2WZXA

Amp-c beta-lactamase (pseudomonas aeruginosa)in complex with compound m-02
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
362
structure length
362
Chain Sequence
EAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Side Chain Sar of Bicyclic Beta-Lactamase Inhibitors (Blis). 1. Discovery of a Class C Bli for Combination with Imipinem.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
total genus 121
structure length 362
sequence length 362
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2wzxA00
4JF6A 4S2MA 4KG2A 5FSRA 1SKFA 5JYOA 5AQBA 3PBOA 4DDSA 1ES4A 1XPBA 4OONA 3GQZA 2OV5A 3RJUA 5EVIC 3ITBA 5F1FA 1KE0A 1BULA 1IYQA 1KVMA 2XD5A 4OH0A 3IH9A 3P09A 5M1AA 4P0MA 5CGXA 5CXWA 3A3FA 1E3UA 1MPLA 4U0TA 4JF4A 5CHJA 5DVAA 3UPNA 2WADA 4JXVA 2J7VA 3DTMA 2G2UA 1GA9A 3LY4A 4FCFA 3UE3A 4S2NC 4Y0TA 3V3SA 3V50A 2OLVA 1NYYA 4UAAA 4WYYA 4R3BA 2EX9A 3LO7A 4GD8A 3HBRA 3ZNYA 2ZQ8A 5A92A 1LL9A 3IF6C 1QMFA 4BQMA 3P98A 2P9VA 3NCKA 4P87A 4E3IA 3N4IA 4KZ3A 1K4FA 3HVFA 3UE0A 3BLSA 5FATA 5DF7A 5CHUA 3VMAA 2P9VB 1HVBA 2WGWA 4GKUA 4MBFA 1KE3A 1ERQA 3BFCA 2A3UA 1BLPA 1MWRA 5FQKA 4ZJ1A 1VQQA 4Y0OA 3PBRA 5GHZA 3IXGA 1K57A 1IKGA 3C7VA 1RCJA 4N1XA 1PWCA 4DRTA 3AGFA 3FV7A 4FH2A 2HDUA 4IVKA 1HTZA 4WMCA 5GLCA 1NRFA 3G2YA 1L2SA 4D2OA 1BTLA 1RP5A 2UWXA 3Q07A 5KSCA 1BZAA 1H5XA 3AGDA 1DJBA 3S1YA 5IHVA 3PTEA 4GOGA 4RA7A 1W8QA 3IF6A 4EUZA 4OQ0A 1K4EA 3B3XA 1XGJA 5D3OA 4JXGA 1W8YA 3VP0A 3W8KA 4EBNA 1JTGA 5DTTA 3G2ZA 1S0WA 4BD1A 5J8XA 4S2NA 4C75A 1NZUA 1XGIA 3SH7A 3WS1A 1FCOA 3DWZA 2EX2A 2Q9NA 3QNBA 3OC2A 4N9LA 4KG6A 4OOMA 5GL9A 5L2FA 3UO9A 1KGGA 4KZ7A 5FAPA 4JKTA 1Q2PA 2FFFB 1G6AA 2Y55A 2RL3A 4LV0A 2EXAA 2XD1A 4KZBA 5CTNA 3Q7ZA 4RVAA 3DWKA 3Q81A 1FCMA 1TDGA 1YLWA 1IYSA 3BM6A 3IWQA 2X01A 2XQZA 2ZQ9A 1JWZA 3CJMA 5G18A 4BL3A 1ONGA 1YM1A 3C7UA 1JWVA 3NY4A 2JC7A 3NBLA 3QNCA 3BLMA 3WRTA 3MZEA 1MY8A 4E3OA 1YMXA 4QY5A 4BD0A 4KG5A 3C5AA 1ESUA 1K54C 2HP5A 3IWIA 3N8LA 4IBXA 4WZ4A 1L0GA 3DW0A 5E2EA 3IXBA 4S2PA 3ZGAB 3WS2A 5GLBA 1I5QA 1ZG4A 3HL9A 4KZ4A 2ZQCA 1DJCA 5BOHA 4H8RA 1Q2QA 1PI4A 3BEBA 2P74A 4HESA 4U3TA 4B4XA 3ZVTA 2J8YA 3OPPA 1IEMA 4OPZA 5KMWA 3HLFA 2QZ6A 2ZQ7A 1GHPA 2HP6A 4FD8A 3WRZA 1BLSA 1BLHA 3MFDA 3W4QA 1TEMA 4YFMA 1QMEA 1KDWA 5TFQA 5FAOA 5DF9A 4IBRA 1E25A 2Y2GA 2Y2OA 4XUXA 2RCXA 3PBSA 1K25A 4DXBA 2Y91A 2ZJ9A 2ZM0A 1C3BA 1HD8A 1SDNA 1WYBA 2WZXA 2X71A 3TG9A 2DCFA 1DJAA 3UDXA 4FH4A 3M6BA 3BYDA 4QY6A 2PU2A 2Y2MA 3A3DA 5U47A 1PW1A 3UDIA 1EI5A 4QB8A 4ZAMA 3C4OA 1ZC2A 3BECA 3Q7VA 1N4OA 1BSGA 3WS4A 3CG5A 2QPNA 4OLDA 3VP3A 1XXMA 3BFDA 3O87A 4OP8A 2WAFA 5FA7A 4MLLA 2PU4A 2GDNA 2FFYA 3M6HA 3PBQA 5E43A 2XR0A 3FWLA 5HARA 2ZM8A 3UE1A 4WMCD 3ZHHA 5A91A 4LCLA 4ZJ3A 2X02A 3SS5A 4GB7A 4E3NA 4JLFA 4BJPA 4PMAA 3GMWA 1FSYA 4JBFA 1ZG6A 4GN2A 4OOYA 3SH9A 4DKIA 2Y2JA 1Z6FA 1IYPA 3A3EA 3HUNA 2Y2IA 4XXRA 2XGNA 4JXWA 4WM9A 1M40A 3EQUA 4OQHA 1LI9A 4QU3A 5HAIA 2Y2LA 3IHBA 3ZNTA 4JPMA 2V2FF 3GVBA 1SCWA 4NETA 4KZ9A 4ZDXA 3Q1FA 4KENB 1PW8A 1Y54A 3HLDA 2H5SA 4S2OA 5AQ7A 5CERA 3FYZA 5M19A 2H0TA 4LCMA 3MXRA 5HFOA 4HBTA 3UDFA 3ZG0A 3S4XA 3OCLA 2E8IA 2R9XA 1CI9A 1L0EA 3HLEA 4E3JA 1K6RA 4KZ8A 2WKIA 2WZZA 5EECA 3G34A 4DE3A 3MBZA 3SS3A 2WGIA 4EV4A 1PWGA 2HP9A 5JYPA 1KGEA 2B5RA 2JBFA 4OLGA 3LCEA 1M6KA 3NI9A 2HDSA 3Q82A 1O07A 4KZ6A 2WGVA 4LENA 5FI7A 3WS0A 4F94A 3NIAA 3OPLA 4RYEA 4N92A 4OP5A 1PWDA 4KZAA 1N9BA 1H8ZA 1VM1A 1WE4A 5HX9A 4JF5A 4RX3A 1CI8A 4E6WA 1OMEA 3IHAA 5CHMA 3UPPA 1K54A 5HL1A 4OPRA 5FQQA 3FKWA 4GD6A 4LV3A 4IVIA 4FSFA 3HUMA 4P85A 3VFHA 2Y59A 4WELA 4BL2A 1K38A 4MBKA 4UA9A 3HLWA 1W79A 4X6TA 5FI6A 2DRWA 2J9PA 1O7EA 1ALQA 1FR1A 4X55A 4EWFA 1U60A 2OLUA 4ZBEA 3TSGA 1LLBA 4UA7A 3G35A 1FSWA 4X69A 1WYCA 5HAQA 4E6XA 4CJNA 1LL5A 1YLTA 3OZHA 4X53A 3W4PA 1MWTA 1PIOA 1CEGA 2ZD8A 4OPYA 4ID4A 4UA6A 4QJGA 2EX8A 4KZ5A 3ISGA 4IEDA 4GDBA 4PM8A 5CTMA 1YLPA 3ZCZA 3MKEA 1GA0A 5HW3A 5CEBA 5I94A 5CEDA 2IWDA 4MNRA 2Z2LB 3MKFA 3N7WA 3NDEA 4O7DA 5TGFA 3PAGA 4K91A 1ONHA 4PPRA 3PBNA 4DF6A 5EVIB 3VSKA 3BRMA 4S2KA 3ZVWA 1PYYA 4EBPA 4WEJA 2IWCA 5FDHA 3O88A 3VSLA 3HUOA 3GV9A 5FQIA 5EVIA 2R9WA 4WBGA 2G2WA 1FCNA 5E2GA 4DE0A 2ZQAA 1W5DA 3A3IA 1ESIA 2H0YA 4S2LA 1ES5A 5CGWA 1CEFA 3AGEA 1BLCA 4PM6A 3UPOA 4R1GA 3I7JA 1XKZA 1NXYA 3N8SA 4Y0UA 1XP4A 2PBYA 3D4FA 1KE4A 4HEFA 4R3JA 1SDEA 5EE8A 4E3LA 3SS4A 5HAPA 5M18A 1S6RA 4R4SA 3O86A 1ERMA 4JXSA 3V3RA 2XEPA 3IXDA 2H10A 2HPBA 1I2SA 4Z9QA 1L0DA 2Y2QA 2Z2MB 5TR7A 1NYMA 3FZCA 5AQ9A 4P6BA 5E2HA 2EX6A 3MXSA 2C6WB 2IWBA 5EVLA 4X68A 3C4PA 3S22A 1IKIA 1LI0A 2Q9MA 1J9MA 3G31A 3GRJA 4R23A 5F1GA 3EQVA 5F82A 1ES2A 3PBTA 5DTKA 4E3MA 1HZOA 4PM5A 3TOIA 1L0FA 3ZFZA 5FAQA 3GTCA 1KDSA 4HBUA 5EOOA 4YINA 3IF6B 1PZPA 2Y2NA 3E2LA 3IXHA 2BLSA 3M2KA 1I2WA 5FQMA 4MEZA 2ZQDA 4U0XA 4XUZA 3GR2A 3OPHA 1FQGA 1EROA 1K56D 4GDNA 4DDYA 4QHCA 3N8RA 2V20A 1DY6A 3ZG5A 1K56A 5AQAA 4OPQA 1ES3A 1W7FA 5FI2A 5GHXA 2ZMAA 4R0QA 1K6SA 1CK3A 2WGWB 3FKVA 3M2JA 3HREA 5F83A 3N6IA 2J9OA 1IELA 1TDLA 3JYIA 2DNSA 4BLMA 4WEKA 2Y2HA 3SH8A 3MZFA 1BUEA 2Y2PA 1LHYA 4N1HA 4S2IA 4C6YA 3BFEA 1BT5A 4A5RA 5KSHA 5DF8A 3OCNA 4R4RA 3G4PA 4KQOA 4M3KA 1TVFA 1YQSA 1RGYA 2XFTA 1NY0A 5CRFA 1IYOA 5E2FA 3VOYA 1AXBA 4B88A 4QD4A 5FASA 3IQAA 2VGJA 4K0WA 1MXOA 4ZTKA 4RX2A 5EOEA 2WKEA 2WYXA 1MWSA 4WZ5C 3VFFA 2XDMA 3MZDA 4Q8IA 2EFXA 1K55A 3RXXA 3PAEA 3BFGA 1MWUA 1YLYA 3CMZA 2HDQA 3NDGA 4S2JA 2CC1A 5FQJA 2WK0A 1MKIA 1SHVA 3WS5A 3O3VA 1H8YA 4EBLA 3ZG7B 3RXWA 1XX2A 1K55C 3ZDJA 3G30A 4CPKA 3G32A 4WZ5A 1JVJA 4LV2A 3WWXA 1EWZA 2ZC5B 4B4ZA 3BFFA 4L0LA 5CGSA 2ZC7A 3HLCA 1RGZA 2WUQA 1PI5A 1E4DA 1NJ4A 4Y7PA 3UNWA 3E2KA 1PZOA 4K0XA 2HDRA 2WKHA 5GHYA 4X56A 5DTSA 1GCEA 1JWPA 1ZKJA 5EUAA 5GLDA 1NZOA 1XA7A 5KZHA 1YLJA 3UN7A 4OKPA 3W4OA 4DE2A 4OQGA 2BG1A 4GZBA 1YLZA 1FR6A 3CZDA 5CECA 5GLAA 2OSUA 4KQRA 3ZG8B 5EPHA 1MBLA 4LV1A 3IH8A 5EVID 1E3UD 3GSGA 2I72A 2XK1A 4GNUA 4BENA 4PM7A 1GHMA 3VOZA 2WAEA 2V1ZA 4OVDA 3VP4A 3V39A 3LEZA 1YMSA 3LY3A 4PM9A 4E3KA 3VP2A 2EFUA 2JCHA 2JE5A 5A90A 2C5WB 2ZC6B 3HLGA 5A93A 2XLNA 2Y2KA 3OPRA 1KVLA 4EQIA 3IWOA 1KGFA 3IF5A 3VP1A 2ZC3B 1XA1A 3Q7VB 3UY6A 2XFSA 2XF3A 2Y4AA 3HLBA 2ZM2A 4ZJ2A 1FOFA 4C3QA 4NK3A 4DE1A 2ZLYA 4KQQA 4N9KA 4MBHA 3A3JA 4OOLA 3NC8A 2QMIA 4UHUA 2EXBA 1JTDA 4DXCA 3ZG9B 3V5MA 1G68A 3ITAA 3IT9A 2VGKA 4OQIA 3SOIA 1K57C 1GHIA 1YT4A 5FQ9A 3QHYA 2ZC4B 2XH9A 2A49A
chains in the Genus database with same CATH superfamily
4S2MA 2QJ7A 5JYOA 4GJ4A 1ES4A 1XPBA 4OONA 3EWKA 5HWVA 1KVMA 1BULA 1IYQA 1CQAA 3IH9A 3UPNA 4JXVA 2J7VA 4LRZE 3UE3A 4Y0TA 3V50A 2OLVA 1NYYA 4WYYA 2V9AA 1LL9A 4M4XA 1YSQA 4E3IA 1D06A 2P9VB 2WGWA 1ERQA 2A3UA 3VE4A 1BLPA 3C38A 4ZJ1A 4Y0OA 4DRTA 3IXGA 3NJAA 3F1PA 4FH2A 4WMCA 4IVKA 3G2YA 1L2SA 1BTLA 1RP5A 1CF0A 1NWZA 5HZHA 4HQAA 4JXGA 3BW6A 2OAP1 5HWTA 3VP0A 1JTGA 1S0WA 3BWLA 3S7OA 4H6JB 5HD3A 3UB7A 2EX2A 4HH2A 3DTEA 4N9LA 4KG6A 5GL9A 1S4RA 5G4ZA 5L2FA 2ACGA 1KGGA 4KZ7A 1Q2PA 2FFFB 2W27A 3F1OB 4KZBA 5CTNA 3S7QA 3Q7ZA 2X01A 1YLWA 4HJ6A 2XQZA 2ZQ9A 2QYBA 2M1CA 1YM1A 3NY4A 5TJJA 3QNCA 3NULA 4EBLA 4BD0A 2QJ5A 2HP5A 3N8LA 4BBTA 3SZTA 1G5UA 2J3TD 5DKKA 4S2PA 1I5QA 1ZG4A 3HL9A 4KZ4A 1LL8A 4H8RA 4HESA 4U3TA 1STZA 5F68A 1SKOB 2QZ6A 1GHPA 2HP6A 2WKRA 2XA7M 3MFDA 2CMNA 3MQQA 1QMEA 4HP4A 5FAOA 3FPWA 4JGOA 2W1RA 4XUXA 4EETB 1XFQA 4DXBA 2DCFA 4QY6A 2PU2A 4G3KA 1D1JA 5L10A 3C4OA 2HJ9C 3WS4A 1LSVA 1XXMA 3BFDA 3O87A 3M6HA 4O8GA 2XR0A 5HARA 2ZM8A 3UE1A 2YKHA 3ZHHA 4EESA 2O9BA 2M7UA 4GS9A 4F3LB 3IBJA 1F5MA 1FSYA 4OOYA 4DKIA 2Y2JA 3OOVA 3A3EA 2Y2IA 2XGNA 4JXWA 4WM9A 3ULFA 4ME4A 5F6AA 5HAIA 4R70A 2GZAA 4NETA 5DKLA 3Q1FA 2HJEA 4S2OA 5CERA 2H0TA 3MXRA 3FG8A 3LYXA 4HBTA 3S4XA 3OCLA 2R9XA 4MCWA 4E3JA 1K6RA 2WGIA 1KGEA 4OLGA 3LCEA 3NI9A 2HDSA 3Q82A 4LENA 2B18A 4F94A 2KLIA 4N92A 4OP5A 1CI8A 3CHWP 5HD5A 1OMEA 5FQQA 4IVIA 4EXOA 3CITA 3HUMA 4WELA 1OJGA 5KIZA 4G3VA 4X6TA 2VGLS 1ALQA 3PXPA 4UA7A 1NRJA 1WYCA 4X69A 1TS8A 4E6XA 4CJNA 1LL5A 3OZHA 2ZD8A 4UA6A 3ZCZA 4PM8A 3MKEA 4ETZA 5CEBA 5CEDA 2Z2LB 4WF0A 3MR0A 4PPRA 2I9VA 4HJ3A 3H82A 4LRXC 4Y5FA 3P7NA 5FQIA 2R9WA 5G4YA 5E2GA 2P7JA 3A3IA 2H0YA 2ZMVA 4PM6A 1KE4A 4HEFA 4R3JA 5EE8A 1OT6A 3QP4A 5HAPA 5M18A 1S6RA 3D3OA 3KSFA 1NYMA 5AQ9A 4P6BA 2FH5A 3D9YA 4X68A 1IKIA 3VSKA 3GRJA 1ES2A 1CJFA 3TOIA 2HZ5A 5FAQA 3IF6B 2Y2NA 3IXHA 2BLSA 2ZQDA 2VX8A 3OPHA 3MS6A 4DDYA 2E8JA 4BWIA 3FKVA 3M2JA 4L9FA 3HREA 2VLGA 1XJ2A 2PR5A 1TDLA 1YPRA 1ZTUA 2VV7A 4WEKA 3LEQA 3V67A 3SH8A 1W63Q 1SKOA 3MZFA 1BUEA 4S2IA 3BFEA 3JVVA 4O0PA 4A5RA 3G4PA 3UB5P 2XFTA 5CRFA 4B88A 1TD5A 2W0NA 5HDSA 5EOEA 2WKEA 1MWSA 3VFFA 2EFXA 1S67L 3RXXA 3CMZA 4X1LA 1MKIA 3T12B 1EWZA 3VV4A 2WUQA 3T4SA 4Y7PA 5GHYA 4X56A 1GCEA 5GLDA 4DE2A 4WUJA 2BG1A 3VOLA 2ZMFA 5GLAA 2K2NA 5EPHA 4LV1A 5EVID 3GSGA 1MC0A 3LR4A 2YKFA 3KYQA 3VOZA 4QWOA 4E3KA 2JCHA 5FDSA 2XLNA 1KVLA 1KGFA 3IF5A 1TS7A 3UB8A 1XA1A 3UY6A 2VV6A 2ZM2A 4YOFA 1FOFA 3F1OA 4C3QA 4N9KA 3A3JA 3NC8A 2KDKA 3U2AA 2PD8A 3ZG9B 3EEHA 3IS2A 4OQIA 3SOIA 4LRYC 3U4LP 5KSCA 2B02A 5EM0A 5FSRA 3PBOA 5TBMB 2O99A 3ITBA 4LPZA 3MMHA 1GSXA 1KE0A 4OH0A 3C8CA 2XD5A 3A3FA 1E3UA 4U0TA 4JF4A 2WADA 3DTMA 2G2UA 4FCFA 3EOIA 3F1NB 3V3SA 1L3LA 5J3WA 4EQ1A 1KOUA 4DJ3A 5A92A 4Y2FA 1QMFA 5HL6A 3P98A 5EV0A 3N4IA 1HLUP 2O9AA 3HJIA 3BLSA 5FATA 3VMAA 1HVBA 4GKUA 3BFCA 5AJGA 1MWRA 3NOUC 5FQKA 1VQQA 3CLOA 1XFNA 1K57A 1NLZA 3AGFA 3FV7A 1HTZA 1NRFA 1VB6A 5HSQA 1H5XA 2JKTI 2JKTM 3AGDA 1DJBA 5MC7A 1W8QA 1Z09A 4EUZA 5L09A 4OQ0A 1XGJA 5D3OA 1W8YA 3W8KA 4EBNA 5DTTA 2ZL1A 4LFUA 3CWFA 1FCOA 3P01A 3QNBA 5FAPA 2Y55A 3QP5A 2EXAA 2XD1A 2W1TA 2Q0OA 4RVAA 1FCMA 1IYSA 3R7WA 3CJMA 1ONGA 4E3OA 4QY5A 4NXEA 1PFLA 1S4SA 1ESUA 3IWIA 4NXBA 4WZ4A 1Y4OA 3WS2A 4AFIA 2O9CA 2ZQCA 4MMNA 3UMEA 5L8MA 3RH8B 1P9RA 5IS1A 1IEMA 4FD8A 3WRZA 1XJ6A 3W4QA 1TEMA 2PYPA 5DF9A 1E25A 2Y2GA 1T1AA 2V0WA 2ZM0A 1C3BA 1HD8A 1SDNA 2WZXA 3TG9A 1W63M 2JN7A 2ZL1B 3BYDA 4PHTA 5U47A 3UDIA 3BY9A 4QB8A 4WLAA 4YWZA 1BSGA 3CG5A 2QPNA 5FA7A 2PU4A 2FFYA 2K7SA 2PD7A 2VKSA 3D72A 3SS5A 4E3NA 4JLFA 4KQDA 4K08A 3SH9A 1VETA 4B93A 5AVEA 4QU3A 3ZNTA 2Y2LA 4JPMA 3GVBA 4KZ9A 3NECA 3FYZA 5FEFA 4HHDA 3VE3A 1L0EA 4R38A 2JKRM 3OBFA 4QPRA 4GS9B 4F3LA 4ZRRA 4EV4A 5JYPA 3E4PA 3LICA 2XA7S 1PRQA 3MQ0A 3OPLA 1TS0A 4KZAA 1VM1A 1H8ZA 4JF5A 4RX3A 5TBMA 4OPRA 3JVUA 4BL2A 1K38A 5FI6A 4UA9A 3HLWA 4MBKA 2DRWA 3T50A 1FR1A 4ESPA 1U60A 2OLUA 5HAQA 2EX8A 4KZ5A 1VETB 4IEDA 3LIAA 4GDBA 1YLPA 3IBRA 3LUQA 1OPXA 4GCZA 3NDEA 3PAGA 4K91A 1ONHA 4DF6A 3T4KA 4S2KA 3ZVWA 1PYYA 4LGWA 2QWSA 3O88A 1S1YA 3HUOA 3VSLA 5A8BA 3GV9A 2BTFP 4DE0A 3HJKA 4S2LA 3H82B 1ES5A 5CGWA 1SZVA 4ARZB 1CEFA 3AGEA 3N8SA 2OOLA 4Y0UA 2JKRI 3UB6A 3LIFA 4MDZA 3D4FA 4EW7A 4E3LA 4Y15A 4JXSA 3V3RA 4EERA 2HPBA 1I2SA 4O01A 3NHQA 1OT9A 2Z6CA 3FZCA 2EX6A 3S22A 1FIKA 1LI0A 5F82A 5DTKA 4E3MA 1HZOA 4PAUA 1IFQA 3FC7A 4HBUA 4YINA 4NG2A 3LI8A 2JKFA 1I2WA 3R7WB 4HNBA 3LIEA 3RFBA 3A0SA 1K56A 5AQAA 4OPQA 3MFXA 5FI2A 3B33A 5GHXA 4HIAA 1H0MA 2WGWB 1YKDA 5F83A 3QP1A 2J9OA 1ODVA 1IELA 3JYIA 2DNSA 2Y2HA 2ZOHA 4N1HA 3UMDA 5DF8A 4R4RA 1XJ4A 1AXBA 1Y28A 5FASA 4MN6A 2VGJA 3LIBA 4K0WA 4RX2A 2WYXA 3NOPC 4LLOB 4WZ5C 2A2LA 3MZDA 3BFGA 2HDQA 4S2JA 2CC1A 3WS5A 1H8YA 2G7UA 1G28A 3ZG7B 3RXWA 4EEUA 4P6ZM 4CPKA 3G32A 4WL9A 4WZ5A 5HDCA 2J80A 4LV2A 5J4EA 3BFFA 4L0LA 2Z6DA 3HLCA 1RGZA 1PI5A 1NJ4A 1PZOA 1ZKJA 1JWPA 1NZOA 1XA7A 1YLJA 4OKPA 4OQGA 4L9EA 1YLZA 3ZG8B 1H8MA 4Z1WA 2R78A 4BENA 3LEZA 1YMSA 4MN7A 4YNRA 5A90A 2JE5A 4HOIA 5A93A 5CX7A 3OPRA 4I38A 3CAXA 5DJUA 4DE1A 2ZLYA 2WKPA 2B95A 4UHUA 1JTDA 2W3DA 3ITAA 3IT9A 3EGXC 1V9YA 3CPTA 3A0VA 1K57C 1LT0A 2ZC4B 4D60A 4JF6A 1SKFA 2PBDP 3P09A 5M1AA 5CGXA 5CXWA 5DVAA 5HPFA 3LY4A 2QHKA 1GSVA 4BBVA 4R3BA 2EX9A 4GD8A 2ZQ8A 4BQMA 2P9VA 1N9NA 3NCKA 3HVFA 4GHIA 2PR6A 4MBFA 1KE3A 3MJQA 4Y3IA 3CUEC 5GHZA 4N1XA 3C7VA 1PWCA 3EGDC 4D2OA 1WA9A 4PKYA 1BZAA 5IHVA 3PTEA 4GOGA 4RA7A 3IF6A 5DJTA 2HF6A 1K4EA 1D7EA 3ICYA 3G2ZA 1P0ZA 5J8XA 4S2NA 4C75A 1NZUA 1XGIA 3SH7A 3RTYA 5K5BA 4UEYA 2OWHA 2Q9NA 3OC2A 4OOMA 4CLCA 2JHEA 1G6AA 4LV0A 1VEUB 1UGUA 5EFWA 3BM6A 1TDGA 3T1QB 3IWQA 3SW1A 1K0KA 5G18A 4BL3A 1JWVA 3NBLA 3WRTA 2D02A 1YMXA 3C5AA 1K54C 2EWWA 3ZGAB 2PYRA 2W3GA 4GLQA 2LB9A 1DJCA 5BOHA 1PI4A 2P74A 3ZVTA 2J8YA 2MJ6A 4OPZA 5KMWA 2ZQ7A 3LR0A 5IT5A 1BLHA 4YFMA 3E0YA 5TFQA 2RCXA 3PBSA 1K25A 2WKQA 1TS6A 2XSSA 1WYBA 2X71A 1OTEA 2Y2MA 1PW1A 4R3AA 4Y17A 4ZAMA 2GNXA 3Q7VA 2A24B 3IX8A 5AVFA 4OP8A 2WAFA 2W3HA 4MLLA 2GDNA 3PBQA 5LBRA 5C5KA 4WMCD 5A91A 4LCLA 4ZJ3A 2PAVP 2INWA 3H7WB 4EU0A 4JBFA 2J3TC 4GN2A 1OTAA 1Z6FA 1IYPA 3HUNA 1M40A 3EQUA 3KO6A 1S1ZA 4ZDXA 4KENB 4UQIM 2H5SA 5M19A 3KSIA 5HWWA 5HFOA 3G6OA 2E8IA 1CI9A 2V8CA 4FTXA 4Y13A 3HLEA 1LSWA 4DE3A 2WKIA 2WZZA 5EECA 3MBZA 3SS3A 3H7WA 2W3EA 5FI7A 3LFVA 3KYZA 4RYEA 2XRNA 3T4OA 2KX6A 1WE4A 3T4TA 3IHAA 3UPPA 4NXFA 4HI4A 5F5YA 1UWNX 3FKWA 3VFHA 2Y59A 1YAXA 3K2NA 2ZOIA 2J9PA 3PYPA 4EWFA 1LLBA 3G35A 1FSWA 1G6OA 1BYWA 3W4PA 4X53A 1PIOA 4ID4A 2NUPC 1OTIA 4QJGA 1T1BA 2VV8A 4II7A 1GA0A 5HW3A 4MNRA 4UQIS 2IA2A 4G3WA 3N7WA 1TF1A 2VJWA 3GECA 2LB5A 5EVIB 1UWPX 4WEJA 5FDHA 3K3CA 5EVIA 2ZBBA 2G2WA 1FCNA 2VEAA 1ESIA 3EEAA 2J3WA 2OAQ1 1BLCA 3UPOA 3CUEA 2VZWA 4B9OA 3BQAA 3C2WA 3O5YA 5EVEA 2EWVA 1XP4A 2XROA 3T1SA 4PKYG 4R4SA 3T1RA 3DTKA 2H10A 4Z9QA 2Y2QA 2Z2MB 5TR7A 2V1BA 3MXSA 2C6WB 2IWBA 5EVLA 3C4PA 2PHYA 3E4QA 1J9MA 5F1GA 4IHQA 4PM5A 1L0FA 3T4LA 3GTCA 1KDSA 1F2KA 3E2LA 1GSWA 5FQMA 4MEZA 4U0XA 4XUZA 1FQGA 4GDNA 1K56D 2V20A 1DY6A 3ZG5A 4NKPA 4DJ2A 3LIDA 1ES3A 1W7FA 4HY8A 1K6SA 4CLCE 1DP6A 3F1PB 1A0KA 5DFYA 3CPTB 2Y2PA 4FOFA 3DAVA 1FILA 3OCNA 4M3KA 4Q0JA 4MN5A 1OTDA 4QD4A 2W3FA 4I3AA 4ZTKA 3LGOA 2PRFA 2XDMA 4Q8IA 4P6ZS 3PAEA 4CQHA 4HJ4A 1MWUA 1YLYA 1MKMA 3NDGA 3OLOA 1XX2A 2GX5A 1JVJA 3TW8A 3E98A 2ZC5B 3MSHA 4EUVA 2ZC7A 2KOIA 1E4DA 3UNWA 4K0XA 2HDRA 5DTSA 5J7EA 3UB9A 5KZHA 4HP9A 3IX4A 3IH8A 1XJ3A 3NOTC 2I72A 2XK1A 4IUKA 4L9GA 4PM7A 2UV0E 1GHMA 2WAEA 3CI6A 3IX3A 1JNUA 3S7PA 3W2ZA 4OVDA 3BJNA 2EFUA 3MXQA 4GHIB 4EQIA 4RQ9A 2ZC3B 3Q7VB 2XF3A 2Y4AA 4NK3A 4KQQA 3PR6A 4BBUA 5IU1A 3E4OA 1ACFA 3FPVA 2EXBA 1MZUA 2VGLM 4DN0A 2VGKA 2P08A 1GHIA 1YT4A 5FQ9A 3QHYA 4ARZA 1YSPA 4KG2A 3IS2B 5AQBA 4DDSA 1OTBA 3GQZA 2OV5A 3RJUA 4Q0HA 5EVIC 5F1FA 4I39A 3A0RA 4P0MA 3KSHA 3C30A 1MPLA 4HH3A 4I5SA 5CHJA 1GA9A 4S2NC 4UAAA 3LO7A 3ZNYA 3HBRA 3F1NA 3IF6C 2OWJA 2PT7A 4P87A 4KZ3A 1K4FA 1LSXA 3UE0A 5DF7A 5CHUA 1S66L 1V9ZA 2M7VA 4NEED 3PBRA 1IKGA 1RCJA 5FL3A 2HDUA 5GLCA 5DFXA 1VHMA 2UWXA 3Q07A 1X0OA 3S1YA 4XT2A 3B3XA 4DMZA 4BD1A 1P9WA 3WS1A 2V1AA 3DWZA 1T1CA 3T4QA 3UO9A 2EA9A 4JKTA 2RL3A 3DWKA 4CLCD 3Q81A 2Y8HA 1JWZA 1DP9A 2HV1A 4XT2B 3C7UA 3DBAA 2JC7A 3BLMA 3MZEA 1MY8A 4KG5A 5KSHA 4IBXA 1L0GA 4X1MA 3DW0A 5E2EA 3IXBA 5GLBA 1Q2QA 3BEBA 2JKGA 4B4XA 3OPPA 3HLFA 2H28A 1BLSA 1N9LA 1KDWA 4JGRA 3LR3A 4IBRA 2Y2OA 2Y91A 2ZJ9A 4JGQA 4BMWA 2FZ0A 1H3QA 3LR5A 1DJAA 3UDXA 4FH4A 3KSGA 3M6BA 4JGPA 3A3DA 1EI5A 1OJ5A 2BASA 1ZC2A 3BECA 1N4OA 3KX0X 3VP3A 4OLDA 2NUTC 4KUKA 5E43A 2GJ3A 3FWLA 1VEUA 1T19A 2X02A 4GB7A 3B47A 3MF0A 4BJPA 4PMAA 3GMWA 4IUHA 3MQOA 1ZG6A 3HCYA 3PHYA 4XXRA 4OQHA 1LI9A 3IHBA 1DRMA 2V2FF 3DTIA 2V0UA 1SCWA 1PW8A 2VA0A 3S7NA 1Y54A 3HLDA 5AQ7A 2A24A 4LCMA 3ZG0A 3UDFA 4FUWA 3B42A 3GDIA 4KZ8A 3T4JA 3G34A 3BY8A 4E04A 1PWGA 2HP9A 3QP2A 2B5RA 2JBFA 2P04A 2W1TB 1M6KA 5HDDA 1O07A 4KZ6A 2WGVA 3WS0A 2DMWA 2O0YA 3L7HA 3NIAA 4X25A 1PWDA 4GW9A 1N9BA 5HX9A 4H6JA 4E6WA 5CHMA 1K54A 5HL1A 5F69A 2L0WA 4GD6A 4LV3A 4FSFA 4P85A 2AVXA 3KYEA 1W79A 1F9IA 1O7EA 4X55A 3R4KA 4ZBEA 3TSGA 2HGVA 1YLTA 1MWTA 1CEGA 4OPYA 4CLCC 3ISGA 5CTMA 5I94A 2IWDA 5FEGA 1T18A 3MKFA 4O7DA 5TGFA 2QKPA 3PBNA 3BRMA 1EW0A 2L1MA 4EBPA 2IWCA 1AWIA 4WBGA 2ZQAA 1W5DA 4R1GA 3I7JA 1XKZA 3ZYTA 1NXYA 2V8FA 2PBYA 1SDEA 3SS4A 3O86A 1ERMA 2XEPA 3IXDA 3QP6A 1L0DA 5E2HA 4ETXA 2Q9MA 3G31A 4R23A 3EQVA 3PBTA 1NLYA 3T1XA 2Y79A 3ZFZA 5EOOA 4EEPA 1PZPA 3M2KA 3GR2A 1EROA 4QHCA 3N8RA 2ZMAA 4R0QA 1CK3A 3N6IA 4BLMA 3K3DA 4C6YA 1LHYA 1BT5A 4KQOA 1TVFA 1YQSA 1RGYA 1NY0A 3VOYA 1IYOA 5E2FA 3IQAA 1MXOA 2D01A 4NXGA 5L07A 1K55A 1J3WA 1IOUA 5FQJA 2WK0A 1SHVA 3O3VA 3TRCA 3ZQ5A 1K55C 3ZDJA 3G30A 3WWXA 3TE8A 4B4ZA 5CGSA 3E2KA 1PNEA 2WKHA 2PDRA 4I3JA 4R6LA 5EUAA 3UN7A 3W4OA 4GZBA 1FR6A 3CZDA 5CECA 2OSUA 4IJGA 4KQRA 5EM1A 2L4RA 3JPUA 1MBLA 1N9OA 4CLCB 1E3UD 3QP8A 4GNUA 3H9WA 2V1ZA 3VP4A 3V39A 3LY3A 4PM9A 3VP2A 2VK3A 4KUOA 4WN5A 2C5WB 2ZC6B 3HLGA 3TJZC 2Y2KA 3IWOA 1ZHHB 4I3IA 3VP1A 2XFSA 3LI9A 3HLBA 1DP8A 4Q0IA 4ZJ2A 4MBHA 2K31A 3BQ8A 4OOLA 1F98A 2QMIA 4DXCA 3UE6A 3V5MA 1G68A 5HPIA 1P97A 3L9KA 5I5LA 2XH9A 2A49A
chains in the Genus database with same CATH topology
4JF6A 4S2MA 4KG2A 5FSRA 1SKFA 5JYOA 5AQBA 3PBOA 4DDSA 1ES4A 1XPBA 4OONA 3GQZA 2OV5A 3RJUA 5EVIC 3ITBA 5F1FA 1KE0A 1BULA 1IYQA 1KVMA 2XD5A 4OH0A 3IH9A 3P09A 5M1AA 4P0MA 5CGXA 5CXWA 3A3FA 1E3UA 1MPLA 4U0TA 4JF4A 5CHJA 5DVAA 3UPNA 2WADA 4JXVA 2J7VA 3DTMA 2G2UA 1GA9A 3LY4A 4FCFA 3UE3A 4S2NC 4Y0TA 3V3SA 3V50A 2OLVA 1NYYA 4UAAA 4WYYA 4R3BA 2EX9A 3LO7A 4GD8A 3HBRA 3ZNYA 2ZQ8A 5A92A 1LL9A 3IF6C 1QMFA 4BQMA 3P98A 2P9VA 3NCKA 4P87A 4E3IA 3N4IA 4KZ3A 1K4FA 3HVFA 3UE0A 3BLSA 5FATA 5DF7A 5CHUA 3VMAA 2P9VB 1HVBA 2WGWA 4GKUA 4MBFA 1KE3A 1ERQA 3BFCA 2A3UA 1BLPA 1MWRA 5FQKA 4ZJ1A 1VQQA 4Y0OA 3PBRA 5GHZA 3IXGA 1K57A 1IKGA 3C7VA 1RCJA 4N1XA 1PWCA 4DRTA 3AGFA 3FV7A 4FH2A 2HDUA 4IVKA 1HTZA 4WMCA 5GLCA 1NRFA 3G2YA 1L2SA 4D2OA 1BTLA 1RP5A 2UWXA 3Q07A 5KSCA 1BZAA 1H5XA 3AGDA 1DJBA 3S1YA 5IHVA 3PTEA 4GOGA 4RA7A 1W8QA 3IF6A 4EUZA 4OQ0A 1K4EA 3B3XA 1XGJA 5D3OA 4JXGA 1W8YA 3VP0A 3W8KA 4EBNA 1JTGA 5DTTA 3G2ZA 1S0WA 4BD1A 5J8XA 4S2NA 4C75A 1NZUA 1XGIA 3SH7A 3WS1A 1FCOA 3DWZA 2EX2A 2Q9NA 3QNBA 3OC2A 4N9LA 4KG6A 4OOMA 5GL9A 5L2FA 3UO9A 1KGGA 4KZ7A 5FAPA 4JKTA 1Q2PA 2FFFB 1G6AA 2Y55A 2RL3A 4LV0A 2EXAA 2XD1A 4KZBA 5CTNA 3Q7ZA 4RVAA 3DWKA 3Q81A 1FCMA 1TDGA 1YLWA 1IYSA 3BM6A 3IWQA 2X01A 2XQZA 2ZQ9A 1JWZA 3CJMA 5G18A 4BL3A 1ONGA 1YM1A 3C7UA 1JWVA 3NY4A 2JC7A 3NBLA 3QNCA 3BLMA 3WRTA 3MZEA 1MY8A 4E3OA 1YMXA 4QY5A 4BD0A 4KG5A 3C5AA 1ESUA 1K54C 2HP5A 3IWIA 3N8LA 4IBXA 4WZ4A 1L0GA 3DW0A 5E2EA 3IXBA 4S2PA 3ZGAB 3WS2A 5GLBA 1I5QA 1ZG4A 3HL9A 4KZ4A 2ZQCA 1DJCA 5BOHA 4H8RA 1Q2QA 1PI4A 3BEBA 2P74A 4HESA 4U3TA 4B4XA 3ZVTA 2J8YA 3OPPA 1IEMA 4OPZA 5KMWA 3HLFA 2QZ6A 2ZQ7A 1GHPA 2HP6A 4FD8A 3WRZA 1BLSA 1BLHA 3MFDA 3W4QA 1TEMA 4YFMA 1QMEA 1KDWA 5TFQA 5FAOA 5DF9A 4IBRA 1E25A 2Y2GA 2Y2OA 4XUXA 2RCXA 3PBSA 1K25A 4DXBA 2Y91A 2ZJ9A 2ZM0A 1C3BA 1HD8A 1SDNA 1WYBA 2WZXA 2X71A 3TG9A 2DCFA 1DJAA 3UDXA 4FH4A 3M6BA 3BYDA 4QY6A 2PU2A 2Y2MA 3A3DA 5U47A 1PW1A 3UDIA 1EI5A 4QB8A 4ZAMA 3C4OA 1ZC2A 3BECA 3Q7VA 1N4OA 1BSGA 3WS4A 3CG5A 2QPNA 4OLDA 3VP3A 1XXMA 3BFDA 3O87A 4OP8A 2WAFA 5FA7A 4MLLA 2PU4A 2GDNA 2FFYA 3M6HA 3PBQA 5E43A 2XR0A 3FWLA 5HARA 2ZM8A 3UE1A 4WMCD 3ZHHA 5A91A 4LCLA 4ZJ3A 2X02A 3SS5A 4GB7A 4E3NA 4JLFA 4BJPA 4PMAA 3GMWA 1FSYA 4JBFA 1ZG6A 4GN2A 4OOYA 3SH9A 4DKIA 2Y2JA 1Z6FA 1IYPA 3A3EA 3HUNA 2Y2IA 4XXRA 2XGNA 4JXWA 4WM9A 1M40A 3EQUA 4OQHA 1LI9A 4QU3A 5HAIA 2Y2LA 3IHBA 3ZNTA 4JPMA 2V2FF 3GVBA 1SCWA 4NETA 4KZ9A 4ZDXA 3Q1FA 4KENB 1PW8A 1Y54A 3HLDA 2H5SA 4S2OA 5AQ7A 5CERA 3FYZA 5M19A 2H0TA 4LCMA 3MXRA 5HFOA 4HBTA 3UDFA 3ZG0A 3S4XA 3OCLA 2E8IA 2R9XA 1CI9A 1L0EA 3HLEA 4E3JA 1K6RA 4KZ8A 2WKIA 2WZZA 5EECA 3G34A 4DE3A 3MBZA 3SS3A 2WGIA 4EV4A 1PWGA 2HP9A 5JYPA 1KGEA 2B5RA 2JBFA 4OLGA 3LCEA 1M6KA 3NI9A 2HDSA 3Q82A 1O07A 4KZ6A 2WGVA 4LENA 5FI7A 3WS0A 4F94A 3NIAA 3OPLA 4RYEA 4N92A 4OP5A 1PWDA 4KZAA 1N9BA 1H8ZA 1VM1A 1WE4A 5HX9A 4JF5A 4RX3A 1CI8A 4E6WA 1OMEA 3IHAA 5CHMA 3UPPA 1K54A 5HL1A 4OPRA 5FQQA 3FKWA 4GD6A 4LV3A 4IVIA 4FSFA 3HUMA 4P85A 3VFHA 2Y59A 4WELA 4BL2A 1K38A 4MBKA 4UA9A 3HLWA 1W79A 4X6TA 5FI6A 2DRWA 2J9PA 1O7EA 1ALQA 1FR1A 4X55A 4EWFA 1U60A 2OLUA 4ZBEA 3TSGA 1LLBA 4UA7A 3G35A 1FSWA 4X69A 1WYCA 5HAQA 4E6XA 4CJNA 1LL5A 1YLTA 3OZHA 4X53A 3W4PA 1MWTA 1PIOA 1CEGA 2ZD8A 4OPYA 4ID4A 4UA6A 4QJGA 2EX8A 4KZ5A 3ISGA 4IEDA 4GDBA 4PM8A 5CTMA 1YLPA 3ZCZA 3MKEA 1GA0A 5HW3A 5CEBA 5I94A 5CEDA 2IWDA 4MNRA 2Z2LB 3MKFA 3N7WA 3NDEA 4O7DA 5TGFA 3PAGA 4K91A 1ONHA 4PPRA 3PBNA 4DF6A 5EVIB 3VSKA 3BRMA 4S2KA 3ZVWA 1PYYA 4EBPA 4WEJA 2IWCA 5FDHA 3O88A 3VSLA 3HUOA 3GV9A 5FQIA 5EVIA 2R9WA 4WBGA 2G2WA 1FCNA 5E2GA 4DE0A 2ZQAA 1W5DA 3A3IA 1ESIA 2H0YA 4S2LA 1ES5A 5CGWA 1CEFA 3AGEA 1BLCA 4PM6A 3UPOA 4R1GA 3I7JA 1XKZA 1NXYA 3N8SA 4Y0UA 1XP4A 2PBYA 3D4FA 1KE4A 4HEFA 4R3JA 1SDEA 5EE8A 4E3LA 3SS4A 5HAPA 5M18A 1S6RA 4R4SA 3O86A 1ERMA 4JXSA 3V3RA 2XEPA 3IXDA 2H10A 2HPBA 1I2SA 4Z9QA 1L0DA 2Y2QA 2Z2MB 5TR7A 1NYMA 3FZCA 5AQ9A 4P6BA 5E2HA 2EX6A 3MXSA 2C6WB 2IWBA 5EVLA 4X68A 3C4PA 3S22A 1IKIA 1LI0A 2Q9MA 1J9MA 3G31A 3GRJA 4R23A 5F1GA 3EQVA 5F82A 1ES2A 3PBTA 5DTKA 4E3MA 1HZOA 4PM5A 3TOIA 1L0FA 3ZFZA 5FAQA 3GTCA 1KDSA 4HBUA 5EOOA 4YINA 3IF6B 1PZPA 2Y2NA 3E2LA 3IXHA 2BLSA 3M2KA 1I2WA 5FQMA 4MEZA 2ZQDA 4U0XA 4XUZA 3GR2A 3OPHA 1FQGA 1EROA 1K56D 4GDNA 4DDYA 4QHCA 3N8RA 2V20A 1DY6A 3ZG5A 1K56A 5AQAA 4OPQA 1ES3A 1W7FA 5FI2A 5GHXA 2ZMAA 4R0QA 1K6SA 1CK3A 2WGWB 3FKVA 3M2JA 3HREA 5F83A 3N6IA 2J9OA 1IELA 1TDLA 3JYIA 2DNSA 4BLMA 4WEKA 2Y2HA 3SH8A 3MZFA 1BUEA 2Y2PA 1LHYA 4N1HA 4S2IA 4C6YA 3BFEA 1BT5A 4A5RA 5KSHA 5DF8A 3OCNA 4R4RA 3G4PA 4KQOA 4M3KA 1TVFA 1YQSA 1RGYA 2XFTA 1NY0A 5CRFA 1IYOA 5E2FA 3VOYA 1AXBA 4B88A 4QD4A 5FASA 3IQAA 2VGJA 4K0WA 1MXOA 4ZTKA 4RX2A 5EOEA 2WKEA 2WYXA 1MWSA 4WZ5C 3VFFA 2XDMA 3MZDA 4Q8IA 2EFXA 1K55A 3RXXA 3PAEA 3BFGA 1MWUA 1YLYA 3CMZA 2HDQA 3NDGA 4S2JA 2CC1A 5FQJA 2WK0A 1MKIA 1SHVA 3WS5A 3O3VA 1H8YA 4EBLA 3ZG7B 3RXWA 1XX2A 1K55C 3ZDJA 3G30A 4CPKA 3G32A 4WZ5A 1JVJA 4LV2A 3WWXA 1EWZA 2ZC5B 4B4ZA 3BFFA 4L0LA 5CGSA 2ZC7A 3HLCA 1RGZA 2WUQA 1PI5A 1E4DA 1NJ4A 4Y7PA 3UNWA 3E2KA 1PZOA 4K0XA 2HDRA 2WKHA 5GHYA 4X56A 5DTSA 1GCEA 1JWPA 1ZKJA 5EUAA 5GLDA 1NZOA 1XA7A 5KZHA 1YLJA 3UN7A 4OKPA 3W4OA 4DE2A 4OQGA 2BG1A 4GZBA 1YLZA 1FR6A 3CZDA 5CECA 5GLAA 2OSUA 4KQRA 3ZG8B 5EPHA 1MBLA 4LV1A 3IH8A 5EVID 1E3UD 3GSGA 2I72A 2XK1A 4GNUA 4BENA 4PM7A 1GHMA 3VOZA 2WAEA 2V1ZA 4OVDA 3VP4A 3V39A 3LEZA 1YMSA 3LY3A 4PM9A 4E3KA 3VP2A 2EFUA 2JCHA 2JE5A 5A90A 2C5WB 2ZC6B 3HLGA 5A93A 2XLNA 2Y2KA 3OPRA 1KVLA 4EQIA 3IWOA 1KGFA 3IF5A 3VP1A 2ZC3B 1XA1A 3Q7VB 3UY6A 2XFSA 2XF3A 2Y4AA 3HLBA 2ZM2A 4ZJ2A 1FOFA 4C3QA 4NK3A 4DE1A 2ZLYA 4KQQA 4N9KA 4MBHA 3A3JA 4OOLA 3NC8A 2QMIA 4UHUA 2EXBA 1JTDA 4DXCA 3ZG9B 3V5MA 1G68A 3ITAA 3IT9A 2VGKA 4OQIA 3SOIA 1K57C 1GHIA 1YT4A 5FQ9A 3QHYA 2ZC4B 2XH9A 2A49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JF6 A;  4S2M A;  4KG2 A;  5FSR A;  1SKF A;  5JYO A;  5AQB A;  3PBO A;  4DDS A;  1ES4 A;  1XPB A;  4OON A;  3GQZ A;  2OV5 A;  3RJU A;  5EVI C;  3ITB A;  5F1F A;  1KE0 A;  1BUL A;  1IYQ A;  1KVM A;  2XD5 A;  4OH0 A;  3IH9 A;  3P09 A;  5M1A A;  4P0M A;  5CGX A;  5CXW A;  3A3F A;  1E3U A;  1MPL A;  4U0T A;  4JF4 A;  5CHJ A;  5DVA A;  3UPN A;  2WAD A;  4JXV A;  2J7V A;  3DTM A;  2G2U A;  1GA9 A;  3LY4 A;  4FCF A;  3UE3 A;  4S2N C;  4Y0T A;  3V3S A;  3V50 A;  2OLV A;  1NYY A;  4UAA A;  4WYY A;  4R3B A;  2EX9 A;  3LO7 A;  4GD8 A;  3HBR A;  3ZNY A;  2ZQ8 A;  5A92 A;  1LL9 A;  3IF6 C;  1QMF A;  4BQM A;  3P98 A;  2P9V A;  3NCK A;  4P87 A;  4E3I A;  3N4I A;  4KZ3 A;  1K4F A;  3HVF A;  3UE0 A;  3BLS A;  5FAT A;  5DF7 A;  5CHU A;  3VMA A;  2P9V B;  1HVB A;  2WGW A;  4GKU A;  4MBF A;  1KE3 A;  1ERQ A;  3BFC A;  2A3U A;  1BLP A;  1MWR A;  5FQK A;  4ZJ1 A;  1VQQ A;  4Y0O A;  3PBR A;  5GHZ A;  3IXG A;  1K57 A;  1IKG A;  3C7V A;  1RCJ A;  4N1X A;  1PWC A;  4DRT A;  3AGF A;  3FV7 A;  4FH2 A;  2HDU A;  4IVK A;  1HTZ A;  4WMC A;  5GLC A;  1NRF A;  3G2Y A;  1L2S A;  4D2O A;  1BTL A;  1RP5 A;  2UWX A;  3Q07 A;  5KSC A;  1BZA A;  1H5X A;  3AGD A;  1DJB A;  3S1Y A;  5IHV A;  3PTE A;  4GOG A;  4RA7 A;  1W8Q A;  3IF6 A;  4EUZ A;  4OQ0 A;  1K4E A;  3B3X A;  1XGJ A;  5D3O A;  4JXG A;  1W8Y A;  3VP0 A;  3W8K A;  4EBN A;  1JTG A;  5DTT A;  3G2Z A;  1S0W A;  4BD1 A;  5J8X A;  4S2N A;  4C75 A;  1NZU A;  1XGI A;  3SH7 A;  3WS1 A;  1FCO A;  3DWZ A;  2EX2 A;  2Q9N A;  3QNB A;  3OC2 A;  4N9L A;  4KG6 A;  4OOM A;  5GL9 A;  5L2F A;  3UO9 A;  1KGG A;  4KZ7 A;  5FAP A;  4JKT A;  1Q2P A;  2FFF B;  1G6A A;  2Y55 A;  2RL3 A;  4LV0 A;  2EXA A;  2XD1 A;  4KZB A;  5CTN A;  3Q7Z A;  4RVA A;  3DWK A;  3Q81 A;  1FCM A;  1TDG A;  1YLW A;  1IYS A;  3BM6 A;  3IWQ A;  2X01 A;  2XQZ A;  2ZQ9 A;  1JWZ A;  3CJM A;  5G18 A;  4BL3 A;  1ONG A;  1YM1 A;  3C7U A;  1JWV A;  3NY4 A;  2JC7 A;  3NBL A;  3QNC A;  3BLM A;  3WRT A;  3MZE A;  1MY8 A;  4E3O A;  1YMX A;  4QY5 A;  4BD0 A;  4KG5 A;  3C5A A;  1ESU A;  1K54 C;  2HP5 A;  3IWI A;  3N8L A;  4IBX A;  4WZ4 A;  1L0G A;  3DW0 A;  5E2E A;  3IXB A;  4S2P A;  3ZGA B;  3WS2 A;  5GLB A;  1I5Q A;  1ZG4 A;  3HL9 A;  4KZ4 A;  2ZQC A;  1DJC A;  5BOH A;  4H8R A;  1Q2Q A;  1PI4 A;  3BEB A;  2P74 A;  4HES A;  4U3T A;  4B4X A;  3ZVT A;  2J8Y A;  3OPP A;  1IEM A;  4OPZ A;  5KMW A;  3HLF A;  2QZ6 A;  2ZQ7 A;  1GHP A;  2HP6 A;  4FD8 A;  3WRZ A;  1BLS A;  1BLH A;  3MFD A;  3W4Q A;  1TEM A;  4YFM A;  1QME A;  1KDW A;  5TFQ A;  5FAO A;  5DF9 A;  4IBR A;  1E25 A;  2Y2G A;  2Y2O A;  4XUX A;  2RCX A;  3PBS A;  1K25 A;  4DXB A;  2Y91 A;  2ZJ9 A;  2ZM0 A;  1C3B A;  1HD8 A;  1SDN A;  1WYB A;  2WZX A;  2X71 A;  3TG9 A;  2DCF A;  1DJA A;  3UDX A;  4FH4 A;  3M6B A;  3BYD A;  4QY6 A;  2PU2 A;  2Y2M A;  3A3D A;  5U47 A;  1PW1 A;  3UDI A;  1EI5 A;  4QB8 A;  4ZAM A;  3C4O A;  1ZC2 A;  3BEC A;  3Q7V A;  1N4O A;  1BSG A;  3WS4 A;  3CG5 A;  2QPN A;  4OLD A;  3VP3 A;  1XXM A;  3BFD A;  3O87 A;  4OP8 A;  2WAF A;  5FA7 A;  4MLL A;  2PU4 A;  2GDN A;  2FFY A;  3M6H A;  3PBQ A;  5E43 A;  2XR0 A;  3FWL A;  5HAR A;  2ZM8 A;  3UE1 A;  4WMC D;  3ZHH A;  5A91 A;  4LCL A;  4ZJ3 A;  2X02 A;  3SS5 A;  4GB7 A;  4E3N A;  4JLF A;  4BJP A;  4PMA A;  3GMW A;  1FSY A;  4JBF A;  1ZG6 A;  4GN2 A;  4OOY A;  3SH9 A;  4DKI A;  2Y2J A;  1Z6F A;  1IYP A;  3A3E A;  3HUN A;  2Y2I A;  4XXR A;  2XGN A;  4JXW A;  4WM9 A;  1M40 A;  3EQU A;  4OQH A;  1LI9 A;  4QU3 A;  5HAI A;  2Y2L A;  3IHB A;  3ZNT A;  4JPM A;  2V2F F;  3GVB A;  1SCW A;  4NET A;  4KZ9 A;  4ZDX A;  3Q1F A;  4KEN B;  1PW8 A;  1Y54 A;  3HLD A;  2H5S A;  4S2O A;  5AQ7 A;  5CER A;  3FYZ A;  5M19 A;  2H0T A;  4LCM A;  3MXR A;  5HFO A;  4HBT A;  3UDF A;  3ZG0 A;  3S4X A;  3OCL A;  2E8I A;  2R9X A;  1CI9 A;  1L0E A;  3HLE A;  4E3J A;  1K6R A;  4KZ8 A;  2WKI A;  2WZZ A;  5EEC A;  3G34 A;  4DE3 A;  3MBZ A;  3SS3 A;  2WGI A;  4EV4 A;  1PWG A;  2HP9 A;  5JYP A;  1KGE A;  2B5R A;  2JBF A;  4OLG A;  3LCE A;  1M6K A;  3NI9 A;  2HDS A;  3Q82 A;  1O07 A;  4KZ6 A;  2WGV A;  4LEN A;  5FI7 A;  3WS0 A;  4F94 A;  3NIA A;  3OPL A;  4RYE A;  4N92 A;  4OP5 A;  1PWD A;  4KZA A;  1N9B A;  1H8Z A;  1VM1 A;  1WE4 A;  5HX9 A;  4JF5 A;  4RX3 A;  1CI8 A;  4E6W A;  1OME A;  3IHA A;  5CHM A;  3UPP A;  1K54 A;  5HL1 A;  4OPR A;  5FQQ A;  3FKW A;  4GD6 A;  4LV3 A;  4IVI A;  4FSF A;  3HUM A;  4P85 A;  3VFH A;  2Y59 A;  4WEL A;  4BL2 A;  1K38 A;  4MBK A;  4UA9 A;  3HLW A;  1W79 A;  4X6T A;  5FI6 A;  2DRW A;  2J9P A;  1O7E A;  1ALQ A;  1FR1 A;  4X55 A;  4EWF A;  1U60 A;  2OLU A;  4ZBE A;  3TSG A;  1LLB A;  4UA7 A;  3G35 A;  1FSW A;  4X69 A;  1WYC A;  5HAQ A;  4E6X A;  4CJN A;  1LL5 A;  1YLT A;  3OZH A;  4X53 A;  3W4P A;  1MWT A;  1PIO A;  1CEG A;  2ZD8 A;  4OPY A;  4ID4 A;  4UA6 A;  4QJG A;  2EX8 A;  4KZ5 A;  3ISG A;  4IED A;  4GDB A;  4PM8 A;  5CTM A;  1YLP A;  3ZCZ A;  3MKE A;  1GA0 A;  5HW3 A;  5CEB A;  5I94 A;  5CED A;  2IWD A;  4MNR A;  2Z2L B;  3MKF A;  3N7W A;  3NDE A;  4O7D A;  5TGF A;  3PAG A;  4K91 A;  1ONH A;  4PPR A;  3PBN A;  4DF6 A;  5EVI B;  3VSK A;  3BRM A;  4S2K A;  3ZVW A;  1PYY A;  4EBP A;  4WEJ A;  2IWC A;  5FDH A;  3O88 A;  3VSL A;  3HUO A;  3GV9 A;  5FQI A;  5EVI A;  2R9W A;  4WBG A;  2G2W A;  1FCN A;  5E2G A;  4DE0 A;  2ZQA A;  1W5D A;  3A3I A;  1ESI A;  2H0Y A;  4S2L A;  1ES5 A;  5CGW A;  1CEF A;  3AGE A;  1BLC A;  4PM6 A;  3UPO A;  4R1G A;  3I7J A;  1XKZ A;  1NXY A;  3N8S A;  4Y0U A;  1XP4 A;  2PBY A;  3D4F A;  1KE4 A;  4HEF A;  4R3J A;  1SDE A;  5EE8 A;  4E3L A;  3SS4 A;  5HAP A;  5M18 A;  1S6R A;  4R4S A;  3O86 A;  1ERM A;  4JXS A;  3V3R A;  2XEP A;  3IXD A;  2H10 A;  2HPB A;  1I2S A;  4Z9Q A;  1L0D A;  2Y2Q A;  2Z2M B;  5TR7 A;  1NYM A;  3FZC A;  5AQ9 A;  4P6B A;  5E2H A;  2EX6 A;  3MXS A;  2C6W B;  2IWB A;  5EVL A;  4X68 A;  3C4P A;  3S22 A;  1IKI A;  1LI0 A;  2Q9M A;  1J9M A;  3G31 A;  3GRJ A;  4R23 A;  5F1G A;  3EQV A;  5F82 A;  1ES2 A;  3PBT A;  5DTK A;  4E3M A;  1HZO A;  4PM5 A;  3TOI A;  1L0F A;  3ZFZ A;  5FAQ A;  3GTC A;  1KDS A;  4HBU A;  5EOO A;  4YIN A;  3IF6 B;  1PZP A;  2Y2N A;  3E2L A;  3IXH A;  2BLS A;  3M2K A;  1I2W A;  5FQM A;  4MEZ A;  2ZQD A;  4U0X A;  4XUZ A;  3GR2 A;  3OPH A;  1FQG A;  1ERO A;  1K56 D;  4GDN A;  4DDY A;  4QHC A;  3N8R A;  2V20 A;  1DY6 A;  3ZG5 A;  1K56 A;  5AQA A;  4OPQ A;  1ES3 A;  1W7F A;  5FI2 A;  5GHX A;  2ZMA A;  4R0Q A;  1K6S A;  1CK3 A;  2WGW B;  3FKV A;  3M2J A;  3HRE A;  5F83 A;  3N6I A;  2J9O A;  1IEL A;  1TDL A;  3JYI A;  2DNS A;  4BLM A;  4WEK A;  2Y2H A;  3SH8 A;  3MZF A;  1BUE A;  2Y2P A;  1LHY A;  4N1H A;  4S2I A;  4C6Y A;  3BFE A;  1BT5 A;  4A5R A;  5KSH A;  5DF8 A;  3OCN A;  4R4R A;  3G4P A;  4KQO A;  4M3K A;  1TVF A;  1YQS A;  1RGY A;  2XFT A;  1NY0 A;  5CRF A;  1IYO A;  5E2F A;  3VOY A;  1AXB A;  4B88 A;  4QD4 A;  5FAS A;  3IQA A;  2VGJ A;  4K0W A;  1MXO A;  4ZTK A;  4RX2 A;  5EOE A;  2WKE A;  2WYX A;  1MWS A;  4WZ5 C;  3VFF A;  2XDM A;  3MZD A;  4Q8I A;  2EFX A;  1K55 A;  3RXX A;  3PAE A;  3BFG A;  1MWU A;  1YLY A;  3CMZ A;  2HDQ A;  3NDG A;  4S2J A;  2CC1 A;  5FQJ A;  2WK0 A;  1MKI A;  1SHV A;  3WS5 A;  3O3V A;  1H8Y A;  4EBL A;  3ZG7 B;  3RXW A;  1XX2 A;  1K55 C;  3ZDJ A;  3G30 A;  4CPK A;  3G32 A;  4WZ5 A;  1JVJ A;  4LV2 A;  3WWX A;  1EWZ A;  2ZC5 B;  4B4Z A;  3BFF A;  4L0L A;  5CGS A;  2ZC7 A;  3HLC A;  1RGZ A;  2WUQ A;  1PI5 A;  1E4D A;  1NJ4 A;  4Y7P A;  3UNW A;  3E2K A;  1PZO A;  4K0X A;  2HDR A;  2WKH A;  5GHY A;  4X56 A;  5DTS A;  1GCE A;  1JWP A;  1ZKJ A;  5EUA A;  5GLD A;  1NZO A;  1XA7 A;  5KZH A;  1YLJ A;  3UN7 A;  4OKP A;  3W4O A;  4DE2 A;  4OQG A;  2BG1 A;  4GZB A;  1YLZ A;  1FR6 A;  3CZD A;  5CEC A;  5GLA A;  2OSU A;  4KQR A;  3ZG8 B;  5EPH A;  1MBL A;  4LV1 A;  3IH8 A;  5EVI D;  1E3U D;  3GSG A;  2I72 A;  2XK1 A;  4GNU A;  4BEN A;  4PM7 A;  1GHM A;  3VOZ A;  2WAE A;  2V1Z A;  4OVD A;  3VP4 A;  3V39 A;  3LEZ A;  1YMS A;  3LY3 A;  4PM9 A;  4E3K A;  3VP2 A;  2EFU A;  2JCH A;  2JE5 A;  5A90 A;  2C5W B;  2ZC6 B;  3HLG A;  5A93 A;  2XLN A;  2Y2K A;  3OPR A;  1KVL A;  4EQI A;  3IWO A;  1KGF A;  3IF5 A;  3VP1 A;  2ZC3 B;  1XA1 A;  3Q7V B;  3UY6 A;  2XFS A;  2XF3 A;  2Y4A A;  3HLB A;  2ZM2 A;  4ZJ2 A;  1FOF A;  4C3Q A;  4NK3 A;  4DE1 A;  2ZLY A;  4KQQ A;  4N9K A;  4MBH A;  3A3J A;  4OOL A;  3NC8 A;  2QMI A;  4UHU A;  2EXB A;  1JTD A;  4DXC A;  3ZG9 B;  3V5M A;  1G68 A;  3ITA A;  3IT9 A;  2VGK A;  4OQI A;  3SOI A;  1K57 C;  1GHI A;  1YT4 A;  5FQ9 A;  3QHY A;  2ZC4 B;  2XH9 A;  2A49 A; 
#chains in the Genus database with same CATH topology
 4S2M A;  2QJ7 A;  5JYO A;  4GJ4 A;  1ES4 A;  1XPB A;  4OON A;  3EWK A;  5HWV A;  1KVM A;  1BUL A;  1IYQ A;  1CQA A;  3IH9 A;  3UPN A;  4JXV A;  2J7V A;  4LRZ E;  3UE3 A;  4Y0T A;  3V50 A;  2OLV A;  1NYY A;  4WYY A;  2V9A A;  1LL9 A;  4M4X A;  1YSQ A;  4E3I A;  1D06 A;  2P9V B;  2WGW A;  1ERQ A;  2A3U A;  3VE4 A;  1BLP A;  3C38 A;  4ZJ1 A;  4Y0O A;  4DRT A;  3IXG A;  3NJA A;  3F1P A;  4FH2 A;  4WMC A;  4IVK A;  3G2Y A;  1L2S A;  1BTL A;  1RP5 A;  1CF0 A;  1NWZ A;  5HZH A;  4HQA A;  4JXG A;  3BW6 A;  2OAP 1;  5HWT A;  3VP0 A;  1JTG A;  1S0W A;  3BWL A;  3S7O A;  4H6J B;  5HD3 A;  3UB7 A;  2EX2 A;  4HH2 A;  3DTE A;  4N9L A;  4KG6 A;  5GL9 A;  1S4R A;  5G4Z A;  5L2F A;  2ACG A;  1KGG A;  4KZ7 A;  1Q2P A;  2FFF B;  2W27 A;  3F1O B;  4KZB A;  5CTN A;  3S7Q A;  3Q7Z A;  2X01 A;  1YLW A;  4HJ6 A;  2XQZ A;  2ZQ9 A;  2QYB A;  2M1C A;  1YM1 A;  3NY4 A;  5TJJ A;  3QNC A;  3NUL A;  4EBL A;  4BD0 A;  2QJ5 A;  2HP5 A;  3N8L A;  4BBT A;  3SZT A;  1G5U A;  2J3T D;  5DKK A;  4S2P A;  1I5Q A;  1ZG4 A;  3HL9 A;  4KZ4 A;  1LL8 A;  4H8R A;  4HES A;  4U3T A;  1STZ A;  5F68 A;  1SKO B;  2QZ6 A;  1GHP A;  2HP6 A;  2WKR A;  2XA7 M;  3MFD A;  2CMN A;  3MQQ A;  1QME A;  4HP4 A;  5FAO A;  3FPW A;  4JGO A;  2W1R A;  4XUX A;  4EET B;  1XFQ A;  4DXB A;  2DCF A;  4QY6 A;  2PU2 A;  4G3K A;  1D1J A;  5L10 A;  3C4O A;  2HJ9 C;  3WS4 A;  1LSV A;  1XXM A;  3BFD A;  3O87 A;  3M6H A;  4O8G A;  2XR0 A;  5HAR A;  2ZM8 A;  3UE1 A;  2YKH A;  3ZHH A;  4EES A;  2O9B A;  2M7U A;  4GS9 A;  4F3L B;  3IBJ A;  1F5M A;  1FSY A;  4OOY A;  4DKI A;  2Y2J A;  3OOV A;  3A3E A;  2Y2I A;  2XGN A;  4JXW A;  4WM9 A;  3ULF A;  4ME4 A;  5F6A A;  5HAI A;  4R70 A;  2GZA A;  4NET A;  5DKL A;  3Q1F A;  2HJE A;  4S2O A;  5CER A;  2H0T A;  3MXR A;  3FG8 A;  3LYX A;  4HBT A;  3S4X A;  3OCL A;  2R9X A;  4MCW A;  4E3J A;  1K6R A;  2WGI A;  1KGE A;  4OLG A;  3LCE A;  3NI9 A;  2HDS A;  3Q82 A;  4LEN A;  2B18 A;  4F94 A;  2KLI A;  4N92 A;  4OP5 A;  1CI8 A;  3CHW P;  5HD5 A;  1OME A;  5FQQ A;  4IVI A;  4EXO A;  3CIT A;  3HUM A;  4WEL A;  1OJG A;  5KIZ A;  4G3V A;  4X6T A;  2VGL S;  1ALQ A;  3PXP A;  4UA7 A;  1NRJ A;  1WYC A;  4X69 A;  1TS8 A;  4E6X A;  4CJN A;  1LL5 A;  3OZH A;  2ZD8 A;  4UA6 A;  3ZCZ A;  4PM8 A;  3MKE A;  4ETZ A;  5CEB A;  5CED A;  2Z2L B;  4WF0 A;  3MR0 A;  4PPR A;  2I9V A;  4HJ3 A;  3H82 A;  4LRX C;  4Y5F A;  3P7N A;  5FQI A;  2R9W A;  5G4Y A;  5E2G A;  2P7J A;  3A3I A;  2H0Y A;  2ZMV A;  4PM6 A;  1KE4 A;  4HEF A;  4R3J A;  5EE8 A;  1OT6 A;  3QP4 A;  5HAP A;  5M18 A;  1S6R A;  3D3O A;  3KSF A;  1NYM A;  5AQ9 A;  4P6B A;  2FH5 A;  3D9Y A;  4X68 A;  1IKI A;  3VSK A;  3GRJ A;  1ES2 A;  1CJF A;  3TOI A;  2HZ5 A;  5FAQ A;  3IF6 B;  2Y2N A;  3IXH A;  2BLS A;  2ZQD A;  2VX8 A;  3OPH A;  3MS6 A;  4DDY A;  2E8J A;  4BWI A;  3FKV A;  3M2J A;  4L9F A;  3HRE A;  2VLG A;  1XJ2 A;  2PR5 A;  1TDL A;  1YPR A;  1ZTU A;  2VV7 A;  4WEK A;  3LEQ A;  3V67 A;  3SH8 A;  1W63 Q;  1SKO A;  3MZF A;  1BUE A;  4S2I A;  3BFE A;  3JVV A;  4O0P A;  4A5R A;  3G4P A;  3UB5 P;  2XFT A;  5CRF A;  4B88 A;  1TD5 A;  2W0N A;  5HDS A;  5EOE A;  2WKE A;  1MWS A;  3VFF A;  2EFX A;  1S67 L;  3RXX A;  3CMZ A;  4X1L A;  1MKI A;  3T12 B;  1EWZ A;  3VV4 A;  2WUQ A;  3T4S A;  4Y7P A;  5GHY A;  4X56 A;  1GCE A;  5GLD A;  4DE2 A;  4WUJ A;  2BG1 A;  3VOL A;  2ZMF A;  5GLA A;  2K2N A;  5EPH A;  4LV1 A;  5EVI D;  3GSG A;  1MC0 A;  3LR4 A;  2YKF A;  3KYQ A;  3VOZ A;  4QWO A;  4E3K A;  2JCH A;  5FDS A;  2XLN A;  1KVL A;  1KGF A;  3IF5 A;  1TS7 A;  3UB8 A;  1XA1 A;  3UY6 A;  2VV6 A;  2ZM2 A;  4YOF A;  1FOF A;  3F1O A;  4C3Q A;  4N9K A;  3A3J A;  3NC8 A;  2KDK A;  3U2A A;  2PD8 A;  3ZG9 B;  3EEH A;  3IS2 A;  4OQI A;  3SOI A;  4LRY C;  3U4L P;  5KSC A;  2B02 A;  5EM0 A;  5FSR A;  3PBO A;  5TBM B;  2O99 A;  3ITB A;  4LPZ A;  3MMH A;  1GSX A;  1KE0 A;  4OH0 A;  3C8C A;  2XD5 A;  3A3F A;  1E3U A;  4U0T A;  4JF4 A;  2WAD A;  3DTM A;  2G2U A;  4FCF A;  3EOI A;  3F1N B;  3V3S A;  1L3L A;  5J3W A;  4EQ1 A;  1KOU A;  4DJ3 A;  5A92 A;  4Y2F A;  1QMF A;  5HL6 A;  3P98 A;  5EV0 A;  3N4I A;  1HLU P;  2O9A A;  3HJI A;  3BLS A;  5FAT A;  3VMA A;  1HVB A;  4GKU A;  3BFC A;  5AJG A;  1MWR A;  3NOU C;  5FQK A;  1VQQ A;  3CLO A;  1XFN A;  1K57 A;  1NLZ A;  3AGF A;  3FV7 A;  1HTZ A;  1NRF A;  1VB6 A;  5HSQ A;  1H5X A;  2JKT I;  2JKT M;  3AGD A;  1DJB A;  5MC7 A;  1W8Q A;  1Z09 A;  4EUZ A;  5L09 A;  4OQ0 A;  1XGJ A;  5D3O A;  1W8Y A;  3W8K A;  4EBN A;  5DTT A;  2ZL1 A;  4LFU A;  3CWF A;  1FCO A;  3P01 A;  3QNB A;  5FAP A;  2Y55 A;  3QP5 A;  2EXA A;  2XD1 A;  2W1T A;  2Q0O A;  4RVA A;  1FCM A;  1IYS A;  3R7W A;  3CJM A;  1ONG A;  4E3O A;  4QY5 A;  4NXE A;  1PFL A;  1S4S A;  1ESU A;  3IWI A;  4NXB A;  4WZ4 A;  1Y4O A;  3WS2 A;  4AFI A;  2O9C A;  2ZQC A;  4MMN A;  3UME A;  5L8M A;  3RH8 B;  1P9R A;  5IS1 A;  1IEM A;  4FD8 A;  3WRZ A;  1XJ6 A;  3W4Q A;  1TEM A;  2PYP A;  5DF9 A;  1E25 A;  2Y2G A;  1T1A A;  2V0W A;  2ZM0 A;  1C3B A;  1HD8 A;  1SDN A;  2WZX A;  3TG9 A;  1W63 M;  2JN7 A;  2ZL1 B;  3BYD A;  4PHT A;  5U47 A;  3UDI A;  3BY9 A;  4QB8 A;  4WLA A;  4YWZ A;  1BSG A;  3CG5 A;  2QPN A;  5FA7 A;  2PU4 A;  2FFY A;  2K7S A;  2PD7 A;  2VKS A;  3D72 A;  3SS5 A;  4E3N A;  4JLF A;  4KQD A;  4K08 A;  3SH9 A;  1VET A;  4B93 A;  5AVE A;  4QU3 A;  3ZNT A;  2Y2L A;  4JPM A;  3GVB A;  4KZ9 A;  3NEC A;  3FYZ A;  5FEF A;  4HHD A;  3VE3 A;  1L0E A;  4R38 A;  2JKR M;  3OBF A;  4QPR A;  4GS9 B;  4F3L A;  4ZRR A;  4EV4 A;  5JYP A;  3E4P A;  3LIC A;  2XA7 S;  1PRQ A;  3MQ0 A;  3OPL A;  1TS0 A;  4KZA A;  1VM1 A;  1H8Z A;  4JF5 A;  4RX3 A;  5TBM A;  4OPR A;  3JVU A;  4BL2 A;  1K38 A;  5FI6 A;  4UA9 A;  3HLW A;  4MBK A;  2DRW A;  3T50 A;  1FR1 A;  4ESP A;  1U60 A;  2OLU A;  5HAQ A;  2EX8 A;  4KZ5 A;  1VET B;  4IED A;  3LIA A;  4GDB A;  1YLP A;  3IBR A;  3LUQ A;  1OPX A;  4GCZ A;  3NDE A;  3PAG A;  4K91 A;  1ONH A;  4DF6 A;  3T4K A;  4S2K A;  3ZVW A;  1PYY A;  4LGW A;  2QWS A;  3O88 A;  1S1Y A;  3HUO A;  3VSL A;  5A8B A;  3GV9 A;  2BTF P;  4DE0 A;  3HJK A;  4S2L A;  3H82 B;  1ES5 A;  5CGW A;  1SZV A;  4ARZ B;  1CEF A;  3AGE A;  3N8S A;  2OOL A;  4Y0U A;  2JKR I;  3UB6 A;  3LIF A;  4MDZ A;  3D4F A;  4EW7 A;  4E3L A;  4Y15 A;  4JXS A;  3V3R A;  4EER A;  2HPB A;  1I2S A;  4O01 A;  3NHQ A;  1OT9 A;  2Z6C A;  3FZC A;  2EX6 A;  3S22 A;  1FIK A;  1LI0 A;  5F82 A;  5DTK A;  4E3M A;  1HZO A;  4PAU A;  1IFQ A;  3FC7 A;  4HBU A;  4YIN A;  4NG2 A;  3LI8 A;  2JKF A;  1I2W A;  3R7W B;  4HNB A;  3LIE A;  3RFB A;  3A0S A;  1K56 A;  5AQA A;  4OPQ A;  3MFX A;  5FI2 A;  3B33 A;  5GHX A;  4HIA A;  1H0M A;  2WGW B;  1YKD A;  5F83 A;  3QP1 A;  2J9O A;  1ODV A;  1IEL A;  3JYI A;  2DNS A;  2Y2H A;  2ZOH A;  4N1H A;  3UMD A;  5DF8 A;  4R4R A;  1XJ4 A;  1AXB A;  1Y28 A;  5FAS A;  4MN6 A;  2VGJ A;  3LIB A;  4K0W A;  4RX2 A;  2WYX A;  3NOP C;  4LLO B;  4WZ5 C;  2A2L A;  3MZD A;  3BFG A;  2HDQ A;  4S2J A;  2CC1 A;  3WS5 A;  1H8Y A;  2G7U A;  1G28 A;  3ZG7 B;  3RXW A;  4EEU A;  4P6Z M;  4CPK A;  3G32 A;  4WL9 A;  4WZ5 A;  5HDC A;  2J80 A;  4LV2 A;  5J4E A;  3BFF A;  4L0L A;  2Z6D A;  3HLC A;  1RGZ A;  1PI5 A;  1NJ4 A;  1PZO A;  1ZKJ A;  1JWP A;  1NZO A;  1XA7 A;  1YLJ A;  4OKP A;  4OQG A;  4L9E A;  1YLZ A;  3ZG8 B;  1H8M A;  4Z1W A;  2R78 A;  4BEN A;  3LEZ A;  1YMS A;  4MN7 A;  4YNR A;  5A90 A;  2JE5 A;  4HOI A;  5A93 A;  5CX7 A;  3OPR A;  4I38 A;  3CAX A;  5DJU A;  4DE1 A;  2ZLY A;  2WKP A;  2B95 A;  4UHU A;  1JTD A;  2W3D A;  3ITA A;  3IT9 A;  3EGX C;  1V9Y A;  3CPT A;  3A0V A;  1K57 C;  1LT0 A;  2ZC4 B;  4D60 A;  4JF6 A;  1SKF A;  2PBD P;  3P09 A;  5M1A A;  5CGX A;  5CXW A;  5DVA A;  5HPF A;  3LY4 A;  2QHK A;  1GSV A;  4BBV A;  4R3B A;  2EX9 A;  4GD8 A;  2ZQ8 A;  4BQM A;  2P9V A;  1N9N A;  3NCK A;  3HVF A;  4GHI A;  2PR6 A;  4MBF A;  1KE3 A;  3MJQ A;  4Y3I A;  3CUE C;  5GHZ A;  4N1X A;  3C7V A;  1PWC A;  3EGD C;  4D2O A;  1WA9 A;  4PKY A;  1BZA A;  5IHV A;  3PTE A;  4GOG A;  4RA7 A;  3IF6 A;  5DJT A;  2HF6 A;  1K4E A;  1D7E A;  3ICY A;  3G2Z A;  1P0Z A;  5J8X A;  4S2N A;  4C75 A;  1NZU A;  1XGI A;  3SH7 A;  3RTY A;  5K5B A;  4UEY A;  2OWH A;  2Q9N A;  3OC2 A;  4OOM A;  4CLC A;  2JHE A;  1G6A A;  4LV0 A;  1VEU B;  1UGU A;  5EFW A;  3BM6 A;  1TDG A;  3T1Q B;  3IWQ A;  3SW1 A;  1K0K A;  5G18 A;  4BL3 A;  1JWV A;  3NBL A;  3WRT A;  2D02 A;  1YMX A;  3C5A A;  1K54 C;  2EWW A;  3ZGA B;  2PYR A;  2W3G A;  4GLQ A;  2LB9 A;  1DJC A;  5BOH A;  1PI4 A;  2P74 A;  3ZVT A;  2J8Y A;  2MJ6 A;  4OPZ A;  5KMW A;  2ZQ7 A;  3LR0 A;  5IT5 A;  1BLH A;  4YFM A;  3E0Y A;  5TFQ A;  2RCX A;  3PBS A;  1K25 A;  2WKQ A;  1TS6 A;  2XSS A;  1WYB A;  2X71 A;  1OTE A;  2Y2M A;  1PW1 A;  4R3A A;  4Y17 A;  4ZAM A;  2GNX A;  3Q7V A;  2A24 B;  3IX8 A;  5AVF A;  4OP8 A;  2WAF A;  2W3H A;  4MLL A;  2GDN A;  3PBQ A;  5LBR A;  5C5K A;  4WMC D;  5A91 A;  4LCL A;  4ZJ3 A;  2PAV P;  2INW A;  3H7W B;  4EU0 A;  4JBF A;  2J3T C;  4GN2 A;  1OTA A;  1Z6F A;  1IYP A;  3HUN A;  1M40 A;  3EQU A;  3KO6 A;  1S1Z A;  4ZDX A;  4KEN B;  4UQI M;  2H5S A;  5M19 A;  3KSI A;  5HWW A;  5HFO A;  3G6O A;  2E8I A;  1CI9 A;  2V8C A;  4FTX A;  4Y13 A;  3HLE A;  1LSW A;  4DE3 A;  2WKI A;  2WZZ A;  5EEC A;  3MBZ A;  3SS3 A;  3H7W A;  2W3E A;  5FI7 A;  3LFV A;  3KYZ A;  4RYE A;  2XRN A;  3T4O A;  2KX6 A;  1WE4 A;  3T4T A;  3IHA A;  3UPP A;  4NXF A;  4HI4 A;  5F5Y A;  1UWN X;  3FKW A;  3VFH A;  2Y59 A;  1YAX A;  3K2N A;  2ZOI A;  2J9P A;  3PYP A;  4EWF A;  1LLB A;  3G35 A;  1FSW A;  1G6O A;  1BYW A;  3W4P A;  4X53 A;  1PIO A;  4ID4 A;  2NUP C;  1OTI A;  4QJG A;  1T1B A;  2VV8 A;  4II7 A;  1GA0 A;  5HW3 A;  4MNR A;  4UQI S;  2IA2 A;  4G3W A;  3N7W A;  1TF1 A;  2VJW A;  3GEC A;  2LB5 A;  5EVI B;  1UWP X;  4WEJ A;  5FDH A;  3K3C A;  5EVI A;  2ZBB A;  2G2W A;  1FCN A;  2VEA A;  1ESI A;  3EEA A;  2J3W A;  2OAQ 1;  1BLC A;  3UPO A;  3CUE A;  2VZW A;  4B9O A;  3BQA A;  3C2W A;  3O5Y A;  5EVE A;  2EWV A;  1XP4 A;  2XRO A;  3T1S A;  4PKY G;  4R4S A;  3T1R A;  3DTK A;  2H10 A;  4Z9Q A;  2Y2Q A;  2Z2M B;  5TR7 A;  2V1B A;  3MXS A;  2C6W B;  2IWB A;  5EVL A;  3C4P A;  2PHY A;  3E4Q A;  1J9M A;  5F1G A;  4IHQ A;  4PM5 A;  1L0F A;  3T4L A;  3GTC A;  1KDS A;  1F2K A;  3E2L A;  1GSW A;  5FQM A;  4MEZ A;  4U0X A;  4XUZ A;  1FQG A;  4GDN A;  1K56 D;  2V20 A;  1DY6 A;  3ZG5 A;  4NKP A;  4DJ2 A;  3LID A;  1ES3 A;  1W7F A;  4HY8 A;  1K6S A;  4CLC E;  1DP6 A;  3F1P B;  1A0K A;  5DFY A;  3CPT B;  2Y2P A;  4FOF A;  3DAV A;  1FIL A;  3OCN A;  4M3K A;  4Q0J A;  4MN5 A;  1OTD A;  4QD4 A;  2W3F A;  4I3A A;  4ZTK A;  3LGO A;  2PRF A;  2XDM A;  4Q8I A;  4P6Z S;  3PAE A;  4CQH A;  4HJ4 A;  1MWU A;  1YLY A;  1MKM A;  3NDG A;  3OLO A;  1XX2 A;  2GX5 A;  1JVJ A;  3TW8 A;  3E98 A;  2ZC5 B;  3MSH A;  4EUV A;  2ZC7 A;  2KOI A;  1E4D A;  3UNW A;  4K0X A;  2HDR A;  5DTS A;  5J7E A;  3UB9 A;  5KZH A;  4HP9 A;  3IX4 A;  3IH8 A;  1XJ3 A;  3NOT C;  2I72 A;  2XK1 A;  4IUK A;  4L9G A;  4PM7 A;  2UV0 E;  1GHM A;  2WAE A;  3CI6 A;  3IX3 A;  1JNU A;  3S7P A;  3W2Z A;  4OVD A;  3BJN A;  2EFU A;  3MXQ A;  4GHI B;  4EQI A;  4RQ9 A;  2ZC3 B;  3Q7V B;  2XF3 A;  2Y4A A;  4NK3 A;  4KQQ A;  3PR6 A;  4BBU A;  5IU1 A;  3E4O A;  1ACF A;  3FPV A;  2EXB A;  1MZU A;  2VGL M;  4DN0 A;  2VGK A;  2P08 A;  1GHI A;  1YT4 A;  5FQ9 A;  3QHY A;  4ARZ A;  1YSP A;  4KG2 A;  3IS2 B;  5AQB A;  4DDS A;  1OTB A;  3GQZ A;  2OV5 A;  3RJU A;  4Q0H A;  5EVI C;  5F1F A;  4I39 A;  3A0R A;  4P0M A;  3KSH A;  3C30 A;  1MPL A;  4HH3 A;  4I5S A;  5CHJ A;  1GA9 A;  4S2N C;  4UAA A;  3LO7 A;  3ZNY A;  3HBR A;  3F1N A;  3IF6 C;  2OWJ A;  2PT7 A;  4P87 A;  4KZ3 A;  1K4F A;  1LSX A;  3UE0 A;  5DF7 A;  5CHU A;  1S66 L;  1V9Z A;  2M7V A;  4NEE D;  3PBR A;  1IKG A;  1RCJ A;  5FL3 A;  2HDU A;  5GLC A;  5DFX A;  1VHM A;  2UWX A;  3Q07 A;  1X0O A;  3S1Y A;  4XT2 A;  3B3X A;  4DMZ A;  4BD1 A;  1P9W A;  3WS1 A;  2V1A A;  3DWZ A;  1T1C A;  3T4Q A;  3UO9 A;  2EA9 A;  4JKT A;  2RL3 A;  3DWK A;  4CLC D;  3Q81 A;  2Y8H A;  1JWZ A;  1DP9 A;  2HV1 A;  4XT2 B;  3C7U A;  3DBA A;  2JC7 A;  3BLM A;  3MZE A;  1MY8 A;  4KG5 A;  5KSH A;  4IBX A;  1L0G A;  4X1M A;  3DW0 A;  5E2E A;  3IXB A;  5GLB A;  1Q2Q A;  3BEB A;  2JKG A;  4B4X A;  3OPP A;  3HLF A;  2H28 A;  1BLS A;  1N9L A;  1KDW A;  4JGR A;  3LR3 A;  4IBR A;  2Y2O A;  2Y91 A;  2ZJ9 A;  4JGQ A;  4BMW A;  2FZ0 A;  1H3Q A;  3LR5 A;  1DJA A;  3UDX A;  4FH4 A;  3KSG A;  3M6B A;  4JGP A;  3A3D A;  1EI5 A;  1OJ5 A;  2BAS A;  1ZC2 A;  3BEC A;  1N4O A;  3KX0 X;  3VP3 A;  4OLD A;  2NUT C;  4KUK A;  5E43 A;  2GJ3 A;  3FWL A;  1VEU A;  1T19 A;  2X02 A;  4GB7 A;  3B47 A;  3MF0 A;  4BJP A;  4PMA A;  3GMW A;  4IUH A;  3MQO A;  1ZG6 A;  3HCY A;  3PHY A;  4XXR A;  4OQH A;  1LI9 A;  3IHB A;  1DRM A;  2V2F F;  3DTI A;  2V0U A;  1SCW A;  1PW8 A;  2VA0 A;  3S7N A;  1Y54 A;  3HLD A;  5AQ7 A;  2A24 A;  4LCM A;  3ZG0 A;  3UDF A;  4FUW A;  3B42 A;  3GDI A;  4KZ8 A;  3T4J A;  3G34 A;  3BY8 A;  4E04 A;  1PWG A;  2HP9 A;  3QP2 A;  2B5R A;  2JBF A;  2P04 A;  2W1T B;  1M6K A;  5HDD A;  1O07 A;  4KZ6 A;  2WGV A;  3WS0 A;  2DMW A;  2O0Y A;  3L7H A;  3NIA A;  4X25 A;  1PWD A;  4GW9 A;  1N9B A;  5HX9 A;  4H6J A;  4E6W A;  5CHM A;  1K54 A;  5HL1 A;  5F69 A;  2L0W A;  4GD6 A;  4LV3 A;  4FSF A;  4P85 A;  2AVX A;  3KYE A;  1W79 A;  1F9I A;  1O7E A;  4X55 A;  3R4K A;  4ZBE A;  3TSG A;  2HGV A;  1YLT A;  1MWT A;  1CEG A;  4OPY A;  4CLC C;  3ISG A;  5CTM A;  5I94 A;  2IWD A;  5FEG A;  1T18 A;  3MKF A;  4O7D A;  5TGF A;  2QKP A;  3PBN A;  3BRM A;  1EW0 A;  2L1M A;  4EBP A;  2IWC A;  1AWI A;  4WBG A;  2ZQA A;  1W5D A;  4R1G A;  3I7J A;  1XKZ A;  3ZYT A;  1NXY A;  2V8F A;  2PBY A;  1SDE A;  3SS4 A;  3O86 A;  1ERM A;  2XEP A;  3IXD A;  3QP6 A;  1L0D A;  5E2H A;  4ETX A;  2Q9M A;  3G31 A;  4R23 A;  3EQV A;  3PBT A;  1NLY A;  3T1X A;  2Y79 A;  3ZFZ A;  5EOO A;  4EEP A;  1PZP A;  3M2K A;  3GR2 A;  1ERO A;  4QHC A;  3N8R A;  2ZMA A;  4R0Q A;  1CK3 A;  3N6I A;  4BLM A;  3K3D A;  4C6Y A;  1LHY A;  1BT5 A;  4KQO A;  1TVF A;  1YQS A;  1RGY A;  1NY0 A;  3VOY A;  1IYO A;  5E2F A;  3IQA A;  1MXO A;  2D01 A;  4NXG A;  5L07 A;  1K55 A;  1J3W A;  1IOU A;  5FQJ A;  2WK0 A;  1SHV A;  3O3V A;  3TRC A;  3ZQ5 A;  1K55 C;  3ZDJ A;  3G30 A;  3WWX A;  3TE8 A;  4B4Z A;  5CGS A;  3E2K A;  1PNE A;  2WKH A;  2PDR A;  4I3J A;  4R6L A;  5EUA A;  3UN7 A;  3W4O A;  4GZB A;  1FR6 A;  3CZD A;  5CEC A;  2OSU A;  4IJG A;  4KQR A;  5EM1 A;  2L4R A;  3JPU A;  1MBL A;  1N9O A;  4CLC B;  1E3U D;  3QP8 A;  4GNU A;  3H9W A;  2V1Z A;  3VP4 A;  3V39 A;  3LY3 A;  4PM9 A;  3VP2 A;  2VK3 A;  4KUO A;  4WN5 A;  2C5W B;  2ZC6 B;  3HLG A;  3TJZ C;  2Y2K A;  3IWO A;  1ZHH B;  4I3I A;  3VP1 A;  2XFS A;  3LI9 A;  3HLB A;  1DP8 A;  4Q0I A;  4ZJ2 A;  4MBH A;  2K31 A;  3BQ8 A;  4OOL A;  1F98 A;  2QMI A;  4DXC A;  3UE6 A;  3V5M A;  1G68 A;  5HPI A;  1P97 A;  3L9K A;  5I5L A;  2XH9 A;  2A49 A; 
#chains in the Genus database with same CATH homology
 4JF6 A;  4S2M A;  4KG2 A;  5FSR A;  1SKF A;  5JYO A;  5AQB A;  3PBO A;  4DDS A;  1ES4 A;  1XPB A;  4OON A;  3GQZ A;  2OV5 A;  3RJU A;  5EVI C;  3ITB A;  5F1F A;  1KE0 A;  1BUL A;  1IYQ A;  1KVM A;  2XD5 A;  4OH0 A;  3IH9 A;  3P09 A;  5M1A A;  4P0M A;  5CGX A;  5CXW A;  3A3F A;  1E3U A;  1MPL A;  4U0T A;  4JF4 A;  5CHJ A;  5DVA A;  3UPN A;  2WAD A;  4JXV A;  2J7V A;  3DTM A;  2G2U A;  1GA9 A;  3LY4 A;  4FCF A;  3UE3 A;  4S2N C;  4Y0T A;  3V3S A;  3V50 A;  2OLV A;  1NYY A;  4UAA A;  4WYY A;  4R3B A;  2EX9 A;  3LO7 A;  4GD8 A;  3HBR A;  3ZNY A;  2ZQ8 A;  5A92 A;  1LL9 A;  3IF6 C;  1QMF A;  4BQM A;  3P98 A;  2P9V A;  3NCK A;  4P87 A;  4E3I A;  3N4I A;  4KZ3 A;  1K4F A;  3HVF A;  3UE0 A;  3BLS A;  5FAT A;  5DF7 A;  5CHU A;  3VMA A;  2P9V B;  1HVB A;  2WGW A;  4GKU A;  4MBF A;  1KE3 A;  1ERQ A;  3BFC A;  2A3U A;  1BLP A;  1MWR A;  5FQK A;  4ZJ1 A;  1VQQ A;  4Y0O A;  3PBR A;  5GHZ A;  3IXG A;  1K57 A;  1IKG A;  3C7V A;  1RCJ A;  4N1X A;  1PWC A;  4DRT A;  3AGF A;  3FV7 A;  4FH2 A;  2HDU A;  4IVK A;  1HTZ A;  4WMC A;  5GLC A;  1NRF A;  3G2Y A;  1L2S A;  4D2O A;  1BTL A;  1RP5 A;  2UWX A;  3Q07 A;  5KSC A;  1BZA A;  1H5X A;  3AGD A;  1DJB A;  3S1Y A;  5IHV A;  3PTE A;  4GOG A;  4RA7 A;  1W8Q A;  3IF6 A;  4EUZ A;  4OQ0 A;  1K4E A;  3B3X A;  1XGJ A;  5D3O A;  4JXG A;  1W8Y A;  3VP0 A;  3W8K A;  4EBN A;  1JTG A;  5DTT A;  3G2Z A;  1S0W A;  4BD1 A;  5J8X A;  4S2N A;  4C75 A;  1NZU A;  1XGI A;  3SH7 A;  3WS1 A;  1FCO A;  3DWZ A;  2EX2 A;  2Q9N A;  3QNB A;  3OC2 A;  4N9L A;  4KG6 A;  4OOM A;  5GL9 A;  5L2F A;  3UO9 A;  1KGG A;  4KZ7 A;  5FAP A;  4JKT A;  1Q2P A;  2FFF B;  1G6A A;  2Y55 A;  2RL3 A;  4LV0 A;  2EXA A;  2XD1 A;  4KZB A;  5CTN A;  3Q7Z A;  4RVA A;  3DWK A;  3Q81 A;  1FCM A;  1TDG A;  1YLW A;  1IYS A;  3BM6 A;  3IWQ A;  2X01 A;  2XQZ A;  2ZQ9 A;  1JWZ A;  3CJM A;  5G18 A;  4BL3 A;  1ONG A;  1YM1 A;  3C7U A;  1JWV A;  3NY4 A;  2JC7 A;  3NBL A;  3QNC A;  3BLM A;  3WRT A;  3MZE A;  1MY8 A;  4E3O A;  1YMX A;  4QY5 A;  4BD0 A;  4KG5 A;  3C5A A;  1ESU A;  1K54 C;  2HP5 A;  3IWI A;  3N8L A;  4IBX A;  4WZ4 A;  1L0G A;  3DW0 A;  5E2E A;  3IXB A;  4S2P A;  3ZGA B;  3WS2 A;  5GLB A;  1I5Q A;  1ZG4 A;  3HL9 A;  4KZ4 A;  2ZQC A;  1DJC A;  5BOH A;  4H8R A;  1Q2Q A;  1PI4 A;  3BEB A;  2P74 A;  4HES A;  4U3T A;  4B4X A;  3ZVT A;  2J8Y A;  3OPP A;  1IEM A;  4OPZ A;  5KMW A;  3HLF A;  2QZ6 A;  2ZQ7 A;  1GHP A;  2HP6 A;  4FD8 A;  3WRZ A;  1BLS A;  1BLH A;  3MFD A;  3W4Q A;  1TEM A;  4YFM A;  1QME A;  1KDW A;  5TFQ A;  5FAO A;  5DF9 A;  4IBR A;  1E25 A;  2Y2G A;  2Y2O A;  4XUX A;  2RCX A;  3PBS A;  1K25 A;  4DXB A;  2Y91 A;  2ZJ9 A;  2ZM0 A;  1C3B A;  1HD8 A;  1SDN A;  1WYB A;  2WZX A;  2X71 A;  3TG9 A;  2DCF A;  1DJA A;  3UDX A;  4FH4 A;  3M6B A;  3BYD A;  4QY6 A;  2PU2 A;  2Y2M A;  3A3D A;  5U47 A;  1PW1 A;  3UDI A;  1EI5 A;  4QB8 A;  4ZAM A;  3C4O A;  1ZC2 A;  3BEC A;  3Q7V A;  1N4O A;  1BSG A;  3WS4 A;  3CG5 A;  2QPN A;  4OLD A;  3VP3 A;  1XXM A;  3BFD A;  3O87 A;  4OP8 A;  2WAF A;  5FA7 A;  4MLL A;  2PU4 A;  2GDN A;  2FFY A;  3M6H A;  3PBQ A;  5E43 A;  2XR0 A;  3FWL A;  5HAR A;  2ZM8 A;  3UE1 A;  4WMC D;  3ZHH A;  5A91 A;  4LCL A;  4ZJ3 A;  2X02 A;  3SS5 A;  4GB7 A;  4E3N A;  4JLF A;  4BJP A;  4PMA A;  3GMW A;  1FSY A;  4JBF A;  1ZG6 A;  4GN2 A;  4OOY A;  3SH9 A;  4DKI A;  2Y2J A;  1Z6F A;  1IYP A;  3A3E A;  3HUN A;  2Y2I A;  4XXR A;  2XGN A;  4JXW A;  4WM9 A;  1M40 A;  3EQU A;  4OQH A;  1LI9 A;  4QU3 A;  5HAI A;  2Y2L A;  3IHB A;  3ZNT A;  4JPM A;  2V2F F;  3GVB A;  1SCW A;  4NET A;  4KZ9 A;  4ZDX A;  3Q1F A;  4KEN B;  1PW8 A;  1Y54 A;  3HLD A;  2H5S A;  4S2O A;  5AQ7 A;  5CER A;  3FYZ A;  5M19 A;  2H0T A;  4LCM A;  3MXR A;  5HFO A;  4HBT A;  3UDF A;  3ZG0 A;  3S4X A;  3OCL A;  2E8I A;  2R9X A;  1CI9 A;  1L0E A;  3HLE A;  4E3J A;  1K6R A;  4KZ8 A;  2WKI A;  2WZZ A;  5EEC A;  3G34 A;  4DE3 A;  3MBZ A;  3SS3 A;  2WGI A;  4EV4 A;  1PWG A;  2HP9 A;  5JYP A;  1KGE A;  2B5R A;  2JBF A;  4OLG A;  3LCE A;  1M6K A;  3NI9 A;  2HDS A;  3Q82 A;  1O07 A;  4KZ6 A;  2WGV A;  4LEN A;  5FI7 A;  3WS0 A;  4F94 A;  3NIA A;  3OPL A;  4RYE A;  4N92 A;  4OP5 A;  1PWD A;  4KZA A;  1N9B A;  1H8Z A;  1VM1 A;  1WE4 A;  5HX9 A;  4JF5 A;  4RX3 A;  1CI8 A;  4E6W A;  1OME A;  3IHA A;  5CHM A;  3UPP A;  1K54 A;  5HL1 A;  4OPR A;  5FQQ A;  3FKW A;  4GD6 A;  4LV3 A;  4IVI A;  4FSF A;  3HUM A;  4P85 A;  3VFH A;  2Y59 A;  4WEL A;  4BL2 A;  1K38 A;  4MBK A;  4UA9 A;  3HLW A;  1W79 A;  4X6T A;  5FI6 A;  2DRW A;  2J9P A;  1O7E A;  1ALQ A;  1FR1 A;  4X55 A;  4EWF A;  1U60 A;  2OLU A;  4ZBE A;  3TSG A;  1LLB A;  4UA7 A;  3G35 A;  1FSW A;  4X69 A;  1WYC A;  5HAQ A;  4E6X A;  4CJN A;  1LL5 A;  1YLT A;  3OZH A;  4X53 A;  3W4P A;  1MWT A;  1PIO A;  1CEG A;  2ZD8 A;  4OPY A;  4ID4 A;  4UA6 A;  4QJG A;  2EX8 A;  4KZ5 A;  3ISG A;  4IED A;  4GDB A;  4PM8 A;  5CTM A;  1YLP A;  3ZCZ A;  3MKE A;  1GA0 A;  5HW3 A;  5CEB A;  5I94 A;  5CED A;  2IWD A;  4MNR A;  2Z2L B;  3MKF A;  3N7W A;  3NDE A;  4O7D A;  5TGF A;  3PAG A;  4K91 A;  1ONH A;  4PPR A;  3PBN A;  4DF6 A;  5EVI B;  3VSK A;  3BRM A;  4S2K A;  3ZVW A;  1PYY A;  4EBP A;  4WEJ A;  2IWC A;  5FDH A;  3O88 A;  3VSL A;  3HUO A;  3GV9 A;  5FQI A;  5EVI A;  2R9W A;  4WBG A;  2G2W A;  1FCN A;  5E2G A;  4DE0 A;  2ZQA A;  1W5D A;  3A3I A;  1ESI A;  2H0Y A;  4S2L A;  1ES5 A;  5CGW A;  1CEF A;  3AGE A;  1BLC A;  4PM6 A;  3UPO A;  4R1G A;  3I7J A;  1XKZ A;  1NXY A;  3N8S A;  4Y0U A;  1XP4 A;  2PBY A;  3D4F A;  1KE4 A;  4HEF A;  4R3J A;  1SDE A;  5EE8 A;  4E3L A;  3SS4 A;  5HAP A;  5M18 A;  1S6R A;  4R4S A;  3O86 A;  1ERM A;  4JXS A;  3V3R A;  2XEP A;  3IXD A;  2H10 A;  2HPB A;  1I2S A;  4Z9Q A;  1L0D A;  2Y2Q A;  2Z2M B;  5TR7 A;  1NYM A;  3FZC A;  5AQ9 A;  4P6B A;  5E2H A;  2EX6 A;  3MXS A;  2C6W B;  2IWB A;  5EVL A;  4X68 A;  3C4P A;  3S22 A;  1IKI A;  1LI0 A;  2Q9M A;  1J9M A;  3G31 A;  3GRJ A;  4R23 A;  5F1G A;  3EQV A;  5F82 A;  1ES2 A;  3PBT A;  5DTK A;  4E3M A;  1HZO A;  4PM5 A;  3TOI A;  1L0F A;  3ZFZ A;  5FAQ A;  3GTC A;  1KDS A;  4HBU A;  5EOO A;  4YIN A;  3IF6 B;  1PZP A;  2Y2N A;  3E2L A;  3IXH A;  2BLS A;  3M2K A;  1I2W A;  5FQM A;  4MEZ A;  2ZQD A;  4U0X A;  4XUZ A;  3GR2 A;  3OPH A;  1FQG A;  1ERO A;  1K56 D;  4GDN A;  4DDY A;  4QHC A;  3N8R A;  2V20 A;  1DY6 A;  3ZG5 A;  1K56 A;  5AQA A;  4OPQ A;  1ES3 A;  1W7F A;  5FI2 A;  5GHX A;  2ZMA A;  4R0Q A;  1K6S A;  1CK3 A;  2WGW B;  3FKV A;  3M2J A;  3HRE A;  5F83 A;  3N6I A;  2J9O A;  1IEL A;  1TDL A;  3JYI A;  2DNS A;  4BLM A;  4WEK A;  2Y2H A;  3SH8 A;  3MZF A;  1BUE A;  2Y2P A;  1LHY A;  4N1H A;  4S2I A;  4C6Y A;  3BFE A;  1BT5 A;  4A5R A;  5KSH A;  5DF8 A;  3OCN A;  4R4R A;  3G4P A;  4KQO A;  4M3K A;  1TVF A;  1YQS A;  1RGY A;  2XFT A;  1NY0 A;  5CRF A;  1IYO A;  5E2F A;  3VOY A;  1AXB A;  4B88 A;  4QD4 A;  5FAS A;  3IQA A;  2VGJ A;  4K0W A;  1MXO A;  4ZTK A;  4RX2 A;  5EOE A;  2WKE A;  2WYX A;  1MWS A;  4WZ5 C;  3VFF A;  2XDM A;  3MZD A;  4Q8I A;  2EFX A;  1K55 A;  3RXX A;  3PAE A;  3BFG A;  1MWU A;  1YLY A;  3CMZ A;  2HDQ A;  3NDG A;  4S2J A;  2CC1 A;  5FQJ A;  2WK0 A;  1MKI A;  1SHV A;  3WS5 A;  3O3V A;  1H8Y A;  4EBL A;  3ZG7 B;  3RXW A;  1XX2 A;  1K55 C;  3ZDJ A;  3G30 A;  4CPK A;  3G32 A;  4WZ5 A;  1JVJ A;  4LV2 A;  3WWX A;  1EWZ A;  2ZC5 B;  4B4Z A;  3BFF A;  4L0L A;  5CGS A;  2ZC7 A;  3HLC A;  1RGZ A;  2WUQ A;  1PI5 A;  1E4D A;  1NJ4 A;  4Y7P A;  3UNW A;  3E2K A;  1PZO A;  4K0X A;  2HDR A;  2WKH A;  5GHY A;  4X56 A;  5DTS A;  1GCE A;  1JWP A;  1ZKJ A;  5EUA A;  5GLD A;  1NZO A;  1XA7 A;  5KZH A;  1YLJ A;  3UN7 A;  4OKP A;  3W4O A;  4DE2 A;  4OQG A;  2BG1 A;  4GZB A;  1YLZ A;  1FR6 A;  3CZD A;  5CEC A;  5GLA A;  2OSU A;  4KQR A;  3ZG8 B;  5EPH A;  1MBL A;  4LV1 A;  3IH8 A;  5EVI D;  1E3U D;  3GSG A;  2I72 A;  2XK1 A;  4GNU A;  4BEN A;  4PM7 A;  1GHM A;  3VOZ A;  2WAE A;  2V1Z A;  4OVD A;  3VP4 A;  3V39 A;  3LEZ A;  1YMS A;  3LY3 A;  4PM9 A;  4E3K A;  3VP2 A;  2EFU A;  2JCH A;  2JE5 A;  5A90 A;  2C5W B;  2ZC6 B;  3HLG A;  5A93 A;  2XLN A;  2Y2K A;  3OPR A;  1KVL A;  4EQI A;  3IWO A;  1KGF A;  3IF5 A;  3VP1 A;  2ZC3 B;  1XA1 A;  3Q7V B;  3UY6 A;  2XFS A;  2XF3 A;  2Y4A A;  3HLB A;  2ZM2 A;  4ZJ2 A;  1FOF A;  4C3Q A;  4NK3 A;  4DE1 A;  2ZLY A;  4KQQ A;  4N9K A;  4MBH A;  3A3J A;  4OOL A;  3NC8 A;  2QMI A;  4UHU A;  2EXB A;  1JTD A;  4DXC A;  3ZG9 B;  3V5M A;  1G68 A;  3ITA A;  3IT9 A;  2VGK A;  4OQI A;  3SOI A;  1K57 C;  1GHI A;  1YT4 A;  5FQ9 A;  3QHY A;  2ZC4 B;  2XH9 A;  2A49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...