2V0WA

N- and c-terminal helices of oat lov2 (404-546) are involved in light- induced signal transduction (cryo-trapped light structure of lov2 (404-546))
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
146
structure length
146
Chain Sequence
GEFLATTLERIEKNFVITDPRLPDNPIIFASDSFLQLTEYSREEILGRNCRFLQGPETDRATVRKIRDAIDNQTEVTVQLINYTKSGKKFWNLFHLQPMRDQKGDVQYFIGVQLDGTEHVRDAAEREGVMLIKKTAENIDEAAKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords NPH1-1
publication title N- and C-Terminal Flanking Regions Modulate Light-Induced Signal Transduction in the Lov2 Domain of the Blue Light Sensor Phototropin 1 from Avena Sativa.
pubmed doi rcsb
source organism Avena sativa
total genus 47
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2007-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2v0wA00
3UB6A 3E4QA 3MQOA 3UB7A 4EERA 2PR5A 4F3LB 1TS6A 4EQ1A 2KX6A 1LL8A 4KQDA 2ZOHA 4R6LA 1XJ2A 1TS8A 3ULFA 2PHYA 5HWVA 3NOTC 3MXQA 1KOUA 3VE4A 5IU1A 1P97A 3A0RA 1WA9A 3CWFA 5G4YA 1D7EA 5I5LA 4GHIB 2VV7A 2VV8A 1GSXA 2PD8A 4K08A 4HHDA 5J3WA 4WN5A 4JGPA 3PHYA 2VEAA 3EEHA 2M1CA 2GJ3A 2V9AA 2OWHA 2V1BA 5TBMA 4WLAA 1S1ZA 4KUKA 3EWKA 2PYPA 4JGRA 3G6OA 1TS7A 5IS1A 2QJ7A 1XJ3A 1OT6A 1Y28A 4EW7A 4XT2A 4B9OA 2INWA 4EEPA 4NXGA 3LYXA 5DJTA 4HY8A 4M4XA 5HDSA 4BBVA 3LIEA 4DJ2A 2P7JA 3K3CA 2VV6A 3OLOA 4F3LA 2OOLA 1OTIA 3BY9A 1OTEA 5TBMB 2Z6DA 1OTAA 5HDCA 5HWTA 4XT2B 3NHQA 2ZOIA 3LICA 3KX0X 3D72A 5F5YA 2YKHA 2KDKA 1LSWA 4WL9A 2W27A 3VE3A 1VB6A 3NOUC 1T1AA 4HI4A 4JGQA 3UMDA 2A24A 3K3DA 1S4SA 4HJ4A 3GECA 4WUJA 2PR6A 3RH8B 2PD7A 3ICYA 2QJ5A 1V9ZA 2K7SA 3BY8A 2Z6CA 2D02A 1MZUA 2L0WA 1XFNA 3VOLA 2A24B 2V1AA 4E04A 4I3IA 3CAXA 1P0ZA 5EFWA 2HV1A 1DRMA 2BASA 1OJ5A 4EESA 4NXFA 5HZHA 1LT0A 4NXBA 3C2WA 4JGOA 2J80A 4H6JA 5DJUA 3T50A 1G28A 3IBRA 4I3AA 4NXEA 2V0WA 5F6AA 3RTYA 3UB9A 3SW1A 4PKYG 2D01A 2PDRA 5HWWA 2QWSA 1S4RA 4HNBA 4L9EA 5J7EA 1N9OA 4GW9A 4HQAA 4R38A 2R78A 3MFXA 1GSWA 4HIAA 4KUOA 4HP4A 4H6JB 2WKQA 4HJ3A 1LSVA 2W0NA 3MR0A 4LRZE 1OTDA 3PYPA 1OT9A 3E4PA 3B33A 3CLOA 3LIFA 3F1PA 2WKPA 4MN5A 3UMEA 1EW0A 1GSVA 2I9VA 2L1MA 3H82B 4L9FA 1DP9A 1S1YA 4MN6A 4HJ6A 2PYRA 3H7WB 4LRYC 1JNUA 5AVFA 2L4RA 3UB8A 4HH2A 4HH3A 1V9YA 2OWJA 3LIBA 4WF0A 4GCZA 2QHKA 1F98A 4RQ9A 4EXOA 1D06A 3A0SA 4BBTA 4R70A 4YWZA 4PKYA 1OJGA 2CMNA 4HOIA 3UE6A 1XFQA 3F1NA 2QKPA 1F9IA 3C8CA 3LIAA 3FC7A 5AVEA 1UWNX 3F1OA 1XJ6A 4BBUA 3F1PB 5HDDA 3LIDA 1UGUA 1T1CA 3BWLA 1DP6A 4LPZA 1S67L 1N9LA 5A8BA 2B02A 1T1BA 3ZQ5A 1BYWA 2ZBBA 1T18A 3GDIA 3A0VA 1ODVA 2VLGA 3NJAA 2YKFA 4HP9A 4GS9A 1N9NA 4I39A 4I38A 3H9WA 5KIZA 1LSXA 5F69A 3F1NB 4LRXC 3F1OB 3IS2A 3HJIA 2V0UA 5J4EA 5HSQA 1TS0A 5HD5A 1DP8A 4EETB 4EEUA 2WKRA 3H82A 3HJKA 3NOPC 5G4ZA 3H7WA 4R3AA 2JN7A 3LI8A 3MJQA 1XJ4A 5HD3A 4GS9B 1S66L 3E4OA 2EA9A 4I5SA 3P7NA 1OTBA 1UWPX 3IS2B 4L9GA 3LUQA 1X0OA 5F68A 2JHEA 3MQQA 4I3JA 3LI9A 4LLOB 5DKLA 4DJ3A 5DKKA 3FG8A 1NWZA 1T19A 2H28A 4GHIA
chains in the Genus database with same CATH superfamily
1PI5A 4FD8A 5FAQA 3VOYA 5FSRA 2M7UA 1HD8A 3UB7A 1WYCA 1HLUP 2PR5A 4F3LB 3UE3A 4Y0UA 3NDGA 4GD6A 5TFQA 1TS6A 1IYSA 3RXXA 3VOZA 3PAGA 4KQDA 1PZPA 2Y2QA 4DE3A 2ZJ9A 1TS8A 2PHYA 1MXOA 4Y0OA 3NOTC 2JKRM 5F1GA 2W3FA 4P0MA 1MWRA 4P85A 3D3OA 1PZOA 3A0RA 2Z2MB 4ZJ1A 1WYBA 2QZ6A 4QJGA 2V2FF 4WN5A 3LY4A 3T4KA 3NCKA 2M1CA 1FR1A 4ARZA 1KE4A 2V1BA 5TBMA 2VX8A 4C3QA 1YLJA 5HAPA 1JWZA 1YMXA 4LV0A 1H8ZA 3Q81A 3T4LA 3WS0A 3AGEA 3A3JA 1Y28A 3OCLA 4H8RA 4WZ5A 1YKDA 1EI5A 2WAFA 3B42A 1YPRA 2INWA 2ZL1B 4FH2A 4Y15A 4YFMA 1DY6A 1VHMA 1PI4A 2HDRA 4DJ2A 2WGWA 3ZDJA 4WZ4A 2HGVA 3OLOA 5L10A 4F3LA 3EQVA 3BY9A 1OTEA 2ZQCA 2XD5A 3OZHA 2KOIA 4UHUA 3WWXA 2JKTM 4OKPA 1XKZA 3C30A 4S2JA 5DF7A 1L2SA 1FIKA 2R9WA 3LICA 4BD1A 2PBYA 3IXDA 5CEDA 1PRQA 4FUWA 2YKHA 1JWPA 3DWKA 3SH7A 3IWOA 4IEDA 2J7VA 3VSKA 1IKGA 3SZTA 1PW8A 2PAVP 3Q7ZA 3FZCA 3UO9A 4MLLA 3UPNA 3UMDA 5CTNA 3TSGA 3P01A 3V5MA 4HJ4A 3GECA 2PR6A 5G18A 3HLDA 2Q0OA 5IT5A 3M6BA 3CHWP 4ETXA 4X25A 2W1TB 2J3TD 4PMAA 3ICYA 2V8FA 3CITA 3BQAA 3GTCA 1ACFA 5FI6A 4UQIM 4ESPA 2K7SA 3MBZA 1KE0A 2Z6CA 4KZBA 4G3WA 2D02A 1MZUA 2L0WA 1F2KA 2V1ZA 2OLVA 2ZQDA 1LLBA 4MDZA 3UY6A 1SHVA 4ZAMA 2V1AA 3CAXA 5EFWA 4R0QA 1L0EA 4LFUA 2HJEA 4NXBA 3R4KA 2OSUA 4IJGA 3DWZA 5DFXA 3SS4A 1FOFA 3MKFA 3KYEA 2ZQ7A 3OOVA 1PYYA 3UN7A 3KSFA 5C5KA 1IOUA 2JC7A 1LHYA 1K6RA 3IBRA 3SS3A 4I3AA 4NXEA 1ES2A 2V0WA 5M1AA 1Z09A 1H8YA 3RTYA 2ACGA 3SW1A 2BLSA 1GHPA 2QWSA 1S4RA 4L9EA 3FV7A 3FPWA 3B47A 2V8CA 1TDGA 1BLSA 4OP8A 4HQAA 2EXBA 4R38A 2R78A 1ES4A 4WZ5C 5GLCA 2Y2HA 3S7QA 2W1TA 4O7DA 3N7WA 3S7PA 4HP4A 3QNBA 3HL9A 2WKQA 4HJ3A 1LSVA 2W0NA 1OTDA 3PYPA 3E4PA 4BQMA 2H5SA 1H5XA 3ZHHA 4DE2A 3IXHA 5EM1A 4NG2A 1ZC2A 4NKPA 3HVFA 4MN6A 4KQQA 1N4OA 4EUVA 4HJ6A 5HFOA 3H7WB 4Q0IA 1BLPA 4N1XA 4UA6A 5EOEA 1F98A 4RQ9A 1TEMA 4KQOA 4BWIA 2W1RA 3E2KA 3DTEA 1FCMA 1OJGA 2VGJA 4UA7A 3HBRA 4BD0A 2LB9A 2WKEA 3C8CA 4MBKA 3FC7A 4S2NC 5HDDA 4R23A 3CZDA 1UGUA 1T1CA 5CECA 1J9MA 4LCLA 2VK3A 3FKWA 4QY6A 5GLBA 2J9PA 3VP3A 4QHCA 3MF0A 4EWFA 4DDSA 1W7FA 3WS2A 4DE1A 1F5MA 3PBSA 5HPIA 5FEFA 3O88A 1TF1A 2VLGA 4EV4A 5HL6A 4GS9A 1N9NA 4I38A 5CHUA 4BL3A 5KIZA 1LSXA 5F69A 2EXAA 2NUPC 5HPFA 1IYQA 2WZZA 4LRXC 1LI0A 1QMEA 3JVVA 1CF0A 4P6BA 3TW8A 4EBNA 2FZ0A 1L3LA 5FEGA 4LCMA 5HD5A 3HUOA 2X02A 5FQQA 4QB8A 5HAIA 4K91A 3BEBA 2WKRA 3H82A 4Y2FA 3LEQA 2EFXA 3H7WA 1L0GA 2DMWA 4FTXA 4O0PA 3MJQA 5E2HA 4S2LA 4IUKA 3O5YA 4KG2A 4GD8A 4I5SA 4MCWA 3C5AA 2Y2NA 3P7NA 4JKTA 2OV5A 2HDSA 3IX4A 5FQJA 4JPMA 1ERMA 3LUQA 5F68A 3Q07A 3MQQA 4DKIA 1K56D 3BLSA 4DJ3A 5HX9A 3DTMA 3EQUA 1NYMA 1ES3A 5EVID 2R9XA 3SH9A 4GHIA 3ZG8B 1CQAA 4GZBA 3UB6A 4R1GA 3E4QA 1CI8A 4KQRA 1JWVA 4GOGA 3OPLA 4AFIA 4GB7A 3K2NA 4Y0TA 3NC8A 5A93A 4EQ1A 1GCEA 1K4FA 1LL8A 2EX6A 2ZOHA 3MQ0A 2DRWA 3ZG9B 4JBFA 1MKMA 3ULFA 1O7EA 2H0TA 4N9KA 1KOUA 1VQQA 5IU1A 2M7VA 2ZM2A 3CWFA 5G4YA 3E2LA 1D7EA 4QU3A 3S1YA 4CLCA 2VV8A 5KSCA 3BLMA 5L2FA 1FILA 1KGFA 4QY5A 5FL3A 2C6WB 2V9AA 4N1HA 4RVAA 1FSWA 3PAEA 4RX2A 3T1SA 4WBGA 1KDSA 3U4LP 1AXBA 1HTZA 2WAEA 4UQIS 1CEGA 5IS1A 2Y59A 2QJ7A 4IHQA 4EW7A 3HUNA 1YQSA 2Y2OA 3G2YA 3QP6A 3VP1A 2XRNA 2ZC5B 4HY8A 5HDSA 5MC7A 3S4XA 2P7JA 3K3CA 5HL1A 4ARZB 4R3JA 5TBMB 3LR0A 5L8MA 2O0YA 3G30A 1OTAA 4S2IA 3V3RA 5KMWA 1L0DA 3UPOA 2ZMVA 2PU4A 1M40A 5HWTA 4JXWA 3EGDC 1HVBA 3LR5A 4CJNA 1YMSA 3HLCA 3CG5A 3UE1A 5TR7A 3MZFA 3GSGA 3KX0X 5EE8A 3D72A 3C38A 5F5YA 2JCHA 2ZLYA 1IKIA 1JVJA 3UDXA 5BOHA 2WGWB 2KDKA 1BZAA 1PW1A 3IF6A 2IWBA 4WL9A 4FH4A 4E3JA 3N8SA 3CUEA 4S2OA 2WKIA 2BTFP 3NDEA 3V39A 2A24A 3K3DA 3QP8A 4KENB 3RFBA 4JF5A 3MZEA 5TJJA 5HARA 1ALQA 4DMZA 3B3XA 2QJ5A 3IF5A 5DVAA 1RP5A 3EOIA 5EVIA 1IYPA 4II7A 2EFUA 4KZ5A 4OONA 3DBAA 3PBOA 2G2UA 3BFDA 4E3KA 1XFNA 2ZC7A 4DE0A 3KSHA 2GZAA 5FDSA 4RA7A 2PBDP 3OCNA 5CHJA 3P09A 1E25A 2JBFA 2Y79A 1DRMA 4BMWA 3PBRA 1OJ5A 3WRZA 4NXFA 1LT0A 1CI9A 3C2WA 5EVLA 4JLFA 4CLCC 4H6JA 5DJUA 4OQGA 4YNRA 2JKRI 5M19A 1G28A 1E4DA 4R4SA 3LY3A 3MFDA 4PKYG 1NYYA 1IEMA 1MC0A 4DDYA 3CPTA 4Z9QA 3V3SA 1CK3A 5KSHA 5J7EA 3ZGAB 4EU0A 4GJ4A 3VP2A 2HP6A 4Z1WA 1LI9A 3MFXA 2HF6A 3HREA 4HBTA 3KYQA 1NJ4A 1LL5A 2VA0A 3BFFA 3B33A 2ZC3B 4S2NA 2HP5A 3CLOA 1FR6A 3QNCA 4OQIA 2B18A 3UMEA 2Y55A 1GSVA 1DP9A 5AQ7A 1S1YA 1NLYA 5KZHA 2JE5A 2PYRA 2GDNA 1W63Q 4HBUA 5E2EA 5AQAA 3ZNTA 1V9YA 4Y5FA 3PBNA 4GCZA 2QHKA 3IXGA 4E3OA 1DJBA 2A49A 1D06A 3SS5A 1G68A 4BBTA 4ZBEA 3MXRA 1SCWA 2CMNA 2G7UA 4WELA 1GHIA 2QKPA 4ZDXA 2WK0A 1K25A 2ZC6B 5AVEA 2JKTI 4OLGA 3F1OA 1GA0A 4BBUA 4KZ7A 4L0LA 3IF6C 1MWSA 1DJAA 2WGVA 3LIDA 4CQHA 3CUEC 3CJMA 4Q0JA 4E3LA 4OP5A 5EM0A 1MPLA 1XGIA 5A90A 2B02A 4X1LA 3G2ZA 2XK1A 4QPRA 3HCYA 1T18A 3GDIA 1K4EA 2HJ9C 1NY0A 1YLWA 4BJPA 3OC2A 4CLCE 3NJAA 1I2WA 2P9VA 2XFSA 1YSPA 4HP9A 3W4QA 4JXVA 1CJFA 2EX9A 4QWOA 5EVIC 3IX3A 3A3IA 1MWUA 3LEZA 3IBJA 5FAPA 5DFYA 1NLZA 2XF3A 3HJIA 2V0UA 3VV4A 4RYEA 2X71A 2UWXA 3W2ZA 1K54A 3UB5P 4EETB 4KG6A 4DRTA 4ID4A 3S7NA 3PTEA 3HJKA 3NOPC 3A3FA 2QPNA 5CGWA 3IQAA 3O3VA 4R3AA 4OQHA 1YLTA 5CGXA 3M2KA 3NIAA 1XJ4A 3HLEA 4GS9B 1H3QA 5D3OA 3D4FA 2EA9A 3T4OA 4G3KA 4E6XA 2I72A 4M3KA 2X01A 1UWPX 1K6SA 2XEPA 1HZOA 3JPUA 4L9GA 4GLQA 5EV0A 5E43A 1X0OA 1DJCA 3HLFA 2JHEA 1ES5A 3GQZA 4ETZA 2OAQ1 4I3JA 4JXGA 3DAVA 3T4JA 3H82B 4RX3A 3PXPA 3LO7A 3OPRA 3MQOA 5A91A 4EERA 5GL9A 3EEAA 1TDLA 2XA7M 2E8IA 2PU2A 4FCFA 1C3BA 3C7VA 4R6LA 4CPKA 1RGZA 1JTGA 1BULA 4X55A 1FCOA 4GDBA 3VE4A 3W8KA 1H8MA 1P97A 1WA9A 1RGYA 4OPQA 3KO6A 4IBRA 5I5LA 1CEFA 2ZQ9A 4GHIB 1ONHA 2EX2A 2VV7A 5CHMA 1KVMA 3AGFA 1YM1A 1GSXA 4K08A 3ZG5A 5J3WA 1NRFA 2Y4AA 4JGPA 2Y2GA 3PHYA 2VEAA 4JF6A 3EEHA 2GJ3A 4ZJ3A 4WLAA 5L09A 4KUKA 1KDWA 4R3BA 3G6OA 3MMHA 3WS5A 1XJ3A 4XT2A 3GMWA 1XPBA 2FFYA 4GNUA 4B9OA 1SDNA 4OOYA 5GLDA 1Q2PA 3SOIA 2HP9A 3R7WA 2VKSA 1VETA 1YSQA 3HLBA 4NK3A 1E3UD 4CLCB 4MBFA 5M18A 3S22A 5DJTA 2DCFA 5U47A 3FYZA 3LIEA 4YINA 2AVXA 2OOLA 2XH9A 3A3DA 3QP4A 2QYBA 1Y4OA 2PT7A 3W4OA 5HDCA 3GRJA 4KZ8A 3Q7VB 4X69A 3NHQA 5CRFA 3MS6A 1K54C 2O99A 2VZWA 3TJZC 3T4SA 3Q82A 4ME4A 4YOFA 2IWDA 4DN0A 5GHYA 1D1JA 2QMIA 3BJNA 2XSSA 1LSWA 4LV2A 2W3HA 4O01A 1SKFA 3T1QB 1T1AA 3V50A 4HI4A 1PWDA 4WEKA 2B95A 3LGOA 3BFEA 4K0WA 2HDUA 3RH8B 4XXRA 3I7JA 2XLNA 4OLDA 3E98A 1GHMA 3QP2A 3MZDA 4D2OA 3DTIA 1V9ZA 2ZMAA 4GN2A 4U0XA 5F83A 1H0MA 3IF6B 1BUEA 3N4IA 2ZD8A 3IH8A 4BL2A 4X53A 3MSHA 3G34A 3VOLA 4P6ZM 2A24B 4I3IA 1P0ZA 1OPXA 4OOLA 3ZCZA 4IUHA 1FQGA 2ZM0A 4Q0HA 3GR2A 3Q7VA 4U3TA 3BYDA 2BASA 3ITAA 3OBFA 5HZHA 4R4RA 4F94A 4JGOA 4WEJA 3CI6A 4B88A 5A92A 2J80A 3U2AA 3ZYTA 5EVIB 3T50A 2Q9NA 4G3VA 4KZ3A 5F6AA 2XROA 3VP4A 3UB9A 4IVKA 3RJUA 2J3TC 1ZG4A 2D01A 4PM6A 3VSLA 4OVDA 4WMCD 4WYYA 4HNBA 4DXCA 2O9AA 1G5UA 1N9OA 5HW3A 1MY8A 4S2MA 2Y91A 3PR6A 3M6HA 5E2GA 1GSWA 2VGLM 5FA7A 1YAXA 3UDIA 4HIAA 2EWVA 4KUOA 1XX2A 5TGFA 4H6JB 2LB5A 5L07A 4DF6A 1OT9A 1IYOA 1XA1A 1YLZA 2WYXA 3LIFA 3ZG7B 3F1PA 2WKPA 3KSGA 1AWIA 1W8YA 1EW0A 2L1MA 2I9VA 3L7HA 1EWZA 4ZRRA 3CPTB 3OPHA 5FQ9A 1G6AA 1JNUA 5AVFA 5HAQA 2L4RA 4B4ZA 3UB8A 3IT9A 5F1FA 4HH3A 1KE3A 3UE0A 3DW0A 3HLGA 2OWJA 4PHTA 1K56A 4UEYA 4PM7A 2CC1A 3A0SA 1OMEA 4R70A 4XUZA 4PKYA 4HOIA 1XFQA 3F1NA 4UAAA 3LCEA 1K38A 1UWNX 4LENA 4EBLA 5FAOA 2HZ5A 5EUAA 1DP6A 3MKEA 2EX8A 1NZOA 2XA7S 4LPZA 1S67L 1N9LA 5A8BA 1SKOA 3ZQ5A 4JXSA 1BYWA 2VGKA 3A0VA 3BECA 1PWCA 2A3UA 1ODVA 2FH5A 1XP4A 2YKFA 4MNRA 1ZG6A 4Y13A 4I39A 2BG1A 2WZXA 3H9WA 1TVFA 3JYIA 2WKHA 3F1OB 2WADA 1VM1A 3IS2A 1FCNA 1VEUA 5J4EA 2W3GA 1TS0A 1KGEA 3BFCA 1NXYA 4QD4A 4OPYA 3E0YA 4D60A 3TRCA 4OPZA 1BLHA 1ESUA 5FQKA 3SH8A 1PFLA 4EQIA 1IFQA 2P9VB 5J8XA 4Q8IA 3VP0A 3LI8A 1S66L 4LV1A 1G6OA 4KZ4A 2IA2A 3TG9A 3NECA 1O07A 4LGWA 3T12B 2XDMA 2P08A 2XQZA 2WUQA 5CGSA 2P74A 5E2FA 4LLOB 2DNSA 5DKLA 1BLCA 5DKKA 3JVUA 1NWZA 3VFFA 4KZ9A 1T19A 2H28A 2O9BA 5AJGA 4Y17A 3OPPA 4WMCA 1GA9A 2IWCA 1XXMA 3ZVTA 2Y2JA 3C7UA 1Y54A 2WGIA 4A5RA 3UNWA 2O9CA 2KX6A 3L9KA 4Y7PA 1S6RA 3NI9A 1XJ2A 4Y3IA 1PIOA 4ZTKA 2K31A 3EGXC 5HWVA 1SZVA 3BQ8A 4LV3A 3MXQA 1ZKJA 1XA7A 5FDHA 2ZL1A 1J3WA 2B5RA 4KG5A 4BENA 2PD8A 2G2WA 4MEZA 2J9OA 4HHDA 4E6WA 4C75A 5DTKA 2OWHA 3MXSA 1S1ZA 3A3EA 3TOIA 1W63M 3EWKA 5CERA 3UPPA 2PYPA 5FQMA 3IWQA 4JGRA 2H10A 2ZQ8A 1TS7A 5GHZA 3S7OA 4PM8A 1OT6A 1P9WA 4GKUA 1W79A 4EEPA 4NXGA 3LYXA 1I2SA 5EVEA 1SDEA 4X1MA 3T1RA 4E3MA 3ISGA 2ZMFA 2H0YA 4P6ZS 4M4XA 3RXWA 4BBVA 1MBLA 1BTLA 5CTMA 1LL9A 1PWGA 2VV6A 1K55A 1ERQA 1OTIA 1IELA 2MJ6A 1RCJA 3BRMA 3QP5A 3FWLA 2Z6DA 4FOFA 4N9LA 4HEFA 2A2LA 3IHBA 5AQBA 4XT2B 4MMNA 5EPHA 1A0KA 1NZUA 3CMZA 2ZOIA 3LR4A 2J8YA 3QHYA 4E3NA 3C4OA 3R7WB 1VETB 2HDQA 4OQ0A 3T4QA 3LFVA 3ZVWA 3QP1A 5EOOA 2Z2LB 1ONGA 3HLWA 3HUMA 2W27A 3VE3A 2VGLS 1VB6A 4BLMA 4CLCD 3NOUC 4S2PA 4JGQA 1S4SA 4KZ6A 1K0KA 4WUJA 1Q2QA 3WRTA 2EWWA 2PD7A 1K57A 5GLAA 1NRJA 1YT4A 2W3DA 1KGGA 4B4XA 2Y8HA 4O8GA 4B93A 2K2NA 3BY8A 3IHAA 4XUXA 3PBTA 1M6KA 2W3EA 5CEBA 2NUTC 3ZG0A 1U60A 2Y2KA 4U0TA 1YLPA 3GV9A 4OPRA 4E04A 4GDNA 1ESIA 2HV1A 4NEED 4EESA 5LBRA 3W4PA 4EUZA 2XD1A 1EROA 5DTSA 3TE8A 1BT5A 4OOMA 3T4TA 1TD5A 4EBPA 4X56A 4WM9A 5K5BA 1QMFA 4UA9A 3T1XA 5EECA 3ITBA 2PDRA 2RCXA 4PM9A 3NBLA 5HWWA 3O86A 1Z6FA 4X68A 4DXBA 2Y2MA 4GW9A 4ZJ2A 5F82A 1W8QA 3KSIA 3NY4A 3V67A 3UDFA 2E8JA 2GNXA 1ZHHB 2Y2IA 3N8RA 3ZFZA 3MR0A 4LRZE 2JKGA 5JYPA 3G31A 1K55C 5FI7A 4PPRA 3WS1A 2FFFB 4P87A 5CX7A 4MN5A 2XFTA 2Y2PA 3O87A 4L9FA 1KVLA 1S0WA 3IH9A 5FQIA 3ZNYA 5JYOA 2PRFA 3N6IA 4FSFA 3Q1FA 4E3IA 4LRYC 4HH2A 4NETA 3IXBA 2VJWA 3PBQA 4K0XA 2KLIA 3LIBA 4WF0A 3IWIA 2J3WA 4EXOA 1WE4A 5I94A 4YWZA 5DF8A 5DF9A 3UE6A 1L0FA 1STZA 1F9IA 3LIAA 4MN7A 4C6YA 3KYZA 1XJ6A 3F1PB 2ZC4B 2ZQAA 3BWLA 3DTKA 4S2KA 2HPBA 2Q9MA 3G4PA 1T1BA 3NULA 2ZBBA 3N8LA 1FSYA 3BW6A 5FASA 4PAUA 2XR0A 2GX5A 5GHXA 1BSGA 1K57C 1YLYA 1N9BA 3FKVA 3F1NB 2V20A 3LR3A 5IHVA 5CXWA 4OH0A 5HSQA 1MKIA 4MBHA 2OAP1 3IX8A 3BFGA 2JKFA 1DP8A 3G32A 2ZM8A 1MWTA 2OLUA 4EEUA 3FPVA 1SKOB 2Y2LA 2C5WB 1ZTUA 5G4ZA 2XGNA 2RL3A 2JN7A 3VMAA 3GVBA 5HD3A 3P98A 4IBXA 1XGJA 3G35A 2UV0E 4IVIA 5AQ9A 3E4OA 5FATA 4KZAA 5DTTA 3WS4A 3D9YA 3M2JA 1OTBA 1E3UA 3BM6A 4HESA 4JF4A 1P9RA 1W5DA 3IS2B 1VEUB 4PM5A 3C4PA 4N92A 3LI9A 1JTDA 2P04A 3FG8A 3AGDA 3VFHA 1I5QA 4X6TA 5FI2A 1PNEA
chains in the Genus database with same CATH topology
3PXPA 5AJGA 3UB6A 3E4QA 3MQOA 2M7UA 3UB7A 4EERA 2PR5A 4AFIA 4F3LB 3EEAA 3K2NA 3UE3A 1TS6A 2O9CA 2XA7M 4EQ1A 2KX6A 1LL8A 4KQDA 2ZOHA 3MQ0A 4R6LA 1XJ2A 4Y3IA 1TS8A 1MKMA 2K31A 3ULFA 3EGXC 2PHYA 5HWVA 3BQ8A 3NOTC 2JKRM 3MXQA 1KOUA 3VE4A 5IU1A 2M7VA 2W3FA 1H8MA 3D3OA 1P97A 3A0RA 1WA9A 3CWFA 3KO6A 5G4YA 1D7EA 5I5LA 4GHIB 2VV7A 4CLCA 2VV8A 1GSXA 2PD8A 4K08A 4HHDA 5J3WA 4WN5A 4JGPA 5FL3A 3PHYA 3T4KA 2VEAA 4GHIA 3EEHA 2M1CA 2GJ3A 2V9AA 4ARZA 2OWHA 2V1BA 5TBMA 2VX8A 4WLAA 1S1ZA 4KUKA 1W63M 3EWKA 2PYPA 3T4LA 4JGRA 4UQIS 3G6OA 1TS7A 3MMHA 5IS1A 4IHQA 2QJ7A 3S7OA 1XJ3A 1OT6A 1Y28A 3OCLA 4EW7A 4XT2A 1P9WA 4B9OA 1YKDA 3B42A 2INWA 4EEPA 4NXGA 3LYXA 3R7WA 2VKSA 1YSQA 4CLCB 2XRNA 2ZMFA 4P6ZS 5DJTA 4HY8A 4M4XA 5HDSA 4BBVA 1VHMA 3LIEA 5MC7A 4DJ2A 2P7JA 3K3CA 2VV6A 2HGVA 3OLOA 4ARZB 4F3LA 3EQVA 2OOLA 1OTIA 3BY9A 2MJ6A 1OTEA 5TBMB 2Z6DA 3LR0A 4FOFA 2QYBA 5L8MA 2O0YA 1OTAA 2A2LA 2KOIA 2PT7A 2ZMVA 5HDCA 5HWTA 3EGDC 3LR5A 4XT2B 3NHQA 4MMNA 2JKTM 2O99A 2ZOIA 2VZWA 3LR4A 3TJZC 3C30A 3R7WB 3T4SA 3LICA 4ME4A 4YOFA 3T4QA 3KX0X 3D72A 3LFVA 3C38A 5F5YA 4DN0A 2YKHA 3BJNA 2KDKA 2XSSA 1LSWA 2W3HA 4WL9A 2W27A 4O01A 3VE3A 2VGLS 1VB6A 3CUEA 4CLCD 3NOUC 1T1AA 4HI4A 4JGQA 3UMDA 3P01A 2A24A 3K3DA 1S4SA 4HJ4A 4WEKA 3GECA 4WUJA 2PR6A 3RFBA 5TJJA 5IT5A 3RH8B 4ETXA 2EWWA 2W1TB 4DMZA 2PD7A 2J3TD 3ICYA 2QJ5A 3CITA 3BQAA 3E98A 1NRJA 2W3DA 3EOIA 4UQIM 4II7A 2Y8HA 1V9ZA 2K7SA 4O8GA 4B93A 2K2NA 3BY8A 3DBAA 3PBOA 2Z6CA 3PBTA 4G3WA 2D02A 1MZUA 2W3EA 2L0WA 2NUTC 1XFNA 4MDZA 3KSHA 2GZAA 3VOLA 4P6ZM 2A24B 2V1AA 4E04A 4I3IA 3CAXA 1P0ZA 3OCNA 1OPXA 5EFWA 2Y79A 4OOLA 4IUHA 2HJEA 2HV1A 1DRMA 4Q0HA 4BMWA 3PBRA 2BASA 4NEED 1OJ5A 4EESA 3OBFA 4NXFA 5HZHA 1LT0A 4NXBA 3C2WA 3R4KA 5LBRA 4JGOA 4IJGA 4WEJA 3CI6A 5DFXA 2J80A 3U2AA 3ZYTA 4CLCC 4H6JA 3TE8A 4OOMA 3T4TA 1TD5A 5DJUA 3T50A 3OOVA 4YNRA 2JKRI 1G28A 3KSFA 5C5KA 1IOUA 3IBRA 4I3AA 5K5BA 4NXEA 4G3VA 2V0WA 5F6AA 2XROA 3RTYA 3UB9A 3SW1A 2J3TC 4PKYG 2D01A 2PDRA 1MC0A 5HWWA 2QWSA 1S4RA 4HNBA 4L9EA 2O9AA 3FPWA 3B47A 5KSHA 5J7EA 1N9OA 4EU0A 4GW9A 3PR6A 4HQAA 4GJ4A 4R38A 2R78A 4Z1WA 3MFXA 1GSWA 2VGLM 1YAXA 2HF6A 3S7QA 2W1TA 4HIAA 2EWVA 3KSIA 4KUOA 3KYQA 3S7PA 3V67A 4HP4A 2GNXA 4H6JB 2LB5A 1ZHHB 2WKQA 4HJ3A 1LSVA 2VA0A 2W0NA 3MR0A 4LRZE 1OTDA 3PYPA 1OT9A 3E4PA 3B33A 3CLOA 3LIFA 3F1PA 2WKPA 3KSGA 5CX7A 4MN5A 2B18A 3UMEA 1EW0A 1GSVA 2I9VA 2L1MA 4L9FA 1DP9A 4ZRRA 1S1YA 1NLYA 4NKPA 4FSFA 4MN6A 4EUVA 4HJ6A 2PYRA 3H7WB 4LRYC 1JNUA 5AVFA 1W63Q 2L4RA 4Q0IA 3UB8A 4HH2A 4HH3A 2VJWA 3PBQA 1V9YA 4PHTA 2OWJA 2KLIA 3LIBA 4WF0A 4Y5FA 2J3WA 3PBNA 4GCZA 2QHKA 1F98A 4RQ9A 4UEYA 4EXOA 4BWIA 4KQOA 1D06A 2W1RA 3A0SA 4BBTA 4R70A 4YWZA 4PKYA 1OJGA 5DF9A 2CMNA 4HOIA 2G7UA 1XFQA 3UE6A 1STZA 3F1NA 2LB9A 2QKPA 1F9IA 3C8CA 4WELA 3LIAA 4MN7A 3FC7A 5AVEA 2JKTI 1UWNX 3F1OA 3KYZA 1XJ6A 4BBUA 3F1PB 5HDDA 4L0LA 3LIDA 1UGUA 4CQHA 1T1CA 3CUEC 3BWLA 4Q0JA 1DP6A 2XA7S 4LPZA 1S67L 1N9LA 5A8BA 3MF0A 2B02A 1T1BA 3ZQ5A 1BYWA 4QPRA 2ZBBA 3HCYA 1F5MA 1T18A 3PBSA 3GDIA 5HPIA 3BW6A 3A0VA 2HJ9C 2FH5A 1ODVA 4PAUA 4BJPA 3OC2A 1TF1A 2VLGA 3NJAA 2GX5A 4CLCE 2YKFA 5HL6A 1YSPA 4HP9A 4GS9A 1N9NA 4I39A 4I38A 3H9WA 5KIZA 1LSXA 5F69A 2NUPC 5HPFA 3F1NB 3IBJA 4LRXC 5DFYA 3F1OB 1NLZA 3JVVA 3LR3A 3IS2A 3HJIA 2V0UA 3VV4A 5J4EA 3TW8A 2FZ0A 5HSQA 2W3GA 1TS0A 2OAP1 5HD5A 3W2ZA 1DP8A 4EETB 3E0YA 4EEUA 2WKRA 3S7NA 3TRCA 3H82A 3FPVA 4Y2FA 3HJKA 1ZTUA 3NOPC 5G4ZA 3H7WA 1IFQA 4R3AA 2DMWA 2JN7A 4O0PA 3LI8A 3MJQA 1XJ4A 5HD3A 4GS9B 1H3QA 1S66L 4IUKA 3O5YA 1G6OA 3E4OA 2EA9A 3T4OA 2IA2A 4I5SA 4MCWA 4G3KA 2O9BA 3P7NA 1OTBA 1UWPX 1P9RA 2P08A 3IS2B 4L9GA 4GLQA 3LUQA 1X0OA 5F68A 2JHEA 4ETZA 2OAQ1 3MQQA 4I3JA 3LI9A 4LLOB 5DKLA 4DJ3A 5DKKA 3JVUA 2P04A 3FG8A 1NWZA 3T4JA 3EQUA 1T19A 2H28A 3H82B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UB6 A;  3E4Q A;  3MQO A;  3UB7 A;  4EER A;  2PR5 A;  4F3L B;  1TS6 A;  4EQ1 A;  2KX6 A;  1LL8 A;  4KQD A;  2ZOH A;  4R6L A;  1XJ2 A;  1TS8 A;  3ULF A;  2PHY A;  5HWV A;  3NOT C;  3MXQ A;  1KOU A;  3VE4 A;  5IU1 A;  1P97 A;  3A0R A;  1WA9 A;  3CWF A;  5G4Y A;  1D7E A;  5I5L A;  4GHI B;  2VV7 A;  2VV8 A;  1GSX A;  2PD8 A;  4K08 A;  4HHD A;  5J3W A;  4WN5 A;  4JGP A;  3PHY A;  2VEA A;  3EEH A;  2M1C A;  2GJ3 A;  2V9A A;  2OWH A;  2V1B A;  5TBM A;  4WLA A;  1S1Z A;  4KUK A;  3EWK A;  2PYP A;  4JGR A;  3G6O A;  1TS7 A;  5IS1 A;  2QJ7 A;  1XJ3 A;  1OT6 A;  1Y28 A;  4EW7 A;  4XT2 A;  4B9O A;  2INW A;  4EEP A;  4NXG A;  3LYX A;  5DJT A;  4HY8 A;  4M4X A;  5HDS A;  4BBV A;  3LIE A;  4DJ2 A;  2P7J A;  3K3C A;  2VV6 A;  3OLO A;  4F3L A;  2OOL A;  1OTI A;  3BY9 A;  1OTE A;  5TBM B;  2Z6D A;  1OTA A;  5HDC A;  5HWT A;  4XT2 B;  3NHQ A;  2ZOI A;  3LIC A;  3KX0 X;  3D72 A;  5F5Y A;  2YKH A;  2KDK A;  1LSW A;  4WL9 A;  2W27 A;  3VE3 A;  1VB6 A;  3NOU C;  1T1A A;  4HI4 A;  4JGQ A;  3UMD A;  2A24 A;  3K3D A;  1S4S A;  4HJ4 A;  3GEC A;  4WUJ A;  2PR6 A;  3RH8 B;  2PD7 A;  3ICY A;  2QJ5 A;  1V9Z A;  2K7S A;  3BY8 A;  2Z6C A;  2D02 A;  1MZU A;  2L0W A;  1XFN A;  3VOL A;  2A24 B;  2V1A A;  4E04 A;  4I3I A;  3CAX A;  1P0Z A;  5EFW A;  2HV1 A;  1DRM A;  2BAS A;  1OJ5 A;  4EES A;  4NXF A;  5HZH A;  1LT0 A;  4NXB A;  3C2W A;  4JGO A;  2J80 A;  4H6J A;  5DJU A;  3T50 A;  1G28 A;  3IBR A;  4I3A A;  4NXE A;  2V0W A;  5F6A A;  3RTY A;  3UB9 A;  3SW1 A;  4PKY G;  2D01 A;  2PDR A;  5HWW A;  2QWS A;  1S4R A;  4HNB A;  4L9E A;  5J7E A;  1N9O A;  4GW9 A;  4HQA A;  4R38 A;  2R78 A;  3MFX A;  1GSW A;  4HIA A;  4KUO A;  4HP4 A;  4H6J B;  2WKQ A;  4HJ3 A;  1LSV A;  2W0N A;  3MR0 A;  4LRZ E;  1OTD A;  3PYP A;  1OT9 A;  3E4P A;  3B33 A;  3CLO A;  3LIF A;  3F1P A;  2WKP A;  4MN5 A;  3UME A;  1EW0 A;  1GSV A;  2I9V A;  2L1M A;  3H82 B;  4L9F A;  1DP9 A;  1S1Y A;  4MN6 A;  4HJ6 A;  2PYR A;  3H7W B;  4LRY C;  1JNU A;  5AVF A;  2L4R A;  3UB8 A;  4HH2 A;  4HH3 A;  1V9Y A;  2OWJ A;  3LIB A;  4WF0 A;  4GCZ A;  2QHK A;  1F98 A;  4RQ9 A;  4EXO A;  1D06 A;  3A0S A;  4BBT A;  4R70 A;  4YWZ A;  4PKY A;  1OJG A;  2CMN A;  4HOI A;  3UE6 A;  1XFQ A;  3F1N A;  2QKP A;  1F9I A;  3C8C A;  3LIA A;  3FC7 A;  5AVE A;  1UWN X;  3F1O A;  1XJ6 A;  4BBU A;  3F1P B;  5HDD A;  3LID A;  1UGU A;  1T1C A;  3BWL A;  1DP6 A;  4LPZ A;  1S67 L;  1N9L A;  5A8B A;  2B02 A;  1T1B A;  3ZQ5 A;  1BYW A;  2ZBB A;  1T18 A;  3GDI A;  3A0V A;  1ODV A;  2VLG A;  3NJA A;  2YKF A;  4HP9 A;  4GS9 A;  1N9N A;  4I39 A;  4I38 A;  3H9W A;  5KIZ A;  1LSX A;  5F69 A;  3F1N B;  4LRX C;  3F1O B;  3IS2 A;  3HJI A;  2V0U A;  5J4E A;  5HSQ A;  1TS0 A;  5HD5 A;  1DP8 A;  4EET B;  4EEU A;  2WKR A;  3H82 A;  3HJK A;  3NOP C;  5G4Z A;  3H7W A;  4R3A A;  2JN7 A;  3LI8 A;  3MJQ A;  1XJ4 A;  5HD3 A;  4GS9 B;  1S66 L;  3E4O A;  2EA9 A;  4I5S A;  3P7N A;  1OTB A;  1UWP X;  3IS2 B;  4L9G A;  3LUQ A;  1X0O A;  5F68 A;  2JHE A;  3MQQ A;  4I3J A;  3LI9 A;  4LLO B;  5DKL A;  4DJ3 A;  5DKK A;  3FG8 A;  1NWZ A;  1T19 A;  2H28 A;  4GHI A; 
#chains in the Genus database with same CATH topology
 1PI5 A;  4FD8 A;  5FAQ A;  3VOY A;  5FSR A;  2M7U A;  1HD8 A;  3UB7 A;  1WYC A;  1HLU P;  2PR5 A;  4F3L B;  3UE3 A;  4Y0U A;  3NDG A;  4GD6 A;  5TFQ A;  1TS6 A;  1IYS A;  3RXX A;  3VOZ A;  3PAG A;  4KQD A;  1PZP A;  2Y2Q A;  4DE3 A;  2ZJ9 A;  1TS8 A;  2PHY A;  1MXO A;  4Y0O A;  3NOT C;  2JKR M;  5F1G A;  2W3F A;  4P0M A;  1MWR A;  4P85 A;  3D3O A;  1PZO A;  3A0R A;  2Z2M B;  4ZJ1 A;  1WYB A;  2QZ6 A;  4QJG A;  2V2F F;  4WN5 A;  3LY4 A;  3T4K A;  3NCK A;  2M1C A;  1FR1 A;  4ARZ A;  1KE4 A;  2V1B A;  5TBM A;  2VX8 A;  4C3Q A;  1YLJ A;  5HAP A;  1JWZ A;  1YMX A;  4LV0 A;  1H8Z A;  3Q81 A;  3T4L A;  3WS0 A;  3AGE A;  3A3J A;  1Y28 A;  3OCL A;  4H8R A;  4WZ5 A;  1YKD A;  1EI5 A;  2WAF A;  3B42 A;  1YPR A;  2INW A;  2ZL1 B;  4FH2 A;  4Y15 A;  4YFM A;  1DY6 A;  1VHM A;  1PI4 A;  2HDR A;  4DJ2 A;  2WGW A;  3ZDJ A;  4WZ4 A;  2HGV A;  3OLO A;  5L10 A;  4F3L A;  3EQV A;  3BY9 A;  1OTE A;  2ZQC A;  2XD5 A;  3OZH A;  2KOI A;  4UHU A;  3WWX A;  2JKT M;  4OKP A;  1XKZ A;  3C30 A;  4S2J A;  5DF7 A;  1L2S A;  1FIK A;  2R9W A;  3LIC A;  4BD1 A;  2PBY A;  3IXD A;  5CED A;  1PRQ A;  4FUW A;  2YKH A;  1JWP A;  3DWK A;  3SH7 A;  3IWO A;  4IED A;  2J7V A;  3VSK A;  1IKG A;  3SZT A;  1PW8 A;  2PAV P;  3Q7Z A;  3FZC A;  3UO9 A;  4MLL A;  3UPN A;  3UMD A;  5CTN A;  3TSG A;  3P01 A;  3V5M A;  4HJ4 A;  3GEC A;  2PR6 A;  5G18 A;  3HLD A;  2Q0O A;  5IT5 A;  3M6B A;  3CHW P;  4ETX A;  4X25 A;  2W1T B;  2J3T D;  4PMA A;  3ICY A;  2V8F A;  3CIT A;  3BQA A;  3GTC A;  1ACF A;  5FI6 A;  4UQI M;  4ESP A;  2K7S A;  3MBZ A;  1KE0 A;  2Z6C A;  4KZB A;  4G3W A;  2D02 A;  1MZU A;  2L0W A;  1F2K A;  2V1Z A;  2OLV A;  2ZQD A;  1LLB A;  4MDZ A;  3UY6 A;  1SHV A;  4ZAM A;  2V1A A;  3CAX A;  5EFW A;  4R0Q A;  1L0E A;  4LFU A;  2HJE A;  4NXB A;  3R4K A;  2OSU A;  4IJG A;  3DWZ A;  5DFX A;  3SS4 A;  1FOF A;  3MKF A;  3KYE A;  2ZQ7 A;  3OOV A;  1PYY A;  3UN7 A;  3KSF A;  5C5K A;  1IOU A;  2JC7 A;  1LHY A;  1K6R A;  3IBR A;  3SS3 A;  4I3A A;  4NXE A;  1ES2 A;  2V0W A;  5M1A A;  1Z09 A;  1H8Y A;  3RTY A;  2ACG A;  3SW1 A;  2BLS A;  1GHP A;  2QWS A;  1S4R A;  4L9E A;  3FV7 A;  3FPW A;  3B47 A;  2V8C A;  1TDG A;  1BLS A;  4OP8 A;  4HQA A;  2EXB A;  4R38 A;  2R78 A;  1ES4 A;  4WZ5 C;  5GLC A;  2Y2H A;  3S7Q A;  2W1T A;  4O7D A;  3N7W A;  3S7P A;  4HP4 A;  3QNB A;  3HL9 A;  2WKQ A;  4HJ3 A;  1LSV A;  2W0N A;  1OTD A;  3PYP A;  3E4P A;  4BQM A;  2H5S A;  1H5X A;  3ZHH A;  4DE2 A;  3IXH A;  5EM1 A;  4NG2 A;  1ZC2 A;  4NKP A;  3HVF A;  4MN6 A;  4KQQ A;  1N4O A;  4EUV A;  4HJ6 A;  5HFO A;  3H7W B;  4Q0I A;  1BLP A;  4N1X A;  4UA6 A;  5EOE A;  1F98 A;  4RQ9 A;  1TEM A;  4KQO A;  4BWI A;  2W1R A;  3E2K A;  3DTE A;  1FCM A;  1OJG A;  2VGJ A;  4UA7 A;  3HBR A;  4BD0 A;  2LB9 A;  2WKE A;  3C8C A;  4MBK A;  3FC7 A;  4S2N C;  5HDD A;  4R23 A;  3CZD A;  1UGU A;  1T1C A;  5CEC A;  1J9M A;  4LCL A;  2VK3 A;  3FKW A;  4QY6 A;  5GLB A;  2J9P A;  3VP3 A;  4QHC A;  3MF0 A;  4EWF A;  4DDS A;  1W7F A;  3WS2 A;  4DE1 A;  1F5M A;  3PBS A;  5HPI A;  5FEF A;  3O88 A;  1TF1 A;  2VLG A;  4EV4 A;  5HL6 A;  4GS9 A;  1N9N A;  4I38 A;  5CHU A;  4BL3 A;  5KIZ A;  1LSX A;  5F69 A;  2EXA A;  2NUP C;  5HPF A;  1IYQ A;  2WZZ A;  4LRX C;  1LI0 A;  1QME A;  3JVV A;  1CF0 A;  4P6B A;  3TW8 A;  4EBN A;  2FZ0 A;  1L3L A;  5FEG A;  4LCM A;  5HD5 A;  3HUO A;  2X02 A;  5FQQ A;  4QB8 A;  5HAI A;  4K91 A;  3BEB A;  2WKR A;  3H82 A;  4Y2F A;  3LEQ A;  2EFX A;  3H7W A;  1L0G A;  2DMW A;  4FTX A;  4O0P A;  3MJQ A;  5E2H A;  4S2L A;  4IUK A;  3O5Y A;  4KG2 A;  4GD8 A;  4I5S A;  4MCW A;  3C5A A;  2Y2N A;  3P7N A;  4JKT A;  2OV5 A;  2HDS A;  3IX4 A;  5FQJ A;  4JPM A;  1ERM A;  3LUQ A;  5F68 A;  3Q07 A;  3MQQ A;  4DKI A;  1K56 D;  3BLS A;  4DJ3 A;  5HX9 A;  3DTM A;  3EQU A;  1NYM A;  1ES3 A;  5EVI D;  2R9X A;  3SH9 A;  4GHI A;  3ZG8 B;  1CQA A;  4GZB A;  3UB6 A;  4R1G A;  3E4Q A;  1CI8 A;  4KQR A;  1JWV A;  4GOG A;  3OPL A;  4AFI A;  4GB7 A;  3K2N A;  4Y0T A;  3NC8 A;  5A93 A;  4EQ1 A;  1GCE A;  1K4F A;  1LL8 A;  2EX6 A;  2ZOH A;  3MQ0 A;  2DRW A;  3ZG9 B;  4JBF A;  1MKM A;  3ULF A;  1O7E A;  2H0T A;  4N9K A;  1KOU A;  1VQQ A;  5IU1 A;  2M7V A;  2ZM2 A;  3CWF A;  5G4Y A;  3E2L A;  1D7E A;  4QU3 A;  3S1Y A;  4CLC A;  2VV8 A;  5KSC A;  3BLM A;  5L2F A;  1FIL A;  1KGF A;  4QY5 A;  5FL3 A;  2C6W B;  2V9A A;  4N1H A;  4RVA A;  1FSW A;  3PAE A;  4RX2 A;  3T1S A;  4WBG A;  1KDS A;  3U4L P;  1AXB A;  1HTZ A;  2WAE A;  4UQI S;  1CEG A;  5IS1 A;  2Y59 A;  2QJ7 A;  4IHQ A;  4EW7 A;  3HUN A;  1YQS A;  2Y2O A;  3G2Y A;  3QP6 A;  3VP1 A;  2XRN A;  2ZC5 B;  4HY8 A;  5HDS A;  5MC7 A;  3S4X A;  2P7J A;  3K3C A;  5HL1 A;  4ARZ B;  4R3J A;  5TBM B;  3LR0 A;  5L8M A;  2O0Y A;  3G30 A;  1OTA A;  4S2I A;  3V3R A;  5KMW A;  1L0D A;  3UPO A;  2ZMV A;  2PU4 A;  1M40 A;  5HWT A;  4JXW A;  3EGD C;  1HVB A;  3LR5 A;  4CJN A;  1YMS A;  3HLC A;  3CG5 A;  3UE1 A;  5TR7 A;  3MZF A;  3GSG A;  3KX0 X;  5EE8 A;  3D72 A;  3C38 A;  5F5Y A;  2JCH A;  2ZLY A;  1IKI A;  1JVJ A;  3UDX A;  5BOH A;  2WGW B;  2KDK A;  1BZA A;  1PW1 A;  3IF6 A;  2IWB A;  4WL9 A;  4FH4 A;  4E3J A;  3N8S A;  3CUE A;  4S2O A;  2WKI A;  2BTF P;  3NDE A;  3V39 A;  2A24 A;  3K3D A;  3QP8 A;  4KEN B;  3RFB A;  4JF5 A;  3MZE A;  5TJJ A;  5HAR A;  1ALQ A;  4DMZ A;  3B3X A;  2QJ5 A;  3IF5 A;  5DVA A;  1RP5 A;  3EOI A;  5EVI A;  1IYP A;  4II7 A;  2EFU A;  4KZ5 A;  4OON A;  3DBA A;  3PBO A;  2G2U A;  3BFD A;  4E3K A;  1XFN A;  2ZC7 A;  4DE0 A;  3KSH A;  2GZA A;  5FDS A;  4RA7 A;  2PBD P;  3OCN A;  5CHJ A;  3P09 A;  1E25 A;  2JBF A;  2Y79 A;  1DRM A;  4BMW A;  3PBR A;  1OJ5 A;  3WRZ A;  4NXF A;  1LT0 A;  1CI9 A;  3C2W A;  5EVL A;  4JLF A;  4CLC C;  4H6J A;  5DJU A;  4OQG A;  4YNR A;  2JKR I;  5M19 A;  1G28 A;  1E4D A;  4R4S A;  3LY3 A;  3MFD A;  4PKY G;  1NYY A;  1IEM A;  1MC0 A;  4DDY A;  3CPT A;  4Z9Q A;  3V3S A;  1CK3 A;  5KSH A;  5J7E A;  3ZGA B;  4EU0 A;  4GJ4 A;  3VP2 A;  2HP6 A;  4Z1W A;  1LI9 A;  3MFX A;  2HF6 A;  3HRE A;  4HBT A;  3KYQ A;  1NJ4 A;  1LL5 A;  2VA0 A;  3BFF A;  3B33 A;  2ZC3 B;  4S2N A;  2HP5 A;  3CLO A;  1FR6 A;  3QNC A;  4OQI A;  2B18 A;  3UME A;  2Y55 A;  1GSV A;  1DP9 A;  5AQ7 A;  1S1Y A;  1NLY A;  5KZH A;  2JE5 A;  2PYR A;  2GDN A;  1W63 Q;  4HBU A;  5E2E A;  5AQA A;  3ZNT A;  1V9Y A;  4Y5F A;  3PBN A;  4GCZ A;  2QHK A;  3IXG A;  4E3O A;  1DJB A;  2A49 A;  1D06 A;  3SS5 A;  1G68 A;  4BBT A;  4ZBE A;  3MXR A;  1SCW A;  2CMN A;  2G7U A;  4WEL A;  1GHI A;  2QKP A;  4ZDX A;  2WK0 A;  1K25 A;  2ZC6 B;  5AVE A;  2JKT I;  4OLG A;  3F1O A;  1GA0 A;  4BBU A;  4KZ7 A;  4L0L A;  3IF6 C;  1MWS A;  1DJA A;  2WGV A;  3LID A;  4CQH A;  3CUE C;  3CJM A;  4Q0J A;  4E3L A;  4OP5 A;  5EM0 A;  1MPL A;  1XGI A;  5A90 A;  2B02 A;  4X1L A;  3G2Z A;  2XK1 A;  4QPR A;  3HCY A;  1T18 A;  3GDI A;  1K4E A;  2HJ9 C;  1NY0 A;  1YLW A;  4BJP A;  3OC2 A;  4CLC E;  3NJA A;  1I2W A;  2P9V A;  2XFS A;  1YSP A;  4HP9 A;  3W4Q A;  4JXV A;  1CJF A;  2EX9 A;  4QWO A;  5EVI C;  3IX3 A;  3A3I A;  1MWU A;  3LEZ A;  3IBJ A;  5FAP A;  5DFY A;  1NLZ A;  2XF3 A;  3HJI A;  2V0U A;  3VV4 A;  4RYE A;  2X71 A;  2UWX A;  3W2Z A;  1K54 A;  3UB5 P;  4EET B;  4KG6 A;  4DRT A;  4ID4 A;  3S7N A;  3PTE A;  3HJK A;  3NOP C;  3A3F A;  2QPN A;  5CGW A;  3IQA A;  3O3V A;  4R3A A;  4OQH A;  1YLT A;  5CGX A;  3M2K A;  3NIA A;  1XJ4 A;  3HLE A;  4GS9 B;  1H3Q A;  5D3O A;  3D4F A;  2EA9 A;  3T4O A;  4G3K A;  4E6X A;  2I72 A;  4M3K A;  2X01 A;  1UWP X;  1K6S A;  2XEP A;  1HZO A;  3JPU A;  4L9G A;  4GLQ A;  5EV0 A;  5E43 A;  1X0O A;  1DJC A;  3HLF A;  2JHE A;  1ES5 A;  3GQZ A;  4ETZ A;  2OAQ 1;  4I3J A;  4JXG A;  3DAV A;  3T4J A;  3H82 B;  4RX3 A;  3PXP A;  3LO7 A;  3OPR A;  3MQO A;  5A91 A;  4EER A;  5GL9 A;  3EEA A;  1TDL A;  2XA7 M;  2E8I A;  2PU2 A;  4FCF A;  1C3B A;  3C7V A;  4R6L A;  4CPK A;  1RGZ A;  1JTG A;  1BUL A;  4X55 A;  1FCO A;  4GDB A;  3VE4 A;  3W8K A;  1H8M A;  1P97 A;  1WA9 A;  1RGY A;  4OPQ A;  3KO6 A;  4IBR A;  5I5L A;  1CEF A;  2ZQ9 A;  4GHI B;  1ONH A;  2EX2 A;  2VV7 A;  5CHM A;  1KVM A;  3AGF A;  1YM1 A;  1GSX A;  4K08 A;  3ZG5 A;  5J3W A;  1NRF A;  2Y4A A;  4JGP A;  2Y2G A;  3PHY A;  2VEA A;  4JF6 A;  3EEH A;  2GJ3 A;  4ZJ3 A;  4WLA A;  5L09 A;  4KUK A;  1KDW A;  4R3B A;  3G6O A;  3MMH A;  3WS5 A;  1XJ3 A;  4XT2 A;  3GMW A;  1XPB A;  2FFY A;  4GNU A;  4B9O A;  1SDN A;  4OOY A;  5GLD A;  1Q2P A;  3SOI A;  2HP9 A;  3R7W A;  2VKS A;  1VET A;  1YSQ A;  3HLB A;  4NK3 A;  1E3U D;  4CLC B;  4MBF A;  5M18 A;  3S22 A;  5DJT A;  2DCF A;  5U47 A;  3FYZ A;  3LIE A;  4YIN A;  2AVX A;  2OOL A;  2XH9 A;  3A3D A;  3QP4 A;  2QYB A;  1Y4O A;  2PT7 A;  3W4O A;  5HDC A;  3GRJ A;  4KZ8 A;  3Q7V B;  4X69 A;  3NHQ A;  5CRF A;  3MS6 A;  1K54 C;  2O99 A;  2VZW A;  3TJZ C;  3T4S A;  3Q82 A;  4ME4 A;  4YOF A;  2IWD A;  4DN0 A;  5GHY A;  1D1J A;  2QMI A;  3BJN A;  2XSS A;  1LSW A;  4LV2 A;  2W3H A;  4O01 A;  1SKF A;  3T1Q B;  1T1A A;  3V50 A;  4HI4 A;  1PWD A;  4WEK A;  2B95 A;  3LGO A;  3BFE A;  4K0W A;  2HDU A;  3RH8 B;  4XXR A;  3I7J A;  2XLN A;  4OLD A;  3E98 A;  1GHM A;  3QP2 A;  3MZD A;  4D2O A;  3DTI A;  1V9Z A;  2ZMA A;  4GN2 A;  4U0X A;  5F83 A;  1H0M A;  3IF6 B;  1BUE A;  3N4I A;  2ZD8 A;  3IH8 A;  4BL2 A;  4X53 A;  3MSH A;  3G34 A;  3VOL A;  4P6Z M;  2A24 B;  4I3I A;  1P0Z A;  1OPX A;  4OOL A;  3ZCZ A;  4IUH A;  1FQG A;  2ZM0 A;  4Q0H A;  3GR2 A;  3Q7V A;  4U3T A;  3BYD A;  2BAS A;  3ITA A;  3OBF A;  5HZH A;  4R4R A;  4F94 A;  4JGO A;  4WEJ A;  3CI6 A;  4B88 A;  5A92 A;  2J80 A;  3U2A A;  3ZYT A;  5EVI B;  3T50 A;  2Q9N A;  4G3V A;  4KZ3 A;  5F6A A;  2XRO A;  3VP4 A;  3UB9 A;  4IVK A;  3RJU A;  2J3T C;  1ZG4 A;  2D01 A;  4PM6 A;  3VSL A;  4OVD A;  4WMC D;  4WYY A;  4HNB A;  4DXC A;  2O9A A;  1G5U A;  1N9O A;  5HW3 A;  1MY8 A;  4S2M A;  2Y91 A;  3PR6 A;  3M6H A;  5E2G A;  1GSW A;  2VGL M;  5FA7 A;  1YAX A;  3UDI A;  4HIA A;  2EWV A;  4KUO A;  1XX2 A;  5TGF A;  4H6J B;  2LB5 A;  5L07 A;  4DF6 A;  1OT9 A;  1IYO A;  1XA1 A;  1YLZ A;  2WYX A;  3LIF A;  3ZG7 B;  3F1P A;  2WKP A;  3KSG A;  1AWI A;  1W8Y A;  1EW0 A;  2L1M A;  2I9V A;  3L7H A;  1EWZ A;  4ZRR A;  3CPT B;  3OPH A;  5FQ9 A;  1G6A A;  1JNU A;  5AVF A;  5HAQ A;  2L4R A;  4B4Z A;  3UB8 A;  3IT9 A;  5F1F A;  4HH3 A;  1KE3 A;  3UE0 A;  3DW0 A;  3HLG A;  2OWJ A;  4PHT A;  1K56 A;  4UEY A;  4PM7 A;  2CC1 A;  3A0S A;  1OME A;  4R70 A;  4XUZ A;  4PKY A;  4HOI A;  1XFQ A;  3F1N A;  4UAA A;  3LCE A;  1K38 A;  1UWN X;  4LEN A;  4EBL A;  5FAO A;  2HZ5 A;  5EUA A;  1DP6 A;  3MKE A;  2EX8 A;  1NZO A;  2XA7 S;  4LPZ A;  1S67 L;  1N9L A;  5A8B A;  1SKO A;  3ZQ5 A;  4JXS A;  1BYW A;  2VGK A;  3A0V A;  3BEC A;  1PWC A;  2A3U A;  1ODV A;  2FH5 A;  1XP4 A;  2YKF A;  4MNR A;  1ZG6 A;  4Y13 A;  4I39 A;  2BG1 A;  2WZX A;  3H9W A;  1TVF A;  3JYI A;  2WKH A;  3F1O B;  2WAD A;  1VM1 A;  3IS2 A;  1FCN A;  1VEU A;  5J4E A;  2W3G A;  1TS0 A;  1KGE A;  3BFC A;  1NXY A;  4QD4 A;  4OPY A;  3E0Y A;  4D60 A;  3TRC A;  4OPZ A;  1BLH A;  1ESU A;  5FQK A;  3SH8 A;  1PFL A;  4EQI A;  1IFQ A;  2P9V B;  5J8X A;  4Q8I A;  3VP0 A;  3LI8 A;  1S66 L;  4LV1 A;  1G6O A;  4KZ4 A;  2IA2 A;  3TG9 A;  3NEC A;  1O07 A;  4LGW A;  3T12 B;  2XDM A;  2P08 A;  2XQZ A;  2WUQ A;  5CGS A;  2P74 A;  5E2F A;  4LLO B;  2DNS A;  5DKL A;  1BLC A;  5DKK A;  3JVU A;  1NWZ A;  3VFF A;  4KZ9 A;  1T19 A;  2H28 A;  2O9B A;  5AJG A;  4Y17 A;  3OPP A;  4WMC A;  1GA9 A;  2IWC A;  1XXM A;  3ZVT A;  2Y2J A;  3C7U A;  1Y54 A;  2WGI A;  4A5R A;  3UNW A;  2O9C A;  2KX6 A;  3L9K A;  4Y7P A;  1S6R A;  3NI9 A;  1XJ2 A;  4Y3I A;  1PIO A;  4ZTK A;  2K31 A;  3EGX C;  5HWV A;  1SZV A;  3BQ8 A;  4LV3 A;  3MXQ A;  1ZKJ A;  1XA7 A;  5FDH A;  2ZL1 A;  1J3W A;  2B5R A;  4KG5 A;  4BEN A;  2PD8 A;  2G2W A;  4MEZ A;  2J9O A;  4HHD A;  4E6W A;  4C75 A;  5DTK A;  2OWH A;  3MXS A;  1S1Z A;  3A3E A;  3TOI A;  1W63 M;  3EWK A;  5CER A;  3UPP A;  2PYP A;  5FQM A;  3IWQ A;  4JGR A;  2H10 A;  2ZQ8 A;  1TS7 A;  5GHZ A;  3S7O A;  4PM8 A;  1OT6 A;  1P9W A;  4GKU A;  1W79 A;  4EEP A;  4NXG A;  3LYX A;  1I2S A;  5EVE A;  1SDE A;  4X1M A;  3T1R A;  4E3M A;  3ISG A;  2ZMF A;  2H0Y A;  4P6Z S;  4M4X A;  3RXW A;  4BBV A;  1MBL A;  1BTL A;  5CTM A;  1LL9 A;  1PWG A;  2VV6 A;  1K55 A;  1ERQ A;  1OTI A;  1IEL A;  2MJ6 A;  1RCJ A;  3BRM A;  3QP5 A;  3FWL A;  2Z6D A;  4FOF A;  4N9L A;  4HEF A;  2A2L A;  3IHB A;  5AQB A;  4XT2 B;  4MMN A;  5EPH A;  1A0K A;  1NZU A;  3CMZ A;  2ZOI A;  3LR4 A;  2J8Y A;  3QHY A;  4E3N A;  3C4O A;  3R7W B;  1VET B;  2HDQ A;  4OQ0 A;  3T4Q A;  3LFV A;  3ZVW A;  3QP1 A;  5EOO A;  2Z2L B;  1ONG A;  3HLW A;  3HUM A;  2W27 A;  3VE3 A;  2VGL S;  1VB6 A;  4BLM A;  4CLC D;  3NOU C;  4S2P A;  4JGQ A;  1S4S A;  4KZ6 A;  1K0K A;  4WUJ A;  1Q2Q A;  3WRT A;  2EWW A;  2PD7 A;  1K57 A;  5GLA A;  1NRJ A;  1YT4 A;  2W3D A;  1KGG A;  4B4X A;  2Y8H A;  4O8G A;  4B93 A;  2K2N A;  3BY8 A;  3IHA A;  4XUX A;  3PBT A;  1M6K A;  2W3E A;  5CEB A;  2NUT C;  3ZG0 A;  1U60 A;  2Y2K A;  4U0T A;  1YLP A;  3GV9 A;  4OPR A;  4E04 A;  4GDN A;  1ESI A;  2HV1 A;  4NEE D;  4EES A;  5LBR A;  3W4P A;  4EUZ A;  2XD1 A;  1ERO A;  5DTS A;  3TE8 A;  1BT5 A;  4OOM A;  3T4T A;  1TD5 A;  4EBP A;  4X56 A;  4WM9 A;  5K5B A;  1QMF A;  4UA9 A;  3T1X A;  5EEC A;  3ITB A;  2PDR A;  2RCX A;  4PM9 A;  3NBL A;  5HWW A;  3O86 A;  1Z6F A;  4X68 A;  4DXB A;  2Y2M A;  4GW9 A;  4ZJ2 A;  5F82 A;  1W8Q A;  3KSI A;  3NY4 A;  3V67 A;  3UDF A;  2E8J A;  2GNX A;  1ZHH B;  2Y2I A;  3N8R A;  3ZFZ A;  3MR0 A;  4LRZ E;  2JKG A;  5JYP A;  3G31 A;  1K55 C;  5FI7 A;  4PPR A;  3WS1 A;  2FFF B;  4P87 A;  5CX7 A;  4MN5 A;  2XFT A;  2Y2P A;  3O87 A;  4L9F A;  1KVL A;  1S0W A;  3IH9 A;  5FQI A;  3ZNY A;  5JYO A;  2PRF A;  3N6I A;  4FSF A;  3Q1F A;  4E3I A;  4LRY C;  4HH2 A;  4NET A;  3IXB A;  2VJW A;  3PBQ A;  4K0X A;  2KLI A;  3LIB A;  4WF0 A;  3IWI A;  2J3W A;  4EXO A;  1WE4 A;  5I94 A;  4YWZ A;  5DF8 A;  5DF9 A;  3UE6 A;  1L0F A;  1STZ A;  1F9I A;  3LIA A;  4MN7 A;  4C6Y A;  3KYZ A;  1XJ6 A;  3F1P B;  2ZC4 B;  2ZQA A;  3BWL A;  3DTK A;  4S2K A;  2HPB A;  2Q9M A;  3G4P A;  1T1B A;  3NUL A;  2ZBB A;  3N8L A;  1FSY A;  3BW6 A;  5FAS A;  4PAU A;  2XR0 A;  2GX5 A;  5GHX A;  1BSG A;  1K57 C;  1YLY A;  1N9B A;  3FKV A;  3F1N B;  2V20 A;  3LR3 A;  5IHV A;  5CXW A;  4OH0 A;  5HSQ A;  1MKI A;  4MBH A;  2OAP 1;  3IX8 A;  3BFG A;  2JKF A;  1DP8 A;  3G32 A;  2ZM8 A;  1MWT A;  2OLU A;  4EEU A;  3FPV A;  1SKO B;  2Y2L A;  2C5W B;  1ZTU A;  5G4Z A;  2XGN A;  2RL3 A;  2JN7 A;  3VMA A;  3GVB A;  5HD3 A;  3P98 A;  4IBX A;  1XGJ A;  3G35 A;  2UV0 E;  4IVI A;  5AQ9 A;  3E4O A;  5FAT A;  4KZA A;  5DTT A;  3WS4 A;  3D9Y A;  3M2J A;  1OTB A;  1E3U A;  3BM6 A;  4HES A;  4JF4 A;  1P9R A;  1W5D A;  3IS2 B;  1VEU B;  4PM5 A;  3C4P A;  4N92 A;  3LI9 A;  1JTD A;  2P04 A;  3FG8 A;  3AGD A;  3VFH A;  1I5Q A;  4X6T A;  5FI2 A;  1PNE A; 
#chains in the Genus database with same CATH homology
 3PXP A;  5AJG A;  3UB6 A;  3E4Q A;  3MQO A;  2M7U A;  3UB7 A;  4EER A;  2PR5 A;  4AFI A;  4F3L B;  3EEA A;  3K2N A;  3UE3 A;  1TS6 A;  2O9C A;  2XA7 M;  4EQ1 A;  2KX6 A;  1LL8 A;  4KQD A;  2ZOH A;  3MQ0 A;  4R6L A;  1XJ2 A;  4Y3I A;  1TS8 A;  1MKM A;  2K31 A;  3ULF A;  3EGX C;  2PHY A;  5HWV A;  3BQ8 A;  3NOT C;  2JKR M;  3MXQ A;  1KOU A;  3VE4 A;  5IU1 A;  2M7V A;  2W3F A;  1H8M A;  3D3O A;  1P97 A;  3A0R A;  1WA9 A;  3CWF A;  3KO6 A;  5G4Y A;  1D7E A;  5I5L A;  4GHI B;  2VV7 A;  4CLC A;  2VV8 A;  1GSX A;  2PD8 A;  4K08 A;  4HHD A;  5J3W A;  4WN5 A;  4JGP A;  5FL3 A;  3PHY A;  3T4K A;  2VEA A;  4GHI A;  3EEH A;  2M1C A;  2GJ3 A;  2V9A A;  4ARZ A;  2OWH A;  2V1B A;  5TBM A;  2VX8 A;  4WLA A;  1S1Z A;  4KUK A;  1W63 M;  3EWK A;  2PYP A;  3T4L A;  4JGR A;  4UQI S;  3G6O A;  1TS7 A;  3MMH A;  5IS1 A;  4IHQ A;  2QJ7 A;  3S7O A;  1XJ3 A;  1OT6 A;  1Y28 A;  3OCL A;  4EW7 A;  4XT2 A;  1P9W A;  4B9O A;  1YKD A;  3B42 A;  2INW A;  4EEP A;  4NXG A;  3LYX A;  3R7W A;  2VKS A;  1YSQ A;  4CLC B;  2XRN A;  2ZMF A;  4P6Z S;  5DJT A;  4HY8 A;  4M4X A;  5HDS A;  4BBV A;  1VHM A;  3LIE A;  5MC7 A;  4DJ2 A;  2P7J A;  3K3C A;  2VV6 A;  2HGV A;  3OLO A;  4ARZ B;  4F3L A;  3EQV A;  2OOL A;  1OTI A;  3BY9 A;  2MJ6 A;  1OTE A;  5TBM B;  2Z6D A;  3LR0 A;  4FOF A;  2QYB A;  5L8M A;  2O0Y A;  1OTA A;  2A2L A;  2KOI A;  2PT7 A;  2ZMV A;  5HDC A;  5HWT A;  3EGD C;  3LR5 A;  4XT2 B;  3NHQ A;  4MMN A;  2JKT M;  2O99 A;  2ZOI A;  2VZW A;  3LR4 A;  3TJZ C;  3C30 A;  3R7W B;  3T4S A;  3LIC A;  4ME4 A;  4YOF A;  3T4Q A;  3KX0 X;  3D72 A;  3LFV A;  3C38 A;  5F5Y A;  4DN0 A;  2YKH A;  3BJN A;  2KDK A;  2XSS A;  1LSW A;  2W3H A;  4WL9 A;  2W27 A;  4O01 A;  3VE3 A;  2VGL S;  1VB6 A;  3CUE A;  4CLC D;  3NOU C;  1T1A A;  4HI4 A;  4JGQ A;  3UMD A;  3P01 A;  2A24 A;  3K3D A;  1S4S A;  4HJ4 A;  4WEK A;  3GEC A;  4WUJ A;  2PR6 A;  3RFB A;  5TJJ A;  5IT5 A;  3RH8 B;  4ETX A;  2EWW A;  2W1T B;  4DMZ A;  2PD7 A;  2J3T D;  3ICY A;  2QJ5 A;  3CIT A;  3BQA A;  3E98 A;  1NRJ A;  2W3D A;  3EOI A;  4UQI M;  4II7 A;  2Y8H A;  1V9Z A;  2K7S A;  4O8G A;  4B93 A;  2K2N A;  3BY8 A;  3DBA A;  3PBO A;  2Z6C A;  3PBT A;  4G3W A;  2D02 A;  1MZU A;  2W3E A;  2L0W A;  2NUT C;  1XFN A;  4MDZ A;  3KSH A;  2GZA A;  3VOL A;  4P6Z M;  2A24 B;  2V1A A;  4E04 A;  4I3I A;  3CAX A;  1P0Z A;  3OCN A;  1OPX A;  5EFW A;  2Y79 A;  4OOL A;  4IUH A;  2HJE A;  2HV1 A;  1DRM A;  4Q0H A;  4BMW A;  3PBR A;  2BAS A;  4NEE D;  1OJ5 A;  4EES A;  3OBF A;  4NXF A;  5HZH A;  1LT0 A;  4NXB A;  3C2W A;  3R4K A;  5LBR A;  4JGO A;  4IJG A;  4WEJ A;  3CI6 A;  5DFX A;  2J80 A;  3U2A A;  3ZYT A;  4CLC C;  4H6J A;  3TE8 A;  4OOM A;  3T4T A;  1TD5 A;  5DJU A;  3T50 A;  3OOV A;  4YNR A;  2JKR I;  1G28 A;  3KSF A;  5C5K A;  1IOU A;  3IBR A;  4I3A A;  5K5B A;  4NXE A;  4G3V A;  2V0W A;  5F6A A;  2XRO A;  3RTY A;  3UB9 A;  3SW1 A;  2J3T C;  4PKY G;  2D01 A;  2PDR A;  1MC0 A;  5HWW A;  2QWS A;  1S4R A;  4HNB A;  4L9E A;  2O9A A;  3FPW A;  3B47 A;  5KSH A;  5J7E A;  1N9O A;  4EU0 A;  4GW9 A;  3PR6 A;  4HQA A;  4GJ4 A;  4R38 A;  2R78 A;  4Z1W A;  3MFX A;  1GSW A;  2VGL M;  1YAX A;  2HF6 A;  3S7Q A;  2W1T A;  4HIA A;  2EWV A;  3KSI A;  4KUO A;  3KYQ A;  3S7P A;  3V67 A;  4HP4 A;  2GNX A;  4H6J B;  2LB5 A;  1ZHH B;  2WKQ A;  4HJ3 A;  1LSV A;  2VA0 A;  2W0N A;  3MR0 A;  4LRZ E;  1OTD A;  3PYP A;  1OT9 A;  3E4P A;  3B33 A;  3CLO A;  3LIF A;  3F1P A;  2WKP A;  3KSG A;  5CX7 A;  4MN5 A;  2B18 A;  3UME A;  1EW0 A;  1GSV A;  2I9V A;  2L1M A;  4L9F A;  1DP9 A;  4ZRR A;  1S1Y A;  1NLY A;  4NKP A;  4FSF A;  4MN6 A;  4EUV A;  4HJ6 A;  2PYR A;  3H7W B;  4LRY C;  1JNU A;  5AVF A;  1W63 Q;  2L4R A;  4Q0I A;  3UB8 A;  4HH2 A;  4HH3 A;  2VJW A;  3PBQ A;  1V9Y A;  4PHT A;  2OWJ A;  2KLI A;  3LIB A;  4WF0 A;  4Y5F A;  2J3W A;  3PBN A;  4GCZ A;  2QHK A;  1F98 A;  4RQ9 A;  4UEY A;  4EXO A;  4BWI A;  4KQO A;  1D06 A;  2W1R A;  3A0S A;  4BBT A;  4R70 A;  4YWZ A;  4PKY A;  1OJG A;  5DF9 A;  2CMN A;  4HOI A;  2G7U A;  1XFQ A;  3UE6 A;  1STZ A;  3F1N A;  2LB9 A;  2QKP A;  1F9I A;  3C8C A;  4WEL A;  3LIA A;  4MN7 A;  3FC7 A;  5AVE A;  2JKT I;  1UWN X;  3F1O A;  3KYZ A;  1XJ6 A;  4BBU A;  3F1P B;  5HDD A;  4L0L A;  3LID A;  1UGU A;  4CQH A;  1T1C A;  3CUE C;  3BWL A;  4Q0J A;  1DP6 A;  2XA7 S;  4LPZ A;  1S67 L;  1N9L A;  5A8B A;  3MF0 A;  2B02 A;  1T1B A;  3ZQ5 A;  1BYW A;  4QPR A;  2ZBB A;  3HCY A;  1F5M A;  1T18 A;  3PBS A;  3GDI A;  5HPI A;  3BW6 A;  3A0V A;  2HJ9 C;  2FH5 A;  1ODV A;  4PAU A;  4BJP A;  3OC2 A;  1TF1 A;  2VLG A;  3NJA A;  2GX5 A;  4CLC E;  2YKF A;  5HL6 A;  1YSP A;  4HP9 A;  4GS9 A;  1N9N A;  4I39 A;  4I38 A;  3H9W A;  5KIZ A;  1LSX A;  5F69 A;  2NUP C;  5HPF A;  3F1N B;  3IBJ A;  4LRX C;  5DFY A;  3F1O B;  1NLZ A;  3JVV A;  3LR3 A;  3IS2 A;  3HJI A;  2V0U A;  3VV4 A;  5J4E A;  3TW8 A;  2FZ0 A;  5HSQ A;  2W3G A;  1TS0 A;  2OAP 1;  5HD5 A;  3W2Z A;  1DP8 A;  4EET B;  3E0Y A;  4EEU A;  2WKR A;  3S7N A;  3TRC A;  3H82 A;  3FPV A;  4Y2F A;  3HJK A;  1ZTU A;  3NOP C;  5G4Z A;  3H7W A;  1IFQ A;  4R3A A;  2DMW A;  2JN7 A;  4O0P A;  3LI8 A;  3MJQ A;  1XJ4 A;  5HD3 A;  4GS9 B;  1H3Q A;  1S66 L;  4IUK A;  3O5Y A;  1G6O A;  3E4O A;  2EA9 A;  3T4O A;  2IA2 A;  4I5S A;  4MCW A;  4G3K A;  2O9B A;  3P7N A;  1OTB A;  1UWP X;  1P9R A;  2P08 A;  3IS2 B;  4L9G A;  4GLQ A;  3LUQ A;  1X0O A;  5F68 A;  2JHE A;  4ETZ A;  2OAQ 1;  3MQQ A;  4I3J A;  3LI9 A;  4LLO B;  5DKL A;  4DJ3 A;  5DKK A;  3JVU A;  2P04 A;  3FG8 A;  1NWZ A;  3T4J A;  3EQU A;  1T19 A;  2H28 A;  3H82 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...