5A91A

15k x-ray ligand free: exploring the mechanism of beta-lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords SULFATE ION
total genus 95
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5a91A00
3WS0A 1XA1A 1M40A 4KZ3A 5FA7A 1GHMA 3OZHA 2XR0A 1SHVA 3FV7A 3VP2A 4S2KA 1O07A 4X55A 1NYYA 4X56A 1K54C 2WKHA 2GDNA 3OPPA 5HAIA 3ZFZA 1MWRA 1ES5A 5HAQA 3N8RA 4RYEA 4P85A 1VM1A 4N9LA 2Y2OA 3M6BA 4OQGA 3BFDA 1JTGA 4S2NA 3ZNYA 4XUXA 1KGGA 2WADA 3HUOA 4KQOA 3UPNA 4GB7A 3JYIA 4JF6A 5AQ7A 3ZNTA 1E3UA 1ZKJA 5FSRA 3PAGA 2C5WB 3VSKA 4B4ZA 1ONHA 3IH9A 5KMWA 3WRZA 1KVMA 3G2YA 3UE1A 1XPBA 4KG2A 5EVIB 3LY4A 2E8IA 1SDEA 1TVFA 3G31A 4KZAA 5DTKA 1YM1A 5E2HA 1EI5A 1BLPA 1NXYA 4OLGA 2WGIA 4BL2A 1TEMA 3HUNA 3MBZA 3Q7VB 3VOYA 4S2LA 2EX8A 5EOOA 3W4OA 4Y0TA 3G30A 5FI6A 3AGDA 1J9MA 4S2JA 3FYZA 3BRMA 3G34A 2V1ZA 5DVAA 4QU3A 5FQ9A 1DJAA 3VP3A 3WWXA 2G2UA 1YLZA 1ZG4A 3W4PA 1GA0A 1KE4A 1IYQA 1LI9A 4EBPA 3IF5A 3O86A 4E3NA 4DDYA 3BYDA 4PM7A 5E43A 3VFHA 1E3UD 4OH0A 5G18A 1IKGA 4QB8A 2PU4A 2HDQA 4WZ5C 3GSGA 1YQSA 4E3IA 4E6XA 1E25A 3PBTA 3Q82A 1YLYA 4PPRA 3HLGA 3HLEA 1PWGA 5GLAA 1BT5A 1SCWA 3DW0A 3MZDA 4LCLA 4QD4A 2QPNA 1PW1A 3OPLA 4R0QA 5KSHA 1MWTA 5E2FA 2I72A 5FQKA 1XGIA 1HTZA 1ERQA 3SS4A 3E2LA 4OPYA 5DTSA 2IWCA 4CPKA 2XGNA 2JBFA 1K55A 5HL1A 3QHYA 2QMIA 5D3OA 4UA6A 1MBLA 2X01A 2HDRA 1IYPA 3Q81A 4MNRA 4JLFA 2ZQ8A 3Q7VA 4PM8A 1G68A 4NK3A 1FCMA 5HFOA 3CG5A 3E2KA 4ZJ3A 1ZC2A 5FATA 1BLHA 4JBFA 1L0EA 3N6IA 1I2SA 1ONGA 5CHMA 2XEPA 1ES2A 1FSYA 1K38A 1L0GA 1RGZA 3QNBA 3V3SA 5FASA 3BLMA 1RP5A 5AQ9A 1U60A 3OC2A 1BUEA 4DDSA 4RA7A 4N9KA 1W5DA 2UWXA 3HL9A 4P87A 3PBRA 2G2WA 4XUZA 5A91A 1ESUA 3UN7A 4OQIA 1YLTA 1C3BA 2Y2KA 3C4PA 3LEZA 1Y54A 3Q07A 3GQZA 4BLMA 1IYOA 3HLDA 1ALQA 1NZUA 1FSWA 1XKZA 3GR2A 4NETA 4PM6A 5CECA 3HLCA 5CERA 3BFCA 3IXHA 1GCEA 3W8KA 2WZXA 3SH8A 3V50A 1I2WA 2JE5A 5KSCA 1K55C 2ZQCA 4WEJA 2ZM2A 4GDBA 3IXDA 4WYYA 2EX9A 3N8SA 1IKIA 3SH7A 3TG9A 2X71A 3CMZA 1IEMA 4R4SA 1GHPA 2FFFB 5EE8A 1MKIA 4IBXA 4OKPA 4YFMA 3WS2A 4KZ5A 3P09A 4LCMA 4XXRA 4QHCA 1JTDA 3B3XA 1BLCA 1TDGA 1MPLA 1PI4A 3FWLA 4HBUA 4N1HA 4DF6A 4U0TA 2A49A 4K0XA 3MXRA 4S2MA 1PIOA 4WZ5A 3O88A 3A3IA 2ZD8A 2WK0A 3O3VA 4FH4A 4KZBA 4U3TA 1CEGA 3IF6C 4WEKA 5GLDA 4D2OA 2FFYA 4HESA 1KGFA 3BFFA 4EBNA 4A5RA 5EOEA 3DTMA 3M2KA 4OPQA 4S2NC 5GL9A 3BM6A 2PU2A 3N8LA 4LV1A 4WELA 1YLPA 2XK1A 1Z6FA 2ZMAA 3SH9A 3ZG0A 3VP1A 4DE3A 2VGKA 4WBGA 2Y2HA 1DY6A 1Q2PA 5EECA 2ZC4B 4ZJ1A 5BOHA 1LHYA 4UA9A 4X69A 4OP8A 3W4QA 3HLBA 3PBOA 4GNUA 4UA7A 3CZDA 2P9VA 4OOMA 1H5XA 4WM9A 1XGJA 5CGSA 5FI2A 1BTLA 5E2EA 5FQQA 2OV5A 3ZG7B 3ZG8B 4EUZA 4LV2A 1PWCA 3NY4A 3UDIA 1GA9A 1K6SA 2ZC5B 4KENB 2C6WB 4OQ0A 1KDSA 4FH2A 1AXBA 1O7EA 1XP4A 3NCKA 3TOIA 3FKVA 1MXOA 3IH8A 1YMSA 3ISGA 4R4RA 5GHXA 3SS3A 3A3JA 3PAEA 3S4XA 3ZHHA 5J8XA 3BLSA 2XDMA 3C4OA 3C7UA 5IHVA 3WRTA 2B5RA 1HD8A 2P9VB 3GRJA 4GD8A 1NJ4A 1DJCA 3AGEA 4LV0A 3A3EA 4MBFA 5A93A 4S2PA 4ZBEA 3UY6A 4EV4A 1IYSA 3M6HA 4X6TA 4KZ8A 4OONA 3IXBA 3PBNA 4Y7PA 3WS5A 3HUMA 1KE0A 1K56D 5CTMA 4DXCA 4E3MA 1QMFA 2H0TA 5JYOA 5E2GA 3UDFA 3GMWA 4GD6A 4GZBA 3ZDJA 1K4FA 1BULA 5FAQA 1K25A 5KZHA 1YT4A 3WS1A 4E3KA 2WAFA 2IWBA 3Q7ZA 2ZLYA 3HLWA 3G32A 5GHZA 3IF6A 1JWPA 5EVID 5FQJA 3BFGA 4BJPA 3IWQA 3LY3A 2Z2MB 2R9WA 4ZJ2A 1K57A 2P74A 3O87A 4E3OA 5FAPA 1MWUA 4IBRA 4L0LA 3S1YA 5FQIA 1ZG6A 3NI9A 1ESIA 1HVBA 4ZAMA 3PBQA 1W8QA 3PTEA 5A92A 4JKTA 1KDWA 5CTNA 2WGWB 4PMAA 2EFUA 2XD1A 2X02A 3RXXA 2BG1A 1HZOA 3LO7A 3MZEA 4GOGA 4ID4A 3UNWA 1L0DA 1NY0A 1SKFA 3A3FA 4OP5A 4OOLA 5EUAA 4BD1A 5TGFA 4P6BA 3TSGA 1FQGA 2Q9MA 1WYCA 3MZFA 3DWZA 1RGYA 4IVIA 1YLWA 2ZM8A 4KZ4A 3N4IA 1XX2A 3M2JA 4CJNA 3NDGA 2Y2MA 1KVLA 1CK3A 1L2SA 4B88A 3IHAA 1NYMA 2HDSA 2EXBA 5HW3A 2PBYA 5DF7A 2BLSA 4RX2A 3ITAA 4MBKA 4KQRA 4RX3A 1FR6A 1GHIA 1OMEA 3BECA 3P98A 4GDNA 3GVBA 4JXGA 4YINA 1SDNA 2OLUA 2Y2QA 4DE2A 4PM5A 1LI0A 2EX6A 4LV3A 4BENA 4R3BA 1Q2QA 4S2OA 3CJMA 4ZDXA 1KE3A 2ZQAA 5AQBA 1XA7A 1S6RA 4JXVA 5GHYA 3VFFA 3ZVTA 2ZC6B 5CGWA 5CEDA 3V3RA 1YMXA 3ZG5A 2WAEA 3ITBA 5DF8A 4OVDA 4EQIA 1ES3A 2VGJA 3ZCZA 4UHUA 3FKWA 2ZC3B 3IT9A 4JPMA 4E6WA 4N1XA 4S2IA 1W79A 3V5MA 3SS5A 1YLJA 4JXWA 1NZOA 2XLNA 4C75A 3HVFA 5EVIA 3RJUA 3VP0A 1DJBA 3C7VA 3OCNA 5M19A 1BZAA 4BD0A 5FQMA 1CEFA 4KG6A 2EX2A 2DNSA 2HP6A 1LLBA 1M6KA 3UE0A 2H5SA 4GN2A 4LENA 5EVLA 5EVIC 1ES4A 3QNCA 2H10A 5HARA 4DKIA 2H0YA 2WUQA 5U47A 3EQUA 4F94A 5A90A 5F1FA 5CRFA 1K56A 4E3JA 2IWDA 1K4EA 5DF9A 2EXAA 5EPHA 3WS4A 3IXGA 4IEDA 5TFQA 2Y2NA 2JC7A 4N92A 3ZG9B 4O7DA 2J9OA 3IF6B 2HDUA 3BFEA 3SOIA 5CHUA 2HP5A 2OSUA 4X68A 1PZPA 3G2ZA 1JVJA 4FCFA 4ZTKA 3VP4A 5FDHA 4DE0A 3IHBA 4KZ7A 2Y2LA 3UO9A 1RCJA 2WGWA 2WKIA 1K6RA 3FZCA 4JF4A 3UPOA 5JYPA 1PW8A 4MEZA 1W8YA 3OPRA 1W7FA 4KZ6A 3AGFA 2Y4AA 2V2FF 1BSGA 4Q8IA 5CXWA 4IVKA 4FD8A 3S22A 4R23A 1PI5A 2A3UA 3G35A 4DXBA 1EROA 4OOYA 3UDXA 4U0XA 5L2FA 4RVAA 4BL3A 3EQVA 1N9BA 1G6AA 3NDEA 4GKUA 4QJGA 1JWVA 4OQHA 4WZ4A 2XH9A 4WMCD 4KG5A 4DRTA 3UE3A 5I94A 4HBTA 3C5AA 1XXMA 4DE1A 3RXWA 5GLCA 2RL3A 5HX9A 1JWZA 3HREA 1N4OA 4Z9QA 4KZ9A 2J8YA 4PM9A 3VOZA 1KGEA 2Y2GA 2XF3A 2JCHA 5HAPA 3A3DA 3PBSA 3NIAA 1PWDA 5FAOA 5M18A 2Y91A 4B4XA 4C3QA 5TR7A 4JXSA 2Y59A 1S0WA 4K91A 4K0WA 2J7VA 3Q1FA 4MBHA 4OPZA 3OCLA 1PZOA 2HP9A 3MKFA 2Y2PA 3MFDA 3V39A 2WKEA 2OLVA 2ZQ7A 1IELA 3GV9A 3VSLA 1MY8A 2ZC7A 4JF5A 3D4FA 3OPHA 3VMAA 4EBLA 1E4DA 4P0MA 5CHJA 5DTTA 2Y2JA 5CGXA 3N7WA 1EWZA 4R1GA 4FSFA 5F82A 1PYYA 2XD5A 4Y0UA 1WYBA 4H8RA 4UAAA 2EFXA 2ZQ9A 3BEBA 1LL9A 4Y0OA 4OPRA 1L0FA 3HBRA 2XFSA 2Y2IA 4HEFA 4BQMA 3NBLA 2XQZA 2QZ6A 2Y55A 4WMCA 2Z2LB 3G4PA 4OLDA 2CC1A 1QMEA 3IWOA 5FI7A 2R9XA 1ERMA 2DCFA 4QY6A 5AQAA 3MKEA 3ZVWA 3MXSA 4QY5A 4EWFA 2WGVA 1LL5A 2WZZA 1CI8A 3LCEA 1H8ZA 3IQAA 2ZJ9A 4KQQA 1FCNA 1I5QA 4M3KA 3GTCA 5GLBA 3NC8A 1BLSA 5F1GA 4C6YA 5F83A 2ZM0A 3IWIA 4R3JA 1FCOA 1CI9A 1MWSA 5CEBA 2XFTA 1TDLA 2ZQDA 1VQQA 2J9PA 3ZGAB 3HLFA 5M1AA 4MLLA 1K54A 2RCXA 2DRWA 3UPPA 1FR1A 1K57C 2V20A 4X53A 3I7JA 2Q9NA 2HPBA 2WYXA 3DWKA 4E3LA 1H8YA 1NRFA 1WE4A 1FOFA
chains in the Genus database with same CATH superfamily
1KOUA 1VEUA 1UWNX 1H3QA 2XR0A 3VP2A 1O07A 5IT5A 2INWA 1K54C 2WKHA 1UWPX 5HAIA 4DN0A 1MWRA 1ES5A 3N8RA 4P85A 4N9LA 4OQGA 3BFDA 4P6ZS 4S2NA 3FC7A 1KGGA 4KQOA 3UPNA 3QP4A 5AQ7A 3E0YA 3MSHA 2C5WB 3IH9A 3ULFA 3KX0X 1KVMA 3G2YA 3LY4A 1TVFA 3G31A 4KZAA 1YKDA 2P7JA 4BBUA 4EW7A 4Y0TA 3IBRA 2G2UA 4BWIA 1KE4A 4HOIA 5E43A 2VV8A 4OH0A 1IKGA 3LGOA 4WZ5C 3S7NA 4QPRA 1PWGA 3DW0A 2I72A 3T4KA 3SS4A 2FH5A 3E2LA 4UQIS 3TJZC 2XGNA 5HL1A 5D3OA 1D06A 1MBLA 2HDRA 4MNRA 2QKPA 2ZQ8A 3Q7VA 1G68A 4NK3A 1FCMA 1ZTUA 3C38A 1VEUB 5FATA 1CQAA 4G3VA 2BASA 1ONGA 3VV4A 1FSYA 1L0GA 1RP5A 1ODVA 2DMWA 5IU1A 4RA7A 2UWXA 1ESUA 4HP4A 5AJGA 4HI4A 4ME4A 3Q07A 2HV1A 1ALQA 1XKZA 1NLZA 3HLCA 4WUJA 3LFVA 4LPZA 4EUVA 3C2WA 3V50A 4CLCE 3TW8A 4GDBA 1TS8A 1OT6A 3IXDA 3F1NB 3N8SA 2WKPA 3SH7A 3T4OA 3UB6A 2PAVP 1GHPA 1GSXA 5EE8A 4DMZA 1MKIA 4QHCA 2K31A 5IS1A 1BLCA 3FWLA 4N1HA 5EVEA 4DF6A 2V8FA 2A49A 4K0XA 4WZ5A 3MFXA 3PXPA 4NG2A 5HWTA 4EBNA 3BFFA 3MXQA 5EOEA 3CLOA 4OPQA 3BM6A 4WELA 1W63Q 2A24A 4DJ2A 2VGKA 4EU0A 2OWJA 3W4QA 4GNUA 4LRYC 2FZ0A 2M7VA 3LIEA 2Y79A 1H5XA 3QP5A 4AFIA 2J80A 1BTLA 4EUZA 2OV5A 3UDIA 5F68A 4OQ0A 2CMNA 3TOIA 3LICA 4R4RA 3SS3A 4HHDA 3A3JA 3PAEA 1OTEA 2L4RA 2XDMA 3WRTA 4X69A 3GRJA 4MBFA 5A93A 3UY6A 4PKYA 3PBNA 3IBJA 4E3MA 1K56D 4NXBA 2H0TA 3PR6A 2Z6DA 1K25A 5KZHA 1DP6A 3HLWA 3G32A 5GHZA 4JGOA 1JWPA 1T1BA 5EVID 3BFGA 2VK3A 2Z2MB 2R9WA 2P74A 5FAPA 4L0LA 2PD8A 2B95A 1ZG6A 4CLCA 4FTXA 1W8QA 3K2NA 2WGWB 4GS9B 3RXXA 4FUWA 4GJ4A 4GOGA 1NY0A 1SKFA 5KIZA 3MZFA 1WYCA 1RGYA 3KSGA 3NDGA 3NJAA 1KVLA 1L2SA 4B88A 3KYEA 3IHAA 4PAUA 4WN5A 4II7A 2PBYA 5DF7A 3ITAA 4RX3A 1FR6A 1OMEA 5EM0A 4YINA 2OLUA 2Y2QA 1LI0A 2EX6A 5J4EA 4JXVA 4LFUA 5CGWA 2WAEA 2PBDP 2VGJA 1G28A 3H82A 4S2IA 3SS5A 3HCYA 4X1MA 3T4LA 4UEYA 1NZOA 1S66L 5G4ZA 5M19A 1DJBA 1T1AA 2DNSA 1M6KA 2JN7A 4GN2A 5EVIC 1ES4A 2H0YA 5F1FA 3KSIA 5CRFA 3K3DA 1NLYA 2O99A 4P6ZM 4X68A 4FCFA 2PR5A 4KZ7A 3A0SA 2WKIA 4MEZA 1W8YA 3OPRA 4KZ6A 1G6OA 4R70A 3C8CA 3DAVA 4FD8A 1LSVA 4Q0HA 1XJ6A 1EROA 4OOYA 4BL3A 1GSWA 3KO6A 2QWSA 2VLGA 4GKUA 1JWVA 4KG5A 3UE3A 5I94A 4DE1A 3TRCA 2RL3A 1F5MA 4EERA 1OTAA 3SZTA 3VOZA 1KGEA 3IX8A 4EEUA 1PWDA 2Y91A 4B4XA 4K0WA 4R38A 4OPZA 3OCLA 1PZOA 2HP9A 3V39A 2WKEA 2ZQ7A 1MY8A 3K3CA 5DTTA 2HJEA 3LR0A 3N7WA 2OAQ1 2Z6CA 4GS9A 4UAAA 1S4RA 3VE4A 1LL9A 4OPRA 3KYZA 2PR6A 3LUQA 2NUPC 4HEFA 4BQMA 2QZ6A 3G4PA 1QMEA 5FI7A 2R9XA 2DCFA 4QY6A 3MXSA 4QY5A 3JVUA 4KQQA 1FCNA 1D1JA 3UMDA 5J3WA 4C6YA 5F6AA 2ZM0A 4R3JA 1FCOA 1CI9A 1P9RA 2O9AA 1TDLA 1VQQA 2DRWA 1FR1A 2V20A 4X1LA 2Q9NA 2HPBA 3DBAA 1H8YA 4KQDA 1FOFA 1YPRA 2HGVA 3FPWA 5FA7A 1GHMA 4MDZA 4S2KA 2JKTI 4X55A 1NYYA 1OJ5A 3ZFZA 4G3WA 3JYIA 4JF6A 3ZNTA 1P97A 2QJ5A 3UE1A 1PNEA 1YM1A 1EI5A 2GNXA 2WGIA 3HUNA 2W0NA 1ZHHB 3VOYA 2EX8A 5EOOA 3W4OA 3G30A 3AGDA 1J9MA 3FG8A 3BRMA 3G34A 3WWXA 4YWZA 5FL3A 1ZG4A 2VA0A 2VV7A 3T1SA 4HH2A 1IYQA 1LI9A 1OPXA 4LRXC 1H8MA 2V1AA 2V0UA 4DDYA 1N9NA 4PM7A 1K0KA 2HJ9C 4QB8A 2PU4A 2HDQA 4GCZA 1E25A 4PPRA 1YLYA 5HSQA 3CUEC 4LCLA 4QD4A 2QPNA 5FQKA 1XGIA 5HPFA 2JBFA 3A0RA 4HQAA 4IUHA 1IYPA 4JLFA 4PM8A 5HFOA 3E2KA 4ZJ3A 1ES2A 4X25A 3IS2B 3QNBA 5L07A 3BLMA 1J3WA 3OC2A 4H6JB 3HL9A 4P87A 3UN7A 1V9ZA 4OQIA 3W2ZA 5HWWA 1C3BA 4LGWA 3C4PA 4BLMA 4Y2FA 3T4QA 1FSWA 3GR2A 4PM6A 3VE3A 5CECA 2OAP1 4Y3IA 3BFCA 3IXHA 1I2WA 5L09A 3LEQA 3T1RA 2ZMFA 4WEJA 1BYWA 3CPTB 2EX9A 4GLQA 4R4SA 2VX8A 3WS2A 4K08A 3P09A 4CLCC 1JTDA 1MPLA 2W3FA 1PIOA 5DKKA 4FH4A 4WEKA 4U3TA 5DJUA 3IF6C 2XROA 2FFYA 4HESA 1KGFA 1SZVA 2NUTC 5TBMB 2WKRA 2GJ3A 3H9WA 3M2KA 5GL9A 2PU2A 1YLPA 2VGLS 3E4OA 3SH9A 3ZG0A 3MS6A 3VP1A 5EECA 2ZC4B 1LHYA 3DTIA 4NXGA 2VGLM 3L7HA 3HLBA 3CZDA 1F2KA 1LT0A 3EGDC 5E2EA 3ZG8B 1WA9A 5FQQA 2JKRI 4LV2A 3NY4A 1GA9A 1SKOB 2ZC5B 4KENB 2C6WB 4GHIB 4PKYG 1AXBA 1XP4A 3FKVA 3IH8A 5GHXA 3S4XA 3BLSA 5L10A 3C7UA 2B5RA 1DJCA 4LV0A 2WKQA 4EV4A 1IYSA 3A0VA 3M6HA 4KZ8A 4OONA 3IXBA 3HUMA 1GSVA 5JYOA 3R7WB 3QP8A 4GZBA 3VOLA 1BULA 1YT4A 3S7PA 4LRZE 4B9OA 2ZLYA 3LIAA 3BY8A 3LY3A 4E3OA 4B93A 2M1CA 1HVBA 4ZAMA 1H0MA 3ZQ5A 3LIFA 4IHQA 3PBQA 4BBTA 4JKTA 5HDCA 1CF0A 4PMAA 2XD1A 2X02A 3MZEA 3UNWA 4ESPA 4OP5A 5DJTA 3TSGA 2M7UA 3DWZA 2V0WA 3MJQA 4L9EA 3M2JA 2W27A 2Y2MA 3EEAA 1NYMA 2BLSA 4MBKA 1GHIA 4GDNA 3GVBA 4LV3A 2W1TA 2J3TD 4R3BA 1Q2QA 3T4JA 4I38A 3CJMA 4ZDXA 1KE3A 2ZQAA 1XA7A 5GHYA 4OVDA 4EQIA 2ZC3B 4Y15A 5EFWA 4JPMA 4E6WA 2V9AA 3RJUA 3C7VA 3S7OA 3OCNA 3LR4A 3T4SA 3F1PB 5FQMA 1LLBA 3RH8B 4LENA 5EVLA 3C30A 3QNCA 4F94A 5A90A 3CITA 2GZAA 2JKGA 2IWDA 1K4EA 2VV6A 4IEDA 1TD5A 1P0ZA 4N92A 3ZG9B 1OTBA 4O7DA 2J9OA 2HDUA 5CHUA 2OSUA 1PZPA 4ZTKA 1JVJA 3NOPC 4JGRA 2JKTM 5FDHA 3IHBA 2EWWA 5HD3A 4WF0A 4JF4A 3UPOA 1PW8A 3L9KA 3AGFA 4ETXA 4Q8IA 5HPIA 4RVAA 3EQVA 3EWKA 5HZHA 1V9YA 2I9VA 4WZ4A 2PD7A 3F1OA 3C5AA 3PHYA 3LR5A 5HX9A 3HREA 1NRJA 2Y2GA 2XF3A 2JCHA 3UE6A 3PBSA 3B42A 3IX4A 2Y59A 1S0WA 2J7VA 3Q1FA 2Q0OA 4MN6A 5MC7A 2QJ7A 3VSLA 3D4FA 3OPHA 4EBLA 4P0MA 1EWZA 4I3IA 4FSFA 3ICYA 4Y0UA 1WYBA 2ZQ9A 4Y0OA 2Y2IA 4WMCA 1T18A 2LB5A 1A0KA 3MMHA 3SW1A 3MKEA 2JKRM 4NKPA 3GTCA 5GLBA 5F1GA 5EM1A 1MWSA 2XFTA 2ZQDA 3CI6A 3ZGAB 3BQAA 1K57C 3MQQA 3BW6A 3ISGA 1S4SA 1XA1A 3WS0A 2W1TB 2LB9A 4M4XA 1SHVA 5AVEA 4X56A 1PFLA 3OPPA 2EWVA 1S1ZA 4RYEA 3M6BA 1JTGA 3ZNYA 4XUXA 2WADA 3HUOA 1VETA 4HNBA 4ETZA 5FSRA 4B4ZA 1ONHA 4HJ4A 4Q0IA 3OBFA 3T1XA 1BLPA 3OOVA 1STZA 4BL2A 1TEMA 4S2LA 3GDIA 4S2JA 3FYZA 2QYBA 4QU3A 1DJAA 5EV0A 4NXFA 3BYDA 1E3UD 3GSGA 1YQSA 4E3IA 3Q82A 3HLGA 3HLEA 3EEHA 1OJGA 5GLAA 1SCWA 2XRNA 1VHMA 3MZDA 1PW1A 5KSHA 3F1OB 4HJ6A 1ERQA 5DTSA 2IWCA 3JVVA 1K55A 2QMIA 3R7WA 4UA6A 1DP8A 2X01A 3Q81A 1YAXA 4UQIM 1ZC2A 1L0EA 3N6IA 1I2SA 2W1RA 1RGZA 1MZUA 3V3SA 1G5UA 5FASA 1TS7A 1BUEA 4DDSA 3PYPA 4N9KA 3PBRA 5AVFA 1YLTA 4IUKA 3LEZA 3GQZA 3HLDA 5A8BA 4DJ3A 2OOLA 1GCEA 3W8KA 2WZXA 3SH8A 2JE5A 1K55C 1Z09A 2ZM2A 1DRMA 4WYYA 2ZBBA 5G4YA 2X71A 1HLUP 3MQ0A 1X0OA 2VEAA 3FPVA 4EETB 4Y17A 4HBUA 1TDGA 4U0TA 3O88A 2ZD8A 2WK0A 3O3VA 3S7QA 1CJFA 2ZMVA 2PYRA 4YNRA 4S2NC 3D3OA 3N8LA 3CWFA 1Z6FA 2ZMAA 3F1PA 4DE3A 4WBGA 2Y2HA 1DY6A 1Q2PA 4ZJ1A 4UA9A 1TS6A 3PBOA 2P9VA 4OOMA 5DFYA 4WM9A 1XGJA 2L0WA 5FI2A 3ZG7B 4EXOA 1PWCA 3UB5P 1KDSA 4FH2A 4LLOB 1O7EA 1MXOA 3ZHHA 4F3LB 3C4OA 5IHVA 2P9VB 1NJ4A 3AGEA 3A3EA 4NXEA 4S2PA 4ZBEA 3HJKA 2J3WA 4Z1WA 2UV0E 2Y8HA 4Y7PA 4Q0JA 5CTMA 1QMFA 3B33A 3D72A 5E2GA 3UDFA 3GMWA 4GD6A 3ZYTA 1K4FA 3MR0A 4HIAA 2ZOHA 3WS1A 4E3KA 1XJ4A 4JGPA 4GW9A 4QWOA 3IF6A 5FQJA 4BJPA 5F5YA 3IWQA 1MWUA 1TS0A 3NI9A 2XSSA 5HL6A 3PTEA 5A92A 3H7WA 2P04A 1HZOA 3LO7A 2YKFA 3UB7A 4OOLA 5EUAA 4BD1A 2Q9MA 2W3GA 4IVIA 1YLWA 2ZM8A 4KZ4A 1IFQA 1XX2A 5FDSA 2PRFA 4CJNA 1CK3A 1XFQA 3MQOA 4RX2A 4KQRA 4JXGA 4KUOA 1SDNA 4S2OA 2KLIA 3VFFA 1UGUA 5CEDA 1YMXA 3ITBA 5DF8A 3ZCZA 4UHUA 1Y28A 3D9YA 4CLCD 3IT9A 2VKSA 3V5MA 4ARZA 4JXWA 2XLNA 3HVFA 5EVIA 3VP0A 1BZAA 4BD0A 4KG6A 4Y5FA 1XFNA 3NULA 1OT9A 5HARA 3JPUA 4DKIA 2WUQA 5U47A 3EQUA 1K56A 4HH3A 5DF9A 3WS4A 1ACFA 2EXAA 2VJWA 5EPHA 3IXGA 5TFQA 2Y2NA 2JC7A 3IF6B 2K7SA 1SKOA 3H7WB 3G2ZA 3VP4A 1RCJA 3F1NA 1K6RA 4IJGA 3CUEA 3CHWP 4E04A 1FILA 3QP2A 1W7FA 2K2NA 1DP9A 2Y4AA 2V2FF 1BSGA 2ZOIA 1PI5A 2A3UA 5L2FA 3TE8A 3UDXA 1EW0A 4YOFA 1XJ3A 3NDEA 4WMCD 4DRTA 1S1YA 4HBTA 1MC0A 3RXWA 5GLCA 1JWZA 1FIKA 4KZ9A 2L1MA 2O0YA 4O0PA 4PM9A 3UMEA 5HAPA 3A3DA 4XT2B 5FAOA 3HJIA 4C3QA 5TR7A 1VETB 4JXSA 4K91A 4CQHA 2Y2PA 3GV9A 3P7NA 2ZC7A 3VMAA 3E98A 2Y2JA 5CGXA 2D01A 2A2LA 4R1GA 2VZWA 5FEFA 4H8RA 2EFXA 1L0FA 2XFSA 3T12B 4I3JA 4BMWA 2Y55A 2Z2LB 2CC1A 2G7UA 3IWOA 3G6OA 4MCWA 3H82B 2J3TC 5AQAA 2ZL1B 4NEED 1LL5A 1CI8A 3LCEA 1H8ZA 3IQAA 2ZJ9A 4MMNA 1I5QA 3NC8A 5F83A 4GHIA 5TJJA 2J9PA 2XA7S 5M1AA 1K54A 3U2AA 3UPPA 4X53A 1NRFA 1M40A 4KZ3A 3OZHA 4WL9A 4MN5A 3FV7A 3E4PA 2GDNA 5HAQA 1VM1A 2Y2OA 3LIDA 3P01A 4GB7A 1E3UA 1ZKJA 3PAGA 4O8GA 3VSKA 5KMWA 3NOTC 3WRZA 1XPBA 4KG2A 5EVIB 2E8IA 1SDEA 4G3KA 4WLAA 5DTKA 5E2HA 1NXYA 4OLGA 4R3AA 3MBZA 3Q7VB 3R4KA 5FI6A 5DVAA 3KSHA 5FQ9A 3VP3A 2V1ZA 3T1QB 2JHEA 1YLZA 3E4QA 3W4PA 1GA0A 2V8CA 4EBPA 3IF5A 3O86A 4E3NA 1F9IA 2P08A 3VFHA 5DKLA 5G18A 3BWLA 2PHYA 4E6XA 3PBTA 1BT5A 4F3LA 3CPTA 1TF1A 3OPLA 4R0QA 3BJNA 1MWTA 5E2FA 1HTZA 4OPYA 4I39A 4CPKA 1D7EA 3QHYA 5C5KA 5F69A 2KDKA 2PT7A 3DTEA 1LSWA 3CG5A 1BLHA 4JBFA 2GX5A 4O01A 5CHMA 2XEPA 1K38A 5CX7A 5AQ9A 1U60A 2B02A 4XT2A 1W5DA 2G2WA 4XUZA 2JKFA 5HDDA 5A91A 4Y13A 2Y2KA 3EGXC 1Y54A 2QHKA 1IYOA 4R6LA 3T4TA 1NZUA 3NHQA 2A24B 4NETA 5CERA 5KSCA 1P9WA 3CAXA 2ZQCA 3KSFA 2OWHA 1IKIA 3TG9A 5HWVA 4EESA 3CMZA 1IEMA 2FFFB 1Y4OA 2W3DA 4IBXA 4OKPA 4YFMA 4KZ5A 4LCMA 4XXRA 3B3XA 1PI4A 3LYXA 3MXRA 4S2MA 3A3IA 4KZBA 1CEGA 4D2OA 5GLDA 3B47A 4A5RA 3LI8A 3DTMA 2XK1A 4I3AA 5BOHA 3LI9A 4OP8A 4UA7A 3GECA 5CGSA 1IOUA 3QP6A 1K6SA 3DTKA 4CLCB 3NCKA 1YMSA 5J7EA 4ZRRA 1N9LA 5J8XA 1HD8A 4GD8A 1S67L 4X6TA 2W3EA 2O9BA 3WS5A 3EOIA 4DXCA 1KE0A 3UB9A 1YSPA 3ZDJA 5FAQA 1LL8A 2WAFA 2IWBA 3Q7ZA 4ZJ2A 1K57A 3O87A 4IBRA 1XJ2A 3S1YA 2E8JA 5FQIA 3KYQA 1ESIA 4I5SA 4H6JA 3NOUC 4MN7A 1KDWA 5CTNA 4L9GA 2EFUA 2BG1A 1NWZA 2ACGA 3IX3A 1L0DA 4ID4A 3A3FA 5TGFA 4P6BA 3UB8A 1FQGA 5HDSA 3N4IA 1N9OA 2HF6A 2HDSA 2EXBA 2HZ5A 5HW3A 3RTYA 3P98A 3BECA 4PM5A 4DE2A 4BENA 1T19A 2KX6A 5AQBA 2D02A 4ARZB 2BTFP 1S6RA 3ZVTA 2ZC6B 3V3RA 5HD5A 3ZG5A 1ES3A 2ZL1A 2O9CA 2EA9A 3FKWA 1T1CA 4N1XA 1W79A 1YLJA 4C75A 4HY8A 2XA7M 1CEFA 2EX2A 2HP6A 3UE0A 3NECA 2H5SA 3O5YA 4KUKA 2H10A 4E3JA 4L9FA 1PRQA 1LSXA 3U4LP 1VB6A 1JNUA 3SOIA 3BFEA 2HP5A 1W63M 1YSQA 4DE0A 3UO9A 2Y2LA 2WGWA 2R78A 3FZCA 5JYPA 1OTDA 5L8MA 2MJ6A 2PDRA 5CXWA 4IVKA 1OTIA 3S22A 4R23A 3G35A 4DXBA 4U0XA 3MF0A 4HP9A 1N9BA 2W3HA 1G6AA 4PHTA 5TBMA 4QJGA 4OQHA 2XH9A 4BBVA 1XXMA 2B18A 1N4OA 4Z9QA 4EQ1A 2J8YA 1F98A 3NIAA 2H28A 5M18A 2IA2A 3T50A 4MBHA 1MKMA 2AVXA 3MKFA 3MFDA 3OLOA 2OLVA 1IELA 4JF5A 3QP1A 4RQ9A 1E4DA 2PYPA 5CHJA 5DFXA 5F82A 1PYYA 2XD5A 3RFBA 3V67A 3BEBA 1L3LA 2KOIA 3HBRA 3IS2A 5LBRA 3NBLA 4EEPA 2XQZA 3LIBA 4OLDA 5I5LA 3LR3A 4FOFA 1ERMA 4HJ3A 3ZVWA 2YKHA 4EWFA 3BQ8A 2WGVA 4D60A 2WZZA 1AWIA 4M3KA 5K5BA 1BLSA 3BY9A 3IWIA 5CEBA 2V1BA 3HLFA 5FEGA 4MLLA 2RCXA 4JGQA 3I7JA 2WYXA 3DWKA 4E3LA 4LV1A 1WE4A
chains in the Genus database with same CATH topology
3WS0A 1XA1A 1M40A 4KZ3A 5FA7A 1GHMA 3OZHA 2XR0A 1SHVA 3FV7A 3VP2A 4S2KA 1O07A 4X55A 1NYYA 4X56A 1K54C 2WKHA 2GDNA 3OPPA 5HAIA 3ZFZA 1MWRA 1ES5A 5HAQA 3N8RA 4RYEA 4P85A 1VM1A 4N9LA 2Y2OA 3M6BA 4OQGA 3BFDA 1JTGA 4S2NA 3ZNYA 4XUXA 1KGGA 2WADA 3HUOA 4KQOA 3UPNA 4GB7A 3JYIA 4JF6A 5AQ7A 3ZNTA 1E3UA 1ZKJA 5FSRA 3PAGA 2C5WB 3VSKA 4B4ZA 1ONHA 3IH9A 5KMWA 3WRZA 1KVMA 3G2YA 3UE1A 1XPBA 4KG2A 5EVIB 3LY4A 2E8IA 1SDEA 1TVFA 3G31A 4KZAA 5DTKA 1YM1A 5E2HA 1EI5A 1BLPA 1NXYA 4OLGA 2WGIA 4BL2A 1TEMA 3HUNA 3MBZA 3Q7VB 3VOYA 4S2LA 2EX8A 5EOOA 3W4OA 4Y0TA 3G30A 5FI6A 3AGDA 1J9MA 4S2JA 3FYZA 3BRMA 3G34A 2V1ZA 5DVAA 4QU3A 5FQ9A 1DJAA 3VP3A 3WWXA 2G2UA 1YLZA 1ZG4A 3W4PA 1GA0A 1KE4A 1IYQA 1LI9A 4EBPA 3IF5A 3O86A 4E3NA 4DDYA 3BYDA 4PM7A 5E43A 3VFHA 1E3UD 4OH0A 5G18A 1IKGA 4QB8A 2PU4A 2HDQA 4WZ5C 3GSGA 1YQSA 4E3IA 4E6XA 1E25A 3PBTA 3Q82A 1YLYA 4PPRA 3HLGA 3HLEA 1PWGA 5GLAA 1BT5A 1SCWA 3DW0A 3MZDA 4LCLA 4QD4A 2QPNA 1PW1A 3OPLA 4R0QA 5KSHA 1MWTA 5E2FA 2I72A 5FQKA 1XGIA 1HTZA 1ERQA 3SS4A 3E2LA 4OPYA 5DTSA 2IWCA 4CPKA 2XGNA 2JBFA 1K55A 5HL1A 3QHYA 2QMIA 5D3OA 4UA6A 1MBLA 2X01A 2HDRA 1IYPA 3Q81A 4MNRA 4JLFA 2ZQ8A 3Q7VA 4PM8A 1G68A 4NK3A 1FCMA 5HFOA 3CG5A 3E2KA 4ZJ3A 1ZC2A 5FATA 1BLHA 4JBFA 1L0EA 3N6IA 1I2SA 1ONGA 5CHMA 2XEPA 1ES2A 1FSYA 1K38A 1L0GA 1RGZA 3QNBA 3V3SA 5FASA 3BLMA 1RP5A 5AQ9A 1U60A 3OC2A 1BUEA 4DDSA 4RA7A 4N9KA 1W5DA 2UWXA 3HL9A 4P87A 3PBRA 2G2WA 4XUZA 5A91A 1ESUA 3UN7A 4OQIA 1YLTA 1C3BA 2Y2KA 3C4PA 3LEZA 1Y54A 3Q07A 3GQZA 4BLMA 1IYOA 3HLDA 1ALQA 1NZUA 1FSWA 1XKZA 3GR2A 4NETA 4PM6A 5CECA 3HLCA 5CERA 3BFCA 3IXHA 1GCEA 3W8KA 2WZXA 3SH8A 3V50A 1I2WA 2JE5A 5KSCA 1K55C 2ZQCA 4WEJA 2ZM2A 4GDBA 3IXDA 4WYYA 2EX9A 3N8SA 1IKIA 3SH7A 3TG9A 2X71A 3CMZA 1IEMA 4R4SA 1GHPA 2FFFB 5EE8A 1MKIA 4IBXA 4OKPA 4YFMA 3WS2A 4KZ5A 3P09A 4LCMA 4XXRA 4QHCA 1JTDA 3B3XA 1BLCA 1TDGA 1MPLA 1PI4A 3FWLA 4HBUA 4N1HA 4DF6A 4U0TA 2A49A 4K0XA 3MXRA 4S2MA 1PIOA 4WZ5A 3O88A 3A3IA 2ZD8A 2WK0A 3O3VA 4FH4A 4KZBA 4U3TA 1CEGA 3IF6C 4WEKA 5GLDA 4D2OA 2FFYA 4HESA 1KGFA 3BFFA 4EBNA 4A5RA 5EOEA 3DTMA 3M2KA 4OPQA 4S2NC 5GL9A 3BM6A 2PU2A 3N8LA 4LV1A 4WELA 1YLPA 2XK1A 1Z6FA 2ZMAA 3SH9A 3ZG0A 3VP1A 4DE3A 2VGKA 4WBGA 2Y2HA 1DY6A 1Q2PA 5EECA 2ZC4B 4ZJ1A 5BOHA 1LHYA 4UA9A 4X69A 4OP8A 3W4QA 3HLBA 3PBOA 4GNUA 4UA7A 3CZDA 2P9VA 4OOMA 1H5XA 4WM9A 1XGJA 5CGSA 5FI2A 1BTLA 5E2EA 5FQQA 2OV5A 3ZG7B 3ZG8B 4EUZA 4LV2A 1PWCA 3NY4A 3UDIA 1GA9A 1K6SA 2ZC5B 4KENB 2C6WB 4OQ0A 1KDSA 4FH2A 1AXBA 1O7EA 1XP4A 3NCKA 3TOIA 3FKVA 1MXOA 3IH8A 1YMSA 3ISGA 4R4RA 5GHXA 3SS3A 3A3JA 3PAEA 3S4XA 3ZHHA 5J8XA 3BLSA 2XDMA 3C4OA 3C7UA 5IHVA 3WRTA 2B5RA 1HD8A 2P9VB 3GRJA 4GD8A 1NJ4A 1DJCA 3AGEA 4LV0A 3A3EA 4MBFA 5A93A 4S2PA 4ZBEA 3UY6A 4EV4A 1IYSA 3M6HA 4X6TA 4KZ8A 4OONA 3IXBA 3PBNA 4Y7PA 3WS5A 3HUMA 1KE0A 1K56D 5CTMA 4DXCA 4E3MA 1QMFA 2H0TA 5JYOA 5E2GA 3UDFA 3GMWA 4GD6A 4GZBA 3ZDJA 1K4FA 1BULA 5FAQA 1K25A 5KZHA 1YT4A 3WS1A 4E3KA 2WAFA 2IWBA 3Q7ZA 2ZLYA 3HLWA 3G32A 5GHZA 3IF6A 1JWPA 5EVID 5FQJA 3BFGA 4BJPA 3IWQA 3LY3A 2Z2MB 2R9WA 4ZJ2A 1K57A 2P74A 3O87A 4E3OA 5FAPA 1MWUA 4IBRA 4L0LA 3S1YA 5FQIA 1ZG6A 3NI9A 1ESIA 1HVBA 4ZAMA 3PBQA 1W8QA 3PTEA 5A92A 4JKTA 1KDWA 5CTNA 2WGWB 4PMAA 2EFUA 2XD1A 2X02A 3RXXA 2BG1A 1HZOA 3LO7A 3MZEA 4GOGA 4ID4A 3UNWA 1L0DA 1NY0A 1SKFA 3A3FA 4OP5A 4OOLA 5EUAA 4BD1A 5TGFA 4P6BA 3TSGA 1FQGA 2Q9MA 1WYCA 3MZFA 3DWZA 1RGYA 4IVIA 1YLWA 2ZM8A 4KZ4A 3N4IA 1XX2A 3M2JA 4CJNA 3NDGA 2Y2MA 1KVLA 1CK3A 1L2SA 4B88A 3IHAA 1NYMA 2HDSA 2EXBA 5HW3A 2PBYA 5DF7A 2BLSA 4RX2A 3ITAA 4MBKA 4KQRA 4RX3A 1FR6A 1GHIA 1OMEA 3BECA 3P98A 4GDNA 3GVBA 4JXGA 4YINA 1SDNA 2OLUA 2Y2QA 4DE2A 4PM5A 1LI0A 2EX6A 4LV3A 4BENA 4R3BA 1Q2QA 4S2OA 3CJMA 4ZDXA 1KE3A 2ZQAA 5AQBA 1XA7A 1S6RA 4JXVA 5GHYA 3VFFA 3ZVTA 2ZC6B 5CGWA 5CEDA 3V3RA 1YMXA 3ZG5A 2WAEA 3ITBA 5DF8A 4OVDA 4EQIA 1ES3A 2VGJA 3ZCZA 4UHUA 3FKWA 2ZC3B 3IT9A 4JPMA 4E6WA 4N1XA 4S2IA 1W79A 3V5MA 3SS5A 1YLJA 4JXWA 1NZOA 2XLNA 4C75A 3HVFA 5EVIA 3RJUA 3VP0A 1DJBA 3C7VA 3OCNA 5M19A 1BZAA 4BD0A 5FQMA 1CEFA 4KG6A 2EX2A 2DNSA 2HP6A 1LLBA 1M6KA 3UE0A 2H5SA 4GN2A 4LENA 5EVLA 5EVIC 1ES4A 3QNCA 2H10A 5HARA 4DKIA 2H0YA 2WUQA 5U47A 3EQUA 4F94A 5A90A 5F1FA 5CRFA 1K56A 4E3JA 2IWDA 1K4EA 5DF9A 2EXAA 5EPHA 3WS4A 3IXGA 4IEDA 5TFQA 2Y2NA 2JC7A 4N92A 3ZG9B 4O7DA 2J9OA 3IF6B 2HDUA 3BFEA 3SOIA 5CHUA 2HP5A 2OSUA 4X68A 1PZPA 3G2ZA 1JVJA 4FCFA 4ZTKA 3VP4A 5FDHA 4DE0A 3IHBA 4KZ7A 2Y2LA 3UO9A 1RCJA 2WGWA 2WKIA 1K6RA 3FZCA 4JF4A 3UPOA 5JYPA 1PW8A 4MEZA 1W8YA 3OPRA 1W7FA 4KZ6A 3AGFA 2Y4AA 2V2FF 1BSGA 4Q8IA 5CXWA 4IVKA 4FD8A 3S22A 4R23A 1PI5A 2A3UA 3G35A 4DXBA 1EROA 4OOYA 3UDXA 4U0XA 5L2FA 4RVAA 4BL3A 3EQVA 1N9BA 1G6AA 3NDEA 4GKUA 4QJGA 1JWVA 4OQHA 4WZ4A 2XH9A 4WMCD 4KG5A 4DRTA 3UE3A 5I94A 4HBTA 3C5AA 1XXMA 4DE1A 3RXWA 5GLCA 2RL3A 5HX9A 1JWZA 3HREA 1N4OA 4Z9QA 4KZ9A 2J8YA 4PM9A 3VOZA 1KGEA 2Y2GA 2XF3A 2JCHA 5HAPA 3A3DA 3PBSA 3NIAA 1PWDA 5FAOA 5M18A 2Y91A 4B4XA 4C3QA 5TR7A 4JXSA 2Y59A 1S0WA 4K91A 4K0WA 2J7VA 3Q1FA 4MBHA 4OPZA 3OCLA 1PZOA 2HP9A 3MKFA 2Y2PA 3MFDA 3V39A 2WKEA 2OLVA 2ZQ7A 1IELA 3GV9A 3VSLA 1MY8A 2ZC7A 4JF5A 3D4FA 3OPHA 3VMAA 4EBLA 1E4DA 4P0MA 5CHJA 5DTTA 2Y2JA 5CGXA 3N7WA 1EWZA 4R1GA 4FSFA 5F82A 1PYYA 2XD5A 4Y0UA 1WYBA 4H8RA 4UAAA 2EFXA 2ZQ9A 3BEBA 1LL9A 4Y0OA 4OPRA 1L0FA 3HBRA 2XFSA 2Y2IA 4HEFA 4BQMA 3NBLA 2XQZA 2QZ6A 2Y55A 4WMCA 2Z2LB 3G4PA 4OLDA 2CC1A 1QMEA 3IWOA 5FI7A 2R9XA 1ERMA 2DCFA 4QY6A 5AQAA 3MKEA 3ZVWA 3MXSA 4QY5A 4EWFA 2WGVA 1LL5A 2WZZA 1CI8A 3LCEA 1H8ZA 3IQAA 2ZJ9A 4KQQA 1FCNA 1I5QA 4M3KA 3GTCA 5GLBA 3NC8A 1BLSA 5F1GA 4C6YA 5F83A 2ZM0A 3IWIA 4R3JA 1FCOA 1CI9A 1MWSA 5CEBA 2XFTA 1TDLA 2ZQDA 1VQQA 2J9PA 3ZGAB 3HLFA 5M1AA 4MLLA 1K54A 2RCXA 2DRWA 3UPPA 1FR1A 1K57C 2V20A 4X53A 3I7JA 2Q9NA 2HPBA 2WYXA 3DWKA 4E3LA 1H8YA 1NRFA 1WE4A 1FOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WS0 A;  1XA1 A;  1M40 A;  4KZ3 A;  5FA7 A;  1GHM A;  3OZH A;  2XR0 A;  1SHV A;  3FV7 A;  3VP2 A;  4S2K A;  1O07 A;  4X55 A;  1NYY A;  4X56 A;  1K54 C;  2WKH A;  2GDN A;  3OPP A;  5HAI A;  3ZFZ A;  1MWR A;  1ES5 A;  5HAQ A;  3N8R A;  4RYE A;  4P85 A;  1VM1 A;  4N9L A;  2Y2O A;  3M6B A;  4OQG A;  3BFD A;  1JTG A;  4S2N A;  3ZNY A;  4XUX A;  1KGG A;  2WAD A;  3HUO A;  4KQO A;  3UPN A;  4GB7 A;  3JYI A;  4JF6 A;  5AQ7 A;  3ZNT A;  1E3U A;  1ZKJ A;  5FSR A;  3PAG A;  2C5W B;  3VSK A;  4B4Z A;  1ONH A;  3IH9 A;  5KMW A;  3WRZ A;  1KVM A;  3G2Y A;  3UE1 A;  1XPB A;  4KG2 A;  5EVI B;  3LY4 A;  2E8I A;  1SDE A;  1TVF A;  3G31 A;  4KZA A;  5DTK A;  1YM1 A;  5E2H A;  1EI5 A;  1BLP A;  1NXY A;  4OLG A;  2WGI A;  4BL2 A;  1TEM A;  3HUN A;  3MBZ A;  3Q7V B;  3VOY A;  4S2L A;  2EX8 A;  5EOO A;  3W4O A;  4Y0T A;  3G30 A;  5FI6 A;  3AGD A;  1J9M A;  4S2J A;  3FYZ A;  3BRM A;  3G34 A;  2V1Z A;  5DVA A;  4QU3 A;  5FQ9 A;  1DJA A;  3VP3 A;  3WWX A;  2G2U A;  1YLZ A;  1ZG4 A;  3W4P A;  1GA0 A;  1KE4 A;  1IYQ A;  1LI9 A;  4EBP A;  3IF5 A;  3O86 A;  4E3N A;  4DDY A;  3BYD A;  4PM7 A;  5E43 A;  3VFH A;  1E3U D;  4OH0 A;  5G18 A;  1IKG A;  4QB8 A;  2PU4 A;  2HDQ A;  4WZ5 C;  3GSG A;  1YQS A;  4E3I A;  4E6X A;  1E25 A;  3PBT A;  3Q82 A;  1YLY A;  4PPR A;  3HLG A;  3HLE A;  1PWG A;  5GLA A;  1BT5 A;  1SCW A;  3DW0 A;  3MZD A;  4LCL A;  4QD4 A;  2QPN A;  1PW1 A;  3OPL A;  4R0Q A;  5KSH A;  1MWT A;  5E2F A;  2I72 A;  5FQK A;  1XGI A;  1HTZ A;  1ERQ A;  3SS4 A;  3E2L A;  4OPY A;  5DTS A;  2IWC A;  4CPK A;  2XGN A;  2JBF A;  1K55 A;  5HL1 A;  3QHY A;  2QMI A;  5D3O A;  4UA6 A;  1MBL A;  2X01 A;  2HDR A;  1IYP A;  3Q81 A;  4MNR A;  4JLF A;  2ZQ8 A;  3Q7V A;  4PM8 A;  1G68 A;  4NK3 A;  1FCM A;  5HFO A;  3CG5 A;  3E2K A;  4ZJ3 A;  1ZC2 A;  5FAT A;  1BLH A;  4JBF A;  1L0E A;  3N6I A;  1I2S A;  1ONG A;  5CHM A;  2XEP A;  1ES2 A;  1FSY A;  1K38 A;  1L0G A;  1RGZ A;  3QNB A;  3V3S A;  5FAS A;  3BLM A;  1RP5 A;  5AQ9 A;  1U60 A;  3OC2 A;  1BUE A;  4DDS A;  4RA7 A;  4N9K A;  1W5D A;  2UWX A;  3HL9 A;  4P87 A;  3PBR A;  2G2W A;  4XUZ A;  5A91 A;  1ESU A;  3UN7 A;  4OQI A;  1YLT A;  1C3B A;  2Y2K A;  3C4P A;  3LEZ A;  1Y54 A;  3Q07 A;  3GQZ A;  4BLM A;  1IYO A;  3HLD A;  1ALQ A;  1NZU A;  1FSW A;  1XKZ A;  3GR2 A;  4NET A;  4PM6 A;  5CEC A;  3HLC A;  5CER A;  3BFC A;  3IXH A;  1GCE A;  3W8K A;  2WZX A;  3SH8 A;  3V50 A;  1I2W A;  2JE5 A;  5KSC A;  1K55 C;  2ZQC A;  4WEJ A;  2ZM2 A;  4GDB A;  3IXD A;  4WYY A;  2EX9 A;  3N8S A;  1IKI A;  3SH7 A;  3TG9 A;  2X71 A;  3CMZ A;  1IEM A;  4R4S A;  1GHP A;  2FFF B;  5EE8 A;  1MKI A;  4IBX A;  4OKP A;  4YFM A;  3WS2 A;  4KZ5 A;  3P09 A;  4LCM A;  4XXR A;  4QHC A;  1JTD A;  3B3X A;  1BLC A;  1TDG A;  1MPL A;  1PI4 A;  3FWL A;  4HBU A;  4N1H A;  4DF6 A;  4U0T A;  2A49 A;  4K0X A;  3MXR A;  4S2M A;  1PIO A;  4WZ5 A;  3O88 A;  3A3I A;  2ZD8 A;  2WK0 A;  3O3V A;  4FH4 A;  4KZB A;  4U3T A;  1CEG A;  3IF6 C;  4WEK A;  5GLD A;  4D2O A;  2FFY A;  4HES A;  1KGF A;  3BFF A;  4EBN A;  4A5R A;  5EOE A;  3DTM A;  3M2K A;  4OPQ A;  4S2N C;  5GL9 A;  3BM6 A;  2PU2 A;  3N8L A;  4LV1 A;  4WEL A;  1YLP A;  2XK1 A;  1Z6F A;  2ZMA A;  3SH9 A;  3ZG0 A;  3VP1 A;  4DE3 A;  2VGK A;  4WBG A;  2Y2H A;  1DY6 A;  1Q2P A;  5EEC A;  2ZC4 B;  4ZJ1 A;  5BOH A;  1LHY A;  4UA9 A;  4X69 A;  4OP8 A;  3W4Q A;  3HLB A;  3PBO A;  4GNU A;  4UA7 A;  3CZD A;  2P9V A;  4OOM A;  1H5X A;  4WM9 A;  1XGJ A;  5CGS A;  5FI2 A;  1BTL A;  5E2E A;  5FQQ A;  2OV5 A;  3ZG7 B;  3ZG8 B;  4EUZ A;  4LV2 A;  1PWC A;  3NY4 A;  3UDI A;  1GA9 A;  1K6S A;  2ZC5 B;  4KEN B;  2C6W B;  4OQ0 A;  1KDS A;  4FH2 A;  1AXB A;  1O7E A;  1XP4 A;  3NCK A;  3TOI A;  3FKV A;  1MXO A;  3IH8 A;  1YMS A;  3ISG A;  4R4R A;  5GHX A;  3SS3 A;  3A3J A;  3PAE A;  3S4X A;  3ZHH A;  5J8X A;  3BLS A;  2XDM A;  3C4O A;  3C7U A;  5IHV A;  3WRT A;  2B5R A;  1HD8 A;  2P9V B;  3GRJ A;  4GD8 A;  1NJ4 A;  1DJC A;  3AGE A;  4LV0 A;  3A3E A;  4MBF A;  5A93 A;  4S2P A;  4ZBE A;  3UY6 A;  4EV4 A;  1IYS A;  3M6H A;  4X6T A;  4KZ8 A;  4OON A;  3IXB A;  3PBN A;  4Y7P A;  3WS5 A;  3HUM A;  1KE0 A;  1K56 D;  5CTM A;  4DXC A;  4E3M A;  1QMF A;  2H0T A;  5JYO A;  5E2G A;  3UDF A;  3GMW A;  4GD6 A;  4GZB A;  3ZDJ A;  1K4F A;  1BUL A;  5FAQ A;  1K25 A;  5KZH A;  1YT4 A;  3WS1 A;  4E3K A;  2WAF A;  2IWB A;  3Q7Z A;  2ZLY A;  3HLW A;  3G32 A;  5GHZ A;  3IF6 A;  1JWP A;  5EVI D;  5FQJ A;  3BFG A;  4BJP A;  3IWQ A;  3LY3 A;  2Z2M B;  2R9W A;  4ZJ2 A;  1K57 A;  2P74 A;  3O87 A;  4E3O A;  5FAP A;  1MWU A;  4IBR A;  4L0L A;  3S1Y A;  5FQI A;  1ZG6 A;  3NI9 A;  1ESI A;  1HVB A;  4ZAM A;  3PBQ A;  1W8Q A;  3PTE A;  5A92 A;  4JKT A;  1KDW A;  5CTN A;  2WGW B;  4PMA A;  2EFU A;  2XD1 A;  2X02 A;  3RXX A;  2BG1 A;  1HZO A;  3LO7 A;  3MZE A;  4GOG A;  4ID4 A;  3UNW A;  1L0D A;  1NY0 A;  1SKF A;  3A3F A;  4OP5 A;  4OOL A;  5EUA A;  4BD1 A;  5TGF A;  4P6B A;  3TSG A;  1FQG A;  2Q9M A;  1WYC A;  3MZF A;  3DWZ A;  1RGY A;  4IVI A;  1YLW A;  2ZM8 A;  4KZ4 A;  3N4I A;  1XX2 A;  3M2J A;  4CJN A;  3NDG A;  2Y2M A;  1KVL A;  1CK3 A;  1L2S A;  4B88 A;  3IHA A;  1NYM A;  2HDS A;  2EXB A;  5HW3 A;  2PBY A;  5DF7 A;  2BLS A;  4RX2 A;  3ITA A;  4MBK A;  4KQR A;  4RX3 A;  1FR6 A;  1GHI A;  1OME A;  3BEC A;  3P98 A;  4GDN A;  3GVB A;  4JXG A;  4YIN A;  1SDN A;  2OLU A;  2Y2Q A;  4DE2 A;  4PM5 A;  1LI0 A;  2EX6 A;  4LV3 A;  4BEN A;  4R3B A;  1Q2Q A;  4S2O A;  3CJM A;  4ZDX A;  1KE3 A;  2ZQA A;  5AQB A;  1XA7 A;  1S6R A;  4JXV A;  5GHY A;  3VFF A;  3ZVT A;  2ZC6 B;  5CGW A;  5CED A;  3V3R A;  1YMX A;  3ZG5 A;  2WAE A;  3ITB A;  5DF8 A;  4OVD A;  4EQI A;  1ES3 A;  2VGJ A;  3ZCZ A;  4UHU A;  3FKW A;  2ZC3 B;  3IT9 A;  4JPM A;  4E6W A;  4N1X A;  4S2I A;  1W79 A;  3V5M A;  3SS5 A;  1YLJ A;  4JXW A;  1NZO A;  2XLN A;  4C75 A;  3HVF A;  5EVI A;  3RJU A;  3VP0 A;  1DJB A;  3C7V A;  3OCN A;  5M19 A;  1BZA A;  4BD0 A;  5FQM A;  1CEF A;  4KG6 A;  2EX2 A;  2DNS A;  2HP6 A;  1LLB A;  1M6K A;  3UE0 A;  2H5S A;  4GN2 A;  4LEN A;  5EVL A;  5EVI C;  1ES4 A;  3QNC A;  2H10 A;  5HAR A;  4DKI A;  2H0Y A;  2WUQ A;  5U47 A;  3EQU A;  4F94 A;  5A90 A;  5F1F A;  5CRF A;  1K56 A;  4E3J A;  2IWD A;  1K4E A;  5DF9 A;  2EXA A;  5EPH A;  3WS4 A;  3IXG A;  4IED A;  5TFQ A;  2Y2N A;  2JC7 A;  4N92 A;  3ZG9 B;  4O7D A;  2J9O A;  3IF6 B;  2HDU A;  3BFE A;  3SOI A;  5CHU A;  2HP5 A;  2OSU A;  4X68 A;  1PZP A;  3G2Z A;  1JVJ A;  4FCF A;  4ZTK A;  3VP4 A;  5FDH A;  4DE0 A;  3IHB A;  4KZ7 A;  2Y2L A;  3UO9 A;  1RCJ A;  2WGW A;  2WKI A;  1K6R A;  3FZC A;  4JF4 A;  3UPO A;  5JYP A;  1PW8 A;  4MEZ A;  1W8Y A;  3OPR A;  1W7F A;  4KZ6 A;  3AGF A;  2Y4A A;  2V2F F;  1BSG A;  4Q8I A;  5CXW A;  4IVK A;  4FD8 A;  3S22 A;  4R23 A;  1PI5 A;  2A3U A;  3G35 A;  4DXB A;  1ERO A;  4OOY A;  3UDX A;  4U0X A;  5L2F A;  4RVA A;  4BL3 A;  3EQV A;  1N9B A;  1G6A A;  3NDE A;  4GKU A;  4QJG A;  1JWV A;  4OQH A;  4WZ4 A;  2XH9 A;  4WMC D;  4KG5 A;  4DRT A;  3UE3 A;  5I94 A;  4HBT A;  3C5A A;  1XXM A;  4DE1 A;  3RXW A;  5GLC A;  2RL3 A;  5HX9 A;  1JWZ A;  3HRE A;  1N4O A;  4Z9Q A;  4KZ9 A;  2J8Y A;  4PM9 A;  3VOZ A;  1KGE A;  2Y2G A;  2XF3 A;  2JCH A;  5HAP A;  3A3D A;  3PBS A;  3NIA A;  1PWD A;  5FAO A;  5M18 A;  2Y91 A;  4B4X A;  4C3Q A;  5TR7 A;  4JXS A;  2Y59 A;  1S0W A;  4K91 A;  4K0W A;  2J7V A;  3Q1F A;  4MBH A;  4OPZ A;  3OCL A;  1PZO A;  2HP9 A;  3MKF A;  2Y2P A;  3MFD A;  3V39 A;  2WKE A;  2OLV A;  2ZQ7 A;  1IEL A;  3GV9 A;  3VSL A;  1MY8 A;  2ZC7 A;  4JF5 A;  3D4F A;  3OPH A;  3VMA A;  4EBL A;  1E4D A;  4P0M A;  5CHJ A;  5DTT A;  2Y2J A;  5CGX A;  3N7W A;  1EWZ A;  4R1G A;  4FSF A;  5F82 A;  1PYY A;  2XD5 A;  4Y0U A;  1WYB A;  4H8R A;  4UAA A;  2EFX A;  2ZQ9 A;  3BEB A;  1LL9 A;  4Y0O A;  4OPR A;  1L0F A;  3HBR A;  2XFS A;  2Y2I A;  4HEF A;  4BQM A;  3NBL A;  2XQZ A;  2QZ6 A;  2Y55 A;  4WMC A;  2Z2L B;  3G4P A;  4OLD A;  2CC1 A;  1QME A;  3IWO A;  5FI7 A;  2R9X A;  1ERM A;  2DCF A;  4QY6 A;  5AQA A;  3MKE A;  3ZVW A;  3MXS A;  4QY5 A;  4EWF A;  2WGV A;  1LL5 A;  2WZZ A;  1CI8 A;  3LCE A;  1H8Z A;  3IQA A;  2ZJ9 A;  4KQQ A;  1FCN A;  1I5Q A;  4M3K A;  3GTC A;  5GLB A;  3NC8 A;  1BLS A;  5F1G A;  4C6Y A;  5F83 A;  2ZM0 A;  3IWI A;  4R3J A;  1FCO A;  1CI9 A;  1MWS A;  5CEB A;  2XFT A;  1TDL A;  2ZQD A;  1VQQ A;  2J9P A;  3ZGA B;  3HLF A;  5M1A A;  4MLL A;  1K54 A;  2RCX A;  2DRW A;  3UPP A;  1FR1 A;  1K57 C;  2V20 A;  4X53 A;  3I7J A;  2Q9N A;  2HPB A;  2WYX A;  3DWK A;  4E3L A;  1H8Y A;  1NRF A;  1WE4 A;  1FOF A; 
#chains in the Genus database with same CATH topology
 1KOU A;  1VEU A;  1UWN X;  1H3Q A;  2XR0 A;  3VP2 A;  1O07 A;  5IT5 A;  2INW A;  1K54 C;  2WKH A;  1UWP X;  5HAI A;  4DN0 A;  1MWR A;  1ES5 A;  3N8R A;  4P85 A;  4N9L A;  4OQG A;  3BFD A;  4P6Z S;  4S2N A;  3FC7 A;  1KGG A;  4KQO A;  3UPN A;  3QP4 A;  5AQ7 A;  3E0Y A;  3MSH A;  2C5W B;  3IH9 A;  3ULF A;  3KX0 X;  1KVM A;  3G2Y A;  3LY4 A;  1TVF A;  3G31 A;  4KZA A;  1YKD A;  2P7J A;  4BBU A;  4EW7 A;  4Y0T A;  3IBR A;  2G2U A;  4BWI A;  1KE4 A;  4HOI A;  5E43 A;  2VV8 A;  4OH0 A;  1IKG A;  3LGO A;  4WZ5 C;  3S7N A;  4QPR A;  1PWG A;  3DW0 A;  2I72 A;  3T4K A;  3SS4 A;  2FH5 A;  3E2L A;  4UQI S;  3TJZ C;  2XGN A;  5HL1 A;  5D3O A;  1D06 A;  1MBL A;  2HDR A;  4MNR A;  2QKP A;  2ZQ8 A;  3Q7V A;  1G68 A;  4NK3 A;  1FCM A;  1ZTU A;  3C38 A;  1VEU B;  5FAT A;  1CQA A;  4G3V A;  2BAS A;  1ONG A;  3VV4 A;  1FSY A;  1L0G A;  1RP5 A;  1ODV A;  2DMW A;  5IU1 A;  4RA7 A;  2UWX A;  1ESU A;  4HP4 A;  5AJG A;  4HI4 A;  4ME4 A;  3Q07 A;  2HV1 A;  1ALQ A;  1XKZ A;  1NLZ A;  3HLC A;  4WUJ A;  3LFV A;  4LPZ A;  4EUV A;  3C2W A;  3V50 A;  4CLC E;  3TW8 A;  4GDB A;  1TS8 A;  1OT6 A;  3IXD A;  3F1N B;  3N8S A;  2WKP A;  3SH7 A;  3T4O A;  3UB6 A;  2PAV P;  1GHP A;  1GSX A;  5EE8 A;  4DMZ A;  1MKI A;  4QHC A;  2K31 A;  5IS1 A;  1BLC A;  3FWL A;  4N1H A;  5EVE A;  4DF6 A;  2V8F A;  2A49 A;  4K0X A;  4WZ5 A;  3MFX A;  3PXP A;  4NG2 A;  5HWT A;  4EBN A;  3BFF A;  3MXQ A;  5EOE A;  3CLO A;  4OPQ A;  3BM6 A;  4WEL A;  1W63 Q;  2A24 A;  4DJ2 A;  2VGK A;  4EU0 A;  2OWJ A;  3W4Q A;  4GNU A;  4LRY C;  2FZ0 A;  2M7V A;  3LIE A;  2Y79 A;  1H5X A;  3QP5 A;  4AFI A;  2J80 A;  1BTL A;  4EUZ A;  2OV5 A;  3UDI A;  5F68 A;  4OQ0 A;  2CMN A;  3TOI A;  3LIC A;  4R4R A;  3SS3 A;  4HHD A;  3A3J A;  3PAE A;  1OTE A;  2L4R A;  2XDM A;  3WRT A;  4X69 A;  3GRJ A;  4MBF A;  5A93 A;  3UY6 A;  4PKY A;  3PBN A;  3IBJ A;  4E3M A;  1K56 D;  4NXB A;  2H0T A;  3PR6 A;  2Z6D A;  1K25 A;  5KZH A;  1DP6 A;  3HLW A;  3G32 A;  5GHZ A;  4JGO A;  1JWP A;  1T1B A;  5EVI D;  3BFG A;  2VK3 A;  2Z2M B;  2R9W A;  2P74 A;  5FAP A;  4L0L A;  2PD8 A;  2B95 A;  1ZG6 A;  4CLC A;  4FTX A;  1W8Q A;  3K2N A;  2WGW B;  4GS9 B;  3RXX A;  4FUW A;  4GJ4 A;  4GOG A;  1NY0 A;  1SKF A;  5KIZ A;  3MZF A;  1WYC A;  1RGY A;  3KSG A;  3NDG A;  3NJA A;  1KVL A;  1L2S A;  4B88 A;  3KYE A;  3IHA A;  4PAU A;  4WN5 A;  4II7 A;  2PBY A;  5DF7 A;  3ITA A;  4RX3 A;  1FR6 A;  1OME A;  5EM0 A;  4YIN A;  2OLU A;  2Y2Q A;  1LI0 A;  2EX6 A;  5J4E A;  4JXV A;  4LFU A;  5CGW A;  2WAE A;  2PBD P;  2VGJ A;  1G28 A;  3H82 A;  4S2I A;  3SS5 A;  3HCY A;  4X1M A;  3T4L A;  4UEY A;  1NZO A;  1S66 L;  5G4Z A;  5M19 A;  1DJB A;  1T1A A;  2DNS A;  1M6K A;  2JN7 A;  4GN2 A;  5EVI C;  1ES4 A;  2H0Y A;  5F1F A;  3KSI A;  5CRF A;  3K3D A;  1NLY A;  2O99 A;  4P6Z M;  4X68 A;  4FCF A;  2PR5 A;  4KZ7 A;  3A0S A;  2WKI A;  4MEZ A;  1W8Y A;  3OPR A;  4KZ6 A;  1G6O A;  4R70 A;  3C8C A;  3DAV A;  4FD8 A;  1LSV A;  4Q0H A;  1XJ6 A;  1ERO A;  4OOY A;  4BL3 A;  1GSW A;  3KO6 A;  2QWS A;  2VLG A;  4GKU A;  1JWV A;  4KG5 A;  3UE3 A;  5I94 A;  4DE1 A;  3TRC A;  2RL3 A;  1F5M A;  4EER A;  1OTA A;  3SZT A;  3VOZ A;  1KGE A;  3IX8 A;  4EEU A;  1PWD A;  2Y91 A;  4B4X A;  4K0W A;  4R38 A;  4OPZ A;  3OCL A;  1PZO A;  2HP9 A;  3V39 A;  2WKE A;  2ZQ7 A;  1MY8 A;  3K3C A;  5DTT A;  2HJE A;  3LR0 A;  3N7W A;  2OAQ 1;  2Z6C A;  4GS9 A;  4UAA A;  1S4R A;  3VE4 A;  1LL9 A;  4OPR A;  3KYZ A;  2PR6 A;  3LUQ A;  2NUP C;  4HEF A;  4BQM A;  2QZ6 A;  3G4P A;  1QME A;  5FI7 A;  2R9X A;  2DCF A;  4QY6 A;  3MXS A;  4QY5 A;  3JVU A;  4KQQ A;  1FCN A;  1D1J A;  3UMD A;  5J3W A;  4C6Y A;  5F6A A;  2ZM0 A;  4R3J A;  1FCO A;  1CI9 A;  1P9R A;  2O9A A;  1TDL A;  1VQQ A;  2DRW A;  1FR1 A;  2V20 A;  4X1L A;  2Q9N A;  2HPB A;  3DBA A;  1H8Y A;  4KQD A;  1FOF A;  1YPR A;  2HGV A;  3FPW A;  5FA7 A;  1GHM A;  4MDZ A;  4S2K A;  2JKT I;  4X55 A;  1NYY A;  1OJ5 A;  3ZFZ A;  4G3W A;  3JYI A;  4JF6 A;  3ZNT A;  1P97 A;  2QJ5 A;  3UE1 A;  1PNE A;  1YM1 A;  1EI5 A;  2GNX A;  2WGI A;  3HUN A;  2W0N A;  1ZHH B;  3VOY A;  2EX8 A;  5EOO A;  3W4O A;  3G30 A;  3AGD A;  1J9M A;  3FG8 A;  3BRM A;  3G34 A;  3WWX A;  4YWZ A;  5FL3 A;  1ZG4 A;  2VA0 A;  2VV7 A;  3T1S A;  4HH2 A;  1IYQ A;  1LI9 A;  1OPX A;  4LRX C;  1H8M A;  2V1A A;  2V0U A;  4DDY A;  1N9N A;  4PM7 A;  1K0K A;  2HJ9 C;  4QB8 A;  2PU4 A;  2HDQ A;  4GCZ A;  1E25 A;  4PPR A;  1YLY A;  5HSQ A;  3CUE C;  4LCL A;  4QD4 A;  2QPN A;  5FQK A;  1XGI A;  5HPF A;  2JBF A;  3A0R A;  4HQA A;  4IUH A;  1IYP A;  4JLF A;  4PM8 A;  5HFO A;  3E2K A;  4ZJ3 A;  1ES2 A;  4X25 A;  3IS2 B;  3QNB A;  5L07 A;  3BLM A;  1J3W A;  3OC2 A;  4H6J B;  3HL9 A;  4P87 A;  3UN7 A;  1V9Z A;  4OQI A;  3W2Z A;  5HWW A;  1C3B A;  4LGW A;  3C4P A;  4BLM A;  4Y2F A;  3T4Q A;  1FSW A;  3GR2 A;  4PM6 A;  3VE3 A;  5CEC A;  2OAP 1;  4Y3I A;  3BFC A;  3IXH A;  1I2W A;  5L09 A;  3LEQ A;  3T1R A;  2ZMF A;  4WEJ A;  1BYW A;  3CPT B;  2EX9 A;  4GLQ A;  4R4S A;  2VX8 A;  3WS2 A;  4K08 A;  3P09 A;  4CLC C;  1JTD A;  1MPL A;  2W3F A;  1PIO A;  5DKK A;  4FH4 A;  4WEK A;  4U3T A;  5DJU A;  3IF6 C;  2XRO A;  2FFY A;  4HES A;  1KGF A;  1SZV A;  2NUT C;  5TBM B;  2WKR A;  2GJ3 A;  3H9W A;  3M2K A;  5GL9 A;  2PU2 A;  1YLP A;  2VGL S;  3E4O A;  3SH9 A;  3ZG0 A;  3MS6 A;  3VP1 A;  5EEC A;  2ZC4 B;  1LHY A;  3DTI A;  4NXG A;  2VGL M;  3L7H A;  3HLB A;  3CZD A;  1F2K A;  1LT0 A;  3EGD C;  5E2E A;  3ZG8 B;  1WA9 A;  5FQQ A;  2JKR I;  4LV2 A;  3NY4 A;  1GA9 A;  1SKO B;  2ZC5 B;  4KEN B;  2C6W B;  4GHI B;  4PKY G;  1AXB A;  1XP4 A;  3FKV A;  3IH8 A;  5GHX A;  3S4X A;  3BLS A;  5L10 A;  3C7U A;  2B5R A;  1DJC A;  4LV0 A;  2WKQ A;  4EV4 A;  1IYS A;  3A0V A;  3M6H A;  4KZ8 A;  4OON A;  3IXB A;  3HUM A;  1GSV A;  5JYO A;  3R7W B;  3QP8 A;  4GZB A;  3VOL A;  1BUL A;  1YT4 A;  3S7P A;  4LRZ E;  4B9O A;  2ZLY A;  3LIA A;  3BY8 A;  3LY3 A;  4E3O A;  4B93 A;  2M1C A;  1HVB A;  4ZAM A;  1H0M A;  3ZQ5 A;  3LIF A;  4IHQ A;  3PBQ A;  4BBT A;  4JKT A;  5HDC A;  1CF0 A;  4PMA A;  2XD1 A;  2X02 A;  3MZE A;  3UNW A;  4ESP A;  4OP5 A;  5DJT A;  3TSG A;  2M7U A;  3DWZ A;  2V0W A;  3MJQ A;  4L9E A;  3M2J A;  2W27 A;  2Y2M A;  3EEA A;  1NYM A;  2BLS A;  4MBK A;  1GHI A;  4GDN A;  3GVB A;  4LV3 A;  2W1T A;  2J3T D;  4R3B A;  1Q2Q A;  3T4J A;  4I38 A;  3CJM A;  4ZDX A;  1KE3 A;  2ZQA A;  1XA7 A;  5GHY A;  4OVD A;  4EQI A;  2ZC3 B;  4Y15 A;  5EFW A;  4JPM A;  4E6W A;  2V9A A;  3RJU A;  3C7V A;  3S7O A;  3OCN A;  3LR4 A;  3T4S A;  3F1P B;  5FQM A;  1LLB A;  3RH8 B;  4LEN A;  5EVL A;  3C30 A;  3QNC A;  4F94 A;  5A90 A;  3CIT A;  2GZA A;  2JKG A;  2IWD A;  1K4E A;  2VV6 A;  4IED A;  1TD5 A;  1P0Z A;  4N92 A;  3ZG9 B;  1OTB A;  4O7D A;  2J9O A;  2HDU A;  5CHU A;  2OSU A;  1PZP A;  4ZTK A;  1JVJ A;  3NOP C;  4JGR A;  2JKT M;  5FDH A;  3IHB A;  2EWW A;  5HD3 A;  4WF0 A;  4JF4 A;  3UPO A;  1PW8 A;  3L9K A;  3AGF A;  4ETX A;  4Q8I A;  5HPI A;  4RVA A;  3EQV A;  3EWK A;  5HZH A;  1V9Y A;  2I9V A;  4WZ4 A;  2PD7 A;  3F1O A;  3C5A A;  3PHY A;  3LR5 A;  5HX9 A;  3HRE A;  1NRJ A;  2Y2G A;  2XF3 A;  2JCH A;  3UE6 A;  3PBS A;  3B42 A;  3IX4 A;  2Y59 A;  1S0W A;  2J7V A;  3Q1F A;  2Q0O A;  4MN6 A;  5MC7 A;  2QJ7 A;  3VSL A;  3D4F A;  3OPH A;  4EBL A;  4P0M A;  1EWZ A;  4I3I A;  4FSF A;  3ICY A;  4Y0U A;  1WYB A;  2ZQ9 A;  4Y0O A;  2Y2I A;  4WMC A;  1T18 A;  2LB5 A;  1A0K A;  3MMH A;  3SW1 A;  3MKE A;  2JKR M;  4NKP A;  3GTC A;  5GLB A;  5F1G A;  5EM1 A;  1MWS A;  2XFT A;  2ZQD A;  3CI6 A;  3ZGA B;  3BQA A;  1K57 C;  3MQQ A;  3BW6 A;  3ISG A;  1S4S A;  1XA1 A;  3WS0 A;  2W1T B;  2LB9 A;  4M4X A;  1SHV A;  5AVE A;  4X56 A;  1PFL A;  3OPP A;  2EWV A;  1S1Z A;  4RYE A;  3M6B A;  1JTG A;  3ZNY A;  4XUX A;  2WAD A;  3HUO A;  1VET A;  4HNB A;  4ETZ A;  5FSR A;  4B4Z A;  1ONH A;  4HJ4 A;  4Q0I A;  3OBF A;  3T1X A;  1BLP A;  3OOV A;  1STZ A;  4BL2 A;  1TEM A;  4S2L A;  3GDI A;  4S2J A;  3FYZ A;  2QYB A;  4QU3 A;  1DJA A;  5EV0 A;  4NXF A;  3BYD A;  1E3U D;  3GSG A;  1YQS A;  4E3I A;  3Q82 A;  3HLG A;  3HLE A;  3EEH A;  1OJG A;  5GLA A;  1SCW A;  2XRN A;  1VHM A;  3MZD A;  1PW1 A;  5KSH A;  3F1O B;  4HJ6 A;  1ERQ A;  5DTS A;  2IWC A;  3JVV A;  1K55 A;  2QMI A;  3R7W A;  4UA6 A;  1DP8 A;  2X01 A;  3Q81 A;  1YAX A;  4UQI M;  1ZC2 A;  1L0E A;  3N6I A;  1I2S A;  2W1R A;  1RGZ A;  1MZU A;  3V3S A;  1G5U A;  5FAS A;  1TS7 A;  1BUE A;  4DDS A;  3PYP A;  4N9K A;  3PBR A;  5AVF A;  1YLT A;  4IUK A;  3LEZ A;  3GQZ A;  3HLD A;  5A8B A;  4DJ3 A;  2OOL A;  1GCE A;  3W8K A;  2WZX A;  3SH8 A;  2JE5 A;  1K55 C;  1Z09 A;  2ZM2 A;  1DRM A;  4WYY A;  2ZBB A;  5G4Y A;  2X71 A;  1HLU P;  3MQ0 A;  1X0O A;  2VEA A;  3FPV A;  4EET B;  4Y17 A;  4HBU A;  1TDG A;  4U0T A;  3O88 A;  2ZD8 A;  2WK0 A;  3O3V A;  3S7Q A;  1CJF A;  2ZMV A;  2PYR A;  4YNR A;  4S2N C;  3D3O A;  3N8L A;  3CWF A;  1Z6F A;  2ZMA A;  3F1P A;  4DE3 A;  4WBG A;  2Y2H A;  1DY6 A;  1Q2P A;  4ZJ1 A;  4UA9 A;  1TS6 A;  3PBO A;  2P9V A;  4OOM A;  5DFY A;  4WM9 A;  1XGJ A;  2L0W A;  5FI2 A;  3ZG7 B;  4EXO A;  1PWC A;  3UB5 P;  1KDS A;  4FH2 A;  4LLO B;  1O7E A;  1MXO A;  3ZHH A;  4F3L B;  3C4O A;  5IHV A;  2P9V B;  1NJ4 A;  3AGE A;  3A3E A;  4NXE A;  4S2P A;  4ZBE A;  3HJK A;  2J3W A;  4Z1W A;  2UV0 E;  2Y8H A;  4Y7P A;  4Q0J A;  5CTM A;  1QMF A;  3B33 A;  3D72 A;  5E2G A;  3UDF A;  3GMW A;  4GD6 A;  3ZYT A;  1K4F A;  3MR0 A;  4HIA A;  2ZOH A;  3WS1 A;  4E3K A;  1XJ4 A;  4JGP A;  4GW9 A;  4QWO A;  3IF6 A;  5FQJ A;  4BJP A;  5F5Y A;  3IWQ A;  1MWU A;  1TS0 A;  3NI9 A;  2XSS A;  5HL6 A;  3PTE A;  5A92 A;  3H7W A;  2P04 A;  1HZO A;  3LO7 A;  2YKF A;  3UB7 A;  4OOL A;  5EUA A;  4BD1 A;  2Q9M A;  2W3G A;  4IVI A;  1YLW A;  2ZM8 A;  4KZ4 A;  1IFQ A;  1XX2 A;  5FDS A;  2PRF A;  4CJN A;  1CK3 A;  1XFQ A;  3MQO A;  4RX2 A;  4KQR A;  4JXG A;  4KUO A;  1SDN A;  4S2O A;  2KLI A;  3VFF A;  1UGU A;  5CED A;  1YMX A;  3ITB A;  5DF8 A;  3ZCZ A;  4UHU A;  1Y28 A;  3D9Y A;  4CLC D;  3IT9 A;  2VKS A;  3V5M A;  4ARZ A;  4JXW A;  2XLN A;  3HVF A;  5EVI A;  3VP0 A;  1BZA A;  4BD0 A;  4KG6 A;  4Y5F A;  1XFN A;  3NUL A;  1OT9 A;  5HAR A;  3JPU A;  4DKI A;  2WUQ A;  5U47 A;  3EQU A;  1K56 A;  4HH3 A;  5DF9 A;  3WS4 A;  1ACF A;  2EXA A;  2VJW A;  5EPH A;  3IXG A;  5TFQ A;  2Y2N A;  2JC7 A;  3IF6 B;  2K7S A;  1SKO A;  3H7W B;  3G2Z A;  3VP4 A;  1RCJ A;  3F1N A;  1K6R A;  4IJG A;  3CUE A;  3CHW P;  4E04 A;  1FIL A;  3QP2 A;  1W7F A;  2K2N A;  1DP9 A;  2Y4A A;  2V2F F;  1BSG A;  2ZOI A;  1PI5 A;  2A3U A;  5L2F A;  3TE8 A;  3UDX A;  1EW0 A;  4YOF A;  1XJ3 A;  3NDE A;  4WMC D;  4DRT A;  1S1Y A;  4HBT A;  1MC0 A;  3RXW A;  5GLC A;  1JWZ A;  1FIK A;  4KZ9 A;  2L1M A;  2O0Y A;  4O0P A;  4PM9 A;  3UME A;  5HAP A;  3A3D A;  4XT2 B;  5FAO A;  3HJI A;  4C3Q A;  5TR7 A;  1VET B;  4JXS A;  4K91 A;  4CQH A;  2Y2P A;  3GV9 A;  3P7N A;  2ZC7 A;  3VMA A;  3E98 A;  2Y2J A;  5CGX A;  2D01 A;  2A2L A;  4R1G A;  2VZW A;  5FEF A;  4H8R A;  2EFX A;  1L0F A;  2XFS A;  3T12 B;  4I3J A;  4BMW A;  2Y55 A;  2Z2L B;  2CC1 A;  2G7U A;  3IWO A;  3G6O A;  4MCW A;  3H82 B;  2J3T C;  5AQA A;  2ZL1 B;  4NEE D;  1LL5 A;  1CI8 A;  3LCE A;  1H8Z A;  3IQA A;  2ZJ9 A;  4MMN A;  1I5Q A;  3NC8 A;  5F83 A;  4GHI A;  5TJJ A;  2J9P A;  2XA7 S;  5M1A A;  1K54 A;  3U2A A;  3UPP A;  4X53 A;  1NRF A;  1M40 A;  4KZ3 A;  3OZH A;  4WL9 A;  4MN5 A;  3FV7 A;  3E4P A;  2GDN A;  5HAQ A;  1VM1 A;  2Y2O A;  3LID A;  3P01 A;  4GB7 A;  1E3U A;  1ZKJ A;  3PAG A;  4O8G A;  3VSK A;  5KMW A;  3NOT C;  3WRZ A;  1XPB A;  4KG2 A;  5EVI B;  2E8I A;  1SDE A;  4G3K A;  4WLA A;  5DTK A;  5E2H A;  1NXY A;  4OLG A;  4R3A A;  3MBZ A;  3Q7V B;  3R4K A;  5FI6 A;  5DVA A;  3KSH A;  5FQ9 A;  3VP3 A;  2V1Z A;  3T1Q B;  2JHE A;  1YLZ A;  3E4Q A;  3W4P A;  1GA0 A;  2V8C A;  4EBP A;  3IF5 A;  3O86 A;  4E3N A;  1F9I A;  2P08 A;  3VFH A;  5DKL A;  5G18 A;  3BWL A;  2PHY A;  4E6X A;  3PBT A;  1BT5 A;  4F3L A;  3CPT A;  1TF1 A;  3OPL A;  4R0Q A;  3BJN A;  1MWT A;  5E2F A;  1HTZ A;  4OPY A;  4I39 A;  4CPK A;  1D7E A;  3QHY A;  5C5K A;  5F69 A;  2KDK A;  2PT7 A;  3DTE A;  1LSW A;  3CG5 A;  1BLH A;  4JBF A;  2GX5 A;  4O01 A;  5CHM A;  2XEP A;  1K38 A;  5CX7 A;  5AQ9 A;  1U60 A;  2B02 A;  4XT2 A;  1W5D A;  2G2W A;  4XUZ A;  2JKF A;  5HDD A;  5A91 A;  4Y13 A;  2Y2K A;  3EGX C;  1Y54 A;  2QHK A;  1IYO A;  4R6L A;  3T4T A;  1NZU A;  3NHQ A;  2A24 B;  4NET A;  5CER A;  5KSC A;  1P9W A;  3CAX A;  2ZQC A;  3KSF A;  2OWH A;  1IKI A;  3TG9 A;  5HWV A;  4EES A;  3CMZ A;  1IEM A;  2FFF B;  1Y4O A;  2W3D A;  4IBX A;  4OKP A;  4YFM A;  4KZ5 A;  4LCM A;  4XXR A;  3B3X A;  1PI4 A;  3LYX A;  3MXR A;  4S2M A;  3A3I A;  4KZB A;  1CEG A;  4D2O A;  5GLD A;  3B47 A;  4A5R A;  3LI8 A;  3DTM A;  2XK1 A;  4I3A A;  5BOH A;  3LI9 A;  4OP8 A;  4UA7 A;  3GEC A;  5CGS A;  1IOU A;  3QP6 A;  1K6S A;  3DTK A;  4CLC B;  3NCK A;  1YMS A;  5J7E A;  4ZRR A;  1N9L A;  5J8X A;  1HD8 A;  4GD8 A;  1S67 L;  4X6T A;  2W3E A;  2O9B A;  3WS5 A;  3EOI A;  4DXC A;  1KE0 A;  3UB9 A;  1YSP A;  3ZDJ A;  5FAQ A;  1LL8 A;  2WAF A;  2IWB A;  3Q7Z A;  4ZJ2 A;  1K57 A;  3O87 A;  4IBR A;  1XJ2 A;  3S1Y A;  2E8J A;  5FQI A;  3KYQ A;  1ESI A;  4I5S A;  4H6J A;  3NOU C;  4MN7 A;  1KDW A;  5CTN A;  4L9G A;  2EFU A;  2BG1 A;  1NWZ A;  2ACG A;  3IX3 A;  1L0D A;  4ID4 A;  3A3F A;  5TGF A;  4P6B A;  3UB8 A;  1FQG A;  5HDS A;  3N4I A;  1N9O A;  2HF6 A;  2HDS A;  2EXB A;  2HZ5 A;  5HW3 A;  3RTY A;  3P98 A;  3BEC A;  4PM5 A;  4DE2 A;  4BEN A;  1T19 A;  2KX6 A;  5AQB A;  2D02 A;  4ARZ B;  2BTF P;  1S6R A;  3ZVT A;  2ZC6 B;  3V3R A;  5HD5 A;  3ZG5 A;  1ES3 A;  2ZL1 A;  2O9C A;  2EA9 A;  3FKW A;  1T1C A;  4N1X A;  1W79 A;  1YLJ A;  4C75 A;  4HY8 A;  2XA7 M;  1CEF A;  2EX2 A;  2HP6 A;  3UE0 A;  3NEC A;  2H5S A;  3O5Y A;  4KUK A;  2H10 A;  4E3J A;  4L9F A;  1PRQ A;  1LSX A;  3U4L P;  1VB6 A;  1JNU A;  3SOI A;  3BFE A;  2HP5 A;  1W63 M;  1YSQ A;  4DE0 A;  3UO9 A;  2Y2L A;  2WGW A;  2R78 A;  3FZC A;  5JYP A;  1OTD A;  5L8M A;  2MJ6 A;  2PDR A;  5CXW A;  4IVK A;  1OTI A;  3S22 A;  4R23 A;  3G35 A;  4DXB A;  4U0X A;  3MF0 A;  4HP9 A;  1N9B A;  2W3H A;  1G6A A;  4PHT A;  5TBM A;  4QJG A;  4OQH A;  2XH9 A;  4BBV A;  1XXM A;  2B18 A;  1N4O A;  4Z9Q A;  4EQ1 A;  2J8Y A;  1F98 A;  3NIA A;  2H28 A;  5M18 A;  2IA2 A;  3T50 A;  4MBH A;  1MKM A;  2AVX A;  3MKF A;  3MFD A;  3OLO A;  2OLV A;  1IEL A;  4JF5 A;  3QP1 A;  4RQ9 A;  1E4D A;  2PYP A;  5CHJ A;  5DFX A;  5F82 A;  1PYY A;  2XD5 A;  3RFB A;  3V67 A;  3BEB A;  1L3L A;  2KOI A;  3HBR A;  3IS2 A;  5LBR A;  3NBL A;  4EEP A;  2XQZ A;  3LIB A;  4OLD A;  5I5L A;  3LR3 A;  4FOF A;  1ERM A;  4HJ3 A;  3ZVW A;  2YKH A;  4EWF A;  3BQ8 A;  2WGV A;  4D60 A;  2WZZ A;  1AWI A;  4M3K A;  5K5B A;  1BLS A;  3BY9 A;  3IWI A;  5CEB A;  2V1B A;  3HLF A;  5FEG A;  4MLL A;  2RCX A;  4JGQ A;  3I7J A;  2WYX A;  3DWK A;  4E3L A;  4LV1 A;  1WE4 A; 
#chains in the Genus database with same CATH homology
 3WS0 A;  1XA1 A;  1M40 A;  4KZ3 A;  5FA7 A;  1GHM A;  3OZH A;  2XR0 A;  1SHV A;  3FV7 A;  3VP2 A;  4S2K A;  1O07 A;  4X55 A;  1NYY A;  4X56 A;  1K54 C;  2WKH A;  2GDN A;  3OPP A;  5HAI A;  3ZFZ A;  1MWR A;  1ES5 A;  5HAQ A;  3N8R A;  4RYE A;  4P85 A;  1VM1 A;  4N9L A;  2Y2O A;  3M6B A;  4OQG A;  3BFD A;  1JTG A;  4S2N A;  3ZNY A;  4XUX A;  1KGG A;  2WAD A;  3HUO A;  4KQO A;  3UPN A;  4GB7 A;  3JYI A;  4JF6 A;  5AQ7 A;  3ZNT A;  1E3U A;  1ZKJ A;  5FSR A;  3PAG A;  2C5W B;  3VSK A;  4B4Z A;  1ONH A;  3IH9 A;  5KMW A;  3WRZ A;  1KVM A;  3G2Y A;  3UE1 A;  1XPB A;  4KG2 A;  5EVI B;  3LY4 A;  2E8I A;  1SDE A;  1TVF A;  3G31 A;  4KZA A;  5DTK A;  1YM1 A;  5E2H A;  1EI5 A;  1BLP A;  1NXY A;  4OLG A;  2WGI A;  4BL2 A;  1TEM A;  3HUN A;  3MBZ A;  3Q7V B;  3VOY A;  4S2L A;  2EX8 A;  5EOO A;  3W4O A;  4Y0T A;  3G30 A;  5FI6 A;  3AGD A;  1J9M A;  4S2J A;  3FYZ A;  3BRM A;  3G34 A;  2V1Z A;  5DVA A;  4QU3 A;  5FQ9 A;  1DJA A;  3VP3 A;  3WWX A;  2G2U A;  1YLZ A;  1ZG4 A;  3W4P A;  1GA0 A;  1KE4 A;  1IYQ A;  1LI9 A;  4EBP A;  3IF5 A;  3O86 A;  4E3N A;  4DDY A;  3BYD A;  4PM7 A;  5E43 A;  3VFH A;  1E3U D;  4OH0 A;  5G18 A;  1IKG A;  4QB8 A;  2PU4 A;  2HDQ A;  4WZ5 C;  3GSG A;  1YQS A;  4E3I A;  4E6X A;  1E25 A;  3PBT A;  3Q82 A;  1YLY A;  4PPR A;  3HLG A;  3HLE A;  1PWG A;  5GLA A;  1BT5 A;  1SCW A;  3DW0 A;  3MZD A;  4LCL A;  4QD4 A;  2QPN A;  1PW1 A;  3OPL A;  4R0Q A;  5KSH A;  1MWT A;  5E2F A;  2I72 A;  5FQK A;  1XGI A;  1HTZ A;  1ERQ A;  3SS4 A;  3E2L A;  4OPY A;  5DTS A;  2IWC A;  4CPK A;  2XGN A;  2JBF A;  1K55 A;  5HL1 A;  3QHY A;  2QMI A;  5D3O A;  4UA6 A;  1MBL A;  2X01 A;  2HDR A;  1IYP A;  3Q81 A;  4MNR A;  4JLF A;  2ZQ8 A;  3Q7V A;  4PM8 A;  1G68 A;  4NK3 A;  1FCM A;  5HFO A;  3CG5 A;  3E2K A;  4ZJ3 A;  1ZC2 A;  5FAT A;  1BLH A;  4JBF A;  1L0E A;  3N6I A;  1I2S A;  1ONG A;  5CHM A;  2XEP A;  1ES2 A;  1FSY A;  1K38 A;  1L0G A;  1RGZ A;  3QNB A;  3V3S A;  5FAS A;  3BLM A;  1RP5 A;  5AQ9 A;  1U60 A;  3OC2 A;  1BUE A;  4DDS A;  4RA7 A;  4N9K A;  1W5D A;  2UWX A;  3HL9 A;  4P87 A;  3PBR A;  2G2W A;  4XUZ A;  5A91 A;  1ESU A;  3UN7 A;  4OQI A;  1YLT A;  1C3B A;  2Y2K A;  3C4P A;  3LEZ A;  1Y54 A;  3Q07 A;  3GQZ A;  4BLM A;  1IYO A;  3HLD A;  1ALQ A;  1NZU A;  1FSW A;  1XKZ A;  3GR2 A;  4NET A;  4PM6 A;  5CEC A;  3HLC A;  5CER A;  3BFC A;  3IXH A;  1GCE A;  3W8K A;  2WZX A;  3SH8 A;  3V50 A;  1I2W A;  2JE5 A;  5KSC A;  1K55 C;  2ZQC A;  4WEJ A;  2ZM2 A;  4GDB A;  3IXD A;  4WYY A;  2EX9 A;  3N8S A;  1IKI A;  3SH7 A;  3TG9 A;  2X71 A;  3CMZ A;  1IEM A;  4R4S A;  1GHP A;  2FFF B;  5EE8 A;  1MKI A;  4IBX A;  4OKP A;  4YFM A;  3WS2 A;  4KZ5 A;  3P09 A;  4LCM A;  4XXR A;  4QHC A;  1JTD A;  3B3X A;  1BLC A;  1TDG A;  1MPL A;  1PI4 A;  3FWL A;  4HBU A;  4N1H A;  4DF6 A;  4U0T A;  2A49 A;  4K0X A;  3MXR A;  4S2M A;  1PIO A;  4WZ5 A;  3O88 A;  3A3I A;  2ZD8 A;  2WK0 A;  3O3V A;  4FH4 A;  4KZB A;  4U3T A;  1CEG A;  3IF6 C;  4WEK A;  5GLD A;  4D2O A;  2FFY A;  4HES A;  1KGF A;  3BFF A;  4EBN A;  4A5R A;  5EOE A;  3DTM A;  3M2K A;  4OPQ A;  4S2N C;  5GL9 A;  3BM6 A;  2PU2 A;  3N8L A;  4LV1 A;  4WEL A;  1YLP A;  2XK1 A;  1Z6F A;  2ZMA A;  3SH9 A;  3ZG0 A;  3VP1 A;  4DE3 A;  2VGK A;  4WBG A;  2Y2H A;  1DY6 A;  1Q2P A;  5EEC A;  2ZC4 B;  4ZJ1 A;  5BOH A;  1LHY A;  4UA9 A;  4X69 A;  4OP8 A;  3W4Q A;  3HLB A;  3PBO A;  4GNU A;  4UA7 A;  3CZD A;  2P9V A;  4OOM A;  1H5X A;  4WM9 A;  1XGJ A;  5CGS A;  5FI2 A;  1BTL A;  5E2E A;  5FQQ A;  2OV5 A;  3ZG7 B;  3ZG8 B;  4EUZ A;  4LV2 A;  1PWC A;  3NY4 A;  3UDI A;  1GA9 A;  1K6S A;  2ZC5 B;  4KEN B;  2C6W B;  4OQ0 A;  1KDS A;  4FH2 A;  1AXB A;  1O7E A;  1XP4 A;  3NCK A;  3TOI A;  3FKV A;  1MXO A;  3IH8 A;  1YMS A;  3ISG A;  4R4R A;  5GHX A;  3SS3 A;  3A3J A;  3PAE A;  3S4X A;  3ZHH A;  5J8X A;  3BLS A;  2XDM A;  3C4O A;  3C7U A;  5IHV A;  3WRT A;  2B5R A;  1HD8 A;  2P9V B;  3GRJ A;  4GD8 A;  1NJ4 A;  1DJC A;  3AGE A;  4LV0 A;  3A3E A;  4MBF A;  5A93 A;  4S2P A;  4ZBE A;  3UY6 A;  4EV4 A;  1IYS A;  3M6H A;  4X6T A;  4KZ8 A;  4OON A;  3IXB A;  3PBN A;  4Y7P A;  3WS5 A;  3HUM A;  1KE0 A;  1K56 D;  5CTM A;  4DXC A;  4E3M A;  1QMF A;  2H0T A;  5JYO A;  5E2G A;  3UDF A;  3GMW A;  4GD6 A;  4GZB A;  3ZDJ A;  1K4F A;  1BUL A;  5FAQ A;  1K25 A;  5KZH A;  1YT4 A;  3WS1 A;  4E3K A;  2WAF A;  2IWB A;  3Q7Z A;  2ZLY A;  3HLW A;  3G32 A;  5GHZ A;  3IF6 A;  1JWP A;  5EVI D;  5FQJ A;  3BFG A;  4BJP A;  3IWQ A;  3LY3 A;  2Z2M B;  2R9W A;  4ZJ2 A;  1K57 A;  2P74 A;  3O87 A;  4E3O A;  5FAP A;  1MWU A;  4IBR A;  4L0L A;  3S1Y A;  5FQI A;  1ZG6 A;  3NI9 A;  1ESI A;  1HVB A;  4ZAM A;  3PBQ A;  1W8Q A;  3PTE A;  5A92 A;  4JKT A;  1KDW A;  5CTN A;  2WGW B;  4PMA A;  2EFU A;  2XD1 A;  2X02 A;  3RXX A;  2BG1 A;  1HZO A;  3LO7 A;  3MZE A;  4GOG A;  4ID4 A;  3UNW A;  1L0D A;  1NY0 A;  1SKF A;  3A3F A;  4OP5 A;  4OOL A;  5EUA A;  4BD1 A;  5TGF A;  4P6B A;  3TSG A;  1FQG A;  2Q9M A;  1WYC A;  3MZF A;  3DWZ A;  1RGY A;  4IVI A;  1YLW A;  2ZM8 A;  4KZ4 A;  3N4I A;  1XX2 A;  3M2J A;  4CJN A;  3NDG A;  2Y2M A;  1KVL A;  1CK3 A;  1L2S A;  4B88 A;  3IHA A;  1NYM A;  2HDS A;  2EXB A;  5HW3 A;  2PBY A;  5DF7 A;  2BLS A;  4RX2 A;  3ITA A;  4MBK A;  4KQR A;  4RX3 A;  1FR6 A;  1GHI A;  1OME A;  3BEC A;  3P98 A;  4GDN A;  3GVB A;  4JXG A;  4YIN A;  1SDN A;  2OLU A;  2Y2Q A;  4DE2 A;  4PM5 A;  1LI0 A;  2EX6 A;  4LV3 A;  4BEN A;  4R3B A;  1Q2Q A;  4S2O A;  3CJM A;  4ZDX A;  1KE3 A;  2ZQA A;  5AQB A;  1XA7 A;  1S6R A;  4JXV A;  5GHY A;  3VFF A;  3ZVT A;  2ZC6 B;  5CGW A;  5CED A;  3V3R A;  1YMX A;  3ZG5 A;  2WAE A;  3ITB A;  5DF8 A;  4OVD A;  4EQI A;  1ES3 A;  2VGJ A;  3ZCZ A;  4UHU A;  3FKW A;  2ZC3 B;  3IT9 A;  4JPM A;  4E6W A;  4N1X A;  4S2I A;  1W79 A;  3V5M A;  3SS5 A;  1YLJ A;  4JXW A;  1NZO A;  2XLN A;  4C75 A;  3HVF A;  5EVI A;  3RJU A;  3VP0 A;  1DJB A;  3C7V A;  3OCN A;  5M19 A;  1BZA A;  4BD0 A;  5FQM A;  1CEF A;  4KG6 A;  2EX2 A;  2DNS A;  2HP6 A;  1LLB A;  1M6K A;  3UE0 A;  2H5S A;  4GN2 A;  4LEN A;  5EVL A;  5EVI C;  1ES4 A;  3QNC A;  2H10 A;  5HAR A;  4DKI A;  2H0Y A;  2WUQ A;  5U47 A;  3EQU A;  4F94 A;  5A90 A;  5F1F A;  5CRF A;  1K56 A;  4E3J A;  2IWD A;  1K4E A;  5DF9 A;  2EXA A;  5EPH A;  3WS4 A;  3IXG A;  4IED A;  5TFQ A;  2Y2N A;  2JC7 A;  4N92 A;  3ZG9 B;  4O7D A;  2J9O A;  3IF6 B;  2HDU A;  3BFE A;  3SOI A;  5CHU A;  2HP5 A;  2OSU A;  4X68 A;  1PZP A;  3G2Z A;  1JVJ A;  4FCF A;  4ZTK A;  3VP4 A;  5FDH A;  4DE0 A;  3IHB A;  4KZ7 A;  2Y2L A;  3UO9 A;  1RCJ A;  2WGW A;  2WKI A;  1K6R A;  3FZC A;  4JF4 A;  3UPO A;  5JYP A;  1PW8 A;  4MEZ A;  1W8Y A;  3OPR A;  1W7F A;  4KZ6 A;  3AGF A;  2Y4A A;  2V2F F;  1BSG A;  4Q8I A;  5CXW A;  4IVK A;  4FD8 A;  3S22 A;  4R23 A;  1PI5 A;  2A3U A;  3G35 A;  4DXB A;  1ERO A;  4OOY A;  3UDX A;  4U0X A;  5L2F A;  4RVA A;  4BL3 A;  3EQV A;  1N9B A;  1G6A A;  3NDE A;  4GKU A;  4QJG A;  1JWV A;  4OQH A;  4WZ4 A;  2XH9 A;  4WMC D;  4KG5 A;  4DRT A;  3UE3 A;  5I94 A;  4HBT A;  3C5A A;  1XXM A;  4DE1 A;  3RXW A;  5GLC A;  2RL3 A;  5HX9 A;  1JWZ A;  3HRE A;  1N4O A;  4Z9Q A;  4KZ9 A;  2J8Y A;  4PM9 A;  3VOZ A;  1KGE A;  2Y2G A;  2XF3 A;  2JCH A;  5HAP A;  3A3D A;  3PBS A;  3NIA A;  1PWD A;  5FAO A;  5M18 A;  2Y91 A;  4B4X A;  4C3Q A;  5TR7 A;  4JXS A;  2Y59 A;  1S0W A;  4K91 A;  4K0W A;  2J7V A;  3Q1F A;  4MBH A;  4OPZ A;  3OCL A;  1PZO A;  2HP9 A;  3MKF A;  2Y2P A;  3MFD A;  3V39 A;  2WKE A;  2OLV A;  2ZQ7 A;  1IEL A;  3GV9 A;  3VSL A;  1MY8 A;  2ZC7 A;  4JF5 A;  3D4F A;  3OPH A;  3VMA A;  4EBL A;  1E4D A;  4P0M A;  5CHJ A;  5DTT A;  2Y2J A;  5CGX A;  3N7W A;  1EWZ A;  4R1G A;  4FSF A;  5F82 A;  1PYY A;  2XD5 A;  4Y0U A;  1WYB A;  4H8R A;  4UAA A;  2EFX A;  2ZQ9 A;  3BEB A;  1LL9 A;  4Y0O A;  4OPR A;  1L0F A;  3HBR A;  2XFS A;  2Y2I A;  4HEF A;  4BQM A;  3NBL A;  2XQZ A;  2QZ6 A;  2Y55 A;  4WMC A;  2Z2L B;  3G4P A;  4OLD A;  2CC1 A;  1QME A;  3IWO A;  5FI7 A;  2R9X A;  1ERM A;  2DCF A;  4QY6 A;  5AQA A;  3MKE A;  3ZVW A;  3MXS A;  4QY5 A;  4EWF A;  2WGV A;  1LL5 A;  2WZZ A;  1CI8 A;  3LCE A;  1H8Z A;  3IQA A;  2ZJ9 A;  4KQQ A;  1FCN A;  1I5Q A;  4M3K A;  3GTC A;  5GLB A;  3NC8 A;  1BLS A;  5F1G A;  4C6Y A;  5F83 A;  2ZM0 A;  3IWI A;  4R3J A;  1FCO A;  1CI9 A;  1MWS A;  5CEB A;  2XFT A;  1TDL A;  2ZQD A;  1VQQ A;  2J9P A;  3ZGA B;  3HLF A;  5M1A A;  4MLL A;  1K54 A;  2RCX A;  2DRW A;  3UPP A;  1FR1 A;  1K57 C;  2V20 A;  4X53 A;  3I7J A;  2Q9N A;  2HPB A;  2WYX A;  3DWK A;  4E3L A;  1H8Y A;  1NRF A;  1WE4 A;  1FOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...