1KGGA

Structure of beta-lactamase glu166gln:asn170asp mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYQIELDYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-LACTAMASE)
publication title Relocation of the catalytic carboxylate group in class A beta-lactamase: the structure and function of the mutant enzyme Glu166-->Gln:Asn170-->Asp.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 93
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1999-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1kggA00
4OQIA 1BLCA 1IYPA 1HD8A 5HARA 4DKIA 4FD8A 3UPOA 3Q07A 5DVAA 5L2FA 1DJCA 2WGWB 3NI9A 3ZVTA 4K0XA 5FATA 3GQZA 1ALQA 3BLMA 3JYIA 3PBTA 4R3BA 1N9BA 4UA7A 1YQSA 4S2NC 5FASA 3GRJA 4DRTA 1ZKJA 1NRFA 5GLAA 5F1GA 1MWRA 2HDUA 4OLGA 2EFUA 4WELA 5EOOA 2EFXA 1VM1A 2Y4AA 3AGDA 5F82A 1EROA 4PM7A 2G2WA 1ES4A 3OZHA 5FQ9A 4X6TA 2FFYA 1BLSA 2Y55A 2UWXA 4JXGA 1DY6A 1PZPA 1NZUA 1TVFA 3DW0A 1KVMA 2BG1A 3IF6C 4LV2A 4PM5A 4DXBA 2BLSA 4ZBEA 1E4DA 3CJMA 1BLHA 3IF6A 3TOIA 5DF7A 5CTNA 4EWFA 1DJBA 4BQMA 1QMEA 2EXBA 2EX8A 4EV4A 1FQGA 2HP6A 2EXAA 2X02A 2V1ZA 1TEMA 5KZHA 2R9XA 1XKZA 1W8YA 1M40A 3PBRA 1L0DA 3WRZA 3ZG9B 2ZQ8A 1IKIA 5FSRA 2WKIA 1YMSA 3LY4A 3O86A 5AQAA 4BL2A 3WWXA 1FCMA 2XD5A 2ZJ9A 3VSKA 1CEFA 4N92A 1JWZA 1H5XA 1PIOA 1PI5A 4RX2A 1YLJA 2ZC4B 1RGYA 4XUXA 1NZOA 3UN7A 1I2WA 5M19A 4WZ5C 4R4SA 1LHYA 1SDNA 3OPHA 3IT9A 2XD1A 4X68A 3RXXA 2I72A 2WYXA 5KSCA 4GN2A 4PMAA 1L0EA 4IVKA 4E6XA 1L0FA 3O88A 1K57C 4EUZA 3UPPA 3HLCA 4FCFA 4MBFA 1K57A 3M2KA 1EI5A 4OQGA 4OPZA 5JYPA 2ZMAA 1C3BA 1K55A 3DWKA 4Q8IA 3FWLA 4P85A 5CRFA 4WBGA 1U60A 5AQ7A 2IWCA 2J7VA 4MNRA 5DTSA 1K38A 2Y2MA 1CEGA 3N7WA 3WS1A 4L0LA 3SH8A 3EQUA 3B3XA 4P0MA 3V3SA 1GHIA 1PWDA 3UO9A 4E6WA 1K4EA 1MXOA 5CHMA 1K6RA 5FAOA 2WGIA 4C3QA 3IF5A 3PBQA 5FAPA 2ZQDA 4H8RA 5HAQA 3IXGA 4BLMA 2EX6A 4LCMA 3E2LA 4N9LA 4Y0UA 5EOEA 3W4PA 2OLUA 1S6RA 4S2JA 5M18A 1JWPA 5FDHA 3SS3A 4OQ0A 5EVIC 2JE5A 4X53A 4R1GA 5CECA 4U0XA 4DE2A 4KENB 1H8ZA 3P09A 1JTDA 3C7VA 5CGSA 3PBNA 3FV7A 4OPRA 1TDGA 1KGGA 2IWDA 2IWBA 3UDIA 1NYMA 1PZOA 3ISGA 4QJGA 1SCWA 3N8SA 4Y0OA 5E2FA 3HLEA 2P74A 1FCOA 3MFDA 4WEJA 3WS2A 4OPQA 1G6AA 1PYYA 3ZG8B 1FR6A 2Y2QA 4GDBA 3UE3A 4A5RA 2J9PA 1BULA 3Q1FA 1ZG4A 2VGJA 3A3IA 1K4FA 4KQRA 4OP8A 1ERMA 4QY5A 4OH0A 3W4QA 1S0WA 1I5QA 3BRMA 5CGWA 3O87A 4UA9A 5EECA 3V50A 4B4XA 4N1XA 3IHAA 4N1HA 1XA7A 2Y2NA 3C5AA 2X71A 3C4OA 4O7DA 2GDNA 1ES3A 3NDEA 3G2YA 3PAGA 5JYOA 1RP5A 2XFTA 1BLPA 4OOLA 3SS4A 3HL9A 4KZ6A 3IWIA 4S2NA 1IYQA 3DTMA 4IBRA 4KG5A 5E2EA 3A3DA 2EX2A 4OP5A 4LV0A 3VP1A 4RVAA 4OPYA 5HW3A 4M3KA 1K6SA 3UDXA 3G32A 2J8YA 1MWSA 2JCHA 3MZFA 3VP2A 4GD8A 3ZG7B 5I94A 1K54C 5EE8A 3UDFA 4IBXA 3N8LA 1EWZA 3PBSA 3ZG5A 3ZNTA 2Q9MA 3IWOA 1XGIA 1FCNA 4OOYA 3AGFA 3LO7A 5GHZA 3HUOA 3Q7VA 3BFFA 3WS5A 3D4FA 2C6WB 3ITAA 4PPRA 4QB8A 1XP4A 1MWUA 4E3IA 4S2LA 4EBNA 3E2KA 1ES5A 4KZ7A 4DE3A 3IH9A 2X01A 1IYOA 1KVLA 1XXMA 1J9MA 2OSUA 2PU2A 3N4IA 5CHJA 1PWCA 4B88A 4JBFA 4RX3A 4FH2A 2ZC5B 5FI6A 3C7UA 2WAEA 1GA0A 4UAAA 3S22A 4UHUA 4XUZA 1ONGA 3HVFA 5DF9A 5IHVA 3MKEA 1SHVA 3G34A 1RCJA 4JF6A 4S2KA 1JWVA 1W79A 2WKEA 3HUNA 4KG6A 2QPNA 5A93A 2Y2LA 1YLWA 3V39A 3SH7A 2XEPA 2DRWA 5GHXA 2ZC3B 5EVID 2ZC6B 3MZEA 2DNSA 4JXSA 3N8RA 4GD6A 3G4PA 4WZ5A 1L0GA 2Z2MB 3LEZA 1LLBA 2Y59A 2Y91A 3PAEA 3OC2A 4R3JA 3N6IA 2HPBA 4BD0A 4FH4A 3ZNYA 3OCNA 2ZQ9A 3MKFA 4Z9QA 4ZJ3A 3A3FA 3I7JA 5D3OA 1PI4A 3HLGA 4BD1A 4EBLA 1IYSA 2PBYA 2XH9A 5FI2A 4MBHA 3M6HA 1IELA 1M6KA 3GVBA 1FSWA 2WK0A 4KZ3A 3ZHHA 4BL3A 2P9VA 3NDGA 1XA1A 4E3OA 3IH8A 2V2FF 4MLLA 2CC1A 4KZ4A 4KZ5A 3HBRA 3MBZA 4EBPA 3M2JA 2RL3A 2ZM2A 4S2MA 1CK3A 1O07A 4ZJ1A 2Y2GA 4OOMA 3UY6A 3VSLA 2XR0A 5GLCA 1YLYA 3IF6B 3BEBA 5EVLA 1SKFA 2QMIA 3UPNA 3Q7VB 3G30A 2Y2JA 5HL1A 1MKIA 5HX9A 4QD4A 4JPMA 3NIAA 4DF6A 1LI9A 2XFSA 1K56D 1BUEA 2Y2IA 4QHCA 4QU3A 4GKUA 5EVIA 2EX9A 1L2SA 2DCFA 1PW8A 4DXCA 4X69A 4JXVA 5FQJA 5GHYA 3VP4A 4DE1A 2ZM8A 1XPBA 4JF4A 3Q7ZA 4X56A 5CERA 2HP5A 5CGXA 4U3TA 1I2SA 1KGEA 4IEDA 1CI8A 2R9WA 1Y54A 3QNBA 1KGFA 3BECA 2OV5A 2XGNA 2WKHA 2WUQA 3GSGA 2C5WB 3HUMA 1FR1A 4WZ4A 5FQIA 2V20A 4EQIA 3QHYA 3WS4A 4WMCD 5DTTA 2RCXA 2Y2OA 3OCLA 4R4RA 4ID4A 1IKGA 4S2PA 2ZQ7A 5E43A 3ZCZA 3IQAA 3VFHA 5DF8A 5BOHA 1ZG6A 3LY3A 1CI9A 2WZZA 1MWTA 3A3EA 3MXRA 3BM6A 3A3JA 5FQKA 4YINA 3UE1A 1K56A 4X55A 4KZ8A 1KE0A 2HDQA 3BFEA 4CJNA 3C4PA 5TFQA 2JBFA 5J8XA 2ZM0A 3HLDA 3ZFZA 1HZOA 5GLBA 3HLWA 1SDEA 3G35A 5CXWA 1QMFA 2OLVA 4C6YA 5HAIA 1LI0A 5FAQA 3BFCA 3NC8A 3IXHA 1BSGA 4LCLA 2Y2PA 4PM6A 4OLDA 1WYBA 4JF5A 4QY6A 3VOYA 1RGZA 3RJUA 3VP0A 2B5RA 3W4OA 1K54A 4NK3A 3ZGAB 2ZLYA 3VOZA 4PM8A 2XQZA 3BFGA 4K0WA 4LENA 1Z6FA 3NBLA 3M6BA 1WE4A 1KDSA 3O3VA 5EVIB 3W8KA 1JVJA 5GL9A 2Z2LB 2Y2KA 2XK1A 4WMCA 3S1YA 2WAFA 3FKWA 1VQQA 3ZG0A 4OKPA 3ZVWA 3HREA 4DDSA 1YLZA 1AXBA 1BTLA 2HDSA 4K91A 4ZTKA 5FI7A 3Q82A 5CTMA 5AQ9A 1KE3A 4F94A 4IVIA 1PWGA 1YMXA 5EPHA 4HBTA 2ZQAA 4D2OA 4HBUA 3UNWA 1G68A 3FYZA 4KZ9A 1E3UD 1N4OA 2VGKA 1NY0A 1ERQA 3PBOA 3V3RA 3NY4A 4N9KA 2HP9A 5CHUA 4KG2A 1ESIA 5KSHA 4OVDA 4KQOA 4KQQA 1KDWA 5TGFA 4E3KA 1XX2A 4DDYA 1WYCA 2A49A 4Y0TA 4PM9A 4S2IA 4ZJ2A 1MY8A 1ES2A 3S4XA 3CG5A 3CMZA 3OPLA 3LCEA 3P98A 2PU4A 1KE4A 3WS0A 2FFFB 4BJPA 1LL5A 1Q2PA 2XDMA 1MPLA 4E3MA 1DJAA 4OONA 1O7EA 3DWZA 1LL9A 3IWQA 3G31A 1TDLA 3MXSA 4GDNA 3BYDA 4LV3A 5G18A 4ZDXA 1ZC2A 2Q9NA 4B4ZA 3SH9A 4U0TA 1NYYA 1FOFA 1BZAA 4LV1A 1H8YA 1YLTA 2XLNA 1GA9A 5M1AA 4WEKA 5FQQA 3FKVA 5KMWA 1NJ4A 3Q81A 2HDRA 1K55C 4UA6A 5EUAA 2WZXA 4NETA 5U47A 1BT5A 1E3UA 2G2UA 1W8QA 2J9OA 3TG9A 4C75A 5HAPA 2WGWA 4JLFA 3RXWA 1HTZA 4WYYA 2QZ6A 3WRTA 4FSFA 4GOGA 4GB7A 1GCEA 2Y2HA 2H0YA 4P87A 2WGVA 1ESUA 3EQVA 1YLPA 3VP3A 3NCKA 2H10A 3ITBA 4YFMA 5HFOA 3MZDA 4JKTA 5GLDA 3BFDA 5DTKA 5FQMA 4E3JA 2H5SA 2A3UA 2ZD8A 4KZAA 5TR7A 3VMAA 3IXBA 4MBKA 1GHMA 1YT4A 5CEBA 3CZDA 3AGEA 3BLSA 4HEFA 4E3NA 5F83A 2H0TA 4RYEA 1W5DA 5F1FA 1ONHA 1K25A 3HLFA 1IEMA 3ZDJA 5CEDA 4OQHA 4P6BA 3QNCA 2JC7A 3PTEA 4DE0A 5FA7A 2ZC7A 1FSYA 5A91A 4XXRA 4ZAMA 4GZBA 4MEZA 3SOIA 3G2ZA 3VFFA 1YM1A 1E25A 1GHPA 5E2GA 4JXWA 3HLBA 2WADA 1Q2QA 4GNUA 2E8IA 2P9VB 3SS5A 4Y7PA 5A92A 3GTCA 1XGJA 3OPPA 5A90A 3UE0A 4KZBA 1JTGA 1NXYA 1OMEA 4BENA 4R23A 1MBLA 3GV9A 3FZCA 3GR2A 4S2OA 3IXDA 5E2HA 3TSGA 1W7FA 3OPRA 2XF3A 4WM9A 5AQBA 3IHBA 4CPKA 1PW1A 4RA7A 4R0QA 4HESA 4E3LA 3GMWA 2ZQCA 3V5MA 1HVBA
chains in the Genus database with same CATH superfamily
4OQIA 4FD8A 5DVAA 4GCZA 4B93A 1DJCA 3V67A 3GQZA 2VX8A 1YQSA 3GRJA 4DRTA 3BY9A 1MWRA 2HDUA 2J3WA 2Y4AA 2FFYA 2Y55A 1PZPA 1LSWA 3DW0A 3IF6C 1KVMA 4LV2A 1LL8A 4ZBEA 1DJBA 1FQGA 2EXAA 2X02A 1TEMA 2R9XA 1W8YA 3ZG9B 1L0DA 2ZQ8A 3NOUC 2WKIA 3MQQA 5AQAA 2NUTC 3VSKA 1P9RA 1S66L 2W3DA 4P6ZM 5DKKA 1YLJA 3P01A 3UB6A 1NZOA 2PR5A 1I2WA 3KSFA 3LR5A 4O0PA 3A0RA 1LHYA 1IFQA 2JKTM 4IVKA 3O88A 1K57A 3M2KA 5JYPA 3IBRA 3A0SA 4BMWA 4HJ4A 2Y2MA 2H28A 1CEGA 3N7WA 3SH8A 3EQUA 3ZQ5A 1K4EA 1K6RA 2WGIA 3IF5A 3PBQA 5FAPA 4YWZA 4H8RA 1PRQA 2L4RA 4BLMA 3K2NA 3W4PA 5M18A 2L0WA 2M1CA 4UQIM 5CGSA 3IX4A 1OPXA 3T1SA 2O0YA 1PZOA 4Y0OA 5E2FA 3HLEA 3MFDA 1G6AA 3UE3A 3UE6A 4A5RA 1ZG4A 3A3IA 4OP8A 3EWKA 4OH0A 3W4QA 1S0WA 1FIKA 3BRMA 3V50A 4B4XA 3CI6A 4O7DA 2Q0OA 4X25A 5JYOA 1W63Q 3LFVA 5A8BA 3IWIA 4KG5A 3DTMA 2O9CA 4OP5A 5HW3A 4G3KA 1K6SA 2VA0A 3VP2A 3T4QA 1K54C 2M7VA 1V9YA 3IWOA 1FCNA 4OOYA 2C6WB 4CLCC 2LB5A 4NEED 4E3IA 4LRXC 4EBNA 3MS6A 5HL6A 2X01A 4LRZE 5CHJA 4JBFA 2W1RA 2ZC5B 2XSSA 2BASA 4XUZA 5DF9A 3HVFA 1JWVA 4KG6A 2YKHA 2QPNA 5A93A 2Y2LA 3BW6A 5TBMB 3LR4A 2ZC6B 2DNSA 3N8RA 2V0UA 2Z2MB 3OC2A 1GSWA 3A3FA 5D3OA 5FI2A 3D9YA 4MBHA 1IELA 3GVBA 3IX3A 2P9VA 3NDGA 1XA1A 2K2NA 2CC1A 4MLLA 2Y8HA 3HBRA 2VGLS 4HJ6A 3HJKA 4ESPA 2ZL1B 3BEBA 3UPNA 3Q7VB 3OBFA 5HX9A 3NIAA 3R4KA 5CGXA 2Z6CA 4IEDA 3UMDA 3QNBA 2PBDP 3DTIA 2XA7S 3HUMA 3L7HA 3UB7A 4WMCD 3LIDA 1F98A 4CLCD 3QP5A 3ZCZA 3IQAA 5BOHA 3LY3A 2WZZA 3A3EA 4WL9A 5FQKA 4YINA 3C38A 4KZ8A 3C4PA 5J8XA 3HLDA 3ZFZA 5MC7A 5CXWA 1QMFA 1UGUA 3BFCA 3TW8A 1VB6A 3RJUA 1CJFA 3D72A 3UMEA 1K54A 2ZLYA 1TF1A 3VOZA 4K0WA 5EVIB 3M6BA 1WE4A 3MQOA 4G3VA 3S1YA 2XK1A 4WMCA 3FKWA 3ZG0A 4CLCA 5FI7A 2HDSA 4WUJA 1KE3A 2B95A 4R38A 5EPHA 2ZQAA 2VGKA 3SZTA 5DJTA 1G5UA 4OVDA 1KDWA 4E3KA 2VEAA 3CMZA 2JKRM 3P98A 2PU4A 3WS0A 4BBVA 4BJPA 4E3MA 1DJAA 1XJ4A 4OONA 4H6JA 1LL9A 1W63M 4GLQA 3MXSA 2JKTI 4GS9A 5G18A 3BYDA 4LLOB 5HDDA 2VKSA 4U0TA 5AVFA 2GX5A 5FDSA 1GA9A 5KMWA 1NJ4A 2GZAA 2HDRA 1YKDA 2P04A 2J80A 5LBRA 1BT5A 2VZWA 4C75A 4JLFA 1HTZA 5HSQA 4WYYA 2QZ6A 4FSFA 4GOGA 4EEPA 1GCEA 2Y2HA 3CPTB 2WGVA 3R7WB 2QJ5A 3ITBA 1PNEA 4LPZA 5GLDA 4PKYA 1TS8A 3FG8A 3VMAA 5TR7A 4ME4A 3AGEA 4HEFA 4EETB 3JVUA 4GJ4A 3JVVA 1ONHA 3HLFA 3ZDJA 4P6BA 3QNCA 4DE0A 5DFYA 5FA7A 2ZC7A 5A91A 1GHPA 2NUPC 2M7UA 4JXWA 5F6AA 2E8IA 2P9VB 4Y7PA 3NECA 3OPPA 5A90A 1NXYA 1OMEA 4BENA 3EEHA 5DKLA 3GV9A 2Y79A 4S2OA 1DP6A 1W7FA 1N9OA 3IHBA 2QHKA 4I39A 3V5MA 4JGRA 1HVBA 4AFIA 1BLCA 1IYPA 5L2FA 3NI9A 3P7NA 2B18A 1ALQA 1ZKJA 4IUKA 3FC7A 4OLGA 4WELA 5EOOA 2EFXA 1VM1A 3AGDA 4PM7A 1ES4A 3OZHA 2VLGA 1BLSA 2UWXA 2A2LA 4PM5A 3CJMA 3E4PA 1T19A 3VE4A 2WKQA 5CTNA 4EWFA 4BQMA 1QMEA 4ARZB 5FEFA 2W1TB 1M40A 3PR6A 3WRZA 4L9EA 1YMSA 3LY4A 4BL2A 3WWXA 2JKFA 1YSPA 4N92A 1PI5A 1ODVA 2ZC4B 2HJ9C 5M19A 4X68A 4F3LB 3NOTC 4GN2A 4PMAA 1K57C 3UPPA 4X1MA 4OPZA 3RH8B 2ZMAA 1C3BA 3EGXC 4MNRA 2O99A 3WS1A 3E98A 5J7EA 3B3XA 4P0MA 1GHIA 4L9FA 1S1ZA 4QPRA 4NXGA 2ZQDA 3FPVA 3IXGA 3E2LA 2OLUA 4S2JA 3SS3A 3MQ0A 5EVIC 5AVEA 2ZOIA 4R1GA 4KENB 3P09A 1KGGA 2W3FA 1NYMA 4MCWA 2PYRA 1FCOA 3KYZA 3WS2A 1XFNA 1PYYA 2V1BA 1FR6A 2B02A 2Y2QA 3UB8A 2J9PA 1OJ5A 1BULA 4QY5A 5TBMA 3LYXA 1OT9A 3IBJA 1I5QA 1P0ZA 4UA9A 4N1XA 2VV6A 4EERA 4DMZA 3NDEA 4Y17A 1X0OA 2JN7A 3SS4A 3T1RA 3ZYTA 1LSXA 3BQ8A 1IYQA 4IBRA 2EX2A 3C30A 2HJEA 3UDXA 3G32A 1MWSA 4GD8A 1ZTUA 3N8LA 3ULFA 1T1BA 2ZL1A 1Y4OA 3LO7A 2XRNA 3Q7VA 3BFFA 5HD5A 3D4FA 5HDCA 4PPRA 2P7JA 5HWWA 2KOIA 5K5BA 4K08A 4DE3A 3IH9A 1L3LA 1IYOA 1KVLA 1J9MA 3N4IA 4NG2A 4RX3A 4MN6A 2WAEA 1ONGA 1SHVA 1RCJA 4GHIB 3HUNA 2KLIA 3V39A 4EQ1A 3RFBA 2ZC3B 5EVID 4JXSA 1XJ6A 2W0NA 3LEZA 2Y91A 2JKRI 4R3JA 3ZNYA 4Z9QA 3MXQA 4ETZA 1PI4A 4BD1A 4MN7A 4EBLA 1IYSA 3ZHHA 1FSWA 2WK0A 3IH8A 4LRYC 4EBPA 3JPUA 2ZM2A 4S2MA 4ZJ1A 3UY6A 4OOMA 3VSLA 2XR0A 5GLCA 1YLYA 1TD5A 2EWVA 5EVLA 5HL1A 1MKIA 4DF6A 1K0KA 2Y2IA 2A24A 4KUKA 3C2WA 3U4LP 4GW9A 4MMNA 4QU3A 3MFXA 4GKUA 5EVIA 4Q0JA 2DCFA 4DXCA 4JXVA 1XPBA 4JF4A 3Q7ZA 5CERA 2HP5A 1I2SA 1KGEA 2R9WA 1SKOB 2OV5A 5I5LA 4WZ4A 5FQIA 4EQIA 2RCXA 3IX8A 4FUWA 5DF8A 4DN0A 4R3AA 1GSXA 1MWTA 5DFXA 2PRFA 3BM6A 3A3JA 3O5YA 2AVXA 5GLBA 3HLWA 1SDEA 3G35A 3LR3A 4C6YA 5HAIA 1LI0A 3NC8A 1BSGA 1XJ3A 2Y2PA 2V9AA 4PM6A 2B5RA 3W4OA 3ZGAB 3DTEA 4PM8A 2PD7A 4LENA 1LT0A 3O3VA 3E0YA 3W8KA 3HJIA 2Y2KA 1VQQA 4HIAA 3HREA 3KX0X 2HZ5A 1BTLA 3CPTA 4ZTKA 3Q82A 3R7WA 4F94A 4IVIA 5EVEA 1YMXA 4HY8A 4O01A 3FYZA 4KZ9A 2UV0E 1E3UD 5HDSA 4I3JA 3PBOA 3MMHA 3CHWP 5CHUA 1ESIA 4X1LA 1OJGA 1XX2A 1WYCA 4S2IA 3S4XA 1ES2A 2FFFB 2V8FA 4XT2B 2WKRA 1NRJA 1MPLA 2FH5A 1TDLA 2PAVP 1UWPX 4GDNA 3OOVA 1VEUB 3SH9A 1FOFA 1BZAA 1YLTA 2XLNA 1E3UA 2G2UA 3RXWA 5EM1A 3CITA 2ZMVA 3GECA 1J3WA 3EQVA 2HGVA 3F1OB 2H10A 4WN5A 2OWJA 4Y13A 4JKTA 4I3IA 1H0MA 1YT4A 5CEBA 1FILA 3QP6A 3BLSA 4E3NA 3K3CA 2OAQ1 2H0TA 4WLAA 4RYEA 1W5DA 5F1FA 1IEMA 3F1PB 5CEDA 3NOPC 5CX7A 2JC7A 4ARZA 2W1TA 1ACFA 4ZAMA 3SOIA 5E2GA 2QJ7A 3HLBA 2W3GA 5A92A 3GTCA 1JTGA 4R23A 1MBLA 3IXDA 2XF3A 4WM9A 3ICYA 2L1MA 4CPKA 4RA7A 4HESA 3EEAA 3GMWA 2ZQCA 4NXBA 4F3LA 3PHYA 3KSHA 4NXFA 5HARA 2FZ0A 3ZVTA 4KQDA 2A24B 3BLMA 3E4OA 3JYIA 1N9BA 4UA7A 5FASA 1NRFA 5F1GA 4EESA 2DMWA 3K3DA 1EROA 5FQ9A 4HQAA 4JXGA 1DY6A 1NZUA 2BG1A 4DXBA 1V9ZA 1BLHA 5DF7A 2EXBA 2V1ZA 5KZHA 1IKIA 3O86A 2XD5A 2ZJ9A 1JWZA 4I38A 1PIOA 4HOIA 3OLOA 5F68A 3MR0A 4RQ9A 4WZ5C 3IT9A 3MJQA 3RXXA 2I72A 2WYXA 2OOLA 1L0EA 4DJ3A 4EUZA 4UEYA 3HLCA 3NHQA 1S4RA 3DWKA 4Q8IA 3FWLA 4P85A 5CRFA 2IWCA 5DTSA 2V0WA 1K38A 3KSIA 1LSVA 4L0LA 5G4YA 2EA9A 4E04A 4E6WA 3UO9A 4P6ZS 3QP1A 4WF0A 2W3EA 5HAQA 3LIEA 4LCMA 4Q0IA 1VETB 4N9LA 4Y0UA 2OAP1 1S6RA 2INWA 1JWPA 3B42A 3B47A 1MZUA 4OQ0A 3G6OA 5CECA 4U0XA 1H8ZA 1JTDA 4PAUA 3PBNA 3FV7A 2ZOHA 4OPRA 1N9NA 1TDGA 2IWBA 1F2KA 3ISGA 3GDIA 2E8JA 4JGQA 4QJGA 1SCWA 4WEJA 5C5KA 3ZG8B 4QWOA 4GHIA 3U2AA 2VGJA 1K4FA 1P97A 2ACGA 3UB9A 4Q0HA 5CGWA 3O87A 3FPWA 3IHAA 1XA7A 2Y2NA 3C5AA 2X71A 3C4OA 3DTKA 2GDNA 2GNXA 3F1NB 1HLUP 2XFTA 1BLPA 4UQIS 3TRCA 3HL9A 2LB9A 4LV0A 4RVAA 4OPYA 3S7QA 2WKPA 3S7PA 1JNUA 4NKPA 4IBXA 3PBSA 1EWZA 2PHYA 1N9LA 1XGIA 3AGFA 3T4KA 3HUOA 4QB8A 1XP4A 4S2LA 4Y2FA 5G4ZA 1VHMA 3H9WA 3E4QA 2VGLM 1S4SA 5J4EA 3C7UA 1DP9A 4UHUA 3MKEA 4S2KA 1W79A 2WKEA 1SKOA 2DRWA 2OWHA 1NWZA 1L0GA 5L10A 3G4PA 4WZ5A 1LLBA 2Y59A 3N6IA 4BD0A 2W3HA 4EUVA 2HV1A 4B9OA 3HLGA 2PBYA 2XH9A 3M6HA 1M6KA 3BJNA 4BL3A 1D1JA 3UB5P 2XA7M 5EM0A 2RL3A 1CF0A 3IS2B 4KUOA 2Y2GA 1SKFA 3G30A 2Y2JA 4JPMA 1LI9A 1K56D 4O8GA 4QHCA 3T4TA 1OTAA 2EX9A 1L2SA 1Y28A 5GHYA 1S1YA 2VV8A 2O9BA 4M4XA 3BECA 2WKHA 2WUQA 3GSGA 3LGOA 4R70A 2V20A 2V1AA 5DTTA 4Y3IA 2Y2OA 3OCLA 4R4RA 5L07A 4ID4A 4S2PA 5E43A 2ZQ7A 3EGDC 3MXRA 5HD3A 1PFLA 3H82B 1K56A 4X55A 5EFWA 1UWNX 3BFEA 4CJNA 4XT2A 3T4JA 2JBFA 1HZOA 2PR6A 2OLVA 3B33A 3PXPA 1VEUA 1H3QA 1Z09A 3IXHA 3LICA 4LCLA 4OLDA 1T1AA 4NK3A 3CWFA 1D7EA 1BYWA 3NBLA 5GL9A 4MDZA 1A0KA 4OKPA 1YLZA 5HPIA 4K91A 5AQ9A 5TJJA 3F1OA 1PWGA 3VV4A 4HBUA 2PDRA 3UNWA 2PD8A 3BY8A 1NY0A 1ERQA 3V3RA 3NY4A 2BTFP 3QP2A 2HP9A 2K31A 1G6OA 5DJUA 3F1PA 2HF6A 4DDYA 4Y0TA 4PM9A 1H8MA 3OPLA 3LCEA 1P9WA 4ETXA 1KE4A 1LL5A 2XDMA 5F69A 1O7EA 1WA9A 3TJZC 3IWQA 3G31A 4ZDXA 1ZC2A 4B4ZA 3LUQA 5M1AA 5FQQA 2CMNA 1K55C 3LIAA 2WZXA 4EXOA 4NETA 5U47A 1W8QA 2J9OA 5HAPA 4LGWA 1EW0A 3KYEA 1ESUA 3LIFA 4YFMA 5IT5A 5HFOA 5HPFA 3BFDA 2GJ3A 4KZAA 3IXBA 4MBKA 1GHMA 2KDKA 5F83A 1K25A 4DJ2A 4OQHA 3PTEA 4L9GA 2V8CA 3T50A 4EW7A 3L9KA 4CQHA 1FSYA 4XXRA 4MEZA 3G2ZA 3VFFA 1YM1A 1E25A 4HH3A 3UE0A 4KZBA 4R6LA 2PYPA 1PW1A 4R0QA 4E3LA 1DP8A 1ZHHB 3DAVA 4PHTA 3LR0A 1HD8A 3UPOA 4DKIA 1XFQA 4BBUA 1T1CA 4HJ3A 3Q07A 2WGWB 4K0XA 5FATA 3PBTA 4R3BA 2JHEA 4S2NC 3T4SA 4ZRRA 2VK3A 2J3TC 5GLAA 2EFUA 5F82A 3H7WB 3TE8A 2G2WA 3EOIA 1STZA 2QKPA 4X6TA 1TVFA 2D02A 2BLSA 1E4DA 3IF6A 3TOIA 1VETA 2PT7A 2EX8A 4EV4A 2HP6A 1XKZA 3PBRA 4II7A 1G28A 5FSRA 1FCMA 3MSHA 1CEFA 1NLZA 4IUHA 1H5XA 2MJ6A 4EU0A 4RX2A 3LI8A 1RGYA 4XUXA 4HH2A 3UN7A 4R4SA 1SDNA 3OPHA 1GSVA 2XD1A 2K7SA 1XJ2A 2D01A 4D60A 4E6XA 1L0FA 4FCFA 4MBFA 1EI5A 4OQGA 1K55A 4WBGA 1U60A 5AQ7A 2J7VA 3F1NA 3T12B 1OTDA 3V3SA 1PWDA 1MXOA 5CHMA 5FAOA 4C3QA 1YSQA 4G3WA 3KO6A 2EX6A 1T18A 3PYPA 3HCYA 5EOEA 5FDHA 2JE5A 4X53A 3CAXA 4DE2A 4BBTA 3C7VA 2J3TD 3DBAA 5L8MA 2IWDA 3UDIA 3N8SA 4Z1WA 2ZMFA 5EV0A 2P74A 1OTEA 4OPQA 4GDBA 3Q1FA 4Y5FA 4KQRA 1ERMA 2I9VA 5EECA 4N1HA 4BWIA 1MKMA 1IOUA 1ES3A 3G2YA 3PAGA 4EEUA 1RP5A 4OOLA 4JGOA 4KZ6A 4S2NA 5E2EA 3A3DA 4NXEA 3VP1A 4IJGA 3S7NA 4M3KA 2XROA 2J8YA 2JCHA 3MZFA 3ZG7B 5I94A 5EE8A 3UDFA 3IS2A 3ZG5A 3ZNTA 2Q9MA 3CUEC 3VOLA 5GHZA 3WS5A 3ITAA 1MWUA 5L09A 5KIZA 3E2KA 1ES5A 4KZ7A 5HWVA 1XXMA 2OSUA 2PU2A 1PWCA 4B88A 4CLCE 4FH2A 5FI6A 4UAAA 1GA0A 3S22A 5IHVA 3G34A 4JF6A 5HZHA 1YLWA 3SW1A 3SH7A 2XEPA 5GHXA 5KSCA 5KSHA 3MZEA 4GD6A 2QWSA 3PAEA 5FEGA 2HPBA 4FH4A 3OCNA 2ZQ9A 3MKFA 4ZJ3A 1F5MA 3I7JA 4IHQA 3QP8A 3A0VA 4KZ3A 2P08A 3H82A 4E3OA 5AJGA 2V2FF 4KZ4A 4KZ5A 3MBZA 2VV7A 3T4LA 3M2JA 1CK3A 4FOFA 1O07A 1OTBA 1D06A 3IF6B 1NLYA 2QMIA 4MN5A 4Y15A 4QD4A 4LFUA 2XFSA 1BUEA 1MC0A 1PW8A 4X69A 5FQJA 1KOUA 3VP4A 4DE1A 2ZM8A 2G7UA 3NULA 5FL3A 4X56A 3S7OA 1TS6A 4U3TA 1CI8A 1Y54A 3MF0A 1KGFA 2XGNA 3NJAA 2C5WB 1FR1A 3BWLA 3QHYA 3WS4A 4HP9A 5IU1A 4I3AA 2JKGA 5HWTA 1IKGA 3QP4A 3KYQA 3VFHA 1CQAA 1ZG6A 2QYBA 1CI9A 4YOFA 2ZBBA 3UE1A 1SZVA 1KE0A 2HDQA 5TFQA 2ZM0A 1S67L 3CLOA 5FAQA 4PKYG 4QY6A 1WYBA 4JF5A 3VOYA 1RGZA 3VP0A 3LI9A 4FTXA 3D3OA 2XQZA 3BFGA 1Z6FA 3CUEA 1KDSA 1JVJA 2YKFA 5J3WA 2Z2LB 2WAFA 3ZVWA 2Z6DA 4DDSA 1AXBA 1DRMA 5CTMA 4HNBA 3T1QB 4HBTA 1OTIA 4D2OA 3KSGA 1G68A 4I5SA 3C8CA 1N4OA 4N9KA 4KG2A 2KX6A 4KQOA 4KQQA 5F5YA 5TGFA 2A49A 2R78A 4ZJ2A 1MY8A 3CG5A 1Q2PA 1AWIA 3DWZA 4LV3A 2IA2A 2Q9NA 1NYYA 4LV1A 4HP4A 1H8YA 4WEKA 3FKVA 3Q81A 4UA6A 5EUAA 3TG9A 1F9IA 2WGWA 3WRTA 4CLCB 2EWWA 4GB7A 4YNRA 2H0YA 4HI4A 4P87A 3W2ZA 3T4OA 1YLPA 3VP3A 3NCKA 3MZDA 2VJWA 1TS7A 3VE3A 3BQAA 5DTKA 5FQMA 4E3JA 2H5SA 2A3UA 2ZD8A 3H7WA 3RTYA 4JGPA 3T1XA 1YAXA 3CZDA 2W27A 5IS1A 4HHDA 1OT6A 1YPRA 4GZBA 2WADA 4H6JB 1Q2QA 4GNUA 3SS5A 4GS9B 1XGJA 1TS0A 3FZCA 3GR2A 5E2HA 3TSGA 3OPRA 3LEQA 5AQBA 2O9AA 3LIBA
chains in the Genus database with same CATH topology
4OQIA 1BLCA 1IYPA 1HD8A 5HARA 4DKIA 4FD8A 3UPOA 3Q07A 5DVAA 5L2FA 1DJCA 2WGWB 3NI9A 3ZVTA 4K0XA 5FATA 3GQZA 1ALQA 3BLMA 3JYIA 3PBTA 4R3BA 1N9BA 4UA7A 1YQSA 4S2NC 5FASA 3GRJA 4DRTA 1ZKJA 1NRFA 5GLAA 5F1GA 1MWRA 2HDUA 4OLGA 2EFUA 4WELA 5EOOA 2EFXA 1VM1A 2Y4AA 3AGDA 5F82A 1EROA 4PM7A 2G2WA 1ES4A 3OZHA 5FQ9A 4X6TA 2FFYA 1BLSA 2Y55A 2UWXA 4JXGA 1DY6A 1PZPA 1NZUA 1TVFA 3DW0A 1KVMA 2BG1A 3IF6C 4LV2A 4PM5A 4DXBA 2BLSA 4ZBEA 1E4DA 3CJMA 1BLHA 3IF6A 3TOIA 5DF7A 5CTNA 4EWFA 1DJBA 4BQMA 1QMEA 2EXBA 2EX8A 4EV4A 1FQGA 2HP6A 2EXAA 2X02A 2V1ZA 1TEMA 5KZHA 2R9XA 1XKZA 1W8YA 1M40A 3PBRA 1L0DA 3WRZA 3ZG9B 2ZQ8A 1IKIA 5FSRA 2WKIA 1YMSA 3LY4A 3O86A 5AQAA 4BL2A 3WWXA 1FCMA 2XD5A 2ZJ9A 3VSKA 1CEFA 4N92A 1JWZA 1H5XA 1PIOA 1PI5A 4RX2A 1YLJA 2ZC4B 1RGYA 4XUXA 1NZOA 3UN7A 1I2WA 5M19A 4WZ5C 4R4SA 1LHYA 1SDNA 3OPHA 3IT9A 2XD1A 4X68A 3RXXA 2I72A 2WYXA 5KSCA 4GN2A 4PMAA 1L0EA 4IVKA 4E6XA 1L0FA 3O88A 1K57C 4EUZA 3UPPA 3HLCA 4FCFA 4MBFA 1K57A 3M2KA 1EI5A 4OQGA 4OPZA 5JYPA 2ZMAA 1C3BA 1K55A 3DWKA 4Q8IA 3FWLA 4P85A 5CRFA 4WBGA 1U60A 5AQ7A 2IWCA 2J7VA 4MNRA 5DTSA 1K38A 2Y2MA 1CEGA 3N7WA 3WS1A 4L0LA 3SH8A 3EQUA 3B3XA 4P0MA 3V3SA 1GHIA 1PWDA 3UO9A 4E6WA 1K4EA 1MXOA 5CHMA 1K6RA 5FAOA 2WGIA 4C3QA 3IF5A 3PBQA 5FAPA 2ZQDA 4H8RA 5HAQA 3IXGA 4BLMA 2EX6A 4LCMA 3E2LA 4N9LA 4Y0UA 5EOEA 3W4PA 2OLUA 1S6RA 4S2JA 5M18A 1JWPA 5FDHA 3SS3A 4OQ0A 5EVIC 2JE5A 4X53A 4R1GA 5CECA 4U0XA 4DE2A 4KENB 1H8ZA 3P09A 1JTDA 3C7VA 5CGSA 3PBNA 3FV7A 4OPRA 1TDGA 1KGGA 2IWDA 2IWBA 3UDIA 1NYMA 1PZOA 3ISGA 4QJGA 1SCWA 3N8SA 4Y0OA 5E2FA 3HLEA 2P74A 1FCOA 3MFDA 4WEJA 3WS2A 4OPQA 1G6AA 1PYYA 3ZG8B 1FR6A 2Y2QA 4GDBA 3UE3A 4A5RA 2J9PA 1BULA 3Q1FA 1ZG4A 2VGJA 3A3IA 1K4FA 4KQRA 4OP8A 1ERMA 4QY5A 4OH0A 3W4QA 1S0WA 1I5QA 3BRMA 5CGWA 3O87A 4UA9A 5EECA 3V50A 4B4XA 4N1XA 3IHAA 4N1HA 1XA7A 2Y2NA 3C5AA 2X71A 3C4OA 4O7DA 2GDNA 1ES3A 3NDEA 3G2YA 3PAGA 5JYOA 1RP5A 2XFTA 1BLPA 4OOLA 3SS4A 3HL9A 4KZ6A 3IWIA 4S2NA 1IYQA 3DTMA 4IBRA 4KG5A 5E2EA 3A3DA 2EX2A 4OP5A 4LV0A 3VP1A 4RVAA 4OPYA 5HW3A 4M3KA 1K6SA 3UDXA 3G32A 2J8YA 1MWSA 2JCHA 3MZFA 3VP2A 4GD8A 3ZG7B 5I94A 1K54C 5EE8A 3UDFA 4IBXA 3N8LA 1EWZA 3PBSA 3ZG5A 3ZNTA 2Q9MA 3IWOA 1XGIA 1FCNA 4OOYA 3AGFA 3LO7A 5GHZA 3HUOA 3Q7VA 3BFFA 3WS5A 3D4FA 2C6WB 3ITAA 4PPRA 4QB8A 1XP4A 1MWUA 4E3IA 4S2LA 4EBNA 3E2KA 1ES5A 4KZ7A 4DE3A 3IH9A 2X01A 1IYOA 1KVLA 1XXMA 1J9MA 2OSUA 2PU2A 3N4IA 5CHJA 1PWCA 4B88A 4JBFA 4RX3A 4FH2A 2ZC5B 5FI6A 3C7UA 2WAEA 1GA0A 4UAAA 3S22A 4UHUA 4XUZA 1ONGA 3HVFA 5DF9A 5IHVA 3MKEA 1SHVA 3G34A 1RCJA 4JF6A 4S2KA 1JWVA 1W79A 2WKEA 3HUNA 4KG6A 2QPNA 5A93A 2Y2LA 1YLWA 3V39A 3SH7A 2XEPA 2DRWA 5GHXA 2ZC3B 5EVID 2ZC6B 3MZEA 2DNSA 4JXSA 3N8RA 4GD6A 3G4PA 4WZ5A 1L0GA 2Z2MB 3LEZA 1LLBA 2Y59A 2Y91A 3PAEA 3OC2A 4R3JA 3N6IA 2HPBA 4BD0A 4FH4A 3ZNYA 3OCNA 2ZQ9A 3MKFA 4Z9QA 4ZJ3A 3A3FA 3I7JA 5D3OA 1PI4A 3HLGA 4BD1A 4EBLA 1IYSA 2PBYA 2XH9A 5FI2A 4MBHA 3M6HA 1IELA 1M6KA 3GVBA 1FSWA 2WK0A 4KZ3A 3ZHHA 4BL3A 2P9VA 3NDGA 1XA1A 4E3OA 3IH8A 2V2FF 4MLLA 2CC1A 4KZ4A 4KZ5A 3HBRA 3MBZA 4EBPA 3M2JA 2RL3A 2ZM2A 4S2MA 1CK3A 1O07A 4ZJ1A 2Y2GA 4OOMA 3UY6A 3VSLA 2XR0A 5GLCA 1YLYA 3IF6B 3BEBA 5EVLA 1SKFA 2QMIA 3UPNA 3Q7VB 3G30A 2Y2JA 5HL1A 1MKIA 5HX9A 4QD4A 4JPMA 3NIAA 4DF6A 1LI9A 2XFSA 1K56D 1BUEA 2Y2IA 4QHCA 4QU3A 4GKUA 5EVIA 2EX9A 1L2SA 2DCFA 1PW8A 4DXCA 4X69A 4JXVA 5FQJA 5GHYA 3VP4A 4DE1A 2ZM8A 1XPBA 4JF4A 3Q7ZA 4X56A 5CERA 2HP5A 5CGXA 4U3TA 1I2SA 1KGEA 4IEDA 1CI8A 2R9WA 1Y54A 3QNBA 1KGFA 3BECA 2OV5A 2XGNA 2WKHA 2WUQA 3GSGA 2C5WB 3HUMA 1FR1A 4WZ4A 5FQIA 2V20A 4EQIA 3QHYA 3WS4A 4WMCD 5DTTA 2RCXA 2Y2OA 3OCLA 4R4RA 4ID4A 1IKGA 4S2PA 2ZQ7A 5E43A 3ZCZA 3IQAA 3VFHA 5DF8A 5BOHA 1ZG6A 3LY3A 1CI9A 2WZZA 1MWTA 3A3EA 3MXRA 3BM6A 3A3JA 5FQKA 4YINA 3UE1A 1K56A 4X55A 4KZ8A 1KE0A 2HDQA 3BFEA 4CJNA 3C4PA 5TFQA 2JBFA 5J8XA 2ZM0A 3HLDA 3ZFZA 1HZOA 5GLBA 3HLWA 1SDEA 3G35A 5CXWA 1QMFA 2OLVA 4C6YA 5HAIA 1LI0A 5FAQA 3BFCA 3NC8A 3IXHA 1BSGA 4LCLA 2Y2PA 4PM6A 4OLDA 1WYBA 4JF5A 4QY6A 3VOYA 1RGZA 3RJUA 3VP0A 2B5RA 3W4OA 1K54A 4NK3A 3ZGAB 2ZLYA 3VOZA 4PM8A 2XQZA 3BFGA 4K0WA 4LENA 1Z6FA 3NBLA 3M6BA 1WE4A 1KDSA 3O3VA 5EVIB 3W8KA 1JVJA 5GL9A 2Z2LB 2Y2KA 2XK1A 4WMCA 3S1YA 2WAFA 3FKWA 1VQQA 3ZG0A 4OKPA 3ZVWA 3HREA 4DDSA 1YLZA 1AXBA 1BTLA 2HDSA 4K91A 4ZTKA 5FI7A 3Q82A 5CTMA 5AQ9A 1KE3A 4F94A 4IVIA 1PWGA 1YMXA 5EPHA 4HBTA 2ZQAA 4D2OA 4HBUA 3UNWA 1G68A 3FYZA 4KZ9A 1E3UD 1N4OA 2VGKA 1NY0A 1ERQA 3PBOA 3V3RA 3NY4A 4N9KA 2HP9A 5CHUA 4KG2A 1ESIA 5KSHA 4OVDA 4KQOA 4KQQA 1KDWA 5TGFA 4E3KA 1XX2A 4DDYA 1WYCA 2A49A 4Y0TA 4PM9A 4S2IA 4ZJ2A 1MY8A 1ES2A 3S4XA 3CG5A 3CMZA 3OPLA 3LCEA 3P98A 2PU4A 1KE4A 3WS0A 2FFFB 4BJPA 1LL5A 1Q2PA 2XDMA 1MPLA 4E3MA 1DJAA 4OONA 1O7EA 3DWZA 1LL9A 3IWQA 3G31A 1TDLA 3MXSA 4GDNA 3BYDA 4LV3A 5G18A 4ZDXA 1ZC2A 2Q9NA 4B4ZA 3SH9A 4U0TA 1NYYA 1FOFA 1BZAA 4LV1A 1H8YA 1YLTA 2XLNA 1GA9A 5M1AA 4WEKA 5FQQA 3FKVA 5KMWA 1NJ4A 3Q81A 2HDRA 1K55C 4UA6A 5EUAA 2WZXA 4NETA 5U47A 1BT5A 1E3UA 2G2UA 1W8QA 2J9OA 3TG9A 4C75A 5HAPA 2WGWA 4JLFA 3RXWA 1HTZA 4WYYA 2QZ6A 3WRTA 4FSFA 4GOGA 4GB7A 1GCEA 2Y2HA 2H0YA 4P87A 2WGVA 1ESUA 3EQVA 1YLPA 3VP3A 3NCKA 2H10A 3ITBA 4YFMA 5HFOA 3MZDA 4JKTA 5GLDA 3BFDA 5DTKA 5FQMA 4E3JA 2H5SA 2A3UA 2ZD8A 4KZAA 5TR7A 3VMAA 3IXBA 4MBKA 1GHMA 1YT4A 5CEBA 3CZDA 3AGEA 3BLSA 4HEFA 4E3NA 5F83A 2H0TA 4RYEA 1W5DA 5F1FA 1ONHA 1K25A 3HLFA 1IEMA 3ZDJA 5CEDA 4OQHA 4P6BA 3QNCA 2JC7A 3PTEA 4DE0A 5FA7A 2ZC7A 1FSYA 5A91A 4XXRA 4ZAMA 4GZBA 4MEZA 3SOIA 3G2ZA 3VFFA 1YM1A 1E25A 1GHPA 5E2GA 4JXWA 3HLBA 2WADA 1Q2QA 4GNUA 2E8IA 2P9VB 3SS5A 4Y7PA 5A92A 3GTCA 1XGJA 3OPPA 5A90A 3UE0A 4KZBA 1JTGA 1NXYA 1OMEA 4BENA 4R23A 1MBLA 3GV9A 3FZCA 3GR2A 4S2OA 3IXDA 5E2HA 3TSGA 1W7FA 3OPRA 2XF3A 4WM9A 5AQBA 3IHBA 4CPKA 1PW1A 4RA7A 4R0QA 4HESA 4E3LA 3GMWA 2ZQCA 3V5MA 1HVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OQI A;  1BLC A;  1IYP A;  1HD8 A;  5HAR A;  4DKI A;  4FD8 A;  3UPO A;  3Q07 A;  5DVA A;  5L2F A;  1DJC A;  2WGW B;  3NI9 A;  3ZVT A;  4K0X A;  5FAT A;  3GQZ A;  1ALQ A;  3BLM A;  3JYI A;  3PBT A;  4R3B A;  1N9B A;  4UA7 A;  1YQS A;  4S2N C;  5FAS A;  3GRJ A;  4DRT A;  1ZKJ A;  1NRF A;  5GLA A;  5F1G A;  1MWR A;  2HDU A;  4OLG A;  2EFU A;  4WEL A;  5EOO A;  2EFX A;  1VM1 A;  2Y4A A;  3AGD A;  5F82 A;  1ERO A;  4PM7 A;  2G2W A;  1ES4 A;  3OZH A;  5FQ9 A;  4X6T A;  2FFY A;  1BLS A;  2Y55 A;  2UWX A;  4JXG A;  1DY6 A;  1PZP A;  1NZU A;  1TVF A;  3DW0 A;  1KVM A;  2BG1 A;  3IF6 C;  4LV2 A;  4PM5 A;  4DXB A;  2BLS A;  4ZBE A;  1E4D A;  3CJM A;  1BLH A;  3IF6 A;  3TOI A;  5DF7 A;  5CTN A;  4EWF A;  1DJB A;  4BQM A;  1QME A;  2EXB A;  2EX8 A;  4EV4 A;  1FQG A;  2HP6 A;  2EXA A;  2X02 A;  2V1Z A;  1TEM A;  5KZH A;  2R9X A;  1XKZ A;  1W8Y A;  1M40 A;  3PBR A;  1L0D A;  3WRZ A;  3ZG9 B;  2ZQ8 A;  1IKI A;  5FSR A;  2WKI A;  1YMS A;  3LY4 A;  3O86 A;  5AQA A;  4BL2 A;  3WWX A;  1FCM A;  2XD5 A;  2ZJ9 A;  3VSK A;  1CEF A;  4N92 A;  1JWZ A;  1H5X A;  1PIO A;  1PI5 A;  4RX2 A;  1YLJ A;  2ZC4 B;  1RGY A;  4XUX A;  1NZO A;  3UN7 A;  1I2W A;  5M19 A;  4WZ5 C;  4R4S A;  1LHY A;  1SDN A;  3OPH A;  3IT9 A;  2XD1 A;  4X68 A;  3RXX A;  2I72 A;  2WYX A;  5KSC A;  4GN2 A;  4PMA A;  1L0E A;  4IVK A;  4E6X A;  1L0F A;  3O88 A;  1K57 C;  4EUZ A;  3UPP A;  3HLC A;  4FCF A;  4MBF A;  1K57 A;  3M2K A;  1EI5 A;  4OQG A;  4OPZ A;  5JYP A;  2ZMA A;  1C3B A;  1K55 A;  3DWK A;  4Q8I A;  3FWL A;  4P85 A;  5CRF A;  4WBG A;  1U60 A;  5AQ7 A;  2IWC A;  2J7V A;  4MNR A;  5DTS A;  1K38 A;  2Y2M A;  1CEG A;  3N7W A;  3WS1 A;  4L0L A;  3SH8 A;  3EQU A;  3B3X A;  4P0M A;  3V3S A;  1GHI A;  1PWD A;  3UO9 A;  4E6W A;  1K4E A;  1MXO A;  5CHM A;  1K6R A;  5FAO A;  2WGI A;  4C3Q A;  3IF5 A;  3PBQ A;  5FAP A;  2ZQD A;  4H8R A;  5HAQ A;  3IXG A;  4BLM A;  2EX6 A;  4LCM A;  3E2L A;  4N9L A;  4Y0U A;  5EOE A;  3W4P A;  2OLU A;  1S6R A;  4S2J A;  5M18 A;  1JWP A;  5FDH A;  3SS3 A;  4OQ0 A;  5EVI C;  2JE5 A;  4X53 A;  4R1G A;  5CEC A;  4U0X A;  4DE2 A;  4KEN B;  1H8Z A;  3P09 A;  1JTD A;  3C7V A;  5CGS A;  3PBN A;  3FV7 A;  4OPR A;  1TDG A;  1KGG A;  2IWD A;  2IWB A;  3UDI A;  1NYM A;  1PZO A;  3ISG A;  4QJG A;  1SCW A;  3N8S A;  4Y0O A;  5E2F A;  3HLE A;  2P74 A;  1FCO A;  3MFD A;  4WEJ A;  3WS2 A;  4OPQ A;  1G6A A;  1PYY A;  3ZG8 B;  1FR6 A;  2Y2Q A;  4GDB A;  3UE3 A;  4A5R A;  2J9P A;  1BUL A;  3Q1F A;  1ZG4 A;  2VGJ A;  3A3I A;  1K4F A;  4KQR A;  4OP8 A;  1ERM A;  4QY5 A;  4OH0 A;  3W4Q A;  1S0W A;  1I5Q A;  3BRM A;  5CGW A;  3O87 A;  4UA9 A;  5EEC A;  3V50 A;  4B4X A;  4N1X A;  3IHA A;  4N1H A;  1XA7 A;  2Y2N A;  3C5A A;  2X71 A;  3C4O A;  4O7D A;  2GDN A;  1ES3 A;  3NDE A;  3G2Y A;  3PAG A;  5JYO A;  1RP5 A;  2XFT A;  1BLP A;  4OOL A;  3SS4 A;  3HL9 A;  4KZ6 A;  3IWI A;  4S2N A;  1IYQ A;  3DTM A;  4IBR A;  4KG5 A;  5E2E A;  3A3D A;  2EX2 A;  4OP5 A;  4LV0 A;  3VP1 A;  4RVA A;  4OPY A;  5HW3 A;  4M3K A;  1K6S A;  3UDX A;  3G32 A;  2J8Y A;  1MWS A;  2JCH A;  3MZF A;  3VP2 A;  4GD8 A;  3ZG7 B;  5I94 A;  1K54 C;  5EE8 A;  3UDF A;  4IBX A;  3N8L A;  1EWZ A;  3PBS A;  3ZG5 A;  3ZNT A;  2Q9M A;  3IWO A;  1XGI A;  1FCN A;  4OOY A;  3AGF A;  3LO7 A;  5GHZ A;  3HUO A;  3Q7V A;  3BFF A;  3WS5 A;  3D4F A;  2C6W B;  3ITA A;  4PPR A;  4QB8 A;  1XP4 A;  1MWU A;  4E3I A;  4S2L A;  4EBN A;  3E2K A;  1ES5 A;  4KZ7 A;  4DE3 A;  3IH9 A;  2X01 A;  1IYO A;  1KVL A;  1XXM A;  1J9M A;  2OSU A;  2PU2 A;  3N4I A;  5CHJ A;  1PWC A;  4B88 A;  4JBF A;  4RX3 A;  4FH2 A;  2ZC5 B;  5FI6 A;  3C7U A;  2WAE A;  1GA0 A;  4UAA A;  3S22 A;  4UHU A;  4XUZ A;  1ONG A;  3HVF A;  5DF9 A;  5IHV A;  3MKE A;  1SHV A;  3G34 A;  1RCJ A;  4JF6 A;  4S2K A;  1JWV A;  1W79 A;  2WKE A;  3HUN A;  4KG6 A;  2QPN A;  5A93 A;  2Y2L A;  1YLW A;  3V39 A;  3SH7 A;  2XEP A;  2DRW A;  5GHX A;  2ZC3 B;  5EVI D;  2ZC6 B;  3MZE A;  2DNS A;  4JXS A;  3N8R A;  4GD6 A;  3G4P A;  4WZ5 A;  1L0G A;  2Z2M B;  3LEZ A;  1LLB A;  2Y59 A;  2Y91 A;  3PAE A;  3OC2 A;  4R3J A;  3N6I A;  2HPB A;  4BD0 A;  4FH4 A;  3ZNY A;  3OCN A;  2ZQ9 A;  3MKF A;  4Z9Q A;  4ZJ3 A;  3A3F A;  3I7J A;  5D3O A;  1PI4 A;  3HLG A;  4BD1 A;  4EBL A;  1IYS A;  2PBY A;  2XH9 A;  5FI2 A;  4MBH A;  3M6H A;  1IEL A;  1M6K A;  3GVB A;  1FSW A;  2WK0 A;  4KZ3 A;  3ZHH A;  4BL3 A;  2P9V A;  3NDG A;  1XA1 A;  4E3O A;  3IH8 A;  2V2F F;  4MLL A;  2CC1 A;  4KZ4 A;  4KZ5 A;  3HBR A;  3MBZ A;  4EBP A;  3M2J A;  2RL3 A;  2ZM2 A;  4S2M A;  1CK3 A;  1O07 A;  4ZJ1 A;  2Y2G A;  4OOM A;  3UY6 A;  3VSL A;  2XR0 A;  5GLC A;  1YLY A;  3IF6 B;  3BEB A;  5EVL A;  1SKF A;  2QMI A;  3UPN A;  3Q7V B;  3G30 A;  2Y2J A;  5HL1 A;  1MKI A;  5HX9 A;  4QD4 A;  4JPM A;  3NIA A;  4DF6 A;  1LI9 A;  2XFS A;  1K56 D;  1BUE A;  2Y2I A;  4QHC A;  4QU3 A;  4GKU A;  5EVI A;  2EX9 A;  1L2S A;  2DCF A;  1PW8 A;  4DXC A;  4X69 A;  4JXV A;  5FQJ A;  5GHY A;  3VP4 A;  4DE1 A;  2ZM8 A;  1XPB A;  4JF4 A;  3Q7Z A;  4X56 A;  5CER A;  2HP5 A;  5CGX A;  4U3T A;  1I2S A;  1KGE A;  4IED A;  1CI8 A;  2R9W A;  1Y54 A;  3QNB A;  1KGF A;  3BEC A;  2OV5 A;  2XGN A;  2WKH A;  2WUQ A;  3GSG A;  2C5W B;  3HUM A;  1FR1 A;  4WZ4 A;  5FQI A;  2V20 A;  4EQI A;  3QHY A;  3WS4 A;  4WMC D;  5DTT A;  2RCX A;  2Y2O A;  3OCL A;  4R4R A;  4ID4 A;  1IKG A;  4S2P A;  2ZQ7 A;  5E43 A;  3ZCZ A;  3IQA A;  3VFH A;  5DF8 A;  5BOH A;  1ZG6 A;  3LY3 A;  1CI9 A;  2WZZ A;  1MWT A;  3A3E A;  3MXR A;  3BM6 A;  3A3J A;  5FQK A;  4YIN A;  3UE1 A;  1K56 A;  4X55 A;  4KZ8 A;  1KE0 A;  2HDQ A;  3BFE A;  4CJN A;  3C4P A;  5TFQ A;  2JBF A;  5J8X A;  2ZM0 A;  3HLD A;  3ZFZ A;  1HZO A;  5GLB A;  3HLW A;  1SDE A;  3G35 A;  5CXW A;  1QMF A;  2OLV A;  4C6Y A;  5HAI A;  1LI0 A;  5FAQ A;  3BFC A;  3NC8 A;  3IXH A;  1BSG A;  4LCL A;  2Y2P A;  4PM6 A;  4OLD A;  1WYB A;  4JF5 A;  4QY6 A;  3VOY A;  1RGZ A;  3RJU A;  3VP0 A;  2B5R A;  3W4O A;  1K54 A;  4NK3 A;  3ZGA B;  2ZLY A;  3VOZ A;  4PM8 A;  2XQZ A;  3BFG A;  4K0W A;  4LEN A;  1Z6F A;  3NBL A;  3M6B A;  1WE4 A;  1KDS A;  3O3V A;  5EVI B;  3W8K A;  1JVJ A;  5GL9 A;  2Z2L B;  2Y2K A;  2XK1 A;  4WMC A;  3S1Y A;  2WAF A;  3FKW A;  1VQQ A;  3ZG0 A;  4OKP A;  3ZVW A;  3HRE A;  4DDS A;  1YLZ A;  1AXB A;  1BTL A;  2HDS A;  4K91 A;  4ZTK A;  5FI7 A;  3Q82 A;  5CTM A;  5AQ9 A;  1KE3 A;  4F94 A;  4IVI A;  1PWG A;  1YMX A;  5EPH A;  4HBT A;  2ZQA A;  4D2O A;  4HBU A;  3UNW A;  1G68 A;  3FYZ A;  4KZ9 A;  1E3U D;  1N4O A;  2VGK A;  1NY0 A;  1ERQ A;  3PBO A;  3V3R A;  3NY4 A;  4N9K A;  2HP9 A;  5CHU A;  4KG2 A;  1ESI A;  5KSH A;  4OVD A;  4KQO A;  4KQQ A;  1KDW A;  5TGF A;  4E3K A;  1XX2 A;  4DDY A;  1WYC A;  2A49 A;  4Y0T A;  4PM9 A;  4S2I A;  4ZJ2 A;  1MY8 A;  1ES2 A;  3S4X A;  3CG5 A;  3CMZ A;  3OPL A;  3LCE A;  3P98 A;  2PU4 A;  1KE4 A;  3WS0 A;  2FFF B;  4BJP A;  1LL5 A;  1Q2P A;  2XDM A;  1MPL A;  4E3M A;  1DJA A;  4OON A;  1O7E A;  3DWZ A;  1LL9 A;  3IWQ A;  3G31 A;  1TDL A;  3MXS A;  4GDN A;  3BYD A;  4LV3 A;  5G18 A;  4ZDX A;  1ZC2 A;  2Q9N A;  4B4Z A;  3SH9 A;  4U0T A;  1NYY A;  1FOF A;  1BZA A;  4LV1 A;  1H8Y A;  1YLT A;  2XLN A;  1GA9 A;  5M1A A;  4WEK A;  5FQQ A;  3FKV A;  5KMW A;  1NJ4 A;  3Q81 A;  2HDR A;  1K55 C;  4UA6 A;  5EUA A;  2WZX A;  4NET A;  5U47 A;  1BT5 A;  1E3U A;  2G2U A;  1W8Q A;  2J9O A;  3TG9 A;  4C75 A;  5HAP A;  2WGW A;  4JLF A;  3RXW A;  1HTZ A;  4WYY A;  2QZ6 A;  3WRT A;  4FSF A;  4GOG A;  4GB7 A;  1GCE A;  2Y2H A;  2H0Y A;  4P87 A;  2WGV A;  1ESU A;  3EQV A;  1YLP A;  3VP3 A;  3NCK A;  2H10 A;  3ITB A;  4YFM A;  5HFO A;  3MZD A;  4JKT A;  5GLD A;  3BFD A;  5DTK A;  5FQM A;  4E3J A;  2H5S A;  2A3U A;  2ZD8 A;  4KZA A;  5TR7 A;  3VMA A;  3IXB A;  4MBK A;  1GHM A;  1YT4 A;  5CEB A;  3CZD A;  3AGE A;  3BLS A;  4HEF A;  4E3N A;  5F83 A;  2H0T A;  4RYE A;  1W5D A;  5F1F A;  1ONH A;  1K25 A;  3HLF A;  1IEM A;  3ZDJ A;  5CED A;  4OQH A;  4P6B A;  3QNC A;  2JC7 A;  3PTE A;  4DE0 A;  5FA7 A;  2ZC7 A;  1FSY A;  5A91 A;  4XXR A;  4ZAM A;  4GZB A;  4MEZ A;  3SOI A;  3G2Z A;  3VFF A;  1YM1 A;  1E25 A;  1GHP A;  5E2G A;  4JXW A;  3HLB A;  2WAD A;  1Q2Q A;  4GNU A;  2E8I A;  2P9V B;  3SS5 A;  4Y7P A;  5A92 A;  3GTC A;  1XGJ A;  3OPP A;  5A90 A;  3UE0 A;  4KZB A;  1JTG A;  1NXY A;  1OME A;  4BEN A;  4R23 A;  1MBL A;  3GV9 A;  3FZC A;  3GR2 A;  4S2O A;  3IXD A;  5E2H A;  3TSG A;  1W7F A;  3OPR A;  2XF3 A;  4WM9 A;  5AQB A;  3IHB A;  4CPK A;  1PW1 A;  4RA7 A;  4R0Q A;  4HES A;  4E3L A;  3GMW A;  2ZQC A;  3V5M A;  1HVB A; 
#chains in the Genus database with same CATH topology
 4OQI A;  4FD8 A;  5DVA A;  4GCZ A;  4B93 A;  1DJC A;  3V67 A;  3GQZ A;  2VX8 A;  1YQS A;  3GRJ A;  4DRT A;  3BY9 A;  1MWR A;  2HDU A;  2J3W A;  2Y4A A;  2FFY A;  2Y55 A;  1PZP A;  1LSW A;  3DW0 A;  3IF6 C;  1KVM A;  4LV2 A;  1LL8 A;  4ZBE A;  1DJB A;  1FQG A;  2EXA A;  2X02 A;  1TEM A;  2R9X A;  1W8Y A;  3ZG9 B;  1L0D A;  2ZQ8 A;  3NOU C;  2WKI A;  3MQQ A;  5AQA A;  2NUT C;  3VSK A;  1P9R A;  1S66 L;  2W3D A;  4P6Z M;  5DKK A;  1YLJ A;  3P01 A;  3UB6 A;  1NZO A;  2PR5 A;  1I2W A;  3KSF A;  3LR5 A;  4O0P A;  3A0R A;  1LHY A;  1IFQ A;  2JKT M;  4IVK A;  3O88 A;  1K57 A;  3M2K A;  5JYP A;  3IBR A;  3A0S A;  4BMW A;  4HJ4 A;  2Y2M A;  2H28 A;  1CEG A;  3N7W A;  3SH8 A;  3EQU A;  3ZQ5 A;  1K4E A;  1K6R A;  2WGI A;  3IF5 A;  3PBQ A;  5FAP A;  4YWZ A;  4H8R A;  1PRQ A;  2L4R A;  4BLM A;  3K2N A;  3W4P A;  5M18 A;  2L0W A;  2M1C A;  4UQI M;  5CGS A;  3IX4 A;  1OPX A;  3T1S A;  2O0Y A;  1PZO A;  4Y0O A;  5E2F A;  3HLE A;  3MFD A;  1G6A A;  3UE3 A;  3UE6 A;  4A5R A;  1ZG4 A;  3A3I A;  4OP8 A;  3EWK A;  4OH0 A;  3W4Q A;  1S0W A;  1FIK A;  3BRM A;  3V50 A;  4B4X A;  3CI6 A;  4O7D A;  2Q0O A;  4X25 A;  5JYO A;  1W63 Q;  3LFV A;  5A8B A;  3IWI A;  4KG5 A;  3DTM A;  2O9C A;  4OP5 A;  5HW3 A;  4G3K A;  1K6S A;  2VA0 A;  3VP2 A;  3T4Q A;  1K54 C;  2M7V A;  1V9Y A;  3IWO A;  1FCN A;  4OOY A;  2C6W B;  4CLC C;  2LB5 A;  4NEE D;  4E3I A;  4LRX C;  4EBN A;  3MS6 A;  5HL6 A;  2X01 A;  4LRZ E;  5CHJ A;  4JBF A;  2W1R A;  2ZC5 B;  2XSS A;  2BAS A;  4XUZ A;  5DF9 A;  3HVF A;  1JWV A;  4KG6 A;  2YKH A;  2QPN A;  5A93 A;  2Y2L A;  3BW6 A;  5TBM B;  3LR4 A;  2ZC6 B;  2DNS A;  3N8R A;  2V0U A;  2Z2M B;  3OC2 A;  1GSW A;  3A3F A;  5D3O A;  5FI2 A;  3D9Y A;  4MBH A;  1IEL A;  3GVB A;  3IX3 A;  2P9V A;  3NDG A;  1XA1 A;  2K2N A;  2CC1 A;  4MLL A;  2Y8H A;  3HBR A;  2VGL S;  4HJ6 A;  3HJK A;  4ESP A;  2ZL1 B;  3BEB A;  3UPN A;  3Q7V B;  3OBF A;  5HX9 A;  3NIA A;  3R4K A;  5CGX A;  2Z6C A;  4IED A;  3UMD A;  3QNB A;  2PBD P;  3DTI A;  2XA7 S;  3HUM A;  3L7H A;  3UB7 A;  4WMC D;  3LID A;  1F98 A;  4CLC D;  3QP5 A;  3ZCZ A;  3IQA A;  5BOH A;  3LY3 A;  2WZZ A;  3A3E A;  4WL9 A;  5FQK A;  4YIN A;  3C38 A;  4KZ8 A;  3C4P A;  5J8X A;  3HLD A;  3ZFZ A;  5MC7 A;  5CXW A;  1QMF A;  1UGU A;  3BFC A;  3TW8 A;  1VB6 A;  3RJU A;  1CJF A;  3D72 A;  3UME A;  1K54 A;  2ZLY A;  1TF1 A;  3VOZ A;  4K0W A;  5EVI B;  3M6B A;  1WE4 A;  3MQO A;  4G3V A;  3S1Y A;  2XK1 A;  4WMC A;  3FKW A;  3ZG0 A;  4CLC A;  5FI7 A;  2HDS A;  4WUJ A;  1KE3 A;  2B95 A;  4R38 A;  5EPH A;  2ZQA A;  2VGK A;  3SZT A;  5DJT A;  1G5U A;  4OVD A;  1KDW A;  4E3K A;  2VEA A;  3CMZ A;  2JKR M;  3P98 A;  2PU4 A;  3WS0 A;  4BBV A;  4BJP A;  4E3M A;  1DJA A;  1XJ4 A;  4OON A;  4H6J A;  1LL9 A;  1W63 M;  4GLQ A;  3MXS A;  2JKT I;  4GS9 A;  5G18 A;  3BYD A;  4LLO B;  5HDD A;  2VKS A;  4U0T A;  5AVF A;  2GX5 A;  5FDS A;  1GA9 A;  5KMW A;  1NJ4 A;  2GZA A;  2HDR A;  1YKD A;  2P04 A;  2J80 A;  5LBR A;  1BT5 A;  2VZW A;  4C75 A;  4JLF A;  1HTZ A;  5HSQ A;  4WYY A;  2QZ6 A;  4FSF A;  4GOG A;  4EEP A;  1GCE A;  2Y2H A;  3CPT B;  2WGV A;  3R7W B;  2QJ5 A;  3ITB A;  1PNE A;  4LPZ A;  5GLD A;  4PKY A;  1TS8 A;  3FG8 A;  3VMA A;  5TR7 A;  4ME4 A;  3AGE A;  4HEF A;  4EET B;  3JVU A;  4GJ4 A;  3JVV A;  1ONH A;  3HLF A;  3ZDJ A;  4P6B A;  3QNC A;  4DE0 A;  5DFY A;  5FA7 A;  2ZC7 A;  5A91 A;  1GHP A;  2NUP C;  2M7U A;  4JXW A;  5F6A A;  2E8I A;  2P9V B;  4Y7P A;  3NEC A;  3OPP A;  5A90 A;  1NXY A;  1OME A;  4BEN A;  3EEH A;  5DKL A;  3GV9 A;  2Y79 A;  4S2O A;  1DP6 A;  1W7F A;  1N9O A;  3IHB A;  2QHK A;  4I39 A;  3V5M A;  4JGR A;  1HVB A;  4AFI A;  1BLC A;  1IYP A;  5L2F A;  3NI9 A;  3P7N A;  2B18 A;  1ALQ A;  1ZKJ A;  4IUK A;  3FC7 A;  4OLG A;  4WEL A;  5EOO A;  2EFX A;  1VM1 A;  3AGD A;  4PM7 A;  1ES4 A;  3OZH A;  2VLG A;  1BLS A;  2UWX A;  2A2L A;  4PM5 A;  3CJM A;  3E4P A;  1T19 A;  3VE4 A;  2WKQ A;  5CTN A;  4EWF A;  4BQM A;  1QME A;  4ARZ B;  5FEF A;  2W1T B;  1M40 A;  3PR6 A;  3WRZ A;  4L9E A;  1YMS A;  3LY4 A;  4BL2 A;  3WWX A;  2JKF A;  1YSP A;  4N92 A;  1PI5 A;  1ODV A;  2ZC4 B;  2HJ9 C;  5M19 A;  4X68 A;  4F3L B;  3NOT C;  4GN2 A;  4PMA A;  1K57 C;  3UPP A;  4X1M A;  4OPZ A;  3RH8 B;  2ZMA A;  1C3B A;  3EGX C;  4MNR A;  2O99 A;  3WS1 A;  3E98 A;  5J7E A;  3B3X A;  4P0M A;  1GHI A;  4L9F A;  1S1Z A;  4QPR A;  4NXG A;  2ZQD A;  3FPV A;  3IXG A;  3E2L A;  2OLU A;  4S2J A;  3SS3 A;  3MQ0 A;  5EVI C;  5AVE A;  2ZOI A;  4R1G A;  4KEN B;  3P09 A;  1KGG A;  2W3F A;  1NYM A;  4MCW A;  2PYR A;  1FCO A;  3KYZ A;  3WS2 A;  1XFN A;  1PYY A;  2V1B A;  1FR6 A;  2B02 A;  2Y2Q A;  3UB8 A;  2J9P A;  1OJ5 A;  1BUL A;  4QY5 A;  5TBM A;  3LYX A;  1OT9 A;  3IBJ A;  1I5Q A;  1P0Z A;  4UA9 A;  4N1X A;  2VV6 A;  4EER A;  4DMZ A;  3NDE A;  4Y17 A;  1X0O A;  2JN7 A;  3SS4 A;  3T1R A;  3ZYT A;  1LSX A;  3BQ8 A;  1IYQ A;  4IBR A;  2EX2 A;  3C30 A;  2HJE A;  3UDX A;  3G32 A;  1MWS A;  4GD8 A;  1ZTU A;  3N8L A;  3ULF A;  1T1B A;  2ZL1 A;  1Y4O A;  3LO7 A;  2XRN A;  3Q7V A;  3BFF A;  5HD5 A;  3D4F A;  5HDC A;  4PPR A;  2P7J A;  5HWW A;  2KOI A;  5K5B A;  4K08 A;  4DE3 A;  3IH9 A;  1L3L A;  1IYO A;  1KVL A;  1J9M A;  3N4I A;  4NG2 A;  4RX3 A;  4MN6 A;  2WAE A;  1ONG A;  1SHV A;  1RCJ A;  4GHI B;  3HUN A;  2KLI A;  3V39 A;  4EQ1 A;  3RFB A;  2ZC3 B;  5EVI D;  4JXS A;  1XJ6 A;  2W0N A;  3LEZ A;  2Y91 A;  2JKR I;  4R3J A;  3ZNY A;  4Z9Q A;  3MXQ A;  4ETZ A;  1PI4 A;  4BD1 A;  4MN7 A;  4EBL A;  1IYS A;  3ZHH A;  1FSW A;  2WK0 A;  3IH8 A;  4LRY C;  4EBP A;  3JPU A;  2ZM2 A;  4S2M A;  4ZJ1 A;  3UY6 A;  4OOM A;  3VSL A;  2XR0 A;  5GLC A;  1YLY A;  1TD5 A;  2EWV A;  5EVL A;  5HL1 A;  1MKI A;  4DF6 A;  1K0K A;  2Y2I A;  2A24 A;  4KUK A;  3C2W A;  3U4L P;  4GW9 A;  4MMN A;  4QU3 A;  3MFX A;  4GKU A;  5EVI A;  4Q0J A;  2DCF A;  4DXC A;  4JXV A;  1XPB A;  4JF4 A;  3Q7Z A;  5CER A;  2HP5 A;  1I2S A;  1KGE A;  2R9W A;  1SKO B;  2OV5 A;  5I5L A;  4WZ4 A;  5FQI A;  4EQI A;  2RCX A;  3IX8 A;  4FUW A;  5DF8 A;  4DN0 A;  4R3A A;  1GSX A;  1MWT A;  5DFX A;  2PRF A;  3BM6 A;  3A3J A;  3O5Y A;  2AVX A;  5GLB A;  3HLW A;  1SDE A;  3G35 A;  3LR3 A;  4C6Y A;  5HAI A;  1LI0 A;  3NC8 A;  1BSG A;  1XJ3 A;  2Y2P A;  2V9A A;  4PM6 A;  2B5R A;  3W4O A;  3ZGA B;  3DTE A;  4PM8 A;  2PD7 A;  4LEN A;  1LT0 A;  3O3V A;  3E0Y A;  3W8K A;  3HJI A;  2Y2K A;  1VQQ A;  4HIA A;  3HRE A;  3KX0 X;  2HZ5 A;  1BTL A;  3CPT A;  4ZTK A;  3Q82 A;  3R7W A;  4F94 A;  4IVI A;  5EVE A;  1YMX A;  4HY8 A;  4O01 A;  3FYZ A;  4KZ9 A;  2UV0 E;  1E3U D;  5HDS A;  4I3J A;  3PBO A;  3MMH A;  3CHW P;  5CHU A;  1ESI A;  4X1L A;  1OJG A;  1XX2 A;  1WYC A;  4S2I A;  3S4X A;  1ES2 A;  2FFF B;  2V8F A;  4XT2 B;  2WKR A;  1NRJ A;  1MPL A;  2FH5 A;  1TDL A;  2PAV P;  1UWP X;  4GDN A;  3OOV A;  1VEU B;  3SH9 A;  1FOF A;  1BZA A;  1YLT A;  2XLN A;  1E3U A;  2G2U A;  3RXW A;  5EM1 A;  3CIT A;  2ZMV A;  3GEC A;  1J3W A;  3EQV A;  2HGV A;  3F1O B;  2H10 A;  4WN5 A;  2OWJ A;  4Y13 A;  4JKT A;  4I3I A;  1H0M A;  1YT4 A;  5CEB A;  1FIL A;  3QP6 A;  3BLS A;  4E3N A;  3K3C A;  2OAQ 1;  2H0T A;  4WLA A;  4RYE A;  1W5D A;  5F1F A;  1IEM A;  3F1P B;  5CED A;  3NOP C;  5CX7 A;  2JC7 A;  4ARZ A;  2W1T A;  1ACF A;  4ZAM A;  3SOI A;  5E2G A;  2QJ7 A;  3HLB A;  2W3G A;  5A92 A;  3GTC A;  1JTG A;  4R23 A;  1MBL A;  3IXD A;  2XF3 A;  4WM9 A;  3ICY A;  2L1M A;  4CPK A;  4RA7 A;  4HES A;  3EEA A;  3GMW A;  2ZQC A;  4NXB A;  4F3L A;  3PHY A;  3KSH A;  4NXF A;  5HAR A;  2FZ0 A;  3ZVT A;  4KQD A;  2A24 B;  3BLM A;  3E4O A;  3JYI A;  1N9B A;  4UA7 A;  5FAS A;  1NRF A;  5F1G A;  4EES A;  2DMW A;  3K3D A;  1ERO A;  5FQ9 A;  4HQA A;  4JXG A;  1DY6 A;  1NZU A;  2BG1 A;  4DXB A;  1V9Z A;  1BLH A;  5DF7 A;  2EXB A;  2V1Z A;  5KZH A;  1IKI A;  3O86 A;  2XD5 A;  2ZJ9 A;  1JWZ A;  4I38 A;  1PIO A;  4HOI A;  3OLO A;  5F68 A;  3MR0 A;  4RQ9 A;  4WZ5 C;  3IT9 A;  3MJQ A;  3RXX A;  2I72 A;  2WYX A;  2OOL A;  1L0E A;  4DJ3 A;  4EUZ A;  4UEY A;  3HLC A;  3NHQ A;  1S4R A;  3DWK A;  4Q8I A;  3FWL A;  4P85 A;  5CRF A;  2IWC A;  5DTS A;  2V0W A;  1K38 A;  3KSI A;  1LSV A;  4L0L A;  5G4Y A;  2EA9 A;  4E04 A;  4E6W A;  3UO9 A;  4P6Z S;  3QP1 A;  4WF0 A;  2W3E A;  5HAQ A;  3LIE A;  4LCM A;  4Q0I A;  1VET B;  4N9L A;  4Y0U A;  2OAP 1;  1S6R A;  2INW A;  1JWP A;  3B42 A;  3B47 A;  1MZU A;  4OQ0 A;  3G6O A;  5CEC A;  4U0X A;  1H8Z A;  1JTD A;  4PAU A;  3PBN A;  3FV7 A;  2ZOH A;  4OPR A;  1N9N A;  1TDG A;  2IWB A;  1F2K A;  3ISG A;  3GDI A;  2E8J A;  4JGQ A;  4QJG A;  1SCW A;  4WEJ A;  5C5K A;  3ZG8 B;  4QWO A;  4GHI A;  3U2A A;  2VGJ A;  1K4F A;  1P97 A;  2ACG A;  3UB9 A;  4Q0H A;  5CGW A;  3O87 A;  3FPW A;  3IHA A;  1XA7 A;  2Y2N A;  3C5A A;  2X71 A;  3C4O A;  3DTK A;  2GDN A;  2GNX A;  3F1N B;  1HLU P;  2XFT A;  1BLP A;  4UQI S;  3TRC A;  3HL9 A;  2LB9 A;  4LV0 A;  4RVA A;  4OPY A;  3S7Q A;  2WKP A;  3S7P A;  1JNU A;  4NKP A;  4IBX A;  3PBS A;  1EWZ A;  2PHY A;  1N9L A;  1XGI A;  3AGF A;  3T4K A;  3HUO A;  4QB8 A;  1XP4 A;  4S2L A;  4Y2F A;  5G4Z A;  1VHM A;  3H9W A;  3E4Q A;  2VGL M;  1S4S A;  5J4E A;  3C7U A;  1DP9 A;  4UHU A;  3MKE A;  4S2K A;  1W79 A;  2WKE A;  1SKO A;  2DRW A;  2OWH A;  1NWZ A;  1L0G A;  5L10 A;  3G4P A;  4WZ5 A;  1LLB A;  2Y59 A;  3N6I A;  4BD0 A;  2W3H A;  4EUV A;  2HV1 A;  4B9O A;  3HLG A;  2PBY A;  2XH9 A;  3M6H A;  1M6K A;  3BJN A;  4BL3 A;  1D1J A;  3UB5 P;  2XA7 M;  5EM0 A;  2RL3 A;  1CF0 A;  3IS2 B;  4KUO A;  2Y2G A;  1SKF A;  3G30 A;  2Y2J A;  4JPM A;  1LI9 A;  1K56 D;  4O8G A;  4QHC A;  3T4T A;  1OTA A;  2EX9 A;  1L2S A;  1Y28 A;  5GHY A;  1S1Y A;  2VV8 A;  2O9B A;  4M4X A;  3BEC A;  2WKH A;  2WUQ A;  3GSG A;  3LGO A;  4R70 A;  2V20 A;  2V1A A;  5DTT A;  4Y3I A;  2Y2O A;  3OCL A;  4R4R A;  5L07 A;  4ID4 A;  4S2P A;  5E43 A;  2ZQ7 A;  3EGD C;  3MXR A;  5HD3 A;  1PFL A;  3H82 B;  1K56 A;  4X55 A;  5EFW A;  1UWN X;  3BFE A;  4CJN A;  4XT2 A;  3T4J A;  2JBF A;  1HZO A;  2PR6 A;  2OLV A;  3B33 A;  3PXP A;  1VEU A;  1H3Q A;  1Z09 A;  3IXH A;  3LIC A;  4LCL A;  4OLD A;  1T1A A;  4NK3 A;  3CWF A;  1D7E A;  1BYW A;  3NBL A;  5GL9 A;  4MDZ A;  1A0K A;  4OKP A;  1YLZ A;  5HPI A;  4K91 A;  5AQ9 A;  5TJJ A;  3F1O A;  1PWG A;  3VV4 A;  4HBU A;  2PDR A;  3UNW A;  2PD8 A;  3BY8 A;  1NY0 A;  1ERQ A;  3V3R A;  3NY4 A;  2BTF P;  3QP2 A;  2HP9 A;  2K31 A;  1G6O A;  5DJU A;  3F1P A;  2HF6 A;  4DDY A;  4Y0T A;  4PM9 A;  1H8M A;  3OPL A;  3LCE A;  1P9W A;  4ETX A;  1KE4 A;  1LL5 A;  2XDM A;  5F69 A;  1O7E A;  1WA9 A;  3TJZ C;  3IWQ A;  3G31 A;  4ZDX A;  1ZC2 A;  4B4Z A;  3LUQ A;  5M1A A;  5FQQ A;  2CMN A;  1K55 C;  3LIA A;  2WZX A;  4EXO A;  4NET A;  5U47 A;  1W8Q A;  2J9O A;  5HAP A;  4LGW A;  1EW0 A;  3KYE A;  1ESU A;  3LIF A;  4YFM A;  5IT5 A;  5HFO A;  5HPF A;  3BFD A;  2GJ3 A;  4KZA A;  3IXB A;  4MBK A;  1GHM A;  2KDK A;  5F83 A;  1K25 A;  4DJ2 A;  4OQH A;  3PTE A;  4L9G A;  2V8C A;  3T50 A;  4EW7 A;  3L9K A;  4CQH A;  1FSY A;  4XXR A;  4MEZ A;  3G2Z A;  3VFF A;  1YM1 A;  1E25 A;  4HH3 A;  3UE0 A;  4KZB A;  4R6L A;  2PYP A;  1PW1 A;  4R0Q A;  4E3L A;  1DP8 A;  1ZHH B;  3DAV A;  4PHT A;  3LR0 A;  1HD8 A;  3UPO A;  4DKI A;  1XFQ A;  4BBU A;  1T1C A;  4HJ3 A;  3Q07 A;  2WGW B;  4K0X A;  5FAT A;  3PBT A;  4R3B A;  2JHE A;  4S2N C;  3T4S A;  4ZRR A;  2VK3 A;  2J3T C;  5GLA A;  2EFU A;  5F82 A;  3H7W B;  3TE8 A;  2G2W A;  3EOI A;  1STZ A;  2QKP A;  4X6T A;  1TVF A;  2D02 A;  2BLS A;  1E4D A;  3IF6 A;  3TOI A;  1VET A;  2PT7 A;  2EX8 A;  4EV4 A;  2HP6 A;  1XKZ A;  3PBR A;  4II7 A;  1G28 A;  5FSR A;  1FCM A;  3MSH A;  1CEF A;  1NLZ A;  4IUH A;  1H5X A;  2MJ6 A;  4EU0 A;  4RX2 A;  3LI8 A;  1RGY A;  4XUX A;  4HH2 A;  3UN7 A;  4R4S A;  1SDN A;  3OPH A;  1GSV A;  2XD1 A;  2K7S A;  1XJ2 A;  2D01 A;  4D60 A;  4E6X A;  1L0F A;  4FCF A;  4MBF A;  1EI5 A;  4OQG A;  1K55 A;  4WBG A;  1U60 A;  5AQ7 A;  2J7V A;  3F1N A;  3T12 B;  1OTD A;  3V3S A;  1PWD A;  1MXO A;  5CHM A;  5FAO A;  4C3Q A;  1YSQ A;  4G3W A;  3KO6 A;  2EX6 A;  1T18 A;  3PYP A;  3HCY A;  5EOE A;  5FDH A;  2JE5 A;  4X53 A;  3CAX A;  4DE2 A;  4BBT A;  3C7V A;  2J3T D;  3DBA A;  5L8M A;  2IWD A;  3UDI A;  3N8S A;  4Z1W A;  2ZMF A;  5EV0 A;  2P74 A;  1OTE A;  4OPQ A;  4GDB A;  3Q1F A;  4Y5F A;  4KQR A;  1ERM A;  2I9V A;  5EEC A;  4N1H A;  4BWI A;  1MKM A;  1IOU A;  1ES3 A;  3G2Y A;  3PAG A;  4EEU A;  1RP5 A;  4OOL A;  4JGO A;  4KZ6 A;  4S2N A;  5E2E A;  3A3D A;  4NXE A;  3VP1 A;  4IJG A;  3S7N A;  4M3K A;  2XRO A;  2J8Y A;  2JCH A;  3MZF A;  3ZG7 B;  5I94 A;  5EE8 A;  3UDF A;  3IS2 A;  3ZG5 A;  3ZNT A;  2Q9M A;  3CUE C;  3VOL A;  5GHZ A;  3WS5 A;  3ITA A;  1MWU A;  5L09 A;  5KIZ A;  3E2K A;  1ES5 A;  4KZ7 A;  5HWV A;  1XXM A;  2OSU A;  2PU2 A;  1PWC A;  4B88 A;  4CLC E;  4FH2 A;  5FI6 A;  4UAA A;  1GA0 A;  3S22 A;  5IHV A;  3G34 A;  4JF6 A;  5HZH A;  1YLW A;  3SW1 A;  3SH7 A;  2XEP A;  5GHX A;  5KSC A;  5KSH A;  3MZE A;  4GD6 A;  2QWS A;  3PAE A;  5FEG A;  2HPB A;  4FH4 A;  3OCN A;  2ZQ9 A;  3MKF A;  4ZJ3 A;  1F5M A;  3I7J A;  4IHQ A;  3QP8 A;  3A0V A;  4KZ3 A;  2P08 A;  3H82 A;  4E3O A;  5AJG A;  2V2F F;  4KZ4 A;  4KZ5 A;  3MBZ A;  2VV7 A;  3T4L A;  3M2J A;  1CK3 A;  4FOF A;  1O07 A;  1OTB A;  1D06 A;  3IF6 B;  1NLY A;  2QMI A;  4MN5 A;  4Y15 A;  4QD4 A;  4LFU A;  2XFS A;  1BUE A;  1MC0 A;  1PW8 A;  4X69 A;  5FQJ A;  1KOU A;  3VP4 A;  4DE1 A;  2ZM8 A;  2G7U A;  3NUL A;  5FL3 A;  4X56 A;  3S7O A;  1TS6 A;  4U3T A;  1CI8 A;  1Y54 A;  3MF0 A;  1KGF A;  2XGN A;  3NJA A;  2C5W B;  1FR1 A;  3BWL A;  3QHY A;  3WS4 A;  4HP9 A;  5IU1 A;  4I3A A;  2JKG A;  5HWT A;  1IKG A;  3QP4 A;  3KYQ A;  3VFH A;  1CQA A;  1ZG6 A;  2QYB A;  1CI9 A;  4YOF A;  2ZBB A;  3UE1 A;  1SZV A;  1KE0 A;  2HDQ A;  5TFQ A;  2ZM0 A;  1S67 L;  3CLO A;  5FAQ A;  4PKY G;  4QY6 A;  1WYB A;  4JF5 A;  3VOY A;  1RGZ A;  3VP0 A;  3LI9 A;  4FTX A;  3D3O A;  2XQZ A;  3BFG A;  1Z6F A;  3CUE A;  1KDS A;  1JVJ A;  2YKF A;  5J3W A;  2Z2L B;  2WAF A;  3ZVW A;  2Z6D A;  4DDS A;  1AXB A;  1DRM A;  5CTM A;  4HNB A;  3T1Q B;  4HBT A;  1OTI A;  4D2O A;  3KSG A;  1G68 A;  4I5S A;  3C8C A;  1N4O A;  4N9K A;  4KG2 A;  2KX6 A;  4KQO A;  4KQQ A;  5F5Y A;  5TGF A;  2A49 A;  2R78 A;  4ZJ2 A;  1MY8 A;  3CG5 A;  1Q2P A;  1AWI A;  3DWZ A;  4LV3 A;  2IA2 A;  2Q9N A;  1NYY A;  4LV1 A;  4HP4 A;  1H8Y A;  4WEK A;  3FKV A;  3Q81 A;  4UA6 A;  5EUA A;  3TG9 A;  1F9I A;  2WGW A;  3WRT A;  4CLC B;  2EWW A;  4GB7 A;  4YNR A;  2H0Y A;  4HI4 A;  4P87 A;  3W2Z A;  3T4O A;  1YLP A;  3VP3 A;  3NCK A;  3MZD A;  2VJW A;  1TS7 A;  3VE3 A;  3BQA A;  5DTK A;  5FQM A;  4E3J A;  2H5S A;  2A3U A;  2ZD8 A;  3H7W A;  3RTY A;  4JGP A;  3T1X A;  1YAX A;  3CZD A;  2W27 A;  5IS1 A;  4HHD A;  1OT6 A;  1YPR A;  4GZB A;  2WAD A;  4H6J B;  1Q2Q A;  4GNU A;  3SS5 A;  4GS9 B;  1XGJ A;  1TS0 A;  3FZC A;  3GR2 A;  5E2H A;  3TSG A;  3OPR A;  3LEQ A;  5AQB A;  2O9A A;  3LIB A; 
#chains in the Genus database with same CATH homology
 4OQI A;  1BLC A;  1IYP A;  1HD8 A;  5HAR A;  4DKI A;  4FD8 A;  3UPO A;  3Q07 A;  5DVA A;  5L2F A;  1DJC A;  2WGW B;  3NI9 A;  3ZVT A;  4K0X A;  5FAT A;  3GQZ A;  1ALQ A;  3BLM A;  3JYI A;  3PBT A;  4R3B A;  1N9B A;  4UA7 A;  1YQS A;  4S2N C;  5FAS A;  3GRJ A;  4DRT A;  1ZKJ A;  1NRF A;  5GLA A;  5F1G A;  1MWR A;  2HDU A;  4OLG A;  2EFU A;  4WEL A;  5EOO A;  2EFX A;  1VM1 A;  2Y4A A;  3AGD A;  5F82 A;  1ERO A;  4PM7 A;  2G2W A;  1ES4 A;  3OZH A;  5FQ9 A;  4X6T A;  2FFY A;  1BLS A;  2Y55 A;  2UWX A;  4JXG A;  1DY6 A;  1PZP A;  1NZU A;  1TVF A;  3DW0 A;  1KVM A;  2BG1 A;  3IF6 C;  4LV2 A;  4PM5 A;  4DXB A;  2BLS A;  4ZBE A;  1E4D A;  3CJM A;  1BLH A;  3IF6 A;  3TOI A;  5DF7 A;  5CTN A;  4EWF A;  1DJB A;  4BQM A;  1QME A;  2EXB A;  2EX8 A;  4EV4 A;  1FQG A;  2HP6 A;  2EXA A;  2X02 A;  2V1Z A;  1TEM A;  5KZH A;  2R9X A;  1XKZ A;  1W8Y A;  1M40 A;  3PBR A;  1L0D A;  3WRZ A;  3ZG9 B;  2ZQ8 A;  1IKI A;  5FSR A;  2WKI A;  1YMS A;  3LY4 A;  3O86 A;  5AQA A;  4BL2 A;  3WWX A;  1FCM A;  2XD5 A;  2ZJ9 A;  3VSK A;  1CEF A;  4N92 A;  1JWZ A;  1H5X A;  1PIO A;  1PI5 A;  4RX2 A;  1YLJ A;  2ZC4 B;  1RGY A;  4XUX A;  1NZO A;  3UN7 A;  1I2W A;  5M19 A;  4WZ5 C;  4R4S A;  1LHY A;  1SDN A;  3OPH A;  3IT9 A;  2XD1 A;  4X68 A;  3RXX A;  2I72 A;  2WYX A;  5KSC A;  4GN2 A;  4PMA A;  1L0E A;  4IVK A;  4E6X A;  1L0F A;  3O88 A;  1K57 C;  4EUZ A;  3UPP A;  3HLC A;  4FCF A;  4MBF A;  1K57 A;  3M2K A;  1EI5 A;  4OQG A;  4OPZ A;  5JYP A;  2ZMA A;  1C3B A;  1K55 A;  3DWK A;  4Q8I A;  3FWL A;  4P85 A;  5CRF A;  4WBG A;  1U60 A;  5AQ7 A;  2IWC A;  2J7V A;  4MNR A;  5DTS A;  1K38 A;  2Y2M A;  1CEG A;  3N7W A;  3WS1 A;  4L0L A;  3SH8 A;  3EQU A;  3B3X A;  4P0M A;  3V3S A;  1GHI A;  1PWD A;  3UO9 A;  4E6W A;  1K4E A;  1MXO A;  5CHM A;  1K6R A;  5FAO A;  2WGI A;  4C3Q A;  3IF5 A;  3PBQ A;  5FAP A;  2ZQD A;  4H8R A;  5HAQ A;  3IXG A;  4BLM A;  2EX6 A;  4LCM A;  3E2L A;  4N9L A;  4Y0U A;  5EOE A;  3W4P A;  2OLU A;  1S6R A;  4S2J A;  5M18 A;  1JWP A;  5FDH A;  3SS3 A;  4OQ0 A;  5EVI C;  2JE5 A;  4X53 A;  4R1G A;  5CEC A;  4U0X A;  4DE2 A;  4KEN B;  1H8Z A;  3P09 A;  1JTD A;  3C7V A;  5CGS A;  3PBN A;  3FV7 A;  4OPR A;  1TDG A;  1KGG A;  2IWD A;  2IWB A;  3UDI A;  1NYM A;  1PZO A;  3ISG A;  4QJG A;  1SCW A;  3N8S A;  4Y0O A;  5E2F A;  3HLE A;  2P74 A;  1FCO A;  3MFD A;  4WEJ A;  3WS2 A;  4OPQ A;  1G6A A;  1PYY A;  3ZG8 B;  1FR6 A;  2Y2Q A;  4GDB A;  3UE3 A;  4A5R A;  2J9P A;  1BUL A;  3Q1F A;  1ZG4 A;  2VGJ A;  3A3I A;  1K4F A;  4KQR A;  4OP8 A;  1ERM A;  4QY5 A;  4OH0 A;  3W4Q A;  1S0W A;  1I5Q A;  3BRM A;  5CGW A;  3O87 A;  4UA9 A;  5EEC A;  3V50 A;  4B4X A;  4N1X A;  3IHA A;  4N1H A;  1XA7 A;  2Y2N A;  3C5A A;  2X71 A;  3C4O A;  4O7D A;  2GDN A;  1ES3 A;  3NDE A;  3G2Y A;  3PAG A;  5JYO A;  1RP5 A;  2XFT A;  1BLP A;  4OOL A;  3SS4 A;  3HL9 A;  4KZ6 A;  3IWI A;  4S2N A;  1IYQ A;  3DTM A;  4IBR A;  4KG5 A;  5E2E A;  3A3D A;  2EX2 A;  4OP5 A;  4LV0 A;  3VP1 A;  4RVA A;  4OPY A;  5HW3 A;  4M3K A;  1K6S A;  3UDX A;  3G32 A;  2J8Y A;  1MWS A;  2JCH A;  3MZF A;  3VP2 A;  4GD8 A;  3ZG7 B;  5I94 A;  1K54 C;  5EE8 A;  3UDF A;  4IBX A;  3N8L A;  1EWZ A;  3PBS A;  3ZG5 A;  3ZNT A;  2Q9M A;  3IWO A;  1XGI A;  1FCN A;  4OOY A;  3AGF A;  3LO7 A;  5GHZ A;  3HUO A;  3Q7V A;  3BFF A;  3WS5 A;  3D4F A;  2C6W B;  3ITA A;  4PPR A;  4QB8 A;  1XP4 A;  1MWU A;  4E3I A;  4S2L A;  4EBN A;  3E2K A;  1ES5 A;  4KZ7 A;  4DE3 A;  3IH9 A;  2X01 A;  1IYO A;  1KVL A;  1XXM A;  1J9M A;  2OSU A;  2PU2 A;  3N4I A;  5CHJ A;  1PWC A;  4B88 A;  4JBF A;  4RX3 A;  4FH2 A;  2ZC5 B;  5FI6 A;  3C7U A;  2WAE A;  1GA0 A;  4UAA A;  3S22 A;  4UHU A;  4XUZ A;  1ONG A;  3HVF A;  5DF9 A;  5IHV A;  3MKE A;  1SHV A;  3G34 A;  1RCJ A;  4JF6 A;  4S2K A;  1JWV A;  1W79 A;  2WKE A;  3HUN A;  4KG6 A;  2QPN A;  5A93 A;  2Y2L A;  1YLW A;  3V39 A;  3SH7 A;  2XEP A;  2DRW A;  5GHX A;  2ZC3 B;  5EVI D;  2ZC6 B;  3MZE A;  2DNS A;  4JXS A;  3N8R A;  4GD6 A;  3G4P A;  4WZ5 A;  1L0G A;  2Z2M B;  3LEZ A;  1LLB A;  2Y59 A;  2Y91 A;  3PAE A;  3OC2 A;  4R3J A;  3N6I A;  2HPB A;  4BD0 A;  4FH4 A;  3ZNY A;  3OCN A;  2ZQ9 A;  3MKF A;  4Z9Q A;  4ZJ3 A;  3A3F A;  3I7J A;  5D3O A;  1PI4 A;  3HLG A;  4BD1 A;  4EBL A;  1IYS A;  2PBY A;  2XH9 A;  5FI2 A;  4MBH A;  3M6H A;  1IEL A;  1M6K A;  3GVB A;  1FSW A;  2WK0 A;  4KZ3 A;  3ZHH A;  4BL3 A;  2P9V A;  3NDG A;  1XA1 A;  4E3O A;  3IH8 A;  2V2F F;  4MLL A;  2CC1 A;  4KZ4 A;  4KZ5 A;  3HBR A;  3MBZ A;  4EBP A;  3M2J A;  2RL3 A;  2ZM2 A;  4S2M A;  1CK3 A;  1O07 A;  4ZJ1 A;  2Y2G A;  4OOM A;  3UY6 A;  3VSL A;  2XR0 A;  5GLC A;  1YLY A;  3IF6 B;  3BEB A;  5EVL A;  1SKF A;  2QMI A;  3UPN A;  3Q7V B;  3G30 A;  2Y2J A;  5HL1 A;  1MKI A;  5HX9 A;  4QD4 A;  4JPM A;  3NIA A;  4DF6 A;  1LI9 A;  2XFS A;  1K56 D;  1BUE A;  2Y2I A;  4QHC A;  4QU3 A;  4GKU A;  5EVI A;  2EX9 A;  1L2S A;  2DCF A;  1PW8 A;  4DXC A;  4X69 A;  4JXV A;  5FQJ A;  5GHY A;  3VP4 A;  4DE1 A;  2ZM8 A;  1XPB A;  4JF4 A;  3Q7Z A;  4X56 A;  5CER A;  2HP5 A;  5CGX A;  4U3T A;  1I2S A;  1KGE A;  4IED A;  1CI8 A;  2R9W A;  1Y54 A;  3QNB A;  1KGF A;  3BEC A;  2OV5 A;  2XGN A;  2WKH A;  2WUQ A;  3GSG A;  2C5W B;  3HUM A;  1FR1 A;  4WZ4 A;  5FQI A;  2V20 A;  4EQI A;  3QHY A;  3WS4 A;  4WMC D;  5DTT A;  2RCX A;  2Y2O A;  3OCL A;  4R4R A;  4ID4 A;  1IKG A;  4S2P A;  2ZQ7 A;  5E43 A;  3ZCZ A;  3IQA A;  3VFH A;  5DF8 A;  5BOH A;  1ZG6 A;  3LY3 A;  1CI9 A;  2WZZ A;  1MWT A;  3A3E A;  3MXR A;  3BM6 A;  3A3J A;  5FQK A;  4YIN A;  3UE1 A;  1K56 A;  4X55 A;  4KZ8 A;  1KE0 A;  2HDQ A;  3BFE A;  4CJN A;  3C4P A;  5TFQ A;  2JBF A;  5J8X A;  2ZM0 A;  3HLD A;  3ZFZ A;  1HZO A;  5GLB A;  3HLW A;  1SDE A;  3G35 A;  5CXW A;  1QMF A;  2OLV A;  4C6Y A;  5HAI A;  1LI0 A;  5FAQ A;  3BFC A;  3NC8 A;  3IXH A;  1BSG A;  4LCL A;  2Y2P A;  4PM6 A;  4OLD A;  1WYB A;  4JF5 A;  4QY6 A;  3VOY A;  1RGZ A;  3RJU A;  3VP0 A;  2B5R A;  3W4O A;  1K54 A;  4NK3 A;  3ZGA B;  2ZLY A;  3VOZ A;  4PM8 A;  2XQZ A;  3BFG A;  4K0W A;  4LEN A;  1Z6F A;  3NBL A;  3M6B A;  1WE4 A;  1KDS A;  3O3V A;  5EVI B;  3W8K A;  1JVJ A;  5GL9 A;  2Z2L B;  2Y2K A;  2XK1 A;  4WMC A;  3S1Y A;  2WAF A;  3FKW A;  1VQQ A;  3ZG0 A;  4OKP A;  3ZVW A;  3HRE A;  4DDS A;  1YLZ A;  1AXB A;  1BTL A;  2HDS A;  4K91 A;  4ZTK A;  5FI7 A;  3Q82 A;  5CTM A;  5AQ9 A;  1KE3 A;  4F94 A;  4IVI A;  1PWG A;  1YMX A;  5EPH A;  4HBT A;  2ZQA A;  4D2O A;  4HBU A;  3UNW A;  1G68 A;  3FYZ A;  4KZ9 A;  1E3U D;  1N4O A;  2VGK A;  1NY0 A;  1ERQ A;  3PBO A;  3V3R A;  3NY4 A;  4N9K A;  2HP9 A;  5CHU A;  4KG2 A;  1ESI A;  5KSH A;  4OVD A;  4KQO A;  4KQQ A;  1KDW A;  5TGF A;  4E3K A;  1XX2 A;  4DDY A;  1WYC A;  2A49 A;  4Y0T A;  4PM9 A;  4S2I A;  4ZJ2 A;  1MY8 A;  1ES2 A;  3S4X A;  3CG5 A;  3CMZ A;  3OPL A;  3LCE A;  3P98 A;  2PU4 A;  1KE4 A;  3WS0 A;  2FFF B;  4BJP A;  1LL5 A;  1Q2P A;  2XDM A;  1MPL A;  4E3M A;  1DJA A;  4OON A;  1O7E A;  3DWZ A;  1LL9 A;  3IWQ A;  3G31 A;  1TDL A;  3MXS A;  4GDN A;  3BYD A;  4LV3 A;  5G18 A;  4ZDX A;  1ZC2 A;  2Q9N A;  4B4Z A;  3SH9 A;  4U0T A;  1NYY A;  1FOF A;  1BZA A;  4LV1 A;  1H8Y A;  1YLT A;  2XLN A;  1GA9 A;  5M1A A;  4WEK A;  5FQQ A;  3FKV A;  5KMW A;  1NJ4 A;  3Q81 A;  2HDR A;  1K55 C;  4UA6 A;  5EUA A;  2WZX A;  4NET A;  5U47 A;  1BT5 A;  1E3U A;  2G2U A;  1W8Q A;  2J9O A;  3TG9 A;  4C75 A;  5HAP A;  2WGW A;  4JLF A;  3RXW A;  1HTZ A;  4WYY A;  2QZ6 A;  3WRT A;  4FSF A;  4GOG A;  4GB7 A;  1GCE A;  2Y2H A;  2H0Y A;  4P87 A;  2WGV A;  1ESU A;  3EQV A;  1YLP A;  3VP3 A;  3NCK A;  2H10 A;  3ITB A;  4YFM A;  5HFO A;  3MZD A;  4JKT A;  5GLD A;  3BFD A;  5DTK A;  5FQM A;  4E3J A;  2H5S A;  2A3U A;  2ZD8 A;  4KZA A;  5TR7 A;  3VMA A;  3IXB A;  4MBK A;  1GHM A;  1YT4 A;  5CEB A;  3CZD A;  3AGE A;  3BLS A;  4HEF A;  4E3N A;  5F83 A;  2H0T A;  4RYE A;  1W5D A;  5F1F A;  1ONH A;  1K25 A;  3HLF A;  1IEM A;  3ZDJ A;  5CED A;  4OQH A;  4P6B A;  3QNC A;  2JC7 A;  3PTE A;  4DE0 A;  5FA7 A;  2ZC7 A;  1FSY A;  5A91 A;  4XXR A;  4ZAM A;  4GZB A;  4MEZ A;  3SOI A;  3G2Z A;  3VFF A;  1YM1 A;  1E25 A;  1GHP A;  5E2G A;  4JXW A;  3HLB A;  2WAD A;  1Q2Q A;  4GNU A;  2E8I A;  2P9V B;  3SS5 A;  4Y7P A;  5A92 A;  3GTC A;  1XGJ A;  3OPP A;  5A90 A;  3UE0 A;  4KZB A;  1JTG A;  1NXY A;  1OME A;  4BEN A;  4R23 A;  1MBL A;  3GV9 A;  3FZC A;  3GR2 A;  4S2O A;  3IXD A;  5E2H A;  3TSG A;  1W7F A;  3OPR A;  2XF3 A;  4WM9 A;  5AQB A;  3IHB A;  4CPK A;  1PW1 A;  4RA7 A;  4R0Q A;  4HES A;  4E3L A;  3GMW A;  2ZQC A;  3V5M A;  1HVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...