1LI0A

Crystal structure of tem-32 beta-lactamase at 1.6 angstrom
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMISTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class A beta-Lactamase- TEM-32
publication title The structural bases of antibiotic resistance in the clinically derived mutant beta-lactamases TEM-30, TEM-32, and TEM-34.
pubmed doi rcsb
source organism Escherichia coli
total genus 90
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1li0A00
1BULA 4KZ9A 4OKPA 4XUZA 1PZOA 3A3EA 3SS5A 4BENA 5CGXA 3HLDA 1XA1A 1KDSA 3ITBA 3V3RA 4EV4A 3M2JA 4FD8A 4K91A 5DTSA 2OV5A 5JYPA 1GA0A 2HDRA 3ZNYA 4E3JA 2RCXA 4RX2A 4HBUA 4M3KA 5FQ9A 3W4QA 4WMCD 3DTMA 3Q7ZA 4Y0UA 4EUZA 1K4EA 3PBOA 2XR0A 4UA7A 1ES2A 1GHMA 1CEGA 4IBRA 4OOLA 5AQ9A 3TSGA 4C75A 3BYDA 4N92A 4U0TA 2HP6A 2ZQDA 3O87A 1PWGA 2XGNA 5E2EA 4OP5A 2CC1A 4OP8A 4X68A 2WKHA 5F1FA 3MBZA 3N8SA 4DXCA 3ZG8B 4QJGA 4FH4A 4GKUA 4S2PA 3MKEA 4FH2A 1GHPA 1K56D 1GCEA 3IHAA 4NK3A 4X6TA 5EOOA 4K0WA 5DF8A 2V20A 3P98A 5EVIB 5EVIA 2Y2LA 1NZOA 1NYYA 2PU4A 3G4PA 4PMAA 2G2WA 4YINA 1CI9A 1Y54A 1PIOA 4OQ0A 5E43A 2H10A 3NI9A 2ZQCA 3O3VA 2ZJ9A 4KQQA 1CK3A 1KGGA 4IVKA 5A92A 3ZG9B 1LLBA 3OZHA 5GL9A 5GLBA 3MZDA 3VP3A 1G68A 1HTZA 2R9XA 4WBGA 3IF6C 1YMSA 1W79A 2QPNA 3VSKA 4HESA 1L2SA 3PAEA 3VFHA 4R3BA 2ZM2A 3C4PA 4MNRA 1PI4A 3OCNA 5IHVA 1ERMA 1I2SA 2P9VB 1PYYA 2P9VA 2ZM8A 4BQMA 4Z9QA 3VP4A 3D4FA 5CERA 5A90A 2GDNA 3MFDA 1S0WA 1PW8A 2VGKA 1PW1A 3PBQA 3RXWA 3HBRA 4CPKA 3GTCA 1K6SA 3ZGAB 3N6IA 1ZKJA 3G31A 1XGJA 1IELA 2EX2A 5D3OA 2Y91A 4F94A 1WYCA 4LV0A 1K56A 3UE1A 3UPOA 3FV7A 3Q1FA 1YLPA 3N7WA 3V50A 1LL5A 4E3LA 4GN2A 4QU3A 4KQRA 2PU2A 1GHIA 4KQOA 4P85A 4EBNA 3BFEA 3BLSA 3MZFA 2XF3A 4OPRA 3BFCA 3Q7VB 5FSRA 3WS0A 4X56A 2HDSA 4X53A 3CJMA 3UE0A 4QB8A 2WZZA 1K57A 4PM7A 4XUXA 3M6BA 2ZM0A 3ZHHA 3GSGA 3W4OA 1L0EA 3P09A 2WKEA 2ZC6B 4E3MA 1BZAA 1JTDA 1ES5A 3VFFA 3G34A 1VQQA 4MBHA 1ZG4A 3PBNA 1MWRA 3SH8A 4KZ7A 3HLBA 3BLMA 3C7UA 2Y2QA 3FKWA 3LCEA 1MBLA 1VM1A 1ZG6A 5FATA 2ZD8A 4LV2A 2Y59A 5GLCA 2ZC7A 4GNUA 4GD6A 4R4RA 4EBLA 1TEMA 4WZ5C 5CHUA 5FQJA 4B4ZA 2QZ6A 3C7VA 4S2MA 3WRZA 3O86A 4DRTA 1Q2QA 1RGYA 3OPRA 3G35A 4PM9A 1SKFA 5CXWA 1H8YA 1JWPA 3MXRA 5TFQA 1L0DA 1N4OA 1Q2PA 1E3UD 3FYZA 3A3FA 3GVBA 4XXRA 4IBXA 1FSYA 5HW3A 4ZBEA 1JTGA 3PTEA 1YMXA 4ZTKA 3I7JA 2B5RA 4KG5A 1FR1A 4KZBA 1MWTA 1HZOA 3HLEA 1MWSA 2H0TA 1K6RA 1PWDA 2XH9A 1MWUA 4MEZA 4MLLA 5M19A 2J8YA 1HVBA 4LV1A 2JBFA 1DJBA 1ESUA 1SDNA 3OCLA 2Y2HA 1K54A 3DWZA 2HDQA 5JYOA 4DDYA 1ERQA 1YM1A 1QMFA 2Z2MB 3AGFA 3VOYA 4R23A 4DE2A 1KE3A 1NYMA 4KZAA 4B88A 3S22A 3EQUA 5HAPA 2I72A 4GDBA 5DVAA 2DNSA 3LO7A 5A91A 1J9MA 3IXBA 4OOMA 3LEZA 4ZJ1A 3UNWA 4OPQA 2R9WA 4KZ6A 2EFXA 1IKIA 5CHJA 3VMAA 4S2JA 4S2OA 1LL9A 1SDEA 1K55A 3BECA 3ISGA 1NJ4A 2WYXA 4X69A 2Y2IA 3A3JA 1LHYA 5FI6A 4DF6A 3FWLA 3BEBA 4C6YA 4BD0A 2Y2GA 5BOHA 5J8XA 1ES3A 5DF7A 1ZC2A 4JXVA 2EX8A 2ZQ9A 1PZPA 4QY5A 5M1AA 2XK1A 4OQHA 2C6WB 4OH0A 4DE0A 3WS5A 4K0XA 2EXBA 3NC8A 4IEDA 5HFOA 3OC2A 1FSWA 4HBTA 3HLWA 4P0MA 1H8ZA 4WMCA 5KZHA 4GZBA 1DY6A 4LCLA 2Y2KA 3BRMA 2Z2LB 2XFTA 2C5WB 1MXOA 2ZC5B 3M6HA 1ESIA 4BLMA 3G32A 4HEFA 4B4XA 4LV3A 2DCFA 3BM6A 5CTNA 3WS4A 2V1ZA 2IWBA 1YLYA 3V39A 2OSUA 2ZQAA 5F83A 1KE0A 4ZAMA 4JF4A 4JXGA 4BL3A 4E3OA 1NY0A 1XPBA 1XXMA 1PWCA 5E2GA 2ZQ7A 3CZDA 1MPLA 3DW0A 5FA7A 2ZQ8A 3IQAA 2WAFA 4Q8IA 1MY8A 3G2YA 2WADA 3E2KA 1FCNA 3OPPA 2A49A 4QY6A 2WGWB 1IEMA 1HD8A 2WGWA 1BSGA 2OLUA 3V5MA 2Y2OA 3IF6B 4OPZA 2WAEA 3IF6A 3IH8A 1SCWA 3N8RA 4GOGA 3ZG5A 4O7DA 5AQBA 5F1GA 3ZG0A 2HDUA 3UPPA 5FAPA 4GB7A 4N1HA 3ZVTA 3Q82A 4WELA 4OOYA 2X02A 1O7EA 5I94A 2XLNA 3N8LA 2VGJA 3ZVWA 4DKIA 4KG2A 3TG9A 2X01A 2H0YA 2BLSA 4JXWA 3WS1A 4CJNA 1FCMA 5DTKA 3EQVA 2JE5A 2P74A 3SH7A 4BL2A 3IHBA 4S2NC 2XDMA 3PBSA 1EWZA 2HP9A 5FAOA 2WZXA 4JPMA 4UA6A 4H8RA 4RYEA 1TDGA 4A5RA 1DJAA 3UDFA 3WWXA 5KSCA 2WUQA 3S1YA 1XX2A 1YLZA 3A3IA 5TR7A 4E3NA 1PI5A 3M2KA 2IWCA 1KVMA 2Q9MA 4NETA 5GHZA 2XD5A 3HLGA 3GQZA 4RA7A 3TOIA 5CECA 2G2UA 1W8YA 3G30A 3IXDA 2J9OA 3CMZA 4KENB 1FQGA 3HLFA 3SS4A 1QMEA 1W8QA 3UDXA 2JC7A 1S6RA 5GLAA 1BLHA 3IF5A 4S2LA 1EROA 4PM8A 3AGDA 3HVFA 1RCJA 1KE4A 3V3SA 5FI7A 4JXSA 5EOEA 3QHYA 5FQMA 1NXYA 2BG1A 4KZ8A 5EE8A 5HARA 2ZLYA 4QD4A 2A3UA 1FCOA 5EVIC 2ZC4B 5TGFA 1M40A 3S4XA 1M6KA 2H5SA 1YLWA 1FR6A 3N4IA 3IT9A 4WZ5A 1U60A 5GHYA 2EX6A 3VP0A 1G6AA 3PBRA 4KZ4A 2Y2JA 1BLPA 5E2FA 4ZDXA 1YLJA 4X55A 4DE1A 3Q81A 1IYQA 2FFYA 3FZCA 3LY4A 4KZ3A 1AXBA 2FFFB 1K25A 1IYSA 2Y2MA 3HUMA 1MKIA 4JLFA 5AQAA 3VP1A 1NRFA 3ZCZA 1E3UA 1FOFA 3ZNTA 1BUEA 3MXSA 4UAAA 1KVLA 1IYPA 2XFSA 1E4DA 1IYOA 2ZMAA 4GD8A 3NIAA 5FI2A 3RXXA 4BJPA 3VOZA 2DRWA 5CTMA 2WKIA 4WM9A 1YLTA 4WYYA 3G2ZA 4UA9A 1JWZA 5CGSA 3VP2A 4OLGA 4E3IA 4R4SA 1ONGA 2RL3A 4DXBA 1GA9A 3PAGA 5GLDA 3ITAA 5CRFA 4ZJ3A 5G18A 4KG6A 4N9KA 2X71A 1WE4A 5DTTA 3ZFZA 3RJUA 4IVIA 3ZG7B 1KGFA 4L0LA 3DWKA 5HAQA 5CGWA 3MKFA 3A3DA 2EFUA 2XQZA 3C4OA 3UDIA 4DDSA 3PBTA 4EQIA 3GR2A 3OPLA 1I5QA 2Q9NA 1C3BA 1LI0A 3BFDA 4PM5A 5E2HA 4R3JA 5FQIA 1BTLA 1BT5A 1ALQA 4P87A 3UPNA 3WRTA 4E3KA 2XD1A 4GDNA 5FQKA 1KGEA 1TVFA 4JF5A 4DE3A 3HUOA 4LCMA 4R1GA 1ONHA 3VSLA 2Y2NA 1I2WA 1K57C 2ZC3B 4N1XA 4ID4A 3NY4A 4UHUA 1L0FA 3HLCA 1CEFA 2Y4AA 3BFFA 3AGEA 3IXHA 4PPRA 5FAQA 1XP4A 2EXAA 4C3QA 3HUNA 4U3TA 3O88A 5EECA 1SHVA 4PM6A 4E6WA 1XA7A 1ES4A 2XEPA 1DJCA 1Z6FA 5FDHA 4JF6A 5KMWA 1K4FA 3GRJA 1H5XA 4OQGA 2QMIA 3ZDJA 3CG5A 5A93A 3HREA 5FASA 4D2OA 5F82A 2JCHA 3IH9A 4R0QA 1TDLA 1WYBA 2PBYA 3QNBA 1YT4A 2UWXA 5CHMA 3IWOA 3IWIA 5GHXA 5DF9A 4LENA 4EBPA 5EVLA 2WGVA 3C5AA 3QNCA 4ZJ2A 5EPHA 4E6XA 2WGIA 3IXGA 4U0XA 1JVJA 4OPYA 5L2FA 3Q7VA 5HX9A 3SOIA 5KSHA 1BLCA 3FKVA 2E8IA 3MZEA 3IWQA 3WS2A 2Y55A 3NDGA 3UN7A 2Y2PA 4OONA 2IWDA 1CI8A 3NBLA 4S2IA 4YFMA 1OMEA 1K38A 3UY6A 4WEKA 3NDEA 3W8KA 3LY3A 3GMWA 4RVAA 3W4PA 3B3XA 4JKTA 4JBFA 4FCFA 4QHCA 1N9BA 1L0GA 2J7VA 4MBFA 2HPBA 1NZUA 1JWVA 1RP5A 4FSFA 4MBKA 5AQ7A 1YQSA 5HAIA 5CEBA 1W7FA 2WK0A 1XKZA 1O07A 1K54C 2HP5A 3GV9A 2V2FF 4N9LA 4Y0OA 4S2KA 3BFGA 1BLSA 5FQQA 1W5DA 3UO9A 1E25A 4KZ5A 4OLDA 1KDWA 2J9PA 4OVDA 3SS3A 3OPHA 5HL1A 3HL9A 2EX9A 5EUAA 3UE3A 1IKGA 1XGIA 5M18A 5U47A 3NCKA 1EI5A 4WEJA 1RGZA 3Q07A 3JYIA 1LI9A 5EVID 4P6BA 3SH9A 4Y0TA 4BD1A 3E2LA 4RX3A 5CEDA 4Y7PA 4WZ4A 2OLVA 1K55C 4OQIA 4S2NA 4EWFA
chains in the Genus database with same CATH superfamily
4BENA 4FUWA 5AVFA 3V3RA 1D1JA 1H3QA 2JKRM 5TBMB 3M2JA 3TW8A 3ZNYA 4E3JA 2RCXA 3QP4A 1PNEA 2PRFA 4HJ3A 3PBOA 1ES2A 3TSGA 4IBRA 4OOLA 5AQ9A 3MSHA 5E2EA 4OP5A 4KQDA 1K56D 2V20A 4PMAA 1NZOA 4DMZA 2JKRI 4OQ0A 2W0NA 3MS6A 3NI9A 2IA2A 2ZJ9A 1KGGA 5A92A 3ZG9B 3OZHA 1HTZA 4WBGA 3VSKA 3PAEA 3VFHA 4I39A 1ERMA 1W63Q 1PYYA 2P9VA 4BQMA 1OTIA 4NXBA 5CERA 2O99A 1XFNA 1PW1A 3PBQA 2JKTI 1WYCA 3UE1A 1XJ6A 2W3GA 2PU2A 3MZFA 4OPRA 3EWKA 2XF3A 3WS0A 5FSRA 3C30A 4X56A 4X53A 2PD7A 3H7WA 1DRMA 4PM7A 3K3CA 2EA9A 5DKLA 1VHMA 2WKEA 4NXEA 3VFFA 1V9YA 1VQQA 2O9AA 2VV8A 3HLBA 3BLMA 4LV2A 1DP8A 4EBLA 1P9WA 4WZ5C 3WRZA 1RGYA 4PM9A 1SKFA 2J3TD 1N4OA 1NRJA 2VV6A 1E3UD 3C8CA 1HLUP 4IBXA 4ZBEA 1FIKA 1EW0A 3I7JA 2B5RA 3MQQA 1K6RA 1PWDA 2XH9A 4MEZA 4DJ2A 2JBFA 1DJBA 1ESUA 3T4JA 5I5LA 3NULA 2A24A 4CLCB 2V0UA 1YM1A 3VOYA 4R23A 4DE2A 1NYMA 4B88A 3S7PA 3S22A 2I72A 5DVAA 5A91A 3MR0A 3IXBA 3LEZA 3UNWA 3BWLA 4OPQA 2R9WA 4EESA 2OAP1 3ISGA 2WYXA 3CUEC 2VJWA 3FWLA 4C6YA 2Y2GA 2HV1A 5J8XA 1ZC2A 4O01A 4QY5A 5M1AA 3FPWA 4KUKA 3IX3A 2C6WB 4DE0A 4GCZA 4K08A 2EXBA 3LICA 3NC8A 4IEDA 1FSWA 4P0MA 4LCLA 2Y2KA 3BRMA 4B4XA 1UWPX 3F1OA 4Y3IA 1YLYA 1T18A 3V39A 3IS2A 3BQAA 1VETB 5AJGA 1NY0A 1XXMA 1PWCA 1XJ2A 3IQAA 1T19A 1FCNA 3OPPA 2R78A 4QY6A 2WGWB 4JGPA 4WL9A 3T4LA 3V5MA 2Y2OA 4OPZA 2G7UA 3ZG0A 3DTEA 5J3WA 2XLNA 2YKFA 1NLZA 4JGOA 3ZVWA 5FDSA 3NOUC 3PBSA 4UQIS 1EWZA 2HP9A 5FAOA 3UDFA 2WUQA 4NKPA 1OT9A 1XX2A 5TR7A 4E3NA 5G4YA 3M2KA 4R3AA 1KVMA 3TOIA 4KENB 1FQGA 2PYPA 1W8QA 2BTFP 2L0WA 4WF0A 1S6RA 3IF5A 2JKFA 4I3IA 1EROA 4PM8A 2ZOIA 3KSFA 3T1XA 4GS9B 4WUJA 4BBTA 2BG1A 2KX6A 5HARA 2ZLYA 4QD4A 2VEAA 3PYPA 2WKQA 5EVIC 5FL3A 3ZQ5A 1FR6A 5GHYA 3PBRA 4X55A 3Q81A 2FFYA 3LY4A 4KZ3A 2FFFB 1K25A 1VB6A 3LFVA 4HH3A 3VP1A 2B18A 1E3UA 1FOFA 3ZNTA 3D3OA 4GD8A 3VOZA 4E3IA 4Y5FA 3IBJA 1F9IA 3L7HA 2W3EA 4L0LA 3DWKA 1TD5A 2XQZA 4DJ3A 4DDSA 2XSSA 3O5YA 4R3JA 5FQIA 3UPNA 4P87A 4E3KA 4Y15A 3E4QA 4E04A 1KGEA 4LCMA 3T1SA 2OWHA 2ZC3B 3EEAA 3BFFA 3IXHA 1XP4A 3HUNA 1YPRA 2GNXA 1Z6FA 4ESPA 5FDHA 1H5XA 5A93A 2QMIA 3CG5A 4D2OA 3UB9A 1TDLA 3QNBA 3IWOA 3IWIA 4PAUA 4LENA 4EBPA 3QP6A 1S4SA 5EVLA 4IHQA 4OPYA 5L2FA 3EOIA 2E8IA 3MZEA 1OJ5A 3UN7A 4S2IA 1CI8A 1OMEA 3UY6A 3KSHA 3LY3A 1OTEA 4LGWA 1N9BA 1L0GA 1D7EA 4HP9A 3NJAA 1YQSA 5TJJA 2WK0A 4CLCD 4N9LA 4NG2A 3GV9A 4ARZA 2ZL1A 3R7WB 4OLDA 2J9PA 4OVDA 3IX4A 5M18A 3E2LA 2OLVA 4XUZA 2ZMFA 1KDSA 4Q0JA 4EETB 3ITBA 4X1MA 1SKOB 1GA0A 2HDRA 4MN7A 2UV0E 3Q7ZA 4Y0UA 4EUZA 5L07A 1GHMA 1CEGA 1XJ4A 3UMDA 1PWGA 2CC1A 4EU0A 3ZG8B 4FH4A 4GKUA 3DTKA 4FH2A 2I9VA 4NK3A 5EOOA 3UE3A 4Q0IA 5EVIB 3P98A 4NXFA 1NYYA 2G2WA 1Y54A 3T1QB 3C38A 3VP3A 2INWA 3IF6C 4BMWA 2M7UA 3BW6A 4R3BA 2ZM2A 4HH2A 5IHVA 2FZ0A 5EM0A 2ZM8A 3OLOA 3T50A 3QP2A 2VGKA 4HHDA 2VLGA 3RXWA 3HBRA 4CPKA 1K6SA 3ZGAB 1IELA 4F94A 4LV0A 3UB8A 1YLPA 4G3KA 1OTDA 3KSIA 4E3LA 4Z1WA 4QU3A 4L9EA 4EBNA 4P85A 2CMNA 3BFEA 4ETXA 5F69A 4HOIA 2O9BA 3F1PB 3CI6A 1JTDA 2QHKA 3KO6A 3G34A 1ZHHB 1MWRA 3C7UA 3FKWA 3LR3A 4LFUA 1S67L 4R4RA 4B4ZA 2QZ6A 3O86A 4DRTA 3MF0A 3A0VA 5DFYA 1JWPA 3MXRA 3JPUA 1L0DA 3FYZA 3A3FA 3FPVA 3RFBA 4L9GA 1YMXA 4ZTKA 1FR1A 4KZBA 1MWTA 2O0YA 1MWSA 1TS8A 2H0TA 4MLLA 1MWUA 3DBAA 1CJFA 5M19A 2J8YA 1HVBA 4LV1A 1DP6A 3OCLA 2W1RA 1K54A 4CLCA 4EW7A 1KE3A 4UEYA 3NECA 3LO7A 4EEUA 4KZ6A 1IKIA 5CHJA 4S2JA 4I3JA 4S2OA 1CQAA 2P08A 1LL9A 1K55A 1NJ4A 4X69A 4EQ1A 2Y2IA 5FI6A 4DF6A 5BOHA 3QP1A 2HJ9C 2EX8A 2ZQ9A 4HIAA 1PZPA 3OBFA 2XK1A 4OH0A 3U4LP 4K0XA 5IS1A 1F2KA 2K31A 3V67A 4LLOB 3PXPA 4HBTA 1JNUA 5KZHA 4GZBA 2XFTA 1OTBA 3H82B 1MXOA 3KSGA 3M6HA 2DCFA 3LR4A 3E0YA 2OSUA 2ZQAA 5F83A 1VETA 4JF4A 4BL3A 1XPBA 5E2GA 1MPLA 3DW0A 2ZQ8A 2WAFA 4O0PA 1MY8A 2WADA 3E2KA 4EUVA 4HY8A 2WGWA 3IF6B 2WAEA 4GOGA 3IH8A 4F3LB 3K2NA 4LRZE 3UPPA 5FAPA 2PBDP 2KLIA 1O7EA 1F5MA 2JHEA 3N8LA 4KG2A 2AVXA 2P74A 3SH7A 3IHBA 1MC0A 2XDMA 2WZXA 4UA6A 4FTXA 2NUTC 5KSCA 2PR6A 5HL6A 2IWCA 5GHZA 4NETA 2XD5A 3CITA 4UQIM 3G30A 5L8MA 3IXDA 3CPTB 3CMZA 3SS4A 1L3LA 1QMEA 3UDXA 1BLHA 4I38A 2QKPA 4GS9A 2VGLS 3DAVA 2OWJA 4G3WA 1M40A 4WZ5A 2HF6A 5HWWA 3LR5A 1UWNX 5E2FA 4PKYA 1OT6A 2Y79A 4I3AA 1MKIA 1OTAA 1NRFA 2VK3A 3ZCZA 3E98A 1BUEA 2XFSA 1E4DA 1IYOA 3NIAA 3MMHA 5FI2A 3RXXA 4BJPA 5CTMA 1YLTA 3G2ZA 3LIDA 1JWZA 4AFIA 3ITAA 5CRFA 1VEUB 4KG6A 4N9KA 4IVIA 3ZG7B 1IFQA 5HAQA 3MKFA 3A3DA 2EFUA 1S1YA 3C4OA 3UDIA 1C3BA 1LI0A 1BT5A 1ALQA 4HP4A 3UB6A 4GDNA 5FQKA 4R1GA 1ONHA 4BBVA 2V1AA 2Y2NA 1I2WA 1K57C 4N1XA 4ID4A 3NY4A 3CUEA 1CEFA 3E4OA 3LR0A 2OAQ1 1NWZA 3O88A 4R70A 3KYZA 3TJZC 3B47A 2XEPA 3LIFA 4JF6A 1K4FA 3ICYA 5FASA 5F82A 5MC7A 4R0QA 3KYEA 1WYBA 4ETZA 1D06A 2Q0OA 5GHXA 2E8JA 5DF9A 1LT0A 2WGVA 3C5AA 4EXOA 1BLCA 4O8GA 3IWQA 4MCWA 4OONA 4YFMA 4P6ZS 3W8KA 3GMWA 4RVAA 1CF0A 4JBFA 4JKTA 4FCFA 1G5UA 4MBFA 5AQ7A 5A8BA 5CEBA 1XKZA 3BFGA 1BLSA 2L1MA 3UO9A 3R7WA 1E25A 3OPHA 2P04A 3SW1A 2W1TA 2EX9A 4YOFA 1DP9A 2J3WA 3JYIA 4HJ6A 3SH9A 4Y0TA 2HZ5A 4HJ4A 2J3TC 1SZVA 5L10A 4OQIA 1BULA 4KZ9A 4OKPA 5CGXA 3KYQA 2KDKA 4ME4A 1LSWA 1SKOA 4G3VA 4K91A 5JYPA 4HBUA 2FH5A 4M3KA 5FQ9A 1YSPA 3R4KA 2XR0A 4C75A 4N92A 4Q0HA 2HP6A 2ZQDA 3O87A 2XGNA 4OP8A 2WKHA 3IBRA 5F1FA 3N8SA 4EERA 4DXCA 4S2PA 1AWIA 1GSWA 1ZTUA 4K0WA 5DF8A 5EVIA 2Y2LA 2PU4A 4HQAA 1CI9A 1PIOA 5E43A 2H10A 1A0KA 3O3VA 4M4XA 4KQQA 2EWWA 3EGXC 5GL9A 2K7SA 4MDZA 4YWZA 3VE4A 2QPNA 4HI4A 4HESA 1L2SA 4R6LA 2A2LA 2HGVA 2PYRA 4MNRA 4Y17A 3OCNA 1I2SA 4LPZA 5LBRA 4Z9QA 3NHQA 1XJ3A 3VP4A 4X1LA 2PDRA 3MFDA 1S0WA 2D01A 3RTYA 5HPFA 2MJ6A 3N6IA 3T1RA 5D3OA 2EX2A 3T4TA 4IJGA 3FV7A 2V0WA 1LL5A 4GN2A 3BQ8A 1GHIA 1TS6A 3BLSA 3F1NB 3BFCA 2HDSA 3CJMA 3UE0A 4QB8A 2WZZA 4XUXA 3T12B 3ZHHA 5HD3A 3F1PA 2XA7M 3P09A 2ZC6B 1TS0A 4E3MA 1BZAA 3G6OA 5HPIA 4MBHA 3PBNA 4KZ7A 3U2AA 1S4RA 2B95A 1ODVA 5FATA 2ZD8A 3ULFA 5GLCA 4GNUA 2W1TB 3IX8A 5FQJA 3C7VA 1YSQA 4S2MA 4WLAA 4CQHA 1Q2QA 3OPRA 1P9RA 5TFQA 4LRXC 4Y2FA 3GECA 4D60A 3GVBA 1FSYA 4BWIA 5HW3A 1JTGA 4KG5A 1HZOA 3HLEA 1H8MA 1S66L 3LI8A 4DDYA 1ERQA 1QMFA 2Z2MB 3RH8B 5HD5A 1BYWA 5EFWA 3EQUA 2WKRA 3D72A 1XFQA 4NXGA 1SDEA 1WA9A 1STZA 1GSXA 1LHYA 3A3JA 3BEBA 3P01A 1ES3A 4JXVA 1H0MA 2ACGA 1H8ZA 2C5WB 3KX0X 3H82A 4GHIB 3G32A 3BM6A 3LIAA 2IWBA 5FEGA 4NEED 2ZQ7A 5FA7A 3G2YA 4H6JB 2A49A 5F6AA 1IEMA 1HD8A 2M1CA 3IF6A 3ZG5A 1SCWA 4GLQA 4F3LA 5F1GA 4HNBA 2Z6DA 5HWVA 3ZVTA 3Q82A 4OOYA 3B42A 5I94A 4DKIA 2H0YA 4JXWA 2VX8A 3WS1A 3H9WA 5CX7A 5DTKA 3EQVA 4BL2A 4S2NC 4WN5A 4JPMA 4H8RA 4RQ9A 4A5RA 1DJAA 3WWXA 1P0ZA 5HWTA 3FC7A 3HLGA 3GQZA 4RA7A 5CECA 2G2UA 3GDIA 3LGOA 3CPTA 4CLCC 5KIZA 3HLFA 3DTIA 2PAVP 2DMWA 2O9CA 5DFXA 5GLAA 4EEPA 4S2LA 3AGDA 3HVFA 1KE4A 5G4ZA 5FI7A 5EOEA 5FQMA 1NXYA 3W2ZA 5J4EA 2Y8HA 2ZC4B 5TGFA 1LL8A 3N4IA 3QP8A 1U60A 4YNRA 3VP0A 4KZ4A 2Y2JA 3S7OA 3BY8A 1YLJA 4DE1A 2VGLM 1IYQA 3T4KA 3FZCA 1AXBA 1IYSA 2Y2MA 3LIEA 4UAAA 3MXSA 1KVLA 4B9OA 4LRYC 2DRWA 2WKIA 4WM9A 4WYYA 3VP2A 4UA9A 1PRQA 1ONGA 2RL3A 4DXBA 2LB9A 4IUKA 3PAGA 5GLDA 4ZJ3A 5G18A 1VEUA 5DTTA 1WE4A 3RJUA 2W3HA 1LSVA 2JKTM 4EQIA 3PBTA 2PT7A 3JVVA 3OPLA 2Q9NA 5J7EA 3BFDA 4PM5A 5E2HA 5HDDA 2JKGA 4JGQA 3D9YA 4DE3A 1TVFA 1Y28A 5EM1A 1V9ZA 4MN6A 2Y4AA 3AGEA 4PPRA 2EXAA 1SHVA 4PM6A 4E6WA 1DJCA 2OOLA 5KMWA 4OQGA 1TS7A 2JCHA 3IH9A 2W3DA 2JN7A 2XRNA 1YT4A 2UWXA 5CHMA 5EPHA 1PFLA 1JVJA 1X0OA 3Q7VA 5KSHA 3OOVA 3FKVA 2Y55A 3NDGA 2Y2PA 3NBLA 1K38A 1G6OA 3W4PA 3B3XA 3LUQA 4QHCA 2J7VA 2V9AA 2HPBA 1NZUA 1RP5A 4FSFA 1W7FA 2BASA 4S2KA 5FQQA 4P6ZM 2V8FA 4PKYG 1KDWA 5HL1A 3HL9A 5EUAA 2P7JA 4CLCE 1IKGA 3EEHA 5F68A 1ACFA 1XGIA 3UE6A 1RGZA 1S1ZA 5EVID 1FILA 4RX3A 5CEDA 4WZ4A 2V1BA 1GHPA 2X01A 4EWFA 5K5BA 1PZOA 3A3EA 3SS5A 3HLDA 1XA1A 1W63M 4EV4A 4FD8A 5DTSA 2OV5A 4RX2A 3W4QA 4WMCD 2GZAA 3DTMA 1K4EA 4UA7A 3BYDA 3T4QA 4U0TA 4X68A 3MBZA 2KOIA 4QJGA 3MKEA 1GCEA 3IHAA 3S7NA 4X6TA 3G4PA 2QJ5A 3FG8A 4YINA 2GJ3A 4KUOA 5DJUA 5AVEA 3A0RA 2ZQCA 1CK3A 4IVKA 3MXQA 1LLBA 5GLBA 3MZDA 1G68A 2R9XA 4MN5A 1YMSA 1W79A 2VKSA 3C4PA 2V8CA 1PI4A 2P9VB 3LIBA 4B93A 2QYBA 3D4FA 5A90A 2GDNA 1PW8A 3GTCA 2PHYA 1ZKJA 3G31A 1XGJA 2Y91A 3UB5P 2VZWA 1K56A 3UPOA 2W3FA 1G28A 4PHTA 3Q1FA 3NOPC 3N7WA 3V50A 4R38A 5HSQA 4KQRA 5HDSA 4KQOA 3Q7VB 3F1NA 3H7WB 4JGRA 2PR5A 1K57A 3M6BA 4II7A 2ZM0A 3GSGA 2D02A 3L9KA 3W4OA 3MQOA 1L0EA 1N9LA 1N9OA 1ES5A 3TRCA 5IT5A 5L09A 3JVUA 4BBUA 1ZG4A 2NUPC 3S7QA 3SH8A 3PHYA 4QPRA 4X25A 5DKKA 2Y2QA 3LCEA 1MBLA 1VM1A 1ZG6A 1UGUA 2Y59A 3BY9A 2ZC7A 2ZMVA 4GD6A 1TEMA 5CHUA 2W27A 3G35A 5CXWA 1H8YA 3CHWP 1Q2PA 1Z09A 4XXRA 2ZBBA 3PTEA 3CLOA 3A0SA 3CAXA 1K0KA 1SDNA 2Y2HA 3LYXA 4XT2A 2A24B 3DWZA 2HDQA 5JYOA 3HJIA 3AGFA 1YAXA 4KZAA 4GJ4A 1T1AA 5HAPA 4GDBA 2DNSA 1J9MA 4OOMA 3TE8A 3SZTA 4ZJ1A 2J80A 2Z6CA 2VA0A 2YKHA 2EFXA 3VMAA 2LB5A 3BECA 4I5SA 4BD0A 3ZYTA 5DF7A 3T4OA 4OQHA 5HZHA 3WS5A 2QWSA 5HFOA 1F98A 3OC2A 3HLWA 1MKMA 4WMCA 1DY6A 2Z2LB 2ZC5B 1ESIA 4BLMA 3UMEA 4GHIA 4HEFA 4LV3A 2QJ7A 1MZUA 5CTNA 3WS4A 2V1ZA 3F1OB 3IS2B 1KE0A 3LI9A 4ZAMA 4JXGA 4E3OA 3CZDA 4Q8IA 3PR6A 4H6JA 1T1BA 3MJQA 1BSGA 2OLUA 3N8RA 4O7DA 5AQBA 2M7VA 2HDUA 4GB7A 3UB7A 4N1HA 3B33A 4WELA 1J3WA 2X02A 2VGJA 3HCYA 3TG9A 4CJNA 2BLSA 1FCMA 2JE5A 5F5YA 4RYEA 1TDGA 1N9NA 3S1YA 1YLZA 3A3IA 1PI5A 2Q9MA 5IU1A 3QP5A 1W8YA 2XROA 1T1CA 2J9OA 1KOUA 2JC7A 4MMNA 1RCJA 1GSVA 5C5KA 3V3SA 4JXSA 3QHYA 4XT2B 4KZ8A 5EE8A 2A3UA 4Y13A 1FCOA 2GX5A 2EWVA 2H28A 3CWFA 1M6KA 3S4XA 2H5SA 1YLWA 3IT9A 2EX6A 1G6AA 2K2NA 1BLPA 4ZDXA 1OJGA 5TBMA 4DN0A 3HUMA 1P97A 4JLFA 5AQAA 1OPXA 3LEQA 4GW9A 1IYPA 2ZMAA 2PD8A 5CGSA 4OLGA 4R4SA 1GA9A 1YKDA 4IUHA 3ZFZA 2X71A 1KGFA 3T4SA 3VE3A 5CGWA 1Y4OA 3BJNA 3EGDC 3GR2A 1I5QA 3WRTA 1BTLA 2ZOHA 2XD1A 4JF5A 3E4PA 3HUOA 3VSLA 4UHUA 5DJTA 3VOLA 1L0FA 3HLCA 3MQ0A 5FAQA 4C3QA 2B02A 4U3TA 5EECA 1LSXA 1ES4A 1XA7A 2VV7A 1IOUA 3GRJA 3ZDJA 3HREA 2HJEA 2PBYA 3VV4A 1TF1A 2XA7S 3QNCA 4ZJ2A 4E6XA 2WGIA 3MFXA 4ZRRA 3IXGA 4U0XA 5HX9A 3SOIA 3WS2A 2IWDA 4WEKA 3NDEA 2L4RA 5HAIA 1JWVA 4MBKA 4FOFA 4L9FA 3HJKA 5HDCA 4Y0OA 1O07A 1K54C 2HP5A 2V2FF 3P7NA 4ARZB 2ZL1B 1W5DA 5FEFA 4KZ5A 4QWOA 3SS3A 5EV0A 2WKPA 5U47A 3NCKA 1EI5A 5EVEA 4WEJA 3Q07A 1LI9A 4P6BA 3NOTC 4BD1A 3C2WA 4Y7PA 3K3DA 1NLYA 1K55C 4S2NA
chains in the Genus database with same CATH topology
1BULA 4KZ9A 4OKPA 4XUZA 1PZOA 3A3EA 3SS5A 4BENA 5CGXA 3HLDA 1XA1A 1KDSA 3ITBA 3V3RA 4EV4A 3M2JA 4FD8A 4K91A 5DTSA 2OV5A 5JYPA 1GA0A 2HDRA 3ZNYA 4E3JA 2RCXA 4RX2A 4HBUA 4M3KA 5FQ9A 3W4QA 4WMCD 3DTMA 3Q7ZA 4Y0UA 4EUZA 1K4EA 3PBOA 2XR0A 4UA7A 1ES2A 1GHMA 1CEGA 4IBRA 4OOLA 5AQ9A 3TSGA 4C75A 3BYDA 4N92A 4U0TA 2HP6A 2ZQDA 3O87A 1PWGA 2XGNA 5E2EA 4OP5A 2CC1A 4OP8A 4X68A 2WKHA 5F1FA 3MBZA 3N8SA 4DXCA 3ZG8B 4QJGA 4FH4A 4GKUA 4S2PA 3MKEA 4FH2A 1GHPA 1K56D 1GCEA 3IHAA 4NK3A 4X6TA 5EOOA 4K0WA 5DF8A 2V20A 3P98A 5EVIB 5EVIA 2Y2LA 1NZOA 1NYYA 2PU4A 3G4PA 4PMAA 2G2WA 4YINA 1CI9A 1Y54A 1PIOA 4OQ0A 5E43A 2H10A 3NI9A 2ZQCA 3O3VA 2ZJ9A 4KQQA 1CK3A 1KGGA 4IVKA 5A92A 3ZG9B 1LLBA 3OZHA 5GL9A 5GLBA 3MZDA 3VP3A 1G68A 1HTZA 2R9XA 4WBGA 3IF6C 1YMSA 1W79A 2QPNA 3VSKA 4HESA 1L2SA 3PAEA 3VFHA 4R3BA 2ZM2A 3C4PA 4MNRA 1PI4A 3OCNA 5IHVA 1ERMA 1I2SA 2P9VB 1PYYA 2P9VA 2ZM8A 4BQMA 4Z9QA 3VP4A 3D4FA 5CERA 5A90A 2GDNA 3MFDA 1S0WA 1PW8A 2VGKA 1PW1A 3PBQA 3RXWA 3HBRA 4CPKA 3GTCA 1K6SA 3ZGAB 3N6IA 1ZKJA 3G31A 1XGJA 1IELA 2EX2A 5D3OA 2Y91A 4F94A 1WYCA 4LV0A 1K56A 3UE1A 3UPOA 3FV7A 3Q1FA 1YLPA 3N7WA 3V50A 1LL5A 4E3LA 4GN2A 4QU3A 4KQRA 2PU2A 1GHIA 4KQOA 4P85A 4EBNA 3BFEA 3BLSA 3MZFA 2XF3A 4OPRA 3BFCA 3Q7VB 5FSRA 3WS0A 4X56A 2HDSA 4X53A 3CJMA 3UE0A 4QB8A 2WZZA 1K57A 4PM7A 4XUXA 3M6BA 2ZM0A 3ZHHA 3GSGA 3W4OA 1L0EA 3P09A 2WKEA 2ZC6B 4E3MA 1BZAA 1JTDA 1ES5A 3VFFA 3G34A 1VQQA 4MBHA 1ZG4A 3PBNA 1MWRA 3SH8A 4KZ7A 3HLBA 3BLMA 3C7UA 2Y2QA 3FKWA 3LCEA 1MBLA 1VM1A 1ZG6A 5FATA 2ZD8A 4LV2A 2Y59A 5GLCA 2ZC7A 4GNUA 4GD6A 4R4RA 4EBLA 1TEMA 4WZ5C 5CHUA 5FQJA 4B4ZA 2QZ6A 3C7VA 4S2MA 3WRZA 3O86A 4DRTA 1Q2QA 1RGYA 3OPRA 3G35A 4PM9A 1SKFA 5CXWA 1H8YA 1JWPA 3MXRA 5TFQA 1L0DA 1N4OA 1Q2PA 1E3UD 3FYZA 3A3FA 3GVBA 4XXRA 4IBXA 1FSYA 5HW3A 4ZBEA 1JTGA 3PTEA 1YMXA 4ZTKA 3I7JA 2B5RA 4KG5A 1FR1A 4KZBA 1MWTA 1HZOA 3HLEA 1MWSA 2H0TA 1K6RA 1PWDA 2XH9A 1MWUA 4MEZA 4MLLA 5M19A 2J8YA 1HVBA 4LV1A 2JBFA 1DJBA 1ESUA 1SDNA 3OCLA 2Y2HA 1K54A 3DWZA 2HDQA 5JYOA 4DDYA 1ERQA 1YM1A 1QMFA 2Z2MB 3AGFA 3VOYA 4R23A 4DE2A 1KE3A 1NYMA 4KZAA 4B88A 3S22A 3EQUA 5HAPA 2I72A 4GDBA 5DVAA 2DNSA 3LO7A 5A91A 1J9MA 3IXBA 4OOMA 3LEZA 4ZJ1A 3UNWA 4OPQA 2R9WA 4KZ6A 2EFXA 1IKIA 5CHJA 3VMAA 4S2JA 4S2OA 1LL9A 1SDEA 1K55A 3BECA 3ISGA 1NJ4A 2WYXA 4X69A 2Y2IA 3A3JA 1LHYA 5FI6A 4DF6A 3FWLA 3BEBA 4C6YA 4BD0A 2Y2GA 5BOHA 5J8XA 1ES3A 5DF7A 1ZC2A 4JXVA 2EX8A 2ZQ9A 1PZPA 4QY5A 5M1AA 2XK1A 4OQHA 2C6WB 4OH0A 4DE0A 3WS5A 4K0XA 2EXBA 3NC8A 4IEDA 5HFOA 3OC2A 1FSWA 4HBTA 3HLWA 4P0MA 1H8ZA 4WMCA 5KZHA 4GZBA 1DY6A 4LCLA 2Y2KA 3BRMA 2Z2LB 2XFTA 2C5WB 1MXOA 2ZC5B 3M6HA 1ESIA 4BLMA 3G32A 4HEFA 4B4XA 4LV3A 2DCFA 3BM6A 5CTNA 3WS4A 2V1ZA 2IWBA 1YLYA 3V39A 2OSUA 2ZQAA 5F83A 1KE0A 4ZAMA 4JF4A 4JXGA 4BL3A 4E3OA 1NY0A 1XPBA 1XXMA 1PWCA 5E2GA 2ZQ7A 3CZDA 1MPLA 3DW0A 5FA7A 2ZQ8A 3IQAA 2WAFA 4Q8IA 1MY8A 3G2YA 2WADA 3E2KA 1FCNA 3OPPA 2A49A 4QY6A 2WGWB 1IEMA 1HD8A 2WGWA 1BSGA 2OLUA 3V5MA 2Y2OA 3IF6B 4OPZA 2WAEA 3IF6A 3IH8A 1SCWA 3N8RA 4GOGA 3ZG5A 4O7DA 5AQBA 5F1GA 3ZG0A 2HDUA 3UPPA 5FAPA 4GB7A 4N1HA 3ZVTA 3Q82A 4WELA 4OOYA 2X02A 1O7EA 5I94A 2XLNA 3N8LA 2VGJA 3ZVWA 4DKIA 4KG2A 3TG9A 2X01A 2H0YA 2BLSA 4JXWA 3WS1A 4CJNA 1FCMA 5DTKA 3EQVA 2JE5A 2P74A 3SH7A 4BL2A 3IHBA 4S2NC 2XDMA 3PBSA 1EWZA 2HP9A 5FAOA 2WZXA 4JPMA 4UA6A 4H8RA 4RYEA 1TDGA 4A5RA 1DJAA 3UDFA 3WWXA 5KSCA 2WUQA 3S1YA 1XX2A 1YLZA 3A3IA 5TR7A 4E3NA 1PI5A 3M2KA 2IWCA 1KVMA 2Q9MA 4NETA 5GHZA 2XD5A 3HLGA 3GQZA 4RA7A 3TOIA 5CECA 2G2UA 1W8YA 3G30A 3IXDA 2J9OA 3CMZA 4KENB 1FQGA 3HLFA 3SS4A 1QMEA 1W8QA 3UDXA 2JC7A 1S6RA 5GLAA 1BLHA 3IF5A 4S2LA 1EROA 4PM8A 3AGDA 3HVFA 1RCJA 1KE4A 3V3SA 5FI7A 4JXSA 5EOEA 3QHYA 5FQMA 1NXYA 2BG1A 4KZ8A 5EE8A 5HARA 2ZLYA 4QD4A 2A3UA 1FCOA 5EVIC 2ZC4B 5TGFA 1M40A 3S4XA 1M6KA 2H5SA 1YLWA 1FR6A 3N4IA 3IT9A 4WZ5A 1U60A 5GHYA 2EX6A 3VP0A 1G6AA 3PBRA 4KZ4A 2Y2JA 1BLPA 5E2FA 4ZDXA 1YLJA 4X55A 4DE1A 3Q81A 1IYQA 2FFYA 3FZCA 3LY4A 4KZ3A 1AXBA 2FFFB 1K25A 1IYSA 2Y2MA 3HUMA 1MKIA 4JLFA 5AQAA 3VP1A 1NRFA 3ZCZA 1E3UA 1FOFA 3ZNTA 1BUEA 3MXSA 4UAAA 1KVLA 1IYPA 2XFSA 1E4DA 1IYOA 2ZMAA 4GD8A 3NIAA 5FI2A 3RXXA 4BJPA 3VOZA 2DRWA 5CTMA 2WKIA 4WM9A 1YLTA 4WYYA 3G2ZA 4UA9A 1JWZA 5CGSA 3VP2A 4OLGA 4E3IA 4R4SA 1ONGA 2RL3A 4DXBA 1GA9A 3PAGA 5GLDA 3ITAA 5CRFA 4ZJ3A 5G18A 4KG6A 4N9KA 2X71A 1WE4A 5DTTA 3ZFZA 3RJUA 4IVIA 3ZG7B 1KGFA 4L0LA 3DWKA 5HAQA 5CGWA 3MKFA 3A3DA 2EFUA 2XQZA 3C4OA 3UDIA 4DDSA 3PBTA 4EQIA 3GR2A 3OPLA 1I5QA 2Q9NA 1C3BA 1LI0A 3BFDA 4PM5A 5E2HA 4R3JA 5FQIA 1BTLA 1BT5A 1ALQA 4P87A 3UPNA 3WRTA 4E3KA 2XD1A 4GDNA 5FQKA 1KGEA 1TVFA 4JF5A 4DE3A 3HUOA 4LCMA 4R1GA 1ONHA 3VSLA 2Y2NA 1I2WA 1K57C 2ZC3B 4N1XA 4ID4A 3NY4A 4UHUA 1L0FA 3HLCA 1CEFA 2Y4AA 3BFFA 3AGEA 3IXHA 4PPRA 5FAQA 1XP4A 2EXAA 4C3QA 3HUNA 4U3TA 3O88A 5EECA 1SHVA 4PM6A 4E6WA 1XA7A 1ES4A 2XEPA 1DJCA 1Z6FA 5FDHA 4JF6A 5KMWA 1K4FA 3GRJA 1H5XA 4OQGA 2QMIA 3ZDJA 3CG5A 5A93A 3HREA 5FASA 4D2OA 5F82A 2JCHA 3IH9A 4R0QA 1TDLA 1WYBA 2PBYA 3QNBA 1YT4A 2UWXA 5CHMA 3IWOA 3IWIA 5GHXA 5DF9A 4LENA 4EBPA 5EVLA 2WGVA 3C5AA 3QNCA 4ZJ2A 5EPHA 4E6XA 2WGIA 3IXGA 4U0XA 1JVJA 4OPYA 5L2FA 3Q7VA 5HX9A 3SOIA 5KSHA 1BLCA 3FKVA 2E8IA 3MZEA 3IWQA 3WS2A 2Y55A 3NDGA 3UN7A 2Y2PA 4OONA 2IWDA 1CI8A 3NBLA 4S2IA 4YFMA 1OMEA 1K38A 3UY6A 4WEKA 3NDEA 3W8KA 3LY3A 3GMWA 4RVAA 3W4PA 3B3XA 4JKTA 4JBFA 4FCFA 4QHCA 1N9BA 1L0GA 2J7VA 4MBFA 2HPBA 1NZUA 1JWVA 1RP5A 4FSFA 4MBKA 5AQ7A 1YQSA 5HAIA 5CEBA 1W7FA 2WK0A 1XKZA 1O07A 1K54C 2HP5A 3GV9A 2V2FF 4N9LA 4Y0OA 4S2KA 3BFGA 1BLSA 5FQQA 1W5DA 3UO9A 1E25A 4KZ5A 4OLDA 1KDWA 2J9PA 4OVDA 3SS3A 3OPHA 5HL1A 3HL9A 2EX9A 5EUAA 3UE3A 1IKGA 1XGIA 5M18A 5U47A 3NCKA 1EI5A 4WEJA 1RGZA 3Q07A 3JYIA 1LI9A 5EVID 4P6BA 3SH9A 4Y0TA 4BD1A 3E2LA 4RX3A 5CEDA 4Y7PA 4WZ4A 2OLVA 1K55C 4OQIA 4S2NA 4EWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BUL A;  4KZ9 A;  4OKP A;  4XUZ A;  1PZO A;  3A3E A;  3SS5 A;  4BEN A;  5CGX A;  3HLD A;  1XA1 A;  1KDS A;  3ITB A;  3V3R A;  4EV4 A;  3M2J A;  4FD8 A;  4K91 A;  5DTS A;  2OV5 A;  5JYP A;  1GA0 A;  2HDR A;  3ZNY A;  4E3J A;  2RCX A;  4RX2 A;  4HBU A;  4M3K A;  5FQ9 A;  3W4Q A;  4WMC D;  3DTM A;  3Q7Z A;  4Y0U A;  4EUZ A;  1K4E A;  3PBO A;  2XR0 A;  4UA7 A;  1ES2 A;  1GHM A;  1CEG A;  4IBR A;  4OOL A;  5AQ9 A;  3TSG A;  4C75 A;  3BYD A;  4N92 A;  4U0T A;  2HP6 A;  2ZQD A;  3O87 A;  1PWG A;  2XGN A;  5E2E A;  4OP5 A;  2CC1 A;  4OP8 A;  4X68 A;  2WKH A;  5F1F A;  3MBZ A;  3N8S A;  4DXC A;  3ZG8 B;  4QJG A;  4FH4 A;  4GKU A;  4S2P A;  3MKE A;  4FH2 A;  1GHP A;  1K56 D;  1GCE A;  3IHA A;  4NK3 A;  4X6T A;  5EOO A;  4K0W A;  5DF8 A;  2V20 A;  3P98 A;  5EVI B;  5EVI A;  2Y2L A;  1NZO A;  1NYY A;  2PU4 A;  3G4P A;  4PMA A;  2G2W A;  4YIN A;  1CI9 A;  1Y54 A;  1PIO A;  4OQ0 A;  5E43 A;  2H10 A;  3NI9 A;  2ZQC A;  3O3V A;  2ZJ9 A;  4KQQ A;  1CK3 A;  1KGG A;  4IVK A;  5A92 A;  3ZG9 B;  1LLB A;  3OZH A;  5GL9 A;  5GLB A;  3MZD A;  3VP3 A;  1G68 A;  1HTZ A;  2R9X A;  4WBG A;  3IF6 C;  1YMS A;  1W79 A;  2QPN A;  3VSK A;  4HES A;  1L2S A;  3PAE A;  3VFH A;  4R3B A;  2ZM2 A;  3C4P A;  4MNR A;  1PI4 A;  3OCN A;  5IHV A;  1ERM A;  1I2S A;  2P9V B;  1PYY A;  2P9V A;  2ZM8 A;  4BQM A;  4Z9Q A;  3VP4 A;  3D4F A;  5CER A;  5A90 A;  2GDN A;  3MFD A;  1S0W A;  1PW8 A;  2VGK A;  1PW1 A;  3PBQ A;  3RXW A;  3HBR A;  4CPK A;  3GTC A;  1K6S A;  3ZGA B;  3N6I A;  1ZKJ A;  3G31 A;  1XGJ A;  1IEL A;  2EX2 A;  5D3O A;  2Y91 A;  4F94 A;  1WYC A;  4LV0 A;  1K56 A;  3UE1 A;  3UPO A;  3FV7 A;  3Q1F A;  1YLP A;  3N7W A;  3V50 A;  1LL5 A;  4E3L A;  4GN2 A;  4QU3 A;  4KQR A;  2PU2 A;  1GHI A;  4KQO A;  4P85 A;  4EBN A;  3BFE A;  3BLS A;  3MZF A;  2XF3 A;  4OPR A;  3BFC A;  3Q7V B;  5FSR A;  3WS0 A;  4X56 A;  2HDS A;  4X53 A;  3CJM A;  3UE0 A;  4QB8 A;  2WZZ A;  1K57 A;  4PM7 A;  4XUX A;  3M6B A;  2ZM0 A;  3ZHH A;  3GSG A;  3W4O A;  1L0E A;  3P09 A;  2WKE A;  2ZC6 B;  4E3M A;  1BZA A;  1JTD A;  1ES5 A;  3VFF A;  3G34 A;  1VQQ A;  4MBH A;  1ZG4 A;  3PBN A;  1MWR A;  3SH8 A;  4KZ7 A;  3HLB A;  3BLM A;  3C7U A;  2Y2Q A;  3FKW A;  3LCE A;  1MBL A;  1VM1 A;  1ZG6 A;  5FAT A;  2ZD8 A;  4LV2 A;  2Y59 A;  5GLC A;  2ZC7 A;  4GNU A;  4GD6 A;  4R4R A;  4EBL A;  1TEM A;  4WZ5 C;  5CHU A;  5FQJ A;  4B4Z A;  2QZ6 A;  3C7V A;  4S2M A;  3WRZ A;  3O86 A;  4DRT A;  1Q2Q A;  1RGY A;  3OPR A;  3G35 A;  4PM9 A;  1SKF A;  5CXW A;  1H8Y A;  1JWP A;  3MXR A;  5TFQ A;  1L0D A;  1N4O A;  1Q2P A;  1E3U D;  3FYZ A;  3A3F A;  3GVB A;  4XXR A;  4IBX A;  1FSY A;  5HW3 A;  4ZBE A;  1JTG A;  3PTE A;  1YMX A;  4ZTK A;  3I7J A;  2B5R A;  4KG5 A;  1FR1 A;  4KZB A;  1MWT A;  1HZO A;  3HLE A;  1MWS A;  2H0T A;  1K6R A;  1PWD A;  2XH9 A;  1MWU A;  4MEZ A;  4MLL A;  5M19 A;  2J8Y A;  1HVB A;  4LV1 A;  2JBF A;  1DJB A;  1ESU A;  1SDN A;  3OCL A;  2Y2H A;  1K54 A;  3DWZ A;  2HDQ A;  5JYO A;  4DDY A;  1ERQ A;  1YM1 A;  1QMF A;  2Z2M B;  3AGF A;  3VOY A;  4R23 A;  4DE2 A;  1KE3 A;  1NYM A;  4KZA A;  4B88 A;  3S22 A;  3EQU A;  5HAP A;  2I72 A;  4GDB A;  5DVA A;  2DNS A;  3LO7 A;  5A91 A;  1J9M A;  3IXB A;  4OOM A;  3LEZ A;  4ZJ1 A;  3UNW A;  4OPQ A;  2R9W A;  4KZ6 A;  2EFX A;  1IKI A;  5CHJ A;  3VMA A;  4S2J A;  4S2O A;  1LL9 A;  1SDE A;  1K55 A;  3BEC A;  3ISG A;  1NJ4 A;  2WYX A;  4X69 A;  2Y2I A;  3A3J A;  1LHY A;  5FI6 A;  4DF6 A;  3FWL A;  3BEB A;  4C6Y A;  4BD0 A;  2Y2G A;  5BOH A;  5J8X A;  1ES3 A;  5DF7 A;  1ZC2 A;  4JXV A;  2EX8 A;  2ZQ9 A;  1PZP A;  4QY5 A;  5M1A A;  2XK1 A;  4OQH A;  2C6W B;  4OH0 A;  4DE0 A;  3WS5 A;  4K0X A;  2EXB A;  3NC8 A;  4IED A;  5HFO A;  3OC2 A;  1FSW A;  4HBT A;  3HLW A;  4P0M A;  1H8Z A;  4WMC A;  5KZH A;  4GZB A;  1DY6 A;  4LCL A;  2Y2K A;  3BRM A;  2Z2L B;  2XFT A;  2C5W B;  1MXO A;  2ZC5 B;  3M6H A;  1ESI A;  4BLM A;  3G32 A;  4HEF A;  4B4X A;  4LV3 A;  2DCF A;  3BM6 A;  5CTN A;  3WS4 A;  2V1Z A;  2IWB A;  1YLY A;  3V39 A;  2OSU A;  2ZQA A;  5F83 A;  1KE0 A;  4ZAM A;  4JF4 A;  4JXG A;  4BL3 A;  4E3O A;  1NY0 A;  1XPB A;  1XXM A;  1PWC A;  5E2G A;  2ZQ7 A;  3CZD A;  1MPL A;  3DW0 A;  5FA7 A;  2ZQ8 A;  3IQA A;  2WAF A;  4Q8I A;  1MY8 A;  3G2Y A;  2WAD A;  3E2K A;  1FCN A;  3OPP A;  2A49 A;  4QY6 A;  2WGW B;  1IEM A;  1HD8 A;  2WGW A;  1BSG A;  2OLU A;  3V5M A;  2Y2O A;  3IF6 B;  4OPZ A;  2WAE A;  3IF6 A;  3IH8 A;  1SCW A;  3N8R A;  4GOG A;  3ZG5 A;  4O7D A;  5AQB A;  5F1G A;  3ZG0 A;  2HDU A;  3UPP A;  5FAP A;  4GB7 A;  4N1H A;  3ZVT A;  3Q82 A;  4WEL A;  4OOY A;  2X02 A;  1O7E A;  5I94 A;  2XLN A;  3N8L A;  2VGJ A;  3ZVW A;  4DKI A;  4KG2 A;  3TG9 A;  2X01 A;  2H0Y A;  2BLS A;  4JXW A;  3WS1 A;  4CJN A;  1FCM A;  5DTK A;  3EQV A;  2JE5 A;  2P74 A;  3SH7 A;  4BL2 A;  3IHB A;  4S2N C;  2XDM A;  3PBS A;  1EWZ A;  2HP9 A;  5FAO A;  2WZX A;  4JPM A;  4UA6 A;  4H8R A;  4RYE A;  1TDG A;  4A5R A;  1DJA A;  3UDF A;  3WWX A;  5KSC A;  2WUQ A;  3S1Y A;  1XX2 A;  1YLZ A;  3A3I A;  5TR7 A;  4E3N A;  1PI5 A;  3M2K A;  2IWC A;  1KVM A;  2Q9M A;  4NET A;  5GHZ A;  2XD5 A;  3HLG A;  3GQZ A;  4RA7 A;  3TOI A;  5CEC A;  2G2U A;  1W8Y A;  3G30 A;  3IXD A;  2J9O A;  3CMZ A;  4KEN B;  1FQG A;  3HLF A;  3SS4 A;  1QME A;  1W8Q A;  3UDX A;  2JC7 A;  1S6R A;  5GLA A;  1BLH A;  3IF5 A;  4S2L A;  1ERO A;  4PM8 A;  3AGD A;  3HVF A;  1RCJ A;  1KE4 A;  3V3S A;  5FI7 A;  4JXS A;  5EOE A;  3QHY A;  5FQM A;  1NXY A;  2BG1 A;  4KZ8 A;  5EE8 A;  5HAR A;  2ZLY A;  4QD4 A;  2A3U A;  1FCO A;  5EVI C;  2ZC4 B;  5TGF A;  1M40 A;  3S4X A;  1M6K A;  2H5S A;  1YLW A;  1FR6 A;  3N4I A;  3IT9 A;  4WZ5 A;  1U60 A;  5GHY A;  2EX6 A;  3VP0 A;  1G6A A;  3PBR A;  4KZ4 A;  2Y2J A;  1BLP A;  5E2F A;  4ZDX A;  1YLJ A;  4X55 A;  4DE1 A;  3Q81 A;  1IYQ A;  2FFY A;  3FZC A;  3LY4 A;  4KZ3 A;  1AXB A;  2FFF B;  1K25 A;  1IYS A;  2Y2M A;  3HUM A;  1MKI A;  4JLF A;  5AQA A;  3VP1 A;  1NRF A;  3ZCZ A;  1E3U A;  1FOF A;  3ZNT A;  1BUE A;  3MXS A;  4UAA A;  1KVL A;  1IYP A;  2XFS A;  1E4D A;  1IYO A;  2ZMA A;  4GD8 A;  3NIA A;  5FI2 A;  3RXX A;  4BJP A;  3VOZ A;  2DRW A;  5CTM A;  2WKI A;  4WM9 A;  1YLT A;  4WYY A;  3G2Z A;  4UA9 A;  1JWZ A;  5CGS A;  3VP2 A;  4OLG A;  4E3I A;  4R4S A;  1ONG A;  2RL3 A;  4DXB A;  1GA9 A;  3PAG A;  5GLD A;  3ITA A;  5CRF A;  4ZJ3 A;  5G18 A;  4KG6 A;  4N9K A;  2X71 A;  1WE4 A;  5DTT A;  3ZFZ A;  3RJU A;  4IVI A;  3ZG7 B;  1KGF A;  4L0L A;  3DWK A;  5HAQ A;  5CGW A;  3MKF A;  3A3D A;  2EFU A;  2XQZ A;  3C4O A;  3UDI A;  4DDS A;  3PBT A;  4EQI A;  3GR2 A;  3OPL A;  1I5Q A;  2Q9N A;  1C3B A;  1LI0 A;  3BFD A;  4PM5 A;  5E2H A;  4R3J A;  5FQI A;  1BTL A;  1BT5 A;  1ALQ A;  4P87 A;  3UPN A;  3WRT A;  4E3K A;  2XD1 A;  4GDN A;  5FQK A;  1KGE A;  1TVF A;  4JF5 A;  4DE3 A;  3HUO A;  4LCM A;  4R1G A;  1ONH A;  3VSL A;  2Y2N A;  1I2W A;  1K57 C;  2ZC3 B;  4N1X A;  4ID4 A;  3NY4 A;  4UHU A;  1L0F A;  3HLC A;  1CEF A;  2Y4A A;  3BFF A;  3AGE A;  3IXH A;  4PPR A;  5FAQ A;  1XP4 A;  2EXA A;  4C3Q A;  3HUN A;  4U3T A;  3O88 A;  5EEC A;  1SHV A;  4PM6 A;  4E6W A;  1XA7 A;  1ES4 A;  2XEP A;  1DJC A;  1Z6F A;  5FDH A;  4JF6 A;  5KMW A;  1K4F A;  3GRJ A;  1H5X A;  4OQG A;  2QMI A;  3ZDJ A;  3CG5 A;  5A93 A;  3HRE A;  5FAS A;  4D2O A;  5F82 A;  2JCH A;  3IH9 A;  4R0Q A;  1TDL A;  1WYB A;  2PBY A;  3QNB A;  1YT4 A;  2UWX A;  5CHM A;  3IWO A;  3IWI A;  5GHX A;  5DF9 A;  4LEN A;  4EBP A;  5EVL A;  2WGV A;  3C5A A;  3QNC A;  4ZJ2 A;  5EPH A;  4E6X A;  2WGI A;  3IXG A;  4U0X A;  1JVJ A;  4OPY A;  5L2F A;  3Q7V A;  5HX9 A;  3SOI A;  5KSH A;  1BLC A;  3FKV A;  2E8I A;  3MZE A;  3IWQ A;  3WS2 A;  2Y55 A;  3NDG A;  3UN7 A;  2Y2P A;  4OON A;  2IWD A;  1CI8 A;  3NBL A;  4S2I A;  4YFM A;  1OME A;  1K38 A;  3UY6 A;  4WEK A;  3NDE A;  3W8K A;  3LY3 A;  3GMW A;  4RVA A;  3W4P A;  3B3X A;  4JKT A;  4JBF A;  4FCF A;  4QHC A;  1N9B A;  1L0G A;  2J7V A;  4MBF A;  2HPB A;  1NZU A;  1JWV A;  1RP5 A;  4FSF A;  4MBK A;  5AQ7 A;  1YQS A;  5HAI A;  5CEB A;  1W7F A;  2WK0 A;  1XKZ A;  1O07 A;  1K54 C;  2HP5 A;  3GV9 A;  2V2F F;  4N9L A;  4Y0O A;  4S2K A;  3BFG A;  1BLS A;  5FQQ A;  1W5D A;  3UO9 A;  1E25 A;  4KZ5 A;  4OLD A;  1KDW A;  2J9P A;  4OVD A;  3SS3 A;  3OPH A;  5HL1 A;  3HL9 A;  2EX9 A;  5EUA A;  3UE3 A;  1IKG A;  1XGI A;  5M18 A;  5U47 A;  3NCK A;  1EI5 A;  4WEJ A;  1RGZ A;  3Q07 A;  3JYI A;  1LI9 A;  5EVI D;  4P6B A;  3SH9 A;  4Y0T A;  4BD1 A;  3E2L A;  4RX3 A;  5CED A;  4Y7P A;  4WZ4 A;  2OLV A;  1K55 C;  4OQI A;  4S2N A;  4EWF A; 
#chains in the Genus database with same CATH topology
 4BEN A;  4FUW A;  5AVF A;  3V3R A;  1D1J A;  1H3Q A;  2JKR M;  5TBM B;  3M2J A;  3TW8 A;  3ZNY A;  4E3J A;  2RCX A;  3QP4 A;  1PNE A;  2PRF A;  4HJ3 A;  3PBO A;  1ES2 A;  3TSG A;  4IBR A;  4OOL A;  5AQ9 A;  3MSH A;  5E2E A;  4OP5 A;  4KQD A;  1K56 D;  2V20 A;  4PMA A;  1NZO A;  4DMZ A;  2JKR I;  4OQ0 A;  2W0N A;  3MS6 A;  3NI9 A;  2IA2 A;  2ZJ9 A;  1KGG A;  5A92 A;  3ZG9 B;  3OZH A;  1HTZ A;  4WBG A;  3VSK A;  3PAE A;  3VFH A;  4I39 A;  1ERM A;  1W63 Q;  1PYY A;  2P9V A;  4BQM A;  1OTI A;  4NXB A;  5CER A;  2O99 A;  1XFN A;  1PW1 A;  3PBQ A;  2JKT I;  1WYC A;  3UE1 A;  1XJ6 A;  2W3G A;  2PU2 A;  3MZF A;  4OPR A;  3EWK A;  2XF3 A;  3WS0 A;  5FSR A;  3C30 A;  4X56 A;  4X53 A;  2PD7 A;  3H7W A;  1DRM A;  4PM7 A;  3K3C A;  2EA9 A;  5DKL A;  1VHM A;  2WKE A;  4NXE A;  3VFF A;  1V9Y A;  1VQQ A;  2O9A A;  2VV8 A;  3HLB A;  3BLM A;  4LV2 A;  1DP8 A;  4EBL A;  1P9W A;  4WZ5 C;  3WRZ A;  1RGY A;  4PM9 A;  1SKF A;  2J3T D;  1N4O A;  1NRJ A;  2VV6 A;  1E3U D;  3C8C A;  1HLU P;  4IBX A;  4ZBE A;  1FIK A;  1EW0 A;  3I7J A;  2B5R A;  3MQQ A;  1K6R A;  1PWD A;  2XH9 A;  4MEZ A;  4DJ2 A;  2JBF A;  1DJB A;  1ESU A;  3T4J A;  5I5L A;  3NUL A;  2A24 A;  4CLC B;  2V0U A;  1YM1 A;  3VOY A;  4R23 A;  4DE2 A;  1NYM A;  4B88 A;  3S7P A;  3S22 A;  2I72 A;  5DVA A;  5A91 A;  3MR0 A;  3IXB A;  3LEZ A;  3UNW A;  3BWL A;  4OPQ A;  2R9W A;  4EES A;  2OAP 1;  3ISG A;  2WYX A;  3CUE C;  2VJW A;  3FWL A;  4C6Y A;  2Y2G A;  2HV1 A;  5J8X A;  1ZC2 A;  4O01 A;  4QY5 A;  5M1A A;  3FPW A;  4KUK A;  3IX3 A;  2C6W B;  4DE0 A;  4GCZ A;  4K08 A;  2EXB A;  3LIC A;  3NC8 A;  4IED A;  1FSW A;  4P0M A;  4LCL A;  2Y2K A;  3BRM A;  4B4X A;  1UWP X;  3F1O A;  4Y3I A;  1YLY A;  1T18 A;  3V39 A;  3IS2 A;  3BQA A;  1VET B;  5AJG A;  1NY0 A;  1XXM A;  1PWC A;  1XJ2 A;  3IQA A;  1T19 A;  1FCN A;  3OPP A;  2R78 A;  4QY6 A;  2WGW B;  4JGP A;  4WL9 A;  3T4L A;  3V5M A;  2Y2O A;  4OPZ A;  2G7U A;  3ZG0 A;  3DTE A;  5J3W A;  2XLN A;  2YKF A;  1NLZ A;  4JGO A;  3ZVW A;  5FDS A;  3NOU C;  3PBS A;  4UQI S;  1EWZ A;  2HP9 A;  5FAO A;  3UDF A;  2WUQ A;  4NKP A;  1OT9 A;  1XX2 A;  5TR7 A;  4E3N A;  5G4Y A;  3M2K A;  4R3A A;  1KVM A;  3TOI A;  4KEN B;  1FQG A;  2PYP A;  1W8Q A;  2BTF P;  2L0W A;  4WF0 A;  1S6R A;  3IF5 A;  2JKF A;  4I3I A;  1ERO A;  4PM8 A;  2ZOI A;  3KSF A;  3T1X A;  4GS9 B;  4WUJ A;  4BBT A;  2BG1 A;  2KX6 A;  5HAR A;  2ZLY A;  4QD4 A;  2VEA A;  3PYP A;  2WKQ A;  5EVI C;  5FL3 A;  3ZQ5 A;  1FR6 A;  5GHY A;  3PBR A;  4X55 A;  3Q81 A;  2FFY A;  3LY4 A;  4KZ3 A;  2FFF B;  1K25 A;  1VB6 A;  3LFV A;  4HH3 A;  3VP1 A;  2B18 A;  1E3U A;  1FOF A;  3ZNT A;  3D3O A;  4GD8 A;  3VOZ A;  4E3I A;  4Y5F A;  3IBJ A;  1F9I A;  3L7H A;  2W3E A;  4L0L A;  3DWK A;  1TD5 A;  2XQZ A;  4DJ3 A;  4DDS A;  2XSS A;  3O5Y A;  4R3J A;  5FQI A;  3UPN A;  4P87 A;  4E3K A;  4Y15 A;  3E4Q A;  4E04 A;  1KGE A;  4LCM A;  3T1S A;  2OWH A;  2ZC3 B;  3EEA A;  3BFF A;  3IXH A;  1XP4 A;  3HUN A;  1YPR A;  2GNX A;  1Z6F A;  4ESP A;  5FDH A;  1H5X A;  5A93 A;  2QMI A;  3CG5 A;  4D2O A;  3UB9 A;  1TDL A;  3QNB A;  3IWO A;  3IWI A;  4PAU A;  4LEN A;  4EBP A;  3QP6 A;  1S4S A;  5EVL A;  4IHQ A;  4OPY A;  5L2F A;  3EOI A;  2E8I A;  3MZE A;  1OJ5 A;  3UN7 A;  4S2I A;  1CI8 A;  1OME A;  3UY6 A;  3KSH A;  3LY3 A;  1OTE A;  4LGW A;  1N9B A;  1L0G A;  1D7E A;  4HP9 A;  3NJA A;  1YQS A;  5TJJ A;  2WK0 A;  4CLC D;  4N9L A;  4NG2 A;  3GV9 A;  4ARZ A;  2ZL1 A;  3R7W B;  4OLD A;  2J9P A;  4OVD A;  3IX4 A;  5M18 A;  3E2L A;  2OLV A;  4XUZ A;  2ZMF A;  1KDS A;  4Q0J A;  4EET B;  3ITB A;  4X1M A;  1SKO B;  1GA0 A;  2HDR A;  4MN7 A;  2UV0 E;  3Q7Z A;  4Y0U A;  4EUZ A;  5L07 A;  1GHM A;  1CEG A;  1XJ4 A;  3UMD A;  1PWG A;  2CC1 A;  4EU0 A;  3ZG8 B;  4FH4 A;  4GKU A;  3DTK A;  4FH2 A;  2I9V A;  4NK3 A;  5EOO A;  3UE3 A;  4Q0I A;  5EVI B;  3P98 A;  4NXF A;  1NYY A;  2G2W A;  1Y54 A;  3T1Q B;  3C38 A;  3VP3 A;  2INW A;  3IF6 C;  4BMW A;  2M7U A;  3BW6 A;  4R3B A;  2ZM2 A;  4HH2 A;  5IHV A;  2FZ0 A;  5EM0 A;  2ZM8 A;  3OLO A;  3T50 A;  3QP2 A;  2VGK A;  4HHD A;  2VLG A;  3RXW A;  3HBR A;  4CPK A;  1K6S A;  3ZGA B;  1IEL A;  4F94 A;  4LV0 A;  3UB8 A;  1YLP A;  4G3K A;  1OTD A;  3KSI A;  4E3L A;  4Z1W A;  4QU3 A;  4L9E A;  4EBN A;  4P85 A;  2CMN A;  3BFE A;  4ETX A;  5F69 A;  4HOI A;  2O9B A;  3F1P B;  3CI6 A;  1JTD A;  2QHK A;  3KO6 A;  3G34 A;  1ZHH B;  1MWR A;  3C7U A;  3FKW A;  3LR3 A;  4LFU A;  1S67 L;  4R4R A;  4B4Z A;  2QZ6 A;  3O86 A;  4DRT A;  3MF0 A;  3A0V A;  5DFY A;  1JWP A;  3MXR A;  3JPU A;  1L0D A;  3FYZ A;  3A3F A;  3FPV A;  3RFB A;  4L9G A;  1YMX A;  4ZTK A;  1FR1 A;  4KZB A;  1MWT A;  2O0Y A;  1MWS A;  1TS8 A;  2H0T A;  4MLL A;  1MWU A;  3DBA A;  1CJF A;  5M19 A;  2J8Y A;  1HVB A;  4LV1 A;  1DP6 A;  3OCL A;  2W1R A;  1K54 A;  4CLC A;  4EW7 A;  1KE3 A;  4UEY A;  3NEC A;  3LO7 A;  4EEU A;  4KZ6 A;  1IKI A;  5CHJ A;  4S2J A;  4I3J A;  4S2O A;  1CQA A;  2P08 A;  1LL9 A;  1K55 A;  1NJ4 A;  4X69 A;  4EQ1 A;  2Y2I A;  5FI6 A;  4DF6 A;  5BOH A;  3QP1 A;  2HJ9 C;  2EX8 A;  2ZQ9 A;  4HIA A;  1PZP A;  3OBF A;  2XK1 A;  4OH0 A;  3U4L P;  4K0X A;  5IS1 A;  1F2K A;  2K31 A;  3V67 A;  4LLO B;  3PXP A;  4HBT A;  1JNU A;  5KZH A;  4GZB A;  2XFT A;  1OTB A;  3H82 B;  1MXO A;  3KSG A;  3M6H A;  2DCF A;  3LR4 A;  3E0Y A;  2OSU A;  2ZQA A;  5F83 A;  1VET A;  4JF4 A;  4BL3 A;  1XPB A;  5E2G A;  1MPL A;  3DW0 A;  2ZQ8 A;  2WAF A;  4O0P A;  1MY8 A;  2WAD A;  3E2K A;  4EUV A;  4HY8 A;  2WGW A;  3IF6 B;  2WAE A;  4GOG A;  3IH8 A;  4F3L B;  3K2N A;  4LRZ E;  3UPP A;  5FAP A;  2PBD P;  2KLI A;  1O7E A;  1F5M A;  2JHE A;  3N8L A;  4KG2 A;  2AVX A;  2P74 A;  3SH7 A;  3IHB A;  1MC0 A;  2XDM A;  2WZX A;  4UA6 A;  4FTX A;  2NUT C;  5KSC A;  2PR6 A;  5HL6 A;  2IWC A;  5GHZ A;  4NET A;  2XD5 A;  3CIT A;  4UQI M;  3G30 A;  5L8M A;  3IXD A;  3CPT B;  3CMZ A;  3SS4 A;  1L3L A;  1QME A;  3UDX A;  1BLH A;  4I38 A;  2QKP A;  4GS9 A;  2VGL S;  3DAV A;  2OWJ A;  4G3W A;  1M40 A;  4WZ5 A;  2HF6 A;  5HWW A;  3LR5 A;  1UWN X;  5E2F A;  4PKY A;  1OT6 A;  2Y79 A;  4I3A A;  1MKI A;  1OTA A;  1NRF A;  2VK3 A;  3ZCZ A;  3E98 A;  1BUE A;  2XFS A;  1E4D A;  1IYO A;  3NIA A;  3MMH A;  5FI2 A;  3RXX A;  4BJP A;  5CTM A;  1YLT A;  3G2Z A;  3LID A;  1JWZ A;  4AFI A;  3ITA A;  5CRF A;  1VEU B;  4KG6 A;  4N9K A;  4IVI A;  3ZG7 B;  1IFQ A;  5HAQ A;  3MKF A;  3A3D A;  2EFU A;  1S1Y A;  3C4O A;  3UDI A;  1C3B A;  1LI0 A;  1BT5 A;  1ALQ A;  4HP4 A;  3UB6 A;  4GDN A;  5FQK A;  4R1G A;  1ONH A;  4BBV A;  2V1A A;  2Y2N A;  1I2W A;  1K57 C;  4N1X A;  4ID4 A;  3NY4 A;  3CUE A;  1CEF A;  3E4O A;  3LR0 A;  2OAQ 1;  1NWZ A;  3O88 A;  4R70 A;  3KYZ A;  3TJZ C;  3B47 A;  2XEP A;  3LIF A;  4JF6 A;  1K4F A;  3ICY A;  5FAS A;  5F82 A;  5MC7 A;  4R0Q A;  3KYE A;  1WYB A;  4ETZ A;  1D06 A;  2Q0O A;  5GHX A;  2E8J A;  5DF9 A;  1LT0 A;  2WGV A;  3C5A A;  4EXO A;  1BLC A;  4O8G A;  3IWQ A;  4MCW A;  4OON A;  4YFM A;  4P6Z S;  3W8K A;  3GMW A;  4RVA A;  1CF0 A;  4JBF A;  4JKT A;  4FCF A;  1G5U A;  4MBF A;  5AQ7 A;  5A8B A;  5CEB A;  1XKZ A;  3BFG A;  1BLS A;  2L1M A;  3UO9 A;  3R7W A;  1E25 A;  3OPH A;  2P04 A;  3SW1 A;  2W1T A;  2EX9 A;  4YOF A;  1DP9 A;  2J3W A;  3JYI A;  4HJ6 A;  3SH9 A;  4Y0T A;  2HZ5 A;  4HJ4 A;  2J3T C;  1SZV A;  5L10 A;  4OQI A;  1BUL A;  4KZ9 A;  4OKP A;  5CGX A;  3KYQ A;  2KDK A;  4ME4 A;  1LSW A;  1SKO A;  4G3V A;  4K91 A;  5JYP A;  4HBU A;  2FH5 A;  4M3K A;  5FQ9 A;  1YSP A;  3R4K A;  2XR0 A;  4C75 A;  4N92 A;  4Q0H A;  2HP6 A;  2ZQD A;  3O87 A;  2XGN A;  4OP8 A;  2WKH A;  3IBR A;  5F1F A;  3N8S A;  4EER A;  4DXC A;  4S2P A;  1AWI A;  1GSW A;  1ZTU A;  4K0W A;  5DF8 A;  5EVI A;  2Y2L A;  2PU4 A;  4HQA A;  1CI9 A;  1PIO A;  5E43 A;  2H10 A;  1A0K A;  3O3V A;  4M4X A;  4KQQ A;  2EWW A;  3EGX C;  5GL9 A;  2K7S A;  4MDZ A;  4YWZ A;  3VE4 A;  2QPN A;  4HI4 A;  4HES A;  1L2S A;  4R6L A;  2A2L A;  2HGV A;  2PYR A;  4MNR A;  4Y17 A;  3OCN A;  1I2S A;  4LPZ A;  5LBR A;  4Z9Q A;  3NHQ A;  1XJ3 A;  3VP4 A;  4X1L A;  2PDR A;  3MFD A;  1S0W A;  2D01 A;  3RTY A;  5HPF A;  2MJ6 A;  3N6I A;  3T1R A;  5D3O A;  2EX2 A;  3T4T A;  4IJG A;  3FV7 A;  2V0W A;  1LL5 A;  4GN2 A;  3BQ8 A;  1GHI A;  1TS6 A;  3BLS A;  3F1N B;  3BFC A;  2HDS A;  3CJM A;  3UE0 A;  4QB8 A;  2WZZ A;  4XUX A;  3T12 B;  3ZHH A;  5HD3 A;  3F1P A;  2XA7 M;  3P09 A;  2ZC6 B;  1TS0 A;  4E3M A;  1BZA A;  3G6O A;  5HPI A;  4MBH A;  3PBN A;  4KZ7 A;  3U2A A;  1S4R A;  2B95 A;  1ODV A;  5FAT A;  2ZD8 A;  3ULF A;  5GLC A;  4GNU A;  2W1T B;  3IX8 A;  5FQJ A;  3C7V A;  1YSQ A;  4S2M A;  4WLA A;  4CQH A;  1Q2Q A;  3OPR A;  1P9R A;  5TFQ A;  4LRX C;  4Y2F A;  3GEC A;  4D60 A;  3GVB A;  1FSY A;  4BWI A;  5HW3 A;  1JTG A;  4KG5 A;  1HZO A;  3HLE A;  1H8M A;  1S66 L;  3LI8 A;  4DDY A;  1ERQ A;  1QMF A;  2Z2M B;  3RH8 B;  5HD5 A;  1BYW A;  5EFW A;  3EQU A;  2WKR A;  3D72 A;  1XFQ A;  4NXG A;  1SDE A;  1WA9 A;  1STZ A;  1GSX A;  1LHY A;  3A3J A;  3BEB A;  3P01 A;  1ES3 A;  4JXV A;  1H0M A;  2ACG A;  1H8Z A;  2C5W B;  3KX0 X;  3H82 A;  4GHI B;  3G32 A;  3BM6 A;  3LIA A;  2IWB A;  5FEG A;  4NEE D;  2ZQ7 A;  5FA7 A;  3G2Y A;  4H6J B;  2A49 A;  5F6A A;  1IEM A;  1HD8 A;  2M1C A;  3IF6 A;  3ZG5 A;  1SCW A;  4GLQ A;  4F3L A;  5F1G A;  4HNB A;  2Z6D A;  5HWV A;  3ZVT A;  3Q82 A;  4OOY A;  3B42 A;  5I94 A;  4DKI A;  2H0Y A;  4JXW A;  2VX8 A;  3WS1 A;  3H9W A;  5CX7 A;  5DTK A;  3EQV A;  4BL2 A;  4S2N C;  4WN5 A;  4JPM A;  4H8R A;  4RQ9 A;  4A5R A;  1DJA A;  3WWX A;  1P0Z A;  5HWT A;  3FC7 A;  3HLG A;  3GQZ A;  4RA7 A;  5CEC A;  2G2U A;  3GDI A;  3LGO A;  3CPT A;  4CLC C;  5KIZ A;  3HLF A;  3DTI A;  2PAV P;  2DMW A;  2O9C A;  5DFX A;  5GLA A;  4EEP A;  4S2L A;  3AGD A;  3HVF A;  1KE4 A;  5G4Z A;  5FI7 A;  5EOE A;  5FQM A;  1NXY A;  3W2Z A;  5J4E A;  2Y8H A;  2ZC4 B;  5TGF A;  1LL8 A;  3N4I A;  3QP8 A;  1U60 A;  4YNR A;  3VP0 A;  4KZ4 A;  2Y2J A;  3S7O A;  3BY8 A;  1YLJ A;  4DE1 A;  2VGL M;  1IYQ A;  3T4K A;  3FZC A;  1AXB A;  1IYS A;  2Y2M A;  3LIE A;  4UAA A;  3MXS A;  1KVL A;  4B9O A;  4LRY C;  2DRW A;  2WKI A;  4WM9 A;  4WYY A;  3VP2 A;  4UA9 A;  1PRQ A;  1ONG A;  2RL3 A;  4DXB A;  2LB9 A;  4IUK A;  3PAG A;  5GLD A;  4ZJ3 A;  5G18 A;  1VEU A;  5DTT A;  1WE4 A;  3RJU A;  2W3H A;  1LSV A;  2JKT M;  4EQI A;  3PBT A;  2PT7 A;  3JVV A;  3OPL A;  2Q9N A;  5J7E A;  3BFD A;  4PM5 A;  5E2H A;  5HDD A;  2JKG A;  4JGQ A;  3D9Y A;  4DE3 A;  1TVF A;  1Y28 A;  5EM1 A;  1V9Z A;  4MN6 A;  2Y4A A;  3AGE A;  4PPR A;  2EXA A;  1SHV A;  4PM6 A;  4E6W A;  1DJC A;  2OOL A;  5KMW A;  4OQG A;  1TS7 A;  2JCH A;  3IH9 A;  2W3D A;  2JN7 A;  2XRN A;  1YT4 A;  2UWX A;  5CHM A;  5EPH A;  1PFL A;  1JVJ A;  1X0O A;  3Q7V A;  5KSH A;  3OOV A;  3FKV A;  2Y55 A;  3NDG A;  2Y2P A;  3NBL A;  1K38 A;  1G6O A;  3W4P A;  3B3X A;  3LUQ A;  4QHC A;  2J7V A;  2V9A A;  2HPB A;  1NZU A;  1RP5 A;  4FSF A;  1W7F A;  2BAS A;  4S2K A;  5FQQ A;  4P6Z M;  2V8F A;  4PKY G;  1KDW A;  5HL1 A;  3HL9 A;  5EUA A;  2P7J A;  4CLC E;  1IKG A;  3EEH A;  5F68 A;  1ACF A;  1XGI A;  3UE6 A;  1RGZ A;  1S1Z A;  5EVI D;  1FIL A;  4RX3 A;  5CED A;  4WZ4 A;  2V1B A;  1GHP A;  2X01 A;  4EWF A;  5K5B A;  1PZO A;  3A3E A;  3SS5 A;  3HLD A;  1XA1 A;  1W63 M;  4EV4 A;  4FD8 A;  5DTS A;  2OV5 A;  4RX2 A;  3W4Q A;  4WMC D;  2GZA A;  3DTM A;  1K4E A;  4UA7 A;  3BYD A;  3T4Q A;  4U0T A;  4X68 A;  3MBZ A;  2KOI A;  4QJG A;  3MKE A;  1GCE A;  3IHA A;  3S7N A;  4X6T A;  3G4P A;  2QJ5 A;  3FG8 A;  4YIN A;  2GJ3 A;  4KUO A;  5DJU A;  5AVE A;  3A0R A;  2ZQC A;  1CK3 A;  4IVK A;  3MXQ A;  1LLB A;  5GLB A;  3MZD A;  1G68 A;  2R9X A;  4MN5 A;  1YMS A;  1W79 A;  2VKS A;  3C4P A;  2V8C A;  1PI4 A;  2P9V B;  3LIB A;  4B93 A;  2QYB A;  3D4F A;  5A90 A;  2GDN A;  1PW8 A;  3GTC A;  2PHY A;  1ZKJ A;  3G31 A;  1XGJ A;  2Y91 A;  3UB5 P;  2VZW A;  1K56 A;  3UPO A;  2W3F A;  1G28 A;  4PHT A;  3Q1F A;  3NOP C;  3N7W A;  3V50 A;  4R38 A;  5HSQ A;  4KQR A;  5HDS A;  4KQO A;  3Q7V B;  3F1N A;  3H7W B;  4JGR A;  2PR5 A;  1K57 A;  3M6B A;  4II7 A;  2ZM0 A;  3GSG A;  2D02 A;  3L9K A;  3W4O A;  3MQO A;  1L0E A;  1N9L A;  1N9O A;  1ES5 A;  3TRC A;  5IT5 A;  5L09 A;  3JVU A;  4BBU A;  1ZG4 A;  2NUP C;  3S7Q A;  3SH8 A;  3PHY A;  4QPR A;  4X25 A;  5DKK A;  2Y2Q A;  3LCE A;  1MBL A;  1VM1 A;  1ZG6 A;  1UGU A;  2Y59 A;  3BY9 A;  2ZC7 A;  2ZMV A;  4GD6 A;  1TEM A;  5CHU A;  2W27 A;  3G35 A;  5CXW A;  1H8Y A;  3CHW P;  1Q2P A;  1Z09 A;  4XXR A;  2ZBB A;  3PTE A;  3CLO A;  3A0S A;  3CAX A;  1K0K A;  1SDN A;  2Y2H A;  3LYX A;  4XT2 A;  2A24 B;  3DWZ A;  2HDQ A;  5JYO A;  3HJI A;  3AGF A;  1YAX A;  4KZA A;  4GJ4 A;  1T1A A;  5HAP A;  4GDB A;  2DNS A;  1J9M A;  4OOM A;  3TE8 A;  3SZT A;  4ZJ1 A;  2J80 A;  2Z6C A;  2VA0 A;  2YKH A;  2EFX A;  3VMA A;  2LB5 A;  3BEC A;  4I5S A;  4BD0 A;  3ZYT A;  5DF7 A;  3T4O A;  4OQH A;  5HZH A;  3WS5 A;  2QWS A;  5HFO A;  1F98 A;  3OC2 A;  3HLW A;  1MKM A;  4WMC A;  1DY6 A;  2Z2L B;  2ZC5 B;  1ESI A;  4BLM A;  3UME A;  4GHI A;  4HEF A;  4LV3 A;  2QJ7 A;  1MZU A;  5CTN A;  3WS4 A;  2V1Z A;  3F1O B;  3IS2 B;  1KE0 A;  3LI9 A;  4ZAM A;  4JXG A;  4E3O A;  3CZD A;  4Q8I A;  3PR6 A;  4H6J A;  1T1B A;  3MJQ A;  1BSG A;  2OLU A;  3N8R A;  4O7D A;  5AQB A;  2M7V A;  2HDU A;  4GB7 A;  3UB7 A;  4N1H A;  3B33 A;  4WEL A;  1J3W A;  2X02 A;  2VGJ A;  3HCY A;  3TG9 A;  4CJN A;  2BLS A;  1FCM A;  2JE5 A;  5F5Y A;  4RYE A;  1TDG A;  1N9N A;  3S1Y A;  1YLZ A;  3A3I A;  1PI5 A;  2Q9M A;  5IU1 A;  3QP5 A;  1W8Y A;  2XRO A;  1T1C A;  2J9O A;  1KOU A;  2JC7 A;  4MMN A;  1RCJ A;  1GSV A;  5C5K A;  3V3S A;  4JXS A;  3QHY A;  4XT2 B;  4KZ8 A;  5EE8 A;  2A3U A;  4Y13 A;  1FCO A;  2GX5 A;  2EWV A;  2H28 A;  3CWF A;  1M6K A;  3S4X A;  2H5S A;  1YLW A;  3IT9 A;  2EX6 A;  1G6A A;  2K2N A;  1BLP A;  4ZDX A;  1OJG A;  5TBM A;  4DN0 A;  3HUM A;  1P97 A;  4JLF A;  5AQA A;  1OPX A;  3LEQ A;  4GW9 A;  1IYP A;  2ZMA A;  2PD8 A;  5CGS A;  4OLG A;  4R4S A;  1GA9 A;  1YKD A;  4IUH A;  3ZFZ A;  2X71 A;  1KGF A;  3T4S A;  3VE3 A;  5CGW A;  1Y4O A;  3BJN A;  3EGD C;  3GR2 A;  1I5Q A;  3WRT A;  1BTL A;  2ZOH A;  2XD1 A;  4JF5 A;  3E4P A;  3HUO A;  3VSL A;  4UHU A;  5DJT A;  3VOL A;  1L0F A;  3HLC A;  3MQ0 A;  5FAQ A;  4C3Q A;  2B02 A;  4U3T A;  5EEC A;  1LSX A;  1ES4 A;  1XA7 A;  2VV7 A;  1IOU A;  3GRJ A;  3ZDJ A;  3HRE A;  2HJE A;  2PBY A;  3VV4 A;  1TF1 A;  2XA7 S;  3QNC A;  4ZJ2 A;  4E6X A;  2WGI A;  3MFX A;  4ZRR A;  3IXG A;  4U0X A;  5HX9 A;  3SOI A;  3WS2 A;  2IWD A;  4WEK A;  3NDE A;  2L4R A;  5HAI A;  1JWV A;  4MBK A;  4FOF A;  4L9F A;  3HJK A;  5HDC A;  4Y0O A;  1O07 A;  1K54 C;  2HP5 A;  2V2F F;  3P7N A;  4ARZ B;  2ZL1 B;  1W5D A;  5FEF A;  4KZ5 A;  4QWO A;  3SS3 A;  5EV0 A;  2WKP A;  5U47 A;  3NCK A;  1EI5 A;  5EVE A;  4WEJ A;  3Q07 A;  1LI9 A;  4P6B A;  3NOT C;  4BD1 A;  3C2W A;  4Y7P A;  3K3D A;  1NLY A;  1K55 C;  4S2N A; 
#chains in the Genus database with same CATH homology
 1BUL A;  4KZ9 A;  4OKP A;  4XUZ A;  1PZO A;  3A3E A;  3SS5 A;  4BEN A;  5CGX A;  3HLD A;  1XA1 A;  1KDS A;  3ITB A;  3V3R A;  4EV4 A;  3M2J A;  4FD8 A;  4K91 A;  5DTS A;  2OV5 A;  5JYP A;  1GA0 A;  2HDR A;  3ZNY A;  4E3J A;  2RCX A;  4RX2 A;  4HBU A;  4M3K A;  5FQ9 A;  3W4Q A;  4WMC D;  3DTM A;  3Q7Z A;  4Y0U A;  4EUZ A;  1K4E A;  3PBO A;  2XR0 A;  4UA7 A;  1ES2 A;  1GHM A;  1CEG A;  4IBR A;  4OOL A;  5AQ9 A;  3TSG A;  4C75 A;  3BYD A;  4N92 A;  4U0T A;  2HP6 A;  2ZQD A;  3O87 A;  1PWG A;  2XGN A;  5E2E A;  4OP5 A;  2CC1 A;  4OP8 A;  4X68 A;  2WKH A;  5F1F A;  3MBZ A;  3N8S A;  4DXC A;  3ZG8 B;  4QJG A;  4FH4 A;  4GKU A;  4S2P A;  3MKE A;  4FH2 A;  1GHP A;  1K56 D;  1GCE A;  3IHA A;  4NK3 A;  4X6T A;  5EOO A;  4K0W A;  5DF8 A;  2V20 A;  3P98 A;  5EVI B;  5EVI A;  2Y2L A;  1NZO A;  1NYY A;  2PU4 A;  3G4P A;  4PMA A;  2G2W A;  4YIN A;  1CI9 A;  1Y54 A;  1PIO A;  4OQ0 A;  5E43 A;  2H10 A;  3NI9 A;  2ZQC A;  3O3V A;  2ZJ9 A;  4KQQ A;  1CK3 A;  1KGG A;  4IVK A;  5A92 A;  3ZG9 B;  1LLB A;  3OZH A;  5GL9 A;  5GLB A;  3MZD A;  3VP3 A;  1G68 A;  1HTZ A;  2R9X A;  4WBG A;  3IF6 C;  1YMS A;  1W79 A;  2QPN A;  3VSK A;  4HES A;  1L2S A;  3PAE A;  3VFH A;  4R3B A;  2ZM2 A;  3C4P A;  4MNR A;  1PI4 A;  3OCN A;  5IHV A;  1ERM A;  1I2S A;  2P9V B;  1PYY A;  2P9V A;  2ZM8 A;  4BQM A;  4Z9Q A;  3VP4 A;  3D4F A;  5CER A;  5A90 A;  2GDN A;  3MFD A;  1S0W A;  1PW8 A;  2VGK A;  1PW1 A;  3PBQ A;  3RXW A;  3HBR A;  4CPK A;  3GTC A;  1K6S A;  3ZGA B;  3N6I A;  1ZKJ A;  3G31 A;  1XGJ A;  1IEL A;  2EX2 A;  5D3O A;  2Y91 A;  4F94 A;  1WYC A;  4LV0 A;  1K56 A;  3UE1 A;  3UPO A;  3FV7 A;  3Q1F A;  1YLP A;  3N7W A;  3V50 A;  1LL5 A;  4E3L A;  4GN2 A;  4QU3 A;  4KQR A;  2PU2 A;  1GHI A;  4KQO A;  4P85 A;  4EBN A;  3BFE A;  3BLS A;  3MZF A;  2XF3 A;  4OPR A;  3BFC A;  3Q7V B;  5FSR A;  3WS0 A;  4X56 A;  2HDS A;  4X53 A;  3CJM A;  3UE0 A;  4QB8 A;  2WZZ A;  1K57 A;  4PM7 A;  4XUX A;  3M6B A;  2ZM0 A;  3ZHH A;  3GSG A;  3W4O A;  1L0E A;  3P09 A;  2WKE A;  2ZC6 B;  4E3M A;  1BZA A;  1JTD A;  1ES5 A;  3VFF A;  3G34 A;  1VQQ A;  4MBH A;  1ZG4 A;  3PBN A;  1MWR A;  3SH8 A;  4KZ7 A;  3HLB A;  3BLM A;  3C7U A;  2Y2Q A;  3FKW A;  3LCE A;  1MBL A;  1VM1 A;  1ZG6 A;  5FAT A;  2ZD8 A;  4LV2 A;  2Y59 A;  5GLC A;  2ZC7 A;  4GNU A;  4GD6 A;  4R4R A;  4EBL A;  1TEM A;  4WZ5 C;  5CHU A;  5FQJ A;  4B4Z A;  2QZ6 A;  3C7V A;  4S2M A;  3WRZ A;  3O86 A;  4DRT A;  1Q2Q A;  1RGY A;  3OPR A;  3G35 A;  4PM9 A;  1SKF A;  5CXW A;  1H8Y A;  1JWP A;  3MXR A;  5TFQ A;  1L0D A;  1N4O A;  1Q2P A;  1E3U D;  3FYZ A;  3A3F A;  3GVB A;  4XXR A;  4IBX A;  1FSY A;  5HW3 A;  4ZBE A;  1JTG A;  3PTE A;  1YMX A;  4ZTK A;  3I7J A;  2B5R A;  4KG5 A;  1FR1 A;  4KZB A;  1MWT A;  1HZO A;  3HLE A;  1MWS A;  2H0T A;  1K6R A;  1PWD A;  2XH9 A;  1MWU A;  4MEZ A;  4MLL A;  5M19 A;  2J8Y A;  1HVB A;  4LV1 A;  2JBF A;  1DJB A;  1ESU A;  1SDN A;  3OCL A;  2Y2H A;  1K54 A;  3DWZ A;  2HDQ A;  5JYO A;  4DDY A;  1ERQ A;  1YM1 A;  1QMF A;  2Z2M B;  3AGF A;  3VOY A;  4R23 A;  4DE2 A;  1KE3 A;  1NYM A;  4KZA A;  4B88 A;  3S22 A;  3EQU A;  5HAP A;  2I72 A;  4GDB A;  5DVA A;  2DNS A;  3LO7 A;  5A91 A;  1J9M A;  3IXB A;  4OOM A;  3LEZ A;  4ZJ1 A;  3UNW A;  4OPQ A;  2R9W A;  4KZ6 A;  2EFX A;  1IKI A;  5CHJ A;  3VMA A;  4S2J A;  4S2O A;  1LL9 A;  1SDE A;  1K55 A;  3BEC A;  3ISG A;  1NJ4 A;  2WYX A;  4X69 A;  2Y2I A;  3A3J A;  1LHY A;  5FI6 A;  4DF6 A;  3FWL A;  3BEB A;  4C6Y A;  4BD0 A;  2Y2G A;  5BOH A;  5J8X A;  1ES3 A;  5DF7 A;  1ZC2 A;  4JXV A;  2EX8 A;  2ZQ9 A;  1PZP A;  4QY5 A;  5M1A A;  2XK1 A;  4OQH A;  2C6W B;  4OH0 A;  4DE0 A;  3WS5 A;  4K0X A;  2EXB A;  3NC8 A;  4IED A;  5HFO A;  3OC2 A;  1FSW A;  4HBT A;  3HLW A;  4P0M A;  1H8Z A;  4WMC A;  5KZH A;  4GZB A;  1DY6 A;  4LCL A;  2Y2K A;  3BRM A;  2Z2L B;  2XFT A;  2C5W B;  1MXO A;  2ZC5 B;  3M6H A;  1ESI A;  4BLM A;  3G32 A;  4HEF A;  4B4X A;  4LV3 A;  2DCF A;  3BM6 A;  5CTN A;  3WS4 A;  2V1Z A;  2IWB A;  1YLY A;  3V39 A;  2OSU A;  2ZQA A;  5F83 A;  1KE0 A;  4ZAM A;  4JF4 A;  4JXG A;  4BL3 A;  4E3O A;  1NY0 A;  1XPB A;  1XXM A;  1PWC A;  5E2G A;  2ZQ7 A;  3CZD A;  1MPL A;  3DW0 A;  5FA7 A;  2ZQ8 A;  3IQA A;  2WAF A;  4Q8I A;  1MY8 A;  3G2Y A;  2WAD A;  3E2K A;  1FCN A;  3OPP A;  2A49 A;  4QY6 A;  2WGW B;  1IEM A;  1HD8 A;  2WGW A;  1BSG A;  2OLU A;  3V5M A;  2Y2O A;  3IF6 B;  4OPZ A;  2WAE A;  3IF6 A;  3IH8 A;  1SCW A;  3N8R A;  4GOG A;  3ZG5 A;  4O7D A;  5AQB A;  5F1G A;  3ZG0 A;  2HDU A;  3UPP A;  5FAP A;  4GB7 A;  4N1H A;  3ZVT A;  3Q82 A;  4WEL A;  4OOY A;  2X02 A;  1O7E A;  5I94 A;  2XLN A;  3N8L A;  2VGJ A;  3ZVW A;  4DKI A;  4KG2 A;  3TG9 A;  2X01 A;  2H0Y A;  2BLS A;  4JXW A;  3WS1 A;  4CJN A;  1FCM A;  5DTK A;  3EQV A;  2JE5 A;  2P74 A;  3SH7 A;  4BL2 A;  3IHB A;  4S2N C;  2XDM A;  3PBS A;  1EWZ A;  2HP9 A;  5FAO A;  2WZX A;  4JPM A;  4UA6 A;  4H8R A;  4RYE A;  1TDG A;  4A5R A;  1DJA A;  3UDF A;  3WWX A;  5KSC A;  2WUQ A;  3S1Y A;  1XX2 A;  1YLZ A;  3A3I A;  5TR7 A;  4E3N A;  1PI5 A;  3M2K A;  2IWC A;  1KVM A;  2Q9M A;  4NET A;  5GHZ A;  2XD5 A;  3HLG A;  3GQZ A;  4RA7 A;  3TOI A;  5CEC A;  2G2U A;  1W8Y A;  3G30 A;  3IXD A;  2J9O A;  3CMZ A;  4KEN B;  1FQG A;  3HLF A;  3SS4 A;  1QME A;  1W8Q A;  3UDX A;  2JC7 A;  1S6R A;  5GLA A;  1BLH A;  3IF5 A;  4S2L A;  1ERO A;  4PM8 A;  3AGD A;  3HVF A;  1RCJ A;  1KE4 A;  3V3S A;  5FI7 A;  4JXS A;  5EOE A;  3QHY A;  5FQM A;  1NXY A;  2BG1 A;  4KZ8 A;  5EE8 A;  5HAR A;  2ZLY A;  4QD4 A;  2A3U A;  1FCO A;  5EVI C;  2ZC4 B;  5TGF A;  1M40 A;  3S4X A;  1M6K A;  2H5S A;  1YLW A;  1FR6 A;  3N4I A;  3IT9 A;  4WZ5 A;  1U60 A;  5GHY A;  2EX6 A;  3VP0 A;  1G6A A;  3PBR A;  4KZ4 A;  2Y2J A;  1BLP A;  5E2F A;  4ZDX A;  1YLJ A;  4X55 A;  4DE1 A;  3Q81 A;  1IYQ A;  2FFY A;  3FZC A;  3LY4 A;  4KZ3 A;  1AXB A;  2FFF B;  1K25 A;  1IYS A;  2Y2M A;  3HUM A;  1MKI A;  4JLF A;  5AQA A;  3VP1 A;  1NRF A;  3ZCZ A;  1E3U A;  1FOF A;  3ZNT A;  1BUE A;  3MXS A;  4UAA A;  1KVL A;  1IYP A;  2XFS A;  1E4D A;  1IYO A;  2ZMA A;  4GD8 A;  3NIA A;  5FI2 A;  3RXX A;  4BJP A;  3VOZ A;  2DRW A;  5CTM A;  2WKI A;  4WM9 A;  1YLT A;  4WYY A;  3G2Z A;  4UA9 A;  1JWZ A;  5CGS A;  3VP2 A;  4OLG A;  4E3I A;  4R4S A;  1ONG A;  2RL3 A;  4DXB A;  1GA9 A;  3PAG A;  5GLD A;  3ITA A;  5CRF A;  4ZJ3 A;  5G18 A;  4KG6 A;  4N9K A;  2X71 A;  1WE4 A;  5DTT A;  3ZFZ A;  3RJU A;  4IVI A;  3ZG7 B;  1KGF A;  4L0L A;  3DWK A;  5HAQ A;  5CGW A;  3MKF A;  3A3D A;  2EFU A;  2XQZ A;  3C4O A;  3UDI A;  4DDS A;  3PBT A;  4EQI A;  3GR2 A;  3OPL A;  1I5Q A;  2Q9N A;  1C3B A;  1LI0 A;  3BFD A;  4PM5 A;  5E2H A;  4R3J A;  5FQI A;  1BTL A;  1BT5 A;  1ALQ A;  4P87 A;  3UPN A;  3WRT A;  4E3K A;  2XD1 A;  4GDN A;  5FQK A;  1KGE A;  1TVF A;  4JF5 A;  4DE3 A;  3HUO A;  4LCM A;  4R1G A;  1ONH A;  3VSL A;  2Y2N A;  1I2W A;  1K57 C;  2ZC3 B;  4N1X A;  4ID4 A;  3NY4 A;  4UHU A;  1L0F A;  3HLC A;  1CEF A;  2Y4A A;  3BFF A;  3AGE A;  3IXH A;  4PPR A;  5FAQ A;  1XP4 A;  2EXA A;  4C3Q A;  3HUN A;  4U3T A;  3O88 A;  5EEC A;  1SHV A;  4PM6 A;  4E6W A;  1XA7 A;  1ES4 A;  2XEP A;  1DJC A;  1Z6F A;  5FDH A;  4JF6 A;  5KMW A;  1K4F A;  3GRJ A;  1H5X A;  4OQG A;  2QMI A;  3ZDJ A;  3CG5 A;  5A93 A;  3HRE A;  5FAS A;  4D2O A;  5F82 A;  2JCH A;  3IH9 A;  4R0Q A;  1TDL A;  1WYB A;  2PBY A;  3QNB A;  1YT4 A;  2UWX A;  5CHM A;  3IWO A;  3IWI A;  5GHX A;  5DF9 A;  4LEN A;  4EBP A;  5EVL A;  2WGV A;  3C5A A;  3QNC A;  4ZJ2 A;  5EPH A;  4E6X A;  2WGI A;  3IXG A;  4U0X A;  1JVJ A;  4OPY A;  5L2F A;  3Q7V A;  5HX9 A;  3SOI A;  5KSH A;  1BLC A;  3FKV A;  2E8I A;  3MZE A;  3IWQ A;  3WS2 A;  2Y55 A;  3NDG A;  3UN7 A;  2Y2P A;  4OON A;  2IWD A;  1CI8 A;  3NBL A;  4S2I A;  4YFM A;  1OME A;  1K38 A;  3UY6 A;  4WEK A;  3NDE A;  3W8K A;  3LY3 A;  3GMW A;  4RVA A;  3W4P A;  3B3X A;  4JKT A;  4JBF A;  4FCF A;  4QHC A;  1N9B A;  1L0G A;  2J7V A;  4MBF A;  2HPB A;  1NZU A;  1JWV A;  1RP5 A;  4FSF A;  4MBK A;  5AQ7 A;  1YQS A;  5HAI A;  5CEB A;  1W7F A;  2WK0 A;  1XKZ A;  1O07 A;  1K54 C;  2HP5 A;  3GV9 A;  2V2F F;  4N9L A;  4Y0O A;  4S2K A;  3BFG A;  1BLS A;  5FQQ A;  1W5D A;  3UO9 A;  1E25 A;  4KZ5 A;  4OLD A;  1KDW A;  2J9P A;  4OVD A;  3SS3 A;  3OPH A;  5HL1 A;  3HL9 A;  2EX9 A;  5EUA A;  3UE3 A;  1IKG A;  1XGI A;  5M18 A;  5U47 A;  3NCK A;  1EI5 A;  4WEJ A;  1RGZ A;  3Q07 A;  3JYI A;  1LI9 A;  5EVI D;  4P6B A;  3SH9 A;  4Y0T A;  4BD1 A;  3E2L A;  4RX3 A;  5CED A;  4Y7P A;  4WZ4 A;  2OLV A;  1K55 C;  4OQI A;  4S2N A;  4EWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...