1KGGA

Structure of beta-lactamase glu166gln:asn170asp mutant
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYQIELDYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Relocation of the catalytic carboxylate group in class A beta-lactamase: the structure and function of the mutant enzyme Glu166-->Gln:Asn170-->Asp.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords PROTEIN (BETA-LACTAMASE)
total genus 93
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1999-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1kggA00
3IH8A 2XH9A 4ZJ3A 2C5WB 3IXDA 3UY6A 3ZGAB 1K4EA 4OPYA 3G32A 3MKFA 4IVIA 3IT9A 5FQIA 4LCLA 2A49A 2EX6A 1MWTA 4EQIA 5HAIA 4GD8A 2WADA 3O86A 2PU4A 3BFCA 4XUZA 1JTGA 1K6SA 1MWUA 5A92A 1BLCA 3GSGA 3ZNTA 4KZ4A 3VOZA 2JCHA 4IBXA 3VOYA 4RYEA 3VFHA 2ZQ9A 2UWXA 5TGFA 1PYYA 1GCEA 2Y2IA 5FSRA 3SS4A 2ZQ8A 4BL3A 4ZJ1A 1E25A 4JF6A 1KGFA 1VQQA 1XXMA 4OQ0A 4A5RA 1SDEA 1WYCA 4PPRA 1YMXA 2ZC5B 5CGWA 2XF3A 4YINA 5F82A 3VFFA 4X69A 5EVLA 2Q9NA 3VMAA 3HLGA 2H0YA 4GOGA 3WS5A 3SH8A 3FZCA 1ONHA 1DJBA 3CZDA 1LL9A 2EXAA 4LV2A 1BTLA 3IF5A 3OPLA 5AQ9A 3WS4A 3HUOA 2HDQA 1H5XA 3HLWA 3W4OA 1NRFA 4OQIA 1KE3A 2ZQ7A 4WELA 4E3LA 1JWZA 4KZ5A 3WWXA 5E2FA 4LV1A 4Q8IA 2ZD8A 3M2JA 1NYYA 4Y0OA 1HTZA 5FI7A 3FKWA 3N8LA 3DWKA 4IEDA 3BLSA 3P98A 4DE1A 2JE5A 2XFTA 4GB7A 2ZM0A 2WGVA 1RGZA 1K57A 3CJMA 4K91A 5EVIB 5CEDA 4X6TA 3SH9A 2J9OA 3Q82A 3TG9A 1CEGA 4QU3A 5M19A 3DW0A 1TDLA 1ERQA 3IQAA 5FQQA 3OCNA 3ZG7B 4RA7A 2JBFA 4OQHA 5FATA 4JXWA 5FDHA 1EROA 3AGDA 3VP0A 1ES3A 2B5RA 3BEBA 4KZ6A 5CXWA 5HAPA 2HDSA 3PBTA 4U0TA 5HFOA 4JXGA 4KENB 1H8ZA 3PBQA 4WZ4A 2HPBA 1JWVA 4DRTA 1FQGA 4N1HA 5DF8A 3HLEA 2OV5A 4C6YA 5HW3A 3VP3A 4DF6A 3N8RA 5GHYA 2DNSA 4L0LA 3ZG8B 4KZ3A 4S2NA 5F83A 4WBGA 4Z9QA 4LV3A 3D4FA 1YQSA 1NY0A 2WZXA 4OPQA 4WYYA 4DE2A 1GHPA 3M6BA 3OPRA 5BOHA 3UPPA 1JTDA 3M6HA 5JYPA 4OP8A 4EWFA 5FAQA 5M18A 4R1GA 1NZOA 4KZBA 1PW8A 3E2LA 5GL9A 1K6RA 3Q7VB 3EQUA 3TSGA 2X71A 5FAOA 1YLYA 4EBPA 4P6BA 1BLHA 3Q81A 3WRTA 4E3NA 1C3BA 3QNCA 4KQQA 2WGWB 1W79A 4E3OA 2XFSA 4N9LA 4WEKA 1YLJA 3NCKA 3C5AA 1KVLA 5CGSA 4C75A 4DE0A 4KZ8A 3N7WA 5F1FA 1MXOA 5HARA 1I5QA 2QPNA 3IF6B 5FQMA 3V50A 5CEBA 1W7FA 4E3IA 3WS1A 1PIOA 3GMWA 4BQMA 5AQAA 3ITBA 3NI9A 1YLTA 4QHCA 1G68A 3ZG9B 5JYOA 1K55A 2DCFA 4DXCA 2CC1A 4JBFA 4PMAA 5GHZA 2XDMA 2ZC4B 3HLFA 4UA9A 5IHVA 1Q2QA 5FA7A 3N4IA 1ESUA 2OLUA 1H8YA 1QMEA 3WS0A 3ZG0A 3ZFZA 4EBNA 3UDXA 4GDBA 3MXRA 4MBKA 4MBHA 3G34A 1SDNA 5A90A 4X56A 5CTNA 1SHVA 1QMFA 2HDRA 1SKFA 2IWDA 2WZZA 4JKTA 1IKIA 3PBOA 3BFDA 4F94A 1HVBA 4EBLA 4KG5A 4E6WA 1RGYA 1XA7A 3BM6A 3BFGA 3ZHHA 1L0FA 5FQKA 4WEJA 5M1AA 1G6AA 2XR0A 4KZ7A 1YMSA 3G31A 2XGNA 1S6RA 2R9WA 2ZLYA 5FASA 3HLBA 4BJPA 3UDIA 1YM1A 5TR7A 5DF9A 1ERMA 4K0XA 3ZCZA 1CK3A 1HD8A 3ZVWA 1MKIA 1IYOA 3VP4A 4GNUA 3SS3A 5EUAA 2Y55A 1SCWA 3RXXA 4MLLA 3GV9A 4R4SA 1I2WA 4HBUA 1FCNA 4KZ9A 1NZUA 3O87A 2J9PA 3G2ZA 4RX3A 4ZJ2A 1YLZA 3TOIA 3A3IA 1GHMA 5A93A 4JXVA 3Q07A 5E2GA 3UO9A 3LY4A 3WS2A 1MWRA 4OPRA 3LY3A 3ZNYA 4OOMA 3C4PA 4GN2A 4R3BA 2Y91A 4LV0A 1AXBA 4OVDA 4R23A 4NK3A 3DTMA 4S2JA 4S2MA 3MKEA 4XXRA 4HEFA 3NDEA 5EVIA 3VSKA 5EECA 4OP5A 2WKEA 1MY8A 3ZDJA 1O7EA 2HP5A 4B4XA 5FI2A 4ZTKA 1K54A 4JF5A 2ZC6B 3FYZA 5D3OA 5J8XA 2Y2OA 2JC7A 3B3XA 3FWLA 5U47A 4DE3A 4UHUA 1YLWA 1W8QA 4KG2A 5EVIC 2WGWA 5A91A 3HBRA 4QJGA 2ZQDA 2ZMAA 1N4OA 1ES4A 1FSWA 3IXHA 4PM6A 4QB8A 2ZQCA 2G2UA 1PW1A 5CECA 4S2LA 3RJUA 2ZQAA 2WKIA 2P74A 2HP6A 1EI5A 4UAAA 2XD5A 5DF7A 3VSLA 2ZC3B 2J7VA 2XQZA 1S0WA 3LEZA 3MBZA 1ZC2A 1K38A 5CERA 4ZBEA 3N8SA 5GLCA 3NIAA 3UE1A 3IXGA 3MZDA 1NYMA 4KQOA 4JF4A 1FCMA 1K56D 1PWDA 1O07A 2R9XA 3BFEA 4D2OA 4S2IA 1ESIA 1K4FA 1LI0A 3PTEA 5EOOA 4JLFA 5CHJA 4X55A 1KGEA 3PBRA 5AQ7A 3IWOA 1K25A 2A3UA 3W4PA 3A3DA 1ES5A 4U0XA 3ZVTA 5DVAA 4XUXA 1XKZA 3S1YA 2WYXA 4B4ZA 4ZDXA 2P9VA 5GHXA 5KSHA 4BD0A 5CHUA 3EQVA 4OOLA 4E3MA 4KZAA 3MZEA 1MWSA 2XD1A 2PU2A 4OLDA 4DKIA 4S2PA 1XX2A 3MXSA 4QD4A 1FOFA 5FAPA 5CRFA 4QY5A 2H10A 1K56A 1LI9A 4NETA 2IWBA 4OOYA 4O7DA 2HDUA 3HUMA 3IF6C 3E2KA 3IWQA 1HZOA 4GDNA 4PM5A 3PAGA 1ALQA 3A3JA 4HBTA 1E3UD 4S2KA 4UA6A 2WUQA 3GRJA 3V3SA 1Q2PA 2I72A 3AGEA 3LCEA 1NJ4A 3IWIA 3NDGA 4DDYA 5AQBA 3QNBA 5FQJA 4PM7A 3UN7A 4OLGA 1U60A 3A3EA 3A3FA 3M2KA 4MNRA 1JVJA 3C7VA 1N9BA 3ISGA 5DTTA 4P87A 4IBRA 4MEZA 3GQZA 1L2SA 2BG1A 4OPZA 3UPNA 4FSFA 1LLBA 1DJCA 3PAEA 5GLDA 5E43A 3RXWA 3OZHA 4R4RA 3Q7VA 4PM8A 5TFQA 4UA7A 2Y2JA 3BLMA 4YFMA 1PZOA 1GA9A 2XK1A 4JPMA 3GTCA 4B88A 4JXSA 1PI5A 2E8IA 2ZM2A 4R3JA 1YLPA 3G35A 2VGJA 1DY6A 1ZG4A 3V3RA 1KE0A 4EV4A 2ZJ9A 3UPOA 1YT4A 3AGFA 2EX8A 1XGIA 3CMZA 4X68A 1ZG6A 5KMWA 3DWZA 4FH4A 1XP4A 3P09A 3G2YA 4OKPA 2V2FF 2HP9A 3OPPA 2Z2MB 2Y59A 2PBYA 2H0TA 1IYQA 5HX9A 4QY6A 3HLDA 2C6WB 1LHYA 1TDGA 2EX2A 3BFFA 4ZAMA 4P85A 2RCXA 4MBFA 4PM9A 1XA1A 2P9VB 1ES2A 2OLVA 2QZ6A 4KG6A 1Y54A 4WM9A 5GLAA 3W4QA 2EFUA 3SS5A 3G4PA 3V5MA 2J8YA 5EVID 5FQ9A 5KSCA 2WKHA 3UE3A 5GLBA 1FR6A 3ITAA 1RP5A 2Y2PA 5FI6A 4E6XA 3NY4A 3N6IA 2FFFB 3UE0A 5E2EA 1IYSA 5EE8A 2Y2GA 4GKUA 5HAQA 3IH9A 3O88A 4FH2A 4IVKA 1PWGA 1J9MA 2BLSA 3BECA 1GA0A 4P0MA 4S2NC 1JWPA 2QMIA 3GR2A 4X53A 2Y2NA 5KZHA 5L2FA 3JYIA 2EFXA 3O3VA 2X01A 4HESA 1BT5A 1CEFA 2ZM8A 1KDSA 1RCJA 1FSYA 4H8RA 4OONA 3Q7ZA 3CG5A 1KDWA 1VM1A 4S2OA 3IXBA 4E3JA 4C3QA 4Y0TA 4BD1A 3WRZA 1E4DA 2Z2LB 3GVBA 4LENA 1PWCA 4GD6A 4GZBA 4RVAA 4U3TA 3ZG5A 3MFDA 1W5DA 2GDNA 1W8YA 3UNWA 1IEMA 1TVFA 3BRMA 5CHMA 2WAFA 4CJNA 3UDFA 3OC2A 4WMCA 5I94A 2Y2LA 5F1GA 5CTMA 2Y2KA 4Y0UA 4Y7PA 3FV7A 5HL1A 3HUNA 4ID4A 1IKGA 1TEMA 1L0GA 3BYDA 1KGGA 1BZAA 3VP2A 1PZPA 1MBLA 2X02A 3VP1A 1BULA 4DXBA 3QHYA 1EWZA 1LL5A 1FCOA 1IYPA 1BSGA 5G18A 4BENA 3I7JA 4EUZA 3HLCA 1WE4A 2Y2HA 3HVFA 1BLSA 2V20A 3LO7A 3S22A 4N9KA 4BLMA 2VGKA 1FR1A 4FD8A 1OMEA 5E2HA 1M6KA 3C7UA 1WYBA 1XPBA 3G30A 2XLNA 2Y4AA 3SOIA 4K0WA 1K55C 5DTKA 3NBLA 2ZC7A 3IHAA 1NXYA 2EXBA 4OH0A 3OPHA 4OQGA 1I2SA 3FKVA 1ZKJA 5DTSA 2Q9MA 3Q1FA 4WMCD 5EPHA 1M40A 1KVMA 5EOEA 1E3UA 2Y2MA 3IHBA 4KQRA 4RX2A 1CI8A 2IWCA 1L0EA 1GHIA 3MZFA 3V39A 4CPKA 1BLPA 3IF6A 2WAEA 2WGIA 4N92A 4DDSA 1K54C 3W8KA 4WZ5A 1MPLA 4E3KA 3PBNA 2FFYA 1IELA 1L0DA 3PBSA 1CI9A 2WK0A 4LCMA 5CGXA 1ONGA 3OCLA 4R0QA 1K57C 3HL9A 3NC8A 4N1XA 3HREA 4M3KA 2V1ZA 4BL2A 1Z6FA 2EX9A 2Y2QA 3C4OA 4FCFA 4WZ5C 3SH7A 2DRWA 2G2WA 1BUEA 2XEPA 2OSUA 1DJAA 1KE4A 1PI4A 2RL3A 3S4XA 2H5SA 1XGJA
chains in the Genus database with same CATH superfamily
3IH8A 4YOFA 3T4JA 3ZGAB 4OPYA 4IVIA 1SKOB 5HDCA 2J3TD 4O0PA 4GS9B 5FQIA 1DP8A 2L0WA 4IHQA 2JKRM 1XJ3A 3BFCA 5A92A 3MR0A 4UQIM 2ZQ9A 3SS4A 2Y2IA 3EEAA 3H82A 1XXMA 4GW9A 4A5RA 1WYCA 2ZC5B 1W63Q 5F82A 3VFFA 5EVLA 2Q9NA 3VMAA 2H0YA 2QJ5A 3C30A 3UB5P 3OPLA 3D3OA 3HLWA 4WLAA 1T19A 4Q8IA 4LV1A 1TS8A 2JE5A 3CJMA 5CEDA 2ACGA 2J9OA 3TG9A 4QU3A 1V9ZA 5M19A 3DW0A 1T1CA 2DMWA 3OCNA 4OQHA 4HP9A 4JXWA 3AGDA 5DJTA 1TS0A 3D9YA 4KENB 3PBQA 1S4RA 2W1TB 3LIDA 4ESPA 4N1HA 5DF8A 3F1NA 5HW3A 3ZG8B 1OTAA 4LV3A 1NY0A 3M6BA 4HOIA 4JGPA 3UPPA 1S67L 3UB9A 5JYPA 4OP8A 4Z1WA 4R1GA 4GS9A 4LPZA 5FAOA 4P6BA 4HJ6A 4E3NA 3QNCA 4WEKA 3C5AA 5CGSA 4C75A 1LT0A 3N7WA 3CITA 1EW0A 1MXOA 5HARA 1J3WA 4E3IA 1PIOA 5A8BA 1YLTA 4KUOA 2IA2A 2JKTI 2ZC4B 3HLFA 1D7EA 1OTIA 3DAVA 1Q2QA 1ESUA 2OLUA 4EBNA 4GDBA 4MBHA 5CTNA 2WZZA 3BFDA 4F94A 4KG5A 1MKMA 3S7QA 1OTBA 3ZHHA 1L0FA 3NECA 4WEJA 5TBMB 5M1AA 3MJQA 3SW1A 1S6RA 2R9WA 3HLBA 4BJPA 5TR7A 2K2NA 1CK3A 3VP4A 4GNUA 3SS3A 4WUJA 3LIEA 3RXXA 1SCWA 3GV9A 4R4SA 2V0UA 4ZJ2A 2J80A 1GHMA 3MF0A 3Q07A 5E2GA 1MWRA 2G7UA 1MZUA 1AXBA 4OVDA 2BASA 3VSKA 4LFUA 3MKEA 3U2AA 4BBTA 4B4XA 5FI2A 4JF5A 2O9CA 3FYZA 3QP4A 1XFNA 1W8QA 3JVVA 2WGWA 2ZQDA 4HQAA 1N4OA 1KOUA 3IXHA 4QB8A 2FZ0A 2PBDP 1PW1A 4S2LA 2P74A 4GHIB 2ZC3B 1S0WA 1ZC2A 3N8SA 2LB9A 1NYMA 2D02A 4JF4A 1FCMA 1K56D 1Y4OA 3F1PA 3BFEA 4JLFA 4BBVA 4X55A 1XFQA 5AQ7A 3W4PA 5DVAA 4EETB 2P9VA 5GHXA 5KSHA 4KZAA 2XD1A 4OLDA 4DKIA 1XX2A 3EGXC 5KIZA 2IWBA 1LI9A 2XSSA 3GECA 3BQAA 4PKYG 3SZTA 2GX5A 4UA6A 2WUQA 3GRJA 1NJ4A 3QP8A 5HWTA 1G6OA 4NKPA 2WKPA 3ISGA 3LI9A 3GQZA 3MFXA 1T1AA 2W3HA 4L9FA 5IS1A 4FSFA 5E43A 4R4RA 4UA7A 2Y2JA 4YFMA 3QP5A 3GTCA 4JXSA 3W2ZA 3T1RA 3UE6A 1DY6A 3H7WB 1KE0A 3IS2A 4EV4A 2A2LA 1XGIA 3CMZA 5IT5A 1ZG6A 1XP4A 2O9AA 4CLCC 2Z2MB 2VV6A 4PKYA 3IX4A 4QY6A 3MQ0A 1LHYA 2PHYA 1P0ZA 2H28A 1OJGA 2VKSA 2L4RA 4H6JA 3W4QA 2EFUA 3G4PA 3V5MA 1T18A 3T4OA 3CUEC 2HJ9C 5FI6A 3NY4A 3N6IA 2EWVA 5FEGA 3UE0A 5L09A 2Y2GA 3IH9A 1PFLA 3O88A 4P0MA 3BECA 2BTFP 2XROA 3GR2A 4YNRA 4CLCD 2X01A 3TJZC 1KDSA 2K31A 1FSYA 3ULFA 3CHWP 3CG5A 5DKKA 4E3JA 4C3QA 1W5DA 2V1BA 4EERA 1CJFA 1TVFA 3BRMA 4CJNA 5I94A 4X25A 4Y7PA 3HUNA 1IKGA 1L0GA 3BYDA 1KGGA 1BZAA 1MBLA 1EWZA 1FCOA 3NJAA 3I7JA 2V20A 3JVUA 3LR0A 4BLMA 4FD8A 2OOLA 5E2HA 1WYBA 1XPBA 4K0WA 1YAXA 2V1AA 4YWZA 3RFBA 3IHAA 2UV0E 2EXBA 3PHYA 3OPHA 4Y15A 4OQGA 1ZKJA 3Q1FA 5EPHA 4DMZA 5EVEA 4MN7A 3UB7A 4RX2A 2IWCA 3DBAA 1GHIA 3V39A 3IF6A 2WAEA 4N92A 3T4QA 5C5KA 4WZ5A 4E3KA 1OT9A 2WK0A 4HP4A 4P6ZM 3R4KA 4M3KA 4BL2A 2DRWA 1PI4A 2RL3A 3EEHA 1XGJA 2C5WB 4WN5A 5J7EA 5MC7A 3E0YA 4LCLA 3UMDA 2A49A 4EQIA 5HAIA 2WADA 1P9RA 4XUZA 1JTGA 1K6SA 2YKFA 4KZ4A 2JCHA 3VOYA 3VFHA 2PRFA 4BL3A 1E25A 3LEQA 1KGFA 1VQQA 2A24A 1TS7A 1VETA 3RTYA 3WS5A 1F9IA 1DJBA 1LL9A 2EXAA 5AQ9A 3IF5A 3HUOA 2HDQA 1H5XA 3NOPC 3W4OA 1KE3A 5E2FA 1NYYA 3N8LA 4DE1A 4IEDA 3BLSA 3P98A 1S1YA 5EVIB 3SH9A 1CEGA 1NLZA 1TDLA 1ERQA 5FATA 4R38A 5FDHA 1TD5A 3VP0A 5HAPA 2HDSA 4U0TA 5HFOA 4JXGA 3EGDC 1X0OA 1JWVA 4DRTA 1XJ6A 2ZL1A 3HLEA 4C6YA 4S2NA 5F83A 2VZWA 1YQSA 5BOHA 3BY9A 3M6HA 3ICYA 1SKOA 1DP6A 5FAQA 4Y13A 3LICA 1PW8A 3E2LA 3EQUA 3TSGA 3H9WA 4KQQA 1W79A 4MN6A 1ODVA 4E3OA 1YLJA 3BQ8A 4MMNA 1UGUA 3H82B 3V50A 3IF6B 3MQOA 3U4LP 4BQMA 3LI8A 3ITBA 3NI9A 1G68A 2B02A 2CC1A 4ME4A 4CLCE 3HCYA 3QP2A 1H8YA 4FUWA 4IUKA 5A90A 3PBOA 4HHDA 4EW7A 3BM6A 2ZLYA 5HD3A 1YM1A 5DF9A 1T1BA 1LSWA 2D01A 4UQIS 1IYOA 5EUAA 2KLIA 2GZAA 4G3VA 1F2KA 3O87A 2J9PA 3TOIA 2NUTC 3WS2A 3LY3A 4OOMA 2PD8A 4R23A 3DTMA 4S2MA 4XXRA 5EVIA 4OP5A 1O7EA 2HP5A 2XA7M 1XJ4A 2ZBBA 4I5SA 4PAUA 5J8XA 2P04A 5A91A 4I38A 5L07A 3MQQA 3LR3A 4UAAA 3VV4A 1PRQA 4O01A 2J7VA 5CERA 2W3DA 4HH3A 2AVXA 3T50A 2VLGA 3UE1A 4D2OA 1Z09A 1ESIA 1K4FA 1LI0A 5EOOA 5CHJA 1GSWA 3G6OA 2GNXA 3PBRA 3IWOA 2A3UA 2OWHA 2V8CA 4XUXA 3EQVA 3MZEA 2PU2A 3NULA 3MXSA 4QD4A 5CRFA 3L9KA 2H10A 3DTEA 4I3IA 3E2KA 1HZOA 4PM5A 1ALQA 3A3JA 4S2KA 1Q2PA 4WF0A 2I72A 3IX3A 4DDYA 3NDGA 3IWIA 5AQBA 3T4LA 5FQJA 1U60A 2HJEA 3A3FA 4MNRA 1JVJA 5DFXA 3UB8A 4UEYA 2O0YA 1N9BA 4IBRA 1L2SA 1TF1A 3UPNA 3B47A 3RXWA 3OZHA 3BLMA 1PZOA 1VEUB 4EUVA 2PAVP 1YLPA 1ZG4A 2B95A 3V3RA 2ZJ9A 1N9NA 5KMWA 2INWA 4X1MA 3DWZA 3P09A 5AJGA 4OKPA 2Z6DA 4ARZB 3HLDA 3CI6A 1TDGA 4CLCA 3BFFA 4NXBA 4P85A 4PM9A 2P9VB 3VE3A 4WM9A 3SS5A 3LUQA 2J8YA 5FQ9A 3OBFA 3ITAA 2Y2PA 4E6XA 2A24B 2JKGA 1GA0A 4Y5FA 5L10A 3BY8A 4X53A 5KZHA 2EFXA 4HESA 4H8RA 2ZM8A 4R6LA 1RCJA 2R78A 4S2OA 3IXBA 3E98A 4BD1A 2ZOIA 4LENA 4GD6A 2GDNA 4JGRA 1IEMA 1P9WA 4WMCA 5CTMA 4EQ1A 4Y0UA 2V0WA 2JHEA 4F3LB 5HL1A 4LGWA 4B9OA 4ID4A 4HH2A 5F68A 4DXBA 1BULA 3QHYA 1BSGA 4BENA 5HWWA 1OPXA 1LSXA 3HVFA 1BLSA 3UB6A 1M6KA 2Y4AA 3SOIA 3IBRA 1S1ZA 3NBLA 3O5YA 3V67A 1I2SA 3FKVA 4WMCD 1M40A 4O8GA 2KX6A 1KVMA 1E3UA 3IHBA 1L0EA 3K3CA 5AVEA 3TRCA 3MZFA 4CPKA 1BLPA 1OTEA 3W8KA 1MPLA 2FFYA 1CI9A 5CGXA 4R0QA 3HREA 4FCFA 4WZ5C 3SH7A 2OSUA 3S4XA 4ZJ3A 3VE4A 3UY6A 1K4EA 3R7WB 3IT9A 2QWSA 1MWTA 3KSHA 3ZQ5A 2PU4A 1MWUA 3VOZA 4I3AA 4IBXA 1ZHHB 2ZOHA 4RYEA 1PYYA 1GCEA 5FSRA 2ZQ8A 4ZJ1A 4JF6A 4OQ0A 1SDEA 1YMXA 2XF3A 4X69A 3HLGA 3NOUC 4GOGA 3DTIA 3SH8A 3FZCA 3H7WA 1F5MA 1H0MA 2ZQ7A 1FILA 1JWZA 3WWXA 5HWVA 2ZD8A 3M2JA 3LIAA 3FKWA 3DWKA 3LFVA 1K57A 2W3EA 2M1CA 4X6TA 4F3LA 4E04A 1VB6A 4I3JA 5FQQA 3KSIA 3ZG7B 4RA7A 2JBFA 1EROA 5EM0A 2B5RA 3BEBA 2QYBA 5CXWA 5FDSA 4CQHA 3PBTA 4WZ4A 1FIKA 1FQGA 2VV8A 2PYPA 3N8RA 5GHYA 5J4EA 2DNSA 4L0LA 4EEUA 3F1PB 4WBGA 4ZRRA 4OPQA 4WYYA 1GHPA 2HZ5A 5M18A 1NZOA 1OTDA 2P08A 2VA0A 5GL9A 1K6RA 3KSGA 2X71A 1YLYA 1BLHA 2WGWB 1H8MA 4N9LA 2PR5A 5K5BA 4KZ8A 4ETXA 3T1QB 4G3WA 1HLUP 4HIAA 5F1FA 4QPRA 1I5QA 2QPNA 5CEBA 2VX8A 2QHKA 1W7FA 4GHIA 3LIBA 2J3WA 5IU1A 3ZG9B 1K55A 2DCFA 5G4ZA 4DXCA 3MMHA 4PMAA 2XDMA 4HJ4A 2MJ6A 3N4IA 3WS0A 3ZG0A 3ZFZA 3UDXA 4MBKA 3MXRA 5EFWA 1SHVA 1QMFA 1SKFA 1MC0A 4JKTA 4R3AA 1IKIA 2EWWA 4EBLA 4E6WA 4K08A 1OJ5A 5FQKA 1G6AA 2XR0A 3P01A 3E4OA 1ERMA 4K0XA 1N9LA 3ZCZA 2XA7S 3ZVWA 1MKIA 4BBUA 1W63M 2Y55A 3C2WA 3KX0X 1I2WA 3TE8A 2HV1A 1FCNA 4HBUA 1NLYA 1NZUA 4RX3A 1YLZA 5CX7A 4JXVA 4D60A 4OPRA 4JGOA 4R3BA 2Y91A 4LV0A 5GHZA 3NDEA 5EECA 2WKEA 2W1RA 1F98A 4ZTKA 2ZC6B 3B33A 1A0KA 2JC7A 3FWLA 2VGLM 4DE3A 3JPUA 4R70A 1PNEA 5FL3A 2HGVA 2ZMAA 1FSWA 3BJNA 3EOIA 1XJ2A 5CECA 3RJUA 2ZQAA 2WKIA 2XD5A 5DF7A 2WKQA 3VSLA 5F6AA 2Z6CA 2XQZA 1K38A 4Y17A 3CPTA 4DJ2A 2E8JA 3IXGA 1PWDA 1O07A 4S2IA 3KSFA 3FC7A 1KGEA 1K25A 3PYPA 5HL6A 3ZVTA 4NXGA 4B4ZA 4ZDXA 4OOLA 4E3MA 3FG8A 1MWSA 2Y79A 4S2PA 4QY5A 4NETA 1GSVA 3HUMA 3IWQA 3IS2B 3T4SA 4HBTA 3V3SA 3TW8A 1H3QA 3QNBA 2JKRI 4GCZA 4PM7A 4OLGA 4Q0JA 3A3EA 3C7VA 4RQ9A 3F1OB 2BG1A 4OPZA 2YKHA 5GLDA 3D72A 4Y3IA 3Q7VA 4IJGA 4PM8A 5TFQA 3ZYTA 4JPMA 1DP9A 4B88A 1BYWA 4KUKA 5DJUA 1PI5A 2E8IA 3HJIA 2VGJA 2VV7A 2W27A 3K2NA 2EX8A 4FH4A 2V2FF 2HP9A 3OPPA 2Y59A 2PBYA 4LRYC 5EM1A 4NEED 2P7JA 5HSQA 1IYQA 5HX9A 4XT2B 2C6WB 4PHTA 4QWOA 2LB5A 4ZAMA 2JKTM 1XA1A 1STZA 1ES2A 2OLVA 4KG6A 1Y54A 2WKRA 2VK3A 5KSCA 3LR5A 4FOFA 5EE8A 2W3FA 4NG2A 4IVKA 1PWGA 4S2NC 3CLOA 1JWPA 2QMIA 2Y2NA 1NRJA 5L2FA 3JYIA 4NXFA 5F69A 3O3VA 4AFIA 4MN5A 2L1MA 3E4QA 4OONA 1VM1A 2O9BA 4Y0TA 1E4DA 2Z2LB 1PWCA 4GZBA 4RVAA 1WA9A 1G28A 3KYEA 1W8YA 4LLOB 4Q0HA 3UNWA 2WAFA 3UDFA 2Y2KA 1YPRA 3MSHA 2X02A 1LL5A 1IYPA 4EUZA 1WE4A 2Y2HA 3LO7A 3S22A 4N9KA 2VGKA 1FR1A 2V9AA 3G30A 2ZL1B 5AVFA 1K55C 5DTKA 1NXYA 2OWJA 3EWKA 4OH0A 5DTSA 2Q9MA 1D1JA 4NXEA 3T12B 5EOEA 5DKLA 3HJKA 2WGIA 2M7VA 1K54C 3PBNA 4L9GA 1D06A 3KO6A 3LGOA 1K57C 3HL9A 4DN0A 2Y2QA 1DRMA 4X1LA 1KE4A 2H5SA 2XH9A 3IXDA 2B18A 3G32A 3MKFA 3MXQA 3LIFA 4B93A 2NUPC 4Y2FA 5L8MA 4BMWA 1K0KA 2EX6A 4GD8A 4XT2A 3GDIA 2PD7A 3O86A 1BLCA 3GSGA 2JKFA 1UWNX 3ZNTA 3BWLA 2PT7A 2K7SA 2UWXA 5TGFA 2O99A 4PPRA 5CGWA 4YINA 1VEUA 5I5LA 4HY8A 1ONHA 1S66L 3CZDA 4LV2A 1BTLA 3WS4A 1NRFA 4OQIA 4WELA 4E3LA 4KZ5A 3VOLA 5FI7A 4Y0OA 1HTZA 5HDDA 3CAXA 1CQAA 2XFTA 4GB7A 2ZM0A 2WGVA 1RGZA 4K91A 3Q82A 3IQAA 4Q0IA 3FPVA 2CMNA 1ES3A 4KZ6A 3C38A 1H8ZA 5TBMA 2HPBA 2OV5A 4ETZA 3VP3A 4DF6A 1CF0A 4KZ3A 4Z9QA 2PR6A 3R7WA 3D4FA 4DE2A 2WZXA 4BWIA 3OPRA 2VEAA 1JTDA 2VJWA 4EWFA 4KZBA 3Q7VB 5FEFA 1S4SA 4EBPA 3Q81A 4WL9A 3WRTA 1C3BA 1TS6A 2XFSA 3L7HA 2FH5A 3NCKA 1KVLA 4L9EA 2KOIA 4DE0A 2VGLS 5FQMA 3P7NA 2EA9A 4I39A 3WS1A 3GMWA 4HI4A 4JGQA 2OAP1 5AQAA 4QHCA 5JYOA 2W0NA 4JBFA 4UA9A 5IHVA 5G4YA 5FA7A 3RH8B 1QMEA 5HDSA 4H6JB 3G34A 1SDNA 2I9VA 4X56A 2HDRA 1YSQA 4M4XA 2IWDA 1HVBA 1RGYA 1XA7A 3BFGA 4KZ7A 1SZVA 1YMSA 3G31A 1LL8A 4DJ3A 2XGNA 5FASA 1Y28A 3UDIA 3A0VA 1HD8A 1ACFA 3KYQA 3A0RA 1VETB 3NOTC 4MLLA 3KYZA 4KZ9A 3G2ZA 1UWPX 3A3IA 3T4TA 5A93A 3UO9A 3LY4A 3ZNYA 3C4PA 4GN2A 4ARZA 4DDSA 4MDZA 4S2JA 4NK3A 4HEFA 2GJ3A 1MY8A 3ZDJA 3T1XA 1K54A 5D3OA 3T1SA 2ZMFA 2Y2OA 3B3XA 5U47A 4UHUA 1YLWA 4KG2A 5EVIC 4II7A 3HBRA 5HPFA 4QJGA 2ZMVA 1ES4A 4PM6A 2ZQCA 2G2UA 2HP6A 1EI5A 3F1NB 3OOVA 5TJJA 3LEZA 3MBZA 4ZBEA 4LRZE 5GLCA 3NIAA 3MZDA 4IUHA 4KQOA 2XRNA 2R9XA 1YKDA 3PTEA 5HZHA 1VHMA 3A3DA 5F5YA 1ES5A 4U0XA 1XKZA 3S1YA 2WYXA 4BD0A 5CHUA 1YSPA 1FOFA 5FAPA 1K56A 4KQDA 4OOYA 4O7DA 2HDUA 3PR6A 3IF6C 4GDNA 3PAGA 1E3UD 3NHQA 3AGEA 3LCEA 3CWFA 2QJ7A 3BW6A 3UN7A 2V8FA 3M2KA 5DTTA 4P87A 4MEZA 3S7OA 3A0SA 1N9OA 1LLBA 1DJCA 3PAEA 1AWIA 1GA9A 2XK1A 4FTXA 2ZM2A 4R3JA 3G35A 3UPOA 1YT4A 3AGFA 5HPIA 4X68A 1IOUA 3G2YA 3S7NA 3K3DA 5HD5A 4EU0A 2H0TA 1JNUA 2EX2A 2RCXA 4MBFA 1G5UA 5GLAA 2QZ6A 5EVID 3QP1A 2WKHA 2QKPA 3UE3A 5GLBA 1FR6A 1RP5A 3T4KA 2M7UA 4GJ4A 2FFFB 5E2EA 1IYSA 4GKUA 2PDRA 5HAQA 4FH2A 2BLSA 1J9MA 3CPTB 3MS6A 3LYXA 1BT5A 1CEFA 3Q7ZA 1KDWA 3F1OA 5J3WA 3WRZA 3GVBA 4G3KA 2KDKA 3PXPA 4U3TA 3ZG5A 4EXOA 1IFQA 3MFDA 3OLOA 3IBJA 4HJ3A 5CHMA 2HF6A 3QP6A 3OC2A 4EESA 4P6ZS 2Y2LA 5F1GA 1OT6A 3E4PA 3UMEA 3FV7A 2W1TA 2JN7A 2Y8HA 1TEMA 3VP2A 1PZPA 3VP1A 5LBRA 5G18A 3HLCA 1L3LA 3FPWA 1OMEA 3C7UA 2PYRA 1LSVA 2XLNA 4GLQA 2OAQ1 2ZC7A 1ZTUA 5EV0A 4HNBA 4MCWA 2J3TC 1NWZA 5DFYA 2Y2MA 1P97A 4KQRA 1CI8A 4CLCB 4LRXC 2Q0OA 3DTKA 3S7PA 3B42A 1V9YA 1IELA 1L0DA 3CUEA 3PBSA 4LCMA 1ONGA 3C8CA 3OCLA 3NC8A 4N1XA 2V1ZA 1Z6FA 2EX9A 3C4OA 1GSXA 2G2WA 4EEPA 1BUEA 2XEPA 3IX8A 1DJAA 2W3GA 3LR4A
chains in the Genus database with same CATH topology
3IH8A 2XH9A 4ZJ3A 2C5WB 3IXDA 3UY6A 3ZGAB 1K4EA 4OPYA 3G32A 3MKFA 4IVIA 3IT9A 5FQIA 4LCLA 2A49A 2EX6A 1MWTA 4EQIA 5HAIA 4GD8A 2WADA 3O86A 2PU4A 3BFCA 4XUZA 1JTGA 1K6SA 1MWUA 5A92A 1BLCA 3GSGA 3ZNTA 4KZ4A 3VOZA 2JCHA 4IBXA 3VOYA 4RYEA 3VFHA 2ZQ9A 2UWXA 5TGFA 1PYYA 1GCEA 2Y2IA 5FSRA 3SS4A 2ZQ8A 4BL3A 4ZJ1A 1E25A 4JF6A 1KGFA 1VQQA 1XXMA 4OQ0A 4A5RA 1SDEA 1WYCA 4PPRA 1YMXA 2ZC5B 5CGWA 2XF3A 4YINA 5F82A 3VFFA 4X69A 5EVLA 2Q9NA 3VMAA 3HLGA 2H0YA 4GOGA 3WS5A 3SH8A 3FZCA 1ONHA 1DJBA 3CZDA 1LL9A 2EXAA 4LV2A 1BTLA 3IF5A 3OPLA 5AQ9A 3WS4A 3HUOA 2HDQA 1H5XA 3HLWA 3W4OA 1NRFA 4OQIA 1KE3A 2ZQ7A 4WELA 4E3LA 1JWZA 4KZ5A 3WWXA 5E2FA 4LV1A 4Q8IA 2ZD8A 3M2JA 1NYYA 4Y0OA 1HTZA 5FI7A 3FKWA 3N8LA 3DWKA 4IEDA 3BLSA 3P98A 4DE1A 2JE5A 2XFTA 4GB7A 2ZM0A 2WGVA 1RGZA 1K57A 3CJMA 4K91A 5EVIB 5CEDA 4X6TA 3SH9A 2J9OA 3Q82A 3TG9A 1CEGA 4QU3A 5M19A 3DW0A 1TDLA 1ERQA 3IQAA 5FQQA 3OCNA 3ZG7B 4RA7A 2JBFA 4OQHA 5FATA 4JXWA 5FDHA 1EROA 3AGDA 3VP0A 1ES3A 2B5RA 3BEBA 4KZ6A 5CXWA 5HAPA 2HDSA 3PBTA 4U0TA 5HFOA 4JXGA 4KENB 1H8ZA 3PBQA 4WZ4A 2HPBA 1JWVA 4DRTA 1FQGA 4N1HA 5DF8A 3HLEA 2OV5A 4C6YA 5HW3A 3VP3A 4DF6A 3N8RA 5GHYA 2DNSA 4L0LA 3ZG8B 4KZ3A 4S2NA 5F83A 4WBGA 4Z9QA 4LV3A 3D4FA 1YQSA 1NY0A 2WZXA 4OPQA 4WYYA 4DE2A 1GHPA 3M6BA 3OPRA 5BOHA 3UPPA 1JTDA 3M6HA 5JYPA 4OP8A 4EWFA 5FAQA 5M18A 4R1GA 1NZOA 4KZBA 1PW8A 3E2LA 5GL9A 1K6RA 3Q7VB 3EQUA 3TSGA 2X71A 5FAOA 1YLYA 4EBPA 4P6BA 1BLHA 3Q81A 3WRTA 4E3NA 1C3BA 3QNCA 4KQQA 2WGWB 1W79A 4E3OA 2XFSA 4N9LA 4WEKA 1YLJA 3NCKA 3C5AA 1KVLA 5CGSA 4C75A 4DE0A 4KZ8A 3N7WA 5F1FA 1MXOA 5HARA 1I5QA 2QPNA 3IF6B 5FQMA 3V50A 5CEBA 1W7FA 4E3IA 3WS1A 1PIOA 3GMWA 4BQMA 5AQAA 3ITBA 3NI9A 1YLTA 4QHCA 1G68A 3ZG9B 5JYOA 1K55A 2DCFA 4DXCA 2CC1A 4JBFA 4PMAA 5GHZA 2XDMA 2ZC4B 3HLFA 4UA9A 5IHVA 1Q2QA 5FA7A 3N4IA 1ESUA 2OLUA 1H8YA 1QMEA 3WS0A 3ZG0A 3ZFZA 4EBNA 3UDXA 4GDBA 3MXRA 4MBKA 4MBHA 3G34A 1SDNA 5A90A 4X56A 5CTNA 1SHVA 1QMFA 2HDRA 1SKFA 2IWDA 2WZZA 4JKTA 1IKIA 3PBOA 3BFDA 4F94A 1HVBA 4EBLA 4KG5A 4E6WA 1RGYA 1XA7A 3BM6A 3BFGA 3ZHHA 1L0FA 5FQKA 4WEJA 5M1AA 1G6AA 2XR0A 4KZ7A 1YMSA 3G31A 2XGNA 1S6RA 2R9WA 2ZLYA 5FASA 3HLBA 4BJPA 3UDIA 1YM1A 5TR7A 5DF9A 1ERMA 4K0XA 3ZCZA 1CK3A 1HD8A 3ZVWA 1MKIA 1IYOA 3VP4A 4GNUA 3SS3A 5EUAA 2Y55A 1SCWA 3RXXA 4MLLA 3GV9A 4R4SA 1I2WA 4HBUA 1FCNA 4KZ9A 1NZUA 3O87A 2J9PA 3G2ZA 4RX3A 4ZJ2A 1YLZA 3TOIA 3A3IA 1GHMA 5A93A 4JXVA 3Q07A 5E2GA 3UO9A 3LY4A 3WS2A 1MWRA 4OPRA 3LY3A 3ZNYA 4OOMA 3C4PA 4GN2A 4R3BA 2Y91A 4LV0A 1AXBA 4OVDA 4R23A 4NK3A 3DTMA 4S2JA 4S2MA 3MKEA 4XXRA 4HEFA 3NDEA 5EVIA 3VSKA 5EECA 4OP5A 2WKEA 1MY8A 3ZDJA 1O7EA 2HP5A 4B4XA 5FI2A 4ZTKA 1K54A 4JF5A 2ZC6B 3FYZA 5D3OA 5J8XA 2Y2OA 2JC7A 3B3XA 3FWLA 5U47A 4DE3A 4UHUA 1YLWA 1W8QA 4KG2A 5EVIC 2WGWA 5A91A 3HBRA 4QJGA 2ZQDA 2ZMAA 1N4OA 1ES4A 1FSWA 3IXHA 4PM6A 4QB8A 2ZQCA 2G2UA 1PW1A 5CECA 4S2LA 3RJUA 2ZQAA 2WKIA 2P74A 2HP6A 1EI5A 4UAAA 2XD5A 5DF7A 3VSLA 2ZC3B 2J7VA 2XQZA 1S0WA 3LEZA 3MBZA 1ZC2A 1K38A 5CERA 4ZBEA 3N8SA 5GLCA 3NIAA 3UE1A 3IXGA 3MZDA 1NYMA 4KQOA 4JF4A 1FCMA 1K56D 1PWDA 1O07A 2R9XA 3BFEA 4D2OA 4S2IA 1ESIA 1K4FA 1LI0A 3PTEA 5EOOA 4JLFA 5CHJA 4X55A 1KGEA 3PBRA 5AQ7A 3IWOA 1K25A 2A3UA 3W4PA 3A3DA 1ES5A 4U0XA 3ZVTA 5DVAA 4XUXA 1XKZA 3S1YA 2WYXA 4B4ZA 4ZDXA 2P9VA 5GHXA 5KSHA 4BD0A 5CHUA 3EQVA 4OOLA 4E3MA 4KZAA 3MZEA 1MWSA 2XD1A 2PU2A 4OLDA 4DKIA 4S2PA 1XX2A 3MXSA 4QD4A 1FOFA 5FAPA 5CRFA 4QY5A 2H10A 1K56A 1LI9A 4NETA 2IWBA 4OOYA 4O7DA 2HDUA 3HUMA 3IF6C 3E2KA 3IWQA 1HZOA 4GDNA 4PM5A 3PAGA 1ALQA 3A3JA 4HBTA 1E3UD 4S2KA 4UA6A 2WUQA 3GRJA 3V3SA 1Q2PA 2I72A 3AGEA 3LCEA 1NJ4A 3IWIA 3NDGA 4DDYA 5AQBA 3QNBA 5FQJA 4PM7A 3UN7A 4OLGA 1U60A 3A3EA 3A3FA 3M2KA 4MNRA 1JVJA 3C7VA 1N9BA 3ISGA 5DTTA 4P87A 4IBRA 4MEZA 3GQZA 1L2SA 2BG1A 4OPZA 3UPNA 4FSFA 1LLBA 1DJCA 3PAEA 5GLDA 5E43A 3RXWA 3OZHA 4R4RA 3Q7VA 4PM8A 5TFQA 4UA7A 2Y2JA 3BLMA 4YFMA 1PZOA 1GA9A 2XK1A 4JPMA 3GTCA 4B88A 4JXSA 1PI5A 2E8IA 2ZM2A 4R3JA 1YLPA 3G35A 2VGJA 1DY6A 1ZG4A 3V3RA 1KE0A 4EV4A 2ZJ9A 3UPOA 1YT4A 3AGFA 2EX8A 1XGIA 3CMZA 4X68A 1ZG6A 5KMWA 3DWZA 4FH4A 1XP4A 3P09A 3G2YA 4OKPA 2V2FF 2HP9A 3OPPA 2Z2MB 2Y59A 2PBYA 2H0TA 1IYQA 5HX9A 4QY6A 3HLDA 2C6WB 1LHYA 1TDGA 2EX2A 3BFFA 4ZAMA 4P85A 2RCXA 4MBFA 4PM9A 1XA1A 2P9VB 1ES2A 2OLVA 2QZ6A 4KG6A 1Y54A 4WM9A 5GLAA 3W4QA 2EFUA 3SS5A 3G4PA 3V5MA 2J8YA 5EVID 5FQ9A 5KSCA 2WKHA 3UE3A 5GLBA 1FR6A 3ITAA 1RP5A 2Y2PA 5FI6A 4E6XA 3NY4A 3N6IA 2FFFB 3UE0A 5E2EA 1IYSA 5EE8A 2Y2GA 4GKUA 5HAQA 3IH9A 3O88A 4FH2A 4IVKA 1PWGA 1J9MA 2BLSA 3BECA 1GA0A 4P0MA 4S2NC 1JWPA 2QMIA 3GR2A 4X53A 2Y2NA 5KZHA 5L2FA 3JYIA 2EFXA 3O3VA 2X01A 4HESA 1BT5A 1CEFA 2ZM8A 1KDSA 1RCJA 1FSYA 4H8RA 4OONA 3Q7ZA 3CG5A 1KDWA 1VM1A 4S2OA 3IXBA 4E3JA 4C3QA 4Y0TA 4BD1A 3WRZA 1E4DA 2Z2LB 3GVBA 4LENA 1PWCA 4GD6A 4GZBA 4RVAA 4U3TA 3ZG5A 3MFDA 1W5DA 2GDNA 1W8YA 3UNWA 1IEMA 1TVFA 3BRMA 5CHMA 2WAFA 4CJNA 3UDFA 3OC2A 4WMCA 5I94A 2Y2LA 5F1GA 5CTMA 2Y2KA 4Y0UA 4Y7PA 3FV7A 5HL1A 3HUNA 4ID4A 1IKGA 1TEMA 1L0GA 3BYDA 1KGGA 1BZAA 3VP2A 1PZPA 1MBLA 2X02A 3VP1A 1BULA 4DXBA 3QHYA 1EWZA 1LL5A 1FCOA 1IYPA 1BSGA 5G18A 4BENA 3I7JA 4EUZA 3HLCA 1WE4A 2Y2HA 3HVFA 1BLSA 2V20A 3LO7A 3S22A 4N9KA 4BLMA 2VGKA 1FR1A 4FD8A 1OMEA 5E2HA 1M6KA 3C7UA 1WYBA 1XPBA 3G30A 2XLNA 2Y4AA 3SOIA 4K0WA 1K55C 5DTKA 3NBLA 2ZC7A 3IHAA 1NXYA 2EXBA 4OH0A 3OPHA 4OQGA 1I2SA 3FKVA 1ZKJA 5DTSA 2Q9MA 3Q1FA 4WMCD 5EPHA 1M40A 1KVMA 5EOEA 1E3UA 2Y2MA 3IHBA 4KQRA 4RX2A 1CI8A 2IWCA 1L0EA 1GHIA 3MZFA 3V39A 4CPKA 1BLPA 3IF6A 2WAEA 2WGIA 4N92A 4DDSA 1K54C 3W8KA 4WZ5A 1MPLA 4E3KA 3PBNA 2FFYA 1IELA 1L0DA 3PBSA 1CI9A 2WK0A 4LCMA 5CGXA 1ONGA 3OCLA 4R0QA 1K57C 3HL9A 3NC8A 4N1XA 3HREA 4M3KA 2V1ZA 4BL2A 1Z6FA 2EX9A 2Y2QA 3C4OA 4FCFA 4WZ5C 3SH7A 2DRWA 2G2WA 1BUEA 2XEPA 2OSUA 1DJAA 1KE4A 1PI4A 2RL3A 3S4XA 2H5SA 1XGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH8 A;  2XH9 A;  4ZJ3 A;  2C5W B;  3IXD A;  3UY6 A;  3ZGA B;  1K4E A;  4OPY A;  3G32 A;  3MKF A;  4IVI A;  3IT9 A;  5FQI A;  4LCL A;  2A49 A;  2EX6 A;  1MWT A;  4EQI A;  5HAI A;  4GD8 A;  2WAD A;  3O86 A;  2PU4 A;  3BFC A;  4XUZ A;  1JTG A;  1K6S A;  1MWU A;  5A92 A;  1BLC A;  3GSG A;  3ZNT A;  4KZ4 A;  3VOZ A;  2JCH A;  4IBX A;  3VOY A;  4RYE A;  3VFH A;  2ZQ9 A;  2UWX A;  5TGF A;  1PYY A;  1GCE A;  2Y2I A;  5FSR A;  3SS4 A;  2ZQ8 A;  4BL3 A;  4ZJ1 A;  1E25 A;  4JF6 A;  1KGF A;  1VQQ A;  1XXM A;  4OQ0 A;  4A5R A;  1SDE A;  1WYC A;  4PPR A;  1YMX A;  2ZC5 B;  5CGW A;  2XF3 A;  4YIN A;  5F82 A;  3VFF A;  4X69 A;  5EVL A;  2Q9N A;  3VMA A;  3HLG A;  2H0Y A;  4GOG A;  3WS5 A;  3SH8 A;  3FZC A;  1ONH A;  1DJB A;  3CZD A;  1LL9 A;  2EXA A;  4LV2 A;  1BTL A;  3IF5 A;  3OPL A;  5AQ9 A;  3WS4 A;  3HUO A;  2HDQ A;  1H5X A;  3HLW A;  3W4O A;  1NRF A;  4OQI A;  1KE3 A;  2ZQ7 A;  4WEL A;  4E3L A;  1JWZ A;  4KZ5 A;  3WWX A;  5E2F A;  4LV1 A;  4Q8I A;  2ZD8 A;  3M2J A;  1NYY A;  4Y0O A;  1HTZ A;  5FI7 A;  3FKW A;  3N8L A;  3DWK A;  4IED A;  3BLS A;  3P98 A;  4DE1 A;  2JE5 A;  2XFT A;  4GB7 A;  2ZM0 A;  2WGV A;  1RGZ A;  1K57 A;  3CJM A;  4K91 A;  5EVI B;  5CED A;  4X6T A;  3SH9 A;  2J9O A;  3Q82 A;  3TG9 A;  1CEG A;  4QU3 A;  5M19 A;  3DW0 A;  1TDL A;  1ERQ A;  3IQA A;  5FQQ A;  3OCN A;  3ZG7 B;  4RA7 A;  2JBF A;  4OQH A;  5FAT A;  4JXW A;  5FDH A;  1ERO A;  3AGD A;  3VP0 A;  1ES3 A;  2B5R A;  3BEB A;  4KZ6 A;  5CXW A;  5HAP A;  2HDS A;  3PBT A;  4U0T A;  5HFO A;  4JXG A;  4KEN B;  1H8Z A;  3PBQ A;  4WZ4 A;  2HPB A;  1JWV A;  4DRT A;  1FQG A;  4N1H A;  5DF8 A;  3HLE A;  2OV5 A;  4C6Y A;  5HW3 A;  3VP3 A;  4DF6 A;  3N8R A;  5GHY A;  2DNS A;  4L0L A;  3ZG8 B;  4KZ3 A;  4S2N A;  5F83 A;  4WBG A;  4Z9Q A;  4LV3 A;  3D4F A;  1YQS A;  1NY0 A;  2WZX A;  4OPQ A;  4WYY A;  4DE2 A;  1GHP A;  3M6B A;  3OPR A;  5BOH A;  3UPP A;  1JTD A;  3M6H A;  5JYP A;  4OP8 A;  4EWF A;  5FAQ A;  5M18 A;  4R1G A;  1NZO A;  4KZB A;  1PW8 A;  3E2L A;  5GL9 A;  1K6R A;  3Q7V B;  3EQU A;  3TSG A;  2X71 A;  5FAO A;  1YLY A;  4EBP A;  4P6B A;  1BLH A;  3Q81 A;  3WRT A;  4E3N A;  1C3B A;  3QNC A;  4KQQ A;  2WGW B;  1W79 A;  4E3O A;  2XFS A;  4N9L A;  4WEK A;  1YLJ A;  3NCK A;  3C5A A;  1KVL A;  5CGS A;  4C75 A;  4DE0 A;  4KZ8 A;  3N7W A;  5F1F A;  1MXO A;  5HAR A;  1I5Q A;  2QPN A;  3IF6 B;  5FQM A;  3V50 A;  5CEB A;  1W7F A;  4E3I A;  3WS1 A;  1PIO A;  3GMW A;  4BQM A;  5AQA A;  3ITB A;  3NI9 A;  1YLT A;  4QHC A;  1G68 A;  3ZG9 B;  5JYO A;  1K55 A;  2DCF A;  4DXC A;  2CC1 A;  4JBF A;  4PMA A;  5GHZ A;  2XDM A;  2ZC4 B;  3HLF A;  4UA9 A;  5IHV A;  1Q2Q A;  5FA7 A;  3N4I A;  1ESU A;  2OLU A;  1H8Y A;  1QME A;  3WS0 A;  3ZG0 A;  3ZFZ A;  4EBN A;  3UDX A;  4GDB A;  3MXR A;  4MBK A;  4MBH A;  3G34 A;  1SDN A;  5A90 A;  4X56 A;  5CTN A;  1SHV A;  1QMF A;  2HDR A;  1SKF A;  2IWD A;  2WZZ A;  4JKT A;  1IKI A;  3PBO A;  3BFD A;  4F94 A;  1HVB A;  4EBL A;  4KG5 A;  4E6W A;  1RGY A;  1XA7 A;  3BM6 A;  3BFG A;  3ZHH A;  1L0F A;  5FQK A;  4WEJ A;  5M1A A;  1G6A A;  2XR0 A;  4KZ7 A;  1YMS A;  3G31 A;  2XGN A;  1S6R A;  2R9W A;  2ZLY A;  5FAS A;  3HLB A;  4BJP A;  3UDI A;  1YM1 A;  5TR7 A;  5DF9 A;  1ERM A;  4K0X A;  3ZCZ A;  1CK3 A;  1HD8 A;  3ZVW A;  1MKI A;  1IYO A;  3VP4 A;  4GNU A;  3SS3 A;  5EUA A;  2Y55 A;  1SCW A;  3RXX A;  4MLL A;  3GV9 A;  4R4S A;  1I2W A;  4HBU A;  1FCN A;  4KZ9 A;  1NZU A;  3O87 A;  2J9P A;  3G2Z A;  4RX3 A;  4ZJ2 A;  1YLZ A;  3TOI A;  3A3I A;  1GHM A;  5A93 A;  4JXV A;  3Q07 A;  5E2G A;  3UO9 A;  3LY4 A;  3WS2 A;  1MWR A;  4OPR A;  3LY3 A;  3ZNY A;  4OOM A;  3C4P A;  4GN2 A;  4R3B A;  2Y91 A;  4LV0 A;  1AXB A;  4OVD A;  4R23 A;  4NK3 A;  3DTM A;  4S2J A;  4S2M A;  3MKE A;  4XXR A;  4HEF A;  3NDE A;  5EVI A;  3VSK A;  5EEC A;  4OP5 A;  2WKE A;  1MY8 A;  3ZDJ A;  1O7E A;  2HP5 A;  4B4X A;  5FI2 A;  4ZTK A;  1K54 A;  4JF5 A;  2ZC6 B;  3FYZ A;  5D3O A;  5J8X A;  2Y2O A;  2JC7 A;  3B3X A;  3FWL A;  5U47 A;  4DE3 A;  4UHU A;  1YLW A;  1W8Q A;  4KG2 A;  5EVI C;  2WGW A;  5A91 A;  3HBR A;  4QJG A;  2ZQD A;  2ZMA A;  1N4O A;  1ES4 A;  1FSW A;  3IXH A;  4PM6 A;  4QB8 A;  2ZQC A;  2G2U A;  1PW1 A;  5CEC A;  4S2L A;  3RJU A;  2ZQA A;  2WKI A;  2P74 A;  2HP6 A;  1EI5 A;  4UAA A;  2XD5 A;  5DF7 A;  3VSL A;  2ZC3 B;  2J7V A;  2XQZ A;  1S0W A;  3LEZ A;  3MBZ A;  1ZC2 A;  1K38 A;  5CER A;  4ZBE A;  3N8S A;  5GLC A;  3NIA A;  3UE1 A;  3IXG A;  3MZD A;  1NYM A;  4KQO A;  4JF4 A;  1FCM A;  1K56 D;  1PWD A;  1O07 A;  2R9X A;  3BFE A;  4D2O A;  4S2I A;  1ESI A;  1K4F A;  1LI0 A;  3PTE A;  5EOO A;  4JLF A;  5CHJ A;  4X55 A;  1KGE A;  3PBR A;  5AQ7 A;  3IWO A;  1K25 A;  2A3U A;  3W4P A;  3A3D A;  1ES5 A;  4U0X A;  3ZVT A;  5DVA A;  4XUX A;  1XKZ A;  3S1Y A;  2WYX A;  4B4Z A;  4ZDX A;  2P9V A;  5GHX A;  5KSH A;  4BD0 A;  5CHU A;  3EQV A;  4OOL A;  4E3M A;  4KZA A;  3MZE A;  1MWS A;  2XD1 A;  2PU2 A;  4OLD A;  4DKI A;  4S2P A;  1XX2 A;  3MXS A;  4QD4 A;  1FOF A;  5FAP A;  5CRF A;  4QY5 A;  2H10 A;  1K56 A;  1LI9 A;  4NET A;  2IWB A;  4OOY A;  4O7D A;  2HDU A;  3HUM A;  3IF6 C;  3E2K A;  3IWQ A;  1HZO A;  4GDN A;  4PM5 A;  3PAG A;  1ALQ A;  3A3J A;  4HBT A;  1E3U D;  4S2K A;  4UA6 A;  2WUQ A;  3GRJ A;  3V3S A;  1Q2P A;  2I72 A;  3AGE A;  3LCE A;  1NJ4 A;  3IWI A;  3NDG A;  4DDY A;  5AQB A;  3QNB A;  5FQJ A;  4PM7 A;  3UN7 A;  4OLG A;  1U60 A;  3A3E A;  3A3F A;  3M2K A;  4MNR A;  1JVJ A;  3C7V A;  1N9B A;  3ISG A;  5DTT A;  4P87 A;  4IBR A;  4MEZ A;  3GQZ A;  1L2S A;  2BG1 A;  4OPZ A;  3UPN A;  4FSF A;  1LLB A;  1DJC A;  3PAE A;  5GLD A;  5E43 A;  3RXW A;  3OZH A;  4R4R A;  3Q7V A;  4PM8 A;  5TFQ A;  4UA7 A;  2Y2J A;  3BLM A;  4YFM A;  1PZO A;  1GA9 A;  2XK1 A;  4JPM A;  3GTC A;  4B88 A;  4JXS A;  1PI5 A;  2E8I A;  2ZM2 A;  4R3J A;  1YLP A;  3G35 A;  2VGJ A;  1DY6 A;  1ZG4 A;  3V3R A;  1KE0 A;  4EV4 A;  2ZJ9 A;  3UPO A;  1YT4 A;  3AGF A;  2EX8 A;  1XGI A;  3CMZ A;  4X68 A;  1ZG6 A;  5KMW A;  3DWZ A;  4FH4 A;  1XP4 A;  3P09 A;  3G2Y A;  4OKP A;  2V2F F;  2HP9 A;  3OPP A;  2Z2M B;  2Y59 A;  2PBY A;  2H0T A;  1IYQ A;  5HX9 A;  4QY6 A;  3HLD A;  2C6W B;  1LHY A;  1TDG A;  2EX2 A;  3BFF A;  4ZAM A;  4P85 A;  2RCX A;  4MBF A;  4PM9 A;  1XA1 A;  2P9V B;  1ES2 A;  2OLV A;  2QZ6 A;  4KG6 A;  1Y54 A;  4WM9 A;  5GLA A;  3W4Q A;  2EFU A;  3SS5 A;  3G4P A;  3V5M A;  2J8Y A;  5EVI D;  5FQ9 A;  5KSC A;  2WKH A;  3UE3 A;  5GLB A;  1FR6 A;  3ITA A;  1RP5 A;  2Y2P A;  5FI6 A;  4E6X A;  3NY4 A;  3N6I A;  2FFF B;  3UE0 A;  5E2E A;  1IYS A;  5EE8 A;  2Y2G A;  4GKU A;  5HAQ A;  3IH9 A;  3O88 A;  4FH2 A;  4IVK A;  1PWG A;  1J9M A;  2BLS A;  3BEC A;  1GA0 A;  4P0M A;  4S2N C;  1JWP A;  2QMI A;  3GR2 A;  4X53 A;  2Y2N A;  5KZH A;  5L2F A;  3JYI A;  2EFX A;  3O3V A;  2X01 A;  4HES A;  1BT5 A;  1CEF A;  2ZM8 A;  1KDS A;  1RCJ A;  1FSY A;  4H8R A;  4OON A;  3Q7Z A;  3CG5 A;  1KDW A;  1VM1 A;  4S2O A;  3IXB A;  4E3J A;  4C3Q A;  4Y0T A;  4BD1 A;  3WRZ A;  1E4D A;  2Z2L B;  3GVB A;  4LEN A;  1PWC A;  4GD6 A;  4GZB A;  4RVA A;  4U3T A;  3ZG5 A;  3MFD A;  1W5D A;  2GDN A;  1W8Y A;  3UNW A;  1IEM A;  1TVF A;  3BRM A;  5CHM A;  2WAF A;  4CJN A;  3UDF A;  3OC2 A;  4WMC A;  5I94 A;  2Y2L A;  5F1G A;  5CTM A;  2Y2K A;  4Y0U A;  4Y7P A;  3FV7 A;  5HL1 A;  3HUN A;  4ID4 A;  1IKG A;  1TEM A;  1L0G A;  3BYD A;  1KGG A;  1BZA A;  3VP2 A;  1PZP A;  1MBL A;  2X02 A;  3VP1 A;  1BUL A;  4DXB A;  3QHY A;  1EWZ A;  1LL5 A;  1FCO A;  1IYP A;  1BSG A;  5G18 A;  4BEN A;  3I7J A;  4EUZ A;  3HLC A;  1WE4 A;  2Y2H A;  3HVF A;  1BLS A;  2V20 A;  3LO7 A;  3S22 A;  4N9K A;  4BLM A;  2VGK A;  1FR1 A;  4FD8 A;  1OME A;  5E2H A;  1M6K A;  3C7U A;  1WYB A;  1XPB A;  3G30 A;  2XLN A;  2Y4A A;  3SOI A;  4K0W A;  1K55 C;  5DTK A;  3NBL A;  2ZC7 A;  3IHA A;  1NXY A;  2EXB A;  4OH0 A;  3OPH A;  4OQG A;  1I2S A;  3FKV A;  1ZKJ A;  5DTS A;  2Q9M A;  3Q1F A;  4WMC D;  5EPH A;  1M40 A;  1KVM A;  5EOE A;  1E3U A;  2Y2M A;  3IHB A;  4KQR A;  4RX2 A;  1CI8 A;  2IWC A;  1L0E A;  1GHI A;  3MZF A;  3V39 A;  4CPK A;  1BLP A;  3IF6 A;  2WAE A;  2WGI A;  4N92 A;  4DDS A;  1K54 C;  3W8K A;  4WZ5 A;  1MPL A;  4E3K A;  3PBN A;  2FFY A;  1IEL A;  1L0D A;  3PBS A;  1CI9 A;  2WK0 A;  4LCM A;  5CGX A;  1ONG A;  3OCL A;  4R0Q A;  1K57 C;  3HL9 A;  3NC8 A;  4N1X A;  3HRE A;  4M3K A;  2V1Z A;  4BL2 A;  1Z6F A;  2EX9 A;  2Y2Q A;  3C4O A;  4FCF A;  4WZ5 C;  3SH7 A;  2DRW A;  2G2W A;  1BUE A;  2XEP A;  2OSU A;  1DJA A;  1KE4 A;  1PI4 A;  2RL3 A;  3S4X A;  2H5S A;  1XGJ A; 
#chains in the Genus database with same CATH topology
 3IH8 A;  4YOF A;  3T4J A;  3ZGA B;  4OPY A;  4IVI A;  1SKO B;  5HDC A;  2J3T D;  4O0P A;  4GS9 B;  5FQI A;  1DP8 A;  2L0W A;  4IHQ A;  2JKR M;  1XJ3 A;  3BFC A;  5A92 A;  3MR0 A;  4UQI M;  2ZQ9 A;  3SS4 A;  2Y2I A;  3EEA A;  3H82 A;  1XXM A;  4GW9 A;  4A5R A;  1WYC A;  2ZC5 B;  1W63 Q;  5F82 A;  3VFF A;  5EVL A;  2Q9N A;  3VMA A;  2H0Y A;  2QJ5 A;  3C30 A;  3UB5 P;  3OPL A;  3D3O A;  3HLW A;  4WLA A;  1T19 A;  4Q8I A;  4LV1 A;  1TS8 A;  2JE5 A;  3CJM A;  5CED A;  2ACG A;  2J9O A;  3TG9 A;  4QU3 A;  1V9Z A;  5M19 A;  3DW0 A;  1T1C A;  2DMW A;  3OCN A;  4OQH A;  4HP9 A;  4JXW A;  3AGD A;  5DJT A;  1TS0 A;  3D9Y A;  4KEN B;  3PBQ A;  1S4R A;  2W1T B;  3LID A;  4ESP A;  4N1H A;  5DF8 A;  3F1N A;  5HW3 A;  3ZG8 B;  1OTA A;  4LV3 A;  1NY0 A;  3M6B A;  4HOI A;  4JGP A;  3UPP A;  1S67 L;  3UB9 A;  5JYP A;  4OP8 A;  4Z1W A;  4R1G A;  4GS9 A;  4LPZ A;  5FAO A;  4P6B A;  4HJ6 A;  4E3N A;  3QNC A;  4WEK A;  3C5A A;  5CGS A;  4C75 A;  1LT0 A;  3N7W A;  3CIT A;  1EW0 A;  1MXO A;  5HAR A;  1J3W A;  4E3I A;  1PIO A;  5A8B A;  1YLT A;  4KUO A;  2IA2 A;  2JKT I;  2ZC4 B;  3HLF A;  1D7E A;  1OTI A;  3DAV A;  1Q2Q A;  1ESU A;  2OLU A;  4EBN A;  4GDB A;  4MBH A;  5CTN A;  2WZZ A;  3BFD A;  4F94 A;  4KG5 A;  1MKM A;  3S7Q A;  1OTB A;  3ZHH A;  1L0F A;  3NEC A;  4WEJ A;  5TBM B;  5M1A A;  3MJQ A;  3SW1 A;  1S6R A;  2R9W A;  3HLB A;  4BJP A;  5TR7 A;  2K2N A;  1CK3 A;  3VP4 A;  4GNU A;  3SS3 A;  4WUJ A;  3LIE A;  3RXX A;  1SCW A;  3GV9 A;  4R4S A;  2V0U A;  4ZJ2 A;  2J80 A;  1GHM A;  3MF0 A;  3Q07 A;  5E2G A;  1MWR A;  2G7U A;  1MZU A;  1AXB A;  4OVD A;  2BAS A;  3VSK A;  4LFU A;  3MKE A;  3U2A A;  4BBT A;  4B4X A;  5FI2 A;  4JF5 A;  2O9C A;  3FYZ A;  3QP4 A;  1XFN A;  1W8Q A;  3JVV A;  2WGW A;  2ZQD A;  4HQA A;  1N4O A;  1KOU A;  3IXH A;  4QB8 A;  2FZ0 A;  2PBD P;  1PW1 A;  4S2L A;  2P74 A;  4GHI B;  2ZC3 B;  1S0W A;  1ZC2 A;  3N8S A;  2LB9 A;  1NYM A;  2D02 A;  4JF4 A;  1FCM A;  1K56 D;  1Y4O A;  3F1P A;  3BFE A;  4JLF A;  4BBV A;  4X55 A;  1XFQ A;  5AQ7 A;  3W4P A;  5DVA A;  4EET B;  2P9V A;  5GHX A;  5KSH A;  4KZA A;  2XD1 A;  4OLD A;  4DKI A;  1XX2 A;  3EGX C;  5KIZ A;  2IWB A;  1LI9 A;  2XSS A;  3GEC A;  3BQA A;  4PKY G;  3SZT A;  2GX5 A;  4UA6 A;  2WUQ A;  3GRJ A;  1NJ4 A;  3QP8 A;  5HWT A;  1G6O A;  4NKP A;  2WKP A;  3ISG A;  3LI9 A;  3GQZ A;  3MFX A;  1T1A A;  2W3H A;  4L9F A;  5IS1 A;  4FSF A;  5E43 A;  4R4R A;  4UA7 A;  2Y2J A;  4YFM A;  3QP5 A;  3GTC A;  4JXS A;  3W2Z A;  3T1R A;  3UE6 A;  1DY6 A;  3H7W B;  1KE0 A;  3IS2 A;  4EV4 A;  2A2L A;  1XGI A;  3CMZ A;  5IT5 A;  1ZG6 A;  1XP4 A;  2O9A A;  4CLC C;  2Z2M B;  2VV6 A;  4PKY A;  3IX4 A;  4QY6 A;  3MQ0 A;  1LHY A;  2PHY A;  1P0Z A;  2H28 A;  1OJG A;  2VKS A;  2L4R A;  4H6J A;  3W4Q A;  2EFU A;  3G4P A;  3V5M A;  1T18 A;  3T4O A;  3CUE C;  2HJ9 C;  5FI6 A;  3NY4 A;  3N6I A;  2EWV A;  5FEG A;  3UE0 A;  5L09 A;  2Y2G A;  3IH9 A;  1PFL A;  3O88 A;  4P0M A;  3BEC A;  2BTF P;  2XRO A;  3GR2 A;  4YNR A;  4CLC D;  2X01 A;  3TJZ C;  1KDS A;  2K31 A;  1FSY A;  3ULF A;  3CHW P;  3CG5 A;  5DKK A;  4E3J A;  4C3Q A;  1W5D A;  2V1B A;  4EER A;  1CJF A;  1TVF A;  3BRM A;  4CJN A;  5I94 A;  4X25 A;  4Y7P A;  3HUN A;  1IKG A;  1L0G A;  3BYD A;  1KGG A;  1BZA A;  1MBL A;  1EWZ A;  1FCO A;  3NJA A;  3I7J A;  2V20 A;  3JVU A;  3LR0 A;  4BLM A;  4FD8 A;  2OOL A;  5E2H A;  1WYB A;  1XPB A;  4K0W A;  1YAX A;  2V1A A;  4YWZ A;  3RFB A;  3IHA A;  2UV0 E;  2EXB A;  3PHY A;  3OPH A;  4Y15 A;  4OQG A;  1ZKJ A;  3Q1F A;  5EPH A;  4DMZ A;  5EVE A;  4MN7 A;  3UB7 A;  4RX2 A;  2IWC A;  3DBA A;  1GHI A;  3V39 A;  3IF6 A;  2WAE A;  4N92 A;  3T4Q A;  5C5K A;  4WZ5 A;  4E3K A;  1OT9 A;  2WK0 A;  4HP4 A;  4P6Z M;  3R4K A;  4M3K A;  4BL2 A;  2DRW A;  1PI4 A;  2RL3 A;  3EEH A;  1XGJ A;  2C5W B;  4WN5 A;  5J7E A;  5MC7 A;  3E0Y A;  4LCL A;  3UMD A;  2A49 A;  4EQI A;  5HAI A;  2WAD A;  1P9R A;  4XUZ A;  1JTG A;  1K6S A;  2YKF A;  4KZ4 A;  2JCH A;  3VOY A;  3VFH A;  2PRF A;  4BL3 A;  1E25 A;  3LEQ A;  1KGF A;  1VQQ A;  2A24 A;  1TS7 A;  1VET A;  3RTY A;  3WS5 A;  1F9I A;  1DJB A;  1LL9 A;  2EXA A;  5AQ9 A;  3IF5 A;  3HUO A;  2HDQ A;  1H5X A;  3NOP C;  3W4O A;  1KE3 A;  5E2F A;  1NYY A;  3N8L A;  4DE1 A;  4IED A;  3BLS A;  3P98 A;  1S1Y A;  5EVI B;  3SH9 A;  1CEG A;  1NLZ A;  1TDL A;  1ERQ A;  5FAT A;  4R38 A;  5FDH A;  1TD5 A;  3VP0 A;  5HAP A;  2HDS A;  4U0T A;  5HFO A;  4JXG A;  3EGD C;  1X0O A;  1JWV A;  4DRT A;  1XJ6 A;  2ZL1 A;  3HLE A;  4C6Y A;  4S2N A;  5F83 A;  2VZW A;  1YQS A;  5BOH A;  3BY9 A;  3M6H A;  3ICY A;  1SKO A;  1DP6 A;  5FAQ A;  4Y13 A;  3LIC A;  1PW8 A;  3E2L A;  3EQU A;  3TSG A;  3H9W A;  4KQQ A;  1W79 A;  4MN6 A;  1ODV A;  4E3O A;  1YLJ A;  3BQ8 A;  4MMN A;  1UGU A;  3H82 B;  3V50 A;  3IF6 B;  3MQO A;  3U4L P;  4BQM A;  3LI8 A;  3ITB A;  3NI9 A;  1G68 A;  2B02 A;  2CC1 A;  4ME4 A;  4CLC E;  3HCY A;  3QP2 A;  1H8Y A;  4FUW A;  4IUK A;  5A90 A;  3PBO A;  4HHD A;  4EW7 A;  3BM6 A;  2ZLY A;  5HD3 A;  1YM1 A;  5DF9 A;  1T1B A;  1LSW A;  2D01 A;  4UQI S;  1IYO A;  5EUA A;  2KLI A;  2GZA A;  4G3V A;  1F2K A;  3O87 A;  2J9P A;  3TOI A;  2NUT C;  3WS2 A;  3LY3 A;  4OOM A;  2PD8 A;  4R23 A;  3DTM A;  4S2M A;  4XXR A;  5EVI A;  4OP5 A;  1O7E A;  2HP5 A;  2XA7 M;  1XJ4 A;  2ZBB A;  4I5S A;  4PAU A;  5J8X A;  2P04 A;  5A91 A;  4I38 A;  5L07 A;  3MQQ A;  3LR3 A;  4UAA A;  3VV4 A;  1PRQ A;  4O01 A;  2J7V A;  5CER A;  2W3D A;  4HH3 A;  2AVX A;  3T50 A;  2VLG A;  3UE1 A;  4D2O A;  1Z09 A;  1ESI A;  1K4F A;  1LI0 A;  5EOO A;  5CHJ A;  1GSW A;  3G6O A;  2GNX A;  3PBR A;  3IWO A;  2A3U A;  2OWH A;  2V8C A;  4XUX A;  3EQV A;  3MZE A;  2PU2 A;  3NUL A;  3MXS A;  4QD4 A;  5CRF A;  3L9K A;  2H10 A;  3DTE A;  4I3I A;  3E2K A;  1HZO A;  4PM5 A;  1ALQ A;  3A3J A;  4S2K A;  1Q2P A;  4WF0 A;  2I72 A;  3IX3 A;  4DDY A;  3NDG A;  3IWI A;  5AQB A;  3T4L A;  5FQJ A;  1U60 A;  2HJE A;  3A3F A;  4MNR A;  1JVJ A;  5DFX A;  3UB8 A;  4UEY A;  2O0Y A;  1N9B A;  4IBR A;  1L2S A;  1TF1 A;  3UPN A;  3B47 A;  3RXW A;  3OZH A;  3BLM A;  1PZO A;  1VEU B;  4EUV A;  2PAV P;  1YLP A;  1ZG4 A;  2B95 A;  3V3R A;  2ZJ9 A;  1N9N A;  5KMW A;  2INW A;  4X1M A;  3DWZ A;  3P09 A;  5AJG A;  4OKP A;  2Z6D A;  4ARZ B;  3HLD A;  3CI6 A;  1TDG A;  4CLC A;  3BFF A;  4NXB A;  4P85 A;  4PM9 A;  2P9V B;  3VE3 A;  4WM9 A;  3SS5 A;  3LUQ A;  2J8Y A;  5FQ9 A;  3OBF A;  3ITA A;  2Y2P A;  4E6X A;  2A24 B;  2JKG A;  1GA0 A;  4Y5F A;  5L10 A;  3BY8 A;  4X53 A;  5KZH A;  2EFX A;  4HES A;  4H8R A;  2ZM8 A;  4R6L A;  1RCJ A;  2R78 A;  4S2O A;  3IXB A;  3E98 A;  4BD1 A;  2ZOI A;  4LEN A;  4GD6 A;  2GDN A;  4JGR A;  1IEM A;  1P9W A;  4WMC A;  5CTM A;  4EQ1 A;  4Y0U A;  2V0W A;  2JHE A;  4F3L B;  5HL1 A;  4LGW A;  4B9O A;  4ID4 A;  4HH2 A;  5F68 A;  4DXB A;  1BUL A;  3QHY A;  1BSG A;  4BEN A;  5HWW A;  1OPX A;  1LSX A;  3HVF A;  1BLS A;  3UB6 A;  1M6K A;  2Y4A A;  3SOI A;  3IBR A;  1S1Z A;  3NBL A;  3O5Y A;  3V67 A;  1I2S A;  3FKV A;  4WMC D;  1M40 A;  4O8G A;  2KX6 A;  1KVM A;  1E3U A;  3IHB A;  1L0E A;  3K3C A;  5AVE A;  3TRC A;  3MZF A;  4CPK A;  1BLP A;  1OTE A;  3W8K A;  1MPL A;  2FFY A;  1CI9 A;  5CGX A;  4R0Q A;  3HRE A;  4FCF A;  4WZ5 C;  3SH7 A;  2OSU A;  3S4X A;  4ZJ3 A;  3VE4 A;  3UY6 A;  1K4E A;  3R7W B;  3IT9 A;  2QWS A;  1MWT A;  3KSH A;  3ZQ5 A;  2PU4 A;  1MWU A;  3VOZ A;  4I3A A;  4IBX A;  1ZHH B;  2ZOH A;  4RYE A;  1PYY A;  1GCE A;  5FSR A;  2ZQ8 A;  4ZJ1 A;  4JF6 A;  4OQ0 A;  1SDE A;  1YMX A;  2XF3 A;  4X69 A;  3HLG A;  3NOU C;  4GOG A;  3DTI A;  3SH8 A;  3FZC A;  3H7W A;  1F5M A;  1H0M A;  2ZQ7 A;  1FIL A;  1JWZ A;  3WWX A;  5HWV A;  2ZD8 A;  3M2J A;  3LIA A;  3FKW A;  3DWK A;  3LFV A;  1K57 A;  2W3E A;  2M1C A;  4X6T A;  4F3L A;  4E04 A;  1VB6 A;  4I3J A;  5FQQ A;  3KSI A;  3ZG7 B;  4RA7 A;  2JBF A;  1ERO A;  5EM0 A;  2B5R A;  3BEB A;  2QYB A;  5CXW A;  5FDS A;  4CQH A;  3PBT A;  4WZ4 A;  1FIK A;  1FQG A;  2VV8 A;  2PYP A;  3N8R A;  5GHY A;  5J4E A;  2DNS A;  4L0L A;  4EEU A;  3F1P B;  4WBG A;  4ZRR A;  4OPQ A;  4WYY A;  1GHP A;  2HZ5 A;  5M18 A;  1NZO A;  1OTD A;  2P08 A;  2VA0 A;  5GL9 A;  1K6R A;  3KSG A;  2X71 A;  1YLY A;  1BLH A;  2WGW B;  1H8M A;  4N9L A;  2PR5 A;  5K5B A;  4KZ8 A;  4ETX A;  3T1Q B;  4G3W A;  1HLU P;  4HIA A;  5F1F A;  4QPR A;  1I5Q A;  2QPN A;  5CEB A;  2VX8 A;  2QHK A;  1W7F A;  4GHI A;  3LIB A;  2J3W A;  5IU1 A;  3ZG9 B;  1K55 A;  2DCF A;  5G4Z A;  4DXC A;  3MMH A;  4PMA A;  2XDM A;  4HJ4 A;  2MJ6 A;  3N4I A;  3WS0 A;  3ZG0 A;  3ZFZ A;  3UDX A;  4MBK A;  3MXR A;  5EFW A;  1SHV A;  1QMF A;  1SKF A;  1MC0 A;  4JKT A;  4R3A A;  1IKI A;  2EWW A;  4EBL A;  4E6W A;  4K08 A;  1OJ5 A;  5FQK A;  1G6A A;  2XR0 A;  3P01 A;  3E4O A;  1ERM A;  4K0X A;  1N9L A;  3ZCZ A;  2XA7 S;  3ZVW A;  1MKI A;  4BBU A;  1W63 M;  2Y55 A;  3C2W A;  3KX0 X;  1I2W A;  3TE8 A;  2HV1 A;  1FCN A;  4HBU A;  1NLY A;  1NZU A;  4RX3 A;  1YLZ A;  5CX7 A;  4JXV A;  4D60 A;  4OPR A;  4JGO A;  4R3B A;  2Y91 A;  4LV0 A;  5GHZ A;  3NDE A;  5EEC A;  2WKE A;  2W1R A;  1F98 A;  4ZTK A;  2ZC6 B;  3B33 A;  1A0K A;  2JC7 A;  3FWL A;  2VGL M;  4DE3 A;  3JPU A;  4R70 A;  1PNE A;  5FL3 A;  2HGV A;  2ZMA A;  1FSW A;  3BJN A;  3EOI A;  1XJ2 A;  5CEC A;  3RJU A;  2ZQA A;  2WKI A;  2XD5 A;  5DF7 A;  2WKQ A;  3VSL A;  5F6A A;  2Z6C A;  2XQZ A;  1K38 A;  4Y17 A;  3CPT A;  4DJ2 A;  2E8J A;  3IXG A;  1PWD A;  1O07 A;  4S2I A;  3KSF A;  3FC7 A;  1KGE A;  1K25 A;  3PYP A;  5HL6 A;  3ZVT A;  4NXG A;  4B4Z A;  4ZDX A;  4OOL A;  4E3M A;  3FG8 A;  1MWS A;  2Y79 A;  4S2P A;  4QY5 A;  4NET A;  1GSV A;  3HUM A;  3IWQ A;  3IS2 B;  3T4S A;  4HBT A;  3V3S A;  3TW8 A;  1H3Q A;  3QNB A;  2JKR I;  4GCZ A;  4PM7 A;  4OLG A;  4Q0J A;  3A3E A;  3C7V A;  4RQ9 A;  3F1O B;  2BG1 A;  4OPZ A;  2YKH A;  5GLD A;  3D72 A;  4Y3I A;  3Q7V A;  4IJG A;  4PM8 A;  5TFQ A;  3ZYT A;  4JPM A;  1DP9 A;  4B88 A;  1BYW A;  4KUK A;  5DJU A;  1PI5 A;  2E8I A;  3HJI A;  2VGJ A;  2VV7 A;  2W27 A;  3K2N A;  2EX8 A;  4FH4 A;  2V2F F;  2HP9 A;  3OPP A;  2Y59 A;  2PBY A;  4LRY C;  5EM1 A;  4NEE D;  2P7J A;  5HSQ A;  1IYQ A;  5HX9 A;  4XT2 B;  2C6W B;  4PHT A;  4QWO A;  2LB5 A;  4ZAM A;  2JKT M;  1XA1 A;  1STZ A;  1ES2 A;  2OLV A;  4KG6 A;  1Y54 A;  2WKR A;  2VK3 A;  5KSC A;  3LR5 A;  4FOF A;  5EE8 A;  2W3F A;  4NG2 A;  4IVK A;  1PWG A;  4S2N C;  3CLO A;  1JWP A;  2QMI A;  2Y2N A;  1NRJ A;  5L2F A;  3JYI A;  4NXF A;  5F69 A;  3O3V A;  4AFI A;  4MN5 A;  2L1M A;  3E4Q A;  4OON A;  1VM1 A;  2O9B A;  4Y0T A;  1E4D A;  2Z2L B;  1PWC A;  4GZB A;  4RVA A;  1WA9 A;  1G28 A;  3KYE A;  1W8Y A;  4LLO B;  4Q0H A;  3UNW A;  2WAF A;  3UDF A;  2Y2K A;  1YPR A;  3MSH A;  2X02 A;  1LL5 A;  1IYP A;  4EUZ A;  1WE4 A;  2Y2H A;  3LO7 A;  3S22 A;  4N9K A;  2VGK A;  1FR1 A;  2V9A A;  3G30 A;  2ZL1 B;  5AVF A;  1K55 C;  5DTK A;  1NXY A;  2OWJ A;  3EWK A;  4OH0 A;  5DTS A;  2Q9M A;  1D1J A;  4NXE A;  3T12 B;  5EOE A;  5DKL A;  3HJK A;  2WGI A;  2M7V A;  1K54 C;  3PBN A;  4L9G A;  1D06 A;  3KO6 A;  3LGO A;  1K57 C;  3HL9 A;  4DN0 A;  2Y2Q A;  1DRM A;  4X1L A;  1KE4 A;  2H5S A;  2XH9 A;  3IXD A;  2B18 A;  3G32 A;  3MKF A;  3MXQ A;  3LIF A;  4B93 A;  2NUP C;  4Y2F A;  5L8M A;  4BMW A;  1K0K A;  2EX6 A;  4GD8 A;  4XT2 A;  3GDI A;  2PD7 A;  3O86 A;  1BLC A;  3GSG A;  2JKF A;  1UWN X;  3ZNT A;  3BWL A;  2PT7 A;  2K7S A;  2UWX A;  5TGF A;  2O99 A;  4PPR A;  5CGW A;  4YIN A;  1VEU A;  5I5L A;  4HY8 A;  1ONH A;  1S66 L;  3CZD A;  4LV2 A;  1BTL A;  3WS4 A;  1NRF A;  4OQI A;  4WEL A;  4E3L A;  4KZ5 A;  3VOL A;  5FI7 A;  4Y0O A;  1HTZ A;  5HDD A;  3CAX A;  1CQA A;  2XFT A;  4GB7 A;  2ZM0 A;  2WGV A;  1RGZ A;  4K91 A;  3Q82 A;  3IQA A;  4Q0I A;  3FPV A;  2CMN A;  1ES3 A;  4KZ6 A;  3C38 A;  1H8Z A;  5TBM A;  2HPB A;  2OV5 A;  4ETZ A;  3VP3 A;  4DF6 A;  1CF0 A;  4KZ3 A;  4Z9Q A;  2PR6 A;  3R7W A;  3D4F A;  4DE2 A;  2WZX A;  4BWI A;  3OPR A;  2VEA A;  1JTD A;  2VJW A;  4EWF A;  4KZB A;  3Q7V B;  5FEF A;  1S4S A;  4EBP A;  3Q81 A;  4WL9 A;  3WRT A;  1C3B A;  1TS6 A;  2XFS A;  3L7H A;  2FH5 A;  3NCK A;  1KVL A;  4L9E A;  2KOI A;  4DE0 A;  2VGL S;  5FQM A;  3P7N A;  2EA9 A;  4I39 A;  3WS1 A;  3GMW A;  4HI4 A;  4JGQ A;  2OAP 1;  5AQA A;  4QHC A;  5JYO A;  2W0N A;  4JBF A;  4UA9 A;  5IHV A;  5G4Y A;  5FA7 A;  3RH8 B;  1QME A;  5HDS A;  4H6J B;  3G34 A;  1SDN A;  2I9V A;  4X56 A;  2HDR A;  1YSQ A;  4M4X A;  2IWD A;  1HVB A;  1RGY A;  1XA7 A;  3BFG A;  4KZ7 A;  1SZV A;  1YMS A;  3G31 A;  1LL8 A;  4DJ3 A;  2XGN A;  5FAS A;  1Y28 A;  3UDI A;  3A0V A;  1HD8 A;  1ACF A;  3KYQ A;  3A0R A;  1VET B;  3NOT C;  4MLL A;  3KYZ A;  4KZ9 A;  3G2Z A;  1UWP X;  3A3I A;  3T4T A;  5A93 A;  3UO9 A;  3LY4 A;  3ZNY A;  3C4P A;  4GN2 A;  4ARZ A;  4DDS A;  4MDZ A;  4S2J A;  4NK3 A;  4HEF A;  2GJ3 A;  1MY8 A;  3ZDJ A;  3T1X A;  1K54 A;  5D3O A;  3T1S A;  2ZMF A;  2Y2O A;  3B3X A;  5U47 A;  4UHU A;  1YLW A;  4KG2 A;  5EVI C;  4II7 A;  3HBR A;  5HPF A;  4QJG A;  2ZMV A;  1ES4 A;  4PM6 A;  2ZQC A;  2G2U A;  2HP6 A;  1EI5 A;  3F1N B;  3OOV A;  5TJJ A;  3LEZ A;  3MBZ A;  4ZBE A;  4LRZ E;  5GLC A;  3NIA A;  3MZD A;  4IUH A;  4KQO A;  2XRN A;  2R9X A;  1YKD A;  3PTE A;  5HZH A;  1VHM A;  3A3D A;  5F5Y A;  1ES5 A;  4U0X A;  1XKZ A;  3S1Y A;  2WYX A;  4BD0 A;  5CHU A;  1YSP A;  1FOF A;  5FAP A;  1K56 A;  4KQD A;  4OOY A;  4O7D A;  2HDU A;  3PR6 A;  3IF6 C;  4GDN A;  3PAG A;  1E3U D;  3NHQ A;  3AGE A;  3LCE A;  3CWF A;  2QJ7 A;  3BW6 A;  3UN7 A;  2V8F A;  3M2K A;  5DTT A;  4P87 A;  4MEZ A;  3S7O A;  3A0S A;  1N9O A;  1LLB A;  1DJC A;  3PAE A;  1AWI A;  1GA9 A;  2XK1 A;  4FTX A;  2ZM2 A;  4R3J A;  3G35 A;  3UPO A;  1YT4 A;  3AGF A;  5HPI A;  4X68 A;  1IOU A;  3G2Y A;  3S7N A;  3K3D A;  5HD5 A;  4EU0 A;  2H0T A;  1JNU A;  2EX2 A;  2RCX A;  4MBF A;  1G5U A;  5GLA A;  2QZ6 A;  5EVI D;  3QP1 A;  2WKH A;  2QKP A;  3UE3 A;  5GLB A;  1FR6 A;  1RP5 A;  3T4K A;  2M7U A;  4GJ4 A;  2FFF B;  5E2E A;  1IYS A;  4GKU A;  2PDR A;  5HAQ A;  4FH2 A;  2BLS A;  1J9M A;  3CPT B;  3MS6 A;  3LYX A;  1BT5 A;  1CEF A;  3Q7Z A;  1KDW A;  3F1O A;  5J3W A;  3WRZ A;  3GVB A;  4G3K A;  2KDK A;  3PXP A;  4U3T A;  3ZG5 A;  4EXO A;  1IFQ A;  3MFD A;  3OLO A;  3IBJ A;  4HJ3 A;  5CHM A;  2HF6 A;  3QP6 A;  3OC2 A;  4EES A;  4P6Z S;  2Y2L A;  5F1G A;  1OT6 A;  3E4P A;  3UME A;  3FV7 A;  2W1T A;  2JN7 A;  2Y8H A;  1TEM A;  3VP2 A;  1PZP A;  3VP1 A;  5LBR A;  5G18 A;  3HLC A;  1L3L A;  3FPW A;  1OME A;  3C7U A;  2PYR A;  1LSV A;  2XLN A;  4GLQ A;  2OAQ 1;  2ZC7 A;  1ZTU A;  5EV0 A;  4HNB A;  4MCW A;  2J3T C;  1NWZ A;  5DFY A;  2Y2M A;  1P97 A;  4KQR A;  1CI8 A;  4CLC B;  4LRX C;  2Q0O A;  3DTK A;  3S7P A;  3B42 A;  1V9Y A;  1IEL A;  1L0D A;  3CUE A;  3PBS A;  4LCM A;  1ONG A;  3C8C A;  3OCL A;  3NC8 A;  4N1X A;  2V1Z A;  1Z6F A;  2EX9 A;  3C4O A;  1GSX A;  2G2W A;  4EEP A;  1BUE A;  2XEP A;  3IX8 A;  1DJA A;  2W3G A;  3LR4 A; 
#chains in the Genus database with same CATH homology
 3IH8 A;  2XH9 A;  4ZJ3 A;  2C5W B;  3IXD A;  3UY6 A;  3ZGA B;  1K4E A;  4OPY A;  3G32 A;  3MKF A;  4IVI A;  3IT9 A;  5FQI A;  4LCL A;  2A49 A;  2EX6 A;  1MWT A;  4EQI A;  5HAI A;  4GD8 A;  2WAD A;  3O86 A;  2PU4 A;  3BFC A;  4XUZ A;  1JTG A;  1K6S A;  1MWU A;  5A92 A;  1BLC A;  3GSG A;  3ZNT A;  4KZ4 A;  3VOZ A;  2JCH A;  4IBX A;  3VOY A;  4RYE A;  3VFH A;  2ZQ9 A;  2UWX A;  5TGF A;  1PYY A;  1GCE A;  2Y2I A;  5FSR A;  3SS4 A;  2ZQ8 A;  4BL3 A;  4ZJ1 A;  1E25 A;  4JF6 A;  1KGF A;  1VQQ A;  1XXM A;  4OQ0 A;  4A5R A;  1SDE A;  1WYC A;  4PPR A;  1YMX A;  2ZC5 B;  5CGW A;  2XF3 A;  4YIN A;  5F82 A;  3VFF A;  4X69 A;  5EVL A;  2Q9N A;  3VMA A;  3HLG A;  2H0Y A;  4GOG A;  3WS5 A;  3SH8 A;  3FZC A;  1ONH A;  1DJB A;  3CZD A;  1LL9 A;  2EXA A;  4LV2 A;  1BTL A;  3IF5 A;  3OPL A;  5AQ9 A;  3WS4 A;  3HUO A;  2HDQ A;  1H5X A;  3HLW A;  3W4O A;  1NRF A;  4OQI A;  1KE3 A;  2ZQ7 A;  4WEL A;  4E3L A;  1JWZ A;  4KZ5 A;  3WWX A;  5E2F A;  4LV1 A;  4Q8I A;  2ZD8 A;  3M2J A;  1NYY A;  4Y0O A;  1HTZ A;  5FI7 A;  3FKW A;  3N8L A;  3DWK A;  4IED A;  3BLS A;  3P98 A;  4DE1 A;  2JE5 A;  2XFT A;  4GB7 A;  2ZM0 A;  2WGV A;  1RGZ A;  1K57 A;  3CJM A;  4K91 A;  5EVI B;  5CED A;  4X6T A;  3SH9 A;  2J9O A;  3Q82 A;  3TG9 A;  1CEG A;  4QU3 A;  5M19 A;  3DW0 A;  1TDL A;  1ERQ A;  3IQA A;  5FQQ A;  3OCN A;  3ZG7 B;  4RA7 A;  2JBF A;  4OQH A;  5FAT A;  4JXW A;  5FDH A;  1ERO A;  3AGD A;  3VP0 A;  1ES3 A;  2B5R A;  3BEB A;  4KZ6 A;  5CXW A;  5HAP A;  2HDS A;  3PBT A;  4U0T A;  5HFO A;  4JXG A;  4KEN B;  1H8Z A;  3PBQ A;  4WZ4 A;  2HPB A;  1JWV A;  4DRT A;  1FQG A;  4N1H A;  5DF8 A;  3HLE A;  2OV5 A;  4C6Y A;  5HW3 A;  3VP3 A;  4DF6 A;  3N8R A;  5GHY A;  2DNS A;  4L0L A;  3ZG8 B;  4KZ3 A;  4S2N A;  5F83 A;  4WBG A;  4Z9Q A;  4LV3 A;  3D4F A;  1YQS A;  1NY0 A;  2WZX A;  4OPQ A;  4WYY A;  4DE2 A;  1GHP A;  3M6B A;  3OPR A;  5BOH A;  3UPP A;  1JTD A;  3M6H A;  5JYP A;  4OP8 A;  4EWF A;  5FAQ A;  5M18 A;  4R1G A;  1NZO A;  4KZB A;  1PW8 A;  3E2L A;  5GL9 A;  1K6R A;  3Q7V B;  3EQU A;  3TSG A;  2X71 A;  5FAO A;  1YLY A;  4EBP A;  4P6B A;  1BLH A;  3Q81 A;  3WRT A;  4E3N A;  1C3B A;  3QNC A;  4KQQ A;  2WGW B;  1W79 A;  4E3O A;  2XFS A;  4N9L A;  4WEK A;  1YLJ A;  3NCK A;  3C5A A;  1KVL A;  5CGS A;  4C75 A;  4DE0 A;  4KZ8 A;  3N7W A;  5F1F A;  1MXO A;  5HAR A;  1I5Q A;  2QPN A;  3IF6 B;  5FQM A;  3V50 A;  5CEB A;  1W7F A;  4E3I A;  3WS1 A;  1PIO A;  3GMW A;  4BQM A;  5AQA A;  3ITB A;  3NI9 A;  1YLT A;  4QHC A;  1G68 A;  3ZG9 B;  5JYO A;  1K55 A;  2DCF A;  4DXC A;  2CC1 A;  4JBF A;  4PMA A;  5GHZ A;  2XDM A;  2ZC4 B;  3HLF A;  4UA9 A;  5IHV A;  1Q2Q A;  5FA7 A;  3N4I A;  1ESU A;  2OLU A;  1H8Y A;  1QME A;  3WS0 A;  3ZG0 A;  3ZFZ A;  4EBN A;  3UDX A;  4GDB A;  3MXR A;  4MBK A;  4MBH A;  3G34 A;  1SDN A;  5A90 A;  4X56 A;  5CTN A;  1SHV A;  1QMF A;  2HDR A;  1SKF A;  2IWD A;  2WZZ A;  4JKT A;  1IKI A;  3PBO A;  3BFD A;  4F94 A;  1HVB A;  4EBL A;  4KG5 A;  4E6W A;  1RGY A;  1XA7 A;  3BM6 A;  3BFG A;  3ZHH A;  1L0F A;  5FQK A;  4WEJ A;  5M1A A;  1G6A A;  2XR0 A;  4KZ7 A;  1YMS A;  3G31 A;  2XGN A;  1S6R A;  2R9W A;  2ZLY A;  5FAS A;  3HLB A;  4BJP A;  3UDI A;  1YM1 A;  5TR7 A;  5DF9 A;  1ERM A;  4K0X A;  3ZCZ A;  1CK3 A;  1HD8 A;  3ZVW A;  1MKI A;  1IYO A;  3VP4 A;  4GNU A;  3SS3 A;  5EUA A;  2Y55 A;  1SCW A;  3RXX A;  4MLL A;  3GV9 A;  4R4S A;  1I2W A;  4HBU A;  1FCN A;  4KZ9 A;  1NZU A;  3O87 A;  2J9P A;  3G2Z A;  4RX3 A;  4ZJ2 A;  1YLZ A;  3TOI A;  3A3I A;  1GHM A;  5A93 A;  4JXV A;  3Q07 A;  5E2G A;  3UO9 A;  3LY4 A;  3WS2 A;  1MWR A;  4OPR A;  3LY3 A;  3ZNY A;  4OOM A;  3C4P A;  4GN2 A;  4R3B A;  2Y91 A;  4LV0 A;  1AXB A;  4OVD A;  4R23 A;  4NK3 A;  3DTM A;  4S2J A;  4S2M A;  3MKE A;  4XXR A;  4HEF A;  3NDE A;  5EVI A;  3VSK A;  5EEC A;  4OP5 A;  2WKE A;  1MY8 A;  3ZDJ A;  1O7E A;  2HP5 A;  4B4X A;  5FI2 A;  4ZTK A;  1K54 A;  4JF5 A;  2ZC6 B;  3FYZ A;  5D3O A;  5J8X A;  2Y2O A;  2JC7 A;  3B3X A;  3FWL A;  5U47 A;  4DE3 A;  4UHU A;  1YLW A;  1W8Q A;  4KG2 A;  5EVI C;  2WGW A;  5A91 A;  3HBR A;  4QJG A;  2ZQD A;  2ZMA A;  1N4O A;  1ES4 A;  1FSW A;  3IXH A;  4PM6 A;  4QB8 A;  2ZQC A;  2G2U A;  1PW1 A;  5CEC A;  4S2L A;  3RJU A;  2ZQA A;  2WKI A;  2P74 A;  2HP6 A;  1EI5 A;  4UAA A;  2XD5 A;  5DF7 A;  3VSL A;  2ZC3 B;  2J7V A;  2XQZ A;  1S0W A;  3LEZ A;  3MBZ A;  1ZC2 A;  1K38 A;  5CER A;  4ZBE A;  3N8S A;  5GLC A;  3NIA A;  3UE1 A;  3IXG A;  3MZD A;  1NYM A;  4KQO A;  4JF4 A;  1FCM A;  1K56 D;  1PWD A;  1O07 A;  2R9X A;  3BFE A;  4D2O A;  4S2I A;  1ESI A;  1K4F A;  1LI0 A;  3PTE A;  5EOO A;  4JLF A;  5CHJ A;  4X55 A;  1KGE A;  3PBR A;  5AQ7 A;  3IWO A;  1K25 A;  2A3U A;  3W4P A;  3A3D A;  1ES5 A;  4U0X A;  3ZVT A;  5DVA A;  4XUX A;  1XKZ A;  3S1Y A;  2WYX A;  4B4Z A;  4ZDX A;  2P9V A;  5GHX A;  5KSH A;  4BD0 A;  5CHU A;  3EQV A;  4OOL A;  4E3M A;  4KZA A;  3MZE A;  1MWS A;  2XD1 A;  2PU2 A;  4OLD A;  4DKI A;  4S2P A;  1XX2 A;  3MXS A;  4QD4 A;  1FOF A;  5FAP A;  5CRF A;  4QY5 A;  2H10 A;  1K56 A;  1LI9 A;  4NET A;  2IWB A;  4OOY A;  4O7D A;  2HDU A;  3HUM A;  3IF6 C;  3E2K A;  3IWQ A;  1HZO A;  4GDN A;  4PM5 A;  3PAG A;  1ALQ A;  3A3J A;  4HBT A;  1E3U D;  4S2K A;  4UA6 A;  2WUQ A;  3GRJ A;  3V3S A;  1Q2P A;  2I72 A;  3AGE A;  3LCE A;  1NJ4 A;  3IWI A;  3NDG A;  4DDY A;  5AQB A;  3QNB A;  5FQJ A;  4PM7 A;  3UN7 A;  4OLG A;  1U60 A;  3A3E A;  3A3F A;  3M2K A;  4MNR A;  1JVJ A;  3C7V A;  1N9B A;  3ISG A;  5DTT A;  4P87 A;  4IBR A;  4MEZ A;  3GQZ A;  1L2S A;  2BG1 A;  4OPZ A;  3UPN A;  4FSF A;  1LLB A;  1DJC A;  3PAE A;  5GLD A;  5E43 A;  3RXW A;  3OZH A;  4R4R A;  3Q7V A;  4PM8 A;  5TFQ A;  4UA7 A;  2Y2J A;  3BLM A;  4YFM A;  1PZO A;  1GA9 A;  2XK1 A;  4JPM A;  3GTC A;  4B88 A;  4JXS A;  1PI5 A;  2E8I A;  2ZM2 A;  4R3J A;  1YLP A;  3G35 A;  2VGJ A;  1DY6 A;  1ZG4 A;  3V3R A;  1KE0 A;  4EV4 A;  2ZJ9 A;  3UPO A;  1YT4 A;  3AGF A;  2EX8 A;  1XGI A;  3CMZ A;  4X68 A;  1ZG6 A;  5KMW A;  3DWZ A;  4FH4 A;  1XP4 A;  3P09 A;  3G2Y A;  4OKP A;  2V2F F;  2HP9 A;  3OPP A;  2Z2M B;  2Y59 A;  2PBY A;  2H0T A;  1IYQ A;  5HX9 A;  4QY6 A;  3HLD A;  2C6W B;  1LHY A;  1TDG A;  2EX2 A;  3BFF A;  4ZAM A;  4P85 A;  2RCX A;  4MBF A;  4PM9 A;  1XA1 A;  2P9V B;  1ES2 A;  2OLV A;  2QZ6 A;  4KG6 A;  1Y54 A;  4WM9 A;  5GLA A;  3W4Q A;  2EFU A;  3SS5 A;  3G4P A;  3V5M A;  2J8Y A;  5EVI D;  5FQ9 A;  5KSC A;  2WKH A;  3UE3 A;  5GLB A;  1FR6 A;  3ITA A;  1RP5 A;  2Y2P A;  5FI6 A;  4E6X A;  3NY4 A;  3N6I A;  2FFF B;  3UE0 A;  5E2E A;  1IYS A;  5EE8 A;  2Y2G A;  4GKU A;  5HAQ A;  3IH9 A;  3O88 A;  4FH2 A;  4IVK A;  1PWG A;  1J9M A;  2BLS A;  3BEC A;  1GA0 A;  4P0M A;  4S2N C;  1JWP A;  2QMI A;  3GR2 A;  4X53 A;  2Y2N A;  5KZH A;  5L2F A;  3JYI A;  2EFX A;  3O3V A;  2X01 A;  4HES A;  1BT5 A;  1CEF A;  2ZM8 A;  1KDS A;  1RCJ A;  1FSY A;  4H8R A;  4OON A;  3Q7Z A;  3CG5 A;  1KDW A;  1VM1 A;  4S2O A;  3IXB A;  4E3J A;  4C3Q A;  4Y0T A;  4BD1 A;  3WRZ A;  1E4D A;  2Z2L B;  3GVB A;  4LEN A;  1PWC A;  4GD6 A;  4GZB A;  4RVA A;  4U3T A;  3ZG5 A;  3MFD A;  1W5D A;  2GDN A;  1W8Y A;  3UNW A;  1IEM A;  1TVF A;  3BRM A;  5CHM A;  2WAF A;  4CJN A;  3UDF A;  3OC2 A;  4WMC A;  5I94 A;  2Y2L A;  5F1G A;  5CTM A;  2Y2K A;  4Y0U A;  4Y7P A;  3FV7 A;  5HL1 A;  3HUN A;  4ID4 A;  1IKG A;  1TEM A;  1L0G A;  3BYD A;  1KGG A;  1BZA A;  3VP2 A;  1PZP A;  1MBL A;  2X02 A;  3VP1 A;  1BUL A;  4DXB A;  3QHY A;  1EWZ A;  1LL5 A;  1FCO A;  1IYP A;  1BSG A;  5G18 A;  4BEN A;  3I7J A;  4EUZ A;  3HLC A;  1WE4 A;  2Y2H A;  3HVF A;  1BLS A;  2V20 A;  3LO7 A;  3S22 A;  4N9K A;  4BLM A;  2VGK A;  1FR1 A;  4FD8 A;  1OME A;  5E2H A;  1M6K A;  3C7U A;  1WYB A;  1XPB A;  3G30 A;  2XLN A;  2Y4A A;  3SOI A;  4K0W A;  1K55 C;  5DTK A;  3NBL A;  2ZC7 A;  3IHA A;  1NXY A;  2EXB A;  4OH0 A;  3OPH A;  4OQG A;  1I2S A;  3FKV A;  1ZKJ A;  5DTS A;  2Q9M A;  3Q1F A;  4WMC D;  5EPH A;  1M40 A;  1KVM A;  5EOE A;  1E3U A;  2Y2M A;  3IHB A;  4KQR A;  4RX2 A;  1CI8 A;  2IWC A;  1L0E A;  1GHI A;  3MZF A;  3V39 A;  4CPK A;  1BLP A;  3IF6 A;  2WAE A;  2WGI A;  4N92 A;  4DDS A;  1K54 C;  3W8K A;  4WZ5 A;  1MPL A;  4E3K A;  3PBN A;  2FFY A;  1IEL A;  1L0D A;  3PBS A;  1CI9 A;  2WK0 A;  4LCM A;  5CGX A;  1ONG A;  3OCL A;  4R0Q A;  1K57 C;  3HL9 A;  3NC8 A;  4N1X A;  3HRE A;  4M3K A;  2V1Z A;  4BL2 A;  1Z6F A;  2EX9 A;  2Y2Q A;  3C4O A;  4FCF A;  4WZ5 C;  3SH7 A;  2DRW A;  2G2W A;  1BUE A;  2XEP A;  2OSU A;  1DJA A;  1KE4 A;  1PI4 A;  2RL3 A;  3S4X A;  2H5S A;  1XGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...