DE1A 5DFXA 1K4FA 2XQZA 4KZ9A 2XD5A 2PRFA 3FYZA 4E3IA 5CEBA 3P09A 3ZDJA 1ODVA 4K0XA 3WS5A 1NYYA 4JKTA 4S2OA 2HV1A 2PHYA 5HWVA 1IOUA 1K25A 4KZ3A 5FI7A 3G32A 3MQQA 3F1OA 3M6BA 4GLQA 5CHUA 4MCWA 1NY0A 2XDMA 4DRTA 5HAIA 1PI4A 3IBRA 2ACGA 2IWBA 5FAOA 2DMWA 3QNCA 3LY4A 4IUKA 3KSGA 4S2MA 3UPOA 2HJEA 2G2WA 3HBRA 3JVUA 3S4XA 1U60A 3DTEA 1G6OA 4X53A 1F9IA 1OT6A 1NZOA 3S7OA 5AVEA 2ZMVA 1OMEA 5DKKA 3C4OA 1XX2A 3NOTC 3MR0A 3W4OA 1O7EA 3WS1A 2J3TC 3UMDA 3A3FA 3GECA 3T4QA 4Z1WA 4I3JA 4JF5A 1W5DA 3BFEA 4LENA 5FEFA 2OAQ1 5EPHA 1ES5A 3C7UA 1LLBA 4E6XA 3WRTA 4UAAA 2XFSA 3MFDA 1DP8A 3SZTA 2HDUA 2GJ3A 4GDBA 2Y4AA 5D3OA 2K2NA 5CXWA 4RX3A 5CHMA 3NIAA 2VGKA 2DRWA 4EUVA 2OLUA 1WA9A 3WS2A 4ETXA 1OTAA 3H82B 3E4OA 2O9CA 4PM8A 4O8GA 1WE4A 5L09A 1SHVA 3IXBA 5FQJA 4U3TA 4FD8A 2BG1A 1T1BA 4EW7A 5G18A 3UY6A 4CLCC 2PR5A 4BJPA 3MBZA 2WUQA 2WKIA 2KOIA 3FV7A 4Y15A 3GSGA 1XA7A 3V5MA 1D06A 3DW0A 1BLCA 2J7VA 2H0YA 5HPFA 4DMZA 4OQHA 1I5QA 2ZM2A 2ZQ7A 1I2WA 3B33A 3HL9A 5IS1A 2Y2PA 3BY9A 3V3SA 3DAVA 1PW8A 4O7DA 4JGPA 3C8CA 3BFFA 2ZL1A 2IWCA 2J3WA 2R9WA 4QY5A 5J3WA 4Y5FA 1BLSA 1NJ4A 1CI9A 4HJ6A 4N1HA 4OLDA 3H7WA 5CERA 4Y13A 1BLPA 2ZQ9A 2V1AA 3CHWP 4BQMA 3CI6A 5FI6A 3EWKA 4KZ7A 3HLFA 2XR0A 4CQHA 3T4JA 2WK0A 4KG2A 4P87A 5FA7A 4KZBA 3IWIA 5DF8A 4P85A 1DJAA 1N9BA 4BLMA 2I72A 1MWUA 2LB5A 1BTLA 1EI5A 2E8JA 2ZLYA 1CEFA 1TD5A 3LR5A 5GHZA 3S7QA 3LI9A 2HF6A 4M4XA 4HI4A 4GDNA 3PTEA 1OTBA 3HUMA 4KENB 3NOUC 4HBUA 4WUJA 1NRFA 4IVIA 2VV6A 3HJKA 4OOYA 2A3UA 1L0DA 1MC0A 1ZKJA 1ALQA 1LI9A 2A24B 4OPRA 4EUZA 3F1NB 5L07A 4KZ6A 1TDGA 2EX9A 2FH5A 3L7HA 4XUXA 3O87A 4Y0TA 4I3AA 3EOIA 4KUOA 4HHDA 4WMCA 1W8YA 4WN5A 4OH0A 3RFBA 1VETA 2QHKA 3PYPA 1K56A 4DF6A 3PBQA 4R6LA 2J3TD 1IYOA 4NK3A 1FOFA 4HH3A 3IT9A 2DNSA 3BQ8A 2VEAA 2H0TA 4KQOA 4G3KA 4WL9A 3MKFA 4PMAA 3VOLA 4R23A 1H8YA 2ZMFA 1PFLA 1K38A 3VMAA 5A91A 2PU4A 4IBXA 2WKHA 1YLYA 5LBRA 3BEBA 2HDQA 4NKPA 4NXBA 2XRNA 1Y28A 2V0WA 1L0GA 1EW0A 4Y3IA 5FDHA 3AGFA 4XT2A 2FFFB 3Q7ZA 4CLCD 2FFYA 3K3CA 3MMHA 1UWPX 4MBHA 1BUEA 3CPTA 4GOGA 3N8SA 1VEUA 4WLAA 4YFMA 4EESA 3KYQA 1K54C 1MWRA 3KYEA 5FDSA 2QMIA 2XH9A 3TRCA 2LB9A 5F69A 1ES4A 3IQAA 5BOHA 2O9AA 3U4LP 3A3DA 3F1PB 3BJNA 5A92A 1J9MA 2PD7A 5FI2A 1VM1A 4OLGA 3JPUA 3H9WA 2WAFA 4KQQA 5EFWA 3OPRA 1YSPA 3M6HA 5G4ZA 4OONA 1W63M 4JBFA 1BYWA 1LL9A 1O07A 4BD0A 3QP2A 4DE2A 2OWHA 4JGQA 3HREA 2H10A 2WZZA 3PAGA 4OQGA 2Y2NA 4IBRA 1HTZA 1K6SA 2B02A 4U0XA 3N7WA 2K31A 3SW1A 5FSRA 2BLSA 5E43A 3LYXA 4E04A 3LR0A 5EVLA 1BULA 1ESIA 1VQQA 3VE3A 5C5KA 3QP5A 4X68A 3B3XA 2XA7M 3QP8A 3IXHA 2KDKA 3M2KA 4R38A 1GHMA 2XF3A 5GLBA 3NY4A 4EU0A 5HFOA 4R4RA 3G31A 4MN5A 2JKRM 3W8KA 5CHJA 5DTSA 3KSFA 5HAQA 4F3LA 3LUQA 3MSHA 3LGOA 3NJAA 4R3AA 2L4RA 5U47A 1BT5A 2ZQCA 3ZVWA 1LSXA 4D60A 1XXMA 5EV0A 4X1LA 5DVAA 2QJ5A 3LCEA 3ZNYA 4GD8A 4M3KA 5J8XA 5FAPA 5CGSA 4HJ4A 3IWOA 3D9YA 4JXWA 3ZG8B 3IF6A 3NC8A 4E3NA 1TF1A 4RX2A 4HJ3A 1W63Q 3UN7A 5CRFA 4FOFA 4HP9A 3EQVA 3TG9A 2EX8A 2WGWB 3OCNA 3FPWA 3Q1FA 2H5SA 1XFNA 5EM1A 3T1SA 2ZM0A 5E2GA 1F2KA 3GQZA 1KDWA 4OQIA 1MXOA 4BENA 3A3JA 1XJ6A 3HUNA 5J7EA 4WF0A 4P0MA 3IH8A 2P9VA 3FPVA 5FQIA 2D01A 5EOEA 5TGFA 4I39A 4BBUA 1IKGA 2PD8A 4QD4A 2XFTA 1NRJA 5FQQA 4YNRA 4O0PA 4S2NC 3OPPA 2Y2OA 4HEFA 3DTKA 3IHAA 3R4KA 5EOOA 1J3WA 3D72A 3G34A 3I7JA 2NUTC 3F1OB 3DTIA 5IHVA 2PU2A 4C75A 1K57A 3UPPA 5F1FA 4B4ZA 2X02A 4JGRA 4UA9A 3EGXC 1TS8A 4ARZA 5HWWA 4KQRA 4R3BA 5AVFA 1K55C 1XGJA 1TVFA 2WKRA 4JPMA 4MBKA 4WEJA 1NWZA 2ZD8A 1RCJA 2OV5A 1ZC2A 3VP0A 4I5SA 4DDYA 3MXSA 4DE0A 1XJ3A 2Y55A 1XFQA 5TFQA 1N9OA 3VP1A 2B18A 4FTXA 2EWWA 4WEKA 4HESA 5JYPA 2O0YA 4GKUA 4XXRA 5EVIC 3O86A 2Y2LA 4Z9QA 1XGIA 3ZG5A 4IHQA 4H8RA 4I38A 1PWGA 3GV9A 3NCKA 5AQ9A 4XUZA 1E3UD 3LR3A 1FR1A 3G35A 4AFIA 3OLOA 5HD5A 2PYPA 5HARA 5I94A 1CQAA 5A93A 1KDSA 4QWOA 2EX6A 3FZCA 4UQIM 3MZFA 1YT4A 4UEYA 3ITBA 3KO6A 1HLUP 1FCMA 5JYOA 4QB8A 4Y0UA 2GDNA 1YLWA 3E2KA 2XGNA 1RP5A 1E25A 3VP3A 3OC2A 2IWDA 2OSUA 3N6IA 3FWLA 4RVAA 5M1AA 3ZFZA 3GRJA 3P98A 2INWA 4S2PA 3HLBA 2WAEA 5DKLA 5F82A 4WZ5C 3BY8A 1LHYA 3U2AA 3T1XA 1S0WA 4ZJ3A 4BWIA 2R9XA 4OVDA 2M1CA 3IBJA 4BL2A 2Z6CA 4DDSA 4R3JA 3H82A 3ITAA 4LFUA 5GLCA 1JWPA 1WYBA 3TOIA 2X01A 1OPXA 3V3RA 3K2NA 3HUOA 4E3OA 1GCEA 1W8QA 4L9GA 3IXDA 4LV0A 4JF4A 3RXXA 1HD8A 3MZDA 2W1TB 1S4SA 4EBLA 4MN6A 3NOPC 4RA7A 1D1JA 2Z2LB 4RQ9A 3T4KA 3HJIA 4X1MA 3SH8A 4UQIS 3VFFA 1C3BA 3HLWA 1PRQA 3CUEC 2JKRI 4GHIA 2Q0OA 1KVMA 1ONHA 3HLEA 1T18A 4JXSA 2Y2JA 4NXGA 1P97A 4O01A 1Q2PA 5HSQA 2QWSA 3M2JA 1S6RA 4GNUA 1D7EA 2J80A 5HAPA 4Y2FA 1KGEA 4NXEA 3ZG7B 4QHCA 3UDIA 1V9ZA 2HPBA 3MZEA 4HP4A 3G4PA 1MKMA 2ZM8A 3UB5P 3Q81A 3P7NA 2B95A 3SS4A 4LRYC 1CK3A 2RCXA 4OPQA 4A5RA 2Q9NA 5HW3A 1OJ5A 1JWZA 5DJTA 2VGLM 3IX8A 1L0EA 3MF0A 3LIDA 5F1GA 3UB7A 2P08A 3AGEA 2A2LA 4JLFA 2JBFA 2O9BA 3O88A 2V20A 4MN7A 4ZJ2A 3NI9A 2WGVA 1X0OA 4WZ4A 5HL1A 4NETA 1Y4OA 3A0VA 3EEHA 5TBMB 1QMEA 3KYZA 5EVEA 2HZ5A 1ZTUA 1S1ZA 4EV4A 1ES3A 4CPKA 3HLDA 1YM1A 3CG5A 5CGXA 1VB6A 3E0YA 5EVID 4I3IA 3UE6A 5CEDA 3CAXA 1F98A 5K5BA 3IS2A 5IT5A 4BL3A 1ERQA 1PZOA 5E2HA 2GX5A 1EROA 3ZQ5A 2A24A 4IVKA 3FKVA 3F1NA 3O5YA 1LT0A 3MXQA 4DKIA 5DTKA 4PM5A 3DWZA 3BECA 3CJMA 1LSWA 5EVIB 1M40A 5AQBA 2ZOHA 4RYEA 1ACFA 2Y2KA 3ULFA 3MQ0A 4BD1A 3TE8A 1HZOA 1TS0A 1YMXA 3BM6A 4K08A 4BMWA 4PKYG 4KG5A 2VGLS 2W3FA 5F6AA 2Q9MA 3EQUA 3LEQA 2VZWA 4EWFA 1P9WA 3CPTB 3QP4A 4LRZE 2KLIA 1PNEA 4DXCA 4GCZA 4E3JA 3OCLA 2I9VA 4K0WA 2XD1A 3UDFA 4X69A 1S66L 3T4LA 5J4EA 1N4OA 1SKOB 3EGDC 4PAUA 2JKTM 2W0NA 1ES2A 2J8YA 3MS6A 3KSIA 1YLPA 1V9YA 3C4PA 4X55A 5HL6A 4N9LA 1TS7A 1H0MA 4KZAA 4WELA 1MBLA 3S22A 2Y2IA 3CITA 5HX9A 3KX0X 1YLJA 1LL5A 1E4DA 3RXWA 1G5UA 4G3WA 1QMFA 4KZ8A 4MEZA 3UO9A 4QY6A 1FR6A 1GSWA 2G7UA 3UMEA 3BFGA 1P9RA 4GS9B 4CLCA 1CEGA 1OTDA 4QJGA 3F1PA 3PXPA 3BFCA 2WKEA 2CMNA 1PWDA 2GZAA 2X71A 1G68A 2W3EA 4LV3A 1OTIA 3HCYA 3HLCA 1AXBA 4GJ4A 2BASA 4QPRA 2QPNA 5EUAA 3T1RA 2UWXA 1XJ2A 4OKPA 2P7JA 3LY3A 5DTTA 2XK1A 3WWXA 3UPNA 4LGWA 4BBTA 5KSCA 1A0KA 1MPLA 3VFHA 1Y54A 5AQ7A 2W3GA 3V50A 4F3LB 1H3QA 3IXGA 4PKYA 4S2KA 1KE3A 1JTGA 3TSGA 2ZOIA 2BTFP 2OAP1 3CWFA 4S2JA 2Y2GA 1IFQA 1YKDA 4R70A 1NLYA 3PR6A 1IELA 3N8RA 4H6JA 1PZPA 3DWKA 1H5XA 3LO7A 2HDRA 5HD3A 3E4PA 3IF6B 1DY6A 3IHBA 4DJ2A 1SKFA 3GTCA 2P74A 2CC1A 5DF7A 2V1ZA 2ZC4B 4DJ3A 2PR6A 3IF5A 3R7WA 3NBLA 4EQ1A 4OOLA 1JWVA 3CZDA 1SDNA 3W2ZA 2WADA 3BLMA 5CX7A 3T4TA 4MDZA 1M6KA 4EBNA 5I5LA 4OP5A 3SS3A 2Y8HA 2WGIA 3HLGA 1Z6FA 1YAXA 1L2SA 5DFYA 3BW6A 3Q7VA 4C3QA 4EQIA 5AJGA 3PAEA 3UB8A 4KUKA 3VP4A 1GSVA 4HNBA 4DXBA 5HZHA 2EWVA 4GD6A 2WGWA 3G2ZA 3G2YA 4FH4A 1L3LA 2UV0E 4KG6A 3JVVA 4Y17A 1JTDA 2VKSA 4NXFA 3SS5A 4WBGA 1KOUA 5F68A 4PM9A 2VA0A 3V67A 4LV1A 4HBTA 4JXGA 1IYQA 2Z2MB 2JN7A 1YMSA 4ARZB 4D2OA 3FC7A 2V8CA 2ZQ8A 1RGZA 1NXYA 1NLZA 2PBDP 2VV7A 4L0LA 3RJUA 3UNWA 1S1YA 1TEMA 3T1QB 1FCOA 4NG2A 3E2LA 5M19A 3N8LA 4JXVA 1EWZA 2WKPA 4DE3A 4ETZA 4KZ4A 4PM6A 4CLCE 2EX2A 3V39A 1MWTA 4JF6A 3GDIA 2ZJ9A 4QU3A 4Y0OA 2FZ0A 5DJUA 4GZBA 3NULA 2XLNA 1VHMA 2H28A 2HGVA 1OT9A 1XA1A 3QP6A 4YOFA 4ZTKA 3AGDA 3PBNA 2JHEA 3DBAA 5KZHA 5HDCA 1NYMA 3UDXA 3GR2A 3T50A 3ZVTA 3E98A 3ISGA 4PM7A 5GL9A 3ZG0A 1K54A 3D4FA 1GHPA 5KMWA 4EBPA 1ZG4A 4FUWA 3C7VA 3QP1A 3SH7A 2JKTI 2Y2MA 1S4RA 1W79A 2P04A 4UA7A 4LLOB 3C2WA 3PHYA 3NDEA 4B93A 1H8ZA 3HVFA 1BZAA 3UB6A 3UE1A 5EM0A 3QNBA 3VSLA 1JNUA 2W3DA 5DF9A 2NUPC 1PI5A 2PBYA 2HJ9C 5HDDA 3O3VA 2PDRA 2OWJA 2D02A 2VX8A 1G6AA 2HP6A 1N9NA 1BSGA 1SCWA 2QKPA 3SH9A 2JKGA 4ZRRA 4K91A 2V8FA 4OQ0A 1E3UA 2ZC5B 3KSHA 3T4OA 4U0TA 2ZQAA 1YLTA 5FASA 2Y2QA 1OJGA 5KSHA 4S2LA 4HOIA 3TW8A 1XPBA 1I2SA 1KGFA 2J9PA 4OOMA 2ZL1B 1T1AA 2XEPA 4YINA 3C38A 3WRZA 4X25A 4IJGA 4CJNA 4Q0JA 1NZUA 4MBFA 3TJZC 2W3HA 1GHIA 3BQAA 5F5YA 3WS4A 4GHIB 3LIFA 1PWCA 5F83A 1L0FA 3H7WB 4B9OA 1BLHA 2QJ7A 1KE0A 4B88A 1DP6A 3NDGA 4N92A 3IX4A 4IEDA 2WYXA 3N4IA 2E8IA 4LPZA 2JCHA 3RTYA 2K7SA 3GVBA 3T12B 2EA9A 1IKIA 3MXRA 4GN2A 2W1TA 5CTMA 5L2FA 5TR7A 3LFVA 2PAVP 3L9KA 4MLLA 3OZHA 3MJQA 2EXAA 3A3IA 1WYCA 2VLGA 5HPIA 2MJ6A 5FAQA 2YKHA 4WMCD 3BLSA 3FKWA 5G4YA 1K4EA 2A49A 2V0UA 1K56D 4LRXC 5EE8A 1HVBA 1YLZA 3MFXA 1ONGA 3G6OA 2Y2HA 2JE5A 3D3OA 5FQMA 3C5AA 5KIZA 3IF6C 1RGYA 2EFXA 3OOVA 4BBVA 3VV4A 5L10A 5EECA 3W4QA 4Q0HA 1VETB 3RH8B 3S1YA 4B4XA 1XJ4A 4LCLA 4ZBEA 4LCMA 3FG8A 3IS2B 5GLDA 5MC7A 1IEMA 4HY8A 4HH2A 2DCFA 2IA2A 4EERA 4S2NA 3E4QA 4EEPA 3MQOA 2VGJA 3VE4A 1MWSA 3ZCZA 5FQ9A 4P6BA 3BRMA 1ESUA 3CMZA 5TJJA 3ZGAB 2Z6DA 4ZAMA 1YPRA 2O99A 2B5RA 3K3DA 2RL3A 5GHXA 2ZBBA 1FQGA 3LIAA 4X56A 3ZNTA 3CLOA 2ZMAA 5TBMA 4OP8A 3VSKA 3OPHA 3MKEA 1KGGA 2JC7A 3LIEA 1K55A 4FSFA 4LV2A 5GHYA 3A0RA 4PPRA 3BFDA 1FIKA 3PBSA 4R0QA 3T4SA 5AQAA 1LI0A 4E3KA 5A8BA 1IYPA 2QYBA 5FL3A 1K57C 2L1MA 2W1RA 3Q82A 4XT2B 3WS0A 1KE4A 4II7A 3UB9A 4E6WA 3ZHHA 4Q0IA 4E3LA 3B47A 1P0ZA 2PYRA 2XSSA 2W27A 4YWZA 5EVIA 2PT7A 5CTNA 1VEUB 2HP9A 1ERMA 4UA6A 5E2EA 3IH9A 2C5WB 3ZYTA 1H8MA 5HWTA 3QHYA 4ID4A 1K6RA 3S7PA 1MY8A 4C6YA 2XROA 1DRMA 4HIAA 2V1BA 3P01A 1T19A 4P6ZM 1PYYA 1DP9A 4G3VA 4FH2A 3S7NA 2J9OA 2Y91A 1OTEA 1TS6A 4X6TA 3SOIA 1T1CA 3C30A 2L0WA 1SKOA 4F94A 5CGWA 1KVLA 4CLCB 3LR4A 1SDEA 1GSXA 5M18A 5FEGA 5GLAA 1MKIA 4PHTA 1DJBA 4R1GA 5E2FA 4UHUA 3BYDA 4JGOA 2ZC6B 3PBOA 2ZC3B 1DJCA 5CECA 4WZ5A 2ZQDA 2M7VA 1CF0A 1CJFA 1FILA 2VV8A 2OLVA 4MNRA 4GB7A 2V2FF 3OPLA 4EXOA 4DN0A 1IYSA 3PBRA 4GW9A
chains in the Genus database with same CATH topology
4DF6A 2R9XA 3PBQA 4OVDA 1XP4A 4D2OA 4BL2A 2ZQ8A 1RGZA 1NXYA 4DDSA 4WM9A 1JVJA 1IYOA 2HDSA 4R3JA 3ITAA 5GLCA 2EFUA 1JWPA 1WYBA 4L0LA 4NK3A 1FOFA 4S2IA 2X01A 3RJUA 1FSWA 4R4SA 1TEMA 3IT9A 3UNWA 2DNSA 3PBTA 1PW1A 3W4PA 1FCOA 3V3RA 3E2LA 5A90A 2QZ6A 5M19A 2HP5A 3HUOA 1GCEA 1W8QA 3N8LA 2WZXA 1EWZA 3IXDA 4JXVA 2H0TA 5FQKA 4LV0A 4DE3A 4JF4A 4KQOA 3MKFA 4KZ4A 4PM6A 3RXXA 1HD8A 3MZDA 4PMAA 2EX2A 3V39A 4EBLA 3A3EA 1MWTA 4JF6A 2ZJ9A 4QU3A 4Y0OA 4R23A 1H8YA 4RA7A 4ZJ1A 2Z2LB 3ZG9B 3SH8A 3VFFA 1K38A 3VMAA 5A91A 3UE3A 1C3BA 3HLWA 4GZBA 3VOYA 3G30A 3Q07A 2PU4A 4IBXA 2XLNA 2WKHA 1YLYA 1XA1A 3BEBA 4ZTKA 3AGDA 1KVMA 2HDQA 1Q2QA 1ONHA 1CI8A 3JYIA 3PBNA 3HLEA 4JXSA 2Y2JA 4Q8IA 1ZG6A 1Q2PA 2Y59A 5KZHA 3VOZA 1NYMA 3M2JA 1L0GA 1S6RA 3UDXA 3GR2A 4GNUA 4ZDXA 3ZVTA 5HAPA 3ISGA 5FDHA 4PM7A 3AGFA 5GL9A 2FFFB 3ZG0A 1W7FA 3Q7ZA 1KGEA 1K54A 2EXBA 3D4FA 1FCNA 3ZG7B 1GHPA 4QHCA 3UDIA 2FFYA 5KMWA 2HPBA 3MZEA 4EBPA 1XKZA 3G4PA 4MBHA 1BUEA 4GOGA 1ZG4A 4OPZA 3N8SA 3C7VA 2G2UA 3Q7VB 2ZM8A 3SH7A 4YFMA 3Q81A 3DTMA 3LEZA 1K54C 1MWRA 4N9KA 3SS4A 2Y2MA 1CK3A 2C6WB 2QMIA 2RCXA 4WYYA 2XH9A 1W79A 4FCFA 4UA7A 4OPQA 3GMWA 1GA9A 1ES4A 2Q9NA 3IQAA 3UE0A 4A5RA 5BOHA 1GA0A 5HW3A 1JWZA 2P9VB 3NDEA 1H8ZA 3HVFA 1BZAA 3A3DA 1L0EA 4OPYA 3UE1A 5A92A 3QNBA 3VSLA 1TDLA 1J9MA 5F1GA 3AGEA 4Y7PA 5FATA 5FI2A 1VM1A 4OLGA 4JLFA 2JBFA 3O88A 4ZJ2A 1YQSA 2V20A 3NI9A 5DF9A 4N1XA 1PI5A 2WAFA 2WGVA 2PBYA 3O3VA 1FSYA 4WZ4A 4KQQA 5HL1A 4NETA 3IWQA 3OPRA 3M6HA 4OONA 4KZ5A 1G6AA 2HP6A 1PIOA 1QMEA 1BSGA 4JBFA 1LL9A 2ZC7A 1SCWA 1O07A 4BD0A 4EV4A 3SH9A 1ES3A 4DE2A 4CPKA 3HLDA 4E3MA 1YM1A 4K91A 3CG5A 4DE1A 5CGXA 4OQ0A 1E3UA 2ZC5B 5EVID 5CEDA 4U0TA 3HREA 2H10A 2WZZA 3PAGA 4OQGA 1K4FA 2Y2NA 1YLTA 2ZQAA 4BL3A 5FASA 4IBRA 2XQZA 1HTZA 1K6SA 2Y2QA 4KZ9A 1ERQA 3N7WA 4U0XA 1PZOA 2XD5A 5KSHA 5E2HA 3FYZA 5FSRA 4S2LA 4E3IA 1EROA 2BLSA 5CEBA 3P09A 4IVKA 1XPBA 5E43A 3ZDJA 1I2SA 3FKVA 4K0XA 3WS5A 1NYYA 4JKTA 1KGFA 2J9PA 4DKIA 4OOMA 5EVLA 1BULA 1ESIA 5DTKA 2XEPA 4PM5A 1VQQA 3DWZA 3BECA 4S2OA 4YINA 3CJMA 3WRZA 5EVIB 4X68A 1M40A 5AQBA 3B3XA 3IXHA 4CJNA 1NZUA 4RYEA 2Y2KA 4MBFA 3M2KA 1GHIA 1GHMA 2XF3A 5GLBA 1K25A 3NY4A 4KZ3A 5FI7A 3WS4A 4BD1A 3G32A 1PWCA 5F83A 1L0FA 5HFOA 3M6BA 1HZOA 1BLHA 4R4RA 5CHUA 1KE0A 1YMXA 4B88A 3G31A 1NY0A 2XDMA 3BM6A 4DRTA 4KG5A 5HAIA 1PI4A 3W8KA 3NDGA 4N92A 5CHJA 2IWBA 5DTSA 4IEDA 2WYXA 5HAQA 5FAOA 3N4IA 2E8IA 2JCHA 3QNCA 3GVBA 2Q9MA 3EQUA 3LY4A 4S2MA 4EWFA 5U47A 1BT5A 3UPOA 2G2WA 2ZQCA 3ZVWA 1IKIA 3MXRA 3HBRA 4GN2A 3S4XA 4DXCA 1U60A 5CTMA 5L2FA 4E3JA 1XXMA 3OCLA 5TR7A 4K0WA 2XD1A 3UDFA 4X53A 4X69A 5DVAA 3LCEA 3ZNYA 4MLLA 3OZHA 4GD8A 4M3KA 5J8XA 1NZOA 5FAPA 1N4OA 5CGSA 2EXAA 1OMEA 3A3IA 3IWOA 1WYCA 4JXWA 3C4OA 1XX2A 5FAQA 4WMCD 1ES2A 3W4OA 3BLSA 3FKWA 2J8YA 1O7EA 3WS1A 1K4EA 3ZG8B 2A49A 3IF6A 3A3FA 3NC8A 1YLPA 1K56D 3C4PA 4X55A 5EE8A 4E3NA 4RX2A 1HVBA 4N9LA 3UN7A 5CRFA 1YLZA 4JF5A 1ONGA 1W5DA 4KZAA 3BFEA 4WELA 2Y2HA 4LENA 1MBLA 2JE5A 3S22A 3EQVA 3TG9A 4E3OA 2EX8A 5FQMA 5EPHA 1ES5A 2WGWB 3C5AA 3IF6C 3C7UA 2Y2IA 1LLBA 3OCNA 1RGYA 2EFXA 3Q1FA 2H5SA 5HX9A 4E6XA 1YLJA 3WRTA 1LL5A 4UAAA 1E4DA 3RXWA 2ZM0A 2XFSA 3MFDA 5EECA 2HDUA 3W4QA 1QMFA 4KZ8A 4MEZA 4GDBA 2Y4AA 4QY6A 5E2GA 3S1YA 3UO9A 4B4XA 3GQZA 4LCLA 5D3OA 4ZBEA 1KDWA 4LCMA 1MXOA 4OQIA 4RX3A 5CXWA 1FR6A 4BENA 3A3JA 5GLDA 5CHMA 3HUNA 3NIAA 1IEMA 2DRWA 2VGKA 2OLUA 2DCFA 3BFGA 4S2NA 3WS2A 4P0MA 3IH8A 2P9VA 5FQIA 2VGJA 1CEGA 1MWSA 4QJGA 3ZCZA 5EOEA 5FQ9A 4P6BA 5TGFA 3BRMA 4PM8A 1WE4A 1ESUA 1IKGA 3BFCA 2WKEA 1SHVA 3CMZA 3IXBA 5FQJA 1PWDA 4FD8A 4U3TA 2X71A 1G68A 4QD4A 2XFTA 4ZAMA 3ZGAB 4LV3A 5FQQA 2B5RA 4S2NC 2BG1A 2Y2OA 3OPPA 2RL3A 4HEFA 3IHAA 5GHXA 5G18A 3HLCA 3UY6A 1AXBA 5EOOA 1FQGA 4BJPA 2QPNA 4X56A 5EUAA 3ZNTA 2ZMAA 2UWXA 3MBZA 3G34A 2WUQA 2WKIA 3I7JA 4OKPA 3FV7A 4OP8A 3VSKA 3LY3A 5DTTA 2XK1A 3WWXA 3OPHA 3UPNA 3MKEA 1KGGA 5IHVA 2JC7A 5KSCA 3GSGA 1K55A 1XA7A 4FSFA 2PU2A 3V5MA 4C75A 1K57A 4LV2A 1MPLA 5GHYA 3UPPA 3VFHA 5F1FA 4PPRA 3BFDA 3DW0A 1Y54A 5AQ7A 2X02A 1BLCA 4B4ZA 3PBSA 4UA9A 2J7VA 2H0YA 4R0QA 3V50A 5AQAA 1LI0A 4OQHA 3IXGA 4E3KA 1I5QA 2ZM2A 4KQRA 4R3BA 2ZQ7A 1I2WA 4S2KA 1KE3A 1IYPA 1JTGA 1K55C 3HL9A 1K57C 2Y2PA 1XGJA 1TVFA 4JPMA 4MBKA 4WEJA 3TSGA 3V3SA 3Q82A 1PW8A 2ZD8A 1RCJA 2OV5A 3WS0A 1KE4A 4E6WA 4O7DA 3ZHHA 1ZC2A 4S2JA 2Y2GA 4E3LA 3BFFA 3VP0A 2IWCA 4DDYA 3MXSA 5EVIA 4DE0A 2R9WA 1IELA 3N8RA 4QY5A 5CTNA 1BLSA 2HP9A 2Y55A 1PZPA 1ERMA 4UA6A 1NJ4A 1CI9A 5TFQA 3DWKA 1H5XA 3VP1A 3LO7A 5E2EA 3IH9A 2C5WB 2HDRA 4N1HA 4OLDA 4WEKA 4HESA 5JYPA 3QHYA 4ID4A 3IF6B 5CERA 4GKUA 4XXRA 1DY6A 3O86A 5EVIC 1K6RA 2Y2LA 4Z9QA 1BLPA 1MY8A 4C6YA 1XGIA 3ZG5A 2ZQ9A 3IHBA 1SKFA 3GTCA 2P74A 4H8RA 2CC1A 5DF7A 2V1ZA 4BQMA 2ZC4B 3IF5A 5FI6A 3NBLA 1PWGA 4OOLA 1JWVA 3CZDA 3GV9A 3NCKA 4KZ7A 3HLFA 1PYYA 4XUZA 5AQ9A 2XR0A 1E3UD 1SDNA 1FR1A 3G35A 2WADA 2WK0A 3BLMA 4KG2A 4P87A 5FA7A 1M6KA 4KZBA 3IWIA 5DF8A 4EBNA 4P85A 4OP5A 4FH2A 1DJAA 3SS3A 1N9BA 2J9OA 4BLMA 2I72A 2Y91A 5HARA 5I94A 2WGIA 1MWUA 1Z6FA 3HLGA 1BTLA 1L2SA 5A93A 1EI5A 2ZLYA 4X6TA 1CEFA 3SOIA 1KDSA 2EX6A 3FZCA 3MZFA 3Q7VA 3VP2A 4C3QA 5GHZA 4F94A 4EQIA 1YT4A 5CGWA 4GDNA 1KVLA 3PTEA 3HUMA 3ITBA 4KENB 1SDEA 1FCMA 4HBUA 3PAEA 5JYOA 4QB8A 4Y0UA 1NRFA 2GDNA 4IVIA 5M18A 3VP4A 5GLAA 4OOYA 1MKIA 2A3UA 1YLWA 1L0DA 1DJBA 4R1GA 5E2FA 1ZKJA 3E2KA 2XGNA 1RP5A 4UHUA 1ALQA 1LI9A 1E25A 4OPRA 4EUZA 3VP3A 3BYDA 4DXBA 2ZC6B 3OC2A 3PBOA 2ZC3B 4KZ6A 1DJCA 2IWDA 4GD6A 1TDGA 2OSUA 2WGWA 3G2ZA 3G2YA 3N6IA 2ZQDA 3FWLA 4FH4A 2EX9A 4WZ5A 4RVAA 3TOIA 5CECA 4KG6A 5M1AA 4XUXA 3O87A 1JTDA 4Y0TA 3ZFZA 3GRJA 2OLVA 3P98A 4WMCA 1W8YA 4MNRA 3SS5A 4GB7A 4OH0A 4WBGA 4S2PA 3HLBA 4PM9A 2V2FF 2WAEA 3OPLA 4HBTA 4LV1A 5F82A 4JXGA 1IYQA 1K56A 2Z2MB 1IYSA 3PBRA 4WZ5C 1LHYA 1YMSA 1S0WA 4ZJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DF6 A;  2R9X A;  3PBQ A;  4OVD A;  1XP4 A;  4D2O A;  4BL2 A;  2ZQ8 A;  1RGZ A;  1NXY A;  4DDS A;  4WM9 A;  1JVJ A;  1IYO A;  2HDS A;  4R3J A;  3ITA A;  5GLC A;  2EFU A;  1JWP A;  1WYB A;  4L0L A;  4NK3 A;  1FOF A;  4S2I A;  2X01 A;  3RJU A;  1FSW A;  4R4S A;  1TEM A;  3IT9 A;  3UNW A;  2DNS A;  3PBT A;  1PW1 A;  3W4P A;  1FCO A;  3V3R A;  3E2L A;  5A90 A;  2QZ6 A;  5M19 A;  2HP5 A;  3HUO A;  1GCE A;  1W8Q A;  3N8L A;  2WZX A;  1EWZ A;  3IXD A;  4JXV A;  2H0T A;  5FQK A;  4LV0 A;  4DE3 A;  4JF4 A;  4KQO A;  3MKF A;  4KZ4 A;  4PM6 A;  3RXX A;  1HD8 A;  3MZD A;  4PMA A;  2EX2 A;  3V39 A;  4EBL A;  3A3E A;  1MWT A;  4JF6 A;  2ZJ9 A;  4QU3 A;  4Y0O A;  4R23 A;  1H8Y A;  4RA7 A;  4ZJ1 A;  2Z2L B;  3ZG9 B;  3SH8 A;  3VFF A;  1K38 A;  3VMA A;  5A91 A;  3UE3 A;  1C3B A;  3HLW A;  4GZB A;  3VOY A;  3G30 A;  3Q07 A;  2PU4 A;  4IBX A;  2XLN A;  2WKH A;  1YLY A;  1XA1 A;  3BEB A;  4ZTK A;  3AGD A;  1KVM A;  2HDQ A;  1Q2Q A;  1ONH A;  1CI8 A;  3JYI A;  3PBN A;  3HLE A;  4JXS A;  2Y2J A;  4Q8I A;  1ZG6 A;  1Q2P A;  2Y59 A;  5KZH A;  3VOZ A;  1NYM A;  3M2J A;  1L0G A;  1S6R A;  3UDX A;  3GR2 A;  4GNU A;  4ZDX A;  3ZVT A;  5HAP A;  3ISG A;  5FDH A;  4PM7 A;  3AGF A;  5GL9 A;  2FFF B;  3ZG0 A;  1W7F A;  3Q7Z A;  1KGE A;  1K54 A;  2EXB A;  3D4F A;  1FCN A;  3ZG7 B;  1GHP A;  4QHC A;  3UDI A;  2FFY A;  5KMW A;  2HPB A;  3MZE A;  4EBP A;  1XKZ A;  3G4P A;  4MBH A;  1BUE A;  4GOG A;  1ZG4 A;  4OPZ A;  3N8S A;  3C7V A;  2G2U A;  3Q7V B;  2ZM8 A;  3SH7 A;  4YFM A;  3Q81 A;  3DTM A;  3LEZ A;  1K54 C;  1MWR A;  4N9K A;  3SS4 A;  2Y2M A;  1CK3 A;  2C6W B;  2QMI A;  2RCX A;  4WYY A;  2XH9 A;  1W79 A;  4FCF A;  4UA7 A;  4OPQ A;  3GMW A;  1GA9 A;  1ES4 A;  2Q9N A;  3IQA A;  3UE0 A;  4A5R A;  5BOH A;  1GA0 A;  5HW3 A;  1JWZ A;  2P9V B;  3NDE A;  1H8Z A;  3HVF A;  1BZA A;  3A3D A;  1L0E A;  4OPY A;  3UE1 A;  5A92 A;  3QNB A;  3VSL A;  1TDL A;  1J9M A;  5F1G A;  3AGE A;  4Y7P A;  5FAT A;  5FI2 A;  1VM1 A;  4OLG A;  4JLF A;  2JBF A;  3O88 A;  4ZJ2 A;  1YQS A;  2V20 A;  3NI9 A;  5DF9 A;  4N1X A;  1PI5 A;  2WAF A;  2WGV A;  2PBY A;  3O3V A;  1FSY A;  4WZ4 A;  4KQQ A;  5HL1 A;  4NET A;  3IWQ A;  3OPR A;  3M6H A;  4OON A;  4KZ5 A;  1G6A A;  2HP6 A;  1PIO A;  1QME A;  1BSG A;  4JBF A;  1LL9 A;  2ZC7 A;  1SCW A;  1O07 A;  4BD0 A;  4EV4 A;  3SH9 A;  1ES3 A;  4DE2 A;  4CPK A;  3HLD A;  4E3M A;  1YM1 A;  4K91 A;  3CG5 A;  4DE1 A;  5CGX A;  4OQ0 A;  1E3U A;  2ZC5 B;  5EVI D;  5CED A;  4U0T A;  3HRE A;  2H10 A;  2WZZ A;  3PAG A;  4OQG A;  1K4F A;  2Y2N A;  1YLT A;  2ZQA A;  4BL3 A;  5FAS A;  4IBR A;  2XQZ A;  1HTZ A;  1K6S A;  2Y2Q A;  4KZ9 A;  1ERQ A;  3N7W A;  4U0X A;  1PZO A;  2XD5 A;  5KSH A;  5E2H A;  3FYZ A;  5FSR A;  4S2L A;  4E3I A;  1ERO A;  2BLS A;  5CEB A;  3P09 A;  4IVK A;  1XPB A;  5E43 A;  3ZDJ A;  1I2S A;  3FKV A;  4K0X A;  3WS5 A;  1NYY A;  4JKT A;  1KGF A;  2J9P A;  4DKI A;  4OOM A;  5EVL A;  1BUL A;  1ESI A;  5DTK A;  2XEP A;  4PM5 A;  1VQQ A;  3DWZ A;  3BEC A;  4S2O A;  4YIN A;  3CJM A;  3WRZ A;  5EVI B;  4X68 A;  1M40 A;  5AQB A;  3B3X A;  3IXH A;  4CJN A;  1NZU A;  4RYE A;  2Y2K A;  4MBF A;  3M2K A;  1GHI A;  1GHM A;  2XF3 A;  5GLB A;  1K25 A;  3NY4 A;  4KZ3 A;  5FI7 A;  3WS4 A;  4BD1 A;  3G32 A;  1PWC A;  5F83 A;  1L0F A;  5HFO A;  3M6B A;  1HZO A;  1BLH A;  4R4R A;  5CHU A;  1KE0 A;  1YMX A;  4B88 A;  3G31 A;  1NY0 A;  2XDM A;  3BM6 A;  4DRT A;  4KG5 A;  5HAI A;  1PI4 A;  3W8K A;  3NDG A;  4N92 A;  5CHJ A;  2IWB A;  5DTS A;  4IED A;  2WYX A;  5HAQ A;  5FAO A;  3N4I A;  2E8I A;  2JCH A;  3QNC A;  3GVB A;  2Q9M A;  3EQU A;  3LY4 A;  4S2M A;  4EWF A;  5U47 A;  1BT5 A;  3UPO A;  2G2W A;  2ZQC A;  3ZVW A;  1IKI A;  3MXR A;  3HBR A;  4GN2 A;  3S4X A;  4DXC A;  1U60 A;  5CTM A;  5L2F A;  4E3J A;  1XXM A;  3OCL A;  5TR7 A;  4K0W A;  2XD1 A;  3UDF A;  4X53 A;  4X69 A;  5DVA A;  3LCE A;  3ZNY A;  4MLL A;  3OZH A;  4GD8 A;  4M3K A;  5J8X A;  1NZO A;  5FAP A;  1N4O A;  5CGS A;  2EXA A;  1OME A;  3A3I A;  3IWO A;  1WYC A;  4JXW A;  3C4O A;  1XX2 A;  5FAQ A;  4WMC D;  1ES2 A;  3W4O A;  3BLS A;  3FKW A;  2J8Y A;  1O7E A;  3WS1 A;  1K4E A;  3ZG8 B;  2A49 A;  3IF6 A;  3A3F A;  3NC8 A;  1YLP A;  1K56 D;  3C4P A;  4X55 A;  5EE8 A;  4E3N A;  4RX2 A;  1HVB A;  4N9L A;  3UN7 A;  5CRF A;  1YLZ A;  4JF5 A;  1ONG A;  1W5D A;  4KZA A;  3BFE A;  4WEL A;  2Y2H A;  4LEN A;  1MBL A;  2JE5 A;  3S22 A;  3EQV A;  3TG9 A;  4E3O A;  2EX8 A;  5FQM A;  5EPH A;  1ES5 A;  2WGW B;  3C5A A;  3IF6 C;  3C7U A;  2Y2I A;  1LLB A;  3OCN A;  1RGY A;  2EFX A;  3Q1F A;  2H5S A;  5HX9 A;  4E6X A;  1YLJ A;  3WRT A;  1LL5 A;  4UAA A;  1E4D A;  3RXW A;  2ZM0 A;  2XFS A;  3MFD A;  5EEC A;  2HDU A;  3W4Q A;  1QMF A;  4KZ8 A;  4MEZ A;  4GDB A;  2Y4A A;  4QY6 A;  5E2G A;  3S1Y A;  3UO9 A;  4B4X A;  3GQZ A;  4LCL A;  5D3O A;  4ZBE A;  1KDW A;  4LCM A;  1MXO A;  4OQI A;  4RX3 A;  5CXW A;  1FR6 A;  4BEN A;  3A3J A;  5GLD A;  5CHM A;  3HUN A;  3NIA A;  1IEM A;  2DRW A;  2VGK A;  2OLU A;  2DCF A;  3BFG A;  4S2N A;  3WS2 A;  4P0M A;  3IH8 A;  2P9V A;  5FQI A;  2VGJ A;  1CEG A;  1MWS A;  4QJG A;  3ZCZ A;  5EOE A;  5FQ9 A;  4P6B A;  5TGF A;  3BRM A;  4PM8 A;  1WE4 A;  1ESU A;  1IKG A;  3BFC A;  2WKE A;  1SHV A;  3CMZ A;  3IXB A;  5FQJ A;  1PWD A;  4FD8 A;  4U3T A;  2X71 A;  1G68 A;  4QD4 A;  2XFT A;  4ZAM A;  3ZGA B;  4LV3 A;  5FQQ A;  2B5R A;  4S2N C;  2BG1 A;  2Y2O A;  3OPP A;  2RL3 A;  4HEF A;  3IHA A;  5GHX A;  5G18 A;  3HLC A;  3UY6 A;  1AXB A;  5EOO A;  1FQG A;  4BJP A;  2QPN A;  4X56 A;  5EUA A;  3ZNT A;  2ZMA A;  2UWX A;  3MBZ A;  3G34 A;  2WUQ A;  2WKI A;  3I7J A;  4OKP A;  3FV7 A;  4OP8 A;  3VSK A;  3LY3 A;  5DTT A;  2XK1 A;  3WWX A;  3OPH A;  3UPN A;  3MKE A;  1KGG A;  5IHV A;  2JC7 A;  5KSC A;  3GSG A;  1K55 A;  1XA7 A;  4FSF A;  2PU2 A;  3V5M A;  4C75 A;  1K57 A;  4LV2 A;  1MPL A;  5GHY A;  3UPP A;  3VFH A;  5F1F A;  4PPR A;  3BFD A;  3DW0 A;  1Y54 A;  5AQ7 A;  2X02 A;  1BLC A;  4B4Z A;  3PBS A;  4UA9 A;  2J7V A;  2H0Y A;  4R0Q A;  3V50 A;  5AQA A;  1LI0 A;  4OQH A;  3IXG A;  4E3K A;  1I5Q A;  2ZM2 A;  4KQR A;  4R3B A;  2ZQ7 A;  1I2W A;  4S2K A;  1KE3 A;  1IYP A;  1JTG A;  1K55 C;  3HL9 A;  1K57 C;  2Y2P A;  1XGJ A;  1TVF A;  4JPM A;  4MBK A;  4WEJ A;  3TSG A;  3V3S A;  3Q82 A;  1PW8 A;  2ZD8 A;  1RCJ A;  2OV5 A;  3WS0 A;  1KE4 A;  4E6W A;  4O7D A;  3ZHH A;  1ZC2 A;  4S2J A;  2Y2G A;  4E3L A;  3BFF A;  3VP0 A;  2IWC A;  4DDY A;  3MXS A;  5EVI A;  4DE0 A;  2R9W A;  1IEL A;  3N8R A;  4QY5 A;  5CTN A;  1BLS A;  2HP9 A;  2Y55 A;  1PZP A;  1ERM A;  4UA6 A;  1NJ4 A;  1CI9 A;  5TFQ A;  3DWK A;  1H5X A;  3VP1 A;  3LO7 A;  5E2E A;  3IH9 A;  2C5W B;  2HDR A;  4N1H A;  4OLD A;  4WEK A;  4HES A;  5JYP A;  3QHY A;  4ID4 A;  3IF6 B;  5CER A;  4GKU A;  4XXR A;  1DY6 A;  3O86 A;  5EVI C;  1K6R A;  2Y2L A;  4Z9Q A;  1BLP A;  1MY8 A;  4C6Y A;  1XGI A;  3ZG5 A;  2ZQ9 A;  3IHB A;  1SKF A;  3GTC A;  2P74 A;  4H8R A;  2CC1 A;  5DF7 A;  2V1Z A;  4BQM A;  2ZC4 B;  3IF5 A;  5FI6 A;  3NBL A;  1PWG A;  4OOL A;  1JWV A;  3CZD A;  3GV9 A;  3NCK A;  4KZ7 A;  3HLF A;  1PYY A;  4XUZ A;  5AQ9 A;  2XR0 A;  1E3U D;  1SDN A;  1FR1 A;  3G35 A;  2WAD A;  2WK0 A;  3BLM A;  4KG2 A;  4P87 A;  5FA7 A;  1M6K A;  4KZB A;  3IWI A;  5DF8 A;  4EBN A;  4P85 A;  4OP5 A;  4FH2 A;  1DJA A;  3SS3 A;  1N9B A;  2J9O A;  4BLM A;  2I72 A;  2Y91 A;  5HAR A;  5I94 A;  2WGI A;  1MWU A;  1Z6F A;  3HLG A;  1BTL A;  1L2S A;  5A93 A;  1EI5 A;  2ZLY A;  4X6T A;  1CEF A;  3SOI A;  1KDS A;  2EX6 A;  3FZC A;  3MZF A;  3Q7V A;  3VP2 A;  4C3Q A;  5GHZ A;  4F94 A;  4EQI A;  1YT4 A;  5CGW A;  4GDN A;  1KVL A;  3PTE A;  3HUM A;  3ITB A;  4KEN B;  1SDE A;  1FCM A;  4HBU A;  3PAE A;  5JYO A;  4QB8 A;  4Y0U A;  1NRF A;  2GDN A;  4IVI A;  5M18 A;  3VP4 A;  5GLA A;  4OOY A;  1MKI A;  2A3U A;  1YLW A;  1L0D A;  1DJB A;  4R1G A;  5E2F A;  1ZKJ A;  3E2K A;  2XGN A;  1RP5 A;  4UHU A;  1ALQ A;  1LI9 A;  1E25 A;  4OPR A;  4EUZ A;  3VP3 A;  3BYD A;  4DXB A;  2ZC6 B;  3OC2 A;  3PBO A;  2ZC3 B;  4KZ6 A;  1DJC A;  2IWD A;  4GD6 A;  1TDG A;  2OSU A;  2WGW A;  3G2Z A;  3G2Y A;  3N6I A;  2ZQD A;  3FWL A;  4FH4 A;  2EX9 A;  4WZ5 A;  4RVA A;  3TOI A;  5CEC A;  4KG6 A;  5M1A A;  4XUX A;  3O87 A;  1JTD A;  4Y0T A;  3ZFZ A;  3GRJ A;  2OLV A;  3P98 A;  4WMC A;  1W8Y A;  4MNR A;  3SS5 A;  4GB7 A;  4OH0 A;  4WBG A;  4S2P A;  3HLB A;  4PM9 A;  2V2F F;  2WAE A;  3OPL A;  4HBT A;  4LV1 A;  5F82 A;  4JXG A;  1IYQ A;  1K56 A;  2Z2M B;  1IYS A;  3PBR A;  4WZ5 C;  1LHY A;  1YMS A;  1S0W A;  4ZJ3 A; 
#chains in the Genus database with same CATH topology
 1XP4 A;  2R78 A;  1N9L A;  3B42 A;  2YKF A;  4GS9 A;  4L9E A;  4WM9 A;  1JVJ A;  2HDS A;  3OBF A;  3VP2 A;  2EFU A;  4S2I A;  1FSW A;  4R4S A;  4P6Z S;  3PBT A;  1PW1 A;  3W4P A;  2AVX A;  5A90 A;  2QZ6 A;  3IX3 A;  2HP5 A;  1K0K A;  2WZX A;  5FQK A;  1S67 L;  4H6J B;  3CUE A;  3A3E A;  4EEU A;  5L8M A;  3LIC A;  4ME4 A;  4ZJ1 A;  2VJW A;  3ZG9 B;  3LI8 A;  3UE3 A;  3VOY A;  1LSV A;  1SZV A;  3G30 A;  3Q07 A;  3BWL A;  5HDS A;  1YSQ A;  3R7W B;  1Q2Q A;  1CI8 A;  3ICY A;  3JYI A;  3NHQ A;  4Q8I A;  1ZG6 A;  4IUH A;  2Y59 A;  1LL8 A;  3VOZ A;  4ZDX A;  4MMN A;  4KQD A;  2JKF A;  2KX6 A;  1AWI A;  1W7F A;  2EXB A;  1FCN A;  2V9A A;  2GNX A;  1XKZ A;  4HQA A;  4OPZ A;  1Z09 A;  3Q7V B;  2G2U A;  1UWN X;  1G28 A;  3DTM A;  3LEZ A;  4N9K A;  2C6W B;  4ESP A;  4WYY A;  4FCF A;  3GMW A;  1GA9 A;  3UE0 A;  1MZU A;  1GA0 A;  2P9V B;  3EEA A;  1F5M A;  4L9F A;  2M7U A;  4OPY A;  1TDL A;  4Y7P A;  5FAT A;  4EET B;  1YQS A;  4N1X A;  3NEC A;  1UGU A;  1FSY A;  2OOL A;  1ZHH B;  2XA7 S;  3IWQ A;  1STZ A;  3A0S A;  2Y79 A;  4KZ5 A;  5IU1 A;  1PIO A;  2ZC7 A;  2VK3 A;  4NEE D;  3LIB A;  4E3M A;  2WKQ A;  4DE1 A;  5DFX A;  1K4F A;  2XQZ A;  4KZ9 A;  2XD5 A;  2PRF A;  3FYZ A;  4E3I A;  5CEB A;  3P09 A;  3ZDJ A;  1ODV A;  4K0X A;  3WS5 A;  1NYY A;  4JKT A;  4S2O A;  2HV1 A;  2PHY A;  5HWV A;  1IOU A;  1K25 A;  4KZ3 A;  5FI7 A;  3G32 A;  3MQQ A;  3F1O A;  3M6B A;  4GLQ A;  5CHU A;  4MCW A;  1NY0 A;  2XDM A;  4DRT A;  5HAI A;  1PI4 A;  3IBR A;  2ACG A;  2IWB A;  5FAO A;  2DMW A;  3QNC A;  3LY4 A;  4IUK A;  3KSG A;  4S2M A;  3UPO A;  2HJE A;  2G2W A;  3HBR A;  3JVU A;  3S4X A;  1U60 A;  3DTE A;  1G6O A;  4X53 A;  1F9I A;  1OT6 A;  1NZO A;  3S7O A;  5AVE A;  2ZMV A;  1OME A;  5DKK A;  3C4O A;  1XX2 A;  3NOT C;  3MR0 A;  3W4O A;  1O7E A;  3WS1 A;  2J3T C;  3UMD A;  3A3F A;  3GEC A;  3T4Q A;  4Z1W A;  4I3J A;  4JF5 A;  1W5D A;  3BFE A;  4LEN A;  5FEF A;  2OAQ 1;  5EPH A;  1ES5 A;  3C7U A;  1LLB A;  4E6X A;  3WRT A;  4UAA A;  2XFS A;  3MFD A;  1DP8 A;  3SZT A;  2HDU A;  2GJ3 A;  4GDB A;  2Y4A A;  5D3O A;  2K2N A;  5CXW A;  4RX3 A;  5CHM A;  3NIA A;  2VGK A;  2DRW A;  4EUV A;  2OLU A;  1WA9 A;  3WS2 A;  4ETX A;  1OTA A;  3H82 B;  3E4O A;  2O9C A;  4PM8 A;  4O8G A;  1WE4 A;  5L09 A;  1SHV A;  3IXB A;  5FQJ A;  4U3T A;  4FD8 A;  2BG1 A;  1T1B A;  4EW7 A;  5G18 A;  3UY6 A;  4CLC C;  2PR5 A;  4BJP A;  3MBZ A;  2WUQ A;  2WKI A;  2KOI A;  3FV7 A;  4Y15 A;  3GSG A;  1XA7 A;  3V5M A;  1D06 A;  3DW0 A;  1BLC A;  2J7V A;  2H0Y A;  5HPF A;  4DMZ A;  4OQH A;  1I5Q A;  2ZM2 A;  2ZQ7 A;  1I2W A;  3B33 A;  3HL9 A;  5IS1 A;  2Y2P A;  3BY9 A;  3V3S A;  3DAV A;  1PW8 A;  4O7D A;  4JGP A;  3C8C A;  3BFF A;  2ZL1 A;  2IWC A;  2J3W A;  2R9W A;  4QY5 A;  5J3W A;  4Y5F A;  1BLS A;  1NJ4 A;  1CI9 A;  4HJ6 A;  4N1H A;  4OLD A;  3H7W A;  5CER A;  4Y13 A;  1BLP A;  2ZQ9 A;  2V1A A;  3CHW P;  4BQM A;  3CI6 A;  5FI6 A;  3EWK A;  4KZ7 A;  3HLF A;  2XR0 A;  4CQH A;  3T4J A;  2WK0 A;  4KG2 A;  4P87 A;  5FA7 A;  4KZB A;  3IWI A;  5DF8 A;  4P85 A;  1DJA A;  1N9B A;  4BLM A;  2I72 A;  1MWU A;  2LB5 A;  1BTL A;  1EI5 A;  2E8J A;  2ZLY A;  1CEF A;  1TD5 A;  3LR5 A;  5GHZ A;  3S7Q A;  3LI9 A;  2HF6 A;  4M4X A;  4HI4 A;  4GDN A;  3PTE A;  1OTB A;  3HUM A;  4KEN B;  3NOU C;  4HBU A;  4WUJ A;  1NRF A;  4IVI A;  2VV6 A;  3HJK A;  4OOY A;  2A3U A;  1L0D A;  1MC0 A;  1ZKJ A;  1ALQ A;  1LI9 A;  2A24 B;  4OPR A;  4EUZ A;  3F1N B;  5L07 A;  4KZ6 A;  1TDG A;  2EX9 A;  2FH5 A;  3L7H A;  4XUX A;  3O87 A;  4Y0T A;  4I3A A;  3EOI A;  4KUO A;  4HHD A;  4WMC A;  1W8Y A;  4WN5 A;  4OH0 A;  3RFB A;  1VET A;  2QHK A;  3PYP A;  1K56 A;  4DF6 A;  3PBQ A;  4R6L A;  2J3T D;  1IYO A;  4NK3 A;  1FOF A;  4HH3 A;  3IT9 A;  2DNS A;  3BQ8 A;  2VEA A;  2H0T A;  4KQO A;  4G3K A;  4WL9 A;  3MKF A;  4PMA A;  3VOL A;  4R23 A;  1H8Y A;  2ZMF A;  1PFL A;  1K38 A;  3VMA A;  5A91 A;  2PU4 A;  4IBX A;  2WKH A;  1YLY A;  5LBR A;  3BEB A;  2HDQ A;  4NKP A;  4NXB A;  2XRN A;  1Y28 A;  2V0W A;  1L0G A;  1EW0 A;  4Y3I A;  5FDH A;  3AGF A;  4XT2 A;  2FFF B;  3Q7Z A;  4CLC D;  2FFY A;  3K3C A;  3MMH A;  1UWP X;  4MBH A;  1BUE A;  3CPT A;  4GOG A;  3N8S A;  1VEU A;  4WLA A;  4YFM A;  4EES A;  3KYQ A;  1K54 C;  1MWR A;  3KYE A;  5FDS A;  2QMI A;  2XH9 A;  3TRC A;  2LB9 A;  5F69 A;  1ES4 A;  3IQA A;  5BOH A;  2O9A A;  3U4L P;  3A3D A;  3F1P B;  3BJN A;  5A92 A;  1J9M A;  2PD7 A;  5FI2 A;  1VM1 A;  4OLG A;  3JPU A;  3H9W A;  2WAF A;  4KQQ A;  5EFW A;  3OPR A;  1YSP A;  3M6H A;  5G4Z A;  4OON A;  1W63 M;  4JBF A;  1BYW A;  1LL9 A;  1O07 A;  4BD0 A;  3QP2 A;  4DE2 A;  2OWH A;  4JGQ A;  3HRE A;  2H10 A;  2WZZ A;  3PAG A;  4OQG A;  2Y2N A;  4IBR A;  1HTZ A;  1K6S A;  2B02 A;  4U0X A;  3N7W A;  2K31 A;  3SW1 A;  5FSR A;  2BLS A;  5E43 A;  3LYX A;  4E04 A;  3LR0 A;  5EVL A;  1BUL A;  1ESI A;  1VQQ A;  3VE3 A;  5C5K A;  3QP5 A;  4X68 A;  3B3X A;  2XA7 M;  3QP8 A;  3IXH A;  2KDK A;  3M2K A;  4R38 A;  1GHM A;  2XF3 A;  5GLB A;  3NY4 A;  4EU0 A;  5HFO A;  4R4R A;  3G31 A;  4MN5 A;  2JKR M;  3W8K A;  5CHJ A;  5DTS A;  3KSF A;  5HAQ A;  4F3L A;  3LUQ A;  3MSH A;  3LGO A;  3NJA A;  4R3A A;  2L4R A;  5U47 A;  1BT5 A;  2ZQC A;  3ZVW A;  1LSX A;  4D60 A;  1XXM A;  5EV0 A;  4X1L A;  5DVA A;  2QJ5 A;  3LCE A;  3ZNY A;  4GD8 A;  4M3K A;  5J8X A;  5FAP A;  5CGS A;  4HJ4 A;  3IWO A;  3D9Y A;  4JXW A;  3ZG8 B;  3IF6 A;  3NC8 A;  4E3N A;  1TF1 A;  4RX2 A;  4HJ3 A;  1W63 Q;  3UN7 A;  5CRF A;  4FOF A;  4HP9 A;  3EQV A;  3TG9 A;  2EX8 A;  2WGW B;  3OCN A;  3FPW A;  3Q1F A;  2H5S A;  1XFN A;  5EM1 A;  3T1S A;  2ZM0 A;  5E2G A;  1F2K A;  3GQZ A;  1KDW A;  4OQI A;  1MXO A;  4BEN A;  3A3J A;  1XJ6 A;  3HUN A;  5J7E A;  4WF0 A;  4P0M A;  3IH8 A;  2P9V A;  3FPV A;  5FQI A;  2D01 A;  5EOE A;  5TGF A;  4I39 A;  4BBU A;  1IKG A;  2PD8 A;  4QD4 A;  2XFT A;  1NRJ A;  5FQQ A;  4YNR A;  4O0P A;  4S2N C;  3OPP A;  2Y2O A;  4HEF A;  3DTK A;  3IHA A;  3R4K A;  5EOO A;  1J3W A;  3D72 A;  3G34 A;  3I7J A;  2NUT C;  3F1O B;  3DTI A;  5IHV A;  2PU2 A;  4C75 A;  1K57 A;  3UPP A;  5F1F A;  4B4Z A;  2X02 A;  4JGR A;  4UA9 A;  3EGX C;  1TS8 A;  4ARZ A;  5HWW A;  4KQR A;  4R3B A;  5AVF A;  1K55 C;  1XGJ A;  1TVF A;  2WKR A;  4JPM A;  4MBK A;  4WEJ A;  1NWZ A;  2ZD8 A;  1RCJ A;  2OV5 A;  1ZC2 A;  3VP0 A;  4I5S A;  4DDY A;  3MXS A;  4DE0 A;  1XJ3 A;  2Y55 A;  1XFQ A;  5TFQ A;  1N9O A;  3VP1 A;  2B18 A;  4FTX A;  2EWW A;  4WEK A;  4HES A;  5JYP A;  2O0Y A;  4GKU A;  4XXR A;  5EVI C;  3O86 A;  2Y2L A;  4Z9Q A;  1XGI A;  3ZG5 A;  4IHQ A;  4H8R A;  4I38 A;  1PWG A;  3GV9 A;  3NCK A;  5AQ9 A;  4XUZ A;  1E3U D;  3LR3 A;  1FR1 A;  3G35 A;  4AFI A;  3OLO A;  5HD5 A;  2PYP A;  5HAR A;  5I94 A;  1CQA A;  5A93 A;  1KDS A;  4QWO A;  2EX6 A;  3FZC A;  4UQI M;  3MZF A;  1YT4 A;  4UEY A;  3ITB A;  3KO6 A;  1HLU P;  1FCM A;  5JYO A;  4QB8 A;  4Y0U A;  2GDN A;  1YLW A;  3E2K A;  2XGN A;  1RP5 A;  1E25 A;  3VP3 A;  3OC2 A;  2IWD A;  2OSU A;  3N6I A;  3FWL A;  4RVA A;  5M1A A;  3ZFZ A;  3GRJ A;  3P98 A;  2INW A;  4S2P A;  3HLB A;  2WAE A;  5DKL A;  5F82 A;  4WZ5 C;  3BY8 A;  1LHY A;  3U2A A;  3T1X A;  1S0W A;  4ZJ3 A;  4BWI A;  2R9X A;  4OVD A;  2M1C A;  3IBJ A;  4BL2 A;  2Z6C A;  4DDS A;  4R3J A;  3H82 A;  3ITA A;  4LFU A;  5GLC A;  1JWP A;  1WYB A;  3TOI A;  2X01 A;  1OPX A;  3V3R A;  3K2N A;  3HUO A;  4E3O A;  1GCE A;  1W8Q A;  4L9G A;  3IXD A;  4LV0 A;  4JF4 A;  3RXX A;  1HD8 A;  3MZD A;  2W1T B;  1S4S A;  4EBL A;  4MN6 A;  3NOP C;  4RA7 A;  1D1J A;  2Z2L B;  4RQ9 A;  3T4K A;  3HJI A;  4X1M A;  3SH8 A;  4UQI S;  3VFF A;  1C3B A;  3HLW A;  1PRQ A;  3CUE C;  2JKR I;  4GHI A;  2Q0O A;  1KVM A;  1ONH A;  3HLE A;  1T18 A;  4JXS A;  2Y2J A;  4NXG A;  1P97 A;  4O01 A;  1Q2P A;  5HSQ A;  2QWS A;  3M2J A;  1S6R A;  4GNU A;  1D7E A;  2J80 A;  5HAP A;  4Y2F A;  1KGE A;  4NXE A;  3ZG7 B;  4QHC A;  3UDI A;  1V9Z A;  2HPB A;  3MZE A;  4HP4 A;  3G4P A;  1MKM A;  2ZM8 A;  3UB5 P;  3Q81 A;  3P7N A;  2B95 A;  3SS4 A;  4LRY C;  1CK3 A;  2RCX A;  4OPQ A;  4A5R A;  2Q9N A;  5HW3 A;  1OJ5 A;  1JWZ A;  5DJT A;  2VGL M;  3IX8 A;  1L0E A;  3MF0 A;  3LID A;  5F1G A;  3UB7 A;  2P08 A;  3AGE A;  2A2L A;  4JLF A;  2JBF A;  2O9B A;  3O88 A;  2V20 A;  4MN7 A;  4ZJ2 A;  3NI9 A;  2WGV A;  1X0O A;  4WZ4 A;  5HL1 A;  4NET A;  1Y4O A;  3A0V A;  3EEH A;  5TBM B;  1QME A;  3KYZ A;  5EVE A;  2HZ5 A;  1ZTU A;  1S1Z A;  4EV4 A;  1ES3 A;  4CPK A;  3HLD A;  1YM1 A;  3CG5 A;  5CGX A;  1VB6 A;  3E0Y A;  5EVI D;  4I3I A;  3UE6 A;  5CED A;  3CAX A;  1F98 A;  5K5B A;  3IS2 A;  5IT5 A;  4BL3 A;  1ERQ A;  1PZO A;  5E2H A;  2GX5 A;  1ERO A;  3ZQ5 A;  2A24 A;  4IVK A;  3FKV A;  3F1N A;  3O5Y A;  1LT0 A;  3MXQ A;  4DKI A;  5DTK A;  4PM5 A;  3DWZ A;  3BEC A;  3CJM A;  1LSW A;  5EVI B;  1M40 A;  5AQB A;  2ZOH A;  4RYE A;  1ACF A;  2Y2K A;  3ULF A;  3MQ0 A;  4BD1 A;  3TE8 A;  1HZO A;  1TS0 A;  1YMX A;  3BM6 A;  4K08 A;  4BMW A;  4PKY G;  4KG5 A;  2VGL S;  2W3F A;  5F6A A;  2Q9M A;  3EQU A;  3LEQ A;  2VZW A;  4EWF A;  1P9W A;  3CPT B;  3QP4 A;  4LRZ E;  2KLI A;  1PNE A;  4DXC A;  4GCZ A;  4E3J A;  3OCL A;  2I9V A;  4K0W A;  2XD1 A;  3UDF A;  4X69 A;  1S66 L;  3T4L A;  5J4E A;  1N4O A;  1SKO B;  3EGD C;  4PAU A;  2JKT M;  2W0N A;  1ES2 A;  2J8Y A;  3MS6 A;  3KSI A;  1YLP A;  1V9Y A;  3C4P A;  4X55 A;  5HL6 A;  4N9L A;  1TS7 A;  1H0M A;  4KZA A;  4WEL A;  1MBL A;  3S22 A;  2Y2I A;  3CIT A;  5HX9 A;  3KX0 X;  1YLJ A;  1LL5 A;  1E4D A;  3RXW A;  1G5U A;  4G3W A;  1QMF A;  4KZ8 A;  4MEZ A;  3UO9 A;  4QY6 A;  1FR6 A;  1GSW A;  2G7U A;  3UME A;  3BFG A;  1P9R A;  4GS9 B;  4CLC A;  1CEG A;  1OTD A;  4QJG A;  3F1P A;  3PXP A;  3BFC A;  2WKE A;  2CMN A;  1PWD A;  2GZA A;  2X71 A;  1G68 A;  2W3E A;  4LV3 A;  1OTI A;  3HCY A;  3HLC A;  1AXB A;  4GJ4 A;  2BAS A;  4QPR A;  2QPN A;  5EUA A;  3T1R A;  2UWX A;  1XJ2 A;  4OKP A;  2P7J A;  3LY3 A;  5DTT A;  2XK1 A;  3WWX A;  3UPN A;  4LGW A;  4BBT A;  5KSC A;  1A0K A;  1MPL A;  3VFH A;  1Y54 A;  5AQ7 A;  2W3G A;  3V50 A;  4F3L B;  1H3Q A;  3IXG A;  4PKY A;  4S2K A;  1KE3 A;  1JTG A;  3TSG A;  2ZOI A;  2BTF P;  2OAP 1;  3CWF A;  4S2J A;  2Y2G A;  1IFQ A;  1YKD A;  4R70 A;  1NLY A;  3PR6 A;  1IEL A;  3N8R A;  4H6J A;  1PZP A;  3DWK A;  1H5X A;  3LO7 A;  2HDR A;  5HD3 A;  3E4P A;  3IF6 B;  1DY6 A;  3IHB A;  4DJ2 A;  1SKF A;  3GTC A;  2P74 A;  2CC1 A;  5DF7 A;  2V1Z A;  2ZC4 B;  4DJ3 A;  2PR6 A;  3IF5 A;  3R7W A;  3NBL A;  4EQ1 A;  4OOL A;  1JWV A;  3CZD A;  1SDN A;  3W2Z A;  2WAD A;  3BLM A;  5CX7 A;  3T4T A;  4MDZ A;  1M6K A;  4EBN A;  5I5L A;  4OP5 A;  3SS3 A;  2Y8H A;  2WGI A;  3HLG A;  1Z6F A;  1YAX A;  1L2S A;  5DFY A;  3BW6 A;  3Q7V A;  4C3Q A;  4EQI A;  5AJG A;  3PAE A;  3UB8 A;  4KUK A;  3VP4 A;  1GSV A;  4HNB A;  4DXB A;  5HZH A;  2EWV A;  4GD6 A;  2WGW A;  3G2Z A;  3G2Y A;  4FH4 A;  1L3L A;  2UV0 E;  4KG6 A;  3JVV A;  4Y17 A;  1JTD A;  2VKS A;  4NXF A;  3SS5 A;  4WBG A;  1KOU A;  5F68 A;  4PM9 A;  2VA0 A;  3V67 A;  4LV1 A;  4HBT A;  4JXG A;  1IYQ A;  2Z2M B;  2JN7 A;  1YMS A;  4ARZ B;  4D2O A;  3FC7 A;  2V8C A;  2ZQ8 A;  1RGZ A;  1NXY A;  1NLZ A;  2PBD P;  2VV7 A;  4L0L A;  3RJU A;  3UNW A;  1S1Y A;  1TEM A;  3T1Q B;  1FCO A;  4NG2 A;  3E2L A;  5M19 A;  3N8L A;  4JXV A;  1EWZ A;  2WKP A;  4DE3 A;  4ETZ A;  4KZ4 A;  4PM6 A;  4CLC E;  2EX2 A;  3V39 A;  1MWT A;  4JF6 A;  3GDI A;  2ZJ9 A;  4QU3 A;  4Y0O A;  2FZ0 A;  5DJU A;  4GZB A;  3NUL A;  2XLN A;  1VHM A;  2H28 A;  2HGV A;  1OT9 A;  1XA1 A;  3QP6 A;  4YOF A;  4ZTK A;  3AGD A;  3PBN A;  2JHE A;  3DBA A;  5KZH A;  5HDC A;  1NYM A;  3UDX A;  3GR2 A;  3T50 A;  3ZVT A;  3E98 A;  3ISG A;  4PM7 A;  5GL9 A;  3ZG0 A;  1K54 A;  3D4F A;  1GHP A;  5KMW A;  4EBP A;  1ZG4 A;  4FUW A;  3C7V A;  3QP1 A;  3SH7 A;  2JKT I;  2Y2M A;  1S4R A;  1W79 A;  2P04 A;  4UA7 A;  4LLO B;  3C2W A;  3PHY A;  3NDE A;  4B93 A;  1H8Z A;  3HVF A;  1BZA A;  3UB6 A;  3UE1 A;  5EM0 A;  3QNB A;  3VSL A;  1JNU A;  2W3D A;  5DF9 A;  2NUP C;  1PI5 A;  2PBY A;  2HJ9 C;  5HDD A;  3O3V A;  2PDR A;  2OWJ A;  2D02 A;  2VX8 A;  1G6A A;  2HP6 A;  1N9N A;  1BSG A;  1SCW A;  2QKP A;  3SH9 A;  2JKG A;  4ZRR A;  4K91 A;  2V8F A;  4OQ0 A;  1E3U A;  2ZC5 B;  3KSH A;  3T4O A;  4U0T A;  2ZQA A;  1YLT A;  5FAS A;  2Y2Q A;  1OJG A;  5KSH A;  4S2L A;  4HOI A;  3TW8 A;  1XPB A;  1I2S A;  1KGF A;  2J9P A;  4OOM A;  2ZL1 B;  1T1A A;  2XEP A;  4YIN A;  3C38 A;  3WRZ A;  4X25 A;  4IJG A;  4CJN A;  4Q0J A;  1NZU A;  4MBF A;  3TJZ C;  2W3H A;  1GHI A;  3BQA A;  5F5Y A;  3WS4 A;  4GHI B;  3LIF A;  1PWC A;  5F83 A;  1L0F A;  3H7W B;  4B9O A;  1BLH A;  2QJ7 A;  1KE0 A;  4B88 A;  1DP6 A;  3NDG A;  4N92 A;  3IX4 A;  4IED A;  2WYX A;  3N4I A;  2E8I A;  4LPZ A;  2JCH A;  3RTY A;  2K7S A;  3GVB A;  3T12 B;  2EA9 A;  1IKI A;  3MXR A;  4GN2 A;  2W1T A;  5CTM A;  5L2F A;  5TR7 A;  3LFV A;  2PAV P;  3L9K A;  4MLL A;  3OZH A;  3MJQ A;  2EXA A;  3A3I A;  1WYC A;  2VLG A;  5HPI A;  2MJ6 A;  5FAQ A;  2YKH A;  4WMC D;  3BLS A;  3FKW A;  5G4Y A;  1K4E A;  2A49 A;  2V0U A;  1K56 D;  4LRX C;  5EE8 A;  1HVB A;  1YLZ A;  3MFX A;  1ONG A;  3G6O A;  2Y2H A;  2JE5 A;  3D3O A;  5FQM A;  3C5A A;  5KIZ A;  3IF6 C;  1RGY A;  2EFX A;  3OOV A;  4BBV A;  3VV4 A;  5L10 A;  5EEC A;  3W4Q A;  4Q0H A;  1VET B;  3RH8 B;  3S1Y A;  4B4X A;  1XJ4 A;  4LCL A;  4ZBE A;  4LCM A;  3FG8 A;  3IS2 B;  5GLD A;  5MC7 A;  1IEM A;  4HY8 A;  4HH2 A;  2DCF A;  2IA2 A;  4EER A;  4S2N A;  3E4Q A;  4EEP A;  3MQO A;  2VGJ A;  3VE4 A;  1MWS A;  3ZCZ A;  5FQ9 A;  4P6B A;  3BRM A;  1ESU A;  3CMZ A;  5TJJ A;  3ZGA B;  2Z6D A;  4ZAM A;  1YPR A;  2O99 A;  2B5R A;  3K3D A;  2RL3 A;  5GHX A;  2ZBB A;  1FQG A;  3LIA A;  4X56 A;  3ZNT A;  3CLO A;  2ZMA A;  5TBM A;  4OP8 A;  3VSK A;  3OPH A;  3MKE A;  1KGG A;  2JC7 A;  3LIE A;  1K55 A;  4FSF A;  4LV2 A;  5GHY A;  3A0R A;  4PPR A;  3BFD A;  1FIK A;  3PBS A;  4R0Q A;  3T4S A;  5AQA A;  1LI0 A;  4E3K A;  5A8B A;  1IYP A;  2QYB A;  5FL3 A;  1K57 C;  2L1M A;  2W1R A;  3Q82 A;  4XT2 B;  3WS0 A;  1KE4 A;  4II7 A;  3UB9 A;  4E6W A;  3ZHH A;  4Q0I A;  4E3L A;  3B47 A;  1P0Z A;  2PYR A;  2XSS A;  2W27 A;  4YWZ A;  5EVI A;  2PT7 A;  5CTN A;  1VEU B;  2HP9 A;  1ERM A;  4UA6 A;  5E2E A;  3IH9 A;  2C5W B;  3ZYT A;  1H8M A;  5HWT A;  3QHY A;  4ID4 A;  1K6R A;  3S7P A;  1MY8 A;  4C6Y A;  2XRO A;  1DRM A;  4HIA A;  2V1B A;  3P01 A;  1T19 A;  4P6Z M;  1PYY A;  1DP9 A;  4G3V A;  4FH2 A;  3S7N A;  2J9O A;  2Y91 A;  1OTE A;  1TS6 A;  4X6T A;  3SOI A;  1T1C A;  3C30 A;  2L0W A;  1SKO A;  4F94 A;  5CGW A;  1KVL A;  4CLC B;  3LR4 A;  1SDE A;  1GSX A;  5M18 A;  5FEG A;  5GLA A;  1MKI A;  4PHT A;  1DJB A;  4R1G A;  5E2F A;  4UHU A;  3BYD A;  4JGO A;  2ZC6 B;  3PBO A;  2ZC3 B;  1DJC A;  5CEC A;  4WZ5 A;  2ZQD A;  2M7V A;  1CF0 A;  1CJF A;  1FIL A;  2VV8 A;  2OLV A;  4MNR A;  4GB7 A;  2V2F F;  3OPL A;  4EXO A;  4DN0 A;  1IYS A;  3PBR A;  4GW9 A; 
#chains in the Genus database with same CATH homology
 4DF6 A;  2R9X A;  3PBQ A;  4OVD A;  1XP4 A;  4D2O A;  4BL2 A;  2ZQ8 A;  1RGZ A;  1NXY A;  4DDS A;  4WM9 A;  1JVJ A;  1IYO A;  2HDS A;  4R3J A;  3ITA A;  5GLC A;  2EFU A;  1JWP A;  1WYB A;  4L0L A;  4NK3 A;  1FOF A;  4S2I A;  2X01 A;  3RJU A;  1FSW A;  4R4S A;  1TEM A;  3IT9 A;  3UNW A;  2DNS A;  3PBT A;  1PW1 A;  3W4P A;  1FCO A;  3V3R A;  3E2L A;  5A90 A;  2QZ6 A;  5M19 A;  2HP5 A;  3HUO A;  1GCE A;  1W8Q A;  3N8L A;  2WZX A;  1EWZ A;  3IXD A;  4JXV A;  2H0T A;  5FQK A;  4LV0 A;  4DE3 A;  4JF4 A;  4KQO A;  3MKF A;  4KZ4 A;  4PM6 A;  3RXX A;  1HD8 A;  3MZD A;  4PMA A;  2EX2 A;  3V39 A;  4EBL A;  3A3E A;  1MWT A;  4JF6 A;  2ZJ9 A;  4QU3 A;  4Y0O A;  4R23 A;  1H8Y A;  4RA7 A;  4ZJ1 A;  2Z2L B;  3ZG9 B;  3SH8 A;  3VFF A;  1K38 A;  3VMA A;  5A91 A;  3UE3 A;  1C3B A;  3HLW A;  4GZB A;  3VOY A;  3G30 A;  3Q07 A;  2PU4 A;  4IBX A;  2XLN A;  2WKH A;  1YLY A;  1XA1 A;  3BEB A;  4ZTK A;  3AGD A;  1KVM A;  2HDQ A;  1Q2Q A;  1ONH A;  1CI8 A;  3JYI A;  3PBN A;  3HLE A;  4JXS A;  2Y2J A;  4Q8I A;  1ZG6 A;  1Q2P A;  2Y59 A;  5KZH A;  3VOZ A;  1NYM A;  3M2J A;  1L0G A;  1S6R A;  3UDX A;  3GR2 A;  4GNU A;  4ZDX A;  3ZVT A;  5HAP A;  3ISG A;  5FDH A;  4PM7 A;  3AGF A;  5GL9 A;  2FFF B;  3ZG0 A;  1W7F A;  3Q7Z A;  1KGE A;  1K54 A;  2EXB A;  3D4F A;  1FCN A;  3ZG7 B;  1GHP A;  4QHC A;  3UDI A;  2FFY A;  5KMW A;  2HPB A;  3MZE A;  4EBP A;  1XKZ A;  3G4P A;  4MBH A;  1BUE A;  4GOG A;  1ZG4 A;  4OPZ A;  3N8S A;  3C7V A;  2G2U A;  3Q7V B;  2ZM8 A;  3SH7 A;  4YFM A;  3Q81 A;  3DTM A;  3LEZ A;  1K54 C;  1MWR A;  4N9K A;  3SS4 A;  2Y2M A;  1CK3 A;  2C6W B;  2QMI A;  2RCX A;  4WYY A;  2XH9 A;  1W79 A;  4FCF A;  4UA7 A;  4OPQ A;  3GMW A;  1GA9 A;  1ES4 A;  2Q9N A;  3IQA A;  3UE0 A;  4A5R A;  5BOH A;  1GA0 A;  5HW3 A;  1JWZ A;  2P9V B;  3NDE A;  1H8Z A;  3HVF A;  1BZA A;  3A3D A;  1L0E A;  4OPY A;  3UE1 A;  5A92 A;  3QNB A;  3VSL A;  1TDL A;  1J9M A;  5F1G A;  3AGE A;  4Y7P A;  5FAT A;  5FI2 A;  1VM1 A;  4OLG A;  4JLF A;  2JBF A;  3O88 A;  4ZJ2 A;  1YQS A;  2V20 A;  3NI9 A;  5DF9 A;  4N1X A;  1PI5 A;  2WAF A;  2WGV A;  2PBY A;  3O3V A;  1FSY A;  4WZ4 A;  4KQQ A;  5HL1 A;  4NET A;  3IWQ A;  3OPR A;  3M6H A;  4OON A;  4KZ5 A;  1G6A A;  2HP6 A;  1PIO A;  1QME A;  1BSG A;  4JBF A;  1LL9 A;  2ZC7 A;  1SCW A;  1O07 A;  4BD0 A;  4EV4 A;  3SH9 A;  1ES3 A;  4DE2 A;  4CPK A;  3HLD A;  4E3M A;  1YM1 A;  4K91 A;  3CG5 A;  4DE1 A;  5CGX A;  4OQ0 A;  1E3U A;  2ZC5 B;  5EVI D;  5CED A;  4U0T A;  3HRE A;  2H10 A;  2WZZ A;  3PAG A;  4OQG A;  1K4F A;  2Y2N A;  1YLT A;  2ZQA A;  4BL3 A;  5FAS A;  4IBR A;  2XQZ A;  1HTZ A;  1K6S A;  2Y2Q A;  4KZ9 A;  1ERQ A;  3N7W A;  4U0X A;  1PZO A;  2XD5 A;  5KSH A;  5E2H A;  3FYZ A;  5FSR A;  4S2L A;  4E3I A;  1ERO A;  2BLS A;  5CEB A;  3P09 A;  4IVK A;  1XPB A;  5E43 A;  3ZDJ A;  1I2S A;  3FKV A;  4K0X A;  3WS5 A;  1NYY A;  4JKT A;  1KGF A;  2J9P A;  4DKI A;  4OOM A;  5EVL A;  1BUL A;  1ESI A;  5DTK A;  2XEP A;  4PM5 A;  1VQQ A;  3DWZ A;  3BEC A;  4S2O A;  4YIN A;  3CJM A;  3WRZ A;  5EVI B;  4X68 A;  1M40 A;  5AQB A;  3B3X A;  3IXH A;  4CJN A;  1NZU A;  4RYE A;  2Y2K A;  4MBF A;  3M2K A;  1GHI A;  1GHM A;  2XF3 A;  5GLB A;  1K25 A;  3NY4 A;  4KZ3 A;  5FI7 A;  3WS4 A;  4BD1 A;  3G32 A;  1PWC A;  5F83 A;  1L0F A;  5HFO A;  3M6B A;  1HZO A;  1BLH A;  4R4R A;  5CHU A;  1KE0 A;  1YMX A;  4B88 A;  3G31 A;  1NY0 A;  2XDM A;  3BM6 A;  4DRT A;  4KG5 A;  5HAI A;  1PI4 A;  3W8K A;  3NDG A;  4N92 A;  5CHJ A;  2IWB A;  5DTS A;  4IED A;  2WYX A;  5HAQ A;  5FAO A;  3N4I A;  2E8I A;  2JCH A;  3QNC A;  3GVB A;  2Q9M A;  3EQU A;  3LY4 A;  4S2M A;  4EWF A;  5U47 A;  1BT5 A;  3UPO A;  2G2W A;  2ZQC A;  3ZVW A;  1IKI A;  3MXR A;  3HBR A;  4GN2 A;  3S4X A;  4DXC A;  1U60 A;  5CTM A;  5L2F A;  4E3J A;  1XXM A;  3OCL A;  5TR7 A;  4K0W A;  2XD1 A;  3UDF A;  4X53 A;  4X69 A;  5DVA A;  3LCE A;  3ZNY A;  4MLL A;  3OZH A;  4GD8 A;  4M3K A;  5J8X A;  1NZO A;  5FAP A;  1N4O A;  5CGS A;  2EXA A;  1OME A;  3A3I A;  3IWO A;  1WYC A;  4JXW A;  3C4O A;  1XX2 A;  5FAQ A;  4WMC D;  1ES2 A;  3W4O A;  3BLS A;  3FKW A;  2J8Y A;  1O7E A;  3WS1 A;  1K4E A;  3ZG8 B;  2A49 A;  3IF6 A;  3A3F A;  3NC8 A;  1YLP A;  1K56 D;  3C4P A;  4X55 A;  5EE8 A;  4E3N A;  4RX2 A;  1HVB A;  4N9L A;  3UN7 A;  5CRF A;  1YLZ A;  4JF5 A;  1ONG A;  1W5D A;  4KZA A;  3BFE A;  4WEL A;  2Y2H A;  4LEN A;  1MBL A;  2JE5 A;  3S22 A;  3EQV A;  3TG9 A;  4E3O A;  2EX8 A;  5FQM A;  5EPH A;  1ES5 A;  2WGW B;  3C5A A;  3IF6 C;  3C7U A;  2Y2I A;  1LLB A;  3OCN A;  1RGY A;  2EFX A;  3Q1F A;  2H5S A;  5HX9 A;  4E6X A;  1YLJ A;  3WRT A;  1LL5 A;  4UAA A;  1E4D A;  3RXW A;  2ZM0 A;  2XFS A;  3MFD A;  5EEC A;  2HDU A;  3W4Q A;  1QMF A;  4KZ8 A;  4MEZ A;  4GDB A;  2Y4A A;  4QY6 A;  5E2G A;  3S1Y A;  3UO9 A;  4B4X A;  3GQZ A;  4LCL A;  5D3O A;  4ZBE A;  1KDW A;  4LCM A;  1MXO A;  4OQI A;  4RX3 A;  5CXW A;  1FR6 A;  4BEN A;  3A3J A;  5GLD A;  5CHM A;  3HUN A;  3NIA A;  1IEM A;  2DRW A;  2VGK A;  2OLU A;  2DCF A;  3BFG A;  4S2N A;  3WS2 A;  4P0M A;  3IH8 A;  2P9V A;  5FQI A;  2VGJ A;  1CEG A;  1MWS A;  4QJG A;  3ZCZ A;  5EOE A;  5FQ9 A;  4P6B A;  5TGF A;  3BRM A;  4PM8 A;  1WE4 A;  1ESU A;  1IKG A;  3BFC A;  2WKE A;  1SHV A;  3CMZ A;  3IXB A;  5FQJ A;  1PWD A;  4FD8 A;  4U3T A;  2X71 A;  1G68 A;  4QD4 A;  2XFT A;  4ZAM A;  3ZGA B;  4LV3 A;  5FQQ A;  2B5R A;  4S2N C;  2BG1 A;  2Y2O A;  3OPP A;  2RL3 A;  4HEF A;  3IHA A;  5GHX A;  5G18 A;  3HLC A;  3UY6 A;  1AXB A;  5EOO A;  1FQG A;  4BJP A;  2QPN A;  4X56 A;  5EUA A;  3ZNT A;  2ZMA A;  2UWX A;  3MBZ A;  3G34 A;  2WUQ A;  2WKI A;  3I7J A;  4OKP A;  3FV7 A;  4OP8 A;  3VSK A;  3LY3 A;  5DTT A;  2XK1 A;  3WWX A;  3OPH A;  3UPN A;  3MKE A;  1KGG A;  5IHV A;  2JC7 A;  5KSC A;  3GSG A;  1K55 A;  1XA7 A;  4FSF A;  2PU2 A;  3V5M A;  4C75 A;  1K57 A;  4LV2 A;  1MPL A;  5GHY A;  3UPP A;  3VFH A;  5F1F A;  4PPR A;  3BFD A;  3DW0 A;  1Y54 A;  5AQ7 A;  2X02 A;  1BLC A;  4B4Z A;  3PBS A;  4UA9 A;  2J7V A;  2H0Y A;  4R0Q A;  3V50 A;  5AQA A;  1LI0 A;  4OQH A;  3IXG A;  4E3K A;  1I5Q A;  2ZM2 A;  4KQR A;  4R3B A;  2ZQ7 A;  1I2W A;  4S2K A;  1KE3 A;  1IYP A;  1JTG A;  1K55 C;  3HL9 A;  1K57 C;  2Y2P A;  1XGJ A;  1TVF A;  4JPM A;  4MBK A;  4WEJ A;  3TSG A;  3V3S A;  3Q82 A;  1PW8 A;  2ZD8 A;  1RCJ A;  2OV5 A;  3WS0 A;  1KE4 A;  4E6W A;  4O7D A;  3ZHH A;  1ZC2 A;  4S2J A;  2Y2G A;  4E3L A;  3BFF A;  3VP0 A;  2IWC A;  4DDY A;  3MXS A;  5EVI A;  4DE0 A;  2R9W A;  1IEL A;  3N8R A;  4QY5 A;  5CTN A;  1BLS A;  2HP9 A;  2Y55 A;  1PZP A;  1ERM A;  4UA6 A;  1NJ4 A;  1CI9 A;  5TFQ A;  3DWK A;  1H5X A;  3VP1 A;  3LO7 A;  5E2E A;  3IH9 A;  2C5W B;  2HDR A;  4N1H A;  4OLD A;  4WEK A;  4HES A;  5JYP A;  3QHY A;  4ID4 A;  3IF6 B;  5CER A;  4GKU A;  4XXR A;  1DY6 A;  3O86 A;  5EVI C;  1K6R A;  2Y2L A;  4Z9Q A;  1BLP A;  1MY8 A;  4C6Y A;  1XGI A;  3ZG5 A;  2ZQ9 A;  3IHB A;  1SKF A;  3GTC A;  2P74 A;  4H8R A;  2CC1 A;  5DF7 A;  2V1Z A;  4BQM A;  2ZC4 B;  3IF5 A;  5FI6 A;  3NBL A;  1PWG A;  4OOL A;  1JWV A;  3CZD A;  3GV9 A;  3NCK A;  4KZ7 A;  3HLF A;  1PYY A;  4XUZ A;  5AQ9 A;  2XR0 A;  1E3U D;  1SDN A;  1FR1 A;  3G35 A;  2WAD A;  2WK0 A;  3BLM A;  4KG2 A;  4P87 A;  5FA7 A;  1M6K A;  4KZB A;  3IWI A;  5DF8 A;  4EBN A;  4P85 A;  4OP5 A;  4FH2 A;  1DJA A;  3SS3 A;  1N9B A;  2J9O A;  4BLM A;  2I72 A;  2Y91 A;  5HAR A;  5I94 A;  2WGI A;  1MWU A;  1Z6F A;  3HLG A;  1BTL A;  1L2S A;  5A93 A;  1EI5 A;  2ZLY A;  4X6T A;  1CEF A;  3SOI A;  1KDS A;  2EX6 A;  3FZC A;  3MZF A;  3Q7V A;  3VP2 A;  4C3Q A;  5GHZ A;  4F94 A;  4EQI A;  1YT4 A;  5CGW A;  4GDN A;  1KVL A;  3PTE A;  3HUM A;  3ITB A;  4KEN B;  1SDE A;  1FCM A;  4HBU A;  3PAE A;  5JYO A;  4QB8 A;  4Y0U A;  1NRF A;  2GDN A;  4IVI A;  5M18 A;  3VP4 A;  5GLA A;  4OOY A;  1MKI A;  2A3U A;  1YLW A;  1L0D A;  1DJB A;  4R1G A;  5E2F A;  1ZKJ A;  3E2K A;  2XGN A;  1RP5 A;  4UHU A;  1ALQ A;  1LI9 A;  1E25 A;  4OPR A;  4EUZ A;  3VP3 A;  3BYD A;  4DXB A;  2ZC6 B;  3OC2 A;  3PBO A;  2ZC3 B;  4KZ6 A;  1DJC A;  2IWD A;  4GD6 A;  1TDG A;  2OSU A;  2WGW A;  3G2Z A;  3G2Y A;  3N6I A;  2ZQD A;  3FWL A;  4FH4 A;  2EX9 A;  4WZ5 A;  4RVA A;  3TOI A;  5CEC A;  4KG6 A;  5M1A A;  4XUX A;  3O87 A;  1JTD A;  4Y0T A;  3ZFZ A;  3GRJ A;  2OLV A;  3P98 A;  4WMC A;  1W8Y A;  4MNR A;  3SS5 A;  4GB7 A;  4OH0 A;  4WBG A;  4S2P A;  3HLB A;  4PM9 A;  2V2F F;  2WAE A;  3OPL A;  4HBT A;  4LV1 A;  5F82 A;  4JXG A;  1IYQ A;  1K56 A;  2Z2M B;  1IYS A;  3PBR A;  4WZ5 C;  1LHY A;  1YMS A;  1S0W A;  4ZJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...