5A91A

15k x-ray ligand free: exploring the mechanism of beta-lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SULFATE ION
publication title Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5a91A00
1H8ZA 2DNSA 4XUXA 5KMWA 2IWCA 5U47A 1LI9A 4JF5A 4X55A 2ZQAA 3G2YA 4K0XA 3W4OA 1PI4A 3WRTA 1LL9A 5EVIA 1SCWA 1W5DA 1NY0A 3PBSA 3PBRA 4MBHA 5F1GA 1K57A 5FA7A 4EBNA 2JBFA 3MZEA 2WKEA 3BFDA 4X56A 4DXBA 2Y2QA 5DTTA 1W7FA 2QZ6A 1HZOA 3OPPA 5F83A 3ZDJA 1PZPA 2OLUA 4OOYA 3DW0A 5AQ9A 3ZNTA 2WGWA 1O07A 1XA1A 5CHMA 1XGJA 5FAOA 5KSCA 4S2LA 3WS1A 2R9WA 5EVIB 4N9LA 1TDGA 3VFHA 5DF8A 4UA9A 3SS4A 1ONGA 4ID4A 3UDXA 4XXRA 3EQUA 4KZ5A 1W79A 4N1XA 3A3IA 4S2MA 3WS0A 2H0YA 3TSGA 4ZDXA 2VGJA 2C5WB 1YLYA 2HDRA 1MWSA 2J8YA 1ERQA 4UA6A 5DF7A 2WGWB 3VSKA 3GSGA 3ZCZA 3DWZA 4JF4A 3M6BA 1MKIA 2WADA 3HLDA 4GN2A 2IWDA 2Y2OA 3MZDA 4MBKA 3PAGA 5DTSA 2FFYA 1NJ4A 5CRFA 2Y2PA 3MXSA 2EFXA 1XP4A 3NBLA 3SH9A 3UE3A 5FI2A 2EXBA 3LO7A 4OQIA 3MFDA 1MWRA 5FDHA 3WRZA 1EROA 4KZ3A 1KE3A 2JCHA 4F94A 4EBLA 4WEKA 3ZG7B 4H8RA 4WZ4A 4RA7A 5EUAA 4ZJ2A 3FV7A 3O88A 1NYYA 2HP9A 5CERA 3JYIA 3WWXA 4BD0A 3G31A 1YLPA 3N8SA 4OPYA 2PBYA 3OPLA 4KG5A 1BLCA 4DE3A 3GMWA 1BLHA 3SS3A 4JXGA 4OONA 4XUZA 1AXBA 5FQ9A 1IEMA 1JWPA 1OMEA 1WE4A 2EX6A 3B3XA 3IF5A 2ZQ7A 4JXWA 4K0WA 4WZ5C 3V3RA 3ZGAB 4E3LA 2ZJ9A 4OOMA 1WYCA 4R1GA 4OPZA 4GD6A 4ZAMA 4U0TA 4IVKA 3IF6C 5A92A 4KZ8A 4OKPA 1K54C 3UE0A 2ZQ8A 4PM8A 1GHIA 4JXVA 3OC2A 4PM6A 2XDMA 5A91A 2XD1A 3OCLA 1PWDA 1IKGA 3QNBA 1S0WA 1BZAA 4OP8A 1BLPA 1XA7A 3ZG8B 4WEJA 3SS5A 3DTMA 3NY4A 2H0TA 3HLGA 4PMAA 3VP4A 4BL2A 1DY6A 4A5RA 3G35A 5DF9A 1QMEA 4HBTA 4YFMA 5E2GA 1BULA 4DF6A 3OPHA 5E2EA 2OLVA 1ERMA 1XKZA 4BLMA 1YM1A 2I72A 4YINA 5EOOA 2ZC6B 4QU3A 1MWUA 5JYOA 5GLCA 1K25A 2Y2JA 1JVJA 3IXHA 3SOIA 1M40A 4N92A 4E3MA 3ZG9B 1LL5A 4R4SA 1ALQA 4HEFA 2HP6A 4GNUA 3LY4A 5M19A 4QJGA 3GR2A 5EPHA 3IWOA 4S2IA 1ZKJA 1K56A 4KZAA 2FFFB 5CGSA 3NIAA 5HFOA 1E3UD 2EX2A 2J7VA 3CJMA 3PBTA 4UAAA 4BQMA 1TEMA 2Y2MA 3IWIA 1KE4A 3HUMA 3N4IA 1G68A 1LHYA 3P09A 1ES5A 3HLEA 4PM9A 4X6TA 4PPRA 4IBXA 1JWZA 4NK3A 2WGVA 4R4RA 2C6WB 5GLBA 3VP1A 5TGFA 3G30A 4D2OA 4DE2A 4DXCA 1CEFA 4Y7PA 4QB8A 3IXDA 5GL9A 3IXGA 4E3OA 1ES2A 3MKEA 4KG6A 2ZQDA 3RXWA 3W8KA 1FR6A 2X71A 1JWVA 2A49A 4OP5A 3P98A 3VSLA 3CMZA 3ZVTA 1ESUA 4OLDA 4KZ9A 1I2SA 2PU4A 2Z2MB 3BEBA 3QNCA 4RYEA 3N8LA 4MLLA 4GD8A 4E6XA 2Y59A 3OZHA 3UPPA 4OVDA 4E6WA 3M2KA 1BLSA 4GDNA 1BUEA 3O87A 5D3OA 1G6AA 1DJAA 3A3JA 1KGEA 4IBRA 5GHZA 3HL9A 3FKWA 3HLBA 4FCFA 3Q82A 1GA0A 5CECA 3Q7ZA 1PYYA 3A3EA 1ES4A 1KDSA 4HESA 2J9PA 1HD8A 5FI6A 3ZFZA 1XXMA 2EFUA 2WUQA 1RGYA 1PIOA 1WYBA 2ZC4B 4OQGA 4UA7A 3MZFA 4PM7A 1C3BA 1PW8A 1YQSA 2PU2A 5EVIC 2P9VA 2Y4AA 1YLZA 1YLTA 5E43A 5GHYA 1K57C 1EWZA 3SH7A 3ZG0A 2Y2GA 2X02A 3S22A 2Y2LA 4WMCD 3PBOA 4ZJ1A 1W8YA 4WYYA 3AGFA 3GQZA 1O7EA 3LCEA 2RL3A 2XFTA 4PM5A 1EI5A 4WZ5A 3HBRA 3BM6A 1K4EA 3IHBA 5GLAA 3N7WA 4KQQA 2EXAA 3BRMA 5HAIA 2P9VB 3Q1FA 5CTMA 3ZG5A 1PI5A 1L0GA 1JTGA 5HW3A 3E2KA 1VQQA 1XX2A 3HLWA 4OPRA 1SHVA 3E2LA 1NXYA 4BL3A 4FD8A 2EX8A 2EX9A 3HUNA 5A90A 5EECA 3Q7VA 1L2SA 3WS5A 2XF3A 4U0XA 4Q8IA 4BJPA 5EVID 2HDQA 3CZDA 3M6HA 4C6YA 5FQJA 4LV2A 4JPMA 4R3JA 4B4ZA 3V50A 5FAQA 1K55A 3BLMA 3BFEA 1E4DA 3V5MA 3VMAA 1M6KA 3BECA 4DKIA 3AGEA 4C75A 1MY8A 3A3DA 4LCLA 4C3QA 2ZQ9A 2XEPA 3Q7VB 5CGXA 4N1HA 4EBPA 1N4OA 1YMXA 4GB7A 5CTNA 4EUZA 2B5RA 4S2NA 5CHUA 1PWGA 5DVAA 3GRJA 2Y55A 3EQVA 3LY3A 1ZC2A 5J8XA 1QMFA 2XD5A 1BSGA 3IH8A 3S4XA 1TVFA 1H5XA 5EOEA 1JTDA 3PBQA 4B88A 4KENB 4MEZA 3ITAA 2XGNA 1Q2PA 4ZBEA 4GDBA 3W4PA 5M1AA 1L0DA 5GLDA 3C5AA 3AGDA 4FH4A 5FQKA 5KZHA 1CK3A 2QPNA 1KVMA 2G2WA 3NDGA 3I7JA 3W4QA 4UHUA 2A3UA 5CHJA 4EQIA 1K6SA 4FSFA 1IYSA 3MKFA 1I5QA 1SKFA 4JBFA 4BENA 3VFFA 4DE0A 3BLSA 3UE1A 2Y2HA 4S2JA 3D4FA 4OOLA 3QHYA 3ZNYA 3NCKA 1KGGA 3PBNA 3RXXA 3Q81A 3ISGA 3TOIA 3NC8A 2ZMAA 3FKVA 3ZHHA 1FSWA 5EVLA 3UDIA 2E8IA 1IYQA 3BFFA 1FOFA 1K6RA 1GCEA 3OPRA 4FH2A 2BLSA 4KQOA 4BD1A 1L0FA 4WM9A 1PW1A 5DTKA 2V20A 4B4XA 4EV4A 4DRTA 5HARA 3C7UA 5HAQA 1KDWA 5FQIA 4KZ4A 5JYPA 2UWXA 2ZC5B 1BTLA 3BYDA 3C4PA 3N6IA 1N9BA 2XFSA 4E3IA 5FQQA 3O86A 5F1FA 2WKIA 4JXSA 1DJBA 3V39A 5AQ7A 5M18A 1FQGA 1GHMA 1NRFA 2DRWA 4OH0A 3OCNA 4WBGA 4IVIA 5G18A 1HVBA 1IELA 2WZXA 5CEDA 5FAPA 5FI7A 2Q9NA 5FASA 2V2FF 3UPNA 3N8RA 5FQMA 4P85A 4X69A 4MNRA 2H5SA 4RVAA 3VOZA 4KQRA 1Y54A 1DJCA 4KZBA 5HL1A 3CG5A 2Y2IA 4WELA 1FCNA 1NZOA 3Q07A 3IWQA 3NI9A 1SDEA 1IYPA 1H8YA 2ZQCA 4CJNA 4E3NA 3GV9A 2Y91A 2HDUA 2XR0A 1YLJA 1CI8A 5A93A 4S2PA 1KVLA 4E3KA 1BT5A 4NETA 4E3JA 1VM1A 4U3TA 3ZVWA 4LV0A 5AQAA 5TR7A 3IQAA 2Y2KA 4Y0OA 3UY6A 1LLBA 1ESIA 4P0MA 5HAPA 1TDLA 1S6RA 1FCMA 3UPOA 4O7DA 2JE5A 2H10A 4R0QA 1FR1A 3GVBA 4KG2A 2XH9A 3UNWA 5CEBA 4Y0UA 4S2OA 1MBLA 1YMSA 5FATA 4MBFA 5FSRA 1K56D 4GKUA 1ONHA 4Y0TA 1U60A 2WGIA 3G34A 3RJUA 1RCJA 3MXRA 2ZM0A 5AQBA 2XK1A 5GHXA 1KGFA 3IF6A 4KZ7A 2ZLYA 3G4PA 5E2FA 5L2FA 1K54A 1YLWA 2OV5A 5F82A 3WS2A 1SDNA 2WK0A 1LI0A 1XGIA 1GA9A 2XQZA 1E25A 2BG1A 4ZJ3A 5EE8A 3HREA 3IXBA 4R3BA 4QHCA 1RP5A 1FSYA 3IF6B 3S1YA 3IH9A 5BOHA 3SH8A 3UN7A 1IKIA 1E3UA 3PTEA 3BFCA 4M3KA 1FCOA 3M2JA 5KSHA 3NDEA 2JC7A 1I2WA 4OPQA 4CPKA 4EWFA 2J9OA 1CEGA 1Q2QA 3G32A 3HUOA 4OQHA 1ZG6A 4LV1A 2ZC7A 5TFQA 3V3SA 2WAFA 4LENA 4P87A 4OLGA 5E2HA 3A3FA 3PAEA 3FYZA 1RGZA 2Q9MA 1HTZA 4N9KA 3TG9A 1CI9A 4RX2A 2ZD8A 2VGKA 4GZBA 4S2KA 2X01A 3C7VA 4L0LA 3VP3A 4OQ0A 1K4FA 2GDNA 4KZ6A 3G2ZA 4P6BA 4QD4A 4R23A 1MPLA 1YT4A 2Y2NA 3FZCA 3IT9A 4ZTKA 5HX9A 3VP0A 5I94A 4GOGA 1MXOA 1K38A 2HDSA 3HLFA 3UO9A 1K55C 2HP5A 2P74A 4JLFA 4LCMA 4K91A 3C4OA 4DE1A 3DWKA 4HBUA 3VP2A 1ZG4A 2HPBA 4JF6A 5CGWA 1W8QA 2G2UA 2V1ZA 3BFGA 3HLCA 2ZM2A 4DDYA 4S2NC 2WAEA 1PZOA 4Z9QA 3UDFA 3IHAA 2R9XA 1GHPA 1L0EA 4RX3A 4IEDA 2DCFA 4QY5A 3FWLA 1NZUA 1NYMA 1MWTA 4JKTA 1IYOA 2WKHA 4WMCA 5CXWA 4X68A 3GTCA 1ES3A 2ZC3B 3VOYA 2ZM8A 4DDSA 2WZZA 2RCXA 1XPBA 3WS4A 2CC1A 2IWBA 1J9MA 2OSUA 2WYXA 2XLNA 2Z2LB 3ITBA 3LEZA 3MBZA 4LV3A 1PWCA 4QY6A 4X53A 3O3VA 1KE0A 2QMIA 5IHVA 3HVFA 1Z6FA
chains in the Genus database with same CATH superfamily
1H8ZA 2IWCA 1LI9A 1OJGA 2ZL1A 3G2YA 4DJ3A 4NKPA 3WRTA 5F1GA 3FG8A 4HI4A 2J80A 1HZOA 3ZDJA 1PZPA 2ZL1B 3T4TA 1MZUA 2WGWA 1XA1A 5CHMA 1XGJA 5KSCA 4S2LA 4N9LA 4CLCA 4ID4A 1OJ5A 3UDXA 1AWIA 3LIDA 3HCYA 1MWSA 3LR5A 1ERQA 4ETZA 2WGWB 4G3WA 3CLOA 2Y2OA 1OTAA 4CLCB 3MXSA 1UWPX 4IJGA 1XP4A 4Y3IA 3LO7A 1MWRA 4H8RA 4WZ4A 4RA7A 2HP9A 5CERA 1YLPA 2PBYA 4KG5A 5L09A 2PD8A 5EVEA 3LIBA 1TS0A 4F3LA 1BLHA 4Y2FA 4JXGA 1AXBA 3B3XA 1WE4A 2JKTI 1F2KA 3V3RA 4I3JA 4R1GA 4U0TA 3IF6C 3UE0A 1GHIA 3OC2A 3CUEC 4PM6A 4F3LB 2XD1A 3OCLA 1IKGA 2KOIA 3QNBA 1BLPA 1YPRA 3JVVA 4PMAA 3VP4A 4BL2A 3CHWP 3T4KA 5DF9A 5K5BA 4HBTA 3MFXA 2XSSA 5E2GA 1BULA 2OLVA 1XKZA 2ZC6B 2W1TA 3LIAA 4QU3A 5JYOA 1JNUA 3NOTC 2Y2JA 1W63Q 1H8MA 3PYPA 4N92A 5J7EA 5EFWA 2HP6A 4QJGA 3GR2A 2W1TB 5EPHA 4L9FA 1E3UD 2J7VA 4UAAA 4NEED 2PR5A 1TEMA 3IWIA 3HUMA 5AJGA 4X6TA 4ZRRA 4B93A 4II7A 1JWZA 2WGVA 5GLBA 4DE2A 3G30A 4D2OA 3MQQA 4QB8A 3IXDA 4KG6A 3W8KA 1FR6A 1V9ZA 3CMZA 3ZVTA 1ESUA 4OLDA 1I2SA 1VHMA 3DBAA 1D06A 4MLLA 4HJ3A 4E6XA 2Y59A 3O87A 1NLZA 3HLBA 3R4KA 2Y8HA 1KDSA 2J9PA 5FI6A 1PIOA 4UA7A 4GHIA 5EM1A 3FPWA 5EVIC 4ARZA 4L9GA 2Y4AA 2Y2GA 2X02A 1LSWA 3GQZA 1O7EA 2XFTA 4PM5A 2W3DA 4GHIB 5GLAA 4KQQA 1ZHHB 1CJFA 1PI5A 3RTYA 2J3WA 3C8CA 3F1NA 4FD8A 1PFLA 2EX9A 3HUNA 3VE3A 3Q7VA 3WS5A 2HDQA 4C6YA 4LV2A 4JPMA 4R3JA 4Y5FA 4B4ZA 3V50A 3BFEA 1M6KA 3F1NB 2W0NA 2NUTC 1OPXA 1UGUA 3Q7VB 1YMXA 4GB7A 4EUZA 2B5RA 4S2NA 3EQVA 4BMWA 2V0WA 1KOUA 4KENB 4MEZA 1ZTUA 3W4PA 5KZHA 5FEGA 4I5SA 4UQIM 3I7JA 3W4QA 4UHUA 2J3TC 2PRFA 4FSFA 1SKFA 4DE0A 4S2JA 3RXXA 5EVLA 2IA2A 1K6RA 2VKSA 4Q0IA 1PW1A 5DTKA 3BQAA 5HARA 4KZ4A 2ZC5B 5HWVA 3C4PA 4KUOA 3N6IA 4E3IA 5FQQA 3TJZC 4JXSA 1CQAA 3NOPC 4WBGA 1IELA 5FAPA 2Q9NA 4P85A 2Y2IA 1FCNA 4CJNA 1K0KA 4GS9A 1FILA 4E3JA 4U3TA 3UB9A 4Q0HA 3UY6A 4O0PA 5HAPA 5HPIA 1S6RA 4R70A 4G3KA 4R0QA 1FR1A 3GVBA 2PYRA 2XH9A 5CEBA 2D02A 4GLQA 4JGRA 5FSRA 4GS9B 4Y0TA 2MJ6A 5TJJA 1RCJA 5GHXA 4KZ7A 2ZLYA 1D1JA 5F82A 1SDNA 4P6ZM 1LI0A 5I5LA 4PKYA 1OTIA 4QPRA 1FSYA 3S1YA 5BOHA 3UN7A 4OPQA 1I2WA 4EWFA 2J9OA 1S1ZA 4M4XA 2ZOIA 3EEAA 4EUVA 3KSIA 4P87A 1Z09A 2ACGA 1Y4OA 4DMZA 4X1MA 4GZBA 3C7VA 4KZ6A 4QD4A 5FL3A 1MPLA 1YT4A 2DMWA 2JKGA 1K38A 1N9OA 2WKRA 4G3VA 4Z1WA 4LLOB 3CI6A 3P01A 4JF6A 5CGWA 3VP2A 3HLCA 4DDYA 2R9XA 1L0EA 2XA7M 2DCFA 1NZUA 2VZWA 1MWTA 4JKTA 4LRYC 3A0SA 5DJUA 2WZZA 2PYPA 2CC1A 3S7QA 5L07A 5LBRA 3QP1A 3DTIA 3E0YA 2Z2LB 3T1SA 3O3VA 2QMIA 3NULA 2DNSA 4XUXA 5KMWA 4EERA 1H0MA 4X55A 1PI4A 3PBSA 1NY0A 1S4SA 1K57A 5FA7A 4HHDA 4X56A 2Y2QA 5DTTA 2OLUA 3DW0A 3ZNTA 3WS1A 1ODVA 5DF8A 3NJAA 4N1XA 3A3IA 3WS0A 4ZDXA 2VGJA 2C5WB 4UA6A 3VSKA 5DF7A 4JF4A 3M6BA 3HLDA 3MZDA 3PAGA 2FFYA 5CRFA 2HV1A 2EFXA 1F9IA 3V67A 5FI2A 2EXBA 2QKPA 1P97A 4OQIA 5FDHA 1EROA 5HWTA 4KZ3A 4HP9A 3E4QA 5EUAA 3FV7A 4BD0A 3JYIA 3WWXA 3G31A 4OPYA 2B18A 3LEQA 2QWSA 3RH8B 4OONA 1IEMA 1JWPA 1OMEA 4WZ5C 4K0WA 4E3LA 4JXWA 1WYCA 4OPZA 4NXBA 2V9AA 4KZ8A 1K54C 2ZQ8A 4PM8A 3TE8A 2XDMA 5A91A 1DP9A 3LYXA 3DTMA 2H0TA 2UV0E 4X25A 1F5MA 2JKFA 4A5RA 4YFMA 1ERMA 1YM1A 3B33A 4YINA 3H9WA 1WA9A 5A8BA 1K25A 1JVJA 3SOIA 4BBVA 2KX6A 3EEHA 4E3MA 2B95A 4R4SA 2V0UA 4EXOA 4GNUA 3IWOA 3MXQA 1ZKJA 1K56A 2FFFB 5HFOA 1S1YA 2Y2MA 1KE4A 3T4SA 3P09A 4PM9A 4R38A 2WKPA 4R4RA 2VLGA 3MQOA 3RXWA 2VV6A 2FZ0A 2QJ5A 4AFIA 4OP5A 3EGDC 3P98A 3VSLA 5AVEA 4KZ9A 2Z2MB 3IS2A 1F98A 3BY9A 4GD8A 3OZHA 4IUHA 4OVDA 4GDNA 4YWZA 4IBRA 3A3JA 1TD5A 3HL9A 4FCFA 3IX4A 4BBTA 1OTEA 3ICYA 3Q7ZA 2ZOHA 2OOLA 3LI9A 4HESA 1MC0A 3IS2B 3T4QA 5HZHA 2WUQA 1RGYA 3HJKA 1WYBA 4Y15A 2OWHA 1PW8A 1LT0A 1EWZA 2QYBA 5CX7A 3R7WA 2Y2LA 1W8YA 3AGFA 3LCEA 5DFYA 3BM6A 4B9OA 3N7WA 1GSVA 3R7WB 4OPRA 1VQQA 4QWOA 2VGLM 3QP2A 1SHVA 4BL3A 3CUEA 2EX8A 2V1AA 5A90A 5EECA 5EVID 5DJTA 5FQJA 5FAQA 1G6OA 1K55A 2ZMFA 3VMAA 1MY8A 4LCLA 4C3QA 1N9LA 2R78A 1TS8A 5CGXA 4EBPA 3MJQA 4WN5A 4JGPA 1PWGA 2Y55A 5DKLA 3LY3A 2E8JA 4HY8A 3S4XA 3UMEA 1TVFA 2GJ3A 2JKRI 3PBQA 3ITAA 2W3EA 2XROA 5GLDA 3G6OA 4FH4A 1UWNX 2XRNA 3GDIA 3NDGA 2OWJA 2A3UA 2EWVA 1IYSA 3MKFA 4JBFA 5HD5A 5HSQA 4LRXC 3UE1A 2Y2HA 5F68A 3ZNYA 3QHYA 1KGGA 3LR3A 5HD3A 2E8IA 1IYQA 3BFFA 1FOFA 1GCEA 4FH2A 4BD1A 4WM9A 2V20A 4WLAA 4EV4A 2L4RA 3C7UA 5HAQA 1N9NA 3T1RA 3K3CA 3UB8A 4OH0A 1NRFA 2J3TD 4IVIA 2W3GA 1HVBA 1P9WA 2WZXA 5FI7A 3L9KA 3UPNA 2VEAA 3N8RA 5FQMA 3K2NA 4X69A 5FDSA 4MNRA 4MDZA 4RVAA 3VOZA 2Y79A 3CG5A 4WELA 3IWQA 3NI9A 1IYPA 2Y91A 3D72A 2XR0A 5HDSA 1CI8A 5A93A 4S2PA 4E3KA 1BT5A 3H7WA 3ZVWA 1TDLA 1FCMA 2O0YA 2H10A 4LFUA 3UNWA 4Y0UA 1MBLA 4I39A 5FATA 3LR4A 1ONHA 2WGIA 3G34A 3H7WB 5HL6A 1A0KA 2D01A 2ZM0A 2XK1A 4UQIS 3VV4A 1KGFA 5E2FA 1YKDA 4YNRA 1MKMA 3LGOA 4ZJ3A 3S7PA 4QHCA 1RP5A 5KIZA 1E3UA 5FEFA 3M2JA 5KSHA 2JC7A 3B47A 5F69A 4LV1A 2ZC7A 5TFQA 4LENA 4OLGA 3A3FA 3PAEA 3FYZA 1HTZA 4HOIA 3KSHA 1CI9A 1XFNA 3D3OA 4NXGA 2ZD8A 2VGKA 1TS7A 4S2KA 1T1CA 1K4FA 3G2ZA 3IT9A 1OTBA 5I94A 2HDSA 3HLFA 3UO9A 4JLFA 3OLOA 4LCMA 4K91A 3C4OA 2HF6A 1W8QA 4S2NC 4BBUA 1XJ6A 3HJIA 2W3FA 1LSXA 1D7EA 3LUQA 4IUKA 4IEDA 3CWFA 1NYMA 3FC7A 4PHTA 5CXWA 4Y17A 3GTCA 2ZC3B 3VOYA 1W63M 1XPBA 1J9MA 1SKOB 1J3WA 2WYXA 3ITBA 4LV3A 4XT2A 3HVFA 4JF5A 4K0XA 3LIFA 1OT6A 1LL9A 1SCWA 4MBHA 1NRJA 4EBNA 4XT2B 5G4YA 4DJ2A 2WKEA 4DXBA 3OPPA 5F83A 3C38A 2KDKA 5AQ9A 3BQ8A 1O07A 2R9WA 3VFHA 4UA9A 3SS4A 2PT7A 4S2MA 3TSGA 1YLYA 2HDRA 5DFXA 3GSGA 3ZCZA 3DWZA 4O8GA 4GN2A 5G4ZA 5DTSA 2Y2PA 4EEPA 3SH9A 3UE3A 4CLCE 3WRZA 2XA7S 4F94A 3ZG7B 3U2AA 1NYYA 3UB7A 3GMWA 4XUZA 5FQ9A 2EX6A 3IF5A 4OOMA 4YOFA 4GD6A 4IVKA 5A92A 1T19A 4OKPA 2P7JA 4JXVA 5TBMA 1S0WA 1BZAA 4DN0A 2VK3A 3ZG8B 3SS5A 1DY6A 3A0RA 5TBMB 3T4JA 1XJ3A 4GCZA 5F6AA 2A24A 3DTEA 1MWUA 3IXHA 1M40A 2A2LA 2VV8A 4JGQA 3ZG9B 5HWWA 4HEFA 4EETB 2A24B 3LY4A 4WF0A 5M19A 4S2IA 1LSVA 1XJ2A 1S67L 2EX2A 3CJMA 3A0VA 2I9VA 2HJEA 1FIKA 4NXFA 3N4IA 1G68A 1ES5A 3HLEA 4PPRA 3MSHA 2PD7A 2C6WB 3VP1A 5TGFA 5GL9A 4Y7PA 1ES2A 3T50A 3O5YA 2EA9A 2X71A 1JWVA 2A49A 2YKFA 3LI8A 4LRZE 2PU4A 3BEBA 3QNCA 4RYEA 3D9YA 1GSXA 3VOLA 1DP8A 2QJ7A 1G6AA 1DJAA 5GHZA 3Q82A 1GA0A 3NOUC 5CECA 4MN7A 3A3EA 1ES4A 4NG2A 2BASA 1HD8A 3VE4A 1XXMA 4I3AA 2ZC4B 4OQGA 3MZFA 1C3BA 2PU2A 2P9VA 1YLZA 1YLTA 5GHYA 1K57C 3ZQ5A 4WMCD 1T1BA 4WYYA 3T4LA 3FPVA 4WZ5A 3HBRA 4HNBA 4CQHA 2EXAA 2V8FA 3BRMA 5HAIA 3F1OA 2P9VB 3Q1FA 4R3AA 2GNXA 3E2KA 3HLWA 5EV0A 1PNEA 3E4OA 2Z6CA 3MMHA 3C2WA 5HPFA 5J4EA 4U0XA 4Q8IA 3F1OB 3B42A 1E4DA 3V5MA 3BECA 4DKIA 3AGEA 5J3WA 4C75A 2ZQ9A 1N4OA 5L8MA 5CHUA 5DVAA 5J8XA 1ZC2A 1QMFA 1BSGA 2JKTM 4O01A 5EOEA 4KUKA 2XGNA 1Q2PA 3W2ZA 4GDBA 3T1QB 5M1AA 1L0DA 4I38A 3C5AA 4FOFA 3AGDA 4EQIA 3LR0A 2CMNA 1I5QA 1DP6A 3VFFA 1VEUA 2Q0OA 3KYEA 3D4FA 4OOLA 3NCKA 1XJ4A 3ISGA 3FKVA 3ZHHA 1FSWA 2BLSA 1L0FA 1VEUB 4R6LA 2VGLS 2UWXA 3BYDA 1BTLA 5HDDA 2XFSA 3O86A 2WKIA 1CF0A 5AQ7A 4ETXA 1GHMA 3OCNA 3P7NA 5IS1A 1P9RA 3OOVA 2V2FF 2H5SA 4KQRA 1Y54A 1DJCA 4KZBA 1ACFA 1NZOA 2W27A 1SDEA 1H8YA 1EW0A 2ZQCA 4E3NA 3GV9A 2HDUA 4HH3A 1YLJA 3SW1A 3JVUA 3H82A 1KVLA 4NETA 1STZA 1BYWA 3IQAA 4Y0OA 3UE6A 1LLBA 4O7DA 3L7HA 3QP8A 4KG2A 4MCWA 4S2OA 1VETA 4MBFA 3H82B 3RJUA 4CLCC 3IF6A 4Q0JA 3G4PA 2INWA 2OV5A 3UMDA 3LIEA 5L10A 1VETB 1GA9A 3IX3A 3HREA 3LFVA 4R3BA 1PRQA 1P0ZA 1XFQA 3IF6B 2G7UA 1FCOA 3NDEA 1CEGA 1Q2QA 3G32A 1GSWA 4OQHA 3BJNA 2WAFA 3V3SA 5E2HA 2H28A 1RGZA 4N9KA 3IBRA 3TG9A 2VA0A 4RX2A 2W1RA 4L0LA 4IHQA 2GDNA 4E04A 4FUWA 4P6BA 3KSGA 2Y2NA 4ZTKA 3PR6A 5HX9A 4EU0A 4GOGA 1MXOA 4D60A 1K55C 2HP5A 2P74A 3K3DA 1OT9A 4NXEA 4DE1A 3DWKA 1NWZA 2JN7A 5C5KA 2V1ZA 3BFGA 4H6JA 2ZM2A 1PZOA 3UDFA 3IHAA 4QY5A 2PHYA 2BTFP 2WKHA 4X68A 2KLIA 4H6JB 2JHEA 3BY8A 3F1PA 2M7UA 3RFBA 3WS4A 2IWBA 4JGOA 1YSQA 4DRTA 3LEZA 4QY6A 5IHVA 2M1CA 1YAXA 3NY4A 1Z6FA 5U47A 4MN6A 1IOUA 2ZQAA 1T1AA 3F1PB 3W4OA 1T18A 5EVIA 1W5DA 3PBRA 2K7SA 2JBFA 3EOIA 3MZEA 3BFDA 2VX8A 3OBFA 1S4RA 1W7FA 2QZ6A 4OOYA 4MN5A 5FAOA 5EVIB 3JPUA 1TDGA 4PKYG 1ONGA 4XXRA 3EQUA 4KZ5A 1W79A 2H0YA 4HIAA 3LICA 2O99A 2J8YA 4EQ1A 1MKIA 2WADA 2IWDA 4MBKA 2HJ9C 2NUPC 1NJ4A 3TW8A 4EEUA 3NBLA 2M7VA 3MFDA 1KE3A 2JCHA 4EBLA 4WEKA 4ZJ2A 3O88A 4ARZB 3N8SA 3OPLA 1BLCA 3E98A 2VV7A 4DE3A 4EW7A 3SS3A 3BW6A 5DKKA 3ZGAB 2WKQA 2ZQ7A 4BWIA 2ZJ9A 4ZAMA 4HJ4A 3KX0X 1PWDA 1L3LA 4OP8A 3KSFA 1XA7A 3NECA 4WEJA 1TS6A 4EESA 3HLGA 3QP5A 3SZTA 3G35A 1YSPA 1QMEA 2O9AA 3MQ0A 4DF6A 3OPHA 5E2EA 4BLMA 2I72A 5EOOA 2AVXA 5GLCA 1SKOA 2L1MA 1LL5A 1ALQA 3U4LP 4KZAA 4P6ZS 5CGSA 3NIAA 3PBTA 4BQMA 2LB9A 1LHYA 4X1LA 5AVFA 4IBXA 4NK3A 4GJ4A 4MMNA 4DXCA 1CEFA 2B02A 3EGXC 3IXGA 4E3OA 2ZBBA 3MKEA 2ZQDA 2HGVA 3N8LA 3UPPA 4ESPA 4E6WA 3M2KA 1BLSA 1BUEA 1VB6A 5D3OA 1KGEA 3FKWA 1PYYA 5MC7A 3ZFZA 2O9BA 2EFUA 1LL8A 4PM7A 1YQSA 3DTKA 5E43A 3SH7A 3ZG0A 2GX5A 3S22A 4WUJA 4ZJ1A 3PBOA 4HQAA 2W3HA 2RL3A 3T1XA 1EI5A 3IHBA 1K4EA 2L0WA 4K08A 5CTMA 3ZG5A 1OTDA 1L0GA 1JTGA 5HW3A 1XX2A 2K2NA 4WL9A 3E2LA 1NXYA 1L2SA 2XF3A 4BJPA 3BWLA 3MF0A 3GECA 3CZDA 3M6HA 5IT5A 3MR0A 2V1BA 3BLMA 2OAQ1 4LPZA 3A3DA 2P04A 3S7OA 4Y13A 2EWWA 2XEPA 4KQDA 4N1HA 5CTNA 1G5UA 3GRJA 4FTXA 2LB5A 2XD5A 3IH8A 2P08A 1H5XA 2K31A 1JTDA 4B88A 4ZBEA 5EM0A 5FQKA 1CK3A 2QPNA 1KVMA 2G2WA 2V8CA 5CHJA 1K6SA 4BENA 3ZYTA 3BLSA 4LGWA 3PBNA 3E4PA 3Q81A 3TOIA 3NC8A 2ZMAA 3UDIA 2PBDP 2QHKA 3OPRA 4KQOA 4B4XA 3NHQA 1KDWA 3IBJA 5FQIA 5JYPA 1N9BA 4HP4A 3T12B 3T4OA 3IX8A 3S7NA 5F1FA 1DJBA 3V39A 5M18A 1FQGA 5G18A 1X0OA 2DRWA 1IFQA 3MS6A 5CEDA 5FASA 3QP4A 2VJWA 2YKHA 5HL1A 1H3QA 1G28A 3Q07A 2FH5A 4UEYA 2PAVP 5F5YA 1VM1A 4LV0A 5AQAA 5TR7A 2Y2KA 4P0MA 1ESIA 2PR6A 3UPOA 2JE5A 3C30A 3PHYA 3CPTA 1YMSA 4L9EA 3PXPA 1K56D 4GKUA 1U60A 3CITA 5IU1A 3MXRA 1V9YA 5AQBA 3KYZA 2O9CA 5L2FA 1K54A 1YLWA 3WS2A 3CPTB 2WK0A 1HLUP 1XGIA 1S66L 2XQZA 1E25A 2BG1A 5EE8A 3IXBA 3KYQA 3IH9A 3QP6A 3SH8A 1IKIA 3PTEA 3EWKA 3BFCA 3DAVA 3KO6A 4M3KA 4CPKA 3ULFA 3HUOA 3CAXA 1ZG6A 2HZ5A 4CLCD 2Q9MA 3UB5P 4GW9A 1SZVA 3UB6A 2X01A 4ME4A 3VP3A 4OQ0A 4R23A 2GZAA 3FZCA 2PDRA 3VP0A 4HJ6A 2ZMVA 2OAP1 4HBUA 1ZG4A 2HPBA 3TRCA 2G2UA 4PAUA 2WAEA 4Z9QA 1GHPA 1TF1A 4RX3A 4RQ9A 4I3IA 3FWLA 2JKRM 2Z6DA 1IYOA 4WMCA 5HDCA 1ES3A 2ZM8A 4DDSA 1DRMA 2RCXA 4HH2A 2OSUA 2XLNA 4X53A 3MBZA 1PWCA 1KE0A 1NLYA 1Y28A
chains in the Genus database with same CATH topology
1H8ZA 2DNSA 4XUXA 5KMWA 2IWCA 5U47A 1LI9A 4JF5A 4X55A 2ZQAA 3G2YA 4K0XA 3W4OA 1PI4A 3WRTA 1LL9A 5EVIA 1SCWA 1W5DA 1NY0A 3PBSA 3PBRA 4MBHA 5F1GA 1K57A 5FA7A 4EBNA 2JBFA 3MZEA 2WKEA 3BFDA 4X56A 4DXBA 2Y2QA 5DTTA 1W7FA 2QZ6A 1HZOA 3OPPA 5F83A 3ZDJA 1PZPA 2OLUA 4OOYA 3DW0A 5AQ9A 3ZNTA 2WGWA 1O07A 1XA1A 5CHMA 1XGJA 5FAOA 5KSCA 4S2LA 3WS1A 2R9WA 5EVIB 4N9LA 1TDGA 3VFHA 5DF8A 4UA9A 3SS4A 1ONGA 4ID4A 3UDXA 4XXRA 3EQUA 4KZ5A 1W79A 4N1XA 3A3IA 4S2MA 3WS0A 2H0YA 3TSGA 4ZDXA 2VGJA 2C5WB 1YLYA 2HDRA 1MWSA 2J8YA 1ERQA 4UA6A 5DF7A 2WGWB 3VSKA 3GSGA 3ZCZA 3DWZA 4JF4A 3M6BA 1MKIA 2WADA 3HLDA 4GN2A 2IWDA 2Y2OA 3MZDA 4MBKA 3PAGA 5DTSA 2FFYA 1NJ4A 5CRFA 2Y2PA 3MXSA 2EFXA 1XP4A 3NBLA 3SH9A 3UE3A 5FI2A 2EXBA 3LO7A 4OQIA 3MFDA 1MWRA 5FDHA 3WRZA 1EROA 4KZ3A 1KE3A 2JCHA 4F94A 4EBLA 4WEKA 3ZG7B 4H8RA 4WZ4A 4RA7A 5EUAA 4ZJ2A 3FV7A 3O88A 1NYYA 2HP9A 5CERA 3JYIA 3WWXA 4BD0A 3G31A 1YLPA 3N8SA 4OPYA 2PBYA 3OPLA 4KG5A 1BLCA 4DE3A 3GMWA 1BLHA 3SS3A 4JXGA 4OONA 4XUZA 1AXBA 5FQ9A 1IEMA 1JWPA 1OMEA 1WE4A 2EX6A 3B3XA 3IF5A 2ZQ7A 4JXWA 4K0WA 4WZ5C 3V3RA 3ZGAB 4E3LA 2ZJ9A 4OOMA 1WYCA 4R1GA 4OPZA 4GD6A 4ZAMA 4U0TA 4IVKA 3IF6C 5A92A 4KZ8A 4OKPA 1K54C 3UE0A 2ZQ8A 4PM8A 1GHIA 4JXVA 3OC2A 4PM6A 2XDMA 5A91A 2XD1A 3OCLA 1PWDA 1IKGA 3QNBA 1S0WA 1BZAA 4OP8A 1BLPA 1XA7A 3ZG8B 4WEJA 3SS5A 3DTMA 3NY4A 2H0TA 3HLGA 4PMAA 3VP4A 4BL2A 1DY6A 4A5RA 3G35A 5DF9A 1QMEA 4HBTA 4YFMA 5E2GA 1BULA 4DF6A 3OPHA 5E2EA 2OLVA 1ERMA 1XKZA 4BLMA 1YM1A 2I72A 4YINA 5EOOA 2ZC6B 4QU3A 1MWUA 5JYOA 5GLCA 1K25A 2Y2JA 1JVJA 3IXHA 3SOIA 1M40A 4N92A 4E3MA 3ZG9B 1LL5A 4R4SA 1ALQA 4HEFA 2HP6A 4GNUA 3LY4A 5M19A 4QJGA 3GR2A 5EPHA 3IWOA 4S2IA 1ZKJA 1K56A 4KZAA 2FFFB 5CGSA 3NIAA 5HFOA 1E3UD 2EX2A 2J7VA 3CJMA 3PBTA 4UAAA 4BQMA 1TEMA 2Y2MA 3IWIA 1KE4A 3HUMA 3N4IA 1G68A 1LHYA 3P09A 1ES5A 3HLEA 4PM9A 4X6TA 4PPRA 4IBXA 1JWZA 4NK3A 2WGVA 4R4RA 2C6WB 5GLBA 3VP1A 5TGFA 3G30A 4D2OA 4DE2A 4DXCA 1CEFA 4Y7PA 4QB8A 3IXDA 5GL9A 3IXGA 4E3OA 1ES2A 3MKEA 4KG6A 2ZQDA 3RXWA 3W8KA 1FR6A 2X71A 1JWVA 2A49A 4OP5A 3P98A 3VSLA 3CMZA 3ZVTA 1ESUA 4OLDA 4KZ9A 1I2SA 2PU4A 2Z2MB 3BEBA 3QNCA 4RYEA 3N8LA 4MLLA 4GD8A 4E6XA 2Y59A 3OZHA 3UPPA 4OVDA 4E6WA 3M2KA 1BLSA 4GDNA 1BUEA 3O87A 5D3OA 1G6AA 1DJAA 3A3JA 1KGEA 4IBRA 5GHZA 3HL9A 3FKWA 3HLBA 4FCFA 3Q82A 1GA0A 5CECA 3Q7ZA 1PYYA 3A3EA 1ES4A 1KDSA 4HESA 2J9PA 1HD8A 5FI6A 3ZFZA 1XXMA 2EFUA 2WUQA 1RGYA 1PIOA 1WYBA 2ZC4B 4OQGA 4UA7A 3MZFA 4PM7A 1C3BA 1PW8A 1YQSA 2PU2A 5EVIC 2P9VA 2Y4AA 1YLZA 1YLTA 5E43A 5GHYA 1K57C 1EWZA 3SH7A 3ZG0A 2Y2GA 2X02A 3S22A 2Y2LA 4WMCD 3PBOA 4ZJ1A 1W8YA 4WYYA 3AGFA 3GQZA 1O7EA 3LCEA 2RL3A 2XFTA 4PM5A 1EI5A 4WZ5A 3HBRA 3BM6A 1K4EA 3IHBA 5GLAA 3N7WA 4KQQA 2EXAA 3BRMA 5HAIA 2P9VB 3Q1FA 5CTMA 3ZG5A 1PI5A 1L0GA 1JTGA 5HW3A 3E2KA 1VQQA 1XX2A 3HLWA 4OPRA 1SHVA 3E2LA 1NXYA 4BL3A 4FD8A 2EX8A 2EX9A 3HUNA 5A90A 5EECA 3Q7VA 1L2SA 3WS5A 2XF3A 4U0XA 4Q8IA 4BJPA 5EVID 2HDQA 3CZDA 3M6HA 4C6YA 5FQJA 4LV2A 4JPMA 4R3JA 4B4ZA 3V50A 5FAQA 1K55A 3BLMA 3BFEA 1E4DA 3V5MA 3VMAA 1M6KA 3BECA 4DKIA 3AGEA 4C75A 1MY8A 3A3DA 4LCLA 4C3QA 2ZQ9A 2XEPA 3Q7VB 5CGXA 4N1HA 4EBPA 1N4OA 1YMXA 4GB7A 5CTNA 4EUZA 2B5RA 4S2NA 5CHUA 1PWGA 5DVAA 3GRJA 2Y55A 3EQVA 3LY3A 1ZC2A 5J8XA 1QMFA 2XD5A 1BSGA 3IH8A 3S4XA 1TVFA 1H5XA 5EOEA 1JTDA 3PBQA 4B88A 4KENB 4MEZA 3ITAA 2XGNA 1Q2PA 4ZBEA 4GDBA 3W4PA 5M1AA 1L0DA 5GLDA 3C5AA 3AGDA 4FH4A 5FQKA 5KZHA 1CK3A 2QPNA 1KVMA 2G2WA 3NDGA 3I7JA 3W4QA 4UHUA 2A3UA 5CHJA 4EQIA 1K6SA 4FSFA 1IYSA 3MKFA 1I5QA 1SKFA 4JBFA 4BENA 3VFFA 4DE0A 3BLSA 3UE1A 2Y2HA 4S2JA 3D4FA 4OOLA 3QHYA 3ZNYA 3NCKA 1KGGA 3PBNA 3RXXA 3Q81A 3ISGA 3TOIA 3NC8A 2ZMAA 3FKVA 3ZHHA 1FSWA 5EVLA 3UDIA 2E8IA 1IYQA 3BFFA 1FOFA 1K6RA 1GCEA 3OPRA 4FH2A 2BLSA 4KQOA 4BD1A 1L0FA 4WM9A 1PW1A 5DTKA 2V20A 4B4XA 4EV4A 4DRTA 5HARA 3C7UA 5HAQA 1KDWA 5FQIA 4KZ4A 5JYPA 2UWXA 2ZC5B 1BTLA 3BYDA 3C4PA 3N6IA 1N9BA 2XFSA 4E3IA 5FQQA 3O86A 5F1FA 2WKIA 4JXSA 1DJBA 3V39A 5AQ7A 5M18A 1FQGA 1GHMA 1NRFA 2DRWA 4OH0A 3OCNA 4WBGA 4IVIA 5G18A 1HVBA 1IELA 2WZXA 5CEDA 5FAPA 5FI7A 2Q9NA 5FASA 2V2FF 3UPNA 3N8RA 5FQMA 4P85A 4X69A 4MNRA 2H5SA 4RVAA 3VOZA 4KQRA 1Y54A 1DJCA 4KZBA 5HL1A 3CG5A 2Y2IA 4WELA 1FCNA 1NZOA 3Q07A 3IWQA 3NI9A 1SDEA 1IYPA 1H8YA 2ZQCA 4CJNA 4E3NA 3GV9A 2Y91A 2HDUA 2XR0A 1YLJA 1CI8A 5A93A 4S2PA 1KVLA 4E3KA 1BT5A 4NETA 4E3JA 1VM1A 4U3TA 3ZVWA 4LV0A 5AQAA 5TR7A 3IQAA 2Y2KA 4Y0OA 3UY6A 1LLBA 1ESIA 4P0MA 5HAPA 1TDLA 1S6RA 1FCMA 3UPOA 4O7DA 2JE5A 2H10A 4R0QA 1FR1A 3GVBA 4KG2A 2XH9A 3UNWA 5CEBA 4Y0UA 4S2OA 1MBLA 1YMSA 5FATA 4MBFA 5FSRA 1K56D 4GKUA 1ONHA 4Y0TA 1U60A 2WGIA 3G34A 3RJUA 1RCJA 3MXRA 2ZM0A 5AQBA 2XK1A 5GHXA 1KGFA 3IF6A 4KZ7A 2ZLYA 3G4PA 5E2FA 5L2FA 1K54A 1YLWA 2OV5A 5F82A 3WS2A 1SDNA 2WK0A 1LI0A 1XGIA 1GA9A 2XQZA 1E25A 2BG1A 4ZJ3A 5EE8A 3HREA 3IXBA 4R3BA 4QHCA 1RP5A 1FSYA 3IF6B 3S1YA 3IH9A 5BOHA 3SH8A 3UN7A 1IKIA 1E3UA 3PTEA 3BFCA 4M3KA 1FCOA 3M2JA 5KSHA 3NDEA 2JC7A 1I2WA 4OPQA 4CPKA 4EWFA 2J9OA 1CEGA 1Q2QA 3G32A 3HUOA 4OQHA 1ZG6A 4LV1A 2ZC7A 5TFQA 3V3SA 2WAFA 4LENA 4P87A 4OLGA 5E2HA 3A3FA 3PAEA 3FYZA 1RGZA 2Q9MA 1HTZA 4N9KA 3TG9A 1CI9A 4RX2A 2ZD8A 2VGKA 4GZBA 4S2KA 2X01A 3C7VA 4L0LA 3VP3A 4OQ0A 1K4FA 2GDNA 4KZ6A 3G2ZA 4P6BA 4QD4A 4R23A 1MPLA 1YT4A 2Y2NA 3FZCA 3IT9A 4ZTKA 5HX9A 3VP0A 5I94A 4GOGA 1MXOA 1K38A 2HDSA 3HLFA 3UO9A 1K55C 2HP5A 2P74A 4JLFA 4LCMA 4K91A 3C4OA 4DE1A 3DWKA 4HBUA 3VP2A 1ZG4A 2HPBA 4JF6A 5CGWA 1W8QA 2G2UA 2V1ZA 3BFGA 3HLCA 2ZM2A 4DDYA 4S2NC 2WAEA 1PZOA 4Z9QA 3UDFA 3IHAA 2R9XA 1GHPA 1L0EA 4RX3A 4IEDA 2DCFA 4QY5A 3FWLA 1NZUA 1NYMA 1MWTA 4JKTA 1IYOA 2WKHA 4WMCA 5CXWA 4X68A 3GTCA 1ES3A 2ZC3B 3VOYA 2ZM8A 4DDSA 2WZZA 2RCXA 1XPBA 3WS4A 2CC1A 2IWBA 1J9MA 2OSUA 2WYXA 2XLNA 2Z2LB 3ITBA 3LEZA 3MBZA 4LV3A 1PWCA 4QY6A 4X53A 3O3VA 1KE0A 2QMIA 5IHVA 3HVFA 1Z6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8Z A;  2DNS A;  4XUX A;  5KMW A;  2IWC A;  5U47 A;  1LI9 A;  4JF5 A;  4X55 A;  2ZQA A;  3G2Y A;  4K0X A;  3W4O A;  1PI4 A;  3WRT A;  1LL9 A;  5EVI A;  1SCW A;  1W5D A;  1NY0 A;  3PBS A;  3PBR A;  4MBH A;  5F1G A;  1K57 A;  5FA7 A;  4EBN A;  2JBF A;  3MZE A;  2WKE A;  3BFD A;  4X56 A;  4DXB A;  2Y2Q A;  5DTT A;  1W7F A;  2QZ6 A;  1HZO A;  3OPP A;  5F83 A;  3ZDJ A;  1PZP A;  2OLU A;  4OOY A;  3DW0 A;  5AQ9 A;  3ZNT A;  2WGW A;  1O07 A;  1XA1 A;  5CHM A;  1XGJ A;  5FAO A;  5KSC A;  4S2L A;  3WS1 A;  2R9W A;  5EVI B;  4N9L A;  1TDG A;  3VFH A;  5DF8 A;  4UA9 A;  3SS4 A;  1ONG A;  4ID4 A;  3UDX A;  4XXR A;  3EQU A;  4KZ5 A;  1W79 A;  4N1X A;  3A3I A;  4S2M A;  3WS0 A;  2H0Y A;  3TSG A;  4ZDX A;  2VGJ A;  2C5W B;  1YLY A;  2HDR A;  1MWS A;  2J8Y A;  1ERQ A;  4UA6 A;  5DF7 A;  2WGW B;  3VSK A;  3GSG A;  3ZCZ A;  3DWZ A;  4JF4 A;  3M6B A;  1MKI A;  2WAD A;  3HLD A;  4GN2 A;  2IWD A;  2Y2O A;  3MZD A;  4MBK A;  3PAG A;  5DTS A;  2FFY A;  1NJ4 A;  5CRF A;  2Y2P A;  3MXS A;  2EFX A;  1XP4 A;  3NBL A;  3SH9 A;  3UE3 A;  5FI2 A;  2EXB A;  3LO7 A;  4OQI A;  3MFD A;  1MWR A;  5FDH A;  3WRZ A;  1ERO A;  4KZ3 A;  1KE3 A;  2JCH A;  4F94 A;  4EBL A;  4WEK A;  3ZG7 B;  4H8R A;  4WZ4 A;  4RA7 A;  5EUA A;  4ZJ2 A;  3FV7 A;  3O88 A;  1NYY A;  2HP9 A;  5CER A;  3JYI A;  3WWX A;  4BD0 A;  3G31 A;  1YLP A;  3N8S A;  4OPY A;  2PBY A;  3OPL A;  4KG5 A;  1BLC A;  4DE3 A;  3GMW A;  1BLH A;  3SS3 A;  4JXG A;  4OON A;  4XUZ A;  1AXB A;  5FQ9 A;  1IEM A;  1JWP A;  1OME A;  1WE4 A;  2EX6 A;  3B3X A;  3IF5 A;  2ZQ7 A;  4JXW A;  4K0W A;  4WZ5 C;  3V3R A;  3ZGA B;  4E3L A;  2ZJ9 A;  4OOM A;  1WYC A;  4R1G A;  4OPZ A;  4GD6 A;  4ZAM A;  4U0T A;  4IVK A;  3IF6 C;  5A92 A;  4KZ8 A;  4OKP A;  1K54 C;  3UE0 A;  2ZQ8 A;  4PM8 A;  1GHI A;  4JXV A;  3OC2 A;  4PM6 A;  2XDM A;  5A91 A;  2XD1 A;  3OCL A;  1PWD A;  1IKG A;  3QNB A;  1S0W A;  1BZA A;  4OP8 A;  1BLP A;  1XA7 A;  3ZG8 B;  4WEJ A;  3SS5 A;  3DTM A;  3NY4 A;  2H0T A;  3HLG A;  4PMA A;  3VP4 A;  4BL2 A;  1DY6 A;  4A5R A;  3G35 A;  5DF9 A;  1QME A;  4HBT A;  4YFM A;  5E2G A;  1BUL A;  4DF6 A;  3OPH A;  5E2E A;  2OLV A;  1ERM A;  1XKZ A;  4BLM A;  1YM1 A;  2I72 A;  4YIN A;  5EOO A;  2ZC6 B;  4QU3 A;  1MWU A;  5JYO A;  5GLC A;  1K25 A;  2Y2J A;  1JVJ A;  3IXH A;  3SOI A;  1M40 A;  4N92 A;  4E3M A;  3ZG9 B;  1LL5 A;  4R4S A;  1ALQ A;  4HEF A;  2HP6 A;  4GNU A;  3LY4 A;  5M19 A;  4QJG A;  3GR2 A;  5EPH A;  3IWO A;  4S2I A;  1ZKJ A;  1K56 A;  4KZA A;  2FFF B;  5CGS A;  3NIA A;  5HFO A;  1E3U D;  2EX2 A;  2J7V A;  3CJM A;  3PBT A;  4UAA A;  4BQM A;  1TEM A;  2Y2M A;  3IWI A;  1KE4 A;  3HUM A;  3N4I A;  1G68 A;  1LHY A;  3P09 A;  1ES5 A;  3HLE A;  4PM9 A;  4X6T A;  4PPR A;  4IBX A;  1JWZ A;  4NK3 A;  2WGV A;  4R4R A;  2C6W B;  5GLB A;  3VP1 A;  5TGF A;  3G30 A;  4D2O A;  4DE2 A;  4DXC A;  1CEF A;  4Y7P A;  4QB8 A;  3IXD A;  5GL9 A;  3IXG A;  4E3O A;  1ES2 A;  3MKE A;  4KG6 A;  2ZQD A;  3RXW A;  3W8K A;  1FR6 A;  2X71 A;  1JWV A;  2A49 A;  4OP5 A;  3P98 A;  3VSL A;  3CMZ A;  3ZVT A;  1ESU A;  4OLD A;  4KZ9 A;  1I2S A;  2PU4 A;  2Z2M B;  3BEB A;  3QNC A;  4RYE A;  3N8L A;  4MLL A;  4GD8 A;  4E6X A;  2Y59 A;  3OZH A;  3UPP A;  4OVD A;  4E6W A;  3M2K A;  1BLS A;  4GDN A;  1BUE A;  3O87 A;  5D3O A;  1G6A A;  1DJA A;  3A3J A;  1KGE A;  4IBR A;  5GHZ A;  3HL9 A;  3FKW A;  3HLB A;  4FCF A;  3Q82 A;  1GA0 A;  5CEC A;  3Q7Z A;  1PYY A;  3A3E A;  1ES4 A;  1KDS A;  4HES A;  2J9P A;  1HD8 A;  5FI6 A;  3ZFZ A;  1XXM A;  2EFU A;  2WUQ A;  1RGY A;  1PIO A;  1WYB A;  2ZC4 B;  4OQG A;  4UA7 A;  3MZF A;  4PM7 A;  1C3B A;  1PW8 A;  1YQS A;  2PU2 A;  5EVI C;  2P9V A;  2Y4A A;  1YLZ A;  1YLT A;  5E43 A;  5GHY A;  1K57 C;  1EWZ A;  3SH7 A;  3ZG0 A;  2Y2G A;  2X02 A;  3S22 A;  2Y2L A;  4WMC D;  3PBO A;  4ZJ1 A;  1W8Y A;  4WYY A;  3AGF A;  3GQZ A;  1O7E A;  3LCE A;  2RL3 A;  2XFT A;  4PM5 A;  1EI5 A;  4WZ5 A;  3HBR A;  3BM6 A;  1K4E A;  3IHB A;  5GLA A;  3N7W A;  4KQQ A;  2EXA A;  3BRM A;  5HAI A;  2P9V B;  3Q1F A;  5CTM A;  3ZG5 A;  1PI5 A;  1L0G A;  1JTG A;  5HW3 A;  3E2K A;  1VQQ A;  1XX2 A;  3HLW A;  4OPR A;  1SHV A;  3E2L A;  1NXY A;  4BL3 A;  4FD8 A;  2EX8 A;  2EX9 A;  3HUN A;  5A90 A;  5EEC A;  3Q7V A;  1L2S A;  3WS5 A;  2XF3 A;  4U0X A;  4Q8I A;  4BJP A;  5EVI D;  2HDQ A;  3CZD A;  3M6H A;  4C6Y A;  5FQJ A;  4LV2 A;  4JPM A;  4R3J A;  4B4Z A;  3V50 A;  5FAQ A;  1K55 A;  3BLM A;  3BFE A;  1E4D A;  3V5M A;  3VMA A;  1M6K A;  3BEC A;  4DKI A;  3AGE A;  4C75 A;  1MY8 A;  3A3D A;  4LCL A;  4C3Q A;  2ZQ9 A;  2XEP A;  3Q7V B;  5CGX A;  4N1H A;  4EBP A;  1N4O A;  1YMX A;  4GB7 A;  5CTN A;  4EUZ A;  2B5R A;  4S2N A;  5CHU A;  1PWG A;  5DVA A;  3GRJ A;  2Y55 A;  3EQV A;  3LY3 A;  1ZC2 A;  5J8X A;  1QMF A;  2XD5 A;  1BSG A;  3IH8 A;  3S4X A;  1TVF A;  1H5X A;  5EOE A;  1JTD A;  3PBQ A;  4B88 A;  4KEN B;  4MEZ A;  3ITA A;  2XGN A;  1Q2P A;  4ZBE A;  4GDB A;  3W4P A;  5M1A A;  1L0D A;  5GLD A;  3C5A A;  3AGD A;  4FH4 A;  5FQK A;  5KZH A;  1CK3 A;  2QPN A;  1KVM A;  2G2W A;  3NDG A;  3I7J A;  3W4Q A;  4UHU A;  2A3U A;  5CHJ A;  4EQI A;  1K6S A;  4FSF A;  1IYS A;  3MKF A;  1I5Q A;  1SKF A;  4JBF A;  4BEN A;  3VFF A;  4DE0 A;  3BLS A;  3UE1 A;  2Y2H A;  4S2J A;  3D4F A;  4OOL A;  3QHY A;  3ZNY A;  3NCK A;  1KGG A;  3PBN A;  3RXX A;  3Q81 A;  3ISG A;  3TOI A;  3NC8 A;  2ZMA A;  3FKV A;  3ZHH A;  1FSW A;  5EVL A;  3UDI A;  2E8I A;  1IYQ A;  3BFF A;  1FOF A;  1K6R A;  1GCE A;  3OPR A;  4FH2 A;  2BLS A;  4KQO A;  4BD1 A;  1L0F A;  4WM9 A;  1PW1 A;  5DTK A;  2V20 A;  4B4X A;  4EV4 A;  4DRT A;  5HAR A;  3C7U A;  5HAQ A;  1KDW A;  5FQI A;  4KZ4 A;  5JYP A;  2UWX A;  2ZC5 B;  1BTL A;  3BYD A;  3C4P A;  3N6I A;  1N9B A;  2XFS A;  4E3I A;  5FQQ A;  3O86 A;  5F1F A;  2WKI A;  4JXS A;  1DJB A;  3V39 A;  5AQ7 A;  5M18 A;  1FQG A;  1GHM A;  1NRF A;  2DRW A;  4OH0 A;  3OCN A;  4WBG A;  4IVI A;  5G18 A;  1HVB A;  1IEL A;  2WZX A;  5CED A;  5FAP A;  5FI7 A;  2Q9N A;  5FAS A;  2V2F F;  3UPN A;  3N8R A;  5FQM A;  4P85 A;  4X69 A;  4MNR A;  2H5S A;  4RVA A;  3VOZ A;  4KQR A;  1Y54 A;  1DJC A;  4KZB A;  5HL1 A;  3CG5 A;  2Y2I A;  4WEL A;  1FCN A;  1NZO A;  3Q07 A;  3IWQ A;  3NI9 A;  1SDE A;  1IYP A;  1H8Y A;  2ZQC A;  4CJN A;  4E3N A;  3GV9 A;  2Y91 A;  2HDU A;  2XR0 A;  1YLJ A;  1CI8 A;  5A93 A;  4S2P A;  1KVL A;  4E3K A;  1BT5 A;  4NET A;  4E3J A;  1VM1 A;  4U3T A;  3ZVW A;  4LV0 A;  5AQA A;  5TR7 A;  3IQA A;  2Y2K A;  4Y0O A;  3UY6 A;  1LLB A;  1ESI A;  4P0M A;  5HAP A;  1TDL A;  1S6R A;  1FCM A;  3UPO A;  4O7D A;  2JE5 A;  2H10 A;  4R0Q A;  1FR1 A;  3GVB A;  4KG2 A;  2XH9 A;  3UNW A;  5CEB A;  4Y0U A;  4S2O A;  1MBL A;  1YMS A;  5FAT A;  4MBF A;  5FSR A;  1K56 D;  4GKU A;  1ONH A;  4Y0T A;  1U60 A;  2WGI A;  3G34 A;  3RJU A;  1RCJ A;  3MXR A;  2ZM0 A;  5AQB A;  2XK1 A;  5GHX A;  1KGF A;  3IF6 A;  4KZ7 A;  2ZLY A;  3G4P A;  5E2F A;  5L2F A;  1K54 A;  1YLW A;  2OV5 A;  5F82 A;  3WS2 A;  1SDN A;  2WK0 A;  1LI0 A;  1XGI A;  1GA9 A;  2XQZ A;  1E25 A;  2BG1 A;  4ZJ3 A;  5EE8 A;  3HRE A;  3IXB A;  4R3B A;  4QHC A;  1RP5 A;  1FSY A;  3IF6 B;  3S1Y A;  3IH9 A;  5BOH A;  3SH8 A;  3UN7 A;  1IKI A;  1E3U A;  3PTE A;  3BFC A;  4M3K A;  1FCO A;  3M2J A;  5KSH A;  3NDE A;  2JC7 A;  1I2W A;  4OPQ A;  4CPK A;  4EWF A;  2J9O A;  1CEG A;  1Q2Q A;  3G32 A;  3HUO A;  4OQH A;  1ZG6 A;  4LV1 A;  2ZC7 A;  5TFQ A;  3V3S A;  2WAF A;  4LEN A;  4P87 A;  4OLG A;  5E2H A;  3A3F A;  3PAE A;  3FYZ A;  1RGZ A;  2Q9M A;  1HTZ A;  4N9K A;  3TG9 A;  1CI9 A;  4RX2 A;  2ZD8 A;  2VGK A;  4GZB A;  4S2K A;  2X01 A;  3C7V A;  4L0L A;  3VP3 A;  4OQ0 A;  1K4F A;  2GDN A;  4KZ6 A;  3G2Z A;  4P6B A;  4QD4 A;  4R23 A;  1MPL A;  1YT4 A;  2Y2N A;  3FZC A;  3IT9 A;  4ZTK A;  5HX9 A;  3VP0 A;  5I94 A;  4GOG A;  1MXO A;  1K38 A;  2HDS A;  3HLF A;  3UO9 A;  1K55 C;  2HP5 A;  2P74 A;  4JLF A;  4LCM A;  4K91 A;  3C4O A;  4DE1 A;  3DWK A;  4HBU A;  3VP2 A;  1ZG4 A;  2HPB A;  4JF6 A;  5CGW A;  1W8Q A;  2G2U A;  2V1Z A;  3BFG A;  3HLC A;  2ZM2 A;  4DDY A;  4S2N C;  2WAE A;  1PZO A;  4Z9Q A;  3UDF A;  3IHA A;  2R9X A;  1GHP A;  1L0E A;  4RX3 A;  4IED A;  2DCF A;  4QY5 A;  3FWL A;  1NZU A;  1NYM A;  1MWT A;  4JKT A;  1IYO A;  2WKH A;  4WMC A;  5CXW A;  4X68 A;  3GTC A;  1ES3 A;  2ZC3 B;  3VOY A;  2ZM8 A;  4DDS A;  2WZZ A;  2RCX A;  1XPB A;  3WS4 A;  2CC1 A;  2IWB A;  1J9M A;  2OSU A;  2WYX A;  2XLN A;  2Z2L B;  3ITB A;  3LEZ A;  3MBZ A;  4LV3 A;  1PWC A;  4QY6 A;  4X53 A;  3O3V A;  1KE0 A;  2QMI A;  5IHV A;  3HVF A;  1Z6F A; 
#chains in the Genus database with same CATH topology
 1H8Z A;  2IWC A;  1LI9 A;  1OJG A;  2ZL1 A;  3G2Y A;  4DJ3 A;  4NKP A;  3WRT A;  5F1G A;  3FG8 A;  4HI4 A;  2J80 A;  1HZO A;  3ZDJ A;  1PZP A;  2ZL1 B;  3T4T A;  1MZU A;  2WGW A;  1XA1 A;  5CHM A;  1XGJ A;  5KSC A;  4S2L A;  4N9L A;  4CLC A;  4ID4 A;  1OJ5 A;  3UDX A;  1AWI A;  3LID A;  3HCY A;  1MWS A;  3LR5 A;  1ERQ A;  4ETZ A;  2WGW B;  4G3W A;  3CLO A;  2Y2O A;  1OTA A;  4CLC B;  3MXS A;  1UWP X;  4IJG A;  1XP4 A;  4Y3I A;  3LO7 A;  1MWR A;  4H8R A;  4WZ4 A;  4RA7 A;  2HP9 A;  5CER A;  1YLP A;  2PBY A;  4KG5 A;  5L09 A;  2PD8 A;  5EVE A;  3LIB A;  1TS0 A;  4F3L A;  1BLH A;  4Y2F A;  4JXG A;  1AXB A;  3B3X A;  1WE4 A;  2JKT I;  1F2K A;  3V3R A;  4I3J A;  4R1G A;  4U0T A;  3IF6 C;  3UE0 A;  1GHI A;  3OC2 A;  3CUE C;  4PM6 A;  4F3L B;  2XD1 A;  3OCL A;  1IKG A;  2KOI A;  3QNB A;  1BLP A;  1YPR A;  3JVV A;  4PMA A;  3VP4 A;  4BL2 A;  3CHW P;  3T4K A;  5DF9 A;  5K5B A;  4HBT A;  3MFX A;  2XSS A;  5E2G A;  1BUL A;  2OLV A;  1XKZ A;  2ZC6 B;  2W1T A;  3LIA A;  4QU3 A;  5JYO A;  1JNU A;  3NOT C;  2Y2J A;  1W63 Q;  1H8M A;  3PYP A;  4N92 A;  5J7E A;  5EFW A;  2HP6 A;  4QJG A;  3GR2 A;  2W1T B;  5EPH A;  4L9F A;  1E3U D;  2J7V A;  4UAA A;  4NEE D;  2PR5 A;  1TEM A;  3IWI A;  3HUM A;  5AJG A;  4X6T A;  4ZRR A;  4B93 A;  4II7 A;  1JWZ A;  2WGV A;  5GLB A;  4DE2 A;  3G30 A;  4D2O A;  3MQQ A;  4QB8 A;  3IXD A;  4KG6 A;  3W8K A;  1FR6 A;  1V9Z A;  3CMZ A;  3ZVT A;  1ESU A;  4OLD A;  1I2S A;  1VHM A;  3DBA A;  1D06 A;  4MLL A;  4HJ3 A;  4E6X A;  2Y59 A;  3O87 A;  1NLZ A;  3HLB A;  3R4K A;  2Y8H A;  1KDS A;  2J9P A;  5FI6 A;  1PIO A;  4UA7 A;  4GHI A;  5EM1 A;  3FPW A;  5EVI C;  4ARZ A;  4L9G A;  2Y4A A;  2Y2G A;  2X02 A;  1LSW A;  3GQZ A;  1O7E A;  2XFT A;  4PM5 A;  2W3D A;  4GHI B;  5GLA A;  4KQQ A;  1ZHH B;  1CJF A;  1PI5 A;  3RTY A;  2J3W A;  3C8C A;  3F1N A;  4FD8 A;  1PFL A;  2EX9 A;  3HUN A;  3VE3 A;  3Q7V A;  3WS5 A;  2HDQ A;  4C6Y A;  4LV2 A;  4JPM A;  4R3J A;  4Y5F A;  4B4Z A;  3V50 A;  3BFE A;  1M6K A;  3F1N B;  2W0N A;  2NUT C;  1OPX A;  1UGU A;  3Q7V B;  1YMX A;  4GB7 A;  4EUZ A;  2B5R A;  4S2N A;  3EQV A;  4BMW A;  2V0W A;  1KOU A;  4KEN B;  4MEZ A;  1ZTU A;  3W4P A;  5KZH A;  5FEG A;  4I5S A;  4UQI M;  3I7J A;  3W4Q A;  4UHU A;  2J3T C;  2PRF A;  4FSF A;  1SKF A;  4DE0 A;  4S2J A;  3RXX A;  5EVL A;  2IA2 A;  1K6R A;  2VKS A;  4Q0I A;  1PW1 A;  5DTK A;  3BQA A;  5HAR A;  4KZ4 A;  2ZC5 B;  5HWV A;  3C4P A;  4KUO A;  3N6I A;  4E3I A;  5FQQ A;  3TJZ C;  4JXS A;  1CQA A;  3NOP C;  4WBG A;  1IEL A;  5FAP A;  2Q9N A;  4P85 A;  2Y2I A;  1FCN A;  4CJN A;  1K0K A;  4GS9 A;  1FIL A;  4E3J A;  4U3T A;  3UB9 A;  4Q0H A;  3UY6 A;  4O0P A;  5HAP A;  5HPI A;  1S6R A;  4R70 A;  4G3K A;  4R0Q A;  1FR1 A;  3GVB A;  2PYR A;  2XH9 A;  5CEB A;  2D02 A;  4GLQ A;  4JGR A;  5FSR A;  4GS9 B;  4Y0T A;  2MJ6 A;  5TJJ A;  1RCJ A;  5GHX A;  4KZ7 A;  2ZLY A;  1D1J A;  5F82 A;  1SDN A;  4P6Z M;  1LI0 A;  5I5L A;  4PKY A;  1OTI A;  4QPR A;  1FSY A;  3S1Y A;  5BOH A;  3UN7 A;  4OPQ A;  1I2W A;  4EWF A;  2J9O A;  1S1Z A;  4M4X A;  2ZOI A;  3EEA A;  4EUV A;  3KSI A;  4P87 A;  1Z09 A;  2ACG A;  1Y4O A;  4DMZ A;  4X1M A;  4GZB A;  3C7V A;  4KZ6 A;  4QD4 A;  5FL3 A;  1MPL A;  1YT4 A;  2DMW A;  2JKG A;  1K38 A;  1N9O A;  2WKR A;  4G3V A;  4Z1W A;  4LLO B;  3CI6 A;  3P01 A;  4JF6 A;  5CGW A;  3VP2 A;  3HLC A;  4DDY A;  2R9X A;  1L0E A;  2XA7 M;  2DCF A;  1NZU A;  2VZW A;  1MWT A;  4JKT A;  4LRY C;  3A0S A;  5DJU A;  2WZZ A;  2PYP A;  2CC1 A;  3S7Q A;  5L07 A;  5LBR A;  3QP1 A;  3DTI A;  3E0Y A;  2Z2L B;  3T1S A;  3O3V A;  2QMI A;  3NUL A;  2DNS A;  4XUX A;  5KMW A;  4EER A;  1H0M A;  4X55 A;  1PI4 A;  3PBS A;  1NY0 A;  1S4S A;  1K57 A;  5FA7 A;  4HHD A;  4X56 A;  2Y2Q A;  5DTT A;  2OLU A;  3DW0 A;  3ZNT A;  3WS1 A;  1ODV A;  5DF8 A;  3NJA A;  4N1X A;  3A3I A;  3WS0 A;  4ZDX A;  2VGJ A;  2C5W B;  4UA6 A;  3VSK A;  5DF7 A;  4JF4 A;  3M6B A;  3HLD A;  3MZD A;  3PAG A;  2FFY A;  5CRF A;  2HV1 A;  2EFX A;  1F9I A;  3V67 A;  5FI2 A;  2EXB A;  2QKP A;  1P97 A;  4OQI A;  5FDH A;  1ERO A;  5HWT A;  4KZ3 A;  4HP9 A;  3E4Q A;  5EUA A;  3FV7 A;  4BD0 A;  3JYI A;  3WWX A;  3G31 A;  4OPY A;  2B18 A;  3LEQ A;  2QWS A;  3RH8 B;  4OON A;  1IEM A;  1JWP A;  1OME A;  4WZ5 C;  4K0W A;  4E3L A;  4JXW A;  1WYC A;  4OPZ A;  4NXB A;  2V9A A;  4KZ8 A;  1K54 C;  2ZQ8 A;  4PM8 A;  3TE8 A;  2XDM A;  5A91 A;  1DP9 A;  3LYX A;  3DTM A;  2H0T A;  2UV0 E;  4X25 A;  1F5M A;  2JKF A;  4A5R A;  4YFM A;  1ERM A;  1YM1 A;  3B33 A;  4YIN A;  3H9W A;  1WA9 A;  5A8B A;  1K25 A;  1JVJ A;  3SOI A;  4BBV A;  2KX6 A;  3EEH A;  4E3M A;  2B95 A;  4R4S A;  2V0U A;  4EXO A;  4GNU A;  3IWO A;  3MXQ A;  1ZKJ A;  1K56 A;  2FFF B;  5HFO A;  1S1Y A;  2Y2M A;  1KE4 A;  3T4S A;  3P09 A;  4PM9 A;  4R38 A;  2WKP A;  4R4R A;  2VLG A;  3MQO A;  3RXW A;  2VV6 A;  2FZ0 A;  2QJ5 A;  4AFI A;  4OP5 A;  3EGD C;  3P98 A;  3VSL A;  5AVE A;  4KZ9 A;  2Z2M B;  3IS2 A;  1F98 A;  3BY9 A;  4GD8 A;  3OZH A;  4IUH A;  4OVD A;  4GDN A;  4YWZ A;  4IBR A;  3A3J A;  1TD5 A;  3HL9 A;  4FCF A;  3IX4 A;  4BBT A;  1OTE A;  3ICY A;  3Q7Z A;  2ZOH A;  2OOL A;  3LI9 A;  4HES A;  1MC0 A;  3IS2 B;  3T4Q A;  5HZH A;  2WUQ A;  1RGY A;  3HJK A;  1WYB A;  4Y15 A;  2OWH A;  1PW8 A;  1LT0 A;  1EWZ A;  2QYB A;  5CX7 A;  3R7W A;  2Y2L A;  1W8Y A;  3AGF A;  3LCE A;  5DFY A;  3BM6 A;  4B9O A;  3N7W A;  1GSV A;  3R7W B;  4OPR A;  1VQQ A;  4QWO A;  2VGL M;  3QP2 A;  1SHV A;  4BL3 A;  3CUE A;  2EX8 A;  2V1A A;  5A90 A;  5EEC A;  5EVI D;  5DJT A;  5FQJ A;  5FAQ A;  1G6O A;  1K55 A;  2ZMF A;  3VMA A;  1MY8 A;  4LCL A;  4C3Q A;  1N9L A;  2R78 A;  1TS8 A;  5CGX A;  4EBP A;  3MJQ A;  4WN5 A;  4JGP A;  1PWG A;  2Y55 A;  5DKL A;  3LY3 A;  2E8J A;  4HY8 A;  3S4X A;  3UME A;  1TVF A;  2GJ3 A;  2JKR I;  3PBQ A;  3ITA A;  2W3E A;  2XRO A;  5GLD A;  3G6O A;  4FH4 A;  1UWN X;  2XRN A;  3GDI A;  3NDG A;  2OWJ A;  2A3U A;  2EWV A;  1IYS A;  3MKF A;  4JBF A;  5HD5 A;  5HSQ A;  4LRX C;  3UE1 A;  2Y2H A;  5F68 A;  3ZNY A;  3QHY A;  1KGG A;  3LR3 A;  5HD3 A;  2E8I A;  1IYQ A;  3BFF A;  1FOF A;  1GCE A;  4FH2 A;  4BD1 A;  4WM9 A;  2V20 A;  4WLA A;  4EV4 A;  2L4R A;  3C7U A;  5HAQ A;  1N9N A;  3T1R A;  3K3C A;  3UB8 A;  4OH0 A;  1NRF A;  2J3T D;  4IVI A;  2W3G A;  1HVB A;  1P9W A;  2WZX A;  5FI7 A;  3L9K A;  3UPN A;  2VEA A;  3N8R A;  5FQM A;  3K2N A;  4X69 A;  5FDS A;  4MNR A;  4MDZ A;  4RVA A;  3VOZ A;  2Y79 A;  3CG5 A;  4WEL A;  3IWQ A;  3NI9 A;  1IYP A;  2Y91 A;  3D72 A;  2XR0 A;  5HDS A;  1CI8 A;  5A93 A;  4S2P A;  4E3K A;  1BT5 A;  3H7W A;  3ZVW A;  1TDL A;  1FCM A;  2O0Y A;  2H10 A;  4LFU A;  3UNW A;  4Y0U A;  1MBL A;  4I39 A;  5FAT A;  3LR4 A;  1ONH A;  2WGI A;  3G34 A;  3H7W B;  5HL6 A;  1A0K A;  2D01 A;  2ZM0 A;  2XK1 A;  4UQI S;  3VV4 A;  1KGF A;  5E2F A;  1YKD A;  4YNR A;  1MKM A;  3LGO A;  4ZJ3 A;  3S7P A;  4QHC A;  1RP5 A;  5KIZ A;  1E3U A;  5FEF A;  3M2J A;  5KSH A;  2JC7 A;  3B47 A;  5F69 A;  4LV1 A;  2ZC7 A;  5TFQ A;  4LEN A;  4OLG A;  3A3F A;  3PAE A;  3FYZ A;  1HTZ A;  4HOI A;  3KSH A;  1CI9 A;  1XFN A;  3D3O A;  4NXG A;  2ZD8 A;  2VGK A;  1TS7 A;  4S2K A;  1T1C A;  1K4F A;  3G2Z A;  3IT9 A;  1OTB A;  5I94 A;  2HDS A;  3HLF A;  3UO9 A;  4JLF A;  3OLO A;  4LCM A;  4K91 A;  3C4O A;  2HF6 A;  1W8Q A;  4S2N C;  4BBU A;  1XJ6 A;  3HJI A;  2W3F A;  1LSX A;  1D7E A;  3LUQ A;  4IUK A;  4IED A;  3CWF A;  1NYM A;  3FC7 A;  4PHT A;  5CXW A;  4Y17 A;  3GTC A;  2ZC3 B;  3VOY A;  1W63 M;  1XPB A;  1J9M A;  1SKO B;  1J3W A;  2WYX A;  3ITB A;  4LV3 A;  4XT2 A;  3HVF A;  4JF5 A;  4K0X A;  3LIF A;  1OT6 A;  1LL9 A;  1SCW A;  4MBH A;  1NRJ A;  4EBN A;  4XT2 B;  5G4Y A;  4DJ2 A;  2WKE A;  4DXB A;  3OPP A;  5F83 A;  3C38 A;  2KDK A;  5AQ9 A;  3BQ8 A;  1O07 A;  2R9W A;  3VFH A;  4UA9 A;  3SS4 A;  2PT7 A;  4S2M A;  3TSG A;  1YLY A;  2HDR A;  5DFX A;  3GSG A;  3ZCZ A;  3DWZ A;  4O8G A;  4GN2 A;  5G4Z A;  5DTS A;  2Y2P A;  4EEP A;  3SH9 A;  3UE3 A;  4CLC E;  3WRZ A;  2XA7 S;  4F94 A;  3ZG7 B;  3U2A A;  1NYY A;  3UB7 A;  3GMW A;  4XUZ A;  5FQ9 A;  2EX6 A;  3IF5 A;  4OOM A;  4YOF A;  4GD6 A;  4IVK A;  5A92 A;  1T19 A;  4OKP A;  2P7J A;  4JXV A;  5TBM A;  1S0W A;  1BZA A;  4DN0 A;  2VK3 A;  3ZG8 B;  3SS5 A;  1DY6 A;  3A0R A;  5TBM B;  3T4J A;  1XJ3 A;  4GCZ A;  5F6A A;  2A24 A;  3DTE A;  1MWU A;  3IXH A;  1M40 A;  2A2L A;  2VV8 A;  4JGQ A;  3ZG9 B;  5HWW A;  4HEF A;  4EET B;  2A24 B;  3LY4 A;  4WF0 A;  5M19 A;  4S2I A;  1LSV A;  1XJ2 A;  1S67 L;  2EX2 A;  3CJM A;  3A0V A;  2I9V A;  2HJE A;  1FIK A;  4NXF A;  3N4I A;  1G68 A;  1ES5 A;  3HLE A;  4PPR A;  3MSH A;  2PD7 A;  2C6W B;  3VP1 A;  5TGF A;  5GL9 A;  4Y7P A;  1ES2 A;  3T50 A;  3O5Y A;  2EA9 A;  2X71 A;  1JWV A;  2A49 A;  2YKF A;  3LI8 A;  4LRZ E;  2PU4 A;  3BEB A;  3QNC A;  4RYE A;  3D9Y A;  1GSX A;  3VOL A;  1DP8 A;  2QJ7 A;  1G6A A;  1DJA A;  5GHZ A;  3Q82 A;  1GA0 A;  3NOU C;  5CEC A;  4MN7 A;  3A3E A;  1ES4 A;  4NG2 A;  2BAS A;  1HD8 A;  3VE4 A;  1XXM A;  4I3A A;  2ZC4 B;  4OQG A;  3MZF A;  1C3B A;  2PU2 A;  2P9V A;  1YLZ A;  1YLT A;  5GHY A;  1K57 C;  3ZQ5 A;  4WMC D;  1T1B A;  4WYY A;  3T4L A;  3FPV A;  4WZ5 A;  3HBR A;  4HNB A;  4CQH A;  2EXA A;  2V8F A;  3BRM A;  5HAI A;  3F1O A;  2P9V B;  3Q1F A;  4R3A A;  2GNX A;  3E2K A;  3HLW A;  5EV0 A;  1PNE A;  3E4O A;  2Z6C A;  3MMH A;  3C2W A;  5HPF A;  5J4E A;  4U0X A;  4Q8I A;  3F1O B;  3B42 A;  1E4D A;  3V5M A;  3BEC A;  4DKI A;  3AGE A;  5J3W A;  4C75 A;  2ZQ9 A;  1N4O A;  5L8M A;  5CHU A;  5DVA A;  5J8X A;  1ZC2 A;  1QMF A;  1BSG A;  2JKT M;  4O01 A;  5EOE A;  4KUK A;  2XGN A;  1Q2P A;  3W2Z A;  4GDB A;  3T1Q B;  5M1A A;  1L0D A;  4I38 A;  3C5A A;  4FOF A;  3AGD A;  4EQI A;  3LR0 A;  2CMN A;  1I5Q A;  1DP6 A;  3VFF A;  1VEU A;  2Q0O A;  3KYE A;  3D4F A;  4OOL A;  3NCK A;  1XJ4 A;  3ISG A;  3FKV A;  3ZHH A;  1FSW A;  2BLS A;  1L0F A;  1VEU B;  4R6L A;  2VGL S;  2UWX A;  3BYD A;  1BTL A;  5HDD A;  2XFS A;  3O86 A;  2WKI A;  1CF0 A;  5AQ7 A;  4ETX A;  1GHM A;  3OCN A;  3P7N A;  5IS1 A;  1P9R A;  3OOV A;  2V2F F;  2H5S A;  4KQR A;  1Y54 A;  1DJC A;  4KZB A;  1ACF A;  1NZO A;  2W27 A;  1SDE A;  1H8Y A;  1EW0 A;  2ZQC A;  4E3N A;  3GV9 A;  2HDU A;  4HH3 A;  1YLJ A;  3SW1 A;  3JVU A;  3H82 A;  1KVL A;  4NET A;  1STZ A;  1BYW A;  3IQA A;  4Y0O A;  3UE6 A;  1LLB A;  4O7D A;  3L7H A;  3QP8 A;  4KG2 A;  4MCW A;  4S2O A;  1VET A;  4MBF A;  3H82 B;  3RJU A;  4CLC C;  3IF6 A;  4Q0J A;  3G4P A;  2INW A;  2OV5 A;  3UMD A;  3LIE A;  5L10 A;  1VET B;  1GA9 A;  3IX3 A;  3HRE A;  3LFV A;  4R3B A;  1PRQ A;  1P0Z A;  1XFQ A;  3IF6 B;  2G7U A;  1FCO A;  3NDE A;  1CEG A;  1Q2Q A;  3G32 A;  1GSW A;  4OQH A;  3BJN A;  2WAF A;  3V3S A;  5E2H A;  2H28 A;  1RGZ A;  4N9K A;  3IBR A;  3TG9 A;  2VA0 A;  4RX2 A;  2W1R A;  4L0L A;  4IHQ A;  2GDN A;  4E04 A;  4FUW A;  4P6B A;  3KSG A;  2Y2N A;  4ZTK A;  3PR6 A;  5HX9 A;  4EU0 A;  4GOG A;  1MXO A;  4D60 A;  1K55 C;  2HP5 A;  2P74 A;  3K3D A;  1OT9 A;  4NXE A;  4DE1 A;  3DWK A;  1NWZ A;  2JN7 A;  5C5K A;  2V1Z A;  3BFG A;  4H6J A;  2ZM2 A;  1PZO A;  3UDF A;  3IHA A;  4QY5 A;  2PHY A;  2BTF P;  2WKH A;  4X68 A;  2KLI A;  4H6J B;  2JHE A;  3BY8 A;  3F1P A;  2M7U A;  3RFB A;  3WS4 A;  2IWB A;  4JGO A;  1YSQ A;  4DRT A;  3LEZ A;  4QY6 A;  5IHV A;  2M1C A;  1YAX A;  3NY4 A;  1Z6F A;  5U47 A;  4MN6 A;  1IOU A;  2ZQA A;  1T1A A;  3F1P B;  3W4O A;  1T18 A;  5EVI A;  1W5D A;  3PBR A;  2K7S A;  2JBF A;  3EOI A;  3MZE A;  3BFD A;  2VX8 A;  3OBF A;  1S4R A;  1W7F A;  2QZ6 A;  4OOY A;  4MN5 A;  5FAO A;  5EVI B;  3JPU A;  1TDG A;  4PKY G;  1ONG A;  4XXR A;  3EQU A;  4KZ5 A;  1W79 A;  2H0Y A;  4HIA A;  3LIC A;  2O99 A;  2J8Y A;  4EQ1 A;  1MKI A;  2WAD A;  2IWD A;  4MBK A;  2HJ9 C;  2NUP C;  1NJ4 A;  3TW8 A;  4EEU A;  3NBL A;  2M7V A;  3MFD A;  1KE3 A;  2JCH A;  4EBL A;  4WEK A;  4ZJ2 A;  3O88 A;  4ARZ B;  3N8S A;  3OPL A;  1BLC A;  3E98 A;  2VV7 A;  4DE3 A;  4EW7 A;  3SS3 A;  3BW6 A;  5DKK A;  3ZGA B;  2WKQ A;  2ZQ7 A;  4BWI A;  2ZJ9 A;  4ZAM A;  4HJ4 A;  3KX0 X;  1PWD A;  1L3L A;  4OP8 A;  3KSF A;  1XA7 A;  3NEC A;  4WEJ A;  1TS6 A;  4EES A;  3HLG A;  3QP5 A;  3SZT A;  3G35 A;  1YSP A;  1QME A;  2O9A A;  3MQ0 A;  4DF6 A;  3OPH A;  5E2E A;  4BLM A;  2I72 A;  5EOO A;  2AVX A;  5GLC A;  1SKO A;  2L1M A;  1LL5 A;  1ALQ A;  3U4L P;  4KZA A;  4P6Z S;  5CGS A;  3NIA A;  3PBT A;  4BQM A;  2LB9 A;  1LHY A;  4X1L A;  5AVF A;  4IBX A;  4NK3 A;  4GJ4 A;  4MMN A;  4DXC A;  1CEF A;  2B02 A;  3EGX C;  3IXG A;  4E3O A;  2ZBB A;  3MKE A;  2ZQD A;  2HGV A;  3N8L A;  3UPP A;  4ESP A;  4E6W A;  3M2K A;  1BLS A;  1BUE A;  1VB6 A;  5D3O A;  1KGE A;  3FKW A;  1PYY A;  5MC7 A;  3ZFZ A;  2O9B A;  2EFU A;  1LL8 A;  4PM7 A;  1YQS A;  3DTK A;  5E43 A;  3SH7 A;  3ZG0 A;  2GX5 A;  3S22 A;  4WUJ A;  4ZJ1 A;  3PBO A;  4HQA A;  2W3H A;  2RL3 A;  3T1X A;  1EI5 A;  3IHB A;  1K4E A;  2L0W A;  4K08 A;  5CTM A;  3ZG5 A;  1OTD A;  1L0G A;  1JTG A;  5HW3 A;  1XX2 A;  2K2N A;  4WL9 A;  3E2L A;  1NXY A;  1L2S A;  2XF3 A;  4BJP A;  3BWL A;  3MF0 A;  3GEC A;  3CZD A;  3M6H A;  5IT5 A;  3MR0 A;  2V1B A;  3BLM A;  2OAQ 1;  4LPZ A;  3A3D A;  2P04 A;  3S7O A;  4Y13 A;  2EWW A;  2XEP A;  4KQD A;  4N1H A;  5CTN A;  1G5U A;  3GRJ A;  4FTX A;  2LB5 A;  2XD5 A;  3IH8 A;  2P08 A;  1H5X A;  2K31 A;  1JTD A;  4B88 A;  4ZBE A;  5EM0 A;  5FQK A;  1CK3 A;  2QPN A;  1KVM A;  2G2W A;  2V8C A;  5CHJ A;  1K6S A;  4BEN A;  3ZYT A;  3BLS A;  4LGW A;  3PBN A;  3E4P A;  3Q81 A;  3TOI A;  3NC8 A;  2ZMA A;  3UDI A;  2PBD P;  2QHK A;  3OPR A;  4KQO A;  4B4X A;  3NHQ A;  1KDW A;  3IBJ A;  5FQI A;  5JYP A;  1N9B A;  4HP4 A;  3T12 B;  3T4O A;  3IX8 A;  3S7N A;  5F1F A;  1DJB A;  3V39 A;  5M18 A;  1FQG A;  5G18 A;  1X0O A;  2DRW A;  1IFQ A;  3MS6 A;  5CED A;  5FAS A;  3QP4 A;  2VJW A;  2YKH A;  5HL1 A;  1H3Q A;  1G28 A;  3Q07 A;  2FH5 A;  4UEY A;  2PAV P;  5F5Y A;  1VM1 A;  4LV0 A;  5AQA A;  5TR7 A;  2Y2K A;  4P0M A;  1ESI A;  2PR6 A;  3UPO A;  2JE5 A;  3C30 A;  3PHY A;  3CPT A;  1YMS A;  4L9E A;  3PXP A;  1K56 D;  4GKU A;  1U60 A;  3CIT A;  5IU1 A;  3MXR A;  1V9Y A;  5AQB A;  3KYZ A;  2O9C A;  5L2F A;  1K54 A;  1YLW A;  3WS2 A;  3CPT B;  2WK0 A;  1HLU P;  1XGI A;  1S66 L;  2XQZ A;  1E25 A;  2BG1 A;  5EE8 A;  3IXB A;  3KYQ A;  3IH9 A;  3QP6 A;  3SH8 A;  1IKI A;  3PTE A;  3EWK A;  3BFC A;  3DAV A;  3KO6 A;  4M3K A;  4CPK A;  3ULF A;  3HUO A;  3CAX A;  1ZG6 A;  2HZ5 A;  4CLC D;  2Q9M A;  3UB5 P;  4GW9 A;  1SZV A;  3UB6 A;  2X01 A;  4ME4 A;  3VP3 A;  4OQ0 A;  4R23 A;  2GZA A;  3FZC A;  2PDR A;  3VP0 A;  4HJ6 A;  2ZMV A;  2OAP 1;  4HBU A;  1ZG4 A;  2HPB A;  3TRC A;  2G2U A;  4PAU A;  2WAE A;  4Z9Q A;  1GHP A;  1TF1 A;  4RX3 A;  4RQ9 A;  4I3I A;  3FWL A;  2JKR M;  2Z6D A;  1IYO A;  4WMC A;  5HDC A;  1ES3 A;  2ZM8 A;  4DDS A;  1DRM A;  2RCX A;  4HH2 A;  2OSU A;  2XLN A;  4X53 A;  3MBZ A;  1PWC A;  1KE0 A;  1NLY A;  1Y28 A; 
#chains in the Genus database with same CATH homology
 1H8Z A;  2DNS A;  4XUX A;  5KMW A;  2IWC A;  5U47 A;  1LI9 A;  4JF5 A;  4X55 A;  2ZQA A;  3G2Y A;  4K0X A;  3W4O A;  1PI4 A;  3WRT A;  1LL9 A;  5EVI A;  1SCW A;  1W5D A;  1NY0 A;  3PBS A;  3PBR A;  4MBH A;  5F1G A;  1K57 A;  5FA7 A;  4EBN A;  2JBF A;  3MZE A;  2WKE A;  3BFD A;  4X56 A;  4DXB A;  2Y2Q A;  5DTT A;  1W7F A;  2QZ6 A;  1HZO A;  3OPP A;  5F83 A;  3ZDJ A;  1PZP A;  2OLU A;  4OOY A;  3DW0 A;  5AQ9 A;  3ZNT A;  2WGW A;  1O07 A;  1XA1 A;  5CHM A;  1XGJ A;  5FAO A;  5KSC A;  4S2L A;  3WS1 A;  2R9W A;  5EVI B;  4N9L A;  1TDG A;  3VFH A;  5DF8 A;  4UA9 A;  3SS4 A;  1ONG A;  4ID4 A;  3UDX A;  4XXR A;  3EQU A;  4KZ5 A;  1W79 A;  4N1X A;  3A3I A;  4S2M A;  3WS0 A;  2H0Y A;  3TSG A;  4ZDX A;  2VGJ A;  2C5W B;  1YLY A;  2HDR A;  1MWS A;  2J8Y A;  1ERQ A;  4UA6 A;  5DF7 A;  2WGW B;  3VSK A;  3GSG A;  3ZCZ A;  3DWZ A;  4JF4 A;  3M6B A;  1MKI A;  2WAD A;  3HLD A;  4GN2 A;  2IWD A;  2Y2O A;  3MZD A;  4MBK A;  3PAG A;  5DTS A;  2FFY A;  1NJ4 A;  5CRF A;  2Y2P A;  3MXS A;  2EFX A;  1XP4 A;  3NBL A;  3SH9 A;  3UE3 A;  5FI2 A;  2EXB A;  3LO7 A;  4OQI A;  3MFD A;  1MWR A;  5FDH A;  3WRZ A;  1ERO A;  4KZ3 A;  1KE3 A;  2JCH A;  4F94 A;  4EBL A;  4WEK A;  3ZG7 B;  4H8R A;  4WZ4 A;  4RA7 A;  5EUA A;  4ZJ2 A;  3FV7 A;  3O88 A;  1NYY A;  2HP9 A;  5CER A;  3JYI A;  3WWX A;  4BD0 A;  3G31 A;  1YLP A;  3N8S A;  4OPY A;  2PBY A;  3OPL A;  4KG5 A;  1BLC A;  4DE3 A;  3GMW A;  1BLH A;  3SS3 A;  4JXG A;  4OON A;  4XUZ A;  1AXB A;  5FQ9 A;  1IEM A;  1JWP A;  1OME A;  1WE4 A;  2EX6 A;  3B3X A;  3IF5 A;  2ZQ7 A;  4JXW A;  4K0W A;  4WZ5 C;  3V3R A;  3ZGA B;  4E3L A;  2ZJ9 A;  4OOM A;  1WYC A;  4R1G A;  4OPZ A;  4GD6 A;  4ZAM A;  4U0T A;  4IVK A;  3IF6 C;  5A92 A;  4KZ8 A;  4OKP A;  1K54 C;  3UE0 A;  2ZQ8 A;  4PM8 A;  1GHI A;  4JXV A;  3OC2 A;  4PM6 A;  2XDM A;  5A91 A;  2XD1 A;  3OCL A;  1PWD A;  1IKG A;  3QNB A;  1S0W A;  1BZA A;  4OP8 A;  1BLP A;  1XA7 A;  3ZG8 B;  4WEJ A;  3SS5 A;  3DTM A;  3NY4 A;  2H0T A;  3HLG A;  4PMA A;  3VP4 A;  4BL2 A;  1DY6 A;  4A5R A;  3G35 A;  5DF9 A;  1QME A;  4HBT A;  4YFM A;  5E2G A;  1BUL A;  4DF6 A;  3OPH A;  5E2E A;  2OLV A;  1ERM A;  1XKZ A;  4BLM A;  1YM1 A;  2I72 A;  4YIN A;  5EOO A;  2ZC6 B;  4QU3 A;  1MWU A;  5JYO A;  5GLC A;  1K25 A;  2Y2J A;  1JVJ A;  3IXH A;  3SOI A;  1M40 A;  4N92 A;  4E3M A;  3ZG9 B;  1LL5 A;  4R4S A;  1ALQ A;  4HEF A;  2HP6 A;  4GNU A;  3LY4 A;  5M19 A;  4QJG A;  3GR2 A;  5EPH A;  3IWO A;  4S2I A;  1ZKJ A;  1K56 A;  4KZA A;  2FFF B;  5CGS A;  3NIA A;  5HFO A;  1E3U D;  2EX2 A;  2J7V A;  3CJM A;  3PBT A;  4UAA A;  4BQM A;  1TEM A;  2Y2M A;  3IWI A;  1KE4 A;  3HUM A;  3N4I A;  1G68 A;  1LHY A;  3P09 A;  1ES5 A;  3HLE A;  4PM9 A;  4X6T A;  4PPR A;  4IBX A;  1JWZ A;  4NK3 A;  2WGV A;  4R4R A;  2C6W B;  5GLB A;  3VP1 A;  5TGF A;  3G30 A;  4D2O A;  4DE2 A;  4DXC A;  1CEF A;  4Y7P A;  4QB8 A;  3IXD A;  5GL9 A;  3IXG A;  4E3O A;  1ES2 A;  3MKE A;  4KG6 A;  2ZQD A;  3RXW A;  3W8K A;  1FR6 A;  2X71 A;  1JWV A;  2A49 A;  4OP5 A;  3P98 A;  3VSL A;  3CMZ A;  3ZVT A;  1ESU A;  4OLD A;  4KZ9 A;  1I2S A;  2PU4 A;  2Z2M B;  3BEB A;  3QNC A;  4RYE A;  3N8L A;  4MLL A;  4GD8 A;  4E6X A;  2Y59 A;  3OZH A;  3UPP A;  4OVD A;  4E6W A;  3M2K A;  1BLS A;  4GDN A;  1BUE A;  3O87 A;  5D3O A;  1G6A A;  1DJA A;  3A3J A;  1KGE A;  4IBR A;  5GHZ A;  3HL9 A;  3FKW A;  3HLB A;  4FCF A;  3Q82 A;  1GA0 A;  5CEC A;  3Q7Z A;  1PYY A;  3A3E A;  1ES4 A;  1KDS A;  4HES A;  2J9P A;  1HD8 A;  5FI6 A;  3ZFZ A;  1XXM A;  2EFU A;  2WUQ A;  1RGY A;  1PIO A;  1WYB A;  2ZC4 B;  4OQG A;  4UA7 A;  3MZF A;  4PM7 A;  1C3B A;  1PW8 A;  1YQS A;  2PU2 A;  5EVI C;  2P9V A;  2Y4A A;  1YLZ A;  1YLT A;  5E43 A;  5GHY A;  1K57 C;  1EWZ A;  3SH7 A;  3ZG0 A;  2Y2G A;  2X02 A;  3S22 A;  2Y2L A;  4WMC D;  3PBO A;  4ZJ1 A;  1W8Y A;  4WYY A;  3AGF A;  3GQZ A;  1O7E A;  3LCE A;  2RL3 A;  2XFT A;  4PM5 A;  1EI5 A;  4WZ5 A;  3HBR A;  3BM6 A;  1K4E A;  3IHB A;  5GLA A;  3N7W A;  4KQQ A;  2EXA A;  3BRM A;  5HAI A;  2P9V B;  3Q1F A;  5CTM A;  3ZG5 A;  1PI5 A;  1L0G A;  1JTG A;  5HW3 A;  3E2K A;  1VQQ A;  1XX2 A;  3HLW A;  4OPR A;  1SHV A;  3E2L A;  1NXY A;  4BL3 A;  4FD8 A;  2EX8 A;  2EX9 A;  3HUN A;  5A90 A;  5EEC A;  3Q7V A;  1L2S A;  3WS5 A;  2XF3 A;  4U0X A;  4Q8I A;  4BJP A;  5EVI D;  2HDQ A;  3CZD A;  3M6H A;  4C6Y A;  5FQJ A;  4LV2 A;  4JPM A;  4R3J A;  4B4Z A;  3V50 A;  5FAQ A;  1K55 A;  3BLM A;  3BFE A;  1E4D A;  3V5M A;  3VMA A;  1M6K A;  3BEC A;  4DKI A;  3AGE A;  4C75 A;  1MY8 A;  3A3D A;  4LCL A;  4C3Q A;  2ZQ9 A;  2XEP A;  3Q7V B;  5CGX A;  4N1H A;  4EBP A;  1N4O A;  1YMX A;  4GB7 A;  5CTN A;  4EUZ A;  2B5R A;  4S2N A;  5CHU A;  1PWG A;  5DVA A;  3GRJ A;  2Y55 A;  3EQV A;  3LY3 A;  1ZC2 A;  5J8X A;  1QMF A;  2XD5 A;  1BSG A;  3IH8 A;  3S4X A;  1TVF A;  1H5X A;  5EOE A;  1JTD A;  3PBQ A;  4B88 A;  4KEN B;  4MEZ A;  3ITA A;  2XGN A;  1Q2P A;  4ZBE A;  4GDB A;  3W4P A;  5M1A A;  1L0D A;  5GLD A;  3C5A A;  3AGD A;  4FH4 A;  5FQK A;  5KZH A;  1CK3 A;  2QPN A;  1KVM A;  2G2W A;  3NDG A;  3I7J A;  3W4Q A;  4UHU A;  2A3U A;  5CHJ A;  4EQI A;  1K6S A;  4FSF A;  1IYS A;  3MKF A;  1I5Q A;  1SKF A;  4JBF A;  4BEN A;  3VFF A;  4DE0 A;  3BLS A;  3UE1 A;  2Y2H A;  4S2J A;  3D4F A;  4OOL A;  3QHY A;  3ZNY A;  3NCK A;  1KGG A;  3PBN A;  3RXX A;  3Q81 A;  3ISG A;  3TOI A;  3NC8 A;  2ZMA A;  3FKV A;  3ZHH A;  1FSW A;  5EVL A;  3UDI A;  2E8I A;  1IYQ A;  3BFF A;  1FOF A;  1K6R A;  1GCE A;  3OPR A;  4FH2 A;  2BLS A;  4KQO A;  4BD1 A;  1L0F A;  4WM9 A;  1PW1 A;  5DTK A;  2V20 A;  4B4X A;  4EV4 A;  4DRT A;  5HAR A;  3C7U A;  5HAQ A;  1KDW A;  5FQI A;  4KZ4 A;  5JYP A;  2UWX A;  2ZC5 B;  1BTL A;  3BYD A;  3C4P A;  3N6I A;  1N9B A;  2XFS A;  4E3I A;  5FQQ A;  3O86 A;  5F1F A;  2WKI A;  4JXS A;  1DJB A;  3V39 A;  5AQ7 A;  5M18 A;  1FQG A;  1GHM A;  1NRF A;  2DRW A;  4OH0 A;  3OCN A;  4WBG A;  4IVI A;  5G18 A;  1HVB A;  1IEL A;  2WZX A;  5CED A;  5FAP A;  5FI7 A;  2Q9N A;  5FAS A;  2V2F F;  3UPN A;  3N8R A;  5FQM A;  4P85 A;  4X69 A;  4MNR A;  2H5S A;  4RVA A;  3VOZ A;  4KQR A;  1Y54 A;  1DJC A;  4KZB A;  5HL1 A;  3CG5 A;  2Y2I A;  4WEL A;  1FCN A;  1NZO A;  3Q07 A;  3IWQ A;  3NI9 A;  1SDE A;  1IYP A;  1H8Y A;  2ZQC A;  4CJN A;  4E3N A;  3GV9 A;  2Y91 A;  2HDU A;  2XR0 A;  1YLJ A;  1CI8 A;  5A93 A;  4S2P A;  1KVL A;  4E3K A;  1BT5 A;  4NET A;  4E3J A;  1VM1 A;  4U3T A;  3ZVW A;  4LV0 A;  5AQA A;  5TR7 A;  3IQA A;  2Y2K A;  4Y0O A;  3UY6 A;  1LLB A;  1ESI A;  4P0M A;  5HAP A;  1TDL A;  1S6R A;  1FCM A;  3UPO A;  4O7D A;  2JE5 A;  2H10 A;  4R0Q A;  1FR1 A;  3GVB A;  4KG2 A;  2XH9 A;  3UNW A;  5CEB A;  4Y0U A;  4S2O A;  1MBL A;  1YMS A;  5FAT A;  4MBF A;  5FSR A;  1K56 D;  4GKU A;  1ONH A;  4Y0T A;  1U60 A;  2WGI A;  3G34 A;  3RJU A;  1RCJ A;  3MXR A;  2ZM0 A;  5AQB A;  2XK1 A;  5GHX A;  1KGF A;  3IF6 A;  4KZ7 A;  2ZLY A;  3G4P A;  5E2F A;  5L2F A;  1K54 A;  1YLW A;  2OV5 A;  5F82 A;  3WS2 A;  1SDN A;  2WK0 A;  1LI0 A;  1XGI A;  1GA9 A;  2XQZ A;  1E25 A;  2BG1 A;  4ZJ3 A;  5EE8 A;  3HRE A;  3IXB A;  4R3B A;  4QHC A;  1RP5 A;  1FSY A;  3IF6 B;  3S1Y A;  3IH9 A;  5BOH A;  3SH8 A;  3UN7 A;  1IKI A;  1E3U A;  3PTE A;  3BFC A;  4M3K A;  1FCO A;  3M2J A;  5KSH A;  3NDE A;  2JC7 A;  1I2W A;  4OPQ A;  4CPK A;  4EWF A;  2J9O A;  1CEG A;  1Q2Q A;  3G32 A;  3HUO A;  4OQH A;  1ZG6 A;  4LV1 A;  2ZC7 A;  5TFQ A;  3V3S A;  2WAF A;  4LEN A;  4P87 A;  4OLG A;  5E2H A;  3A3F A;  3PAE A;  3FYZ A;  1RGZ A;  2Q9M A;  1HTZ A;  4N9K A;  3TG9 A;  1CI9 A;  4RX2 A;  2ZD8 A;  2VGK A;  4GZB A;  4S2K A;  2X01 A;  3C7V A;  4L0L A;  3VP3 A;  4OQ0 A;  1K4F A;  2GDN A;  4KZ6 A;  3G2Z A;  4P6B A;  4QD4 A;  4R23 A;  1MPL A;  1YT4 A;  2Y2N A;  3FZC A;  3IT9 A;  4ZTK A;  5HX9 A;  3VP0 A;  5I94 A;  4GOG A;  1MXO A;  1K38 A;  2HDS A;  3HLF A;  3UO9 A;  1K55 C;  2HP5 A;  2P74 A;  4JLF A;  4LCM A;  4K91 A;  3C4O A;  4DE1 A;  3DWK A;  4HBU A;  3VP2 A;  1ZG4 A;  2HPB A;  4JF6 A;  5CGW A;  1W8Q A;  2G2U A;  2V1Z A;  3BFG A;  3HLC A;  2ZM2 A;  4DDY A;  4S2N C;  2WAE A;  1PZO A;  4Z9Q A;  3UDF A;  3IHA A;  2R9X A;  1GHP A;  1L0E A;  4RX3 A;  4IED A;  2DCF A;  4QY5 A;  3FWL A;  1NZU A;  1NYM A;  1MWT A;  4JKT A;  1IYO A;  2WKH A;  4WMC A;  5CXW A;  4X68 A;  3GTC A;  1ES3 A;  2ZC3 B;  3VOY A;  2ZM8 A;  4DDS A;  2WZZ A;  2RCX A;  1XPB A;  3WS4 A;  2CC1 A;  2IWB A;  1J9M A;  2OSU A;  2WYX A;  2XLN A;  2Z2L B;  3ITB A;  3LEZ A;  3MBZ A;  4LV3 A;  1PWC A;  4QY6 A;  4X53 A;  3O3V A;  1KE0 A;  2QMI A;  5IHV A;  3HVF A;  1Z6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...