2WZXA

Amp-c beta-lactamase (pseudomonas aeruginosa)in complex with compound m-02
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
362
structure length
362
Chain Sequence
EAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Side Chain Sar of Bicyclic Beta-Lactamase Inhibitors (Blis). 1. Discovery of a Class C Bli for Combination with Imipinem.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 121
structure length 362
sequence length 362
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 2wzxA00
4R4SA 4S2MA 4E3LA 3A3FA 4FSFA 5TR7A 4QB8A 2ZM2A 1XXMA 5DF7A 5DVAA 4EBLA 5CEBA 2WZZA 4K0XA 1I5QA 4OOMA 2RL3A 2Z2MB 3HVFA 1MPLA 3SS3A 1K6SA 2ZM0A 3SH8A 3VFHA 5HL1A 3TSGA 1MXOA 5M1AA 1ZG4A 1KE0A 4QJGA 1L2SA 4MBKA 1KDSA 4DDSA 1BZAA 2EX2A 3BFCA 3E2KA 4UHUA 3G4PA 2X01A 1JWVA 2VGKA 2EFUA 3HLFA 4LCLA 4OQ0A 4FH2A 3N7WA 3VOZA 2ZC3B 4KZ9A 4RVAA 3C4PA 1ES4A 4OKPA 2XGNA 5A91A 1JWPA 3W8KA 3NIAA 4ZJ3A 3HUOA 4MEZA 4LV3A 2PU4A 3DW0A 2JE5A 3G31A 5BOHA 3FZCA 3HLCA 5EPHA 3Q7VB 4KZ4A 4KZ6A 4Y0UA 5KZHA 1IYOA 2G2WA 3IWQA 1ES3A 4OP8A 1FOFA 4Y7PA 3UDFA 3Q81A 3IHBA 2WUQA 2J8YA 4GNUA 3A3IA 2ZQ9A 1H5XA 4H8RA 3Q7VA 4OPQA 1ZKJA 5FQJA 3ZNTA 5F1FA 2X02A 3UN7A 1QMFA 2HP6A 2ZC5B 1K54A 1LL9A 3FKWA 4WBGA 5HW3A 2H5SA 4N1HA 2Y91A 4LV1A 4GKUA 4KZ3A 3PBOA 1CI8A 1KVLA 5FQKA 5FAOA 4X53A 5FQIA 2Y2QA 4EUZA 1Y54A 3N4IA 5FQ9A 1K54C 1N9BA 4OOYA 3VMAA 3M2KA 5CECA 3ZGAB 3QNBA 2ZQ7A 4CPKA 2XQZA 2ZQDA 3A3EA 1FR1A 3NC8A 5DF8A 3RXWA 3UE1A 4A5RA 4ZTKA 5F83A 5J8XA 3ZNYA 4R0QA 2WGIA 1FSYA 3IXDA 1CEFA 1VQQA 4EQIA 5CHJA 2E8IA 3O86A 3M6HA 2J7VA 3G2ZA 3OPPA 4HBTA 4KZBA 4GZBA 1PZPA 1YLYA 2XDMA 2IWDA 3GRJA 3N8RA 5CGXA 3BLMA 3FYZA 3PBNA 1I2SA 1K6RA 4N9LA 1NRFA 5F1GA 3VP1A 1ONGA 3UE0A 3VSLA 4P85A 5CGWA 2C6WB 3G35A 3GVBA 4NETA 5EE8A 4BENA 4WZ5A 1FQGA 3C4OA 2WKEA 1PW8A 2HP9A 2XR0A 5IHVA 4PM7A 3NI9A 3N8SA 2WADA 5E43A 4OPYA 3C7UA 1BUEA 1SDNA 3OCLA 2R9WA 3I7JA 3N6IA 5F82A 4WZ5C 3V50A 5AQBA 3IXGA 3VP3A 1PIOA 1FSWA 3QHYA 2B5RA 1K38A 1K56D 3BRMA 3MKEA 5KMWA 3GV9A 2HP5A 5GLDA 3SH7A 1YLPA 1WE4A 1PI4A 3LO7A 1PZOA 3Q7ZA 2BLSA 3A3JA 1PI5A 2Y2JA 2ZMAA 3QNCA 4HESA 4DRTA 3NDGA 4PMAA 1PWDA 3NY4A 5FA7A 2CC1A 1GHIA 4OPZA 1XGIA 4WEKA 4MBHA 1W5DA 3OZHA 3G34A 4U0XA 4EWFA 5CGSA 4R23A 2OLUA 4OLGA 1YLZA 4PM8A 3UO9A 2ZLYA 3MBZA 1FR6A 4FCFA 3IXBA 4R3JA 4UAAA 4X69A 3UDXA 1W7FA 1IKIA 4MLLA 1LI0A 4QY6A 2XFTA 5AQ7A 2DRWA 3PBQA 1BULA 1GCEA 2FFYA 4GDNA 4UA6A 4PPRA 5EVIA 2QPNA 4YFMA 2Y2IA 3SH9A 4LENA 5GLAA 2ZJ9A 1EWZA 1KE3A 4JKTA 3FV7A 5L2FA 3BFDA 1ZC2A 4ZJ1A 5GL9A 1C3BA 1U60A 3PBRA 4F94A 1MBLA 2Y4AA 4S2PA 2ZM8A 1ESUA 3S4XA 5GHYA 3HUMA 1NZUA 4OPRA 5EECA 4IVIA 3WS1A 4EBNA 4IVKA 3RJUA 3UY6A 1HD8A 1MWRA 4C75A 1KGEA 4WZ4A 2ZQCA 5E2GA 3MZDA 4KZ8A 4DXCA 5FQQA 5CTNA 5HARA 3ZCZA 4X68A 2QMIA 1LL5A 3BECA 3WWXA 1FCOA 1ZG6A 1NYYA 1BLSA 1EI5A 1KGGA 2Y2HA 4WYYA 4CJNA 2Y2OA 2WAEA 4L0LA 4X6TA 4WEJA 1GHMA 4KQRA 2Y59A 1HTZA 3IHAA 3VP4A 2ZC7A 3BM6A 1Q2PA 5CRFA 1HVBA 5FQMA 3ZHHA 5A93A 3MKFA 1YMXA 4JBFA 4E6WA 2JBFA 1NJ4A 4KQOA 1O07A 4PM6A 3ITAA 3TG9A 2P9VB 5FI6A 2WAFA 2XFSA 3UPOA 3NCKA 3IF5A 4OONA 2OV5A 2HDSA 4WM9A 1L0FA 2WYXA 1G68A 5EOEA 2P9VA 1N4OA 5FI2A 4S2NA 4JXSA 3SS4A 3UPNA 3VSKA 4Q8IA 3HLWA 3LCEA 3NBLA 4MBFA 2Q9NA 3Q1FA 1KGFA 1L0DA 2H0YA 3ITBA 1E3UA 4OH0A 3PAGA 4JXGA 5E2FA 1Q2QA 4E6XA 4Y0TA 4ZAMA 1TEMA 2HDQA 4S2NC 1J9MA 4KENB 4UA9A 3ZG8B 3IXHA 4JPMA 4B4ZA 4DXBA 2ZD8A 4JXWA 3BFEA 4HBUA 1FCNA 1SCWA 2V1ZA 3ZG0A 4DKIA 4KG6A 2ZQAA 4S2JA 1H8YA 2ZC4B 2WGVA 1AXBA 1YQSA 2HDUA 1CI9A 4EV4A 3Q07A 4N9KA 3Q82A 4LV0A 3NDEA 4C3QA 3W4QA 1JWZA 3WRZA 3VOYA 4JXVA 1JTDA 2X71A 4O7DA 1OMEA 1XX2A 2P74A 4ZBEA 3OPLA 1KE4A 2V20A 1RP5A 3M2JA 3GSGA 2Y55A 1XPBA 4GDBA 4WELA 2A3UA 5EUAA 1XKZA 4X55A 3PBTA 5I94A 1JVJA 1S6RA 5HAQA 1ERMA 1XP4A 1YT4A 2A49A 2RCXA 4BLMA 4E3KA 1BLPA 1LI9A 4X56A 4BJPA 1ESIA 1IELA 1YMSA 3MZFA 4JF4A 5M19A 3UDIA 1CK3A 3DTMA 4QHCA 1O7EA 4R4RA 3ZVTA 4OQHA 1W8YA 5FDHA 4OVDA 1RGZA 4S2LA 3AGEA 5CTMA 2I72A 5GHXA 2OSUA 5DTTA 4XUZA 3RXXA 1MY8A 2EXBA 5FATA 2Y2GA 2EX9A 4QY5A 3DWKA 5EVLA 1JTGA 5GLBA 2Y2MA 5DTSA 2QZ6A 5JYPA 4KG2A 3AGDA 2G2UA 2HDRA 1TVFA 3IH9A 4MNRA 4D2OA 3ISGA 3O87A 4HEFA 5GLCA 4E3JA 3WS4A 4QU3A 4E3IA 2XF3A 1NYMA 4M3KA 1ES5A 4DE0A 3LY4A 4K0WA 3HREA 1IYPA 2WGWA 3HLBA 1PWCA 5EVIB 4GD6A 1RGYA 1PYYA 3SOIA 3LEZA 3MXRA 3ZVWA 3V5MA 1IKGA 3ZG9B 1GHPA 5HAIA 3HLGA 3CMZA 3C7VA 1PWGA 3S22A 5TGFA 5CHMA 2XD1A 2GDNA 2IWBA 2WK0A 5EVIC 1K55A 4LCMA 4S2IA 3UE3A 3P09A 4LV2A 4N1XA 5FAPA 3S1YA 3BEBA 3MXSA 2PU2A 4WMCA 2EFXA 5D3OA 5KSHA 1RCJA 3MFDA 3VP2A 2UWXA 3B3XA 5AQ9A 4DDYA 3GTCA 4JLFA 4GN2A 1K55C 3M6BA 4DE3A 1WYCA 4JF5A 3FWLA 1TDGA 5CXWA 1TDLA 3CZDA 3ZG5A 3HLDA 1K57A 3HLEA 5FI7A 4P6BA 3SS5A 4DE1A 2ZC6B 1DJAA 3W4OA 1W79A 4K91A 2H0TA 3PAEA 4DF6A 2XH9A 1ERQA 4U0TA 1K57C 5A90A 4C6YA 1SHVA 2XK1A 3HL9A 5DTKA 3G30A 5FSRA 5HAPA 1DY6A 3V3RA 1XA7A 4OLDA 3BLSA 2EX6A 3AGFA 4E3OA 4N92A 2EX8A 3A3DA 1E3UD 1ONHA 2PBYA 2J9OA 2Y2NA 5G18A 1BSGA 2WZXA 3O3VA 5HFOA 1H8ZA 2J9PA 3WS2A 2Y2KA 4KQQA 4P87A 3V39A 3EQVA 4ZJ2A 3HBRA 1NXYA 1MKIA 1PW1A 3CJMA 3CG5A 3IH8A 4JF6A 5M18A 4ZDXA 2R9XA 4ID4A 1BTLA 4OQIA 3LY3A 4R1GA 4GD8A 1YLTA 3OC2A 2WKIA 3EQUA 3P98A 1WYBA 5E2EA 1LHYA 4RA7A 4UA7A 1LLBA 4GOGA 3G32A 3C5AA 4BD1A 1BT5A 1DJCA 2Y2LA 4RX3A 3ZFZA 4BL3A 1HZOA 5CHUA 1ALQA 2DNSA 1G6AA 3BFGA 1KDWA 4Y0OA 2IWCA 2JCHA 3VP0A 1BLCA 4B4XA 4E3NA 4BQMA 1CEGA 5U47A 3GR2A 5TFQA 2DCFA 1FCMA 3JYIA 4E3MA 4YINA 3GQZA 1EROA 3IF6B 1M6KA 1MWUA 1K4FA 2EXAA 4RX2A 2V2FF 3PTEA 4KG5A 1K4EA 3G2YA 3HUNA 4GB7A 5EOOA 3WS0A 4FD8A 3IF6A 3PBSA 4Z9QA 1SDEA 1L0GA 1MWTA 1YM1A 3OPHA 1DJBA 2C5WB 4KZ7A 3ZDJA 4XUXA 4OQGA 3W4PA 5JYOA 2JC7A 3N8LA 3VFFA 1YLWA 5CEDA 5FASA 1S0WA 3IQAA 1QMEA 2ZQ8A 3IF6C 3D4FA 4RYEA 4IEDA 1K25A 1M40A 4QD4A 3GMWA 1IYQA 4S2OA 3IWIA 2Q9MA 3TOIA 1IYSA 3OCNA 4NK3A 4BD0A 2XD5A 5FAQA 1BLHA 4IBXA 5GHZA 2WGWB 3O88A 4IBRA 5KSCA 1GA0A 5DF9A 3IT9A 4DE2A 2WKHA 3FKVA 4BL2A 2FFFB 3DWZA 1W8QA 4U3TA 3UNWA 5EVID 3ZG7B 1I2WA 4P0MA 5CERA 2OLVA 4S2KA 1E4DA 4R3BA 1GA9A 1KVMA 1XGJA 3IWOA 5A92A 3OPRA 1K56A 3MZEA 3E2LA 1SKFA 4OOLA 5HX9A 3UPPA 1NY0A 1Z6FA 2H10A 3BYDA 4OP5A 2HPBA 2VGJA 2Y2PA 3BFFA 3V3SA 4PM5A 1IEMA 5E2HA 1YLJA 4B88A 1XA1A 4FH4A 4PM9A 4WMCD 3WRTA 4KZ5A 5AQAA 1E25A 1L0EA 1VM1A 2Z2LB 4KZAA 4EBPA 2BG1A 1ES2A 3WS5A 1MWSA 2XLNA 2XEPA 4XXRA 1NZOA
chains in the Genus database with same CATH superfamily
4E3LA 4FSFA 1GSVA 1OJGA 2I9VA 4QB8A 1MPLA 3IX8A 3F1PA 1MXOA 3H9WA 1KE0A 1L2SA 4LRZE 4DDSA 1BZAA 3BFCA 1JWVA 2VA0A 3B33A 4OKPA 2PRFA 4LV3A 2J3WA 3FZCA 3Q7VB 4KZ4A 1ES3A 5EM0A 1FOFA 3Q81A 2J8YA 2W27A 5FQJA 1S67L 1LL9A 3FKWA 3IX3A 3MFXA 2H5SA 4LV1A 3PBOA 1CI8A 2KLIA 1N9NA 5F5YA 4CLCA 4OOYA 2V0WA 5CECA 4HOIA 5DJTA 3QNBA 2ZQ7A 4CPKA 5HWVA 4A5RA 3KX0X 4ZTKA 3LI8A 4H6JA 4G3VA 4Q0IA 5CHJA 3KSHA 1DP9A 3M6HA 3FYZA 3UMDA 3VSLA 4P85A 5CGWA 3LIBA 1F98A 1G5UA 4BENA 4PHTA 3C4OA 2HV1A 2WKEA 4MN5A 2B02A 1D7EA 2WADA 4OPYA 3C7UA 1BUEA 2R9WA 1H8MA 5F82A 4XT2B 3V50A 5HPFA 3QHYA 1WE4A 3LO7A 3Q7ZA 4R6LA 2ZMAA 3QNCA 3NDGA 4PMAA 3NY4A 4KUOA 4OPZA 4OLGA 3U2AA 1FR6A 1LL8A 1T1AA 4X69A 5IS1A 1YKDA 5AQ7A 4GDNA 2OAQ1 3SH9A 3A0SA 4LENA 3T4QA 5GLAA 2PT7A 1KE3A 3BFDA 4ZJ1A 1C3BA 1TS6A 4F94A 1MBLA 5HDDA 1ESUA 4OPRA 4EBNA 4IVKA 4EW7A 4C75A 4HHDA 4DXCA 5CTNA 4X68A 1EI5A 4WEJA 5I5LA 1Q2PA 2O9BA 4Z1WA 5F6AA 3ZHHA 4JBFA 4E6WA 4O0PA 2P9VB 2HDSA 4WM9A 4GCZA 2WYXA 3H7WA 2W1TA 3T4JA 5IU1A 1T1BA 3VSKA 4MBFA 3Q1FA 1KGFA 1L0DA 4JXGA 3T50A 5DKKA 2HDQA 3KYZA 4HY8A 3ZG8B 3E4PA 4KG6A 1P97A 2ZQAA 2J3TC 4LRXC 1YQSA 3Q07A 4LV0A 1DRMA 3WRZA 2Y8HA 2P74A 4ZBEA 3OPLA 3TRCA 3GSGA 5EUAA 3TW8A 2A3UA 4X55A 4Y3IA 2PR6A 1XP4A 2A49A 2RCXA 4BLMA 4E3KA 1ESIA 1IELA 4Q0JA 3UDIA 1CK3A 4Y13A 4OQHA 3DTKA 2JKFA 1XJ4A 2OSUA 2ZMFA 2ZL1B 2EXBA 4L9EA 2O0YA 3L9KA 5DTSA 2QZ6A 2HDRA 1TVFA 3R4KA 5FL3A 2QKPA 2VLGA 2W3DA 5GLCA 4NG2A 5DJUA 4QU3A 2XF3A 4K0WA 4AFIA 4GD6A 1OPXA 3SOIA 3MXRA 1ODVA 5L10A 2Q0OA 3CMZA 1PWGA 5K5BA 3UB9A 3HJKA 5EVIC 4LCMA 1KOUA 1OTEA 2P7JA 5D3OA 1RCJA 2UWXA 3B3XA 5AQ9A 4JLFA 2OAP1 4DE3A 1K55C 3M6BA 3FWLA 4PAUA 5TJJA 1TDLA 1K57A 4P6BA 4DE1A 2PDRA 2EWVA 4MDZA 3W4OA 5G4YA 4EEUA 2XH9A 1ERQA 4U0TA 5HPIA 2PD7A 4R38A 1WA9A 5HAPA 4E3OA 1OTIA 1E3UD 2Y2NA 2J9OA 3KO6A 1BSGA 1LT0A 1VETB 3WS2A 2Y2KA 1S1YA 3EQVA 1PW1A 3F1NB 4ETZA 1BTLA 4Y17A 1YLTA 3ULFA 2WKIA 1WYBA 1YSQA 2XSSA 3U4LP 2W3FA 1G6OA 1HZOA 1ALQA 3BFGA 1S4SA 3H82B 4B4XA 4BQMA 5TFQA 3NJAA 3IF6B 3DBAA 4FUWA 2V2FF 4KG5A 3HUNA 4GB7A 2OOLA 3PBSA 1SDEA 5FDSA 3KSGA 1V9YA 2C5WB 4XUXA 3W4PA 1QMEA 3D4FA 1AWIA 4RYEA 4IEDA 1K25A 1JNUA 3IWIA 2Q9MA 1IYSA 3OCNA 5FAQA 1GSXA 1GA0A 3LI9A 4DE2A 4BL2A 3UNWA 1W8QA 3ZG7B 1E4DA 5A92A 1CQAA 1SKFA 1NY0A 1Z09A 4WUJA 3BFFA 4HP4A 3V3SA 3SZTA 4PM9A 4EU0A 2JKGA 3WRTA 5AQAA 1ES2A 1NZOA 2ZM2A 5CEBA 4K0XA 3EWKA 4OOMA 5HL1A 3VFHA 2ZMVA 1K6SA 2ZM0A 1ZG4A 1ZHHB 4MBKA 4UHUA 2X01A 4LCLA 4OQ0A 1T19A 1ES4A 3LICA 3RTYA 3W8KA 4ZJ3A 4MEZA 5BOHA 2JE5A 3HLCA 2G2WA 3ZQ5A 3LUQA 3BY9A 5J3WA 5HZHA 2WUQA 3E0YA 2ZQ9A 1H5XA 3Q7VA 1ZKJA 1H0MA 1QMFA 2HP6A 5HW3A 2Y91A 3JPUA 4GKUA 1Y4OA 5FQKA 1VEUB 4GS9B 5FAOA 4X53A 3NHQA 1VB6A 1N9BA 3EEAA 3NECA 2XQZA 3UMEA 5DF8A 1FSYA 1EW0A 4CLCC 3CAXA 2BTFP 1CEFA 4EQIA 2E8IA 3O86A 3OPPA 4HBTA 1PZPA 3EGDC 1LSVA 3ZYTA 1I2SA 1NRFA 3VP1A 4HQAA 3CI6A 2C6WB 3GVBA 5EE8A 1PW8A 2XR0A 3NI9A 4MCWA 3LEQA 1T18A 1OT9A 3I7JA 3N6IA 5AQBA 3IBJA 3IXGA 3BY8A 1K38A 3IBRA 4XT2A 2BLSA 3MJQA 3A3JA 4X1LA 1PI5A 4IUHA 2G7UA 2CC1A 4WEKA 4MBHA 1W5DA 1P0ZA 3UO9A 2ZLYA 3MBZA 2WKPA 4R3JA 1W7FA 1IKIA 4MLLA 4QY6A 1GCEA 1S1ZA 1V9ZA 4I3IA 2VGLM 3LR5A 5L2FA 1ZC2A 2B95A 4WL9A 1G28A 4ME4A 3R7WA 3HUMA 3WS1A 2QJ7A 2VV7A 1HD8A 4WZ4A 3T4OA 4BBUA 3LIFA 4KZ8A 5FQQA 3LYXA 5HARA 3ZCZA 1CF0A 4GLQA 1LL5A 1ZG6A 1NYYA 4CJNA 2WAEA 4UEYA 4KQRA 1HTZA 3VP4A 2VV6A 2XRNA 2VGLS 5HDSA 1J3WA 1O07A 3TG9A 5FI6A 2WAFA 3O5YA 1YPRA 2OV5A 4PKYA 2P9VA 1N4OA 2JKRI 4Q8IA 4I3JA 3NBLA 2EWWA 1F5MA 2H0YA 1E3UA 4OH0A 3PAGA 1Q2QA 5AVFA 5EVEA 4DXBA 4JXWA 1FCNA 3ICYA 4DKIA 2L0WA 1AXBA 3QP2A 4EV4A 3IX4A 3NDEA 3VOYA 1PFLA 4JXVA 2X71A 1OMEA 3M2JA 1RP5A 3OBFA 5HD5A 4WELA 1XKZA 2JKRM 5C5KA 1S6RA 3FG8A 1LI9A 2Y79A 1YMSA 4JF4A 5M19A 2JKTI 3UB7A 4QHCA 3ZVTA 5GHXA 4S2LA 3T1RA 4XUZA 5FATA 4EUVA 2ZL1A 1JTGA 4NEED 3AGDA 2G2UA 3IH9A 3O87A 4HEFA 4K08A 1TS8A 4F3LA 1ES5A 4Y2FA 3MR0A 3HREA 3FPVA 2WGWA 1NLZA 3LGOA 3ZG9B 4DJ3A 3HLGA 2OWJA 3A0VA 3R7WB 4BBVA 5TGFA 3T1QB 2XD1A 2GDNA 2IWBA 2PYRA 4S2IA 3UE3A 3B42A 3S7OA 4N1XA 4NXBA 2PU2A 3MFDA 3VP2A 1D06A 3C2WA 1WYCA 2LB5A 5HD3A 1TDGA 5CXWA 5HWTA 3HLDA 3HLEA 3SS5A 1OT6A 2PYPA 4K91A 3QP4A 3EEHA 3PAEA 5FEGA 4DF6A 5L8MA 3T4TA 4MN6A 3VV4A 1K57C 5A90A 4O8GA 4C6YA 2XK1A 3HL9A 3G30A 1DY6A 3V3RA 2EX6A 3EGXC 3A3DA 1ONHA 2PBYA 5G18A 1H8ZA 4Y15A 2Z6DA 4KQQA 1S66L 3CJMA 4G3KA 3CG5A 3PHYA 5LBRA 1VETA 5HWWA 3CLOA 4GD8A 3OC2A 3P98A 3F1NA 5E2EA 4UA7A 4GOGA 3G32A 4BD1A 1DJCA 2Y2LA 4RX3A 3ZFZA 4BL3A 4BMWA 1G6AA 2IWCA 2HJEA 1H3QA 5U47A 3GR2A 4L9FA 2ZBBA 2V1BA 4NKPA 4G3WA 4E3MA 4YINA 3H82A 2O9CA 1MWUA 1K4EA 3G2YA 4DMZA 3IF6A 2QJ5A 2PHYA 1MWTA 3OPHA 1DJBA 3ZDJA 4OQGA 3KYQA 2K7SA 5JYOA 2EA9A 2FZ0A 2V8CA 1S0WA 3IQAA 3LIEA 4RQ9A 1UWNX 3T1SA 4LLOB 2E8JA 1M40A 4QD4A 4BD0A 2XD5A 4F3LB 1BLHA 4IBXA 2WGWB 3O88A 3IT9A 2D02A 3A0RA 2PR5A 3DWZA 1HLUP 2OLVA 3BWLA 4S2KA 1GA9A 1KVMA 1XGJA 3IWOA 3MZEA 4OOLA 3UPPA 2O9AA 2VGJA 4PKYG 4B88A 4WMCD 1F9IA 4KZ5A 1L0EA 1VM1A 5HL6A 2XLNA 1P9RA 4S2MA 3A3FA 3TJZC 1N9LA 1MZUA 5TR7A 1XXMA 5DF7A 4EBLA 2WZZA 2RL3A 3HVFA 3SS3A 3PYPA 3TSGA 5M1AA 1KDSA 3E2KA 3G4PA 3CPTB 4IHQA 2EFUA 2K2NA 3N7WA 3VOZA 4KZ9A 3MQ0A 3C4PA 3T12B 5A91A 3NIAA 3HUOA 3DW0A 5EPHA 5KZHA 3UDFA 4OP8A 5EV0A 4MMNA 3IHBA 1VHMA 3A3IA 4H8RA 4IJGA 4YOFA 2GNXA 3UN7A 2ZC5B 1K54A 1LSXA 3RH8B 4FOFA 1KVLA 3QP1A 3N4IA 3FC7A 3VMAA 3M2KA 1VEUA 4GS9A 3ZGAB 4X1MA 3A3EA 1FR1A 3UE1A 5F83A 5J8XA 2W3EA 3ZNYA 3IXDA 4Y5FA 1VQQA 2VKSA 3G2ZA 3UB8A 4KZBA 1YLYA 2IWDA 2XDMA 3GRJA 2V9AA 2GX5A 3BLMA 3E4OA 1K6RA 1ONGA 2BASA 4HH3A 4WZ5A 1FQGA 1TS0A 2LB9A 3N8SA 5E43A 1SDNA 3OCLA 5KIZA 3VP3A 1FSWA 2B5RA 5KMWA 3GV9A 2HP5A 3SH7A 1YLPA 3DAVA 1PI4A 2YKHA 1PZOA 4MN7A 4HESA 4GW9A 5FA7A 4WF0A 3OZHA 4EXOA 3UDXA 3OLOA 1LI0A 2XFTA 2PBDP 4UA6A 4BWIA 4PPRA 5EVIA 4YFMA 4YNRA 2ZJ9A 1EWZA 2HF6A 3FV7A 1U60A 2Y4AA 3D3OA 3V67A 3S4XA 5EECA 3MS6A 3UY6A 2V1AA 1MWRA 1KGEA 5E2GA 4GJ4A 4I5SA 1FCOA 3S7NA 1BLSA 2Y2HA 4WYYA 4L0LA 5F69A 3IHAA 2ZC7A 1HVBA 4BBTA 1YMXA 1NJ4A 4PM6A 5G4ZA 3PR6A 3IF5A 4M4XA 1L0FA 5EOEA 1F2KA 3UB6A 4S2NA 4HNBA 2M7UA 3NOPC 3UPNA 3LCEA 2Q9NA 2A24B 5E2FA 4E6XA 1L3LA 4ZAMA 1TEMA 3FPWA 4ETXA 1J9MA 3IXHA 4B4ZA 5J7EA 1SCWA 2QHKA 4HJ6A 2ZC4B 2HDUA 2FH5A 3Q82A 2XA7M 1JWZA 4O7DA 1KE4A 1XFQA 1XPBA 4GDBA 2JHEA 1ERMA 2M7VA 1YT4A 2H28A 4X56A 4BJPA 3MZFA 4JGPA 1T1CA 3DTMA 1O7EA 5L09A 5FDHA 4OVDA 1RGZA 2XA7S 4LRYC 1NRJA 5DTTA 5EM1A 3RXXA 3CWFA 4GHIB 1D1JA 2Y2GA 3DWKA 4HJ3A 5EVLA 5GLBA 2Y2MA 4KG2A 4P6ZM 3NOUC 4MNRA 3DTEA 3ISGA 4E3JA 2W1RA 3WS4A 4E3IA 3BJNA 3BQ8A 4M3KA 4DE0A 3LY4A 5EVIB 1IYPA 3C38A 3KSIA 1RGYA 1PYYA 3BQAA 3ZVWA 1PNEA 3V5MA 3EOIA 5L07A 4X25A 2WKRA 3C7VA 5CHMA 2VEAA 4HP9A 3CUEA 4P6ZS 2WK0A 1TD5A 5DFXA 4I38A 4LV2A 3S1YA 3BEBA 4WMCA 5KSHA 4NXEA 3GTCA 4JF5A 3CZDA 4HJ4A 5FI7A 2ZC6B 3L7HA 1DJAA 4HIAA 1W79A 2H0TA 2KOIA 3QP8A 1XJ6A 3TE8A 3PXPA 4LPZA 2DMWA 1XA7A 4QPRA 1YAXA 5HSQA 2HGVA 2J3TD 2WZXA 5HFOA 2J9PA 4LGWA 4P87A 3V39A 1DP8A 4ZJ2A 1NXYA 3LR3A 5IT5A 5M18A 2R9XA 4ID4A 2OWHA 1STZA 4ESPA 3LY3A 4R1GA 2V0UA 4R70A 1OJ5A 1LLBA 1BT5A 3MMHA 2DNSA 4Y0OA 1KDWA 3K2NA 4YWZA 1BLCA 1CEGA 2DCFA 1FCMA 1M6KA 1K4FA 5EOOA 3NULA 4FD8A 3JVVA 4QWOA 4Z9QA 3IS2B 1L0GA 5TBMB 4KZ7A 4D60A 3VE4A 2JC7A 3VFFA 1YLWA 2XROA 4O01A 1MKMA 1SZVA 3IF6C 3MF0A 4NXFA 1S4RA 3QP5A 2Z6CA 4EERA 3GMWA 4LFUA 3TOIA 1K0KA 4WLAA 3T4LA 5DF9A 2VZWA 2WKHA 2FFFB 5CX7A 5EVID 1I2WA 4P0MA 1SKOB 4R3BA 1W63M 3OPRA 1Y28A 3E2LA 5HX9A 3HJIA 3BYDA 1PRQA 2H10A 2JKTM 1UGUA 4ARZA 4PM5A 1YLJA 1DP6A 3CHWP 2VK3A 3F1OB 1E25A 2Z2LB 4KZAA 4EBPA 2BG1A 2V8FA 3UE6A 1MWSA 2XEPA 4XXRA 4CLCE 4R4SA 3F1PB 1TF1A 3E98A 5DVAA 4WN5A 1I5QA 2Z2MB 4I39A 5AJGA 3SH8A 4QJGA 2EX2A 3HLFA 2VGKA 1FIKA 4Q0HA 4FH2A 2YKFA 2GZAA 2ZC3B 4RVAA 3DTIA 3CPTA 4KQDA 2XGNA 1JWPA 3K3CA 3KSFA 2PU4A 3G31A 4EETB 1OTAA 1P9WA 4KZ6A 4Y0UA 1IYOA 3IWQA 4Y7PA 3QP6A 4GNUA 1NLYA 4OPQA 3ZNTA 5F1FA 2X02A 4WBGA 2QWSA 4HH2A 4N1HA 4CLCB 4KZ3A 2ACGA 2B18A 2L4RA 2M1CA 3MQOA 5FQIA 2Y2QA 3GDIA 4EUZA 1Y54A 5FQ9A 1K54C 3GECA 3G6OA 4H6JB 2PD8A 2ZQDA 3NC8A 3RXWA 3OOVA 4R0QA 3VOLA 2WGIA 4IUKA 2J7VA 2CMNA 2NUTC 4GZBA 3N8RA 5CGXA 3PBNA 4N9LA 5F1GA 1IOUA 3UE0A 2W0NA 3G35A 1XFNA 4NETA 2W3GA 5FEFA 2HP9A 5IHVA 4PM7A 3D9YA 3MQQA 1OTBA 4WZ5C 1W63Q 4DJ2A 1PIOA 2VJWA 1K56D 3BRMA 3MKEA 5GLDA 3MXQA 3VE3A 2P08A 5DFYA 4ARZB 2Y2JA 4DRTA 1PWDA 5EFWA 1GHIA 4B9OA 1XGIA 2P04A 3G34A 4U0XA 4EWFA 5CGSA 4R23A 2AVXA 2OLUA 1YLZA 3BW6A 4PM8A 5J4EA 4FCFA 3IXBA 4UAAA 5A8BA 3S7QA 1IFQA 4II7A 2DRWA 3PBQA 1BULA 2FFYA 4JGOA 2QPNA 2Y2IA 2ZOIA 4JKTA 5GL9A 1UWPX 3CITA 3PBRA 4S2PA 3RFBA 2ZM8A 5GHYA 1NZUA 4IVIA 3RJUA 3LIAA 2O99A 4UQIM 2ZQCA 3MZDA 3UB5P 2QMIA 3BECA 3WWXA 5AVEA 1KGGA 2Y2OA 4X6TA 1GHMA 2Y59A 3BM6A 3D72A 5CRFA 2QYBA 5FQMA 3E4QA 5A93A 1OTDA 2A2LA 3MKFA 4CQHA 2JBFA 1LSWA 4KQOA 1A0KA 3H7WB 3ITAA 2W1TB 5F68A 2XFSA 3UPOA 4CLCD 3NCKA 4OONA 3T4SA 1GSWA 4UQIS 1G68A 3HCYA 2JN7A 5FI2A 4JXSA 3SS4A 3HLWA 3LR4A 2J80A 2IA2A 3ITBA 4Y0TA 2KX6A 4S2NC 4KENB 4UA9A 2A24A 4JPMA 4I3AA 2ZD8A 3BFEA 4HBUA 2V1ZA 3ZG0A 4S2JA 1H8YA 2WGVA 1CI9A 2PAVP 3W2ZA 4N9KA 3JVUA 4C3QA 3W4QA 1JTDA 1XX2A 2R78A 2V20A 2Y55A 5I94A 3PBTA 3SW1A 1JVJA 5HAQA 1BLPA 4R4RA 1W8YA 2D01A 3AGEA 5CTMA 2I72A 5HDCA 4EQ1A 1MY8A 1X0OA 2W3HA 2EX9A 4QY5A 5JYPA 2NUPC 4GHIA 3K3DA 3S7PA 4D2OA 4ZRRA 1NYMA 1XJ2A 3HLBA 1PWCA 1CJFA 3LEZA 2VX8A 4NXGA 3LIDA 1IKGA 2K31A 1GHPA 5HAIA 1N9OA 3S22A 1K55A 3P09A 5FAPA 3MXSA 2EFXA 3T1XA 4DDYA 3CUEC 4GN2A 3ZG5A 2MJ6A 4JGQA 3KYEA 1SHVA 5DTKA 5FSRA 4OLDA 3BLSA 3AGFA 4N92A 2EX8A 2GJ3A 4FTXA 4EESA 3O3VA 4B93A 1ZTUA 3HBRA 5MC7A 1MKIA 4JF6A 3IH8A 4ZDXA 4OQIA 4DN0A 3EQUA 1LHYA 1BYWA 4RA7A 3C5AA 1TS7A 5CHUA 4EEPA 2VV8A 2JCHA 3LFVA 3VP0A 4E3NA 1XJ3A 1ACFA 1MC0A 1NWZA 4HI4A 3JYIA 3T4KA 3P01A 3GQZA 4KUKA 2UV0E 1EROA 3C8CA 2WKQA 2EXAA 4RX2A 3PTEA 3LR0A 3WS0A 2INWA 4JGRA 5DKLA 1YM1A 3N8LA 3IS2A 5CEDA 5FASA 5TBMA 2ZQ8A 3P7NA 1IYQA 4S2OA 2KDKA 1YSPA 4NK3A 4E04A 3C30A 5GHZA 5KSCA 3NOTC 4IBRA 3FKVA 4U3TA 4R3AA 5CERA 1K56A 2HZ5A 1Z6FA 1SKOA 4OP5A 2HPBA 1FILA 2Y2PA 1IEMA 5E2HA 2HJ9C 3MSHA 1XA1A 4FH4A 3B47A 2L1MA 3WS5A 4L9GA 3F1OA 2ZOHA
chains in the Genus database with same CATH topology
4R4SA 4S2MA 4E3LA 3A3FA 4FSFA 5TR7A 4QB8A 2ZM2A 1XXMA 5DF7A 5DVAA 4EBLA 5CEBA 2WZZA 4K0XA 1I5QA 4OOMA 2RL3A 2Z2MB 3HVFA 1MPLA 3SS3A 1K6SA 2ZM0A 3SH8A 3VFHA 5HL1A 3TSGA 1MXOA 5M1AA 1ZG4A 1KE0A 4QJGA 1L2SA 4MBKA 1KDSA 4DDSA 1BZAA 2EX2A 3BFCA 3E2KA 4UHUA 3G4PA 2X01A 1JWVA 2VGKA 2EFUA 3HLFA 4LCLA 4OQ0A 4FH2A 3N7WA 3VOZA 2ZC3B 4KZ9A 4RVAA 3C4PA 1ES4A 4OKPA 2XGNA 5A91A 1JWPA 3W8KA 3NIAA 4ZJ3A 3HUOA 4MEZA 4LV3A 2PU4A 3DW0A 2JE5A 3G31A 5BOHA 3FZCA 3HLCA 5EPHA 3Q7VB 4KZ4A 4KZ6A 4Y0UA 5KZHA 1IYOA 2G2WA 3IWQA 1ES3A 4OP8A 1FOFA 4Y7PA 3UDFA 3Q81A 3IHBA 2WUQA 2J8YA 4GNUA 3A3IA 2ZQ9A 1H5XA 4H8RA 3Q7VA 4OPQA 1ZKJA 5FQJA 3ZNTA 5F1FA 2X02A 3UN7A 1QMFA 2HP6A 2ZC5B 1K54A 1LL9A 3FKWA 4WBGA 5HW3A 2H5SA 4N1HA 2Y91A 4LV1A 4GKUA 4KZ3A 3PBOA 1CI8A 1KVLA 5FQKA 5FAOA 4X53A 5FQIA 2Y2QA 4EUZA 1Y54A 3N4IA 5FQ9A 1K54C 1N9BA 4OOYA 3VMAA 3M2KA 5CECA 3ZGAB 3QNBA 2ZQ7A 4CPKA 2XQZA 2ZQDA 3A3EA 1FR1A 3NC8A 5DF8A 3RXWA 3UE1A 4A5RA 4ZTKA 5F83A 5J8XA 3ZNYA 4R0QA 2WGIA 1FSYA 3IXDA 1CEFA 1VQQA 4EQIA 5CHJA 2E8IA 3O86A 3M6HA 2J7VA 3G2ZA 3OPPA 4HBTA 4KZBA 4GZBA 1PZPA 1YLYA 2XDMA 2IWDA 3GRJA 3N8RA 5CGXA 3BLMA 3FYZA 3PBNA 1I2SA 1K6RA 4N9LA 1NRFA 5F1GA 3VP1A 1ONGA 3UE0A 3VSLA 4P85A 5CGWA 2C6WB 3G35A 3GVBA 4NETA 5EE8A 4BENA 4WZ5A 1FQGA 3C4OA 2WKEA 1PW8A 2HP9A 2XR0A 5IHVA 4PM7A 3NI9A 3N8SA 2WADA 5E43A 4OPYA 3C7UA 1BUEA 1SDNA 3OCLA 2R9WA 3I7JA 3N6IA 5F82A 4WZ5C 3V50A 5AQBA 3IXGA 3VP3A 1PIOA 1FSWA 3QHYA 2B5RA 1K38A 1K56D 3BRMA 3MKEA 5KMWA 3GV9A 2HP5A 5GLDA 3SH7A 1YLPA 1WE4A 1PI4A 3LO7A 1PZOA 3Q7ZA 2BLSA 3A3JA 1PI5A 2Y2JA 2ZMAA 3QNCA 4HESA 4DRTA 3NDGA 4PMAA 1PWDA 3NY4A 5FA7A 2CC1A 1GHIA 4OPZA 1XGIA 4WEKA 4MBHA 1W5DA 3OZHA 3G34A 4U0XA 4EWFA 5CGSA 4R23A 2OLUA 4OLGA 1YLZA 4PM8A 3UO9A 2ZLYA 3MBZA 1FR6A 4FCFA 3IXBA 4R3JA 4UAAA 4X69A 3UDXA 1W7FA 1IKIA 4MLLA 1LI0A 4QY6A 2XFTA 5AQ7A 2DRWA 3PBQA 1BULA 1GCEA 2FFYA 4GDNA 4UA6A 4PPRA 5EVIA 2QPNA 4YFMA 2Y2IA 3SH9A 4LENA 5GLAA 2ZJ9A 1EWZA 1KE3A 4JKTA 3FV7A 5L2FA 3BFDA 1ZC2A 4ZJ1A 5GL9A 1C3BA 1U60A 3PBRA 4F94A 1MBLA 2Y4AA 4S2PA 2ZM8A 1ESUA 3S4XA 5GHYA 3HUMA 1NZUA 4OPRA 5EECA 4IVIA 3WS1A 4EBNA 4IVKA 3RJUA 3UY6A 1HD8A 1MWRA 4C75A 1KGEA 4WZ4A 2ZQCA 5E2GA 3MZDA 4KZ8A 4DXCA 5FQQA 5CTNA 5HARA 3ZCZA 4X68A 2QMIA 1LL5A 3BECA 3WWXA 1FCOA 1ZG6A 1NYYA 1BLSA 1EI5A 1KGGA 2Y2HA 4WYYA 4CJNA 2Y2OA 2WAEA 4L0LA 4X6TA 4WEJA 1GHMA 4KQRA 2Y59A 1HTZA 3IHAA 3VP4A 2ZC7A 3BM6A 1Q2PA 5CRFA 1HVBA 5FQMA 3ZHHA 5A93A 3MKFA 1YMXA 4JBFA 4E6WA 2JBFA 1NJ4A 4KQOA 1O07A 4PM6A 3ITAA 3TG9A 2P9VB 5FI6A 2WAFA 2XFSA 3UPOA 3NCKA 3IF5A 4OONA 2OV5A 2HDSA 4WM9A 1L0FA 2WYXA 1G68A 5EOEA 2P9VA 1N4OA 5FI2A 4S2NA 4JXSA 3SS4A 3UPNA 3VSKA 4Q8IA 3HLWA 3LCEA 3NBLA 4MBFA 2Q9NA 3Q1FA 1KGFA 1L0DA 2H0YA 3ITBA 1E3UA 4OH0A 3PAGA 4JXGA 5E2FA 1Q2QA 4E6XA 4Y0TA 4ZAMA 1TEMA 2HDQA 4S2NC 1J9MA 4KENB 4UA9A 3ZG8B 3IXHA 4JPMA 4B4ZA 4DXBA 2ZD8A 4JXWA 3BFEA 4HBUA 1FCNA 1SCWA 2V1ZA 3ZG0A 4DKIA 4KG6A 2ZQAA 4S2JA 1H8YA 2ZC4B 2WGVA 1AXBA 1YQSA 2HDUA 1CI9A 4EV4A 3Q07A 4N9KA 3Q82A 4LV0A 3NDEA 4C3QA 3W4QA 1JWZA 3WRZA 3VOYA 4JXVA 1JTDA 2X71A 4O7DA 1OMEA 1XX2A 2P74A 4ZBEA 3OPLA 1KE4A 2V20A 1RP5A 3M2JA 3GSGA 2Y55A 1XPBA 4GDBA 4WELA 2A3UA 5EUAA 1XKZA 4X55A 3PBTA 5I94A 1JVJA 1S6RA 5HAQA 1ERMA 1XP4A 1YT4A 2A49A 2RCXA 4BLMA 4E3KA 1BLPA 1LI9A 4X56A 4BJPA 1ESIA 1IELA 1YMSA 3MZFA 4JF4A 5M19A 3UDIA 1CK3A 3DTMA 4QHCA 1O7EA 4R4RA 3ZVTA 4OQHA 1W8YA 5FDHA 4OVDA 1RGZA 4S2LA 3AGEA 5CTMA 2I72A 5GHXA 2OSUA 5DTTA 4XUZA 3RXXA 1MY8A 2EXBA 5FATA 2Y2GA 2EX9A 4QY5A 3DWKA 5EVLA 1JTGA 5GLBA 2Y2MA 5DTSA 2QZ6A 5JYPA 4KG2A 3AGDA 2G2UA 2HDRA 1TVFA 3IH9A 4MNRA 4D2OA 3ISGA 3O87A 4HEFA 5GLCA 4E3JA 3WS4A 4QU3A 4E3IA 2XF3A 1NYMA 4M3KA 1ES5A 4DE0A 3LY4A 4K0WA 3HREA 1IYPA 2WGWA 3HLBA 1PWCA 5EVIB 4GD6A 1RGYA 1PYYA 3SOIA 3LEZA 3MXRA 3ZVWA 3V5MA 1IKGA 3ZG9B 1GHPA 5HAIA 3HLGA 3CMZA 3C7VA 1PWGA 3S22A 5TGFA 5CHMA 2XD1A 2GDNA 2IWBA 2WK0A 5EVIC 1K55A 4LCMA 4S2IA 3UE3A 3P09A 4LV2A 4N1XA 5FAPA 3S1YA 3BEBA 3MXSA 2PU2A 4WMCA 2EFXA 5D3OA 5KSHA 1RCJA 3MFDA 3VP2A 2UWXA 3B3XA 5AQ9A 4DDYA 3GTCA 4JLFA 4GN2A 1K55C 3M6BA 4DE3A 1WYCA 4JF5A 3FWLA 1TDGA 5CXWA 1TDLA 3CZDA 3ZG5A 3HLDA 1K57A 3HLEA 5FI7A 4P6BA 3SS5A 4DE1A 2ZC6B 1DJAA 3W4OA 1W79A 4K91A 2H0TA 3PAEA 4DF6A 2XH9A 1ERQA 4U0TA 1K57C 5A90A 4C6YA 1SHVA 2XK1A 3HL9A 5DTKA 3G30A 5FSRA 5HAPA 1DY6A 3V3RA 1XA7A 4OLDA 3BLSA 2EX6A 3AGFA 4E3OA 4N92A 2EX8A 3A3DA 1E3UD 1ONHA 2PBYA 2J9OA 2Y2NA 5G18A 1BSGA 2WZXA 3O3VA 5HFOA 1H8ZA 2J9PA 3WS2A 2Y2KA 4KQQA 4P87A 3V39A 3EQVA 4ZJ2A 3HBRA 1NXYA 1MKIA 1PW1A 3CJMA 3CG5A 3IH8A 4JF6A 5M18A 4ZDXA 2R9XA 4ID4A 1BTLA 4OQIA 3LY3A 4R1GA 4GD8A 1YLTA 3OC2A 2WKIA 3EQUA 3P98A 1WYBA 5E2EA 1LHYA 4RA7A 4UA7A 1LLBA 4GOGA 3G32A 3C5AA 4BD1A 1BT5A 1DJCA 2Y2LA 4RX3A 3ZFZA 4BL3A 1HZOA 5CHUA 1ALQA 2DNSA 1G6AA 3BFGA 1KDWA 4Y0OA 2IWCA 2JCHA 3VP0A 1BLCA 4B4XA 4E3NA 4BQMA 1CEGA 5U47A 3GR2A 5TFQA 2DCFA 1FCMA 3JYIA 4E3MA 4YINA 3GQZA 1EROA 3IF6B 1M6KA 1MWUA 1K4FA 2EXAA 4RX2A 2V2FF 3PTEA 4KG5A 1K4EA 3G2YA 3HUNA 4GB7A 5EOOA 3WS0A 4FD8A 3IF6A 3PBSA 4Z9QA 1SDEA 1L0GA 1MWTA 1YM1A 3OPHA 1DJBA 2C5WB 4KZ7A 3ZDJA 4XUXA 4OQGA 3W4PA 5JYOA 2JC7A 3N8LA 3VFFA 1YLWA 5CEDA 5FASA 1S0WA 3IQAA 1QMEA 2ZQ8A 3IF6C 3D4FA 4RYEA 4IEDA 1K25A 1M40A 4QD4A 3GMWA 1IYQA 4S2OA 3IWIA 2Q9MA 3TOIA 1IYSA 3OCNA 4NK3A 4BD0A 2XD5A 5FAQA 1BLHA 4IBXA 5GHZA 2WGWB 3O88A 4IBRA 5KSCA 1GA0A 5DF9A 3IT9A 4DE2A 2WKHA 3FKVA 4BL2A 2FFFB 3DWZA 1W8QA 4U3TA 3UNWA 5EVID 3ZG7B 1I2WA 4P0MA 5CERA 2OLVA 4S2KA 1E4DA 4R3BA 1GA9A 1KVMA 1XGJA 3IWOA 5A92A 3OPRA 1K56A 3MZEA 3E2LA 1SKFA 4OOLA 5HX9A 3UPPA 1NY0A 1Z6FA 2H10A 3BYDA 4OP5A 2HPBA 2VGJA 2Y2PA 3BFFA 3V3SA 4PM5A 1IEMA 5E2HA 1YLJA 4B88A 1XA1A 4FH4A 4PM9A 4WMCD 3WRTA 4KZ5A 5AQAA 1E25A 1L0EA 1VM1A 2Z2LB 4KZAA 4EBPA 2BG1A 1ES2A 3WS5A 1MWSA 2XLNA 2XEPA 4XXRA 1NZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4S A;  4S2M A;  4E3L A;  3A3F A;  4FSF A;  5TR7 A;  4QB8 A;  2ZM2 A;  1XXM A;  5DF7 A;  5DVA A;  4EBL A;  5CEB A;  2WZZ A;  4K0X A;  1I5Q A;  4OOM A;  2RL3 A;  2Z2M B;  3HVF A;  1MPL A;  3SS3 A;  1K6S A;  2ZM0 A;  3SH8 A;  3VFH A;  5HL1 A;  3TSG A;  1MXO A;  5M1A A;  1ZG4 A;  1KE0 A;  4QJG A;  1L2S A;  4MBK A;  1KDS A;  4DDS A;  1BZA A;  2EX2 A;  3BFC A;  3E2K A;  4UHU A;  3G4P A;  2X01 A;  1JWV A;  2VGK A;  2EFU A;  3HLF A;  4LCL A;  4OQ0 A;  4FH2 A;  3N7W A;  3VOZ A;  2ZC3 B;  4KZ9 A;  4RVA A;  3C4P A;  1ES4 A;  4OKP A;  2XGN A;  5A91 A;  1JWP A;  3W8K A;  3NIA A;  4ZJ3 A;  3HUO A;  4MEZ A;  4LV3 A;  2PU4 A;  3DW0 A;  2JE5 A;  3G31 A;  5BOH A;  3FZC A;  3HLC A;  5EPH A;  3Q7V B;  4KZ4 A;  4KZ6 A;  4Y0U A;  5KZH A;  1IYO A;  2G2W A;  3IWQ A;  1ES3 A;  4OP8 A;  1FOF A;  4Y7P A;  3UDF A;  3Q81 A;  3IHB A;  2WUQ A;  2J8Y A;  4GNU A;  3A3I A;  2ZQ9 A;  1H5X A;  4H8R A;  3Q7V A;  4OPQ A;  1ZKJ A;  5FQJ A;  3ZNT A;  5F1F A;  2X02 A;  3UN7 A;  1QMF A;  2HP6 A;  2ZC5 B;  1K54 A;  1LL9 A;  3FKW A;  4WBG A;  5HW3 A;  2H5S A;  4N1H A;  2Y91 A;  4LV1 A;  4GKU A;  4KZ3 A;  3PBO A;  1CI8 A;  1KVL A;  5FQK A;  5FAO A;  4X53 A;  5FQI A;  2Y2Q A;  4EUZ A;  1Y54 A;  3N4I A;  5FQ9 A;  1K54 C;  1N9B A;  4OOY A;  3VMA A;  3M2K A;  5CEC A;  3ZGA B;  3QNB A;  2ZQ7 A;  4CPK A;  2XQZ A;  2ZQD A;  3A3E A;  1FR1 A;  3NC8 A;  5DF8 A;  3RXW A;  3UE1 A;  4A5R A;  4ZTK A;  5F83 A;  5J8X A;  3ZNY A;  4R0Q A;  2WGI A;  1FSY A;  3IXD A;  1CEF A;  1VQQ A;  4EQI A;  5CHJ A;  2E8I A;  3O86 A;  3M6H A;  2J7V A;  3G2Z A;  3OPP A;  4HBT A;  4KZB A;  4GZB A;  1PZP A;  1YLY A;  2XDM A;  2IWD A;  3GRJ A;  3N8R A;  5CGX A;  3BLM A;  3FYZ A;  3PBN A;  1I2S A;  1K6R A;  4N9L A;  1NRF A;  5F1G A;  3VP1 A;  1ONG A;  3UE0 A;  3VSL A;  4P85 A;  5CGW A;  2C6W B;  3G35 A;  3GVB A;  4NET A;  5EE8 A;  4BEN A;  4WZ5 A;  1FQG A;  3C4O A;  2WKE A;  1PW8 A;  2HP9 A;  2XR0 A;  5IHV A;  4PM7 A;  3NI9 A;  3N8S A;  2WAD A;  5E43 A;  4OPY A;  3C7U A;  1BUE A;  1SDN A;  3OCL A;  2R9W A;  3I7J A;  3N6I A;  5F82 A;  4WZ5 C;  3V50 A;  5AQB A;  3IXG A;  3VP3 A;  1PIO A;  1FSW A;  3QHY A;  2B5R A;  1K38 A;  1K56 D;  3BRM A;  3MKE A;  5KMW A;  3GV9 A;  2HP5 A;  5GLD A;  3SH7 A;  1YLP A;  1WE4 A;  1PI4 A;  3LO7 A;  1PZO A;  3Q7Z A;  2BLS A;  3A3J A;  1PI5 A;  2Y2J A;  2ZMA A;  3QNC A;  4HES A;  4DRT A;  3NDG A;  4PMA A;  1PWD A;  3NY4 A;  5FA7 A;  2CC1 A;  1GHI A;  4OPZ A;  1XGI A;  4WEK A;  4MBH A;  1W5D A;  3OZH A;  3G34 A;  4U0X A;  4EWF A;  5CGS A;  4R23 A;  2OLU A;  4OLG A;  1YLZ A;  4PM8 A;  3UO9 A;  2ZLY A;  3MBZ A;  1FR6 A;  4FCF A;  3IXB A;  4R3J A;  4UAA A;  4X69 A;  3UDX A;  1W7F A;  1IKI A;  4MLL A;  1LI0 A;  4QY6 A;  2XFT A;  5AQ7 A;  2DRW A;  3PBQ A;  1BUL A;  1GCE A;  2FFY A;  4GDN A;  4UA6 A;  4PPR A;  5EVI A;  2QPN A;  4YFM A;  2Y2I A;  3SH9 A;  4LEN A;  5GLA A;  2ZJ9 A;  1EWZ A;  1KE3 A;  4JKT A;  3FV7 A;  5L2F A;  3BFD A;  1ZC2 A;  4ZJ1 A;  5GL9 A;  1C3B A;  1U60 A;  3PBR A;  4F94 A;  1MBL A;  2Y4A A;  4S2P A;  2ZM8 A;  1ESU A;  3S4X A;  5GHY A;  3HUM A;  1NZU A;  4OPR A;  5EEC A;  4IVI A;  3WS1 A;  4EBN A;  4IVK A;  3RJU A;  3UY6 A;  1HD8 A;  1MWR A;  4C75 A;  1KGE A;  4WZ4 A;  2ZQC A;  5E2G A;  3MZD A;  4KZ8 A;  4DXC A;  5FQQ A;  5CTN A;  5HAR A;  3ZCZ A;  4X68 A;  2QMI A;  1LL5 A;  3BEC A;  3WWX A;  1FCO A;  1ZG6 A;  1NYY A;  1BLS A;  1EI5 A;  1KGG A;  2Y2H A;  4WYY A;  4CJN A;  2Y2O A;  2WAE A;  4L0L A;  4X6T A;  4WEJ A;  1GHM A;  4KQR A;  2Y59 A;  1HTZ A;  3IHA A;  3VP4 A;  2ZC7 A;  3BM6 A;  1Q2P A;  5CRF A;  1HVB A;  5FQM A;  3ZHH A;  5A93 A;  3MKF A;  1YMX A;  4JBF A;  4E6W A;  2JBF A;  1NJ4 A;  4KQO A;  1O07 A;  4PM6 A;  3ITA A;  3TG9 A;  2P9V B;  5FI6 A;  2WAF A;  2XFS A;  3UPO A;  3NCK A;  3IF5 A;  4OON A;  2OV5 A;  2HDS A;  4WM9 A;  1L0F A;  2WYX A;  1G68 A;  5EOE A;  2P9V A;  1N4O A;  5FI2 A;  4S2N A;  4JXS A;  3SS4 A;  3UPN A;  3VSK A;  4Q8I A;  3HLW A;  3LCE A;  3NBL A;  4MBF A;  2Q9N A;  3Q1F A;  1KGF A;  1L0D A;  2H0Y A;  3ITB A;  1E3U A;  4OH0 A;  3PAG A;  4JXG A;  5E2F A;  1Q2Q A;  4E6X A;  4Y0T A;  4ZAM A;  1TEM A;  2HDQ A;  4S2N C;  1J9M A;  4KEN B;  4UA9 A;  3ZG8 B;  3IXH A;  4JPM A;  4B4Z A;  4DXB A;  2ZD8 A;  4JXW A;  3BFE A;  4HBU A;  1FCN A;  1SCW A;  2V1Z A;  3ZG0 A;  4DKI A;  4KG6 A;  2ZQA A;  4S2J A;  1H8Y A;  2ZC4 B;  2WGV A;  1AXB A;  1YQS A;  2HDU A;  1CI9 A;  4EV4 A;  3Q07 A;  4N9K A;  3Q82 A;  4LV0 A;  3NDE A;  4C3Q A;  3W4Q A;  1JWZ A;  3WRZ A;  3VOY A;  4JXV A;  1JTD A;  2X71 A;  4O7D A;  1OME A;  1XX2 A;  2P74 A;  4ZBE A;  3OPL A;  1KE4 A;  2V20 A;  1RP5 A;  3M2J A;  3GSG A;  2Y55 A;  1XPB A;  4GDB A;  4WEL A;  2A3U A;  5EUA A;  1XKZ A;  4X55 A;  3PBT A;  5I94 A;  1JVJ A;  1S6R A;  5HAQ A;  1ERM A;  1XP4 A;  1YT4 A;  2A49 A;  2RCX A;  4BLM A;  4E3K A;  1BLP A;  1LI9 A;  4X56 A;  4BJP A;  1ESI A;  1IEL A;  1YMS A;  3MZF A;  4JF4 A;  5M19 A;  3UDI A;  1CK3 A;  3DTM A;  4QHC A;  1O7E A;  4R4R A;  3ZVT A;  4OQH A;  1W8Y A;  5FDH A;  4OVD A;  1RGZ A;  4S2L A;  3AGE A;  5CTM A;  2I72 A;  5GHX A;  2OSU A;  5DTT A;  4XUZ A;  3RXX A;  1MY8 A;  2EXB A;  5FAT A;  2Y2G A;  2EX9 A;  4QY5 A;  3DWK A;  5EVL A;  1JTG A;  5GLB A;  2Y2M A;  5DTS A;  2QZ6 A;  5JYP A;  4KG2 A;  3AGD A;  2G2U A;  2HDR A;  1TVF A;  3IH9 A;  4MNR A;  4D2O A;  3ISG A;  3O87 A;  4HEF A;  5GLC A;  4E3J A;  3WS4 A;  4QU3 A;  4E3I A;  2XF3 A;  1NYM A;  4M3K A;  1ES5 A;  4DE0 A;  3LY4 A;  4K0W A;  3HRE A;  1IYP A;  2WGW A;  3HLB A;  1PWC A;  5EVI B;  4GD6 A;  1RGY A;  1PYY A;  3SOI A;  3LEZ A;  3MXR A;  3ZVW A;  3V5M A;  1IKG A;  3ZG9 B;  1GHP A;  5HAI A;  3HLG A;  3CMZ A;  3C7V A;  1PWG A;  3S22 A;  5TGF A;  5CHM A;  2XD1 A;  2GDN A;  2IWB A;  2WK0 A;  5EVI C;  1K55 A;  4LCM A;  4S2I A;  3UE3 A;  3P09 A;  4LV2 A;  4N1X A;  5FAP A;  3S1Y A;  3BEB A;  3MXS A;  2PU2 A;  4WMC A;  2EFX A;  5D3O A;  5KSH A;  1RCJ A;  3MFD A;  3VP2 A;  2UWX A;  3B3X A;  5AQ9 A;  4DDY A;  3GTC A;  4JLF A;  4GN2 A;  1K55 C;  3M6B A;  4DE3 A;  1WYC A;  4JF5 A;  3FWL A;  1TDG A;  5CXW A;  1TDL A;  3CZD A;  3ZG5 A;  3HLD A;  1K57 A;  3HLE A;  5FI7 A;  4P6B A;  3SS5 A;  4DE1 A;  2ZC6 B;  1DJA A;  3W4O A;  1W79 A;  4K91 A;  2H0T A;  3PAE A;  4DF6 A;  2XH9 A;  1ERQ A;  4U0T A;  1K57 C;  5A90 A;  4C6Y A;  1SHV A;  2XK1 A;  3HL9 A;  5DTK A;  3G30 A;  5FSR A;  5HAP A;  1DY6 A;  3V3R A;  1XA7 A;  4OLD A;  3BLS A;  2EX6 A;  3AGF A;  4E3O A;  4N92 A;  2EX8 A;  3A3D A;  1E3U D;  1ONH A;  2PBY A;  2J9O A;  2Y2N A;  5G18 A;  1BSG A;  2WZX A;  3O3V A;  5HFO A;  1H8Z A;  2J9P A;  3WS2 A;  2Y2K A;  4KQQ A;  4P87 A;  3V39 A;  3EQV A;  4ZJ2 A;  3HBR A;  1NXY A;  1MKI A;  1PW1 A;  3CJM A;  3CG5 A;  3IH8 A;  4JF6 A;  5M18 A;  4ZDX A;  2R9X A;  4ID4 A;  1BTL A;  4OQI A;  3LY3 A;  4R1G A;  4GD8 A;  1YLT A;  3OC2 A;  2WKI A;  3EQU A;  3P98 A;  1WYB A;  5E2E A;  1LHY A;  4RA7 A;  4UA7 A;  1LLB A;  4GOG A;  3G32 A;  3C5A A;  4BD1 A;  1BT5 A;  1DJC A;  2Y2L A;  4RX3 A;  3ZFZ A;  4BL3 A;  1HZO A;  5CHU A;  1ALQ A;  2DNS A;  1G6A A;  3BFG A;  1KDW A;  4Y0O A;  2IWC A;  2JCH A;  3VP0 A;  1BLC A;  4B4X A;  4E3N A;  4BQM A;  1CEG A;  5U47 A;  3GR2 A;  5TFQ A;  2DCF A;  1FCM A;  3JYI A;  4E3M A;  4YIN A;  3GQZ A;  1ERO A;  3IF6 B;  1M6K A;  1MWU A;  1K4F A;  2EXA A;  4RX2 A;  2V2F F;  3PTE A;  4KG5 A;  1K4E A;  3G2Y A;  3HUN A;  4GB7 A;  5EOO A;  3WS0 A;  4FD8 A;  3IF6 A;  3PBS A;  4Z9Q A;  1SDE A;  1L0G A;  1MWT A;  1YM1 A;  3OPH A;  1DJB A;  2C5W B;  4KZ7 A;  3ZDJ A;  4XUX A;  4OQG A;  3W4P A;  5JYO A;  2JC7 A;  3N8L A;  3VFF A;  1YLW A;  5CED A;  5FAS A;  1S0W A;  3IQA A;  1QME A;  2ZQ8 A;  3IF6 C;  3D4F A;  4RYE A;  4IED A;  1K25 A;  1M40 A;  4QD4 A;  3GMW A;  1IYQ A;  4S2O A;  3IWI A;  2Q9M A;  3TOI A;  1IYS A;  3OCN A;  4NK3 A;  4BD0 A;  2XD5 A;  5FAQ A;  1BLH A;  4IBX A;  5GHZ A;  2WGW B;  3O88 A;  4IBR A;  5KSC A;  1GA0 A;  5DF9 A;  3IT9 A;  4DE2 A;  2WKH A;  3FKV A;  4BL2 A;  2FFF B;  3DWZ A;  1W8Q A;  4U3T A;  3UNW A;  5EVI D;  3ZG7 B;  1I2W A;  4P0M A;  5CER A;  2OLV A;  4S2K A;  1E4D A;  4R3B A;  1GA9 A;  1KVM A;  1XGJ A;  3IWO A;  5A92 A;  3OPR A;  1K56 A;  3MZE A;  3E2L A;  1SKF A;  4OOL A;  5HX9 A;  3UPP A;  1NY0 A;  1Z6F A;  2H10 A;  3BYD A;  4OP5 A;  2HPB A;  2VGJ A;  2Y2P A;  3BFF A;  3V3S A;  4PM5 A;  1IEM A;  5E2H A;  1YLJ A;  4B88 A;  1XA1 A;  4FH4 A;  4PM9 A;  4WMC D;  3WRT A;  4KZ5 A;  5AQA A;  1E25 A;  1L0E A;  1VM1 A;  2Z2L B;  4KZA A;  4EBP A;  2BG1 A;  1ES2 A;  3WS5 A;  1MWS A;  2XLN A;  2XEP A;  4XXR A;  1NZO A; 
#chains in the Genus database with same CATH topology
 4E3L A;  4FSF A;  1GSV A;  1OJG A;  2I9V A;  4QB8 A;  1MPL A;  3IX8 A;  3F1P A;  1MXO A;  3H9W A;  1KE0 A;  1L2S A;  4LRZ E;  4DDS A;  1BZA A;  3BFC A;  1JWV A;  2VA0 A;  3B33 A;  4OKP A;  2PRF A;  4LV3 A;  2J3W A;  3FZC A;  3Q7V B;  4KZ4 A;  1ES3 A;  5EM0 A;  1FOF A;  3Q81 A;  2J8Y A;  2W27 A;  5FQJ A;  1S67 L;  1LL9 A;  3FKW A;  3IX3 A;  3MFX A;  2H5S A;  4LV1 A;  3PBO A;  1CI8 A;  2KLI A;  1N9N A;  5F5Y A;  4CLC A;  4OOY A;  2V0W A;  5CEC A;  4HOI A;  5DJT A;  3QNB A;  2ZQ7 A;  4CPK A;  5HWV A;  4A5R A;  3KX0 X;  4ZTK A;  3LI8 A;  4H6J A;  4G3V A;  4Q0I A;  5CHJ A;  3KSH A;  1DP9 A;  3M6H A;  3FYZ A;  3UMD A;  3VSL A;  4P85 A;  5CGW A;  3LIB A;  1F98 A;  1G5U A;  4BEN A;  4PHT A;  3C4O A;  2HV1 A;  2WKE A;  4MN5 A;  2B02 A;  1D7E A;  2WAD A;  4OPY A;  3C7U A;  1BUE A;  2R9W A;  1H8M A;  5F82 A;  4XT2 B;  3V50 A;  5HPF A;  3QHY A;  1WE4 A;  3LO7 A;  3Q7Z A;  4R6L A;  2ZMA A;  3QNC A;  3NDG A;  4PMA A;  3NY4 A;  4KUO A;  4OPZ A;  4OLG A;  3U2A A;  1FR6 A;  1LL8 A;  1T1A A;  4X69 A;  5IS1 A;  1YKD A;  5AQ7 A;  4GDN A;  2OAQ 1;  3SH9 A;  3A0S A;  4LEN A;  3T4Q A;  5GLA A;  2PT7 A;  1KE3 A;  3BFD A;  4ZJ1 A;  1C3B A;  1TS6 A;  4F94 A;  1MBL A;  5HDD A;  1ESU A;  4OPR A;  4EBN A;  4IVK A;  4EW7 A;  4C75 A;  4HHD A;  4DXC A;  5CTN A;  4X68 A;  1EI5 A;  4WEJ A;  5I5L A;  1Q2P A;  2O9B A;  4Z1W A;  5F6A A;  3ZHH A;  4JBF A;  4E6W A;  4O0P A;  2P9V B;  2HDS A;  4WM9 A;  4GCZ A;  2WYX A;  3H7W A;  2W1T A;  3T4J A;  5IU1 A;  1T1B A;  3VSK A;  4MBF A;  3Q1F A;  1KGF A;  1L0D A;  4JXG A;  3T50 A;  5DKK A;  2HDQ A;  3KYZ A;  4HY8 A;  3ZG8 B;  3E4P A;  4KG6 A;  1P97 A;  2ZQA A;  2J3T C;  4LRX C;  1YQS A;  3Q07 A;  4LV0 A;  1DRM A;  3WRZ A;  2Y8H A;  2P74 A;  4ZBE A;  3OPL A;  3TRC A;  3GSG A;  5EUA A;  3TW8 A;  2A3U A;  4X55 A;  4Y3I A;  2PR6 A;  1XP4 A;  2A49 A;  2RCX A;  4BLM A;  4E3K A;  1ESI A;  1IEL A;  4Q0J A;  3UDI A;  1CK3 A;  4Y13 A;  4OQH A;  3DTK A;  2JKF A;  1XJ4 A;  2OSU A;  2ZMF A;  2ZL1 B;  2EXB A;  4L9E A;  2O0Y A;  3L9K A;  5DTS A;  2QZ6 A;  2HDR A;  1TVF A;  3R4K A;  5FL3 A;  2QKP A;  2VLG A;  2W3D A;  5GLC A;  4NG2 A;  5DJU A;  4QU3 A;  2XF3 A;  4K0W A;  4AFI A;  4GD6 A;  1OPX A;  3SOI A;  3MXR A;  1ODV A;  5L10 A;  2Q0O A;  3CMZ A;  1PWG A;  5K5B A;  3UB9 A;  3HJK A;  5EVI C;  4LCM A;  1KOU A;  1OTE A;  2P7J A;  5D3O A;  1RCJ A;  2UWX A;  3B3X A;  5AQ9 A;  4JLF A;  2OAP 1;  4DE3 A;  1K55 C;  3M6B A;  3FWL A;  4PAU A;  5TJJ A;  1TDL A;  1K57 A;  4P6B A;  4DE1 A;  2PDR A;  2EWV A;  4MDZ A;  3W4O A;  5G4Y A;  4EEU A;  2XH9 A;  1ERQ A;  4U0T A;  5HPI A;  2PD7 A;  4R38 A;  1WA9 A;  5HAP A;  4E3O A;  1OTI A;  1E3U D;  2Y2N A;  2J9O A;  3KO6 A;  1BSG A;  1LT0 A;  1VET B;  3WS2 A;  2Y2K A;  1S1Y A;  3EQV A;  1PW1 A;  3F1N B;  4ETZ A;  1BTL A;  4Y17 A;  1YLT A;  3ULF A;  2WKI A;  1WYB A;  1YSQ A;  2XSS A;  3U4L P;  2W3F A;  1G6O A;  1HZO A;  1ALQ A;  3BFG A;  1S4S A;  3H82 B;  4B4X A;  4BQM A;  5TFQ A;  3NJA A;  3IF6 B;  3DBA A;  4FUW A;  2V2F F;  4KG5 A;  3HUN A;  4GB7 A;  2OOL A;  3PBS A;  1SDE A;  5FDS A;  3KSG A;  1V9Y A;  2C5W B;  4XUX A;  3W4P A;  1QME A;  3D4F A;  1AWI A;  4RYE A;  4IED A;  1K25 A;  1JNU A;  3IWI A;  2Q9M A;  1IYS A;  3OCN A;  5FAQ A;  1GSX A;  1GA0 A;  3LI9 A;  4DE2 A;  4BL2 A;  3UNW A;  1W8Q A;  3ZG7 B;  1E4D A;  5A92 A;  1CQA A;  1SKF A;  1NY0 A;  1Z09 A;  4WUJ A;  3BFF A;  4HP4 A;  3V3S A;  3SZT A;  4PM9 A;  4EU0 A;  2JKG A;  3WRT A;  5AQA A;  1ES2 A;  1NZO A;  2ZM2 A;  5CEB A;  4K0X A;  3EWK A;  4OOM A;  5HL1 A;  3VFH A;  2ZMV A;  1K6S A;  2ZM0 A;  1ZG4 A;  1ZHH B;  4MBK A;  4UHU A;  2X01 A;  4LCL A;  4OQ0 A;  1T19 A;  1ES4 A;  3LIC A;  3RTY A;  3W8K A;  4ZJ3 A;  4MEZ A;  5BOH A;  2JE5 A;  3HLC A;  2G2W A;  3ZQ5 A;  3LUQ A;  3BY9 A;  5J3W A;  5HZH A;  2WUQ A;  3E0Y A;  2ZQ9 A;  1H5X A;  3Q7V A;  1ZKJ A;  1H0M A;  1QMF A;  2HP6 A;  5HW3 A;  2Y91 A;  3JPU A;  4GKU A;  1Y4O A;  5FQK A;  1VEU B;  4GS9 B;  5FAO A;  4X53 A;  3NHQ A;  1VB6 A;  1N9B A;  3EEA A;  3NEC A;  2XQZ A;  3UME A;  5DF8 A;  1FSY A;  1EW0 A;  4CLC C;  3CAX A;  2BTF P;  1CEF A;  4EQI A;  2E8I A;  3O86 A;  3OPP A;  4HBT A;  1PZP A;  3EGD C;  1LSV A;  3ZYT A;  1I2S A;  1NRF A;  3VP1 A;  4HQA A;  3CI6 A;  2C6W B;  3GVB A;  5EE8 A;  1PW8 A;  2XR0 A;  3NI9 A;  4MCW A;  3LEQ A;  1T18 A;  1OT9 A;  3I7J A;  3N6I A;  5AQB A;  3IBJ A;  3IXG A;  3BY8 A;  1K38 A;  3IBR A;  4XT2 A;  2BLS A;  3MJQ A;  3A3J A;  4X1L A;  1PI5 A;  4IUH A;  2G7U A;  2CC1 A;  4WEK A;  4MBH A;  1W5D A;  1P0Z A;  3UO9 A;  2ZLY A;  3MBZ A;  2WKP A;  4R3J A;  1W7F A;  1IKI A;  4MLL A;  4QY6 A;  1GCE A;  1S1Z A;  1V9Z A;  4I3I A;  2VGL M;  3LR5 A;  5L2F A;  1ZC2 A;  2B95 A;  4WL9 A;  1G28 A;  4ME4 A;  3R7W A;  3HUM A;  3WS1 A;  2QJ7 A;  2VV7 A;  1HD8 A;  4WZ4 A;  3T4O A;  4BBU A;  3LIF A;  4KZ8 A;  5FQQ A;  3LYX A;  5HAR A;  3ZCZ A;  1CF0 A;  4GLQ A;  1LL5 A;  1ZG6 A;  1NYY A;  4CJN A;  2WAE A;  4UEY A;  4KQR A;  1HTZ A;  3VP4 A;  2VV6 A;  2XRN A;  2VGL S;  5HDS A;  1J3W A;  1O07 A;  3TG9 A;  5FI6 A;  2WAF A;  3O5Y A;  1YPR A;  2OV5 A;  4PKY A;  2P9V A;  1N4O A;  2JKR I;  4Q8I A;  4I3J A;  3NBL A;  2EWW A;  1F5M A;  2H0Y A;  1E3U A;  4OH0 A;  3PAG A;  1Q2Q A;  5AVF A;  5EVE A;  4DXB A;  4JXW A;  1FCN A;  3ICY A;  4DKI A;  2L0W A;  1AXB A;  3QP2 A;  4EV4 A;  3IX4 A;  3NDE A;  3VOY A;  1PFL A;  4JXV A;  2X71 A;  1OME A;  3M2J A;  1RP5 A;  3OBF A;  5HD5 A;  4WEL A;  1XKZ A;  2JKR M;  5C5K A;  1S6R A;  3FG8 A;  1LI9 A;  2Y79 A;  1YMS A;  4JF4 A;  5M19 A;  2JKT I;  3UB7 A;  4QHC A;  3ZVT A;  5GHX A;  4S2L A;  3T1R A;  4XUZ A;  5FAT A;  4EUV A;  2ZL1 A;  1JTG A;  4NEE D;  3AGD A;  2G2U A;  3IH9 A;  3O87 A;  4HEF A;  4K08 A;  1TS8 A;  4F3L A;  1ES5 A;  4Y2F A;  3MR0 A;  3HRE A;  3FPV A;  2WGW A;  1NLZ A;  3LGO A;  3ZG9 B;  4DJ3 A;  3HLG A;  2OWJ A;  3A0V A;  3R7W B;  4BBV A;  5TGF A;  3T1Q B;  2XD1 A;  2GDN A;  2IWB A;  2PYR A;  4S2I A;  3UE3 A;  3B42 A;  3S7O A;  4N1X A;  4NXB A;  2PU2 A;  3MFD A;  3VP2 A;  1D06 A;  3C2W A;  1WYC A;  2LB5 A;  5HD3 A;  1TDG A;  5CXW A;  5HWT A;  3HLD A;  3HLE A;  3SS5 A;  1OT6 A;  2PYP A;  4K91 A;  3QP4 A;  3EEH A;  3PAE A;  5FEG A;  4DF6 A;  5L8M A;  3T4T A;  4MN6 A;  3VV4 A;  1K57 C;  5A90 A;  4O8G A;  4C6Y A;  2XK1 A;  3HL9 A;  3G30 A;  1DY6 A;  3V3R A;  2EX6 A;  3EGX C;  3A3D A;  1ONH A;  2PBY A;  5G18 A;  1H8Z A;  4Y15 A;  2Z6D A;  4KQQ A;  1S66 L;  3CJM A;  4G3K A;  3CG5 A;  3PHY A;  5LBR A;  1VET A;  5HWW A;  3CLO A;  4GD8 A;  3OC2 A;  3P98 A;  3F1N A;  5E2E A;  4UA7 A;  4GOG A;  3G32 A;  4BD1 A;  1DJC A;  2Y2L A;  4RX3 A;  3ZFZ A;  4BL3 A;  4BMW A;  1G6A A;  2IWC A;  2HJE A;  1H3Q A;  5U47 A;  3GR2 A;  4L9F A;  2ZBB A;  2V1B A;  4NKP A;  4G3W A;  4E3M A;  4YIN A;  3H82 A;  2O9C A;  1MWU A;  1K4E A;  3G2Y A;  4DMZ A;  3IF6 A;  2QJ5 A;  2PHY A;  1MWT A;  3OPH A;  1DJB A;  3ZDJ A;  4OQG A;  3KYQ A;  2K7S A;  5JYO A;  2EA9 A;  2FZ0 A;  2V8C A;  1S0W A;  3IQA A;  3LIE A;  4RQ9 A;  1UWN X;  3T1S A;  4LLO B;  2E8J A;  1M40 A;  4QD4 A;  4BD0 A;  2XD5 A;  4F3L B;  1BLH A;  4IBX A;  2WGW B;  3O88 A;  3IT9 A;  2D02 A;  3A0R A;  2PR5 A;  3DWZ A;  1HLU P;  2OLV A;  3BWL A;  4S2K A;  1GA9 A;  1KVM A;  1XGJ A;  3IWO A;  3MZE A;  4OOL A;  3UPP A;  2O9A A;  2VGJ A;  4PKY G;  4B88 A;  4WMC D;  1F9I A;  4KZ5 A;  1L0E A;  1VM1 A;  5HL6 A;  2XLN A;  1P9R A;  4S2M A;  3A3F A;  3TJZ C;  1N9L A;  1MZU A;  5TR7 A;  1XXM A;  5DF7 A;  4EBL A;  2WZZ A;  2RL3 A;  3HVF A;  3SS3 A;  3PYP A;  3TSG A;  5M1A A;  1KDS A;  3E2K A;  3G4P A;  3CPT B;  4IHQ A;  2EFU A;  2K2N A;  3N7W A;  3VOZ A;  4KZ9 A;  3MQ0 A;  3C4P A;  3T12 B;  5A91 A;  3NIA A;  3HUO A;  3DW0 A;  5EPH A;  5KZH A;  3UDF A;  4OP8 A;  5EV0 A;  4MMN A;  3IHB A;  1VHM A;  3A3I A;  4H8R A;  4IJG A;  4YOF A;  2GNX A;  3UN7 A;  2ZC5 B;  1K54 A;  1LSX A;  3RH8 B;  4FOF A;  1KVL A;  3QP1 A;  3N4I A;  3FC7 A;  3VMA A;  3M2K A;  1VEU A;  4GS9 A;  3ZGA B;  4X1M A;  3A3E A;  1FR1 A;  3UE1 A;  5F83 A;  5J8X A;  2W3E A;  3ZNY A;  3IXD A;  4Y5F A;  1VQQ A;  2VKS A;  3G2Z A;  3UB8 A;  4KZB A;  1YLY A;  2IWD A;  2XDM A;  3GRJ A;  2V9A A;  2GX5 A;  3BLM A;  3E4O A;  1K6R A;  1ONG A;  2BAS A;  4HH3 A;  4WZ5 A;  1FQG A;  1TS0 A;  2LB9 A;  3N8S A;  5E43 A;  1SDN A;  3OCL A;  5KIZ A;  3VP3 A;  1FSW A;  2B5R A;  5KMW A;  3GV9 A;  2HP5 A;  3SH7 A;  1YLP A;  3DAV A;  1PI4 A;  2YKH A;  1PZO A;  4MN7 A;  4HES A;  4GW9 A;  5FA7 A;  4WF0 A;  3OZH A;  4EXO A;  3UDX A;  3OLO A;  1LI0 A;  2XFT A;  2PBD P;  4UA6 A;  4BWI A;  4PPR A;  5EVI A;  4YFM A;  4YNR A;  2ZJ9 A;  1EWZ A;  2HF6 A;  3FV7 A;  1U60 A;  2Y4A A;  3D3O A;  3V67 A;  3S4X A;  5EEC A;  3MS6 A;  3UY6 A;  2V1A A;  1MWR A;  1KGE A;  5E2G A;  4GJ4 A;  4I5S A;  1FCO A;  3S7N A;  1BLS A;  2Y2H A;  4WYY A;  4L0L A;  5F69 A;  3IHA A;  2ZC7 A;  1HVB A;  4BBT A;  1YMX A;  1NJ4 A;  4PM6 A;  5G4Z A;  3PR6 A;  3IF5 A;  4M4X A;  1L0F A;  5EOE A;  1F2K A;  3UB6 A;  4S2N A;  4HNB A;  2M7U A;  3NOP C;  3UPN A;  3LCE A;  2Q9N A;  2A24 B;  5E2F A;  4E6X A;  1L3L A;  4ZAM A;  1TEM A;  3FPW A;  4ETX A;  1J9M A;  3IXH A;  4B4Z A;  5J7E A;  1SCW A;  2QHK A;  4HJ6 A;  2ZC4 B;  2HDU A;  2FH5 A;  3Q82 A;  2XA7 M;  1JWZ A;  4O7D A;  1KE4 A;  1XFQ A;  1XPB A;  4GDB A;  2JHE A;  1ERM A;  2M7V A;  1YT4 A;  2H28 A;  4X56 A;  4BJP A;  3MZF A;  4JGP A;  1T1C A;  3DTM A;  1O7E A;  5L09 A;  5FDH A;  4OVD A;  1RGZ A;  2XA7 S;  4LRY C;  1NRJ A;  5DTT A;  5EM1 A;  3RXX A;  3CWF A;  4GHI B;  1D1J A;  2Y2G A;  3DWK A;  4HJ3 A;  5EVL A;  5GLB A;  2Y2M A;  4KG2 A;  4P6Z M;  3NOU C;  4MNR A;  3DTE A;  3ISG A;  4E3J A;  2W1R A;  3WS4 A;  4E3I A;  3BJN A;  3BQ8 A;  4M3K A;  4DE0 A;  3LY4 A;  5EVI B;  1IYP A;  3C38 A;  3KSI A;  1RGY A;  1PYY A;  3BQA A;  3ZVW A;  1PNE A;  3V5M A;  3EOI A;  5L07 A;  4X25 A;  2WKR A;  3C7V A;  5CHM A;  2VEA A;  4HP9 A;  3CUE A;  4P6Z S;  2WK0 A;  1TD5 A;  5DFX A;  4I38 A;  4LV2 A;  3S1Y A;  3BEB A;  4WMC A;  5KSH A;  4NXE A;  3GTC A;  4JF5 A;  3CZD A;  4HJ4 A;  5FI7 A;  2ZC6 B;  3L7H A;  1DJA A;  4HIA A;  1W79 A;  2H0T A;  2KOI A;  3QP8 A;  1XJ6 A;  3TE8 A;  3PXP A;  4LPZ A;  2DMW A;  1XA7 A;  4QPR A;  1YAX A;  5HSQ A;  2HGV A;  2J3T D;  2WZX A;  5HFO A;  2J9P A;  4LGW A;  4P87 A;  3V39 A;  1DP8 A;  4ZJ2 A;  1NXY A;  3LR3 A;  5IT5 A;  5M18 A;  2R9X A;  4ID4 A;  2OWH A;  1STZ A;  4ESP A;  3LY3 A;  4R1G A;  2V0U A;  4R70 A;  1OJ5 A;  1LLB A;  1BT5 A;  3MMH A;  2DNS A;  4Y0O A;  1KDW A;  3K2N A;  4YWZ A;  1BLC A;  1CEG A;  2DCF A;  1FCM A;  1M6K A;  1K4F A;  5EOO A;  3NUL A;  4FD8 A;  3JVV A;  4QWO A;  4Z9Q A;  3IS2 B;  1L0G A;  5TBM B;  4KZ7 A;  4D60 A;  3VE4 A;  2JC7 A;  3VFF A;  1YLW A;  2XRO A;  4O01 A;  1MKM A;  1SZV A;  3IF6 C;  3MF0 A;  4NXF A;  1S4R A;  3QP5 A;  2Z6C A;  4EER A;  3GMW A;  4LFU A;  3TOI A;  1K0K A;  4WLA A;  3T4L A;  5DF9 A;  2VZW A;  2WKH A;  2FFF B;  5CX7 A;  5EVI D;  1I2W A;  4P0M A;  1SKO B;  4R3B A;  1W63 M;  3OPR A;  1Y28 A;  3E2L A;  5HX9 A;  3HJI A;  3BYD A;  1PRQ A;  2H10 A;  2JKT M;  1UGU A;  4ARZ A;  4PM5 A;  1YLJ A;  1DP6 A;  3CHW P;  2VK3 A;  3F1O B;  1E25 A;  2Z2L B;  4KZA A;  4EBP A;  2BG1 A;  2V8F A;  3UE6 A;  1MWS A;  2XEP A;  4XXR A;  4CLC E;  4R4S A;  3F1P B;  1TF1 A;  3E98 A;  5DVA A;  4WN5 A;  1I5Q A;  2Z2M B;  4I39 A;  5AJG A;  3SH8 A;  4QJG A;  2EX2 A;  3HLF A;  2VGK A;  1FIK A;  4Q0H A;  4FH2 A;  2YKF A;  2GZA A;  2ZC3 B;  4RVA A;  3DTI A;  3CPT A;  4KQD A;  2XGN A;  1JWP A;  3K3C A;  3KSF A;  2PU4 A;  3G31 A;  4EET B;  1OTA A;  1P9W A;  4KZ6 A;  4Y0U A;  1IYO A;  3IWQ A;  4Y7P A;  3QP6 A;  4GNU A;  1NLY A;  4OPQ A;  3ZNT A;  5F1F A;  2X02 A;  4WBG A;  2QWS A;  4HH2 A;  4N1H A;  4CLC B;  4KZ3 A;  2ACG A;  2B18 A;  2L4R A;  2M1C A;  3MQO A;  5FQI A;  2Y2Q A;  3GDI A;  4EUZ A;  1Y54 A;  5FQ9 A;  1K54 C;  3GEC A;  3G6O A;  4H6J B;  2PD8 A;  2ZQD A;  3NC8 A;  3RXW A;  3OOV A;  4R0Q A;  3VOL A;  2WGI A;  4IUK A;  2J7V A;  2CMN A;  2NUT C;  4GZB A;  3N8R A;  5CGX A;  3PBN A;  4N9L A;  5F1G A;  1IOU A;  3UE0 A;  2W0N A;  3G35 A;  1XFN A;  4NET A;  2W3G A;  5FEF A;  2HP9 A;  5IHV A;  4PM7 A;  3D9Y A;  3MQQ A;  1OTB A;  4WZ5 C;  1W63 Q;  4DJ2 A;  1PIO A;  2VJW A;  1K56 D;  3BRM A;  3MKE A;  5GLD A;  3MXQ A;  3VE3 A;  2P08 A;  5DFY A;  4ARZ B;  2Y2J A;  4DRT A;  1PWD A;  5EFW A;  1GHI A;  4B9O A;  1XGI A;  2P04 A;  3G34 A;  4U0X A;  4EWF A;  5CGS A;  4R23 A;  2AVX A;  2OLU A;  1YLZ A;  3BW6 A;  4PM8 A;  5J4E A;  4FCF A;  3IXB A;  4UAA A;  5A8B A;  3S7Q A;  1IFQ A;  4II7 A;  2DRW A;  3PBQ A;  1BUL A;  2FFY A;  4JGO A;  2QPN A;  2Y2I A;  2ZOI A;  4JKT A;  5GL9 A;  1UWP X;  3CIT A;  3PBR A;  4S2P A;  3RFB A;  2ZM8 A;  5GHY A;  1NZU A;  4IVI A;  3RJU A;  3LIA A;  2O99 A;  4UQI M;  2ZQC A;  3MZD A;  3UB5 P;  2QMI A;  3BEC A;  3WWX A;  5AVE A;  1KGG A;  2Y2O A;  4X6T A;  1GHM A;  2Y59 A;  3BM6 A;  3D72 A;  5CRF A;  2QYB A;  5FQM A;  3E4Q A;  5A93 A;  1OTD A;  2A2L A;  3MKF A;  4CQH A;  2JBF A;  1LSW A;  4KQO A;  1A0K A;  3H7W B;  3ITA A;  2W1T B;  5F68 A;  2XFS A;  3UPO A;  4CLC D;  3NCK A;  4OON A;  3T4S A;  1GSW A;  4UQI S;  1G68 A;  3HCY A;  2JN7 A;  5FI2 A;  4JXS A;  3SS4 A;  3HLW A;  3LR4 A;  2J80 A;  2IA2 A;  3ITB A;  4Y0T A;  2KX6 A;  4S2N C;  4KEN B;  4UA9 A;  2A24 A;  4JPM A;  4I3A A;  2ZD8 A;  3BFE A;  4HBU A;  2V1Z A;  3ZG0 A;  4S2J A;  1H8Y A;  2WGV A;  1CI9 A;  2PAV P;  3W2Z A;  4N9K A;  3JVU A;  4C3Q A;  3W4Q A;  1JTD A;  1XX2 A;  2R78 A;  2V20 A;  2Y55 A;  5I94 A;  3PBT A;  3SW1 A;  1JVJ A;  5HAQ A;  1BLP A;  4R4R A;  1W8Y A;  2D01 A;  3AGE A;  5CTM A;  2I72 A;  5HDC A;  4EQ1 A;  1MY8 A;  1X0O A;  2W3H A;  2EX9 A;  4QY5 A;  5JYP A;  2NUP C;  4GHI A;  3K3D A;  3S7P A;  4D2O A;  4ZRR A;  1NYM A;  1XJ2 A;  3HLB A;  1PWC A;  1CJF A;  3LEZ A;  2VX8 A;  4NXG A;  3LID A;  1IKG A;  2K31 A;  1GHP A;  5HAI A;  1N9O A;  3S22 A;  1K55 A;  3P09 A;  5FAP A;  3MXS A;  2EFX A;  3T1X A;  4DDY A;  3CUE C;  4GN2 A;  3ZG5 A;  2MJ6 A;  4JGQ A;  3KYE A;  1SHV A;  5DTK A;  5FSR A;  4OLD A;  3BLS A;  3AGF A;  4N92 A;  2EX8 A;  2GJ3 A;  4FTX A;  4EES A;  3O3V A;  4B93 A;  1ZTU A;  3HBR A;  5MC7 A;  1MKI A;  4JF6 A;  3IH8 A;  4ZDX A;  4OQI A;  4DN0 A;  3EQU A;  1LHY A;  1BYW A;  4RA7 A;  3C5A A;  1TS7 A;  5CHU A;  4EEP A;  2VV8 A;  2JCH A;  3LFV A;  3VP0 A;  4E3N A;  1XJ3 A;  1ACF A;  1MC0 A;  1NWZ A;  4HI4 A;  3JYI A;  3T4K A;  3P01 A;  3GQZ A;  4KUK A;  2UV0 E;  1ERO A;  3C8C A;  2WKQ A;  2EXA A;  4RX2 A;  3PTE A;  3LR0 A;  3WS0 A;  2INW A;  4JGR A;  5DKL A;  1YM1 A;  3N8L A;  3IS2 A;  5CED A;  5FAS A;  5TBM A;  2ZQ8 A;  3P7N A;  1IYQ A;  4S2O A;  2KDK A;  1YSP A;  4NK3 A;  4E04 A;  3C30 A;  5GHZ A;  5KSC A;  3NOT C;  4IBR A;  3FKV A;  4U3T A;  4R3A A;  5CER A;  1K56 A;  2HZ5 A;  1Z6F A;  1SKO A;  4OP5 A;  2HPB A;  1FIL A;  2Y2P A;  1IEM A;  5E2H A;  2HJ9 C;  3MSH A;  1XA1 A;  4FH4 A;  3B47 A;  2L1M A;  3WS5 A;  4L9G A;  3F1O A;  2ZOH A; 
#chains in the Genus database with same CATH homology
 4R4S A;  4S2M A;  4E3L A;  3A3F A;  4FSF A;  5TR7 A;  4QB8 A;  2ZM2 A;  1XXM A;  5DF7 A;  5DVA A;  4EBL A;  5CEB A;  2WZZ A;  4K0X A;  1I5Q A;  4OOM A;  2RL3 A;  2Z2M B;  3HVF A;  1MPL A;  3SS3 A;  1K6S A;  2ZM0 A;  3SH8 A;  3VFH A;  5HL1 A;  3TSG A;  1MXO A;  5M1A A;  1ZG4 A;  1KE0 A;  4QJG A;  1L2S A;  4MBK A;  1KDS A;  4DDS A;  1BZA A;  2EX2 A;  3BFC A;  3E2K A;  4UHU A;  3G4P A;  2X01 A;  1JWV A;  2VGK A;  2EFU A;  3HLF A;  4LCL A;  4OQ0 A;  4FH2 A;  3N7W A;  3VOZ A;  2ZC3 B;  4KZ9 A;  4RVA A;  3C4P A;  1ES4 A;  4OKP A;  2XGN A;  5A91 A;  1JWP A;  3W8K A;  3NIA A;  4ZJ3 A;  3HUO A;  4MEZ A;  4LV3 A;  2PU4 A;  3DW0 A;  2JE5 A;  3G31 A;  5BOH A;  3FZC A;  3HLC A;  5EPH A;  3Q7V B;  4KZ4 A;  4KZ6 A;  4Y0U A;  5KZH A;  1IYO A;  2G2W A;  3IWQ A;  1ES3 A;  4OP8 A;  1FOF A;  4Y7P A;  3UDF A;  3Q81 A;  3IHB A;  2WUQ A;  2J8Y A;  4GNU A;  3A3I A;  2ZQ9 A;  1H5X A;  4H8R A;  3Q7V A;  4OPQ A;  1ZKJ A;  5FQJ A;  3ZNT A;  5F1F A;  2X02 A;  3UN7 A;  1QMF A;  2HP6 A;  2ZC5 B;  1K54 A;  1LL9 A;  3FKW A;  4WBG A;  5HW3 A;  2H5S A;  4N1H A;  2Y91 A;  4LV1 A;  4GKU A;  4KZ3 A;  3PBO A;  1CI8 A;  1KVL A;  5FQK A;  5FAO A;  4X53 A;  5FQI A;  2Y2Q A;  4EUZ A;  1Y54 A;  3N4I A;  5FQ9 A;  1K54 C;  1N9B A;  4OOY A;  3VMA A;  3M2K A;  5CEC A;  3ZGA B;  3QNB A;  2ZQ7 A;  4CPK A;  2XQZ A;  2ZQD A;  3A3E A;  1FR1 A;  3NC8 A;  5DF8 A;  3RXW A;  3UE1 A;  4A5R A;  4ZTK A;  5F83 A;  5J8X A;  3ZNY A;  4R0Q A;  2WGI A;  1FSY A;  3IXD A;  1CEF A;  1VQQ A;  4EQI A;  5CHJ A;  2E8I A;  3O86 A;  3M6H A;  2J7V A;  3G2Z A;  3OPP A;  4HBT A;  4KZB A;  4GZB A;  1PZP A;  1YLY A;  2XDM A;  2IWD A;  3GRJ A;  3N8R A;  5CGX A;  3BLM A;  3FYZ A;  3PBN A;  1I2S A;  1K6R A;  4N9L A;  1NRF A;  5F1G A;  3VP1 A;  1ONG A;  3UE0 A;  3VSL A;  4P85 A;  5CGW A;  2C6W B;  3G35 A;  3GVB A;  4NET A;  5EE8 A;  4BEN A;  4WZ5 A;  1FQG A;  3C4O A;  2WKE A;  1PW8 A;  2HP9 A;  2XR0 A;  5IHV A;  4PM7 A;  3NI9 A;  3N8S A;  2WAD A;  5E43 A;  4OPY A;  3C7U A;  1BUE A;  1SDN A;  3OCL A;  2R9W A;  3I7J A;  3N6I A;  5F82 A;  4WZ5 C;  3V50 A;  5AQB A;  3IXG A;  3VP3 A;  1PIO A;  1FSW A;  3QHY A;  2B5R A;  1K38 A;  1K56 D;  3BRM A;  3MKE A;  5KMW A;  3GV9 A;  2HP5 A;  5GLD A;  3SH7 A;  1YLP A;  1WE4 A;  1PI4 A;  3LO7 A;  1PZO A;  3Q7Z A;  2BLS A;  3A3J A;  1PI5 A;  2Y2J A;  2ZMA A;  3QNC A;  4HES A;  4DRT A;  3NDG A;  4PMA A;  1PWD A;  3NY4 A;  5FA7 A;  2CC1 A;  1GHI A;  4OPZ A;  1XGI A;  4WEK A;  4MBH A;  1W5D A;  3OZH A;  3G34 A;  4U0X A;  4EWF A;  5CGS A;  4R23 A;  2OLU A;  4OLG A;  1YLZ A;  4PM8 A;  3UO9 A;  2ZLY A;  3MBZ A;  1FR6 A;  4FCF A;  3IXB A;  4R3J A;  4UAA A;  4X69 A;  3UDX A;  1W7F A;  1IKI A;  4MLL A;  1LI0 A;  4QY6 A;  2XFT A;  5AQ7 A;  2DRW A;  3PBQ A;  1BUL A;  1GCE A;  2FFY A;  4GDN A;  4UA6 A;  4PPR A;  5EVI A;  2QPN A;  4YFM A;  2Y2I A;  3SH9 A;  4LEN A;  5GLA A;  2ZJ9 A;  1EWZ A;  1KE3 A;  4JKT A;  3FV7 A;  5L2F A;  3BFD A;  1ZC2 A;  4ZJ1 A;  5GL9 A;  1C3B A;  1U60 A;  3PBR A;  4F94 A;  1MBL A;  2Y4A A;  4S2P A;  2ZM8 A;  1ESU A;  3S4X A;  5GHY A;  3HUM A;  1NZU A;  4OPR A;  5EEC A;  4IVI A;  3WS1 A;  4EBN A;  4IVK A;  3RJU A;  3UY6 A;  1HD8 A;  1MWR A;  4C75 A;  1KGE A;  4WZ4 A;  2ZQC A;  5E2G A;  3MZD A;  4KZ8 A;  4DXC A;  5FQQ A;  5CTN A;  5HAR A;  3ZCZ A;  4X68 A;  2QMI A;  1LL5 A;  3BEC A;  3WWX A;  1FCO A;  1ZG6 A;  1NYY A;  1BLS A;  1EI5 A;  1KGG A;  2Y2H A;  4WYY A;  4CJN A;  2Y2O A;  2WAE A;  4L0L A;  4X6T A;  4WEJ A;  1GHM A;  4KQR A;  2Y59 A;  1HTZ A;  3IHA A;  3VP4 A;  2ZC7 A;  3BM6 A;  1Q2P A;  5CRF A;  1HVB A;  5FQM A;  3ZHH A;  5A93 A;  3MKF A;  1YMX A;  4JBF A;  4E6W A;  2JBF A;  1NJ4 A;  4KQO A;  1O07 A;  4PM6 A;  3ITA A;  3TG9 A;  2P9V B;  5FI6 A;  2WAF A;  2XFS A;  3UPO A;  3NCK A;  3IF5 A;  4OON A;  2OV5 A;  2HDS A;  4WM9 A;  1L0F A;  2WYX A;  1G68 A;  5EOE A;  2P9V A;  1N4O A;  5FI2 A;  4S2N A;  4JXS A;  3SS4 A;  3UPN A;  3VSK A;  4Q8I A;  3HLW A;  3LCE A;  3NBL A;  4MBF A;  2Q9N A;  3Q1F A;  1KGF A;  1L0D A;  2H0Y A;  3ITB A;  1E3U A;  4OH0 A;  3PAG A;  4JXG A;  5E2F A;  1Q2Q A;  4E6X A;  4Y0T A;  4ZAM A;  1TEM A;  2HDQ A;  4S2N C;  1J9M A;  4KEN B;  4UA9 A;  3ZG8 B;  3IXH A;  4JPM A;  4B4Z A;  4DXB A;  2ZD8 A;  4JXW A;  3BFE A;  4HBU A;  1FCN A;  1SCW A;  2V1Z A;  3ZG0 A;  4DKI A;  4KG6 A;  2ZQA A;  4S2J A;  1H8Y A;  2ZC4 B;  2WGV A;  1AXB A;  1YQS A;  2HDU A;  1CI9 A;  4EV4 A;  3Q07 A;  4N9K A;  3Q82 A;  4LV0 A;  3NDE A;  4C3Q A;  3W4Q A;  1JWZ A;  3WRZ A;  3VOY A;  4JXV A;  1JTD A;  2X71 A;  4O7D A;  1OME A;  1XX2 A;  2P74 A;  4ZBE A;  3OPL A;  1KE4 A;  2V20 A;  1RP5 A;  3M2J A;  3GSG A;  2Y55 A;  1XPB A;  4GDB A;  4WEL A;  2A3U A;  5EUA A;  1XKZ A;  4X55 A;  3PBT A;  5I94 A;  1JVJ A;  1S6R A;  5HAQ A;  1ERM A;  1XP4 A;  1YT4 A;  2A49 A;  2RCX A;  4BLM A;  4E3K A;  1BLP A;  1LI9 A;  4X56 A;  4BJP A;  1ESI A;  1IEL A;  1YMS A;  3MZF A;  4JF4 A;  5M19 A;  3UDI A;  1CK3 A;  3DTM A;  4QHC A;  1O7E A;  4R4R A;  3ZVT A;  4OQH A;  1W8Y A;  5FDH A;  4OVD A;  1RGZ A;  4S2L A;  3AGE A;  5CTM A;  2I72 A;  5GHX A;  2OSU A;  5DTT A;  4XUZ A;  3RXX A;  1MY8 A;  2EXB A;  5FAT A;  2Y2G A;  2EX9 A;  4QY5 A;  3DWK A;  5EVL A;  1JTG A;  5GLB A;  2Y2M A;  5DTS A;  2QZ6 A;  5JYP A;  4KG2 A;  3AGD A;  2G2U A;  2HDR A;  1TVF A;  3IH9 A;  4MNR A;  4D2O A;  3ISG A;  3O87 A;  4HEF A;  5GLC A;  4E3J A;  3WS4 A;  4QU3 A;  4E3I A;  2XF3 A;  1NYM A;  4M3K A;  1ES5 A;  4DE0 A;  3LY4 A;  4K0W A;  3HRE A;  1IYP A;  2WGW A;  3HLB A;  1PWC A;  5EVI B;  4GD6 A;  1RGY A;  1PYY A;  3SOI A;  3LEZ A;  3MXR A;  3ZVW A;  3V5M A;  1IKG A;  3ZG9 B;  1GHP A;  5HAI A;  3HLG A;  3CMZ A;  3C7V A;  1PWG A;  3S22 A;  5TGF A;  5CHM A;  2XD1 A;  2GDN A;  2IWB A;  2WK0 A;  5EVI C;  1K55 A;  4LCM A;  4S2I A;  3UE3 A;  3P09 A;  4LV2 A;  4N1X A;  5FAP A;  3S1Y A;  3BEB A;  3MXS A;  2PU2 A;  4WMC A;  2EFX A;  5D3O A;  5KSH A;  1RCJ A;  3MFD A;  3VP2 A;  2UWX A;  3B3X A;  5AQ9 A;  4DDY A;  3GTC A;  4JLF A;  4GN2 A;  1K55 C;  3M6B A;  4DE3 A;  1WYC A;  4JF5 A;  3FWL A;  1TDG A;  5CXW A;  1TDL A;  3CZD A;  3ZG5 A;  3HLD A;  1K57 A;  3HLE A;  5FI7 A;  4P6B A;  3SS5 A;  4DE1 A;  2ZC6 B;  1DJA A;  3W4O A;  1W79 A;  4K91 A;  2H0T A;  3PAE A;  4DF6 A;  2XH9 A;  1ERQ A;  4U0T A;  1K57 C;  5A90 A;  4C6Y A;  1SHV A;  2XK1 A;  3HL9 A;  5DTK A;  3G30 A;  5FSR A;  5HAP A;  1DY6 A;  3V3R A;  1XA7 A;  4OLD A;  3BLS A;  2EX6 A;  3AGF A;  4E3O A;  4N92 A;  2EX8 A;  3A3D A;  1E3U D;  1ONH A;  2PBY A;  2J9O A;  2Y2N A;  5G18 A;  1BSG A;  2WZX A;  3O3V A;  5HFO A;  1H8Z A;  2J9P A;  3WS2 A;  2Y2K A;  4KQQ A;  4P87 A;  3V39 A;  3EQV A;  4ZJ2 A;  3HBR A;  1NXY A;  1MKI A;  1PW1 A;  3CJM A;  3CG5 A;  3IH8 A;  4JF6 A;  5M18 A;  4ZDX A;  2R9X A;  4ID4 A;  1BTL A;  4OQI A;  3LY3 A;  4R1G A;  4GD8 A;  1YLT A;  3OC2 A;  2WKI A;  3EQU A;  3P98 A;  1WYB A;  5E2E A;  1LHY A;  4RA7 A;  4UA7 A;  1LLB A;  4GOG A;  3G32 A;  3C5A A;  4BD1 A;  1BT5 A;  1DJC A;  2Y2L A;  4RX3 A;  3ZFZ A;  4BL3 A;  1HZO A;  5CHU A;  1ALQ A;  2DNS A;  1G6A A;  3BFG A;  1KDW A;  4Y0O A;  2IWC A;  2JCH A;  3VP0 A;  1BLC A;  4B4X A;  4E3N A;  4BQM A;  1CEG A;  5U47 A;  3GR2 A;  5TFQ A;  2DCF A;  1FCM A;  3JYI A;  4E3M A;  4YIN A;  3GQZ A;  1ERO A;  3IF6 B;  1M6K A;  1MWU A;  1K4F A;  2EXA A;  4RX2 A;  2V2F F;  3PTE A;  4KG5 A;  1K4E A;  3G2Y A;  3HUN A;  4GB7 A;  5EOO A;  3WS0 A;  4FD8 A;  3IF6 A;  3PBS A;  4Z9Q A;  1SDE A;  1L0G A;  1MWT A;  1YM1 A;  3OPH A;  1DJB A;  2C5W B;  4KZ7 A;  3ZDJ A;  4XUX A;  4OQG A;  3W4P A;  5JYO A;  2JC7 A;  3N8L A;  3VFF A;  1YLW A;  5CED A;  5FAS A;  1S0W A;  3IQA A;  1QME A;  2ZQ8 A;  3IF6 C;  3D4F A;  4RYE A;  4IED A;  1K25 A;  1M40 A;  4QD4 A;  3GMW A;  1IYQ A;  4S2O A;  3IWI A;  2Q9M A;  3TOI A;  1IYS A;  3OCN A;  4NK3 A;  4BD0 A;  2XD5 A;  5FAQ A;  1BLH A;  4IBX A;  5GHZ A;  2WGW B;  3O88 A;  4IBR A;  5KSC A;  1GA0 A;  5DF9 A;  3IT9 A;  4DE2 A;  2WKH A;  3FKV A;  4BL2 A;  2FFF B;  3DWZ A;  1W8Q A;  4U3T A;  3UNW A;  5EVI D;  3ZG7 B;  1I2W A;  4P0M A;  5CER A;  2OLV A;  4S2K A;  1E4D A;  4R3B A;  1GA9 A;  1KVM A;  1XGJ A;  3IWO A;  5A92 A;  3OPR A;  1K56 A;  3MZE A;  3E2L A;  1SKF A;  4OOL A;  5HX9 A;  3UPP A;  1NY0 A;  1Z6F A;  2H10 A;  3BYD A;  4OP5 A;  2HPB A;  2VGJ A;  2Y2P A;  3BFF A;  3V3S A;  4PM5 A;  1IEM A;  5E2H A;  1YLJ A;  4B88 A;  1XA1 A;  4FH4 A;  4PM9 A;  4WMC D;  3WRT A;  4KZ5 A;  5AQA A;  1E25 A;  1L0E A;  1VM1 A;  2Z2L B;  4KZA A;  4EBP A;  2BG1 A;  1ES2 A;  3WS5 A;  1MWS A;  2XLN A;  2XEP A;  4XXR A;  1NZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...