1LI0A

Crystal structure of tem-32 beta-lactamase at 1.6 angstrom
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
263
Chain Sequence
b'HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMISTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class A beta-Lactamase- TEM-32
publication title The structural bases of antibiotic resistance in the clinically derived mutant beta-lactamases TEM-30, TEM-32, and TEM-34.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 90
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1li0A00
2WKHA 3M2JA 4KG6A 4BQMA 1FCMA 4RVAA 4DE0A 1KGGA 3EQVA 2A3UA 5FAPA 4DXCA 3VOYA 4WEJA 4BENA 4OQ0A 1L0DA 3S1YA 3PBTA 1IEMA 2G2UA 1GA9A 5CTNA 1NYMA 3A3EA 3HUOA 4GN2A 4QJGA 5FQJA 3DWKA 3O88A 4S2NC 5D3OA 1WYBA 4R0QA 3ZFZA 3Q82A 1YQSA 2EFXA 1ZC2A 1J9MA 3N7WA 4OP8A 5E2HA 3MXSA 2J9OA 3TOIA 3UE1A 1CK3A 1KGEA 2ZLYA 4X56A 1K38A 4MBFA 5HX9A 3TG9A 5F82A 3VOZA 1GHMA 2EX8A 3IT9A 2EXBA 1JVJA 1BLCA 5G18A 3P98A 3ZCZA 2WAFA 2JBFA 3PTEA 4ZBEA 5FATA 1HD8A 2JCHA 3UDFA 4ZDXA 1LI0A 3TSGA 3VP0A 1JWVA 4PM9A 3PAEA 4JXGA 2Y2HA 2Z2MB 4BL2A 2CC1A 2EX2A 5FSRA 3ZNTA 2WGWB 3C4OA 3IHAA 5EOOA 2FFFB 3BEBA 3ZG0A 3E2KA 4LV3A 2RCXA 3SS3A 4U0TA 5HARA 1K56A 1PIOA 2P9VA 1YLJA 3VSLA 1H5XA 1LL9A 1VM1A 2WZZA 3ITAA 2RL3A 3UE3A 1K55A 4UA9A 5FI6A 1IYPA 1GHIA 1K25A 3G4PA 4N9KA 5CTMA 4P0MA 4QD4A 4HBTA 3HLCA 4HESA 4K91A 2ZC4B 1Q2PA 2ZC7A 1TVFA 5A91A 4KZ5A 3PAGA 4ZAMA 5JYOA 4E3OA 1PWCA 3S4XA 3A3IA 3RXXA 4PM5A 3BYDA 4ID4A 1VQQA 4GKUA 4N1XA 1EI5A 3HUMA 1K57A 4PPRA 4FD8A 5HAIA 3M6HA 2Y2MA 4OOYA 5KSHA 4L0LA 2X01A 3ZDJA 3MZEA 4FCFA 2ZMAA 3ISGA 1KE0A 1RCJA 1QMEA 3JYIA 2QPNA 5FI7A 4EBPA 3IF6C 4OPZA 3V50A 3O86A 4H8RA 1K56D 2VGJA 2DNSA 3NY4A 5AQ9A 3PBRA 4KZ8A 4K0XA 3WS4A 4BL3A 1HVBA 4OQGA 1ES2A 1W79A 1M40A 2Y4AA 3BM6A 3W4QA 1K55C 3CZDA 3AGEA 3UPNA 3C4PA 4R1GA 4GD8A 3LO7A 4C75A 4IBXA 4DF6A 5HAPA 4RA7A 2P74A 1SDNA 4N1HA 1DJAA 5FAQA 1BSGA 5GLBA 2ZM2A 4S2OA 3IF5A 1TDLA 4D2OA 3FWLA 4XUXA 4MLLA 5HL1A 4QY5A 3Q07A 1GHPA 5AQAA 4CPKA 4X55A 2XF3A 1PW8A 2HDQA 1W8QA 1BT5A 1FSWA 5CECA 2EXAA 1YLPA 2EX9A 4EQIA 3M2KA 1I2WA 3O3VA 4S2NA 4B4XA 1MWTA 3G2YA 5CRFA 2Y59A 3LCEA 1E25A 4S2KA 3SOIA 2ZM0A 3UO9A 2XD5A 3PBSA 4P85A 1KVLA 3CG5A 2XFTA 4DE2A 4PM8A 5I94A 1KE4A 3BRMA 4FSFA 3G32A 1TEMA 1IYSA 3ITBA 1BULA 3OCNA 4X69A 5GHXA 4P87A 1G68A 4S2PA 1LI9A 3PBQA 4R4RA 2JC7A 4R3JA 3WRTA 2J7VA 5A90A 1C3BA 4PM6A 3LY3A 5DTSA 3SS5A 3ZHHA 2V1ZA 4DKIA 4JXWA 1I5QA 4OOMA 1G6AA 5FDHA 2ZM8A 5M19A 1K6RA 4WYYA 5CGSA 2C6WB 2DCFA 3A3JA 2WKIA 3VP2A 4A5RA 4X6TA 4EBLA 3UDIA 1U60A 2C5WB 4MEZA 4OONA 3C7VA 1YLZA 4N92A 5FASA 4DXBA 4JXVA 1WYCA 4Y7PA 3VFFA 4EUZA 3OPPA 5CEDA 1KDWA 1BLHA 3LY4A 4QHCA 2HDUA 5GLCA 4KG2A 5CHMA 1PI5A 5CGXA 1FQGA 1DY6A 5E2EA 3P09A 5TR7A 3IXBA 4S2MA 1JTDA 3V3RA 1PWGA 4E3IA 3MBZA 3IWIA 1PYYA 3G31A 1BLPA 2J9PA 1ZG6A 5FQIA 3MKFA 1ERQA 3OZHA 4LV1A 3GRJA 4B4ZA 1NY0A 2IWCA 2XGNA 3IXHA 4IVIA 3UPPA 1Q2QA 3W4OA 3BFGA 3FZCA 3OPLA 1K4FA 1FOFA 1PI4A 4GB7A 4WZ4A 2BLSA 4DRTA 1HTZA 4WMCA 5L2FA 4DE1A 4Q8IA 1W8YA 5AQBA 4C3QA 4B88A 2H0TA 1XX2A 3SH7A 5CERA 1S6RA 1H8YA 3VP3A 1N9BA 1EWZA 3IXDA 3C7UA 2J8YA 1CI9A 2JE5A 4E3LA 1AXBA 3BFFA 4OLGA 4UHUA 4EWFA 1OMEA 4KQRA 3W8KA 1ERMA 3ZVTA 5JYPA 3B3XA 3OPRA 1KVMA 2DRWA 3AGFA 2Y2PA 5CGWA 3HVFA 4OQIA 1RP5A 2P9VB 1GA0A 5HW3A 4WEKA 3BFCA 4O7DA 1K6SA 2WAEA 2X02A 4BD1A 1I2SA 3I7JA 3M6BA 4E3JA 5FAOA 4NETA 2OLUA 4WELA 3HLGA 3UPOA 1RGYA 4HBUA 5EVIB 2ZD8A 2OV5A 4N9LA 1ONHA 3WS5A 3G30A 3GR2A 1BZAA 1MY8A 2Y2LA 1LHYA 4WMCD 4E6XA 1NXYA 1E4DA 4Y0OA 2WYXA 1LL5A 3ZG8B 1FR1A 4LV0A 1L2SA 1MWSA 4OH0A 3RXWA 1Y54A 2IWBA 4QY6A 2Y2OA 2WZXA 4JF6A 4OPQA 5EECA 3ZG7B 4E3KA 5U47A 2HDRA 4BJPA 3CMZA 3N6IA 1FCOA 5EVLA 3HLWA 2R9XA 3EQUA 3Q7VB 1PW1A 1WE4A 3HUNA 1ESUA 1ESIA 4MBHA 4GDBA 4PM7A 1BLSA 3N4IA 3UDXA 3IQAA 1FSYA 1MBLA 3BLSA 4QB8A 2FFYA 3HLBA 5HFOA 2X71A 1XA7A 3IWOA 3FYZA 2WUQA 1XA1A 4S2JA 4DDYA 4Y0TA 1YMXA 4ZJ2A 3AGDA 4JPMA 4X68A 5GLAA 3ZVWA 4OLDA 3G34A 3IF6B 4JLFA 5DVAA 1MWRA 1ES5A 1JWZA 2WGVA 2WK0A 3QNBA 5GHYA 4OVDA 1XGJA 2PU4A 2OSUA 4LCLA 3WS2A 2IWDA 1YLYA 2H0YA 4GZBA 4KQOA 5M18A 4ZJ1A 1GCEA 3ZNYA 3DWZA 1JWPA 3HLEA 3O87A 3S22A 3WS0A 2XEPA 2Y55A 1PZOA 4S2LA 2PBYA 4M3KA 3VP1A 4U3TA 3NDEA 3GVBA 4OP5A 3DW0A 1M6KA 5FQQA 2Y2GA 2ZC6B 3HLFA 1L0EA 3DTMA 4MBKA 1PWDA 5EPHA 4JXSA 5TFQA 4KZAA 2ZC3B 2V20A 3WRZA 2ZQ7A 4OPYA 2EX6A 3WS1A 3MKEA 4KG5A 3V39A 1MWUA 3A3DA 1PZPA 3GV9A 1NRFA 1IKIA 2WGIA 3IH9A 4E6WA 5KSCA 2PU2A 1ZG4A 4YINA 3LEZA 3SH9A 2Q9MA 1MPLA 1O7EA 5A92A 4C6YA 4KENB 1DJCA 2EFUA 2H10A 2ZQCA 3SH8A 4RX2A 3QNCA 1DJBA 4WBGA 1L0GA 4GDNA 5TGFA 2XK1A 2R9WA 1IYQA 1NYYA 2Z2LB 5KMWA 3QHYA 5FQMA 5GL9A 3MXRA 1SKFA 3FKWA 4JF4A 5E2GA 5FI2A 3C5AA 3UE0A 3HBRA 2XD1A 2HDSA 2WKEA 3NC8A 4WZ5C 1IELA 3OPHA 3HLDA 4XUZA 1O07A 3SS4A 2B5RA 4R23A 3UN7A 2A49A 4DE3A 1XPBA 3V5MA 3ZGAB 3ZG9B 4UA6A 2XDMA 1XXMA 4E3NA 2WADA 5F83A 3CJMA 4FH2A 4KZ7A 3IH8A 1YLTA 1EROA 4IVKA 3RJUA 1MXOA 2XR0A 3VSKA 3GQZA 3MZFA 4IBRA 4JF5A 3UY6A 4MNRA 5EOEA 1QMFA 3IHBA 4E3MA 2Y2IA 2WGWA 1CEFA 4UAAA 1ES4A 3IXGA 3NCKA 2E8IA 5E43A 4JBFA 3IWQA 3Q7ZA 4RYEA 2QMIA 1MKIA 1ES3A 3V3SA 5EE8A 1N4OA 4S2IA 5AQ7A 2ZQ8A 2ZQAA 5DF9A 1BUEA 4LCMA 3A3FA 2V2FF 2XFSA 2XQZA 1S0WA 3PBOA 4KZ4A 4NK3A 1KE3A 4U0XA 3BFEA 3WWXA 4HEFA 4CJNA 2Y91A 4IEDA 4P6BA 5E2FA 5A93A 3D4FA 3HREA 4GD6A 1CI8A 4KZ6A 4Z9QA 3Q1FA 5EVIA 1XGIA 2HPBA 2ZQDA 3PBNA 1K54A 5DTKA 3BECA 1IYOA 3Q81A 4WM9A 3VFHA 4F94A 5CEBA 4X53A 3MFDA 3NIAA 4DDSA 3FV7A 3BFDA 1SHVA 1FR6A 3G2ZA 1KDSA 3N8RA 3FKVA 1IKGA 4GOGA 4KQQA 5IHVA 2HP5A 2Y2KA 3E2LA 5GLDA 5KZHA 1E3UA 1KGFA 4K0WA 2HP6A 3GMWA 1JTGA 3Q7VA 5FA7A 5FQ9A 4EBNA 4LV2A 1BTLA 3W4PA 1YM1A 1W7FA 4GNUA 2G2WA 1SDEA 2BG1A 1XKZA 1LLBA 4QU3A 2I72A 2ZQ9A 3OCLA 1TDGA 5HAQA 5J8XA 4BLMA 3GSGA 4JKTA 4R3BA 5FQKA 1YT4A 1ALQA 2Y2QA 5EVID 3IF6A 2OLVA 4FH4A 5EVIC 5DTTA 2XH9A 1K54C 2Y2JA 1YMSA 4XXRA 5DF8A 1ONGA 4OOLA 5M1AA 1ZKJA 1YLWA 3ZG5A 1CEGA 2Q9NA 5CHUA 1XP4A 4OKPA 5CXWA 1L0FA 1FCNA 5BOHA 2ZJ9A 3VP4A 3GTCA 3HL9A 1HZOA 2HP9A 4PMAA 4WZ5A 4ZJ3A 2VGKA 3NDGA 5DF7A 5GHZA 1K57C 4R4SA 4OQHA 1E3UD 1W5DA 2QZ6A 2Y2NA 2ZC5B 4Y0UA 5F1GA 5F1FA 4RX3A 4BD0A 4YFMA 3VMAA 2UWXA 2H5SA 3N8LA 3NI9A 4KZ9A 1Z6FA 4UA7A 1RGZA 1NZUA 4OPRA 1H8ZA 1NJ4A 2XLNA 3N8SA 3OC2A 3MZDA 4KZBA 4EV4A 2GDNA 1NZOA 1K4EA 4ZTKA 4LENA 5EUAA 4KZ3A 3NBLA 3UNWA 3BLMA 3G35A 1SCWA 5CHJA
chains in the Genus database with same CATH superfamily
4BQMA 3OLOA 4RVAA 3EQVA 2A3UA 2LB5A 4I3JA 4EEPA 1CJFA 4OQ0A 2HJEA 3S1YA 3PBTA 1NYMA 3HUOA 1S4RA 4WL9A 1YQSA 1VETA 3MXSA 1YSQA 2ZLYA 5HX9A 4MBFA 3TG9A 2HJ9C 3P98A 2WAFA 2D02A 1K0KA 5FATA 1HD8A 2JCHA 3UDFA 3L9KA 3TSGA 1JWVA 2CC1A 3T4TA 3ZNTA 3IHAA 2FFFB 3BEBA 3ZG0A 3E2KA 4HP4A 4LV3A 2XA7S 3KSFA 4LGWA 1K55A 5FI6A 1IYPA 2A24A 5CTMA 4P0MA 2INWA 4K91A 5DFYA 4I38A 1CF0A 3ZYTA 4ZAMA 3PAGA 1N9NA 3S4XA 2PD7A 3A3IA 1YPRA 3BYDA 1T18A 3IBRA 4II7A 4GKUA 3HUMA 5HAIA 4Q0JA 1TF1A 4L0LA 2X01A 4JGQA 2QPNA 1DRMA 1G5UA 2VGJA 1GSWA 2FZ0A 3WS4A 1VEUA 4OQGA 1ES2A 1MC0A 2P04A 2Y4AA 1K55C 2WKRA 3CPTB 3LO7A 4IBXA 4IJGA 4N1HA 5FAQA 2PRFA 2YKFA 1TDLA 4GHIA 2ZMFA 4QY5A 3Q07A 4CPKA 4MCWA 4X55A 1FIKA 1W8QA 1BT5A 3O3VA 4S2NA 4X1MA 3LCEA 4S2KA 4P85A 1KVLA 1F98A 4ETZA 3UB8A 1NLZA 3ITBA 1STZA 2ACGA 3OCNA 4S2PA 1LI9A 4KUOA 3PBQA 4R3JA 3WRTA 1V9YA 2J7VA 1C3BA 4JXWA 3RTYA 1WA9A 5FDHA 4DJ2A 2EWVA 3E98A 5HDSA 3BW6A 3C7VA 2BTFP 2V0UA 5CEDA 1YKDA 2OAQ1 3JVUA 4KG2A 5CHMA 1FQGA 1DY6A 4Y15A 3IXBA 1TS8A 3MKFA 4B4ZA 2IWCA 2XGNA 1NRJA 3IXHA 3UPPA 2J80A 3BFGA 4LPZA 1K4FA 4GB7A 2VV7A 2BLSA 2OOLA 4ESPA 3T1XA 4I5SA 4C3QA 2H0TA 1XX2A 2HZ5A 1S6RA 1N9BA 3C7UA 1PFLA 2NUPC 3BFFA 4ETXA 3HVFA 1GA0A 2WAEA 2X02A 1I2SA 5FAOA 4NETA 2OLUA 3HLGA 4K08A 5EVIB 2ZD8A 5TBMA 3EGXC 3GR2A 1LHYA 4WMCD 4E6XA 1Y54A 2IWBA 4JF6A 4EETB 4JGRA 5EVLA 3EQUA 3HUNA 1FSYA 4DMZA 4BBUA 4GCZA 3HLBA 1T1BA 3FYZA 1D7EA 1S66L 3AGDA 3F1NB 1BYWA 4JPMA 3ZVWA 3LFVA 1JWZA 2WK0A 2WGVA 2P08A 1XGJA 3VE4A 2ZL1B 2IWDA 2H0YA 4ZJ1A 4MN7A 3HLEA 3O87A 4PKYG 3WS0A 2XEPA 1PZOA 4HY8A 1YAXA 4EQ1A 2W27A 5I5LA 3A0RA 3PR6A 4BWIA 1F5MA 2ZC3B 2EX6A 4KG5A 2K7SA 3GV9A 2WGIA 2PU2A 4YINA 3SH9A 2Q9MA 4C6YA 3D72A 1TD5A 5LBRA 2H10A 3KSIA 3UB9A 5TJJA 2XK1A 5FQMA 3MXRA 1SKFA 3FKWA 3C5AA 3H82A 3P01A 2WKEA 4MDZA 4M4XA 1XPBA 2W3HA 4UA6A 2UV0E 3NOTC 4KZ7A 2V1BA 3NJAA 3IH8A 4CLCA 1YLTA 2VV6A 3RJUA 1OT9A 1MKMA 2W3FA 1AWIA 2H28A 3ICYA 4JF5A 5EOEA 2VJWA 3IHBA 4UAAA 2E8IA 4JBFA 3QP2A 3QP5A 1N4OA 2ZQ8A 5DF9A 3H9WA 4I3IA 3K3DA 3PBOA 2Y91A 4FOFA 5A93A 3HREA 1TS7A 2B02A 4GD6A 2O9CA 1V9ZA 4KZ6A 4CLCC 2W3EA 2OWJA 4EESA 2HPBA 5DTKA 2PYRA 3PBNA 3P7NA 3EGDC 3Q81A 1S67L 4IUHA 5K5BA 4X53A 4WN5A 5FDSA 2VEAA 3MFDA 3CUEA 3BFDA 3G2ZA 1KDSA 3FKVA 5IHVA 4Y3IA 2Y2KA 4K0WA 4LV2A 1BTLA 3FC7A 1W7FA 2JN7A 3BQAA 3MQ0A 2ZQ9A 5HAQA 1J3WA 4FH4A 4HHDA 5DTTA 4XXRA 3BQ8A 1XP4A 4OKPA 5CXWA 2Y8HA 2ZJ9A 3VP4A 3CUEC 4ZJ3A 1UWPX 5L8MA 3MJQA 3NDGA 1K57C 1E3UD 2ZC5B 1HLUP 1PRQA 4YFMA 4I3AA 3B47A 1F9IA 4OPRA 1H8ZA 1LL8A 4EV4A 2GDNA 1K4EA 4H6JA 5EUAA 4IUKA 5G4ZA 2WKHA 1P0ZA 3LIFA 5FAPA 4DXCA 4WEJA 1MZUA 1L0DA 2E8JA 5CTNA 3F1OB 2XSSA 4GN2A 4F3LA 1Y28A 5F5YA 3O88A 4NXEA 3TE8A 1WYBA 3ZFZA 2EFXA 1ZC2A 1J9MA 2V9AA 3N7WA 2J3TC 4G3VA 1CK3A 1OJ5A 2PYPA 1GHMA 2JKGA 1BLCA 5DFXA 4ZBEA 1H3QA 2VX8A 3OBFA 4HNBA 2WKQA 3BWLA 3VP0A 5EM1A 4JXGA 4BL2A 1S1YA 2EX2A 5FSRA 3C4OA 3LR0A 3MFXA 2VZWA 4EU0A 4Q0IA 1K56A 5HARA 1PIOA 2P9VA 1YLJA 3VSLA 1OTBA 3S7QA 1T1CA 2RL3A 1GHIA 4HBTA 3HLCA 4HESA 1TS6A 5A91A 1TVFA 4LRZE 4B9OA 4KZ5A 1A0KA 5JYOA 4EERA 4L9EA 4PM5A 3ZQ5A 4N1XA 4YWZA 1H0MA 4FD8A 3M6HA 2Y2MA 4GS9A 3MZEA 2ZMAA 5J3WA 3KSHA 3JYIA 5FI7A 4EBPA 3LEQA 4H8RA 3NY4A 4R38A 3NOUC 3BM6A 5DJTA 3CZDA 3UPNA 3TW8A 4RA7A 2P74A 4S2OA 3V67A 1GHPA 2XF3A 2HDQA 3IS2A 5CECA 2EXAA 2EX9A 1I2WA 1MWTA 3G2YA 2ZM0A 3CI6A 2XFTA 4I39A 4DE2A 1UWNX 1KE4A 3BY9A 4FSFA 5HL6A 3C8CA 1TEMA 5HDCA 1IYSA 2PD8A 4P87A 2O9BA 2W3GA 3LY3A 3SS5A 4PAUA 1G6AA 2ZM8A 5M19A 1K6RA 4WYYA 2C6WB 3A3JA 4A5RA 3K2NA 4X6TA 5HDDA 4EBLA 2W1TA 4MEZA 4N92A 5FASA 4Y7PA 1WYCA 4XT2B 4QHCA 2HDUA 5GLCA 5CGXA 5EV0A 3P09A 1PWGA 3MBZA 2VV8A 3EEAA 5HD3A 1PYYA 2ZOIA 4LV1A 3OZHA 3T4OA 2FH5A 3GRJA 3FZCA 1PI4A 4WZ4A 1OTIA 4DE1A 1D1JA 3C2WA 4B88A 3VP3A 1EWZA 3IXDA 2JHEA 2J8YA 2JE5A 4E3LA 3GDIA 4EWFA 2CMNA 3W8KA 3B3XA 3BY8A 3K3CA 2DRWA 3FG8A 2HGVA 1CQAA 1XJ4A 1K6SA 3M6BA 3UPOA 4HBUA 2A24B 4N9LA 4FUWA 4Y13A 2Y2LA 2K31A 5AJGA 1LL5A 3H7WA 3RXWA 4QY6A 4O8GA 3ZG7B 5HD5A 4E3KA 2HDRA 3CMZA 3HLWA 2R9XA 3MS6A 3HJIA 3Q7VB 1WE4A 4MBHA 4MN6A 3QP8A 1BLSA 3BLSA 5AVFA 5HFOA 1VEUB 4IHQA 2V8FA 4S2JA 4DDYA 3T4QA 3IF6B 4JLFA 1ES5A 1ZHHB 2OSUA 3CPTA 1YLYA 4KQOA 2VGLM 1GCEA 3ZNYA 3DWZA 3T4SA 3VP1A 4U3TA 3NDEA 3DW0A 1M6KA 2W3DA 2VK3A 5TFQA 4KZAA 2ZQ7A 2L0WA 2P7JA 3MKEA 2O99A 3WS1A 3A3DA 3T1RA 5KSCA 2WKPA 1O7EA 3PHYA 2EFUA 4QWOA 3CITA 3QNCA 4WBGA 4JGPA 3LIEA 2DMWA 5HZHA 3CWFA 4NXGA 3QHYA 5GL9A 2Y79A 5FI2A 5E2GA 4JF4A 2HDSA 3NC8A 3HLDA 1O07A 3TRCA 4R23A 5DKLA 3IX8A 2Q0OA 3JVVA 4IVKA 3UY6A 1QMFA 2Y2IA 2WGWA 1CEFA 2VKSA 3NCKA 4WUJA 4RYEA 5EE8A 4S2IA 2ZQAA 1BUEA 2XFSA 2XQZA 4KUKA 4KZ4A 4NK3A 1KE3A 3QP1A 1F2KA 3WWXA 4IEDA 4P6BA 5E2FA 3D4FA 4CLCD 5EVIA 1CI8A 3Q1FA 4X1LA 2O9AA 2PBDP 1IYOA 5J4EA 5CEBA 4DDSA 1FR6A 4KQQA 5KZHA 3GMWA 1JTGA 2ZOHA 5FA7A 3W4PA 1LLBA 3OCLA 5J8XA 2V0WA 5MC7A 5L10A 1ALQA 1FILA 1T19A 2OLVA 5EVIC 1EW0A 5M1AA 1YLWA 4G3KA 5CHUA 2ZL1A 3UB5P 3IX3A 5F68A 3GTCA 1IOUA 2HP9A 4PMAA 2VGKA 5GHZA 4R4SA 2HF6A 2YKHA 1RGZA 3C30A 1NJ4A 3OC2A 5A8BA 4KZBA 3CHWP 2V8CA 3BLMA 1L3LA 3TOIA 3M2JA 4KG6A 1FCMA 4DE0A 4NKPA 1IEMA 1XFNA 4QJGA 3S7OA 3DBAA 3DWKA 3PXPA 5D3OA 3NULA 3T50A 5EM0A 2Z6CA 4OP8A 5E2HA 2J3TD 3UE1A 3A0VA 4X56A 1K38A 3D3OA 5F82A 1N9OA 1VB6A 2EXBA 4EEUA 3MF0A 5G18A 3LR5A 4WLAA 3PTEA 5HSQA 5CX7A 4CLCB 1ACFA 3DTKA 4ZDXA 4NEED 1OT6A 5HWVA 1SKOB 1XJ6A 3PAEA 2Y2HA 5EOOA 3E0YA 3PYPA 2GZAA 3NHQA 3SS3A 4U0TA 1H5XA 1VM1A 3ITAA 3MQOA 4YOFA 2KLIA 4UA9A 3G4PA 1K25A 4N9KA 2ZC4B 1Q2PA 1PWCA 3MR0A 4HP9A 4ID4A 1EI5A 4PPRA 1K57A 2GNXA 4Y2FA 5KSHA 3KYZA 1RCJA 2GX5A 1Y4OA 3UMDA 1K56D 2DNSA 1HVBA 3B33A 5L09A 4HOIA 1S4SA 1M40A 4MMNA 3AGEA 3C4PA 4R1GA 4DF6A 1BSGA 2ZM2A 3IF5A 4D2OA 3FWLA 4XUXA 1PW8A 4EW7A 1FSWA 1YLPA 5G4YA 4EQIA 4B4XA 2JKRM 2Y59A 1E25A 3JPUA 3UO9A 2XD5A 5FEFA 3CG5A 2JKTM 4X69A 5GHXA 1YSPA 2A2LA 2JKFA 5DTSA 3ZHHA 2V1ZA 4DKIA 1I5QA 4OOMA 2DCFA 2WKIA 3VP2A 3EWKA 4OONA 1YLZA 2V1AA 3HJKA 4DXBA 3VFFA 5IU1A 3E4OA 4EUZA 4EXOA 4F3LB 1PI5A 1NLYA 4ARZA 4LLOB 5TR7A 3DTIA 4S2MA 1JTDA 3F1OA 4E3IA 3IWIA 5J7EA 3U2AA 3G31A 3UB6A 2J9PA 1ERQA 4NG2A 3FPWA 4IVIA 2VLGA 5DKKA 3FPVA 3OPLA 1HTZA 5L2FA 4Q8IA 2QYBA 1W8YA 5AQBA 3KYQA 5CERA 1CI9A 4BBVA 3F1PB 4FTXA 2IA2A 2PT7A 4OLGA 4UHUA 1OMEA 4E04A 5JYPA 3OPRA 2Y2PA 5CGWA 4UQIM 1RP5A 2P9VB 4O7DA 4WELA 1ONHA 1OTAA 4GLQA 3T12B 4UEYA 4B93A 1BZAA 1Z09A 1NXYA 4Y0OA 4PKYA 2WYXA 4NXFA 3ZG8B 1FR1A 1L2SA 1MWSA 2Y2OA 5EECA 3R7WB 5U47A 4BJPA 3UMEA 1PW1A 1ESUA 4GS9B 3N4IA 3UDXA 4QB8A 2X71A 3LGOA 1XA1A 5GLAA 1MWRA 3QNBA 4OVDA 2PU4A 4HQAA 4D60A 5M18A 3HCYA 2EWWA 2QKPA 1OTDA 1JWPA 3S22A 4S2LA 2PBYA 5F69A 3GVBA 4OP5A 2Y2GA 2ZC6B 3HLFA 1LSWA 3QP6A 3LIAA 5EPHA 4R6LA 3WRZA 4OPYA 3V39A 1PZPA 3IH9A 1NRFA 4E6WA 3S7PA 2W1RA 3LEZA 2W1TB 4KENB 2ZQCA 3SH8A 4RX2A 1L0GA 1IYQA 1VETB 5KMWA 1XJ2A 4LFUA 4XT2A 3BJNA 3HBRA 2XD1A 2D01A 4WZ5C 3OPHA 3O5YA 3SS4A 3UN7A 3IX4A 4DE3A 4E3NA 3C38A 2L1MA 2WADA 5F83A 4FH2A 1EROA 4Y17A 2R78A 1MXOA 2XR0A 4KQDA 3VSKA 3GECA 3GQZA 4O01A 4MNRA 4E3MA 5FEGA 1ES4A 3IXGA 3UE6A 2Z6DA 2QWSA 3Q7ZA 5HPIA 2KDKA 1MKIA 4L9FA 1ES3A 3V3SA 5AQ7A 2XA7M 1OTEA 2G7UA 1NWZA 4U0XA 3BFEA 2ZMVA 4HEFA 5DJUA 1OPXA 2ZBBA 3IBJA 4HH3A 1XGIA 2QJ5A 3MSHA 1K54A 5HWTA 2L4RA 3H7WB 3EEHA 4WM9A 4BMWA 3N8RA 1IKGA 4GOGA 3E2LA 1KGFA 2KOIA 3VE3A 3Q7VA 5FQ9A 4GNUA 2BG1A 1VHMA 3A0SA 4GHIB 3GSGA 4P6ZM 1YT4A 5FQKA 3T1SA 5EVID 3IF6A 1DP6A 4P6ZS 2VGLS 2Y2JA 1K54C 4G3WA 3UB7A 1FCNA 1HZOA 3DAVA 2OAP1 5DF7A 3CAXA 5AVEA 3E4QA 5L07A 2QZ6A 2Y2NA 5F1GA 4BD0A 2UWXA 5FL3A 3LR3A 3NI9A 4KZ9A 3TJZC 3SZTA 1NZUA 2XLNA 2O0YA 3N8SA 3MZDA 3L7HA 1NZOA 5F6AA 3B42A 2GJ3A 4LENA 3UNWA 3IF6C 1SCWA 1ZTUA 1LT0A 1KGGA 3VOYA 1P9RA 4BENA 2G2UA 1GA9A 3A3EA 1TS0A 5FQJA 4S2NC 5C5KA 4R0QA 3Q82A 1OJGA 3KYEA 2XRNA 2J9OA 4NXBA 1KGEA 3VOZA 2EX8A 3IT9A 1JVJA 3ZCZA 2JBFA 1DP8A 2MJ6A 1LI0A 3LI9A 1S1ZA 4PM9A 2Z2MB 4Q0HA 1H8MA 2WGWB 3KX0X 3T4KA 3T4LA 3NOPC 3QP4A 2RCXA 3E4PA 1GSVA 5TBMB 1LL9A 2WZZA 4LRXC 3UE3A 4ZRRA 4QD4A 1P9WA 2ZC7A 4DN0A 2QHKA 4E3OA 4HIAA 3RXXA 2M7UA 1VQQA 1XFQA 3DTEA 4OOYA 3ZDJA 4FCFA 1N9LA 5EVEA 2XROA 3ISGA 1KE0A 1QMEA 1GSXA 4OPZA 3V50A 3O86A 5AQ9A 3PBRA 4KZ8A 4K0XA 4BL3A 3SW1A 3D9YA 1W79A 3F1NA 3NBLA 3MXQA 3W4QA 4GD8A 4C75A 5HAPA 5HWWA 1SDNA 1DJAA 5GLBA 4MLLA 5HL1A 5AQAA 2JKRI 3M2KA 5CRFA 3SOIA 3PBSA 4PM8A 5I94A 3BRMA 2JKTI 4Z1WA 3G32A 2M7VA 2HV1A 1BULA 1G68A 4R4RA 2JC7A 3S7NA 5A90A 4QPRA 4PM6A 1XJ3A 2LB9A 2BASA 3T4JA 3RH8B 5CGSA 4CQHA 2PHYA 3UDIA 1U60A 2C5WB 1UGUA 4JXVA 3OPPA 1KDWA 3MQQA 1BLHA 2PAVP 3LY4A 3H82B 5E2EA 3V3RA 3EOIA 4YNRA 1LSVA 1BLPA 1ZG6A 5FQIA 1NY0A 1Q2QA 3W4OA 1FOFA 5EFWA 4DRTA 4WMCA 3SH7A 3MMHA 1H8YA 2PDRA 3CLOA 1AXBA 1DP9A 1SKOA 4KQRA 1ERMA 3ZVTA 1KVMA 4X25A 3AGFA 4OQIA 5HW3A 4WEKA 3BFCA 3LIDA 1IFQA 4BD1A 3I7JA 4E3JA 1RGYA 2OV5A 5HPFA 3WS5A 3G30A 1MY8A 4O0PA 1E4DA 4LV0A 4OH0A 2WZXA 4OPQA 1ODVA 3KO6A 3N6IA 1FCOA 4GW9A 4JGOA 1ESIA 4GDBA 4PM7A 3IQAA 1MBLA 2FFYA 1XA7A 3IWOA 2WUQA 4Y0TA 3KSGA 1YMXA 4ZJ2A 4X68A 4OLDA 3LI8A 2B18A 3G34A 4AFIA 5DVAA 1KOUA 3U4LP 5GHYA 5IT5A 4LCLA 3WS2A 4LRYC 4GZBA 2Y55A 4BBTA 3LICA 4HI4A 2K2NA 5FQQA 1L0EA 3DTMA 4MBKA 1PWDA 4JXSA 2PR5A 4H6JB 2V20A 1SZVA 1MWUA 1IKIA 1G6OA 1ZG4A 1MPLA 5A92A 2QJ7A 1DJCA 3LIBA 2AVXA 4RQ9A 1DJBA 4GDNA 5TGFA 2R9WA 3VV4A 5IS1A 1NYYA 2Z2LB 4ARZB 3ULFA 3UE0A 4HJ6A 1IELA 4XUZA 4PHTA 2B5RA 2A49A 2VA0A 3V5MA 3ZGAB 3ZG9B 2XDMA 1JNUA 1XXMA 3CJMA 2B95A 3NECA 1D06A 2W0NA 3LYXA 4WF0A 3MZFA 4IBRA 4GJ4A 5E43A 4UQIS 3F1PA 3IWQA 2QMIA 4DJ3A 5KIZA 4LCMA 3A3FA 2V2FF 1S0WA 3LUQA 1G28A 4R70A 3OOVA 4CJNA 4Y5FA 2PR6A 4Z9QA 1LSXA 2ZQDA 3R4KA 3BECA 4MN5A 2M1CA 3VFHA 3VOLA 4F94A 3RFBA 3NIAA 3FV7A 4R3AA 3T1QB 1SHVA 2OWHA 2HP5A 1X0OA 5GLDA 3R7WA 1E3UA 4HJ4A 2HP6A 4EBNA 1YM1A 4HH2A 2G2WA 1SDEA 1XKZA 4QU3A 2I72A 1TDGA 2KX6A 4BLMA 4JKTA 4R3BA 2Y2QA 3IS2B 2XH9A 2I9VA 1T1AA 1YMSA 5DF8A 1ONGA 4OOLA 1ZKJA 3ZG5A 4CLCE 1CEGA 1W63M 2Q9NA 1L0FA 5BOHA 3HL9A 1W63Q 4WZ5A 3G6OA 4OQHA 1W5DA 4Y0UA 5F1FA 4RX3A 1P97A 3VMAA 2NUTC 1PNEA 2H5SA 3N8LA 4ME4A 1Z6FA 3W2ZA 4UA7A 4EUVA 3LR4A 4L9GA 4ZTKA 4KZ3A 4HJ3A 2J3WA 4M3KA 3G35A 2EA9A 5CHJA
chains in the Genus database with same CATH topology
2WKHA 3M2JA 4KG6A 4BQMA 1FCMA 4RVAA 4DE0A 1KGGA 3EQVA 2A3UA 5FAPA 4DXCA 3VOYA 4WEJA 4BENA 4OQ0A 1L0DA 3S1YA 3PBTA 1IEMA 2G2UA 1GA9A 5CTNA 1NYMA 3A3EA 3HUOA 4GN2A 4QJGA 5FQJA 3DWKA 3O88A 4S2NC 5D3OA 1WYBA 4R0QA 3ZFZA 3Q82A 1YQSA 2EFXA 1ZC2A 1J9MA 3N7WA 4OP8A 5E2HA 3MXSA 2J9OA 3TOIA 3UE1A 1CK3A 1KGEA 2ZLYA 4X56A 1K38A 4MBFA 5HX9A 3TG9A 5F82A 3VOZA 1GHMA 2EX8A 3IT9A 2EXBA 1JVJA 1BLCA 5G18A 3P98A 3ZCZA 2WAFA 2JBFA 3PTEA 4ZBEA 5FATA 1HD8A 2JCHA 3UDFA 4ZDXA 1LI0A 3TSGA 3VP0A 1JWVA 4PM9A 3PAEA 4JXGA 2Y2HA 2Z2MB 4BL2A 2CC1A 2EX2A 5FSRA 3ZNTA 2WGWB 3C4OA 3IHAA 5EOOA 2FFFB 3BEBA 3ZG0A 3E2KA 4LV3A 2RCXA 3SS3A 4U0TA 5HARA 1K56A 1PIOA 2P9VA 1YLJA 3VSLA 1H5XA 1LL9A 1VM1A 2WZZA 3ITAA 2RL3A 3UE3A 1K55A 4UA9A 5FI6A 1IYPA 1GHIA 1K25A 3G4PA 4N9KA 5CTMA 4P0MA 4QD4A 4HBTA 3HLCA 4HESA 4K91A 2ZC4B 1Q2PA 2ZC7A 1TVFA 5A91A 4KZ5A 3PAGA 4ZAMA 5JYOA 4E3OA 1PWCA 3S4XA 3A3IA 3RXXA 4PM5A 3BYDA 4ID4A 1VQQA 4GKUA 4N1XA 1EI5A 3HUMA 1K57A 4PPRA 4FD8A 5HAIA 3M6HA 2Y2MA 4OOYA 5KSHA 4L0LA 2X01A 3ZDJA 3MZEA 4FCFA 2ZMAA 3ISGA 1KE0A 1RCJA 1QMEA 3JYIA 2QPNA 5FI7A 4EBPA 3IF6C 4OPZA 3V50A 3O86A 4H8RA 1K56D 2VGJA 2DNSA 3NY4A 5AQ9A 3PBRA 4KZ8A 4K0XA 3WS4A 4BL3A 1HVBA 4OQGA 1ES2A 1W79A 1M40A 2Y4AA 3BM6A 3W4QA 1K55C 3CZDA 3AGEA 3UPNA 3C4PA 4R1GA 4GD8A 3LO7A 4C75A 4IBXA 4DF6A 5HAPA 4RA7A 2P74A 1SDNA 4N1HA 1DJAA 5FAQA 1BSGA 5GLBA 2ZM2A 4S2OA 3IF5A 1TDLA 4D2OA 3FWLA 4XUXA 4MLLA 5HL1A 4QY5A 3Q07A 1GHPA 5AQAA 4CPKA 4X55A 2XF3A 1PW8A 2HDQA 1W8QA 1BT5A 1FSWA 5CECA 2EXAA 1YLPA 2EX9A 4EQIA 3M2KA 1I2WA 3O3VA 4S2NA 4B4XA 1MWTA 3G2YA 5CRFA 2Y59A 3LCEA 1E25A 4S2KA 3SOIA 2ZM0A 3UO9A 2XD5A 3PBSA 4P85A 1KVLA 3CG5A 2XFTA 4DE2A 4PM8A 5I94A 1KE4A 3BRMA 4FSFA 3G32A 1TEMA 1IYSA 3ITBA 1BULA 3OCNA 4X69A 5GHXA 4P87A 1G68A 4S2PA 1LI9A 3PBQA 4R4RA 2JC7A 4R3JA 3WRTA 2J7VA 5A90A 1C3BA 4PM6A 3LY3A 5DTSA 3SS5A 3ZHHA 2V1ZA 4DKIA 4JXWA 1I5QA 4OOMA 1G6AA 5FDHA 2ZM8A 5M19A 1K6RA 4WYYA 5CGSA 2C6WB 2DCFA 3A3JA 2WKIA 3VP2A 4A5RA 4X6TA 4EBLA 3UDIA 1U60A 2C5WB 4MEZA 4OONA 3C7VA 1YLZA 4N92A 5FASA 4DXBA 4JXVA 1WYCA 4Y7PA 3VFFA 4EUZA 3OPPA 5CEDA 1KDWA 1BLHA 3LY4A 4QHCA 2HDUA 5GLCA 4KG2A 5CHMA 1PI5A 5CGXA 1FQGA 1DY6A 5E2EA 3P09A 5TR7A 3IXBA 4S2MA 1JTDA 3V3RA 1PWGA 4E3IA 3MBZA 3IWIA 1PYYA 3G31A 1BLPA 2J9PA 1ZG6A 5FQIA 3MKFA 1ERQA 3OZHA 4LV1A 3GRJA 4B4ZA 1NY0A 2IWCA 2XGNA 3IXHA 4IVIA 3UPPA 1Q2QA 3W4OA 3BFGA 3FZCA 3OPLA 1K4FA 1FOFA 1PI4A 4GB7A 4WZ4A 2BLSA 4DRTA 1HTZA 4WMCA 5L2FA 4DE1A 4Q8IA 1W8YA 5AQBA 4C3QA 4B88A 2H0TA 1XX2A 3SH7A 5CERA 1S6RA 1H8YA 3VP3A 1N9BA 1EWZA 3IXDA 3C7UA 2J8YA 1CI9A 2JE5A 4E3LA 1AXBA 3BFFA 4OLGA 4UHUA 4EWFA 1OMEA 4KQRA 3W8KA 1ERMA 3ZVTA 5JYPA 3B3XA 3OPRA 1KVMA 2DRWA 3AGFA 2Y2PA 5CGWA 3HVFA 4OQIA 1RP5A 2P9VB 1GA0A 5HW3A 4WEKA 3BFCA 4O7DA 1K6SA 2WAEA 2X02A 4BD1A 1I2SA 3I7JA 3M6BA 4E3JA 5FAOA 4NETA 2OLUA 4WELA 3HLGA 3UPOA 1RGYA 4HBUA 5EVIB 2ZD8A 2OV5A 4N9LA 1ONHA 3WS5A 3G30A 3GR2A 1BZAA 1MY8A 2Y2LA 1LHYA 4WMCD 4E6XA 1NXYA 1E4DA 4Y0OA 2WYXA 1LL5A 3ZG8B 1FR1A 4LV0A 1L2SA 1MWSA 4OH0A 3RXWA 1Y54A 2IWBA 4QY6A 2Y2OA 2WZXA 4JF6A 4OPQA 5EECA 3ZG7B 4E3KA 5U47A 2HDRA 4BJPA 3CMZA 3N6IA 1FCOA 5EVLA 3HLWA 2R9XA 3EQUA 3Q7VB 1PW1A 1WE4A 3HUNA 1ESUA 1ESIA 4MBHA 4GDBA 4PM7A 1BLSA 3N4IA 3UDXA 3IQAA 1FSYA 1MBLA 3BLSA 4QB8A 2FFYA 3HLBA 5HFOA 2X71A 1XA7A 3IWOA 3FYZA 2WUQA 1XA1A 4S2JA 4DDYA 4Y0TA 1YMXA 4ZJ2A 3AGDA 4JPMA 4X68A 5GLAA 3ZVWA 4OLDA 3G34A 3IF6B 4JLFA 5DVAA 1MWRA 1ES5A 1JWZA 2WGVA 2WK0A 3QNBA 5GHYA 4OVDA 1XGJA 2PU4A 2OSUA 4LCLA 3WS2A 2IWDA 1YLYA 2H0YA 4GZBA 4KQOA 5M18A 4ZJ1A 1GCEA 3ZNYA 3DWZA 1JWPA 3HLEA 3O87A 3S22A 3WS0A 2XEPA 2Y55A 1PZOA 4S2LA 2PBYA 4M3KA 3VP1A 4U3TA 3NDEA 3GVBA 4OP5A 3DW0A 1M6KA 5FQQA 2Y2GA 2ZC6B 3HLFA 1L0EA 3DTMA 4MBKA 1PWDA 5EPHA 4JXSA 5TFQA 4KZAA 2ZC3B 2V20A 3WRZA 2ZQ7A 4OPYA 2EX6A 3WS1A 3MKEA 4KG5A 3V39A 1MWUA 3A3DA 1PZPA 3GV9A 1NRFA 1IKIA 2WGIA 3IH9A 4E6WA 5KSCA 2PU2A 1ZG4A 4YINA 3LEZA 3SH9A 2Q9MA 1MPLA 1O7EA 5A92A 4C6YA 4KENB 1DJCA 2EFUA 2H10A 2ZQCA 3SH8A 4RX2A 3QNCA 1DJBA 4WBGA 1L0GA 4GDNA 5TGFA 2XK1A 2R9WA 1IYQA 1NYYA 2Z2LB 5KMWA 3QHYA 5FQMA 5GL9A 3MXRA 1SKFA 3FKWA 4JF4A 5E2GA 5FI2A 3C5AA 3UE0A 3HBRA 2XD1A 2HDSA 2WKEA 3NC8A 4WZ5C 1IELA 3OPHA 3HLDA 4XUZA 1O07A 3SS4A 2B5RA 4R23A 3UN7A 2A49A 4DE3A 1XPBA 3V5MA 3ZGAB 3ZG9B 4UA6A 2XDMA 1XXMA 4E3NA 2WADA 5F83A 3CJMA 4FH2A 4KZ7A 3IH8A 1YLTA 1EROA 4IVKA 3RJUA 1MXOA 2XR0A 3VSKA 3GQZA 3MZFA 4IBRA 4JF5A 3UY6A 4MNRA 5EOEA 1QMFA 3IHBA 4E3MA 2Y2IA 2WGWA 1CEFA 4UAAA 1ES4A 3IXGA 3NCKA 2E8IA 5E43A 4JBFA 3IWQA 3Q7ZA 4RYEA 2QMIA 1MKIA 1ES3A 3V3SA 5EE8A 1N4OA 4S2IA 5AQ7A 2ZQ8A 2ZQAA 5DF9A 1BUEA 4LCMA 3A3FA 2V2FF 2XFSA 2XQZA 1S0WA 3PBOA 4KZ4A 4NK3A 1KE3A 4U0XA 3BFEA 3WWXA 4HEFA 4CJNA 2Y91A 4IEDA 4P6BA 5E2FA 5A93A 3D4FA 3HREA 4GD6A 1CI8A 4KZ6A 4Z9QA 3Q1FA 5EVIA 1XGIA 2HPBA 2ZQDA 3PBNA 1K54A 5DTKA 3BECA 1IYOA 3Q81A 4WM9A 3VFHA 4F94A 5CEBA 4X53A 3MFDA 3NIAA 4DDSA 3FV7A 3BFDA 1SHVA 1FR6A 3G2ZA 1KDSA 3N8RA 3FKVA 1IKGA 4GOGA 4KQQA 5IHVA 2HP5A 2Y2KA 3E2LA 5GLDA 5KZHA 1E3UA 1KGFA 4K0WA 2HP6A 3GMWA 1JTGA 3Q7VA 5FA7A 5FQ9A 4EBNA 4LV2A 1BTLA 3W4PA 1YM1A 1W7FA 4GNUA 2G2WA 1SDEA 2BG1A 1XKZA 1LLBA 4QU3A 2I72A 2ZQ9A 3OCLA 1TDGA 5HAQA 5J8XA 4BLMA 3GSGA 4JKTA 4R3BA 5FQKA 1YT4A 1ALQA 2Y2QA 5EVID 3IF6A 2OLVA 4FH4A 5EVIC 5DTTA 2XH9A 1K54C 2Y2JA 1YMSA 4XXRA 5DF8A 1ONGA 4OOLA 5M1AA 1ZKJA 1YLWA 3ZG5A 1CEGA 2Q9NA 5CHUA 1XP4A 4OKPA 5CXWA 1L0FA 1FCNA 5BOHA 2ZJ9A 3VP4A 3GTCA 3HL9A 1HZOA 2HP9A 4PMAA 4WZ5A 4ZJ3A 2VGKA 3NDGA 5DF7A 5GHZA 1K57C 4R4SA 4OQHA 1E3UD 1W5DA 2QZ6A 2Y2NA 2ZC5B 4Y0UA 5F1GA 5F1FA 4RX3A 4BD0A 4YFMA 3VMAA 2UWXA 2H5SA 3N8LA 3NI9A 4KZ9A 1Z6FA 4UA7A 1RGZA 1NZUA 4OPRA 1H8ZA 1NJ4A 2XLNA 3N8SA 3OC2A 3MZDA 4KZBA 4EV4A 2GDNA 1NZOA 1K4EA 4ZTKA 4LENA 5EUAA 4KZ3A 3NBLA 3UNWA 3BLMA 3G35A 1SCWA 5CHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WKH A;  3M2J A;  4KG6 A;  4BQM A;  1FCM A;  4RVA A;  4DE0 A;  1KGG A;  3EQV A;  2A3U A;  5FAP A;  4DXC A;  3VOY A;  4WEJ A;  4BEN A;  4OQ0 A;  1L0D A;  3S1Y A;  3PBT A;  1IEM A;  2G2U A;  1GA9 A;  5CTN A;  1NYM A;  3A3E A;  3HUO A;  4GN2 A;  4QJG A;  5FQJ A;  3DWK A;  3O88 A;  4S2N C;  5D3O A;  1WYB A;  4R0Q A;  3ZFZ A;  3Q82 A;  1YQS A;  2EFX A;  1ZC2 A;  1J9M A;  3N7W A;  4OP8 A;  5E2H A;  3MXS A;  2J9O A;  3TOI A;  3UE1 A;  1CK3 A;  1KGE A;  2ZLY A;  4X56 A;  1K38 A;  4MBF A;  5HX9 A;  3TG9 A;  5F82 A;  3VOZ A;  1GHM A;  2EX8 A;  3IT9 A;  2EXB A;  1JVJ A;  1BLC A;  5G18 A;  3P98 A;  3ZCZ A;  2WAF A;  2JBF A;  3PTE A;  4ZBE A;  5FAT A;  1HD8 A;  2JCH A;  3UDF A;  4ZDX A;  1LI0 A;  3TSG A;  3VP0 A;  1JWV A;  4PM9 A;  3PAE A;  4JXG A;  2Y2H A;  2Z2M B;  4BL2 A;  2CC1 A;  2EX2 A;  5FSR A;  3ZNT A;  2WGW B;  3C4O A;  3IHA A;  5EOO A;  2FFF B;  3BEB A;  3ZG0 A;  3E2K A;  4LV3 A;  2RCX A;  3SS3 A;  4U0T A;  5HAR A;  1K56 A;  1PIO A;  2P9V A;  1YLJ A;  3VSL A;  1H5X A;  1LL9 A;  1VM1 A;  2WZZ A;  3ITA A;  2RL3 A;  3UE3 A;  1K55 A;  4UA9 A;  5FI6 A;  1IYP A;  1GHI A;  1K25 A;  3G4P A;  4N9K A;  5CTM A;  4P0M A;  4QD4 A;  4HBT A;  3HLC A;  4HES A;  4K91 A;  2ZC4 B;  1Q2P A;  2ZC7 A;  1TVF A;  5A91 A;  4KZ5 A;  3PAG A;  4ZAM A;  5JYO A;  4E3O A;  1PWC A;  3S4X A;  3A3I A;  3RXX A;  4PM5 A;  3BYD A;  4ID4 A;  1VQQ A;  4GKU A;  4N1X A;  1EI5 A;  3HUM A;  1K57 A;  4PPR A;  4FD8 A;  5HAI A;  3M6H A;  2Y2M A;  4OOY A;  5KSH A;  4L0L A;  2X01 A;  3ZDJ A;  3MZE A;  4FCF A;  2ZMA A;  3ISG A;  1KE0 A;  1RCJ A;  1QME A;  3JYI A;  2QPN A;  5FI7 A;  4EBP A;  3IF6 C;  4OPZ A;  3V50 A;  3O86 A;  4H8R A;  1K56 D;  2VGJ A;  2DNS A;  3NY4 A;  5AQ9 A;  3PBR A;  4KZ8 A;  4K0X A;  3WS4 A;  4BL3 A;  1HVB A;  4OQG A;  1ES2 A;  1W79 A;  1M40 A;  2Y4A A;  3BM6 A;  3W4Q A;  1K55 C;  3CZD A;  3AGE A;  3UPN A;  3C4P A;  4R1G A;  4GD8 A;  3LO7 A;  4C75 A;  4IBX A;  4DF6 A;  5HAP A;  4RA7 A;  2P74 A;  1SDN A;  4N1H A;  1DJA A;  5FAQ A;  1BSG A;  5GLB A;  2ZM2 A;  4S2O A;  3IF5 A;  1TDL A;  4D2O A;  3FWL A;  4XUX A;  4MLL A;  5HL1 A;  4QY5 A;  3Q07 A;  1GHP A;  5AQA A;  4CPK A;  4X55 A;  2XF3 A;  1PW8 A;  2HDQ A;  1W8Q A;  1BT5 A;  1FSW A;  5CEC A;  2EXA A;  1YLP A;  2EX9 A;  4EQI A;  3M2K A;  1I2W A;  3O3V A;  4S2N A;  4B4X A;  1MWT A;  3G2Y A;  5CRF A;  2Y59 A;  3LCE A;  1E25 A;  4S2K A;  3SOI A;  2ZM0 A;  3UO9 A;  2XD5 A;  3PBS A;  4P85 A;  1KVL A;  3CG5 A;  2XFT A;  4DE2 A;  4PM8 A;  5I94 A;  1KE4 A;  3BRM A;  4FSF A;  3G32 A;  1TEM A;  1IYS A;  3ITB A;  1BUL A;  3OCN A;  4X69 A;  5GHX A;  4P87 A;  1G68 A;  4S2P A;  1LI9 A;  3PBQ A;  4R4R A;  2JC7 A;  4R3J A;  3WRT A;  2J7V A;  5A90 A;  1C3B A;  4PM6 A;  3LY3 A;  5DTS A;  3SS5 A;  3ZHH A;  2V1Z A;  4DKI A;  4JXW A;  1I5Q A;  4OOM A;  1G6A A;  5FDH A;  2ZM8 A;  5M19 A;  1K6R A;  4WYY A;  5CGS A;  2C6W B;  2DCF A;  3A3J A;  2WKI A;  3VP2 A;  4A5R A;  4X6T A;  4EBL A;  3UDI A;  1U60 A;  2C5W B;  4MEZ A;  4OON A;  3C7V A;  1YLZ A;  4N92 A;  5FAS A;  4DXB A;  4JXV A;  1WYC A;  4Y7P A;  3VFF A;  4EUZ A;  3OPP A;  5CED A;  1KDW A;  1BLH A;  3LY4 A;  4QHC A;  2HDU A;  5GLC A;  4KG2 A;  5CHM A;  1PI5 A;  5CGX A;  1FQG A;  1DY6 A;  5E2E A;  3P09 A;  5TR7 A;  3IXB A;  4S2M A;  1JTD A;  3V3R A;  1PWG A;  4E3I A;  3MBZ A;  3IWI A;  1PYY A;  3G31 A;  1BLP A;  2J9P A;  1ZG6 A;  5FQI A;  3MKF A;  1ERQ A;  3OZH A;  4LV1 A;  3GRJ A;  4B4Z A;  1NY0 A;  2IWC A;  2XGN A;  3IXH A;  4IVI A;  3UPP A;  1Q2Q A;  3W4O A;  3BFG A;  3FZC A;  3OPL A;  1K4F A;  1FOF A;  1PI4 A;  4GB7 A;  4WZ4 A;  2BLS A;  4DRT A;  1HTZ A;  4WMC A;  5L2F A;  4DE1 A;  4Q8I A;  1W8Y A;  5AQB A;  4C3Q A;  4B88 A;  2H0T A;  1XX2 A;  3SH7 A;  5CER A;  1S6R A;  1H8Y A;  3VP3 A;  1N9B A;  1EWZ A;  3IXD A;  3C7U A;  2J8Y A;  1CI9 A;  2JE5 A;  4E3L A;  1AXB A;  3BFF A;  4OLG A;  4UHU A;  4EWF A;  1OME A;  4KQR A;  3W8K A;  1ERM A;  3ZVT A;  5JYP A;  3B3X A;  3OPR A;  1KVM A;  2DRW A;  3AGF A;  2Y2P A;  5CGW A;  3HVF A;  4OQI A;  1RP5 A;  2P9V B;  1GA0 A;  5HW3 A;  4WEK A;  3BFC A;  4O7D A;  1K6S A;  2WAE A;  2X02 A;  4BD1 A;  1I2S A;  3I7J A;  3M6B A;  4E3J A;  5FAO A;  4NET A;  2OLU A;  4WEL A;  3HLG A;  3UPO A;  1RGY A;  4HBU A;  5EVI B;  2ZD8 A;  2OV5 A;  4N9L A;  1ONH A;  3WS5 A;  3G30 A;  3GR2 A;  1BZA A;  1MY8 A;  2Y2L A;  1LHY A;  4WMC D;  4E6X A;  1NXY A;  1E4D A;  4Y0O A;  2WYX A;  1LL5 A;  3ZG8 B;  1FR1 A;  4LV0 A;  1L2S A;  1MWS A;  4OH0 A;  3RXW A;  1Y54 A;  2IWB A;  4QY6 A;  2Y2O A;  2WZX A;  4JF6 A;  4OPQ A;  5EEC A;  3ZG7 B;  4E3K A;  5U47 A;  2HDR A;  4BJP A;  3CMZ A;  3N6I A;  1FCO A;  5EVL A;  3HLW A;  2R9X A;  3EQU A;  3Q7V B;  1PW1 A;  1WE4 A;  3HUN A;  1ESU A;  1ESI A;  4MBH A;  4GDB A;  4PM7 A;  1BLS A;  3N4I A;  3UDX A;  3IQA A;  1FSY A;  1MBL A;  3BLS A;  4QB8 A;  2FFY A;  3HLB A;  5HFO A;  2X71 A;  1XA7 A;  3IWO A;  3FYZ A;  2WUQ A;  1XA1 A;  4S2J A;  4DDY A;  4Y0T A;  1YMX A;  4ZJ2 A;  3AGD A;  4JPM A;  4X68 A;  5GLA A;  3ZVW A;  4OLD A;  3G34 A;  3IF6 B;  4JLF A;  5DVA A;  1MWR A;  1ES5 A;  1JWZ A;  2WGV A;  2WK0 A;  3QNB A;  5GHY A;  4OVD A;  1XGJ A;  2PU4 A;  2OSU A;  4LCL A;  3WS2 A;  2IWD A;  1YLY A;  2H0Y A;  4GZB A;  4KQO A;  5M18 A;  4ZJ1 A;  1GCE A;  3ZNY A;  3DWZ A;  1JWP A;  3HLE A;  3O87 A;  3S22 A;  3WS0 A;  2XEP A;  2Y55 A;  1PZO A;  4S2L A;  2PBY A;  4M3K A;  3VP1 A;  4U3T A;  3NDE A;  3GVB A;  4OP5 A;  3DW0 A;  1M6K A;  5FQQ A;  2Y2G A;  2ZC6 B;  3HLF A;  1L0E A;  3DTM A;  4MBK A;  1PWD A;  5EPH A;  4JXS A;  5TFQ A;  4KZA A;  2ZC3 B;  2V20 A;  3WRZ A;  2ZQ7 A;  4OPY A;  2EX6 A;  3WS1 A;  3MKE A;  4KG5 A;  3V39 A;  1MWU A;  3A3D A;  1PZP A;  3GV9 A;  1NRF A;  1IKI A;  2WGI A;  3IH9 A;  4E6W A;  5KSC A;  2PU2 A;  1ZG4 A;  4YIN A;  3LEZ A;  3SH9 A;  2Q9M A;  1MPL A;  1O7E A;  5A92 A;  4C6Y A;  4KEN B;  1DJC A;  2EFU A;  2H10 A;  2ZQC A;  3SH8 A;  4RX2 A;  3QNC A;  1DJB A;  4WBG A;  1L0G A;  4GDN A;  5TGF A;  2XK1 A;  2R9W A;  1IYQ A;  1NYY A;  2Z2L B;  5KMW A;  3QHY A;  5FQM A;  5GL9 A;  3MXR A;  1SKF A;  3FKW A;  4JF4 A;  5E2G A;  5FI2 A;  3C5A A;  3UE0 A;  3HBR A;  2XD1 A;  2HDS A;  2WKE A;  3NC8 A;  4WZ5 C;  1IEL A;  3OPH A;  3HLD A;  4XUZ A;  1O07 A;  3SS4 A;  2B5R A;  4R23 A;  3UN7 A;  2A49 A;  4DE3 A;  1XPB A;  3V5M A;  3ZGA B;  3ZG9 B;  4UA6 A;  2XDM A;  1XXM A;  4E3N A;  2WAD A;  5F83 A;  3CJM A;  4FH2 A;  4KZ7 A;  3IH8 A;  1YLT A;  1ERO A;  4IVK A;  3RJU A;  1MXO A;  2XR0 A;  3VSK A;  3GQZ A;  3MZF A;  4IBR A;  4JF5 A;  3UY6 A;  4MNR A;  5EOE A;  1QMF A;  3IHB A;  4E3M A;  2Y2I A;  2WGW A;  1CEF A;  4UAA A;  1ES4 A;  3IXG A;  3NCK A;  2E8I A;  5E43 A;  4JBF A;  3IWQ A;  3Q7Z A;  4RYE A;  2QMI A;  1MKI A;  1ES3 A;  3V3S A;  5EE8 A;  1N4O A;  4S2I A;  5AQ7 A;  2ZQ8 A;  2ZQA A;  5DF9 A;  1BUE A;  4LCM A;  3A3F A;  2V2F F;  2XFS A;  2XQZ A;  1S0W A;  3PBO A;  4KZ4 A;  4NK3 A;  1KE3 A;  4U0X A;  3BFE A;  3WWX A;  4HEF A;  4CJN A;  2Y91 A;  4IED A;  4P6B A;  5E2F A;  5A93 A;  3D4F A;  3HRE A;  4GD6 A;  1CI8 A;  4KZ6 A;  4Z9Q A;  3Q1F A;  5EVI A;  1XGI A;  2HPB A;  2ZQD A;  3PBN A;  1K54 A;  5DTK A;  3BEC A;  1IYO A;  3Q81 A;  4WM9 A;  3VFH A;  4F94 A;  5CEB A;  4X53 A;  3MFD A;  3NIA A;  4DDS A;  3FV7 A;  3BFD A;  1SHV A;  1FR6 A;  3G2Z A;  1KDS A;  3N8R A;  3FKV A;  1IKG A;  4GOG A;  4KQQ A;  5IHV A;  2HP5 A;  2Y2K A;  3E2L A;  5GLD A;  5KZH A;  1E3U A;  1KGF A;  4K0W A;  2HP6 A;  3GMW A;  1JTG A;  3Q7V A;  5FA7 A;  5FQ9 A;  4EBN A;  4LV2 A;  1BTL A;  3W4P A;  1YM1 A;  1W7F A;  4GNU A;  2G2W A;  1SDE A;  2BG1 A;  1XKZ A;  1LLB A;  4QU3 A;  2I72 A;  2ZQ9 A;  3OCL A;  1TDG A;  5HAQ A;  5J8X A;  4BLM A;  3GSG A;  4JKT A;  4R3B A;  5FQK A;  1YT4 A;  1ALQ A;  2Y2Q A;  5EVI D;  3IF6 A;  2OLV A;  4FH4 A;  5EVI C;  5DTT A;  2XH9 A;  1K54 C;  2Y2J A;  1YMS A;  4XXR A;  5DF8 A;  1ONG A;  4OOL A;  5M1A A;  1ZKJ A;  1YLW A;  3ZG5 A;  1CEG A;  2Q9N A;  5CHU A;  1XP4 A;  4OKP A;  5CXW A;  1L0F A;  1FCN A;  5BOH A;  2ZJ9 A;  3VP4 A;  3GTC A;  3HL9 A;  1HZO A;  2HP9 A;  4PMA A;  4WZ5 A;  4ZJ3 A;  2VGK A;  3NDG A;  5DF7 A;  5GHZ A;  1K57 C;  4R4S A;  4OQH A;  1E3U D;  1W5D A;  2QZ6 A;  2Y2N A;  2ZC5 B;  4Y0U A;  5F1G A;  5F1F A;  4RX3 A;  4BD0 A;  4YFM A;  3VMA A;  2UWX A;  2H5S A;  3N8L A;  3NI9 A;  4KZ9 A;  1Z6F A;  4UA7 A;  1RGZ A;  1NZU A;  4OPR A;  1H8Z A;  1NJ4 A;  2XLN A;  3N8S A;  3OC2 A;  3MZD A;  4KZB A;  4EV4 A;  2GDN A;  1NZO A;  1K4E A;  4ZTK A;  4LEN A;  5EUA A;  4KZ3 A;  3NBL A;  3UNW A;  3BLM A;  3G35 A;  1SCW A;  5CHJ A; 
#chains in the Genus database with same CATH topology
 4BQM A;  3OLO A;  4RVA A;  3EQV A;  2A3U A;  2LB5 A;  4I3J A;  4EEP A;  1CJF A;  4OQ0 A;  2HJE A;  3S1Y A;  3PBT A;  1NYM A;  3HUO A;  1S4R A;  4WL9 A;  1YQS A;  1VET A;  3MXS A;  1YSQ A;  2ZLY A;  5HX9 A;  4MBF A;  3TG9 A;  2HJ9 C;  3P98 A;  2WAF A;  2D02 A;  1K0K A;  5FAT A;  1HD8 A;  2JCH A;  3UDF A;  3L9K A;  3TSG A;  1JWV A;  2CC1 A;  3T4T A;  3ZNT A;  3IHA A;  2FFF B;  3BEB A;  3ZG0 A;  3E2K A;  4HP4 A;  4LV3 A;  2XA7 S;  3KSF A;  4LGW A;  1K55 A;  5FI6 A;  1IYP A;  2A24 A;  5CTM A;  4P0M A;  2INW A;  4K91 A;  5DFY A;  4I38 A;  1CF0 A;  3ZYT A;  4ZAM A;  3PAG A;  1N9N A;  3S4X A;  2PD7 A;  3A3I A;  1YPR A;  3BYD A;  1T18 A;  3IBR A;  4II7 A;  4GKU A;  3HUM A;  5HAI A;  4Q0J A;  1TF1 A;  4L0L A;  2X01 A;  4JGQ A;  2QPN A;  1DRM A;  1G5U A;  2VGJ A;  1GSW A;  2FZ0 A;  3WS4 A;  1VEU A;  4OQG A;  1ES2 A;  1MC0 A;  2P04 A;  2Y4A A;  1K55 C;  2WKR A;  3CPT B;  3LO7 A;  4IBX A;  4IJG A;  4N1H A;  5FAQ A;  2PRF A;  2YKF A;  1TDL A;  4GHI A;  2ZMF A;  4QY5 A;  3Q07 A;  4CPK A;  4MCW A;  4X55 A;  1FIK A;  1W8Q A;  1BT5 A;  3O3V A;  4S2N A;  4X1M A;  3LCE A;  4S2K A;  4P85 A;  1KVL A;  1F98 A;  4ETZ A;  3UB8 A;  1NLZ A;  3ITB A;  1STZ A;  2ACG A;  3OCN A;  4S2P A;  1LI9 A;  4KUO A;  3PBQ A;  4R3J A;  3WRT A;  1V9Y A;  2J7V A;  1C3B A;  4JXW A;  3RTY A;  1WA9 A;  5FDH A;  4DJ2 A;  2EWV A;  3E98 A;  5HDS A;  3BW6 A;  3C7V A;  2BTF P;  2V0U A;  5CED A;  1YKD A;  2OAQ 1;  3JVU A;  4KG2 A;  5CHM A;  1FQG A;  1DY6 A;  4Y15 A;  3IXB A;  1TS8 A;  3MKF A;  4B4Z A;  2IWC A;  2XGN A;  1NRJ A;  3IXH A;  3UPP A;  2J80 A;  3BFG A;  4LPZ A;  1K4F A;  4GB7 A;  2VV7 A;  2BLS A;  2OOL A;  4ESP A;  3T1X A;  4I5S A;  4C3Q A;  2H0T A;  1XX2 A;  2HZ5 A;  1S6R A;  1N9B A;  3C7U A;  1PFL A;  2NUP C;  3BFF A;  4ETX A;  3HVF A;  1GA0 A;  2WAE A;  2X02 A;  1I2S A;  5FAO A;  4NET A;  2OLU A;  3HLG A;  4K08 A;  5EVI B;  2ZD8 A;  5TBM A;  3EGX C;  3GR2 A;  1LHY A;  4WMC D;  4E6X A;  1Y54 A;  2IWB A;  4JF6 A;  4EET B;  4JGR A;  5EVL A;  3EQU A;  3HUN A;  1FSY A;  4DMZ A;  4BBU A;  4GCZ A;  3HLB A;  1T1B A;  3FYZ A;  1D7E A;  1S66 L;  3AGD A;  3F1N B;  1BYW A;  4JPM A;  3ZVW A;  3LFV A;  1JWZ A;  2WK0 A;  2WGV A;  2P08 A;  1XGJ A;  3VE4 A;  2ZL1 B;  2IWD A;  2H0Y A;  4ZJ1 A;  4MN7 A;  3HLE A;  3O87 A;  4PKY G;  3WS0 A;  2XEP A;  1PZO A;  4HY8 A;  1YAX A;  4EQ1 A;  2W27 A;  5I5L A;  3A0R A;  3PR6 A;  4BWI A;  1F5M A;  2ZC3 B;  2EX6 A;  4KG5 A;  2K7S A;  3GV9 A;  2WGI A;  2PU2 A;  4YIN A;  3SH9 A;  2Q9M A;  4C6Y A;  3D72 A;  1TD5 A;  5LBR A;  2H10 A;  3KSI A;  3UB9 A;  5TJJ A;  2XK1 A;  5FQM A;  3MXR A;  1SKF A;  3FKW A;  3C5A A;  3H82 A;  3P01 A;  2WKE A;  4MDZ A;  4M4X A;  1XPB A;  2W3H A;  4UA6 A;  2UV0 E;  3NOT C;  4KZ7 A;  2V1B A;  3NJA A;  3IH8 A;  4CLC A;  1YLT A;  2VV6 A;  3RJU A;  1OT9 A;  1MKM A;  2W3F A;  1AWI A;  2H28 A;  3ICY A;  4JF5 A;  5EOE A;  2VJW A;  3IHB A;  4UAA A;  2E8I A;  4JBF A;  3QP2 A;  3QP5 A;  1N4O A;  2ZQ8 A;  5DF9 A;  3H9W A;  4I3I A;  3K3D A;  3PBO A;  2Y91 A;  4FOF A;  5A93 A;  3HRE A;  1TS7 A;  2B02 A;  4GD6 A;  2O9C A;  1V9Z A;  4KZ6 A;  4CLC C;  2W3E A;  2OWJ A;  4EES A;  2HPB A;  5DTK A;  2PYR A;  3PBN A;  3P7N A;  3EGD C;  3Q81 A;  1S67 L;  4IUH A;  5K5B A;  4X53 A;  4WN5 A;  5FDS A;  2VEA A;  3MFD A;  3CUE A;  3BFD A;  3G2Z A;  1KDS A;  3FKV A;  5IHV A;  4Y3I A;  2Y2K A;  4K0W A;  4LV2 A;  1BTL A;  3FC7 A;  1W7F A;  2JN7 A;  3BQA A;  3MQ0 A;  2ZQ9 A;  5HAQ A;  1J3W A;  4FH4 A;  4HHD A;  5DTT A;  4XXR A;  3BQ8 A;  1XP4 A;  4OKP A;  5CXW A;  2Y8H A;  2ZJ9 A;  3VP4 A;  3CUE C;  4ZJ3 A;  1UWP X;  5L8M A;  3MJQ A;  3NDG A;  1K57 C;  1E3U D;  2ZC5 B;  1HLU P;  1PRQ A;  4YFM A;  4I3A A;  3B47 A;  1F9I A;  4OPR A;  1H8Z A;  1LL8 A;  4EV4 A;  2GDN A;  1K4E A;  4H6J A;  5EUA A;  4IUK A;  5G4Z A;  2WKH A;  1P0Z A;  3LIF A;  5FAP A;  4DXC A;  4WEJ A;  1MZU A;  1L0D A;  2E8J A;  5CTN A;  3F1O B;  2XSS A;  4GN2 A;  4F3L A;  1Y28 A;  5F5Y A;  3O88 A;  4NXE A;  3TE8 A;  1WYB A;  3ZFZ A;  2EFX A;  1ZC2 A;  1J9M A;  2V9A A;  3N7W A;  2J3T C;  4G3V A;  1CK3 A;  1OJ5 A;  2PYP A;  1GHM A;  2JKG A;  1BLC A;  5DFX A;  4ZBE A;  1H3Q A;  2VX8 A;  3OBF A;  4HNB A;  2WKQ A;  3BWL A;  3VP0 A;  5EM1 A;  4JXG A;  4BL2 A;  1S1Y A;  2EX2 A;  5FSR A;  3C4O A;  3LR0 A;  3MFX A;  2VZW A;  4EU0 A;  4Q0I A;  1K56 A;  5HAR A;  1PIO A;  2P9V A;  1YLJ A;  3VSL A;  1OTB A;  3S7Q A;  1T1C A;  2RL3 A;  1GHI A;  4HBT A;  3HLC A;  4HES A;  1TS6 A;  5A91 A;  1TVF A;  4LRZ E;  4B9O A;  4KZ5 A;  1A0K A;  5JYO A;  4EER A;  4L9E A;  4PM5 A;  3ZQ5 A;  4N1X A;  4YWZ A;  1H0M A;  4FD8 A;  3M6H A;  2Y2M A;  4GS9 A;  3MZE A;  2ZMA A;  5J3W A;  3KSH A;  3JYI A;  5FI7 A;  4EBP A;  3LEQ A;  4H8R A;  3NY4 A;  4R38 A;  3NOU C;  3BM6 A;  5DJT A;  3CZD A;  3UPN A;  3TW8 A;  4RA7 A;  2P74 A;  4S2O A;  3V67 A;  1GHP A;  2XF3 A;  2HDQ A;  3IS2 A;  5CEC A;  2EXA A;  2EX9 A;  1I2W A;  1MWT A;  3G2Y A;  2ZM0 A;  3CI6 A;  2XFT A;  4I39 A;  4DE2 A;  1UWN X;  1KE4 A;  3BY9 A;  4FSF A;  5HL6 A;  3C8C A;  1TEM A;  5HDC A;  1IYS A;  2PD8 A;  4P87 A;  2O9B A;  2W3G A;  3LY3 A;  3SS5 A;  4PAU A;  1G6A A;  2ZM8 A;  5M19 A;  1K6R A;  4WYY A;  2C6W B;  3A3J A;  4A5R A;  3K2N A;  4X6T A;  5HDD A;  4EBL A;  2W1T A;  4MEZ A;  4N92 A;  5FAS A;  4Y7P A;  1WYC A;  4XT2 B;  4QHC A;  2HDU A;  5GLC A;  5CGX A;  5EV0 A;  3P09 A;  1PWG A;  3MBZ A;  2VV8 A;  3EEA A;  5HD3 A;  1PYY A;  2ZOI A;  4LV1 A;  3OZH A;  3T4O A;  2FH5 A;  3GRJ A;  3FZC A;  1PI4 A;  4WZ4 A;  1OTI A;  4DE1 A;  1D1J A;  3C2W A;  4B88 A;  3VP3 A;  1EWZ A;  3IXD A;  2JHE A;  2J8Y A;  2JE5 A;  4E3L A;  3GDI A;  4EWF A;  2CMN A;  3W8K A;  3B3X A;  3BY8 A;  3K3C A;  2DRW A;  3FG8 A;  2HGV A;  1CQA A;  1XJ4 A;  1K6S A;  3M6B A;  3UPO A;  4HBU A;  2A24 B;  4N9L A;  4FUW A;  4Y13 A;  2Y2L A;  2K31 A;  5AJG A;  1LL5 A;  3H7W A;  3RXW A;  4QY6 A;  4O8G A;  3ZG7 B;  5HD5 A;  4E3K A;  2HDR A;  3CMZ A;  3HLW A;  2R9X A;  3MS6 A;  3HJI A;  3Q7V B;  1WE4 A;  4MBH A;  4MN6 A;  3QP8 A;  1BLS A;  3BLS A;  5AVF A;  5HFO A;  1VEU B;  4IHQ A;  2V8F A;  4S2J A;  4DDY A;  3T4Q A;  3IF6 B;  4JLF A;  1ES5 A;  1ZHH B;  2OSU A;  3CPT A;  1YLY A;  4KQO A;  2VGL M;  1GCE A;  3ZNY A;  3DWZ A;  3T4S A;  3VP1 A;  4U3T A;  3NDE A;  3DW0 A;  1M6K A;  2W3D A;  2VK3 A;  5TFQ A;  4KZA A;  2ZQ7 A;  2L0W A;  2P7J A;  3MKE A;  2O99 A;  3WS1 A;  3A3D A;  3T1R A;  5KSC A;  2WKP A;  1O7E A;  3PHY A;  2EFU A;  4QWO A;  3CIT A;  3QNC A;  4WBG A;  4JGP A;  3LIE A;  2DMW A;  5HZH A;  3CWF A;  4NXG A;  3QHY A;  5GL9 A;  2Y79 A;  5FI2 A;  5E2G A;  4JF4 A;  2HDS A;  3NC8 A;  3HLD A;  1O07 A;  3TRC A;  4R23 A;  5DKL A;  3IX8 A;  2Q0O A;  3JVV A;  4IVK A;  3UY6 A;  1QMF A;  2Y2I A;  2WGW A;  1CEF A;  2VKS A;  3NCK A;  4WUJ A;  4RYE A;  5EE8 A;  4S2I A;  2ZQA A;  1BUE A;  2XFS A;  2XQZ A;  4KUK A;  4KZ4 A;  4NK3 A;  1KE3 A;  3QP1 A;  1F2K A;  3WWX A;  4IED A;  4P6B A;  5E2F A;  3D4F A;  4CLC D;  5EVI A;  1CI8 A;  3Q1F A;  4X1L A;  2O9A A;  2PBD P;  1IYO A;  5J4E A;  5CEB A;  4DDS A;  1FR6 A;  4KQQ A;  5KZH A;  3GMW A;  1JTG A;  2ZOH A;  5FA7 A;  3W4P A;  1LLB A;  3OCL A;  5J8X A;  2V0W A;  5MC7 A;  5L10 A;  1ALQ A;  1FIL A;  1T19 A;  2OLV A;  5EVI C;  1EW0 A;  5M1A A;  1YLW A;  4G3K A;  5CHU A;  2ZL1 A;  3UB5 P;  3IX3 A;  5F68 A;  3GTC A;  1IOU A;  2HP9 A;  4PMA A;  2VGK A;  5GHZ A;  4R4S A;  2HF6 A;  2YKH A;  1RGZ A;  3C30 A;  1NJ4 A;  3OC2 A;  5A8B A;  4KZB A;  3CHW P;  2V8C A;  3BLM A;  1L3L A;  3TOI A;  3M2J A;  4KG6 A;  1FCM A;  4DE0 A;  4NKP A;  1IEM A;  1XFN A;  4QJG A;  3S7O A;  3DBA A;  3DWK A;  3PXP A;  5D3O A;  3NUL A;  3T50 A;  5EM0 A;  2Z6C A;  4OP8 A;  5E2H A;  2J3T D;  3UE1 A;  3A0V A;  4X56 A;  1K38 A;  3D3O A;  5F82 A;  1N9O A;  1VB6 A;  2EXB A;  4EEU A;  3MF0 A;  5G18 A;  3LR5 A;  4WLA A;  3PTE A;  5HSQ A;  5CX7 A;  4CLC B;  1ACF A;  3DTK A;  4ZDX A;  4NEE D;  1OT6 A;  5HWV A;  1SKO B;  1XJ6 A;  3PAE A;  2Y2H A;  5EOO A;  3E0Y A;  3PYP A;  2GZA A;  3NHQ A;  3SS3 A;  4U0T A;  1H5X A;  1VM1 A;  3ITA A;  3MQO A;  4YOF A;  2KLI A;  4UA9 A;  3G4P A;  1K25 A;  4N9K A;  2ZC4 B;  1Q2P A;  1PWC A;  3MR0 A;  4HP9 A;  4ID4 A;  1EI5 A;  4PPR A;  1K57 A;  2GNX A;  4Y2F A;  5KSH A;  3KYZ A;  1RCJ A;  2GX5 A;  1Y4O A;  3UMD A;  1K56 D;  2DNS A;  1HVB A;  3B33 A;  5L09 A;  4HOI A;  1S4S A;  1M40 A;  4MMN A;  3AGE A;  3C4P A;  4R1G A;  4DF6 A;  1BSG A;  2ZM2 A;  3IF5 A;  4D2O A;  3FWL A;  4XUX A;  1PW8 A;  4EW7 A;  1FSW A;  1YLP A;  5G4Y A;  4EQI A;  4B4X A;  2JKR M;  2Y59 A;  1E25 A;  3JPU A;  3UO9 A;  2XD5 A;  5FEF A;  3CG5 A;  2JKT M;  4X69 A;  5GHX A;  1YSP A;  2A2L A;  2JKF A;  5DTS A;  3ZHH A;  2V1Z A;  4DKI A;  1I5Q A;  4OOM A;  2DCF A;  2WKI A;  3VP2 A;  3EWK A;  4OON A;  1YLZ A;  2V1A A;  3HJK A;  4DXB A;  3VFF A;  5IU1 A;  3E4O A;  4EUZ A;  4EXO A;  4F3L B;  1PI5 A;  1NLY A;  4ARZ A;  4LLO B;  5TR7 A;  3DTI A;  4S2M A;  1JTD A;  3F1O A;  4E3I A;  3IWI A;  5J7E A;  3U2A A;  3G31 A;  3UB6 A;  2J9P A;  1ERQ A;  4NG2 A;  3FPW A;  4IVI A;  2VLG A;  5DKK A;  3FPV A;  3OPL A;  1HTZ A;  5L2F A;  4Q8I A;  2QYB A;  1W8Y A;  5AQB A;  3KYQ A;  5CER A;  1CI9 A;  4BBV A;  3F1P B;  4FTX A;  2IA2 A;  2PT7 A;  4OLG A;  4UHU A;  1OME A;  4E04 A;  5JYP A;  3OPR A;  2Y2P A;  5CGW A;  4UQI M;  1RP5 A;  2P9V B;  4O7D A;  4WEL A;  1ONH A;  1OTA A;  4GLQ A;  3T12 B;  4UEY A;  4B93 A;  1BZA A;  1Z09 A;  1NXY A;  4Y0O A;  4PKY A;  2WYX A;  4NXF A;  3ZG8 B;  1FR1 A;  1L2S A;  1MWS A;  2Y2O A;  5EEC A;  3R7W B;  5U47 A;  4BJP A;  3UME A;  1PW1 A;  1ESU A;  4GS9 B;  3N4I A;  3UDX A;  4QB8 A;  2X71 A;  3LGO A;  1XA1 A;  5GLA A;  1MWR A;  3QNB A;  4OVD A;  2PU4 A;  4HQA A;  4D60 A;  5M18 A;  3HCY A;  2EWW A;  2QKP A;  1OTD A;  1JWP A;  3S22 A;  4S2L A;  2PBY A;  5F69 A;  3GVB A;  4OP5 A;  2Y2G A;  2ZC6 B;  3HLF A;  1LSW A;  3QP6 A;  3LIA A;  5EPH A;  4R6L A;  3WRZ A;  4OPY A;  3V39 A;  1PZP A;  3IH9 A;  1NRF A;  4E6W A;  3S7P A;  2W1R A;  3LEZ A;  2W1T B;  4KEN B;  2ZQC A;  3SH8 A;  4RX2 A;  1L0G A;  1IYQ A;  1VET B;  5KMW A;  1XJ2 A;  4LFU A;  4XT2 A;  3BJN A;  3HBR A;  2XD1 A;  2D01 A;  4WZ5 C;  3OPH A;  3O5Y A;  3SS4 A;  3UN7 A;  3IX4 A;  4DE3 A;  4E3N A;  3C38 A;  2L1M A;  2WAD A;  5F83 A;  4FH2 A;  1ERO A;  4Y17 A;  2R78 A;  1MXO A;  2XR0 A;  4KQD A;  3VSK A;  3GEC A;  3GQZ A;  4O01 A;  4MNR A;  4E3M A;  5FEG A;  1ES4 A;  3IXG A;  3UE6 A;  2Z6D A;  2QWS A;  3Q7Z A;  5HPI A;  2KDK A;  1MKI A;  4L9F A;  1ES3 A;  3V3S A;  5AQ7 A;  2XA7 M;  1OTE A;  2G7U A;  1NWZ A;  4U0X A;  3BFE A;  2ZMV A;  4HEF A;  5DJU A;  1OPX A;  2ZBB A;  3IBJ A;  4HH3 A;  1XGI A;  2QJ5 A;  3MSH A;  1K54 A;  5HWT A;  2L4R A;  3H7W B;  3EEH A;  4WM9 A;  4BMW A;  3N8R A;  1IKG A;  4GOG A;  3E2L A;  1KGF A;  2KOI A;  3VE3 A;  3Q7V A;  5FQ9 A;  4GNU A;  2BG1 A;  1VHM A;  3A0S A;  4GHI B;  3GSG A;  4P6Z M;  1YT4 A;  5FQK A;  3T1S A;  5EVI D;  3IF6 A;  1DP6 A;  4P6Z S;  2VGL S;  2Y2J A;  1K54 C;  4G3W A;  3UB7 A;  1FCN A;  1HZO A;  3DAV A;  2OAP 1;  5DF7 A;  3CAX A;  5AVE A;  3E4Q A;  5L07 A;  2QZ6 A;  2Y2N A;  5F1G A;  4BD0 A;  2UWX A;  5FL3 A;  3LR3 A;  3NI9 A;  4KZ9 A;  3TJZ C;  3SZT A;  1NZU A;  2XLN A;  2O0Y A;  3N8S A;  3MZD A;  3L7H A;  1NZO A;  5F6A A;  3B42 A;  2GJ3 A;  4LEN A;  3UNW A;  3IF6 C;  1SCW A;  1ZTU A;  1LT0 A;  1KGG A;  3VOY A;  1P9R A;  4BEN A;  2G2U A;  1GA9 A;  3A3E A;  1TS0 A;  5FQJ A;  4S2N C;  5C5K A;  4R0Q A;  3Q82 A;  1OJG A;  3KYE A;  2XRN A;  2J9O A;  4NXB A;  1KGE A;  3VOZ A;  2EX8 A;  3IT9 A;  1JVJ A;  3ZCZ A;  2JBF A;  1DP8 A;  2MJ6 A;  1LI0 A;  3LI9 A;  1S1Z A;  4PM9 A;  2Z2M B;  4Q0H A;  1H8M A;  2WGW B;  3KX0 X;  3T4K A;  3T4L A;  3NOP C;  3QP4 A;  2RCX A;  3E4P A;  1GSV A;  5TBM B;  1LL9 A;  2WZZ A;  4LRX C;  3UE3 A;  4ZRR A;  4QD4 A;  1P9W A;  2ZC7 A;  4DN0 A;  2QHK A;  4E3O A;  4HIA A;  3RXX A;  2M7U A;  1VQQ A;  1XFQ A;  3DTE A;  4OOY A;  3ZDJ A;  4FCF A;  1N9L A;  5EVE A;  2XRO A;  3ISG A;  1KE0 A;  1QME A;  1GSX A;  4OPZ A;  3V50 A;  3O86 A;  5AQ9 A;  3PBR A;  4KZ8 A;  4K0X A;  4BL3 A;  3SW1 A;  3D9Y A;  1W79 A;  3F1N A;  3NBL A;  3MXQ A;  3W4Q A;  4GD8 A;  4C75 A;  5HAP A;  5HWW A;  1SDN A;  1DJA A;  5GLB A;  4MLL A;  5HL1 A;  5AQA A;  2JKR I;  3M2K A;  5CRF A;  3SOI A;  3PBS A;  4PM8 A;  5I94 A;  3BRM A;  2JKT I;  4Z1W A;  3G32 A;  2M7V A;  2HV1 A;  1BUL A;  1G68 A;  4R4R A;  2JC7 A;  3S7N A;  5A90 A;  4QPR A;  4PM6 A;  1XJ3 A;  2LB9 A;  2BAS A;  3T4J A;  3RH8 B;  5CGS A;  4CQH A;  2PHY A;  3UDI A;  1U60 A;  2C5W B;  1UGU A;  4JXV A;  3OPP A;  1KDW A;  3MQQ A;  1BLH A;  2PAV P;  3LY4 A;  3H82 B;  5E2E A;  3V3R A;  3EOI A;  4YNR A;  1LSV A;  1BLP A;  1ZG6 A;  5FQI A;  1NY0 A;  1Q2Q A;  3W4O A;  1FOF A;  5EFW A;  4DRT A;  4WMC A;  3SH7 A;  3MMH A;  1H8Y A;  2PDR A;  3CLO A;  1AXB A;  1DP9 A;  1SKO A;  4KQR A;  1ERM A;  3ZVT A;  1KVM A;  4X25 A;  3AGF A;  4OQI A;  5HW3 A;  4WEK A;  3BFC A;  3LID A;  1IFQ A;  4BD1 A;  3I7J A;  4E3J A;  1RGY A;  2OV5 A;  5HPF A;  3WS5 A;  3G30 A;  1MY8 A;  4O0P A;  1E4D A;  4LV0 A;  4OH0 A;  2WZX A;  4OPQ A;  1ODV A;  3KO6 A;  3N6I A;  1FCO A;  4GW9 A;  4JGO A;  1ESI A;  4GDB A;  4PM7 A;  3IQA A;  1MBL A;  2FFY A;  1XA7 A;  3IWO A;  2WUQ A;  4Y0T A;  3KSG A;  1YMX A;  4ZJ2 A;  4X68 A;  4OLD A;  3LI8 A;  2B18 A;  3G34 A;  4AFI A;  5DVA A;  1KOU A;  3U4L P;  5GHY A;  5IT5 A;  4LCL A;  3WS2 A;  4LRY C;  4GZB A;  2Y55 A;  4BBT A;  3LIC A;  4HI4 A;  2K2N A;  5FQQ A;  1L0E A;  3DTM A;  4MBK A;  1PWD A;  4JXS A;  2PR5 A;  4H6J B;  2V20 A;  1SZV A;  1MWU A;  1IKI A;  1G6O A;  1ZG4 A;  1MPL A;  5A92 A;  2QJ7 A;  1DJC A;  3LIB A;  2AVX A;  4RQ9 A;  1DJB A;  4GDN A;  5TGF A;  2R9W A;  3VV4 A;  5IS1 A;  1NYY A;  2Z2L B;  4ARZ B;  3ULF A;  3UE0 A;  4HJ6 A;  1IEL A;  4XUZ A;  4PHT A;  2B5R A;  2A49 A;  2VA0 A;  3V5M A;  3ZGA B;  3ZG9 B;  2XDM A;  1JNU A;  1XXM A;  3CJM A;  2B95 A;  3NEC A;  1D06 A;  2W0N A;  3LYX A;  4WF0 A;  3MZF A;  4IBR A;  4GJ4 A;  5E43 A;  4UQI S;  3F1P A;  3IWQ A;  2QMI A;  4DJ3 A;  5KIZ A;  4LCM A;  3A3F A;  2V2F F;  1S0W A;  3LUQ A;  1G28 A;  4R70 A;  3OOV A;  4CJN A;  4Y5F A;  2PR6 A;  4Z9Q A;  1LSX A;  2ZQD A;  3R4K A;  3BEC A;  4MN5 A;  2M1C A;  3VFH A;  3VOL A;  4F94 A;  3RFB A;  3NIA A;  3FV7 A;  4R3A A;  3T1Q B;  1SHV A;  2OWH A;  2HP5 A;  1X0O A;  5GLD A;  3R7W A;  1E3U A;  4HJ4 A;  2HP6 A;  4EBN A;  1YM1 A;  4HH2 A;  2G2W A;  1SDE A;  1XKZ A;  4QU3 A;  2I72 A;  1TDG A;  2KX6 A;  4BLM A;  4JKT A;  4R3B A;  2Y2Q A;  3IS2 B;  2XH9 A;  2I9V A;  1T1A A;  1YMS A;  5DF8 A;  1ONG A;  4OOL A;  1ZKJ A;  3ZG5 A;  4CLC E;  1CEG A;  1W63 M;  2Q9N A;  1L0F A;  5BOH A;  3HL9 A;  1W63 Q;  4WZ5 A;  3G6O A;  4OQH A;  1W5D A;  4Y0U A;  5F1F A;  4RX3 A;  1P97 A;  3VMA A;  2NUT C;  1PNE A;  2H5S A;  3N8L A;  4ME4 A;  1Z6F A;  3W2Z A;  4UA7 A;  4EUV A;  3LR4 A;  4L9G A;  4ZTK A;  4KZ3 A;  4HJ3 A;  2J3W A;  4M3K A;  3G35 A;  2EA9 A;  5CHJ A; 
#chains in the Genus database with same CATH homology
 2WKH A;  3M2J A;  4KG6 A;  4BQM A;  1FCM A;  4RVA A;  4DE0 A;  1KGG A;  3EQV A;  2A3U A;  5FAP A;  4DXC A;  3VOY A;  4WEJ A;  4BEN A;  4OQ0 A;  1L0D A;  3S1Y A;  3PBT A;  1IEM A;  2G2U A;  1GA9 A;  5CTN A;  1NYM A;  3A3E A;  3HUO A;  4GN2 A;  4QJG A;  5FQJ A;  3DWK A;  3O88 A;  4S2N C;  5D3O A;  1WYB A;  4R0Q A;  3ZFZ A;  3Q82 A;  1YQS A;  2EFX A;  1ZC2 A;  1J9M A;  3N7W A;  4OP8 A;  5E2H A;  3MXS A;  2J9O A;  3TOI A;  3UE1 A;  1CK3 A;  1KGE A;  2ZLY A;  4X56 A;  1K38 A;  4MBF A;  5HX9 A;  3TG9 A;  5F82 A;  3VOZ A;  1GHM A;  2EX8 A;  3IT9 A;  2EXB A;  1JVJ A;  1BLC A;  5G18 A;  3P98 A;  3ZCZ A;  2WAF A;  2JBF A;  3PTE A;  4ZBE A;  5FAT A;  1HD8 A;  2JCH A;  3UDF A;  4ZDX A;  1LI0 A;  3TSG A;  3VP0 A;  1JWV A;  4PM9 A;  3PAE A;  4JXG A;  2Y2H A;  2Z2M B;  4BL2 A;  2CC1 A;  2EX2 A;  5FSR A;  3ZNT A;  2WGW B;  3C4O A;  3IHA A;  5EOO A;  2FFF B;  3BEB A;  3ZG0 A;  3E2K A;  4LV3 A;  2RCX A;  3SS3 A;  4U0T A;  5HAR A;  1K56 A;  1PIO A;  2P9V A;  1YLJ A;  3VSL A;  1H5X A;  1LL9 A;  1VM1 A;  2WZZ A;  3ITA A;  2RL3 A;  3UE3 A;  1K55 A;  4UA9 A;  5FI6 A;  1IYP A;  1GHI A;  1K25 A;  3G4P A;  4N9K A;  5CTM A;  4P0M A;  4QD4 A;  4HBT A;  3HLC A;  4HES A;  4K91 A;  2ZC4 B;  1Q2P A;  2ZC7 A;  1TVF A;  5A91 A;  4KZ5 A;  3PAG A;  4ZAM A;  5JYO A;  4E3O A;  1PWC A;  3S4X A;  3A3I A;  3RXX A;  4PM5 A;  3BYD A;  4ID4 A;  1VQQ A;  4GKU A;  4N1X A;  1EI5 A;  3HUM A;  1K57 A;  4PPR A;  4FD8 A;  5HAI A;  3M6H A;  2Y2M A;  4OOY A;  5KSH A;  4L0L A;  2X01 A;  3ZDJ A;  3MZE A;  4FCF A;  2ZMA A;  3ISG A;  1KE0 A;  1RCJ A;  1QME A;  3JYI A;  2QPN A;  5FI7 A;  4EBP A;  3IF6 C;  4OPZ A;  3V50 A;  3O86 A;  4H8R A;  1K56 D;  2VGJ A;  2DNS A;  3NY4 A;  5AQ9 A;  3PBR A;  4KZ8 A;  4K0X A;  3WS4 A;  4BL3 A;  1HVB A;  4OQG A;  1ES2 A;  1W79 A;  1M40 A;  2Y4A A;  3BM6 A;  3W4Q A;  1K55 C;  3CZD A;  3AGE A;  3UPN A;  3C4P A;  4R1G A;  4GD8 A;  3LO7 A;  4C75 A;  4IBX A;  4DF6 A;  5HAP A;  4RA7 A;  2P74 A;  1SDN A;  4N1H A;  1DJA A;  5FAQ A;  1BSG A;  5GLB A;  2ZM2 A;  4S2O A;  3IF5 A;  1TDL A;  4D2O A;  3FWL A;  4XUX A;  4MLL A;  5HL1 A;  4QY5 A;  3Q07 A;  1GHP A;  5AQA A;  4CPK A;  4X55 A;  2XF3 A;  1PW8 A;  2HDQ A;  1W8Q A;  1BT5 A;  1FSW A;  5CEC A;  2EXA A;  1YLP A;  2EX9 A;  4EQI A;  3M2K A;  1I2W A;  3O3V A;  4S2N A;  4B4X A;  1MWT A;  3G2Y A;  5CRF A;  2Y59 A;  3LCE A;  1E25 A;  4S2K A;  3SOI A;  2ZM0 A;  3UO9 A;  2XD5 A;  3PBS A;  4P85 A;  1KVL A;  3CG5 A;  2XFT A;  4DE2 A;  4PM8 A;  5I94 A;  1KE4 A;  3BRM A;  4FSF A;  3G32 A;  1TEM A;  1IYS A;  3ITB A;  1BUL A;  3OCN A;  4X69 A;  5GHX A;  4P87 A;  1G68 A;  4S2P A;  1LI9 A;  3PBQ A;  4R4R A;  2JC7 A;  4R3J A;  3WRT A;  2J7V A;  5A90 A;  1C3B A;  4PM6 A;  3LY3 A;  5DTS A;  3SS5 A;  3ZHH A;  2V1Z A;  4DKI A;  4JXW A;  1I5Q A;  4OOM A;  1G6A A;  5FDH A;  2ZM8 A;  5M19 A;  1K6R A;  4WYY A;  5CGS A;  2C6W B;  2DCF A;  3A3J A;  2WKI A;  3VP2 A;  4A5R A;  4X6T A;  4EBL A;  3UDI A;  1U60 A;  2C5W B;  4MEZ A;  4OON A;  3C7V A;  1YLZ A;  4N92 A;  5FAS A;  4DXB A;  4JXV A;  1WYC A;  4Y7P A;  3VFF A;  4EUZ A;  3OPP A;  5CED A;  1KDW A;  1BLH A;  3LY4 A;  4QHC A;  2HDU A;  5GLC A;  4KG2 A;  5CHM A;  1PI5 A;  5CGX A;  1FQG A;  1DY6 A;  5E2E A;  3P09 A;  5TR7 A;  3IXB A;  4S2M A;  1JTD A;  3V3R A;  1PWG A;  4E3I A;  3MBZ A;  3IWI A;  1PYY A;  3G31 A;  1BLP A;  2J9P A;  1ZG6 A;  5FQI A;  3MKF A;  1ERQ A;  3OZH A;  4LV1 A;  3GRJ A;  4B4Z A;  1NY0 A;  2IWC A;  2XGN A;  3IXH A;  4IVI A;  3UPP A;  1Q2Q A;  3W4O A;  3BFG A;  3FZC A;  3OPL A;  1K4F A;  1FOF A;  1PI4 A;  4GB7 A;  4WZ4 A;  2BLS A;  4DRT A;  1HTZ A;  4WMC A;  5L2F A;  4DE1 A;  4Q8I A;  1W8Y A;  5AQB A;  4C3Q A;  4B88 A;  2H0T A;  1XX2 A;  3SH7 A;  5CER A;  1S6R A;  1H8Y A;  3VP3 A;  1N9B A;  1EWZ A;  3IXD A;  3C7U A;  2J8Y A;  1CI9 A;  2JE5 A;  4E3L A;  1AXB A;  3BFF A;  4OLG A;  4UHU A;  4EWF A;  1OME A;  4KQR A;  3W8K A;  1ERM A;  3ZVT A;  5JYP A;  3B3X A;  3OPR A;  1KVM A;  2DRW A;  3AGF A;  2Y2P A;  5CGW A;  3HVF A;  4OQI A;  1RP5 A;  2P9V B;  1GA0 A;  5HW3 A;  4WEK A;  3BFC A;  4O7D A;  1K6S A;  2WAE A;  2X02 A;  4BD1 A;  1I2S A;  3I7J A;  3M6B A;  4E3J A;  5FAO A;  4NET A;  2OLU A;  4WEL A;  3HLG A;  3UPO A;  1RGY A;  4HBU A;  5EVI B;  2ZD8 A;  2OV5 A;  4N9L A;  1ONH A;  3WS5 A;  3G30 A;  3GR2 A;  1BZA A;  1MY8 A;  2Y2L A;  1LHY A;  4WMC D;  4E6X A;  1NXY A;  1E4D A;  4Y0O A;  2WYX A;  1LL5 A;  3ZG8 B;  1FR1 A;  4LV0 A;  1L2S A;  1MWS A;  4OH0 A;  3RXW A;  1Y54 A;  2IWB A;  4QY6 A;  2Y2O A;  2WZX A;  4JF6 A;  4OPQ A;  5EEC A;  3ZG7 B;  4E3K A;  5U47 A;  2HDR A;  4BJP A;  3CMZ A;  3N6I A;  1FCO A;  5EVL A;  3HLW A;  2R9X A;  3EQU A;  3Q7V B;  1PW1 A;  1WE4 A;  3HUN A;  1ESU A;  1ESI A;  4MBH A;  4GDB A;  4PM7 A;  1BLS A;  3N4I A;  3UDX A;  3IQA A;  1FSY A;  1MBL A;  3BLS A;  4QB8 A;  2FFY A;  3HLB A;  5HFO A;  2X71 A;  1XA7 A;  3IWO A;  3FYZ A;  2WUQ A;  1XA1 A;  4S2J A;  4DDY A;  4Y0T A;  1YMX A;  4ZJ2 A;  3AGD A;  4JPM A;  4X68 A;  5GLA A;  3ZVW A;  4OLD A;  3G34 A;  3IF6 B;  4JLF A;  5DVA A;  1MWR A;  1ES5 A;  1JWZ A;  2WGV A;  2WK0 A;  3QNB A;  5GHY A;  4OVD A;  1XGJ A;  2PU4 A;  2OSU A;  4LCL A;  3WS2 A;  2IWD A;  1YLY A;  2H0Y A;  4GZB A;  4KQO A;  5M18 A;  4ZJ1 A;  1GCE A;  3ZNY A;  3DWZ A;  1JWP A;  3HLE A;  3O87 A;  3S22 A;  3WS0 A;  2XEP A;  2Y55 A;  1PZO A;  4S2L A;  2PBY A;  4M3K A;  3VP1 A;  4U3T A;  3NDE A;  3GVB A;  4OP5 A;  3DW0 A;  1M6K A;  5FQQ A;  2Y2G A;  2ZC6 B;  3HLF A;  1L0E A;  3DTM A;  4MBK A;  1PWD A;  5EPH A;  4JXS A;  5TFQ A;  4KZA A;  2ZC3 B;  2V20 A;  3WRZ A;  2ZQ7 A;  4OPY A;  2EX6 A;  3WS1 A;  3MKE A;  4KG5 A;  3V39 A;  1MWU A;  3A3D A;  1PZP A;  3GV9 A;  1NRF A;  1IKI A;  2WGI A;  3IH9 A;  4E6W A;  5KSC A;  2PU2 A;  1ZG4 A;  4YIN A;  3LEZ A;  3SH9 A;  2Q9M A;  1MPL A;  1O7E A;  5A92 A;  4C6Y A;  4KEN B;  1DJC A;  2EFU A;  2H10 A;  2ZQC A;  3SH8 A;  4RX2 A;  3QNC A;  1DJB A;  4WBG A;  1L0G A;  4GDN A;  5TGF A;  2XK1 A;  2R9W A;  1IYQ A;  1NYY A;  2Z2L B;  5KMW A;  3QHY A;  5FQM A;  5GL9 A;  3MXR A;  1SKF A;  3FKW A;  4JF4 A;  5E2G A;  5FI2 A;  3C5A A;  3UE0 A;  3HBR A;  2XD1 A;  2HDS A;  2WKE A;  3NC8 A;  4WZ5 C;  1IEL A;  3OPH A;  3HLD A;  4XUZ A;  1O07 A;  3SS4 A;  2B5R A;  4R23 A;  3UN7 A;  2A49 A;  4DE3 A;  1XPB A;  3V5M A;  3ZGA B;  3ZG9 B;  4UA6 A;  2XDM A;  1XXM A;  4E3N A;  2WAD A;  5F83 A;  3CJM A;  4FH2 A;  4KZ7 A;  3IH8 A;  1YLT A;  1ERO A;  4IVK A;  3RJU A;  1MXO A;  2XR0 A;  3VSK A;  3GQZ A;  3MZF A;  4IBR A;  4JF5 A;  3UY6 A;  4MNR A;  5EOE A;  1QMF A;  3IHB A;  4E3M A;  2Y2I A;  2WGW A;  1CEF A;  4UAA A;  1ES4 A;  3IXG A;  3NCK A;  2E8I A;  5E43 A;  4JBF A;  3IWQ A;  3Q7Z A;  4RYE A;  2QMI A;  1MKI A;  1ES3 A;  3V3S A;  5EE8 A;  1N4O A;  4S2I A;  5AQ7 A;  2ZQ8 A;  2ZQA A;  5DF9 A;  1BUE A;  4LCM A;  3A3F A;  2V2F F;  2XFS A;  2XQZ A;  1S0W A;  3PBO A;  4KZ4 A;  4NK3 A;  1KE3 A;  4U0X A;  3BFE A;  3WWX A;  4HEF A;  4CJN A;  2Y91 A;  4IED A;  4P6B A;  5E2F A;  5A93 A;  3D4F A;  3HRE A;  4GD6 A;  1CI8 A;  4KZ6 A;  4Z9Q A;  3Q1F A;  5EVI A;  1XGI A;  2HPB A;  2ZQD A;  3PBN A;  1K54 A;  5DTK A;  3BEC A;  1IYO A;  3Q81 A;  4WM9 A;  3VFH A;  4F94 A;  5CEB A;  4X53 A;  3MFD A;  3NIA A;  4DDS A;  3FV7 A;  3BFD A;  1SHV A;  1FR6 A;  3G2Z A;  1KDS A;  3N8R A;  3FKV A;  1IKG A;  4GOG A;  4KQQ A;  5IHV A;  2HP5 A;  2Y2K A;  3E2L A;  5GLD A;  5KZH A;  1E3U A;  1KGF A;  4K0W A;  2HP6 A;  3GMW A;  1JTG A;  3Q7V A;  5FA7 A;  5FQ9 A;  4EBN A;  4LV2 A;  1BTL A;  3W4P A;  1YM1 A;  1W7F A;  4GNU A;  2G2W A;  1SDE A;  2BG1 A;  1XKZ A;  1LLB A;  4QU3 A;  2I72 A;  2ZQ9 A;  3OCL A;  1TDG A;  5HAQ A;  5J8X A;  4BLM A;  3GSG A;  4JKT A;  4R3B A;  5FQK A;  1YT4 A;  1ALQ A;  2Y2Q A;  5EVI D;  3IF6 A;  2OLV A;  4FH4 A;  5EVI C;  5DTT A;  2XH9 A;  1K54 C;  2Y2J A;  1YMS A;  4XXR A;  5DF8 A;  1ONG A;  4OOL A;  5M1A A;  1ZKJ A;  1YLW A;  3ZG5 A;  1CEG A;  2Q9N A;  5CHU A;  1XP4 A;  4OKP A;  5CXW A;  1L0F A;  1FCN A;  5BOH A;  2ZJ9 A;  3VP4 A;  3GTC A;  3HL9 A;  1HZO A;  2HP9 A;  4PMA A;  4WZ5 A;  4ZJ3 A;  2VGK A;  3NDG A;  5DF7 A;  5GHZ A;  1K57 C;  4R4S A;  4OQH A;  1E3U D;  1W5D A;  2QZ6 A;  2Y2N A;  2ZC5 B;  4Y0U A;  5F1G A;  5F1F A;  4RX3 A;  4BD0 A;  4YFM A;  3VMA A;  2UWX A;  2H5S A;  3N8L A;  3NI9 A;  4KZ9 A;  1Z6F A;  4UA7 A;  1RGZ A;  1NZU A;  4OPR A;  1H8Z A;  1NJ4 A;  2XLN A;  3N8S A;  3OC2 A;  3MZD A;  4KZB A;  4EV4 A;  2GDN A;  1NZO A;  1K4E A;  4ZTK A;  4LEN A;  5EUA A;  4KZ3 A;  3NBL A;  3UNW A;  3BLM A;  3G35 A;  1SCW A;  5CHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...