1LI0A

Crystal structure of tem-32 beta-lactamase at 1.6 angstrom
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMISTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-Lactamase- TEM-32
publication title The structural bases of antibiotic resistance in the clinically derived mutant beta-lactamases TEM-30, TEM-32, and TEM-34.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 90
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1li0A00
5FQIA 1PZOA 4X53A 3S1YA 4OQ0A 4Q8IA 4E3IA 1FSYA 2Y2NA 1L2SA 4KQQA 4OPRA 4OVDA 1RGZA 1L0DA 2J9OA 1KE4A 1NYMA 5DTKA 4HESA 3SH9A 4P85A 1IKIA 4U0XA 4QJGA 1WYCA 5KSHA 1DJBA 3W4OA 4RX2A 3WS1A 3GTCA 4BD0A 4WM9A 1XX2A 4K0WA 1YQSA 4KZ4A 3VP4A 5A92A 4DDSA 3GRJA 3DW0A 3IWIA 1DJAA 4MNRA 2UWXA 1S6RA 1K38A 5FSRA 2XFTA 4E6XA 4PM7A 4OQHA 1W5DA 4WEKA 1HTZA 2J7VA 2Y2IA 3OPLA 5I94A 2A3UA 2XFSA 2C6WB 2RCXA 5E2GA 1BLHA 5GLCA 1FCNA 4IVIA 1NY0A 4GKUA 3G2ZA 1EROA 2DRWA 4GNUA 1YLZA 4KQOA 4Y0OA 2WAFA 4KZ5A 3UY6A 3DWKA 4EWFA 5F1FA 3GR2A 1G6AA 3HUMA 4DE1A 4BJPA 1XP4A 3BYDA 4P6BA 4Y0TA 4JF4A 3SS5A 5EVIA 4NETA 2HDSA 3HREA 3UNWA 5CHUA 3GMWA 5HAPA 2ZQ7A 4JXWA 1KVLA 4XXRA 1RP5A 4ZBEA 3V3SA 1MPLA 1ES5A 5BOHA 1I5QA 3ZCZA 3ITBA 2J9PA 3NBLA 4S2NA 2XD5A 5HAQA 2XGNA 4DXCA 3V39A 5L2FA 3QHYA 5HFOA 3DWZA 4U0TA 3WS0A 5GHYA 5FQJA 4KZ7A 4QB8A 3V50A 4JKTA 3ZNYA 4C75A 1E3UA 1GHPA 4FH2A 4R4RA 3VP3A 5CEDA 3VSKA 1K54A 1PWCA 3ZG0A 4ZJ1A 4BQMA 2QMIA 4JXVA 2Y2KA 3UDFA 3VOZA 4S2IA 1KE3A 3NY4A 3N8RA 1XPBA 4UA9A 4FCFA 3IXHA 1IYSA 4R23A 4WZ4A 3ZG9B 5FAOA 1GA9A 3WS4A 4IVKA 4GB7A 1DY6A 1C3BA 1ESUA 4QD4A 5DF8A 2XR0A 5EOOA 2JE5A 2ZC3B 4N9LA 5CEBA 2WZZA 1W79A 1JVJA 3Q1FA 5E2EA 2EX9A 3HUOA 2EXBA 4JXSA 4PPRA 4FSFA 2XK1A 2Z2LB 1SKFA 1ALQA 5DVAA 3ZG7B 3ZVWA 4XUZA 4OLGA 2P74A 4MLLA 2WGWB 2ZM2A 1H8ZA 4QY5A 4C3QA 5HL1A 4OQGA 1NYYA 3NIAA 1MWUA 3B3XA 3BEBA 5EECA 2ZM0A 4GD6A 4GDNA 1PIOA 1MWTA 1Q2QA 3EQVA 3M6HA 4S2MA 4E3LA 3WS5A 3PBSA 3IF6B 1ZC2A 1XA1A 1YMXA 3BFFA 1GA0A 2WKIA 2Y59A 3P98A 2QZ6A 3MBZA 1GCEA 1E4DA 1CEGA 1BULA 2J8YA 3A3DA 3W4QA 5A90A 3C5AA 4DKIA 3VMAA 5AQ7A 2IWDA 5M19A 5CERA 1ESIA 1K57A 1I2SA 2JC7A 3G35A 3CZDA 1H5XA 1K6SA 3ISGA 4LV0A 2Q9MA 3HL9A 2HDUA 3NC8A 1XXMA 3UDXA 3CJMA 1IELA 4GDBA 4NK3A 3V5MA 4S2OA 2FFFB 1GHMA 2HP6A 5KZHA 3MXRA 5DF9A 1YLPA 5E2HA 4BLMA 4KZ6A 1FCMA 3OPHA 1HVBA 1LI0A 1SHVA 2Y2PA 2XQZA 4IBXA 1Q2PA 1IYOA 3A3JA 3BLMA 1K4FA 4GOGA 2ZC7A 1W8YA 1EWZA 2ZQCA 4WBGA 2BLSA 2Y55A 1E25A 2ZQAA 3BFGA 4DE3A 1DJCA 2X71A 4E3OA 3ZGAB 4X56A 1XA7A 3RJUA 4YFMA 5HAIA 1IYQA 4GZBA 5E2FA 4N92A 4PM5A 1BSGA 3SS3A 5FQ9A 5FQKA 2I72A 5M18A 4HEFA 1SDNA 2R9WA 5EVIB 2Y91A 4RVAA 4B4XA 4KZ3A 5HARA 4OOYA 5FI2A 5FA7A 1IKGA 3C7UA 3MFDA 3WWXA 3C7VA 4UHUA 4U3TA 3IHBA 1BZAA 2OLUA 2FFYA 5TFQA 5HW3A 4KZBA 2H5SA 2H0TA 3PTEA 3IF6C 5A91A 5GHXA 1K25A 1MKIA 3BRMA 3IWQA 3UPOA 3MKEA 1N9BA 1LL5A 5AQAA 3IT9A 4UAAA 1CI8A 3MZEA 3O87A 1L0EA 1JTGA 2WGVA 2WKHA 5F83A 5FAPA 4R0QA 1LHYA 1FSWA 2V2FF 3ZHHA 4PM9A 5CTNA 3UPNA 3Q7ZA 4KG5A 1BLPA 4ZJ3A 2XEPA 2V1ZA 4EUZA 4ZTKA 4DE2A 4B4ZA 2Y2MA 3HBRA 4CPKA 4X68A 4LV2A 4N1HA 3LCEA 1G68A 3OPPA 4EBPA 2P9VA 5E43A 3JYIA 4LCLA 2IWCA 2ZC5B 3NCKA 5EUAA 3BFDA 3N4IA 1PW8A 2EX6A 2Y2GA 1FOFA 2ZLYA 2Y2JA 2XH9A 1BLCA 4MBFA 1HZOA 5AQ9A 4EBNA 3PBTA 3LEZA 4H8RA 4KZ8A 1LLBA 4Z9QA 4UA6A 4KG6A 3HUNA 1U60A 4JF5A 2IWBA 2OLVA 2WADA 1MY8A 2Y2HA 2X02A 1MXOA 1ES2A 1EI5A 4WYYA 3HLEA 5CECA 4MBHA 1VM1A 2RL3A 3LO7A 1PWDA 2DCFA 4S2JA 2X01A 3MZDA 2Q9NA 1ES3A 1K55C 4D2OA 3N8LA 1O7EA 1KGFA 5D3OA 1ERMA 3Q07A 5DF7A 1J9MA 5TGFA 1KE0A 3IXGA 2Y2OA 4DF6A 3HLGA 4MBKA 2R9XA 4OP5A 1NZUA 1YLJA 2V20A 4LV1A 2HP5A 4X55A 3I7JA 3HLFA 1MWRA 3PBRA 1K56D 1YMSA 5EPHA 1BUEA 1ERQA 2ZC6B 1PWGA 4P0MA 2EX8A 3AGFA 1MWSA 1PYYA 3MKFA 3PAGA 4IBRA 4R3BA 5IHVA 1L0GA 3OZHA 5GL9A 5GLBA 3GQZA 5CTMA 2XD1A 5CHMA 2JCHA 3GV9A 4OPQA 3UE1A 4CJNA 2B5RA 3MXSA 1O07A 4DRTA 1VQQA 3PAEA 4A5RA 3C4PA 3OCLA 4WELA 3VP1A 3Q7VA 3HLBA 4PMAA 5KMWA 3IH9A 3RXWA 5DTTA 1GHIA 3MZFA 3UE0A 4Y0UA 3ZG8B 4C6YA 1K56A 5FDHA 3EQUA 3HVFA 1M6KA 4OQIA 3M2JA 4BD1A 1BTLA 4BENA 4OOMA 1M40A 1FQGA 2EX2A 2E8IA 1TEMA 2VGJA 1SCWA 2HDRA 3G2YA 1JTDA 1XGIA 4DDYA 4WZ5C 2Y2LA 2Y2QA 1H8YA 3N8SA 4RA7A 5EVLA 3IH8A 4F94A 1BLSA 3A3IA 1PI4A 1N4OA 4ZDXA 5TR7A 1HD8A 4E3KA 3HLDA 1PI5A 4KZAA 3BM6A 4UA7A 5CGXA 3O86A 5JYPA 4K0XA 3NI9A 3O88A 5EE8A 2WYXA 3WRZA 3A3FA 2WKEA 1CI9A 3G31A 4P87A 3UE3A 4HBUA 3Q82A 4S2KA 5GHZA 1I2WA 3VFHA 1ZG6A 3TG9A 1NJ4A 3G34A 5U47A 3QNBA 3GVBA 1ZKJA 2WUQA 3FV7A 4LCMA 2WGIA 5FATA 3C4OA 3BFCA 2H10A 3HLCA 4PM8A 2Y4AA 5CGSA 2OSUA 2P9VB 2ZQ9A 3M6BA 2HP9A 4DE0A 1FCOA 1PZPA 3PBNA 4ID4A 3FYZA 3IF6A 4GN2A 5GLAA 3VP2A 4QY6A 1PW1A 3SOIA 2JBFA 1KVMA 4QU3A 1Y54A 4BL2A 1IEMA 1RCJA 2HDQA 2H0YA 5DTSA 1FR1A 1K6RA 3P09A 4KG2A 3TSGA 2BG1A 3FWLA 2PU4A 5J8XA 4OONA 4OPZA 1JWPA 3G4PA 2G2WA 3FZCA 5CRFA 3E2KA 4JF6A 2DNSA 4YINA 1YLWA 3N7WA 4X6TA 2VGKA 5EVID 5AQBA 1KGEA 3SH8A 3VP0A 3ZNTA 5CHJA 3ZVTA 3VSLA 1OMEA 3WS2A 3OCNA 2EFXA 4OH0A 2C5WB 4IEDA 4S2PA 4EQIA 4R3JA 1XKZA 1CK3A 4OLDA 3WRTA 1FR6A 1JWVA 3GSGA 1TVFA 3Q81A 4FD8A 4Y7PA 2XDMA 3FKWA 3UO9A 2WZXA 4KZ9A 4MEZA 2OV5A 1E3UD 3LY4A 4JLFA 3N6IA 5F1GA 1NZOA 3IXBA 1KDSA 3LY3A 5EVIC 3RXXA 2G2UA 1YLTA 4WMCD 3BFEA 3E2LA 3OPRA 4R4SA 5G18A 2ZQ8A 3ZFZA 2ZM8A 5JYOA 3W8KA 1W7FA 2GDNA 2EFUA 2XF3A 3IF5A 3VOYA 1TDGA 3FKVA 4S2NC 4ZJ2A 1YLYA 1L0FA 1K55A 3Q7VB 3NDEA 5CGWA 1NXYA 1LI9A 2XLNA 4BL3A 2WAEA 3NDGA 1XGJA 3BLSA 1WE4A 1IYPA 2ZD8A 5EOEA 3G32A 1MBLA 1NRFA 3V3RA 1K54C 1QMEA 4LV3A 4PM6A 1AXBA 1ONHA 5FQMA 1Z6FA 2EXAA 3AGDA 1CEFA 4XUXA 3SH7A 3A3EA 4WMCA 5FAQA 4JXGA 5CXWA 4JPMA 2HPBA 4ZAMA 3ZG5A 3OC2A 5FQQA 3AGEA 4N1XA 4OOLA 3ZDJA 1QMFA 1WYBA 4S2LA 4HBTA 3HLWA 1YM1A 1W8QA 3IHAA 3UDIA 2CC1A 4RYEA 1LL9A 1S0WA 4O7DA 2WK0A 3ITAA 4WEJA 4JBFA 5A93A 4EBLA 3CMZA 2ZQDA 3IWOA 4EV4A 2PU2A 4E3MA 3S4XA 1ES4A 3IXDA 3SS4A 4E3NA 1ONGA 3O3VA 4OP8A 3DTMA 5FASA 4L0LA 4K91A 2A49A 4WZ5A 4X69A 3VFFA 5FI7A 1TDLA 3W4PA 2Z2MB 4E3JA 2ZMAA 1YT4A 1ZG4A 2ZC4B 4KENB 1BT5A 2ZJ9A 4LENA 3IQAA 3CG5A 3QNCA 4R1GA 2QPNA 4FH4A 1RGYA 1SDEA 3UN7A 3PBOA 4KQRA 5GLDA 3PBQA 1JWZA 4B88A 1K57C 4GD8A 5M1AA 4OKPA 1KDWA 5F82A 4DXBA 4N9KA 3M2KA 4E6WA 1K4EA 3G30A 3BECA 2WGWA 3D4FA 4RX3A 3TOIA 5KSCA 2PBYA 4QHCA 4M3KA 3S22A 5FI6A 1KGGA 3UPPA 4OPYA 5HX9A
chains in the Genus database with same CATH superfamily
4OVDA 4IJGA 1KE4A 1NYMA 3DAVA 4P85A 1IKIA 4WM9A 4M4XA 3VP4A 2EWVA 3GRJA 4CLCB 1DJAA 3CWFA 4MNRA 1S6RA 4E6XA 3OPLA 1VHMA 1ACFA 2VGLS 3FPWA 3G2ZA 1YLZA 5F1FA 4KZ5A 3GR2A 4DE1A 5FDSA 2NUTC 3R7WA 4JF4A 3SS5A 4DMZA 1DP6A 4NETA 4EXOA 4Y15A 3UNWA 2EA9A 2W0NA 4PKYG 2WKRA 3LFVA 5C5KA 1XJ4A 1RP5A 4ZBEA 1I5QA 3FG8A 3C30A 1OT9A 1V9ZA 3OLOA 1D7EA 3MSHA 4QB8A 4JKTA 1E3UA 2WKPA 2YKFA 3ZG0A 2QMIA 3EWKA 2Y2KA 4S2IA 3N8RA 3ZG9B 5FAOA 3CITA 3WS4A 1H0MA 3MQ0A 4IVKA 4GB7A 1C3BA 4QD4A 4ARZB 2XR0A 5EOOA 4N9LA 1W79A 4JXSA 2XK1A 2P74A 4MLLA 2WGWB 2ZM2A 3MFXA 4Q0HA 4GD6A 5TBMB 1PIOA 3MMHA 4Y5FA 3NULA 3VE3A 3P98A 2QZ6A 5A90A 2LB5A 3RH8B 4DKIA 3VMAA 2L1MA 5AQ7A 2GZAA 5M19A 4LV0A 1XXMA 2KDKA 3UDXA 4NK3A 2FFFB 5E2HA 4BLMA 3VOLA 2JHEA 4GOGA 4WBGA 4ZRRA 2KOIA 2Y55A 3BFGA 2Q0OA 2QWSA 3MR0A 3QP1A 4DJ3A 4X56A 3RJUA 5HAIA 2V9AA 1W63Q 2YKHA 4PM5A 3UB7A 2I72A 4OOYA 5FI2A 3C7UA 3UE6A 3IHBA 3T1QB 4HJ6A 4G3KA 2H0TA 1MKIA 3BRMA 3BJNA 2XRNA 1N9BA 2INWA 3IT9A 4UAAA 3O87A 4GLQA 2CMNA 2WKHA 4R0QA 1LHYA 3LIAA 4PM9A 3R4KA 3VV4A 4EUZA 4N1HA 3LCEA 4ETXA 2W3FA 2IWCA 4Z1WA 3W2ZA 3BFDA 3T4TA 2EX6A 3E4QA 2UV0E 1BLCA 1HZOA 3PBTA 3EGXC 1LLBA 3GECA 2V0WA 3QP4A 4PHTA 2X02A 3FC7A 4H6JA 2RL3A 4LLOB 3U2AA 3MZDA 4G3WA 5L8MA 3T4SA 1KGFA 1ERMA 3Q07A 1J9MA 3IXGA 2R9XA 2V20A 4EEPA 1Z09A 3DTKA 5EPHA 1AWIA 1CF0A 2HJ9C 2ZC6B 4P0MA 1VETB 4I3JA 5GL9A 3GQZA 4BBUA 2XD1A 2JCHA 3UE1A 1F98A 4DRTA 4A5RA 3C4PA 3S7OA 1F5MA 3HLBA 1G28A 1GHIA 1K56A 3EQUA 1VEUA 1F9IA 3U4LP 4OOMA 3EEAA 4NXFA 3T1SA 2E8IA 1TEMA 2HDRA 1JTDA 1XGIA 2O99A 4WZ5C 1H8YA 1PI4A 3IS2A 3HLDA 5CGXA 4HP4A 2O9AA 3O86A 3MQQA 5JYPA 4K0XA 3WRZA 3T4LA 2WKEA 3T4OA 3G31A 1BYWA 2VV8A 3Q82A 4S2KA 1I2WA 3VFHA 1ODVA 5U47A 3GVBA 4R3AA 4PM8A 2OSUA 5TBMA 2HP9A 1PZPA 3PBNA 3HJIA 5GLAA 3VP2A 3SOIA 1PW1A 5HDSA 4QU3A 4BL2A 1RCJA 5DTSA 3PXPA 5I5LA 4R38A 3TSGA 2BG1A 2ZL1B 2P7JA 3FWLA 5J7EA 4OONA 1JWPA 2G2WA 3FZCA 3E2KA 4YINA 5EVID 3ZNTA 5AQBA 1N9NA 2EFXA 5J3WA 4XT2B 4IEDA 4R3JA 2W3HA 3BQAA 3WRTA 1JWVA 3TE8A 3Q81A 2XDMA 3UO9A 2OV5A 2V8CA 3LY4A 3N6IA 5HSQA 1S1YA 3IXBA 3LY3A 3RXXA 4R4SA 2ZQ8A 3W8KA 2EFUA 1TDGA 1L0FA 3NDEA 4GW9A 5EOEA 1LT0A 1PFLA 1QMEA 3NECA 1AXBA 1Z6FA 3A0VA 3AGDA 1CEFA 1VB6A 4HOIA 2PD7A 3T4KA 2W3DA 2HPBA 2O9CA 1TS0A 2E8JA 4MDZA 1LL9A 1EW0A 4O7DA 3K3CA 1UGUA 1T1CA 3LICA 4HI4A 4WEJA 5A93A 4EBLA 4EV4A 3KYEA 2PU2A 4NXGA 4E3MA 3F1OA 1ONGA 3O3VA 4ESPA 4L0LA 2Z2MB 4F3LA 1ZG4A 3IQAA 3HCYA 2OWHA 4R1GA 5HL6A 3UMEA 3UN7A 5GLDA 4DXBA 4LFUA 4E6WA 1SKOA 1OTEA 4BMWA 3D4FA 3H7WA 2VLGA 5KSCA 1K0KA 4M3KA 3K3DA 1KGGA 3UPPA 2ZBBA 3CPTB 5FQIA 1PZOA 4X53A 4Q8IA 4E3IA 3EOIA 4KQQA 5L10A 4GJ4A 1OTIA 5KSHA 3DTIA 4GHIA 4RX2A 3WS1A 3KSFA 3GTCA 1YQSA 4L9EA 4I38A 5J4EA 2UWXA 3O5YA 5FSRA 4WL9A 1W5DA 1HTZA 2XFSA 5GLCA 2QJ5A 3E4PA 3VE4A 4KQOA 3DWKA 4HQAA 4EWFA 1DP9A 1G6AA 3T4QA 5EVIA 5CHUA 2M7VA 2A24B 5LBRA 2W3GA 3QP8A 4MCWA 3CAXA 5L2FA 4U0TA 5GHYA 4KZ7A 3V50A 4C75A 3LR3A 1J3WA 3PHYA 1K54A 1PWCA 1P0ZA 2ZL1A 3BW6A 3UDFA 3VOZA 1XPBA 4UA9A 4WZ4A 4JGQA 3LGOA 1ZTUA 1TS7A 1DY6A 2K2NA 5G4ZA 3L9KA 5EVEA 4PPRA 4HJ4A 1OT6A 5DVAA 4EW7A 4C3QA 4OQGA 3NIAA 1Q2QA 3EQVA 4S2MA 4E3LA 3WS5A 3IF6B 1XA1A 4AFIA 3BFFA 1GA0A 1CEGA 2J8YA 2BTFP 3C5AA 3C8CA 5CERA 2JC7A 3G35A 3ISGA 3CZDA 3HL9A 2HDUA 1MKMA 3CJMA 4JGRA 5KZHA 3MXRA 2XQZA 1Q2PA 2ZMVA 2JN7A 3A3JA 1JNUA 1K4FA 1EWZA 1G6OA 2ZQCA 2ACGA 2ZQAA 1DJCA 4E3OA 3ZGAB 1XA7A 4YFMA 1IYQA 4GZBA 5M18A 5FQ9A 5FQKA 1SDNA 2Y91A 4RVAA 5EFWA 4KZ3A 3MFDA 2BASA 3WWXA 3C7VA 4U3TA 1BZAA 5A91A 1K25A 5AQAA 3PR6A 1CI8A 3LI8A 3MZEA 3C38A 1H3QA 1JTGA 1FSWA 3LR5A 3Q7ZA 2PRFA 2V1ZA 1S66L 5DFYA 4I3AA 4B4ZA 4CLCD 4X68A 2XROA 4EESA 5FL3A 2P9VA 5E43A 3JYIA 3KSGA 1UWPX 3LIBA 1PRQA 1FOFA 2XH9A 4MBFA 2J3TD 2B02A 4Z9QA 3HUNA 1U60A 2VEAA 4JF5A 4LRXC 5IT5A 3KX0X 3MS6A 2Y2HA 1MXOA 1HLUP 1EI5A 2EWWA 2PDRA 4UEYA 2Q9NA 4YOFA 4D2OA 3IX8A 4Y3IA 4GS9B 5TGFA 4I3IA 3H82B 4DF6A 4MBKA 4OP5A 1YLJA 4LV1A 4X55A 3UB9A 3PBRA 1K56D 2H28A 3PYPA 1ERQA 3E4OA 3PAGA 4R3BA 4NKPA 2M1CA 5CHMA 2JKTM 1F2KA 2B5RA 3MXSA 1OTAA 1VQQA 3F1NA 3OCLA 4WELA 3VP1A 3Q7VA 5AJGA 3IH9A 3UE0A 5DTTA 3MZFA 3ZG8B 4IHQA 5FDHA 1M6KA 3M2JA 4BD1A 4HP9A 5EVLA 3IH8A 1N4OA 4E3KA 3EEHA 1A0KA 5EE8A 3GDIA 4P87A 4HBUA 5GHZA 2GX5A 1NJ4A 3FV7A 2ZOHA 2WGIA 1IOUA 3C4OA 2VK3A 4BBTA 1XJ6A 5CGSA 2ZQ9A 5TJJA 2W1TB 3M6BA 1S1ZA 3IF6A 2GJ3A 3ULFA 2VA0A 1Y54A 1IEMA 2W1RA 3T50A 2HDQA 5CRFA 4JF6A 2DNSA 5F68A 3N7WA 2VGKA 5CHJA 5HD5A 3VSLA 2O9BA 4OH0A 1D1JA 3EGDC 4EQIA 1FR6A 3LUQA 4FD8A 4Y7PA 3FKWA 4KZ9A 5F1GA 1G5UA 1NZOA 1KDSA 3NOPC 5DKLA 5EVIC 2M7UA 4CLCA 3BWLA 3E2LA 3OPRA 1DP8A 1N9LA 2GDNA 2VX8A 3IF5A 5CGWA 4BL3A 2WAEA 3NDGA 4WUJA 1WE4A 1DRMA 3KYZA 5HDDA 4EEUA 3G32A 3QP6A 1MBLA 4PM6A 1K54C 3UB8A 4JXGA 4I5SA 3ZG5A 3LR0A 4N1XA 4MN7A 1YM1A 1W8QA 3IHAA 2HGVA 4RYEA 3JVVA 4P6ZS 4YWZA 3MF0A 4II7A 2HJEA 3IWOA 1GSXA 5HZHA 2R78A 1LSWA 1ES4A 4E3NA 5FASA 3DTMA 1PNEA 4X69A 4B93A 3SZTA 4JGPA 3BY8A 1YT4A 1D06A 2ZJ9A 4JGOA 3QNCA 4FH4A 4ARZA 2VKSA 1SDEA 3TW8A 5HPIA 5F82A 4K08A 1NRJA 3M2KA 3G30A 3BECA 2WGWA 3TOIA 1S4SA 3DTEA 5HX9A 5DJTA 4EUVA 1FSYA 1YKDA 1L0DA 4NXEA 5DTKA 3SH9A 3F1PB 3W4OA 4BD0A 1XX2A 2Z6CA 4KZ4A 4DDSA 4WLAA 4E04A 2XFTA 4PM7A 1OJ5A 2A3UA 1LSVA 1BLHA 4IVIA 1LL8A 1NY0A 4GKUA 2A2LA 1EROA 2DRWA 4Y0OA 3UY6A 2WAFA 3HUMA 4P6BA 2QYBA 2HDSA 1YPRA 3HREA 3OOVA 3MQOA 2ZQ7A 1KVLA 4XXRA 2W1TA 3JPUA 1ES5A 5BOHA 2O0YA 3CLOA 3NBLA 4S2NA 2XD5A 4DXCA 3V39A 5HFOA 4GCZA 3MJQA 5L07A 5FQJA 1P9RA 1GHPA 4FH2A 4R4RA 3VP3A 3VSKA 4ZJ1A 4JXVA 1GSVA 4HJ3A 1UWNX 3IXHA 1IYSA 2OWJA 1T18A 2JE5A 5CEBA 2WZZA 5E2EA 1JVJA 3Q1FA 5KIZA 3HUOA 3ZG7B 1SKFA 1ALQA 4OLGA 1KOUA 3BQ8A 1NYYA 5MC7A 2P08A 3V67A 1OTDA 4ETZA 3PBSA 1ZC2A 2D02A 3IBRA 1GCEA 1E4DA 1BULA 3W4QA 5F6AA 3KYQA 2IWDA 1ESIA 2JKRM 1H5XA 2Q9MA 3FPVA 3NC8A 4GDBA 1VETA 5DF9A 1YLPA 1FCMA 4EU0A 2ZC7A 1XJ2A 2PR5A 2BLSA 1E25A 2X71A 4O01A 5EM1A 3CUEA 4N92A 3IX4A 1BSGA 2R9WA 5FA7A 1IKGA 4B9OA 3B42A 3RTYA 3PTEA 3IF6C 3IWQA 2J3WA 1LL5A 1L0EA 2L0WA 2WGVA 5F83A 4QWOA 3UPNA 4KG5A 1YSPA 2XEPA 1OTBA 2Y2MA 4LV2A 4EBPA 4HH3A 2ZC5B 3NCKA 2D01A 2ZLYA 5AQ9A 4UA6A 4KG6A 1XJ3A 2WADA 4CLCC 1MY8A 1ES2A 4MMNA 3HLEA 4D60A 5CECA 3LO7A 4O0PA 2X01A 1ES3A 4XT2A 2V1BA 3N8LA 5D3OA 2B18A 2J3TC 3P7NA 2OOLA 3HLGA 3I7JA 2I9VA 4LPZA 1X0OA 5IU1A 1PWGA 3E98A 3AGFA 1MWSA 3UB6A 1PYYA 3MKFA 4HNBA 4IBRA 2PR6A 5IHVA 3OZHA 5GLBA 5CTMA 4IUHA 4OPQA 1O07A 1XFNA 4L9GA 2K7SA 3UMDA 4OQIA 1BTLA 3LIFA 4BENA 1FQGA 1SCWA 3G2YA 4DDYA 3E0YA 2Y2LA 1P97A 2Y2QA 3N8SA 4RA7A 2QHKA 2JKFA 5FEFA 1FIKA 1HD8A 3IBJA 1P9WA 1PI5A 3BM6A 4UA7A 3NI9A 2WYXA 4Q0JA 4NEED 1CI9A 3UE3A 1ZG6A 4P6ZM 3G34A 2WUQA 4LCMA 5FATA 2HV1A 3HLCA 2Y4AA 4UQIS 1CJFA 1FCOA 4ID4A 3FYZA 4LGWA 1XFQA 1H8MA 4QY6A 1YSQA 4LRZE 4MN5A 4G3VA 3ICYA 1WA9A 5HDCA 1K6RA 3P09A 4KG2A 2PU4A 5J8XA 3SW1A 4OPZA 3G4PA 2VV6A 4H6JB 4X6TA 1S4RA 3VP0A 1KGEA 5HWTA 3ZVTA 1IFQA 5K5BA 1OMEA 3WS2A 3OCNA 3CPTA 3ZYTA 2C5WB 2QJ7A 4S2PA 1XKZA 1CK3A 4PAUA 4FTXA 1TVFA 3QP2A 2WZXA 4MEZA 4JLFA 2J80A 4HY8A 2LB9A 5IS1A 4Q0IA 5G18A 3ZFZA 2ZM8A 2XF3A 4S2NC 4ZJ2A 1YLYA 1K55A 1LI9A 2XLNA 1CQAA 2HF6A 1VEUB 2ZD8A 3V3RA 4LV3A 4EETB 1ONHA 5FQMA 2EXAA 4XUXA 3SH7A 3A3EA 4WMCA 5FAQA 3LI9A 5CXWA 2JKTI 4JPMA 3NOUC 4PKYA 4ZAMA 3OC2A 2A24A 4Y13A 4NG2A 3ZDJA 1QMFA 4HBTA 3HLWA 3IS2B 1Y28A 5DKKA 1S0WA 3D72A 3A0RA 2WK0A 3ITAA 4JBFA 2ZQDA 3T1RA 3S4XA 1T19A 2XSSA 4K91A 2ZOIA 1TS6A 3VFFA 4FUWA 5FI7A 1TDLA 3TJZC 3W4PA 4E3JA 2ZMAA 2ZC4B 4KENB 3HJKA 4LENA 3CG5A 2XA7M 3UB5P 1RGYA 2W27A 3D3OA 3PBOA 4KQRA 3PBQA 4B88A 4GD8A 1KDWA 4KQDA 1K4EA 1OPXA 4QHCA 5FI6A 4OPYA 3S1YA 4OQ0A 1OJGA 2Y2NA 1L2SA 4OPRA 1RGZA 2J9OA 1T1AA 4HESA 4U0XA 4QJGA 1WYCA 3CUEC 1DJBA 4K0WA 5A92A 4QPRA 3DW0A 3IWIA 4HHDA 2FH5A 1K38A 3MXQA 3CHWP 4OQHA 4WEKA 2J7VA 2Y2IA 5I94A 3DBAA 2C6WB 2RCXA 5E2GA 1FCNA 1TS8A 4GNUA 2PHYA 2Y79A 4BJPA 1XP4A 3BYDA 4Y0TA 3GMWA 5HAPA 3H9WA 3LIDA 4JXWA 2PD8A 3V3SA 1MPLA 3ZCZA 3ITBA 2J9PA 5HAQA 2XGNA 3QHYA 3DWZA 3WS0A 4CQHA 3ZNYA 5CEDA 4BQMA 3F1OB 2PAVP 1KE3A 3NY4A 4LRYC 1TF1A 4FCFA 4R23A 1GA9A 4F3LB 2MJ6A 1ESUA 5DF8A 2ZC3B 5CX7A 2EX9A 2EXBA 5G4YA 4FSFA 5HD3A 2Z2LB 3ZVWA 3LYXA 4XUZA 1SKOB 3H7WB 3T1XA 1H8ZA 4QY5A 5HL1A 1MWUA 3B3XA 3BEBA 5EECA 3S7PA 2ZM0A 4GDNA 1MWTA 3M6HA 4BWIA 1YMXA 2WKIA 2Y59A 3MBZA 4GS9A 5DFXA 3A3DA 4GHIB 3H82A 4HIAA 3LIEA 2NUPC 1K57A 1I2SA 1K6SA 1IELA 3V5MA 4S2OA 5A8BA 1GHMA 2HP6A 5HWWA 4KZ6A 3OPHA 1HVBA 5HPFA 1LI0A 1SHVA 2Y2PA 4IBXA 3BLMA 1IYOA 3S7NA 1W8YA 4DE3A 2KX6A 5E2FA 1V9YA 4I39A 3SS3A 4HEFA 5EVIB 1GSWA 4B4XA 5HARA 1L3LA 1SZVA 4DN0A 2PBDP 4UHUA 2OLUA 2FFYA 5TFQA 5HW3A 4KZBA 2H5SA 5GHXA 3TRCA 3UPOA 3MKEA 3K2NA 4X1LA 2K31A 5FAPA 2V2FF 4HH2A 3IX3A 4KUOA 4MN6A 3ZHHA 5CTNA 1BLPA 4ZJ3A 4ZTKA 4DE2A 2HZ5A 2OAP1 3HBRA 5EV0A 4CPKA 1ZHHB 1G68A 3OPPA 2B95A 4LCLA 4O8GA 4UQIM 5EUAA 2VV7A 3N4IA 1PW8A 2Y2GA 3JVUA 5L09A 2Y2JA 4EBNA 3LEZA 4H8RA 4KZ8A 3KSIA 1NLZA 2IWBA 2OLVA 4DJ2A 4YNRA 4BBVA 4WYYA 4MBHA 1VM1A 2PYPA 1PWDA 2DCFA 4S2JA 2XA7S 1K55C 1O7EA 1YAXA 5DF7A 1KE0A 2VGLM 3A0SA 2Y2OA 1NZUA 2HP5A 3HLFA 1MWRA 1YMSA 1BUEA 1LSXA 2EX8A 1Y4OA 1L0GA 2ZMFA 4L9FA 4CJNA 3ZQ5A 3GV9A 3QP5A 3KSHA 3PAEA 2JKRI 4ME4A 3P01A 4PMAA 5KMWA 3RXWA 4C6YA 4Y0UA 3HVFA 4IUKA 3G6OA 1M40A 2EX2A 3NHQA 4FOFA 2VGJA 1N9OA 3LEQA 4F94A 2DMWA 1BLSA 3A3IA 2KLIA 3D9YA 2VJWA 4ZDXA 5TR7A 1MZUA 4KZAA 1STZA 5AVFA 3O88A 2G7UA 3A3FA 2P04A 4R70A 3C2WA 3TG9A 3R7WB 3QNBA 1ZKJA 3BFCA 5F69A 2H10A 2P9VB 4DE0A 4GN2A 2JBFA 1KVMA 3S7QA 4X25A 2H0YA 1FR1A 5AVEA 4Y2FA 1YLWA 3SH8A 2FZ0A 4OLDA 2AVXA 3T12B 3GSGA 5F5YA 4Y17A 3B47A 5EM0A 3F1PA 3B33A 1E3UD 2QKPA 1TD5A 2G2UA 1YLTA 4WMCD 3BFEA 5JYOA 1W7FA 4X1MA 3VOYA 3FKVA 3LR4A 3F1NB 3Q7VB 1NXYA 1XGJA 3BLSA 1IYPA 1FILA 2Y8HA 4NXBA 1NRFA 1T1BA 2PYRA 2IA2A 1S67L 2Z6DA 3CI6A 4CLCE 2PT7A 1NWZA 2JKGA 3NJAA 1NLYA 3AGEA 3L7HA 5FQQA 4OOLA 1WYBA 4S2LA 5DJUA 5HWVA 3UDIA 2CC1A 1MC0A 2WKQA 3CMZA 2VZWA 4RQ9A 3IXDA 3SS4A 5FEGA 4OP8A 2V0UA 4EQ1A 2A49A 4WZ5A 2V8FA 2L4RA 4WF0A 1BT5A 2W3EA 2QPNA 4WN5A 4KUKA 2GNXA 2OAQ1 1JWZA 3T4JA 3KO6A 1K57C 5M1AA 4EERA 4OKPA 2V1AA 1W63M 4N9KA 4RX3A 3BY9A 3RFBA 2PBYA 3NOTC 3OBFA 3S22A 4R6LA
chains in the Genus database with same CATH topology
5FQIA 1PZOA 4X53A 3S1YA 4OQ0A 4Q8IA 4E3IA 1FSYA 2Y2NA 1L2SA 4KQQA 4OPRA 4OVDA 1RGZA 1L0DA 2J9OA 1KE4A 1NYMA 5DTKA 4HESA 3SH9A 4P85A 1IKIA 4U0XA 4QJGA 1WYCA 5KSHA 1DJBA 3W4OA 4RX2A 3WS1A 3GTCA 4BD0A 4WM9A 1XX2A 4K0WA 1YQSA 4KZ4A 3VP4A 5A92A 4DDSA 3GRJA 3DW0A 3IWIA 1DJAA 4MNRA 2UWXA 1S6RA 1K38A 5FSRA 2XFTA 4E6XA 4PM7A 4OQHA 1W5DA 4WEKA 1HTZA 2J7VA 2Y2IA 3OPLA 5I94A 2A3UA 2XFSA 2C6WB 2RCXA 5E2GA 1BLHA 5GLCA 1FCNA 4IVIA 1NY0A 4GKUA 3G2ZA 1EROA 2DRWA 4GNUA 1YLZA 4KQOA 4Y0OA 2WAFA 4KZ5A 3UY6A 3DWKA 4EWFA 5F1FA 3GR2A 1G6AA 3HUMA 4DE1A 4BJPA 1XP4A 3BYDA 4P6BA 4Y0TA 4JF4A 3SS5A 5EVIA 4NETA 2HDSA 3HREA 3UNWA 5CHUA 3GMWA 5HAPA 2ZQ7A 4JXWA 1KVLA 4XXRA 1RP5A 4ZBEA 3V3SA 1MPLA 1ES5A 5BOHA 1I5QA 3ZCZA 3ITBA 2J9PA 3NBLA 4S2NA 2XD5A 5HAQA 2XGNA 4DXCA 3V39A 5L2FA 3QHYA 5HFOA 3DWZA 4U0TA 3WS0A 5GHYA 5FQJA 4KZ7A 4QB8A 3V50A 4JKTA 3ZNYA 4C75A 1E3UA 1GHPA 4FH2A 4R4RA 3VP3A 5CEDA 3VSKA 1K54A 1PWCA 3ZG0A 4ZJ1A 4BQMA 2QMIA 4JXVA 2Y2KA 3UDFA 3VOZA 4S2IA 1KE3A 3NY4A 3N8RA 1XPBA 4UA9A 4FCFA 3IXHA 1IYSA 4R23A 4WZ4A 3ZG9B 5FAOA 1GA9A 3WS4A 4IVKA 4GB7A 1DY6A 1C3BA 1ESUA 4QD4A 5DF8A 2XR0A 5EOOA 2JE5A 2ZC3B 4N9LA 5CEBA 2WZZA 1W79A 1JVJA 3Q1FA 5E2EA 2EX9A 3HUOA 2EXBA 4JXSA 4PPRA 4FSFA 2XK1A 2Z2LB 1SKFA 1ALQA 5DVAA 3ZG7B 3ZVWA 4XUZA 4OLGA 2P74A 4MLLA 2WGWB 2ZM2A 1H8ZA 4QY5A 4C3QA 5HL1A 4OQGA 1NYYA 3NIAA 1MWUA 3B3XA 3BEBA 5EECA 2ZM0A 4GD6A 4GDNA 1PIOA 1MWTA 1Q2QA 3EQVA 3M6HA 4S2MA 4E3LA 3WS5A 3PBSA 3IF6B 1ZC2A 1XA1A 1YMXA 3BFFA 1GA0A 2WKIA 2Y59A 3P98A 2QZ6A 3MBZA 1GCEA 1E4DA 1CEGA 1BULA 2J8YA 3A3DA 3W4QA 5A90A 3C5AA 4DKIA 3VMAA 5AQ7A 2IWDA 5M19A 5CERA 1ESIA 1K57A 1I2SA 2JC7A 3G35A 3CZDA 1H5XA 1K6SA 3ISGA 4LV0A 2Q9MA 3HL9A 2HDUA 3NC8A 1XXMA 3UDXA 3CJMA 1IELA 4GDBA 4NK3A 3V5MA 4S2OA 2FFFB 1GHMA 2HP6A 5KZHA 3MXRA 5DF9A 1YLPA 5E2HA 4BLMA 4KZ6A 1FCMA 3OPHA 1HVBA 1LI0A 1SHVA 2Y2PA 2XQZA 4IBXA 1Q2PA 1IYOA 3A3JA 3BLMA 1K4FA 4GOGA 2ZC7A 1W8YA 1EWZA 2ZQCA 4WBGA 2BLSA 2Y55A 1E25A 2ZQAA 3BFGA 4DE3A 1DJCA 2X71A 4E3OA 3ZGAB 4X56A 1XA7A 3RJUA 4YFMA 5HAIA 1IYQA 4GZBA 5E2FA 4N92A 4PM5A 1BSGA 3SS3A 5FQ9A 5FQKA 2I72A 5M18A 4HEFA 1SDNA 2R9WA 5EVIB 2Y91A 4RVAA 4B4XA 4KZ3A 5HARA 4OOYA 5FI2A 5FA7A 1IKGA 3C7UA 3MFDA 3WWXA 3C7VA 4UHUA 4U3TA 3IHBA 1BZAA 2OLUA 2FFYA 5TFQA 5HW3A 4KZBA 2H5SA 2H0TA 3PTEA 3IF6C 5A91A 5GHXA 1K25A 1MKIA 3BRMA 3IWQA 3UPOA 3MKEA 1N9BA 1LL5A 5AQAA 3IT9A 4UAAA 1CI8A 3MZEA 3O87A 1L0EA 1JTGA 2WGVA 2WKHA 5F83A 5FAPA 4R0QA 1LHYA 1FSWA 2V2FF 3ZHHA 4PM9A 5CTNA 3UPNA 3Q7ZA 4KG5A 1BLPA 4ZJ3A 2XEPA 2V1ZA 4EUZA 4ZTKA 4DE2A 4B4ZA 2Y2MA 3HBRA 4CPKA 4X68A 4LV2A 4N1HA 3LCEA 1G68A 3OPPA 4EBPA 2P9VA 5E43A 3JYIA 4LCLA 2IWCA 2ZC5B 3NCKA 5EUAA 3BFDA 3N4IA 1PW8A 2EX6A 2Y2GA 1FOFA 2ZLYA 2Y2JA 2XH9A 1BLCA 4MBFA 1HZOA 5AQ9A 4EBNA 3PBTA 3LEZA 4H8RA 4KZ8A 1LLBA 4Z9QA 4UA6A 4KG6A 3HUNA 1U60A 4JF5A 2IWBA 2OLVA 2WADA 1MY8A 2Y2HA 2X02A 1MXOA 1ES2A 1EI5A 4WYYA 3HLEA 5CECA 4MBHA 1VM1A 2RL3A 3LO7A 1PWDA 2DCFA 4S2JA 2X01A 3MZDA 2Q9NA 1ES3A 1K55C 4D2OA 3N8LA 1O7EA 1KGFA 5D3OA 1ERMA 3Q07A 5DF7A 1J9MA 5TGFA 1KE0A 3IXGA 2Y2OA 4DF6A 3HLGA 4MBKA 2R9XA 4OP5A 1NZUA 1YLJA 2V20A 4LV1A 2HP5A 4X55A 3I7JA 3HLFA 1MWRA 3PBRA 1K56D 1YMSA 5EPHA 1BUEA 1ERQA 2ZC6B 1PWGA 4P0MA 2EX8A 3AGFA 1MWSA 1PYYA 3MKFA 3PAGA 4IBRA 4R3BA 5IHVA 1L0GA 3OZHA 5GL9A 5GLBA 3GQZA 5CTMA 2XD1A 5CHMA 2JCHA 3GV9A 4OPQA 3UE1A 4CJNA 2B5RA 3MXSA 1O07A 4DRTA 1VQQA 3PAEA 4A5RA 3C4PA 3OCLA 4WELA 3VP1A 3Q7VA 3HLBA 4PMAA 5KMWA 3IH9A 3RXWA 5DTTA 1GHIA 3MZFA 3UE0A 4Y0UA 3ZG8B 4C6YA 1K56A 5FDHA 3EQUA 3HVFA 1M6KA 4OQIA 3M2JA 4BD1A 1BTLA 4BENA 4OOMA 1M40A 1FQGA 2EX2A 2E8IA 1TEMA 2VGJA 1SCWA 2HDRA 3G2YA 1JTDA 1XGIA 4DDYA 4WZ5C 2Y2LA 2Y2QA 1H8YA 3N8SA 4RA7A 5EVLA 3IH8A 4F94A 1BLSA 3A3IA 1PI4A 1N4OA 4ZDXA 5TR7A 1HD8A 4E3KA 3HLDA 1PI5A 4KZAA 3BM6A 4UA7A 5CGXA 3O86A 5JYPA 4K0XA 3NI9A 3O88A 5EE8A 2WYXA 3WRZA 3A3FA 2WKEA 1CI9A 3G31A 4P87A 3UE3A 4HBUA 3Q82A 4S2KA 5GHZA 1I2WA 3VFHA 1ZG6A 3TG9A 1NJ4A 3G34A 5U47A 3QNBA 3GVBA 1ZKJA 2WUQA 3FV7A 4LCMA 2WGIA 5FATA 3C4OA 3BFCA 2H10A 3HLCA 4PM8A 2Y4AA 5CGSA 2OSUA 2P9VB 2ZQ9A 3M6BA 2HP9A 4DE0A 1FCOA 1PZPA 3PBNA 4ID4A 3FYZA 3IF6A 4GN2A 5GLAA 3VP2A 4QY6A 1PW1A 3SOIA 2JBFA 1KVMA 4QU3A 1Y54A 4BL2A 1IEMA 1RCJA 2HDQA 2H0YA 5DTSA 1FR1A 1K6RA 3P09A 4KG2A 3TSGA 2BG1A 3FWLA 2PU4A 5J8XA 4OONA 4OPZA 1JWPA 3G4PA 2G2WA 3FZCA 5CRFA 3E2KA 4JF6A 2DNSA 4YINA 1YLWA 3N7WA 4X6TA 2VGKA 5EVID 5AQBA 1KGEA 3SH8A 3VP0A 3ZNTA 5CHJA 3ZVTA 3VSLA 1OMEA 3WS2A 3OCNA 2EFXA 4OH0A 2C5WB 4IEDA 4S2PA 4EQIA 4R3JA 1XKZA 1CK3A 4OLDA 3WRTA 1FR6A 1JWVA 3GSGA 1TVFA 3Q81A 4FD8A 4Y7PA 2XDMA 3FKWA 3UO9A 2WZXA 4KZ9A 4MEZA 2OV5A 1E3UD 3LY4A 4JLFA 3N6IA 5F1GA 1NZOA 3IXBA 1KDSA 3LY3A 5EVIC 3RXXA 2G2UA 1YLTA 4WMCD 3BFEA 3E2LA 3OPRA 4R4SA 5G18A 2ZQ8A 3ZFZA 2ZM8A 5JYOA 3W8KA 1W7FA 2GDNA 2EFUA 2XF3A 3IF5A 3VOYA 1TDGA 3FKVA 4S2NC 4ZJ2A 1YLYA 1L0FA 1K55A 3Q7VB 3NDEA 5CGWA 1NXYA 1LI9A 2XLNA 4BL3A 2WAEA 3NDGA 1XGJA 3BLSA 1WE4A 1IYPA 2ZD8A 5EOEA 3G32A 1MBLA 1NRFA 3V3RA 1K54C 1QMEA 4LV3A 4PM6A 1AXBA 1ONHA 5FQMA 1Z6FA 2EXAA 3AGDA 1CEFA 4XUXA 3SH7A 3A3EA 4WMCA 5FAQA 4JXGA 5CXWA 4JPMA 2HPBA 4ZAMA 3ZG5A 3OC2A 5FQQA 3AGEA 4N1XA 4OOLA 3ZDJA 1QMFA 1WYBA 4S2LA 4HBTA 3HLWA 1YM1A 1W8QA 3IHAA 3UDIA 2CC1A 4RYEA 1LL9A 1S0WA 4O7DA 2WK0A 3ITAA 4WEJA 4JBFA 5A93A 4EBLA 3CMZA 2ZQDA 3IWOA 4EV4A 2PU2A 4E3MA 3S4XA 1ES4A 3IXDA 3SS4A 4E3NA 1ONGA 3O3VA 4OP8A 3DTMA 5FASA 4L0LA 4K91A 2A49A 4WZ5A 4X69A 3VFFA 5FI7A 1TDLA 3W4PA 2Z2MB 4E3JA 2ZMAA 1YT4A 1ZG4A 2ZC4B 4KENB 1BT5A 2ZJ9A 4LENA 3IQAA 3CG5A 3QNCA 4R1GA 2QPNA 4FH4A 1RGYA 1SDEA 3UN7A 3PBOA 4KQRA 5GLDA 3PBQA 1JWZA 4B88A 1K57C 4GD8A 5M1AA 4OKPA 1KDWA 5F82A 4DXBA 4N9KA 3M2KA 4E6WA 1K4EA 3G30A 3BECA 2WGWA 3D4FA 4RX3A 3TOIA 5KSCA 2PBYA 4QHCA 4M3KA 3S22A 5FI6A 1KGGA 3UPPA 4OPYA 5HX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQI A;  1PZO A;  4X53 A;  3S1Y A;  4OQ0 A;  4Q8I A;  4E3I A;  1FSY A;  2Y2N A;  1L2S A;  4KQQ A;  4OPR A;  4OVD A;  1RGZ A;  1L0D A;  2J9O A;  1KE4 A;  1NYM A;  5DTK A;  4HES A;  3SH9 A;  4P85 A;  1IKI A;  4U0X A;  4QJG A;  1WYC A;  5KSH A;  1DJB A;  3W4O A;  4RX2 A;  3WS1 A;  3GTC A;  4BD0 A;  4WM9 A;  1XX2 A;  4K0W A;  1YQS A;  4KZ4 A;  3VP4 A;  5A92 A;  4DDS A;  3GRJ A;  3DW0 A;  3IWI A;  1DJA A;  4MNR A;  2UWX A;  1S6R A;  1K38 A;  5FSR A;  2XFT A;  4E6X A;  4PM7 A;  4OQH A;  1W5D A;  4WEK A;  1HTZ A;  2J7V A;  2Y2I A;  3OPL A;  5I94 A;  2A3U A;  2XFS A;  2C6W B;  2RCX A;  5E2G A;  1BLH A;  5GLC A;  1FCN A;  4IVI A;  1NY0 A;  4GKU A;  3G2Z A;  1ERO A;  2DRW A;  4GNU A;  1YLZ A;  4KQO A;  4Y0O A;  2WAF A;  4KZ5 A;  3UY6 A;  3DWK A;  4EWF A;  5F1F A;  3GR2 A;  1G6A A;  3HUM A;  4DE1 A;  4BJP A;  1XP4 A;  3BYD A;  4P6B A;  4Y0T A;  4JF4 A;  3SS5 A;  5EVI A;  4NET A;  2HDS A;  3HRE A;  3UNW A;  5CHU A;  3GMW A;  5HAP A;  2ZQ7 A;  4JXW A;  1KVL A;  4XXR A;  1RP5 A;  4ZBE A;  3V3S A;  1MPL A;  1ES5 A;  5BOH A;  1I5Q A;  3ZCZ A;  3ITB A;  2J9P A;  3NBL A;  4S2N A;  2XD5 A;  5HAQ A;  2XGN A;  4DXC A;  3V39 A;  5L2F A;  3QHY A;  5HFO A;  3DWZ A;  4U0T A;  3WS0 A;  5GHY A;  5FQJ A;  4KZ7 A;  4QB8 A;  3V50 A;  4JKT A;  3ZNY A;  4C75 A;  1E3U A;  1GHP A;  4FH2 A;  4R4R A;  3VP3 A;  5CED A;  3VSK A;  1K54 A;  1PWC A;  3ZG0 A;  4ZJ1 A;  4BQM A;  2QMI A;  4JXV A;  2Y2K A;  3UDF A;  3VOZ A;  4S2I A;  1KE3 A;  3NY4 A;  3N8R A;  1XPB A;  4UA9 A;  4FCF A;  3IXH A;  1IYS A;  4R23 A;  4WZ4 A;  3ZG9 B;  5FAO A;  1GA9 A;  3WS4 A;  4IVK A;  4GB7 A;  1DY6 A;  1C3B A;  1ESU A;  4QD4 A;  5DF8 A;  2XR0 A;  5EOO A;  2JE5 A;  2ZC3 B;  4N9L A;  5CEB A;  2WZZ A;  1W79 A;  1JVJ A;  3Q1F A;  5E2E A;  2EX9 A;  3HUO A;  2EXB A;  4JXS A;  4PPR A;  4FSF A;  2XK1 A;  2Z2L B;  1SKF A;  1ALQ A;  5DVA A;  3ZG7 B;  3ZVW A;  4XUZ A;  4OLG A;  2P74 A;  4MLL A;  2WGW B;  2ZM2 A;  1H8Z A;  4QY5 A;  4C3Q A;  5HL1 A;  4OQG A;  1NYY A;  3NIA A;  1MWU A;  3B3X A;  3BEB A;  5EEC A;  2ZM0 A;  4GD6 A;  4GDN A;  1PIO A;  1MWT A;  1Q2Q A;  3EQV A;  3M6H A;  4S2M A;  4E3L A;  3WS5 A;  3PBS A;  3IF6 B;  1ZC2 A;  1XA1 A;  1YMX A;  3BFF A;  1GA0 A;  2WKI A;  2Y59 A;  3P98 A;  2QZ6 A;  3MBZ A;  1GCE A;  1E4D A;  1CEG A;  1BUL A;  2J8Y A;  3A3D A;  3W4Q A;  5A90 A;  3C5A A;  4DKI A;  3VMA A;  5AQ7 A;  2IWD A;  5M19 A;  5CER A;  1ESI A;  1K57 A;  1I2S A;  2JC7 A;  3G35 A;  3CZD A;  1H5X A;  1K6S A;  3ISG A;  4LV0 A;  2Q9M A;  3HL9 A;  2HDU A;  3NC8 A;  1XXM A;  3UDX A;  3CJM A;  1IEL A;  4GDB A;  4NK3 A;  3V5M A;  4S2O A;  2FFF B;  1GHM A;  2HP6 A;  5KZH A;  3MXR A;  5DF9 A;  1YLP A;  5E2H A;  4BLM A;  4KZ6 A;  1FCM A;  3OPH A;  1HVB A;  1LI0 A;  1SHV A;  2Y2P A;  2XQZ A;  4IBX A;  1Q2P A;  1IYO A;  3A3J A;  3BLM A;  1K4F A;  4GOG A;  2ZC7 A;  1W8Y A;  1EWZ A;  2ZQC A;  4WBG A;  2BLS A;  2Y55 A;  1E25 A;  2ZQA A;  3BFG A;  4DE3 A;  1DJC A;  2X71 A;  4E3O A;  3ZGA B;  4X56 A;  1XA7 A;  3RJU A;  4YFM A;  5HAI A;  1IYQ A;  4GZB A;  5E2F A;  4N92 A;  4PM5 A;  1BSG A;  3SS3 A;  5FQ9 A;  5FQK A;  2I72 A;  5M18 A;  4HEF A;  1SDN A;  2R9W A;  5EVI B;  2Y91 A;  4RVA A;  4B4X A;  4KZ3 A;  5HAR A;  4OOY A;  5FI2 A;  5FA7 A;  1IKG A;  3C7U A;  3MFD A;  3WWX A;  3C7V A;  4UHU A;  4U3T A;  3IHB A;  1BZA A;  2OLU A;  2FFY A;  5TFQ A;  5HW3 A;  4KZB A;  2H5S A;  2H0T A;  3PTE A;  3IF6 C;  5A91 A;  5GHX A;  1K25 A;  1MKI A;  3BRM A;  3IWQ A;  3UPO A;  3MKE A;  1N9B A;  1LL5 A;  5AQA A;  3IT9 A;  4UAA A;  1CI8 A;  3MZE A;  3O87 A;  1L0E A;  1JTG A;  2WGV A;  2WKH A;  5F83 A;  5FAP A;  4R0Q A;  1LHY A;  1FSW A;  2V2F F;  3ZHH A;  4PM9 A;  5CTN A;  3UPN A;  3Q7Z A;  4KG5 A;  1BLP A;  4ZJ3 A;  2XEP A;  2V1Z A;  4EUZ A;  4ZTK A;  4DE2 A;  4B4Z A;  2Y2M A;  3HBR A;  4CPK A;  4X68 A;  4LV2 A;  4N1H A;  3LCE A;  1G68 A;  3OPP A;  4EBP A;  2P9V A;  5E43 A;  3JYI A;  4LCL A;  2IWC A;  2ZC5 B;  3NCK A;  5EUA A;  3BFD A;  3N4I A;  1PW8 A;  2EX6 A;  2Y2G A;  1FOF A;  2ZLY A;  2Y2J A;  2XH9 A;  1BLC A;  4MBF A;  1HZO A;  5AQ9 A;  4EBN A;  3PBT A;  3LEZ A;  4H8R A;  4KZ8 A;  1LLB A;  4Z9Q A;  4UA6 A;  4KG6 A;  3HUN A;  1U60 A;  4JF5 A;  2IWB A;  2OLV A;  2WAD A;  1MY8 A;  2Y2H A;  2X02 A;  1MXO A;  1ES2 A;  1EI5 A;  4WYY A;  3HLE A;  5CEC A;  4MBH A;  1VM1 A;  2RL3 A;  3LO7 A;  1PWD A;  2DCF A;  4S2J A;  2X01 A;  3MZD A;  2Q9N A;  1ES3 A;  1K55 C;  4D2O A;  3N8L A;  1O7E A;  1KGF A;  5D3O A;  1ERM A;  3Q07 A;  5DF7 A;  1J9M A;  5TGF A;  1KE0 A;  3IXG A;  2Y2O A;  4DF6 A;  3HLG A;  4MBK A;  2R9X A;  4OP5 A;  1NZU A;  1YLJ A;  2V20 A;  4LV1 A;  2HP5 A;  4X55 A;  3I7J A;  3HLF A;  1MWR A;  3PBR A;  1K56 D;  1YMS A;  5EPH A;  1BUE A;  1ERQ A;  2ZC6 B;  1PWG A;  4P0M A;  2EX8 A;  3AGF A;  1MWS A;  1PYY A;  3MKF A;  3PAG A;  4IBR A;  4R3B A;  5IHV A;  1L0G A;  3OZH A;  5GL9 A;  5GLB A;  3GQZ A;  5CTM A;  2XD1 A;  5CHM A;  2JCH A;  3GV9 A;  4OPQ A;  3UE1 A;  4CJN A;  2B5R A;  3MXS A;  1O07 A;  4DRT A;  1VQQ A;  3PAE A;  4A5R A;  3C4P A;  3OCL A;  4WEL A;  3VP1 A;  3Q7V A;  3HLB A;  4PMA A;  5KMW A;  3IH9 A;  3RXW A;  5DTT A;  1GHI A;  3MZF A;  3UE0 A;  4Y0U A;  3ZG8 B;  4C6Y A;  1K56 A;  5FDH A;  3EQU A;  3HVF A;  1M6K A;  4OQI A;  3M2J A;  4BD1 A;  1BTL A;  4BEN A;  4OOM A;  1M40 A;  1FQG A;  2EX2 A;  2E8I A;  1TEM A;  2VGJ A;  1SCW A;  2HDR A;  3G2Y A;  1JTD A;  1XGI A;  4DDY A;  4WZ5 C;  2Y2L A;  2Y2Q A;  1H8Y A;  3N8S A;  4RA7 A;  5EVL A;  3IH8 A;  4F94 A;  1BLS A;  3A3I A;  1PI4 A;  1N4O A;  4ZDX A;  5TR7 A;  1HD8 A;  4E3K A;  3HLD A;  1PI5 A;  4KZA A;  3BM6 A;  4UA7 A;  5CGX A;  3O86 A;  5JYP A;  4K0X A;  3NI9 A;  3O88 A;  5EE8 A;  2WYX A;  3WRZ A;  3A3F A;  2WKE A;  1CI9 A;  3G31 A;  4P87 A;  3UE3 A;  4HBU A;  3Q82 A;  4S2K A;  5GHZ A;  1I2W A;  3VFH A;  1ZG6 A;  3TG9 A;  1NJ4 A;  3G34 A;  5U47 A;  3QNB A;  3GVB A;  1ZKJ A;  2WUQ A;  3FV7 A;  4LCM A;  2WGI A;  5FAT A;  3C4O A;  3BFC A;  2H10 A;  3HLC A;  4PM8 A;  2Y4A A;  5CGS A;  2OSU A;  2P9V B;  2ZQ9 A;  3M6B A;  2HP9 A;  4DE0 A;  1FCO A;  1PZP A;  3PBN A;  4ID4 A;  3FYZ A;  3IF6 A;  4GN2 A;  5GLA A;  3VP2 A;  4QY6 A;  1PW1 A;  3SOI A;  2JBF A;  1KVM A;  4QU3 A;  1Y54 A;  4BL2 A;  1IEM A;  1RCJ A;  2HDQ A;  2H0Y A;  5DTS A;  1FR1 A;  1K6R A;  3P09 A;  4KG2 A;  3TSG A;  2BG1 A;  3FWL A;  2PU4 A;  5J8X A;  4OON A;  4OPZ A;  1JWP A;  3G4P A;  2G2W A;  3FZC A;  5CRF A;  3E2K A;  4JF6 A;  2DNS A;  4YIN A;  1YLW A;  3N7W A;  4X6T A;  2VGK A;  5EVI D;  5AQB A;  1KGE A;  3SH8 A;  3VP0 A;  3ZNT A;  5CHJ A;  3ZVT A;  3VSL A;  1OME A;  3WS2 A;  3OCN A;  2EFX A;  4OH0 A;  2C5W B;  4IED A;  4S2P A;  4EQI A;  4R3J A;  1XKZ A;  1CK3 A;  4OLD A;  3WRT A;  1FR6 A;  1JWV A;  3GSG A;  1TVF A;  3Q81 A;  4FD8 A;  4Y7P A;  2XDM A;  3FKW A;  3UO9 A;  2WZX A;  4KZ9 A;  4MEZ A;  2OV5 A;  1E3U D;  3LY4 A;  4JLF A;  3N6I A;  5F1G A;  1NZO A;  3IXB A;  1KDS A;  3LY3 A;  5EVI C;  3RXX A;  2G2U A;  1YLT A;  4WMC D;  3BFE A;  3E2L A;  3OPR A;  4R4S A;  5G18 A;  2ZQ8 A;  3ZFZ A;  2ZM8 A;  5JYO A;  3W8K A;  1W7F A;  2GDN A;  2EFU A;  2XF3 A;  3IF5 A;  3VOY A;  1TDG A;  3FKV A;  4S2N C;  4ZJ2 A;  1YLY A;  1L0F A;  1K55 A;  3Q7V B;  3NDE A;  5CGW A;  1NXY A;  1LI9 A;  2XLN A;  4BL3 A;  2WAE A;  3NDG A;  1XGJ A;  3BLS A;  1WE4 A;  1IYP A;  2ZD8 A;  5EOE A;  3G32 A;  1MBL A;  1NRF A;  3V3R A;  1K54 C;  1QME A;  4LV3 A;  4PM6 A;  1AXB A;  1ONH A;  5FQM A;  1Z6F A;  2EXA A;  3AGD A;  1CEF A;  4XUX A;  3SH7 A;  3A3E A;  4WMC A;  5FAQ A;  4JXG A;  5CXW A;  4JPM A;  2HPB A;  4ZAM A;  3ZG5 A;  3OC2 A;  5FQQ A;  3AGE A;  4N1X A;  4OOL A;  3ZDJ A;  1QMF A;  1WYB A;  4S2L A;  4HBT A;  3HLW A;  1YM1 A;  1W8Q A;  3IHA A;  3UDI A;  2CC1 A;  4RYE A;  1LL9 A;  1S0W A;  4O7D A;  2WK0 A;  3ITA A;  4WEJ A;  4JBF A;  5A93 A;  4EBL A;  3CMZ A;  2ZQD A;  3IWO A;  4EV4 A;  2PU2 A;  4E3M A;  3S4X A;  1ES4 A;  3IXD A;  3SS4 A;  4E3N A;  1ONG A;  3O3V A;  4OP8 A;  3DTM A;  5FAS A;  4L0L A;  4K91 A;  2A49 A;  4WZ5 A;  4X69 A;  3VFF A;  5FI7 A;  1TDL A;  3W4P A;  2Z2M B;  4E3J A;  2ZMA A;  1YT4 A;  1ZG4 A;  2ZC4 B;  4KEN B;  1BT5 A;  2ZJ9 A;  4LEN A;  3IQA A;  3CG5 A;  3QNC A;  4R1G A;  2QPN A;  4FH4 A;  1RGY A;  1SDE A;  3UN7 A;  3PBO A;  4KQR A;  5GLD A;  3PBQ A;  1JWZ A;  4B88 A;  1K57 C;  4GD8 A;  5M1A A;  4OKP A;  1KDW A;  5F82 A;  4DXB A;  4N9K A;  3M2K A;  4E6W A;  1K4E A;  3G30 A;  3BEC A;  2WGW A;  3D4F A;  4RX3 A;  3TOI A;  5KSC A;  2PBY A;  4QHC A;  4M3K A;  3S22 A;  5FI6 A;  1KGG A;  3UPP A;  4OPY A;  5HX9 A; 
#chains in the Genus database with same CATH topology
 4OVD A;  4IJG A;  1KE4 A;  1NYM A;  3DAV A;  4P85 A;  1IKI A;  4WM9 A;  4M4X A;  3VP4 A;  2EWV A;  3GRJ A;  4CLC B;  1DJA A;  3CWF A;  4MNR A;  1S6R A;  4E6X A;  3OPL A;  1VHM A;  1ACF A;  2VGL S;  3FPW A;  3G2Z A;  1YLZ A;  5F1F A;  4KZ5 A;  3GR2 A;  4DE1 A;  5FDS A;  2NUT C;  3R7W A;  4JF4 A;  3SS5 A;  4DMZ A;  1DP6 A;  4NET A;  4EXO A;  4Y15 A;  3UNW A;  2EA9 A;  2W0N A;  4PKY G;  2WKR A;  3LFV A;  5C5K A;  1XJ4 A;  1RP5 A;  4ZBE A;  1I5Q A;  3FG8 A;  3C30 A;  1OT9 A;  1V9Z A;  3OLO A;  1D7E A;  3MSH A;  4QB8 A;  4JKT A;  1E3U A;  2WKP A;  2YKF A;  3ZG0 A;  2QMI A;  3EWK A;  2Y2K A;  4S2I A;  3N8R A;  3ZG9 B;  5FAO A;  3CIT A;  3WS4 A;  1H0M A;  3MQ0 A;  4IVK A;  4GB7 A;  1C3B A;  4QD4 A;  4ARZ B;  2XR0 A;  5EOO A;  4N9L A;  1W79 A;  4JXS A;  2XK1 A;  2P74 A;  4MLL A;  2WGW B;  2ZM2 A;  3MFX A;  4Q0H A;  4GD6 A;  5TBM B;  1PIO A;  3MMH A;  4Y5F A;  3NUL A;  3VE3 A;  3P98 A;  2QZ6 A;  5A90 A;  2LB5 A;  3RH8 B;  4DKI A;  3VMA A;  2L1M A;  5AQ7 A;  2GZA A;  5M19 A;  4LV0 A;  1XXM A;  2KDK A;  3UDX A;  4NK3 A;  2FFF B;  5E2H A;  4BLM A;  3VOL A;  2JHE A;  4GOG A;  4WBG A;  4ZRR A;  2KOI A;  2Y55 A;  3BFG A;  2Q0O A;  2QWS A;  3MR0 A;  3QP1 A;  4DJ3 A;  4X56 A;  3RJU A;  5HAI A;  2V9A A;  1W63 Q;  2YKH A;  4PM5 A;  3UB7 A;  2I72 A;  4OOY A;  5FI2 A;  3C7U A;  3UE6 A;  3IHB A;  3T1Q B;  4HJ6 A;  4G3K A;  2H0T A;  1MKI A;  3BRM A;  3BJN A;  2XRN A;  1N9B A;  2INW A;  3IT9 A;  4UAA A;  3O87 A;  4GLQ A;  2CMN A;  2WKH A;  4R0Q A;  1LHY A;  3LIA A;  4PM9 A;  3R4K A;  3VV4 A;  4EUZ A;  4N1H A;  3LCE A;  4ETX A;  2W3F A;  2IWC A;  4Z1W A;  3W2Z A;  3BFD A;  3T4T A;  2EX6 A;  3E4Q A;  2UV0 E;  1BLC A;  1HZO A;  3PBT A;  3EGX C;  1LLB A;  3GEC A;  2V0W A;  3QP4 A;  4PHT A;  2X02 A;  3FC7 A;  4H6J A;  2RL3 A;  4LLO B;  3U2A A;  3MZD A;  4G3W A;  5L8M A;  3T4S A;  1KGF A;  1ERM A;  3Q07 A;  1J9M A;  3IXG A;  2R9X A;  2V20 A;  4EEP A;  1Z09 A;  3DTK A;  5EPH A;  1AWI A;  1CF0 A;  2HJ9 C;  2ZC6 B;  4P0M A;  1VET B;  4I3J A;  5GL9 A;  3GQZ A;  4BBU A;  2XD1 A;  2JCH A;  3UE1 A;  1F98 A;  4DRT A;  4A5R A;  3C4P A;  3S7O A;  1F5M A;  3HLB A;  1G28 A;  1GHI A;  1K56 A;  3EQU A;  1VEU A;  1F9I A;  3U4L P;  4OOM A;  3EEA A;  4NXF A;  3T1S A;  2E8I A;  1TEM A;  2HDR A;  1JTD A;  1XGI A;  2O99 A;  4WZ5 C;  1H8Y A;  1PI4 A;  3IS2 A;  3HLD A;  5CGX A;  4HP4 A;  2O9A A;  3O86 A;  3MQQ A;  5JYP A;  4K0X A;  3WRZ A;  3T4L A;  2WKE A;  3T4O A;  3G31 A;  1BYW A;  2VV8 A;  3Q82 A;  4S2K A;  1I2W A;  3VFH A;  1ODV A;  5U47 A;  3GVB A;  4R3A A;  4PM8 A;  2OSU A;  5TBM A;  2HP9 A;  1PZP A;  3PBN A;  3HJI A;  5GLA A;  3VP2 A;  3SOI A;  1PW1 A;  5HDS A;  4QU3 A;  4BL2 A;  1RCJ A;  5DTS A;  3PXP A;  5I5L A;  4R38 A;  3TSG A;  2BG1 A;  2ZL1 B;  2P7J A;  3FWL A;  5J7E A;  4OON A;  1JWP A;  2G2W A;  3FZC A;  3E2K A;  4YIN A;  5EVI D;  3ZNT A;  5AQB A;  1N9N A;  2EFX A;  5J3W A;  4XT2 B;  4IED A;  4R3J A;  2W3H A;  3BQA A;  3WRT A;  1JWV A;  3TE8 A;  3Q81 A;  2XDM A;  3UO9 A;  2OV5 A;  2V8C A;  3LY4 A;  3N6I A;  5HSQ A;  1S1Y A;  3IXB A;  3LY3 A;  3RXX A;  4R4S A;  2ZQ8 A;  3W8K A;  2EFU A;  1TDG A;  1L0F A;  3NDE A;  4GW9 A;  5EOE A;  1LT0 A;  1PFL A;  1QME A;  3NEC A;  1AXB A;  1Z6F A;  3A0V A;  3AGD A;  1CEF A;  1VB6 A;  4HOI A;  2PD7 A;  3T4K A;  2W3D A;  2HPB A;  2O9C A;  1TS0 A;  2E8J A;  4MDZ A;  1LL9 A;  1EW0 A;  4O7D A;  3K3C A;  1UGU A;  1T1C A;  3LIC A;  4HI4 A;  4WEJ A;  5A93 A;  4EBL A;  4EV4 A;  3KYE A;  2PU2 A;  4NXG A;  4E3M A;  3F1O A;  1ONG A;  3O3V A;  4ESP A;  4L0L A;  2Z2M B;  4F3L A;  1ZG4 A;  3IQA A;  3HCY A;  2OWH A;  4R1G A;  5HL6 A;  3UME A;  3UN7 A;  5GLD A;  4DXB A;  4LFU A;  4E6W A;  1SKO A;  1OTE A;  4BMW A;  3D4F A;  3H7W A;  2VLG A;  5KSC A;  1K0K A;  4M3K A;  3K3D A;  1KGG A;  3UPP A;  2ZBB A;  3CPT B;  5FQI A;  1PZO A;  4X53 A;  4Q8I A;  4E3I A;  3EOI A;  4KQQ A;  5L10 A;  4GJ4 A;  1OTI A;  5KSH A;  3DTI A;  4GHI A;  4RX2 A;  3WS1 A;  3KSF A;  3GTC A;  1YQS A;  4L9E A;  4I38 A;  5J4E A;  2UWX A;  3O5Y A;  5FSR A;  4WL9 A;  1W5D A;  1HTZ A;  2XFS A;  5GLC A;  2QJ5 A;  3E4P A;  3VE4 A;  4KQO A;  3DWK A;  4HQA A;  4EWF A;  1DP9 A;  1G6A A;  3T4Q A;  5EVI A;  5CHU A;  2M7V A;  2A24 B;  5LBR A;  2W3G A;  3QP8 A;  4MCW A;  3CAX A;  5L2F A;  4U0T A;  5GHY A;  4KZ7 A;  3V50 A;  4C75 A;  3LR3 A;  1J3W A;  3PHY A;  1K54 A;  1PWC A;  1P0Z A;  2ZL1 A;  3BW6 A;  3UDF A;  3VOZ A;  1XPB A;  4UA9 A;  4WZ4 A;  4JGQ A;  3LGO A;  1ZTU A;  1TS7 A;  1DY6 A;  2K2N A;  5G4Z A;  3L9K A;  5EVE A;  4PPR A;  4HJ4 A;  1OT6 A;  5DVA A;  4EW7 A;  4C3Q A;  4OQG A;  3NIA A;  1Q2Q A;  3EQV A;  4S2M A;  4E3L A;  3WS5 A;  3IF6 B;  1XA1 A;  4AFI A;  3BFF A;  1GA0 A;  1CEG A;  2J8Y A;  2BTF P;  3C5A A;  3C8C A;  5CER A;  2JC7 A;  3G35 A;  3ISG A;  3CZD A;  3HL9 A;  2HDU A;  1MKM A;  3CJM A;  4JGR A;  5KZH A;  3MXR A;  2XQZ A;  1Q2P A;  2ZMV A;  2JN7 A;  3A3J A;  1JNU A;  1K4F A;  1EWZ A;  1G6O A;  2ZQC A;  2ACG A;  2ZQA A;  1DJC A;  4E3O A;  3ZGA B;  1XA7 A;  4YFM A;  1IYQ A;  4GZB A;  5M18 A;  5FQ9 A;  5FQK A;  1SDN A;  2Y91 A;  4RVA A;  5EFW A;  4KZ3 A;  3MFD A;  2BAS A;  3WWX A;  3C7V A;  4U3T A;  1BZA A;  5A91 A;  1K25 A;  5AQA A;  3PR6 A;  1CI8 A;  3LI8 A;  3MZE A;  3C38 A;  1H3Q A;  1JTG A;  1FSW A;  3LR5 A;  3Q7Z A;  2PRF A;  2V1Z A;  1S66 L;  5DFY A;  4I3A A;  4B4Z A;  4CLC D;  4X68 A;  2XRO A;  4EES A;  5FL3 A;  2P9V A;  5E43 A;  3JYI A;  3KSG A;  1UWP X;  3LIB A;  1PRQ A;  1FOF A;  2XH9 A;  4MBF A;  2J3T D;  2B02 A;  4Z9Q A;  3HUN A;  1U60 A;  2VEA A;  4JF5 A;  4LRX C;  5IT5 A;  3KX0 X;  3MS6 A;  2Y2H A;  1MXO A;  1HLU P;  1EI5 A;  2EWW A;  2PDR A;  4UEY A;  2Q9N A;  4YOF A;  4D2O A;  3IX8 A;  4Y3I A;  4GS9 B;  5TGF A;  4I3I A;  3H82 B;  4DF6 A;  4MBK A;  4OP5 A;  1YLJ A;  4LV1 A;  4X55 A;  3UB9 A;  3PBR A;  1K56 D;  2H28 A;  3PYP A;  1ERQ A;  3E4O A;  3PAG A;  4R3B A;  4NKP A;  2M1C A;  5CHM A;  2JKT M;  1F2K A;  2B5R A;  3MXS A;  1OTA A;  1VQQ A;  3F1N A;  3OCL A;  4WEL A;  3VP1 A;  3Q7V A;  5AJG A;  3IH9 A;  3UE0 A;  5DTT A;  3MZF A;  3ZG8 B;  4IHQ A;  5FDH A;  1M6K A;  3M2J A;  4BD1 A;  4HP9 A;  5EVL A;  3IH8 A;  1N4O A;  4E3K A;  3EEH A;  1A0K A;  5EE8 A;  3GDI A;  4P87 A;  4HBU A;  5GHZ A;  2GX5 A;  1NJ4 A;  3FV7 A;  2ZOH A;  2WGI A;  1IOU A;  3C4O A;  2VK3 A;  4BBT A;  1XJ6 A;  5CGS A;  2ZQ9 A;  5TJJ A;  2W1T B;  3M6B A;  1S1Z A;  3IF6 A;  2GJ3 A;  3ULF A;  2VA0 A;  1Y54 A;  1IEM A;  2W1R A;  3T50 A;  2HDQ A;  5CRF A;  4JF6 A;  2DNS A;  5F68 A;  3N7W A;  2VGK A;  5CHJ A;  5HD5 A;  3VSL A;  2O9B A;  4OH0 A;  1D1J A;  3EGD C;  4EQI A;  1FR6 A;  3LUQ A;  4FD8 A;  4Y7P A;  3FKW A;  4KZ9 A;  5F1G A;  1G5U A;  1NZO A;  1KDS A;  3NOP C;  5DKL A;  5EVI C;  2M7U A;  4CLC A;  3BWL A;  3E2L A;  3OPR A;  1DP8 A;  1N9L A;  2GDN A;  2VX8 A;  3IF5 A;  5CGW A;  4BL3 A;  2WAE A;  3NDG A;  4WUJ A;  1WE4 A;  1DRM A;  3KYZ A;  5HDD A;  4EEU A;  3G32 A;  3QP6 A;  1MBL A;  4PM6 A;  1K54 C;  3UB8 A;  4JXG A;  4I5S A;  3ZG5 A;  3LR0 A;  4N1X A;  4MN7 A;  1YM1 A;  1W8Q A;  3IHA A;  2HGV A;  4RYE A;  3JVV A;  4P6Z S;  4YWZ A;  3MF0 A;  4II7 A;  2HJE A;  3IWO A;  1GSX A;  5HZH A;  2R78 A;  1LSW A;  1ES4 A;  4E3N A;  5FAS A;  3DTM A;  1PNE A;  4X69 A;  4B93 A;  3SZT A;  4JGP A;  3BY8 A;  1YT4 A;  1D06 A;  2ZJ9 A;  4JGO A;  3QNC A;  4FH4 A;  4ARZ A;  2VKS A;  1SDE A;  3TW8 A;  5HPI A;  5F82 A;  4K08 A;  1NRJ A;  3M2K A;  3G30 A;  3BEC A;  2WGW A;  3TOI A;  1S4S A;  3DTE A;  5HX9 A;  5DJT A;  4EUV A;  1FSY A;  1YKD A;  1L0D A;  4NXE A;  5DTK A;  3SH9 A;  3F1P B;  3W4O A;  4BD0 A;  1XX2 A;  2Z6C A;  4KZ4 A;  4DDS A;  4WLA A;  4E04 A;  2XFT A;  4PM7 A;  1OJ5 A;  2A3U A;  1LSV A;  1BLH A;  4IVI A;  1LL8 A;  1NY0 A;  4GKU A;  2A2L A;  1ERO A;  2DRW A;  4Y0O A;  3UY6 A;  2WAF A;  3HUM A;  4P6B A;  2QYB A;  2HDS A;  1YPR A;  3HRE A;  3OOV A;  3MQO A;  2ZQ7 A;  1KVL A;  4XXR A;  2W1T A;  3JPU A;  1ES5 A;  5BOH A;  2O0Y A;  3CLO A;  3NBL A;  4S2N A;  2XD5 A;  4DXC A;  3V39 A;  5HFO A;  4GCZ A;  3MJQ A;  5L07 A;  5FQJ A;  1P9R A;  1GHP A;  4FH2 A;  4R4R A;  3VP3 A;  3VSK A;  4ZJ1 A;  4JXV A;  1GSV A;  4HJ3 A;  1UWN X;  3IXH A;  1IYS A;  2OWJ A;  1T18 A;  2JE5 A;  5CEB A;  2WZZ A;  5E2E A;  1JVJ A;  3Q1F A;  5KIZ A;  3HUO A;  3ZG7 B;  1SKF A;  1ALQ A;  4OLG A;  1KOU A;  3BQ8 A;  1NYY A;  5MC7 A;  2P08 A;  3V67 A;  1OTD A;  4ETZ A;  3PBS A;  1ZC2 A;  2D02 A;  3IBR A;  1GCE A;  1E4D A;  1BUL A;  3W4Q A;  5F6A A;  3KYQ A;  2IWD A;  1ESI A;  2JKR M;  1H5X A;  2Q9M A;  3FPV A;  3NC8 A;  4GDB A;  1VET A;  5DF9 A;  1YLP A;  1FCM A;  4EU0 A;  2ZC7 A;  1XJ2 A;  2PR5 A;  2BLS A;  1E25 A;  2X71 A;  4O01 A;  5EM1 A;  3CUE A;  4N92 A;  3IX4 A;  1BSG A;  2R9W A;  5FA7 A;  1IKG A;  4B9O A;  3B42 A;  3RTY A;  3PTE A;  3IF6 C;  3IWQ A;  2J3W A;  1LL5 A;  1L0E A;  2L0W A;  2WGV A;  5F83 A;  4QWO A;  3UPN A;  4KG5 A;  1YSP A;  2XEP A;  1OTB A;  2Y2M A;  4LV2 A;  4EBP A;  4HH3 A;  2ZC5 B;  3NCK A;  2D01 A;  2ZLY A;  5AQ9 A;  4UA6 A;  4KG6 A;  1XJ3 A;  2WAD A;  4CLC C;  1MY8 A;  1ES2 A;  4MMN A;  3HLE A;  4D60 A;  5CEC A;  3LO7 A;  4O0P A;  2X01 A;  1ES3 A;  4XT2 A;  2V1B A;  3N8L A;  5D3O A;  2B18 A;  2J3T C;  3P7N A;  2OOL A;  3HLG A;  3I7J A;  2I9V A;  4LPZ A;  1X0O A;  5IU1 A;  1PWG A;  3E98 A;  3AGF A;  1MWS A;  3UB6 A;  1PYY A;  3MKF A;  4HNB A;  4IBR A;  2PR6 A;  5IHV A;  3OZH A;  5GLB A;  5CTM A;  4IUH A;  4OPQ A;  1O07 A;  1XFN A;  4L9G A;  2K7S A;  3UMD A;  4OQI A;  1BTL A;  3LIF A;  4BEN A;  1FQG A;  1SCW A;  3G2Y A;  4DDY A;  3E0Y A;  2Y2L A;  1P97 A;  2Y2Q A;  3N8S A;  4RA7 A;  2QHK A;  2JKF A;  5FEF A;  1FIK A;  1HD8 A;  3IBJ A;  1P9W A;  1PI5 A;  3BM6 A;  4UA7 A;  3NI9 A;  2WYX A;  4Q0J A;  4NEE D;  1CI9 A;  3UE3 A;  1ZG6 A;  4P6Z M;  3G34 A;  2WUQ A;  4LCM A;  5FAT A;  2HV1 A;  3HLC A;  2Y4A A;  4UQI S;  1CJF A;  1FCO A;  4ID4 A;  3FYZ A;  4LGW A;  1XFQ A;  1H8M A;  4QY6 A;  1YSQ A;  4LRZ E;  4MN5 A;  4G3V A;  3ICY A;  1WA9 A;  5HDC A;  1K6R A;  3P09 A;  4KG2 A;  2PU4 A;  5J8X A;  3SW1 A;  4OPZ A;  3G4P A;  2VV6 A;  4H6J B;  4X6T A;  1S4R A;  3VP0 A;  1KGE A;  5HWT A;  3ZVT A;  1IFQ A;  5K5B A;  1OME A;  3WS2 A;  3OCN A;  3CPT A;  3ZYT A;  2C5W B;  2QJ7 A;  4S2P A;  1XKZ A;  1CK3 A;  4PAU A;  4FTX A;  1TVF A;  3QP2 A;  2WZX A;  4MEZ A;  4JLF A;  2J80 A;  4HY8 A;  2LB9 A;  5IS1 A;  4Q0I A;  5G18 A;  3ZFZ A;  2ZM8 A;  2XF3 A;  4S2N C;  4ZJ2 A;  1YLY A;  1K55 A;  1LI9 A;  2XLN A;  1CQA A;  2HF6 A;  1VEU B;  2ZD8 A;  3V3R A;  4LV3 A;  4EET B;  1ONH A;  5FQM A;  2EXA A;  4XUX A;  3SH7 A;  3A3E A;  4WMC A;  5FAQ A;  3LI9 A;  5CXW A;  2JKT I;  4JPM A;  3NOU C;  4PKY A;  4ZAM A;  3OC2 A;  2A24 A;  4Y13 A;  4NG2 A;  3ZDJ A;  1QMF A;  4HBT A;  3HLW A;  3IS2 B;  1Y28 A;  5DKK A;  1S0W A;  3D72 A;  3A0R A;  2WK0 A;  3ITA A;  4JBF A;  2ZQD A;  3T1R A;  3S4X A;  1T19 A;  2XSS A;  4K91 A;  2ZOI A;  1TS6 A;  3VFF A;  4FUW A;  5FI7 A;  1TDL A;  3TJZ C;  3W4P A;  4E3J A;  2ZMA A;  2ZC4 B;  4KEN B;  3HJK A;  4LEN A;  3CG5 A;  2XA7 M;  3UB5 P;  1RGY A;  2W27 A;  3D3O A;  3PBO A;  4KQR A;  3PBQ A;  4B88 A;  4GD8 A;  1KDW A;  4KQD A;  1K4E A;  1OPX A;  4QHC A;  5FI6 A;  4OPY A;  3S1Y A;  4OQ0 A;  1OJG A;  2Y2N A;  1L2S A;  4OPR A;  1RGZ A;  2J9O A;  1T1A A;  4HES A;  4U0X A;  4QJG A;  1WYC A;  3CUE C;  1DJB A;  4K0W A;  5A92 A;  4QPR A;  3DW0 A;  3IWI A;  4HHD A;  2FH5 A;  1K38 A;  3MXQ A;  3CHW P;  4OQH A;  4WEK A;  2J7V A;  2Y2I A;  5I94 A;  3DBA A;  2C6W B;  2RCX A;  5E2G A;  1FCN A;  1TS8 A;  4GNU A;  2PHY A;  2Y79 A;  4BJP A;  1XP4 A;  3BYD A;  4Y0T A;  3GMW A;  5HAP A;  3H9W A;  3LID A;  4JXW A;  2PD8 A;  3V3S A;  1MPL A;  3ZCZ A;  3ITB A;  2J9P A;  5HAQ A;  2XGN A;  3QHY A;  3DWZ A;  3WS0 A;  4CQH A;  3ZNY A;  5CED A;  4BQM A;  3F1O B;  2PAV P;  1KE3 A;  3NY4 A;  4LRY C;  1TF1 A;  4FCF A;  4R23 A;  1GA9 A;  4F3L B;  2MJ6 A;  1ESU A;  5DF8 A;  2ZC3 B;  5CX7 A;  2EX9 A;  2EXB A;  5G4Y A;  4FSF A;  5HD3 A;  2Z2L B;  3ZVW A;  3LYX A;  4XUZ A;  1SKO B;  3H7W B;  3T1X A;  1H8Z A;  4QY5 A;  5HL1 A;  1MWU A;  3B3X A;  3BEB A;  5EEC A;  3S7P A;  2ZM0 A;  4GDN A;  1MWT A;  3M6H A;  4BWI A;  1YMX A;  2WKI A;  2Y59 A;  3MBZ A;  4GS9 A;  5DFX A;  3A3D A;  4GHI B;  3H82 A;  4HIA A;  3LIE A;  2NUP C;  1K57 A;  1I2S A;  1K6S A;  1IEL A;  3V5M A;  4S2O A;  5A8B A;  1GHM A;  2HP6 A;  5HWW A;  4KZ6 A;  3OPH A;  1HVB A;  5HPF A;  1LI0 A;  1SHV A;  2Y2P A;  4IBX A;  3BLM A;  1IYO A;  3S7N A;  1W8Y A;  4DE3 A;  2KX6 A;  5E2F A;  1V9Y A;  4I39 A;  3SS3 A;  4HEF A;  5EVI B;  1GSW A;  4B4X A;  5HAR A;  1L3L A;  1SZV A;  4DN0 A;  2PBD P;  4UHU A;  2OLU A;  2FFY A;  5TFQ A;  5HW3 A;  4KZB A;  2H5S A;  5GHX A;  3TRC A;  3UPO A;  3MKE A;  3K2N A;  4X1L A;  2K31 A;  5FAP A;  2V2F F;  4HH2 A;  3IX3 A;  4KUO A;  4MN6 A;  3ZHH A;  5CTN A;  1BLP A;  4ZJ3 A;  4ZTK A;  4DE2 A;  2HZ5 A;  2OAP 1;  3HBR A;  5EV0 A;  4CPK A;  1ZHH B;  1G68 A;  3OPP A;  2B95 A;  4LCL A;  4O8G A;  4UQI M;  5EUA A;  2VV7 A;  3N4I A;  1PW8 A;  2Y2G A;  3JVU A;  5L09 A;  2Y2J A;  4EBN A;  3LEZ A;  4H8R A;  4KZ8 A;  3KSI A;  1NLZ A;  2IWB A;  2OLV A;  4DJ2 A;  4YNR A;  4BBV A;  4WYY A;  4MBH A;  1VM1 A;  2PYP A;  1PWD A;  2DCF A;  4S2J A;  2XA7 S;  1K55 C;  1O7E A;  1YAX A;  5DF7 A;  1KE0 A;  2VGL M;  3A0S A;  2Y2O A;  1NZU A;  2HP5 A;  3HLF A;  1MWR A;  1YMS A;  1BUE A;  1LSX A;  2EX8 A;  1Y4O A;  1L0G A;  2ZMF A;  4L9F A;  4CJN A;  3ZQ5 A;  3GV9 A;  3QP5 A;  3KSH A;  3PAE A;  2JKR I;  4ME4 A;  3P01 A;  4PMA A;  5KMW A;  3RXW A;  4C6Y A;  4Y0U A;  3HVF A;  4IUK A;  3G6O A;  1M40 A;  2EX2 A;  3NHQ A;  4FOF A;  2VGJ A;  1N9O A;  3LEQ A;  4F94 A;  2DMW A;  1BLS A;  3A3I A;  2KLI A;  3D9Y A;  2VJW A;  4ZDX A;  5TR7 A;  1MZU A;  4KZA A;  1STZ A;  5AVF A;  3O88 A;  2G7U A;  3A3F A;  2P04 A;  4R70 A;  3C2W A;  3TG9 A;  3R7W B;  3QNB A;  1ZKJ A;  3BFC A;  5F69 A;  2H10 A;  2P9V B;  4DE0 A;  4GN2 A;  2JBF A;  1KVM A;  3S7Q A;  4X25 A;  2H0Y A;  1FR1 A;  5AVE A;  4Y2F A;  1YLW A;  3SH8 A;  2FZ0 A;  4OLD A;  2AVX A;  3T12 B;  3GSG A;  5F5Y A;  4Y17 A;  3B47 A;  5EM0 A;  3F1P A;  3B33 A;  1E3U D;  2QKP A;  1TD5 A;  2G2U A;  1YLT A;  4WMC D;  3BFE A;  5JYO A;  1W7F A;  4X1M A;  3VOY A;  3FKV A;  3LR4 A;  3F1N B;  3Q7V B;  1NXY A;  1XGJ A;  3BLS A;  1IYP A;  1FIL A;  2Y8H A;  4NXB A;  1NRF A;  1T1B A;  2PYR A;  2IA2 A;  1S67 L;  2Z6D A;  3CI6 A;  4CLC E;  2PT7 A;  1NWZ A;  2JKG A;  3NJA A;  1NLY A;  3AGE A;  3L7H A;  5FQQ A;  4OOL A;  1WYB A;  4S2L A;  5DJU A;  5HWV A;  3UDI A;  2CC1 A;  1MC0 A;  2WKQ A;  3CMZ A;  2VZW A;  4RQ9 A;  3IXD A;  3SS4 A;  5FEG A;  4OP8 A;  2V0U A;  4EQ1 A;  2A49 A;  4WZ5 A;  2V8F A;  2L4R A;  4WF0 A;  1BT5 A;  2W3E A;  2QPN A;  4WN5 A;  4KUK A;  2GNX A;  2OAQ 1;  1JWZ A;  3T4J A;  3KO6 A;  1K57 C;  5M1A A;  4EER A;  4OKP A;  2V1A A;  1W63 M;  4N9K A;  4RX3 A;  3BY9 A;  3RFB A;  2PBY A;  3NOT C;  3OBF A;  3S22 A;  4R6L A; 
#chains in the Genus database with same CATH homology
 5FQI A;  1PZO A;  4X53 A;  3S1Y A;  4OQ0 A;  4Q8I A;  4E3I A;  1FSY A;  2Y2N A;  1L2S A;  4KQQ A;  4OPR A;  4OVD A;  1RGZ A;  1L0D A;  2J9O A;  1KE4 A;  1NYM A;  5DTK A;  4HES A;  3SH9 A;  4P85 A;  1IKI A;  4U0X A;  4QJG A;  1WYC A;  5KSH A;  1DJB A;  3W4O A;  4RX2 A;  3WS1 A;  3GTC A;  4BD0 A;  4WM9 A;  1XX2 A;  4K0W A;  1YQS A;  4KZ4 A;  3VP4 A;  5A92 A;  4DDS A;  3GRJ A;  3DW0 A;  3IWI A;  1DJA A;  4MNR A;  2UWX A;  1S6R A;  1K38 A;  5FSR A;  2XFT A;  4E6X A;  4PM7 A;  4OQH A;  1W5D A;  4WEK A;  1HTZ A;  2J7V A;  2Y2I A;  3OPL A;  5I94 A;  2A3U A;  2XFS A;  2C6W B;  2RCX A;  5E2G A;  1BLH A;  5GLC A;  1FCN A;  4IVI A;  1NY0 A;  4GKU A;  3G2Z A;  1ERO A;  2DRW A;  4GNU A;  1YLZ A;  4KQO A;  4Y0O A;  2WAF A;  4KZ5 A;  3UY6 A;  3DWK A;  4EWF A;  5F1F A;  3GR2 A;  1G6A A;  3HUM A;  4DE1 A;  4BJP A;  1XP4 A;  3BYD A;  4P6B A;  4Y0T A;  4JF4 A;  3SS5 A;  5EVI A;  4NET A;  2HDS A;  3HRE A;  3UNW A;  5CHU A;  3GMW A;  5HAP A;  2ZQ7 A;  4JXW A;  1KVL A;  4XXR A;  1RP5 A;  4ZBE A;  3V3S A;  1MPL A;  1ES5 A;  5BOH A;  1I5Q A;  3ZCZ A;  3ITB A;  2J9P A;  3NBL A;  4S2N A;  2XD5 A;  5HAQ A;  2XGN A;  4DXC A;  3V39 A;  5L2F A;  3QHY A;  5HFO A;  3DWZ A;  4U0T A;  3WS0 A;  5GHY A;  5FQJ A;  4KZ7 A;  4QB8 A;  3V50 A;  4JKT A;  3ZNY A;  4C75 A;  1E3U A;  1GHP A;  4FH2 A;  4R4R A;  3VP3 A;  5CED A;  3VSK A;  1K54 A;  1PWC A;  3ZG0 A;  4ZJ1 A;  4BQM A;  2QMI A;  4JXV A;  2Y2K A;  3UDF A;  3VOZ A;  4S2I A;  1KE3 A;  3NY4 A;  3N8R A;  1XPB A;  4UA9 A;  4FCF A;  3IXH A;  1IYS A;  4R23 A;  4WZ4 A;  3ZG9 B;  5FAO A;  1GA9 A;  3WS4 A;  4IVK A;  4GB7 A;  1DY6 A;  1C3B A;  1ESU A;  4QD4 A;  5DF8 A;  2XR0 A;  5EOO A;  2JE5 A;  2ZC3 B;  4N9L A;  5CEB A;  2WZZ A;  1W79 A;  1JVJ A;  3Q1F A;  5E2E A;  2EX9 A;  3HUO A;  2EXB A;  4JXS A;  4PPR A;  4FSF A;  2XK1 A;  2Z2L B;  1SKF A;  1ALQ A;  5DVA A;  3ZG7 B;  3ZVW A;  4XUZ A;  4OLG A;  2P74 A;  4MLL A;  2WGW B;  2ZM2 A;  1H8Z A;  4QY5 A;  4C3Q A;  5HL1 A;  4OQG A;  1NYY A;  3NIA A;  1MWU A;  3B3X A;  3BEB A;  5EEC A;  2ZM0 A;  4GD6 A;  4GDN A;  1PIO A;  1MWT A;  1Q2Q A;  3EQV A;  3M6H A;  4S2M A;  4E3L A;  3WS5 A;  3PBS A;  3IF6 B;  1ZC2 A;  1XA1 A;  1YMX A;  3BFF A;  1GA0 A;  2WKI A;  2Y59 A;  3P98 A;  2QZ6 A;  3MBZ A;  1GCE A;  1E4D A;  1CEG A;  1BUL A;  2J8Y A;  3A3D A;  3W4Q A;  5A90 A;  3C5A A;  4DKI A;  3VMA A;  5AQ7 A;  2IWD A;  5M19 A;  5CER A;  1ESI A;  1K57 A;  1I2S A;  2JC7 A;  3G35 A;  3CZD A;  1H5X A;  1K6S A;  3ISG A;  4LV0 A;  2Q9M A;  3HL9 A;  2HDU A;  3NC8 A;  1XXM A;  3UDX A;  3CJM A;  1IEL A;  4GDB A;  4NK3 A;  3V5M A;  4S2O A;  2FFF B;  1GHM A;  2HP6 A;  5KZH A;  3MXR A;  5DF9 A;  1YLP A;  5E2H A;  4BLM A;  4KZ6 A;  1FCM A;  3OPH A;  1HVB A;  1LI0 A;  1SHV A;  2Y2P A;  2XQZ A;  4IBX A;  1Q2P A;  1IYO A;  3A3J A;  3BLM A;  1K4F A;  4GOG A;  2ZC7 A;  1W8Y A;  1EWZ A;  2ZQC A;  4WBG A;  2BLS A;  2Y55 A;  1E25 A;  2ZQA A;  3BFG A;  4DE3 A;  1DJC A;  2X71 A;  4E3O A;  3ZGA B;  4X56 A;  1XA7 A;  3RJU A;  4YFM A;  5HAI A;  1IYQ A;  4GZB A;  5E2F A;  4N92 A;  4PM5 A;  1BSG A;  3SS3 A;  5FQ9 A;  5FQK A;  2I72 A;  5M18 A;  4HEF A;  1SDN A;  2R9W A;  5EVI B;  2Y91 A;  4RVA A;  4B4X A;  4KZ3 A;  5HAR A;  4OOY A;  5FI2 A;  5FA7 A;  1IKG A;  3C7U A;  3MFD A;  3WWX A;  3C7V A;  4UHU A;  4U3T A;  3IHB A;  1BZA A;  2OLU A;  2FFY A;  5TFQ A;  5HW3 A;  4KZB A;  2H5S A;  2H0T A;  3PTE A;  3IF6 C;  5A91 A;  5GHX A;  1K25 A;  1MKI A;  3BRM A;  3IWQ A;  3UPO A;  3MKE A;  1N9B A;  1LL5 A;  5AQA A;  3IT9 A;  4UAA A;  1CI8 A;  3MZE A;  3O87 A;  1L0E A;  1JTG A;  2WGV A;  2WKH A;  5F83 A;  5FAP A;  4R0Q A;  1LHY A;  1FSW A;  2V2F F;  3ZHH A;  4PM9 A;  5CTN A;  3UPN A;  3Q7Z A;  4KG5 A;  1BLP A;  4ZJ3 A;  2XEP A;  2V1Z A;  4EUZ A;  4ZTK A;  4DE2 A;  4B4Z A;  2Y2M A;  3HBR A;  4CPK A;  4X68 A;  4LV2 A;  4N1H A;  3LCE A;  1G68 A;  3OPP A;  4EBP A;  2P9V A;  5E43 A;  3JYI A;  4LCL A;  2IWC A;  2ZC5 B;  3NCK A;  5EUA A;  3BFD A;  3N4I A;  1PW8 A;  2EX6 A;  2Y2G A;  1FOF A;  2ZLY A;  2Y2J A;  2XH9 A;  1BLC A;  4MBF A;  1HZO A;  5AQ9 A;  4EBN A;  3PBT A;  3LEZ A;  4H8R A;  4KZ8 A;  1LLB A;  4Z9Q A;  4UA6 A;  4KG6 A;  3HUN A;  1U60 A;  4JF5 A;  2IWB A;  2OLV A;  2WAD A;  1MY8 A;  2Y2H A;  2X02 A;  1MXO A;  1ES2 A;  1EI5 A;  4WYY A;  3HLE A;  5CEC A;  4MBH A;  1VM1 A;  2RL3 A;  3LO7 A;  1PWD A;  2DCF A;  4S2J A;  2X01 A;  3MZD A;  2Q9N A;  1ES3 A;  1K55 C;  4D2O A;  3N8L A;  1O7E A;  1KGF A;  5D3O A;  1ERM A;  3Q07 A;  5DF7 A;  1J9M A;  5TGF A;  1KE0 A;  3IXG A;  2Y2O A;  4DF6 A;  3HLG A;  4MBK A;  2R9X A;  4OP5 A;  1NZU A;  1YLJ A;  2V20 A;  4LV1 A;  2HP5 A;  4X55 A;  3I7J A;  3HLF A;  1MWR A;  3PBR A;  1K56 D;  1YMS A;  5EPH A;  1BUE A;  1ERQ A;  2ZC6 B;  1PWG A;  4P0M A;  2EX8 A;  3AGF A;  1MWS A;  1PYY A;  3MKF A;  3PAG A;  4IBR A;  4R3B A;  5IHV A;  1L0G A;  3OZH A;  5GL9 A;  5GLB A;  3GQZ A;  5CTM A;  2XD1 A;  5CHM A;  2JCH A;  3GV9 A;  4OPQ A;  3UE1 A;  4CJN A;  2B5R A;  3MXS A;  1O07 A;  4DRT A;  1VQQ A;  3PAE A;  4A5R A;  3C4P A;  3OCL A;  4WEL A;  3VP1 A;  3Q7V A;  3HLB A;  4PMA A;  5KMW A;  3IH9 A;  3RXW A;  5DTT A;  1GHI A;  3MZF A;  3UE0 A;  4Y0U A;  3ZG8 B;  4C6Y A;  1K56 A;  5FDH A;  3EQU A;  3HVF A;  1M6K A;  4OQI A;  3M2J A;  4BD1 A;  1BTL A;  4BEN A;  4OOM A;  1M40 A;  1FQG A;  2EX2 A;  2E8I A;  1TEM A;  2VGJ A;  1SCW A;  2HDR A;  3G2Y A;  1JTD A;  1XGI A;  4DDY A;  4WZ5 C;  2Y2L A;  2Y2Q A;  1H8Y A;  3N8S A;  4RA7 A;  5EVL A;  3IH8 A;  4F94 A;  1BLS A;  3A3I A;  1PI4 A;  1N4O A;  4ZDX A;  5TR7 A;  1HD8 A;  4E3K A;  3HLD A;  1PI5 A;  4KZA A;  3BM6 A;  4UA7 A;  5CGX A;  3O86 A;  5JYP A;  4K0X A;  3NI9 A;  3O88 A;  5EE8 A;  2WYX A;  3WRZ A;  3A3F A;  2WKE A;  1CI9 A;  3G31 A;  4P87 A;  3UE3 A;  4HBU A;  3Q82 A;  4S2K A;  5GHZ A;  1I2W A;  3VFH A;  1ZG6 A;  3TG9 A;  1NJ4 A;  3G34 A;  5U47 A;  3QNB A;  3GVB A;  1ZKJ A;  2WUQ A;  3FV7 A;  4LCM A;  2WGI A;  5FAT A;  3C4O A;  3BFC A;  2H10 A;  3HLC A;  4PM8 A;  2Y4A A;  5CGS A;  2OSU A;  2P9V B;  2ZQ9 A;  3M6B A;  2HP9 A;  4DE0 A;  1FCO A;  1PZP A;  3PBN A;  4ID4 A;  3FYZ A;  3IF6 A;  4GN2 A;  5GLA A;  3VP2 A;  4QY6 A;  1PW1 A;  3SOI A;  2JBF A;  1KVM A;  4QU3 A;  1Y54 A;  4BL2 A;  1IEM A;  1RCJ A;  2HDQ A;  2H0Y A;  5DTS A;  1FR1 A;  1K6R A;  3P09 A;  4KG2 A;  3TSG A;  2BG1 A;  3FWL A;  2PU4 A;  5J8X A;  4OON A;  4OPZ A;  1JWP A;  3G4P A;  2G2W A;  3FZC A;  5CRF A;  3E2K A;  4JF6 A;  2DNS A;  4YIN A;  1YLW A;  3N7W A;  4X6T A;  2VGK A;  5EVI D;  5AQB A;  1KGE A;  3SH8 A;  3VP0 A;  3ZNT A;  5CHJ A;  3ZVT A;  3VSL A;  1OME A;  3WS2 A;  3OCN A;  2EFX A;  4OH0 A;  2C5W B;  4IED A;  4S2P A;  4EQI A;  4R3J A;  1XKZ A;  1CK3 A;  4OLD A;  3WRT A;  1FR6 A;  1JWV A;  3GSG A;  1TVF A;  3Q81 A;  4FD8 A;  4Y7P A;  2XDM A;  3FKW A;  3UO9 A;  2WZX A;  4KZ9 A;  4MEZ A;  2OV5 A;  1E3U D;  3LY4 A;  4JLF A;  3N6I A;  5F1G A;  1NZO A;  3IXB A;  1KDS A;  3LY3 A;  5EVI C;  3RXX A;  2G2U A;  1YLT A;  4WMC D;  3BFE A;  3E2L A;  3OPR A;  4R4S A;  5G18 A;  2ZQ8 A;  3ZFZ A;  2ZM8 A;  5JYO A;  3W8K A;  1W7F A;  2GDN A;  2EFU A;  2XF3 A;  3IF5 A;  3VOY A;  1TDG A;  3FKV A;  4S2N C;  4ZJ2 A;  1YLY A;  1L0F A;  1K55 A;  3Q7V B;  3NDE A;  5CGW A;  1NXY A;  1LI9 A;  2XLN A;  4BL3 A;  2WAE A;  3NDG A;  1XGJ A;  3BLS A;  1WE4 A;  1IYP A;  2ZD8 A;  5EOE A;  3G32 A;  1MBL A;  1NRF A;  3V3R A;  1K54 C;  1QME A;  4LV3 A;  4PM6 A;  1AXB A;  1ONH A;  5FQM A;  1Z6F A;  2EXA A;  3AGD A;  1CEF A;  4XUX A;  3SH7 A;  3A3E A;  4WMC A;  5FAQ A;  4JXG A;  5CXW A;  4JPM A;  2HPB A;  4ZAM A;  3ZG5 A;  3OC2 A;  5FQQ A;  3AGE A;  4N1X A;  4OOL A;  3ZDJ A;  1QMF A;  1WYB A;  4S2L A;  4HBT A;  3HLW A;  1YM1 A;  1W8Q A;  3IHA A;  3UDI A;  2CC1 A;  4RYE A;  1LL9 A;  1S0W A;  4O7D A;  2WK0 A;  3ITA A;  4WEJ A;  4JBF A;  5A93 A;  4EBL A;  3CMZ A;  2ZQD A;  3IWO A;  4EV4 A;  2PU2 A;  4E3M A;  3S4X A;  1ES4 A;  3IXD A;  3SS4 A;  4E3N A;  1ONG A;  3O3V A;  4OP8 A;  3DTM A;  5FAS A;  4L0L A;  4K91 A;  2A49 A;  4WZ5 A;  4X69 A;  3VFF A;  5FI7 A;  1TDL A;  3W4P A;  2Z2M B;  4E3J A;  2ZMA A;  1YT4 A;  1ZG4 A;  2ZC4 B;  4KEN B;  1BT5 A;  2ZJ9 A;  4LEN A;  3IQA A;  3CG5 A;  3QNC A;  4R1G A;  2QPN A;  4FH4 A;  1RGY A;  1SDE A;  3UN7 A;  3PBO A;  4KQR A;  5GLD A;  3PBQ A;  1JWZ A;  4B88 A;  1K57 C;  4GD8 A;  5M1A A;  4OKP A;  1KDW A;  5F82 A;  4DXB A;  4N9K A;  3M2K A;  4E6W A;  1K4E A;  3G30 A;  3BEC A;  2WGW A;  3D4F A;  4RX3 A;  3TOI A;  5KSC A;  2PBY A;  4QHC A;  4M3K A;  3S22 A;  5FI6 A;  1KGG A;  3UPP A;  4OPY A;  5HX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...