5A91A

15k x-ray ligand free: exploring the mechanism of beta-lactam ring protonation in the class a beta-lactamase acylation mechanism using neutron and x-ray crystallography
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
260
structure length
260
Chain Sequence
SVQQQLEALEKSSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAAAAVLKQSESDKHLLNQRVEIKKSDLVNYNPIAEKHVNGTMTLAELGAAALQYSDNTAMNKLIAHLGGPDKVTAFARSLGDETFRLDRTAPTLNTAIPGDPRDTTTPLAMAQTLKNLTLGKALAETQRAQLVTWLKGNTTGSASIRAGLPKSWVVGDKTGSGDYGTTNDIAVIWPENHAPLVLVTYFTQPEQKAENRNDILAAAAKIVTHGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFATE ION
publication title Exploring the Mechanism of Beta-Lactam Ring Protonation in the Class a Beta-Lactamase Acylation Mechanism Using Neutron and X-Ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 260
sequence length 260
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 5a91A00
4UAAA 5EVIB 1XGIA 3HREA 4B4ZA 4R4SA 4S2PA 5HAQA 3ZGAB 3M2KA 1ONHA 4C6YA 4HBUA 3WS0A 5FQJA 4X53A 1ESIA 1H5XA 5IHVA 4KZBA 4MBHA 3IT9A 2EX9A 3PBOA 4RVAA 3Q1FA 5DF7A 2FFFB 3OPLA 5E2EA 3UPNA 3NIAA 4CJNA 2VGKA 5FASA 2ZM2A 5EUAA 3WRTA 4EWFA 2Q9NA 1WE4A 1GHPA 3O87A 3V50A 1K56A 4IBRA 5FDHA 4MBKA 1LI9A 4XXRA 3GRJA 4RYEA 3UDIA 3LY3A 3Q7ZA 4D2OA 4Y0TA 3IWQA 4HEFA 1LL5A 4KZ5A 4HESA 5HFOA 3PTEA 3DW0A 1CEFA 3TSGA 4OOYA 1HVBA 1NJ4A 4OP5A 3FZCA 5DTTA 4F94A 2WAFA 2XEPA 1ERQA 2Y2JA 4OP8A 1YMXA 3A3IA 4C75A 1K38A 1SDNA 5DF9A 1BTLA 3BFGA 3DWZA 5D3OA 1NY0A 3G30A 2WADA 4RA7A 1AXBA 3CMZA 5DTKA 5EVID 3ZNTA 3MBZA 5CXWA 4N9KA 2UWXA 4K0WA 4E3OA 2JCHA 3RJUA 2Y2GA 1RP5A 1KGGA 4EV4A 1E3UA 3FV7A 1K57C 4BENA 1K6SA 3G35A 5DF8A 4WBGA 1E25A 1M40A 5BOHA 1FQGA 1MWUA 2Y2IA 2Y59A 5TR7A 1ES4A 4S2MA 1PZOA 4KQRA 4E3IA 4YINA 3HLFA 2H10A 4N1XA 4JXWA 4R0QA 5EECA 1YLYA 1PIOA 2IWCA 4R23A 1K57A 1Y54A 3PBRA 5E2HA 3PBTA 3BFFA 4FCFA 2XDMA 3BFEA 4LV1A 4MEZA 5FAOA 3ZG8B 3AGFA 5CTMA 1I5QA 1PI4A 4OQ0A 5AQBA 3UPOA 4FH4A 3ZHHA 3ISGA 2H5SA 3MZFA 3VP2A 3ZG0A 3HUOA 3V3RA 3UY6A 4GNUA 1FSWA 4WZ5C 5L2FA 3IHAA 3BFCA 4E3JA 5GLDA 1ZG4A 4X6TA 5CTNA 1CI9A 2Y2PA 2J9PA 3C7UA 4NK3A 5FA7A 2PU4A 4EQIA 1ZG6A 1MPLA 2XD5A 3BEBA 1BLCA 3NI9A 3N8LA 3WS2A 3HL9A 4KG6A 4PPRA 4GD6A 3M2JA 4U0TA 2J8YA 4WZ5A 1ES3A 5EVIC 1KVMA 4DE0A 2Y2HA 3DWKA 3WS5A 4PM8A 3E2LA 4FD8A 1KVLA 1KGEA 4ZJ1A 4DE1A 1BULA 1KE3A 3IXHA 2DRWA 1GA9A 1O7EA 1W5DA 4DDSA 3BLMA 3HLCA 4E6XA 3ZG7B 5A93A 5FSRA 1DY6A 4OPQA 2DNSA 4M3KA 4ZJ2A 1E3UD 3M6HA 4C3QA 1NYYA 2ZLYA 3GTCA 5EVIA 5F1FA 3ZG9B 3HLDA 2IWBA 4N1HA 4E3MA 1YLPA 3UNWA 1W79A 5FQIA 1I2WA 2V2FF 4OH0A 4DXCA 2XK1A 4XUZA 5JYOA 5CEBA 3GR2A 2G2UA 3OPPA 3BM6A 1ONGA 4XUXA 1ERMA 3BECA 5CGXA 1GCEA 4Y0OA 4JXSA 4DE3A 3V5MA 4EUZA 2RL3A 3V3SA 4IVIA 4OPYA 4QJGA 1YLTA 4UA7A 4BL3A 2EXAA 1JTGA 1DJAA 3SS4A 3UN7A 5CHJA 4JF6A 1SCWA 2ZQ7A 3V39A 4N9LA 4ZBEA 3IXBA 4DDYA 1U60A 4DF6A 5HAIA 5KMWA 3GV9A 4MLLA 3ZVWA 2ZC6B 5FQMA 4P0MA 3NY4A 2C5WB 3ZFZA 2XFTA 3CZDA 3N8RA 4WZ4A 3Q7VB 2WKIA 3W8KA 3FYZA 3G31A 2PBYA 3IXGA 4BD0A 1YM1A 5M18A 3A3JA 2Y91A 1IELA 4GN2A 2ZQAA 5CEDA 4OONA 1FR6A 3A3EA 5AQAA 3C4OA 3SH9A 3C7VA 1K55C 1L2SA 3IH8A 4FSFA 5FQKA 3HLWA 5CERA 4R1GA 3G34A 4WMCA 3UDFA 5HAPA 3HLBA 3M6BA 4JLFA 1XPBA 4PMAA 2EXBA 5HW3A 4ZJ3A 4E3NA 1ZKJA 4GKUA 1LLBA 3SH7A 5M19A 4QHCA 4HBTA 4JF5A 2E8IA 4LENA 1NYMA 2Q9MA 4S2LA 3O88A 2A49A 2IWDA 4FH2A 1K55A 1PI5A 2WYXA 3E2KA 2WKEA 4MBFA 4OOMA 1KE4A 2J9OA 4WELA 5GLAA 3UE3A 4E3LA 5G18A 2OSUA 3IH9A 5E2GA 4LV3A 3UE1A 4E3KA 3ZG5A 1J9MA 3A3DA 5FI6A 2WZZA 3ZNYA 1KDWA 3G2ZA 2ZC7A 1SKFA 3VSLA 1W7FA 2R9XA 4GOGA 4QY6A 4JXVA 4KG2A 2WZXA 1TVFA 5AQ7A 1NRFA 2EX8A 3C4PA 5GL9A 1MWRA 2WAEA 2WK0A 3IHBA 3I7JA 2ZQCA 1JTDA 2XGNA 1DJCA 1E4DA 4S2IA 4UA6A 4GDBA 4YFMA 1HZOA 3DTMA 2V1ZA 2ZC5B 4JF4A 1BUEA 2ZM0A 4X69A 3S1YA 5FI7A 1NXYA 5FQQA 2HDQA 1MBLA 3VP3A 4E6WA 1DJBA 1G68A 3PAGA 3HLGA 4JBFA 2H0TA 5TFQA 3P98A 2Z2MB 1KGFA 2WGIA 1XP4A 4EBPA 1O07A 2JBFA 5CHMA 4BJPA 3N4IA 3SS5A 4LCMA 4O7DA 3Q07A 2X01A 4WMCD 1OMEA 5E43A 5FATA 1C3BA 5EPHA 1TDLA 3MZEA 5FQ9A 3IWIA 5DTSA 3G4PA 4PM6A 3BLSA 3D4FA 4KZ9A 3TG9A 1K54C 3IXDA 2J7VA 2PU2A 3FKVA 5FAPA 2ZM8A 1MY8A 1EROA 3W4QA 3MXRA 2Y2OA 1QMFA 4Y0UA 4RX2A 1PW1A 3WS1A 3VP0A 1IYPA 4CPKA 1L0GA 2OLVA 3IF6C 3LEZA 1H8YA 1VM1A 2B5RA 2Z2LB 1ZC2A 4OPZA 3MKEA 3RXXA 4EBNA 1K25A 2ZQ9A 1ALQA 4LV2A 2GDNA 3G2YA 3LO7A 4GDNA 4R4RA 3SH8A 3QNBA 4JKTA 2ZC3B 3NDGA 2WGVA 4X68A 3IF6A 3Q7VA 3B3XA 3VOZA 2EFUA 5DVAA 1W8QA 3ZCZA 1ES5A 4P85A 4QB8A 3WS4A 1BT5A 1PYYA 1TDGA 4Q8IA 2ZJ9A 2XH9A 2C6WB 5F83A 3LY4A 5TGFA 2ZQ8A 1XKZA 3Q81A 1XGJA 4OVDA 3C5AA 1MKIA 4K0XA 1PWGA 1PWCA 1SDEA 1XA7A 4KQQA 2P9VA 4S2NC 1YQSA 4BL2A 3NDEA 3UPPA 1BLSA 2X02A 1YMSA 2JC7A 1CI8A 3VFHA 1XA1A 5CRFA 1GHIA 4Z9QA 3W4OA 1K4FA 1IYSA 3QHYA 3GSGA 4QD4A 2A3UA 2QPNA 4Y7PA 3IF6B 4KENB 4IBXA 4KZ6A 4UHUA 4S2NA 5M1AA 4OLGA 4WM9A 4GD8A 1EWZA 3OCLA 3BFDA 1S0WA 4PM9A 5GHZA 3PBSA 5A91A 3UO9A 2XD1A 3N7WA 3QNCA 2RCXA 1H8ZA 3FKWA 4B4XA 1N9BA 1GHMA 5GLBA 2P9VB 4S2JA 2G2WA 3N6IA 1PZPA 3Q82A 1L0EA 1W8YA 3ITBA 1GA0A 3O86A 4ID4A 2HDUA 2VGJA 2ZMAA 4IVKA 4WEKA 5GHYA 2WUQA 4EBLA 3UDXA 1MWSA 4S2KA 3IQAA 4X56A 3PBQA 1XX2A 3MKFA 2V20A 3OPHA 4L0LA 4QY5A 3FWLA 3G32A 4DKIA 3HLEA 1BLPA 5I94A 1JVJA 5KZHA 2CC1A 1QMEA 2Y4AA 3CJMA 4S2OA 4RX3A 5HARA 4B88A 3HUMA 4X55A 5GLCA 3OC2A 1LHYA 1M6KA 3MFDA 1L0DA 4GZBA 1RGZA 1NZUA 1VQQA 2R9WA 4OOLA 5A90A 1ES2A 4KZ4A 4IEDA 4ZTKA 3EQVA 3HVFA 2OLUA 3SOIA 2BG1A 4GB7A 2XFSA 4OQHA 4U0XA 5F1GA 1CEGA 1FCNA 1KDSA 2Y2LA 4NETA 5HX9A 1YLZA 1MWTA 5E2FA 3TOIA 1PW8A 1EI5A 1WYBA 1HD8A 2WKHA 4R3BA 3VSKA 1YT4A 2DCFA 2Y2MA 3BRMA 3MXSA 2ZQDA 1WYCA 5KSCA 1RGYA 3BYDA 3S4XA 1Q2QA 4KZ8A 5A92A 5CECA 2EX6A 4R3JA 2X71A 3HUNA 1FOFA 4N92A 1I2SA 1YLWA 1K4EA 4OKPA 4JPMA 1FCOA 4PM5A 3PAEA 4DXBA 4BQMA 3EQUA 4LCLA 4KG5A 4DRTA 2HP5A 4DE2A 2OV5A 5CGWA 4P87A 3IWOA 1BZAA 1IEMA 4KZ3A 5F82A 5EVLA 2WGWA 3OZHA 2EX2A 3P09A 3RXWA 3ITAA 5GHXA 2XQZA 4WEJA 1L0FA 2HDSA 2HPBA 4H8RA 3VP1A 2HDRA 3OCNA 2Y55A 1K54A 3HBRA 3MZDA 5FAQA 2QMIA 1S6RA 5J8XA 1JWPA 3GVBA 1K6RA 1Z6FA 4K91A 1K56D 1G6AA 1NZOA 2ZC4B 3VP4A 2Y2NA 5JYPA 1LI0A 2Y2KA 4KZ7A 1TEMA 3LCEA 4LV0A 3AGDA 3VFFA 4BD1A 5HL1A 1JWVA 1IYOA 5EE8A 4OPRA 1FCMA 5EOOA 1SHVA 3GMWA 2FFYA 1BSGA 5FI2A 1FSYA 2WGWB 1YLJA 3VMAA 2XLNA 1LL9A 4ZDXA 1PWDA 2HP9A 2Y2QA 2EFXA 2P74A 4BLMA 4WYYA 4OQIA 2HP6A 3W4PA 5U47A 1HTZA 1IYQA 4OLDA 3UE0A 4OQGA 1N4OA 1JWZA 4MNRA 1IKIA 4P6BA 5CGSA 4U3TA 3S22A 2ZD8A 3ZVTA 2H0YA 4UA9A 4A5RA 1XXMA 1FR1A 2XR0A 4PM7A 1Q2PA 1BLHA 1KE0A 1RCJA 5CHUA 1ESUA 3NC8A 3WWXA 3ZDJA 4KZAA 3GQZA 3N8SA 2XF3A 4KQOA 4ZAMA 3AGEA 3JYIA 3SS3A 1MXOA 3A3FA 2QZ6A 3CG5A 2BLSA 3OPRA 2I72A 3O3VA 3NCKA 5EOEA 3VOYA 3IF5A 3PBNA 3NBLA 1IKGA 1CK3A 4QU3A 2JE5A 5AQ9A 4JXGA 5KSHA 3WRZA
chains in the Genus database with same CATH superfamily
1OTEA 4BBUA 4CLCC 3T4TA 4B4ZA 4S2PA 3M2KA 4C6YA 4HBUA 3MQQA 4HIAA 3Q1FA 2O9BA 2ZM2A 1WE4A 3O87A 1K56A 3LEQA 3GRJA 4M4XA 1OJ5A 3Q7ZA 3IWQA 4HEFA 3H7WB 4KZ5A 3DW0A 4X25A 3TSGA 1NJ4A 3FZCA 1ERQA 3A3IA 4ARZB 1K38A 3E98A 4RA7A 1AXBA 3CMZA 5DTKA 4KQDA 3HCYA 1OT6A 1E3UA 2JKFA 3T1QB 4HH2A 2DMWA 3MS6A 5HD3A 1H8MA 2Z6DA 2OWJA 4NXEA 4E3IA 3HLFA 2H10A 3JPUA 5EECA 4R0QA 1K57A 3MMHA 1Y54A 3PBRA 3ULFA 1I5QA 1PI4A 1CQAA 5L2FA 3T50A 5GLDA 1ZG4A 1CI9A 1OTIA 3C7UA 4R38A 5KIZA 4MCWA 4RQ9A 1MPLA 2XD5A 3NI9A 3N8LA 5F68A 4PPRA 4I38A 1KVMA 3LYXA 3CPTA 4PKYG 2DRWA 3HLCA 5HPIA 1DY6A 4OPQA 4M3KA 5CX7A 3MFXA 5MC7A 3ZG9B 3HLDA 4N1HA 1YLPA 3UNWA 5FQIA 1Y4OA 2EWWA 2GNXA 3GR2A 4XUXA 5CGXA 1ONGA 1GCEA 1P9WA 3V3SA 1YKDA 4QJGA 4BL3A 1DJAA 4D60A 1GSXA 5F6AA 3IXBA 5HAIA 4P0MA 3KSIA 2XFTA 3CZDA 3FYZA 5I5LA 5J7EA 2PBYA 3EGXC 4BD0A 3A3EA 3C4OA 1KOUA 3C7VA 1K55C 2I9VA 4EUVA 3HLBA 5HW3A 4ZJ3A 4E3NA 3F1NA 5M19A 2Q0OA 4QHCA 4BWIA 3NJAA 1K0KA 4JF5A 4LENA 1NYMA 3F1OA 3O88A 4LFUA 2VGLS 1NWZA 4FH2A 1PI5A 2WKEA 4NXBA 4MBFA 4LV3A 3ZG5A 3ZNYA 2EA9A 4HQAA 4E04A 4JXVA 2WZXA 2INWA 2PBDP 1TVFA 3U4LP 1HLUP 1MWRA 2WAEA 3IHBA 3I7JA 4S2IA 2PDRA 3PR6A 1XFQA 2V1ZA 3DTMA 5DKLA 4IJGA 4LLOB 4KUKA 1V9YA 3MQOA 1SKOA 1G68A 4ME4A 3HLGA 2H0TA 2MJ6A 3BQAA 4EBPA 4XT2A 5E43A 5EPHA 3MZEA 4HJ4A 4PM6A 4KZ9A 3MQ0A 4IUKA 3EEHA 3MXRA 2W1TA 2Y2OA 3LICA 5EVEA 4RX2A 1PW1A 2OLVA 1H8YA 2KX6A 1ZC2A 4NXFA 3RXXA 3W2ZA 3LIBA 4NEED 2GDNA 2JHEA 4R4RA 4MDZA 3QNBA 2ZC3B 3NDGA 1F2KA 4EEPA 1ES5A 1BT5A 2ZJ9A 3PXPA 5F83A 2ZQ8A 1XKZA 4OVDA 1XGJA 1MKIA 3LIFA 1PWCA 5A8BA 3UPPA 2X02A 4HOIA 2JC7A 3IS2A 3D72A 4Z9QA 3QHYA 4BMWA 2A3UA 3IF6B 4JGRA 4IBXA 4UHUA 1LSVA 4WM9A 1EWZA 1PNEA 1S0WA 3PBSA 5TJJA 3N7WA 1N9BA 3V67A 3N6IA 2XROA 3ITBA 3P7NA 4I3AA 2VV8A 2WUQA 3UDXA 1XJ6A 1XX2A 4L0LA 1OTBA 3B33A 3T1XA 3MFDA 4GZBA 1RGZA 1NZUA 1VQQA 2R9WA 4G3VA 4KZ4A 4WLAA 2VA0A 3SOIA 1CEGA 1NLZA 4CQHA 1FCNA 1OTAA 1KDSA 1V9ZA 1MWTA 3QP2A 2QYBA 3F1PA 4LPZA 1EI5A 1WYBA 5AVEA 2PD7A 2Y2MA 3BRMA 4B93A 3S4XA 5CECA 4KZ8A 3LGOA 2EX6A 4R3JA 2V0WA 1FOFA 3T1SA 4N92A 2M7VA 1TD5A 3EQUA 1YSQA 3P01A 5EVLA 1IOUA 3FPWA 2V0UA 3P09A 3ITAA 3D9YA 2XQZA 4WEJA 3VP1A 2HDRA 2ZL1A 3UB5P 3MZDA 5J8XA 3O5YA 1JWPA 3GVBA 3HJKA 1K56D 2ZC4B 1N9OA 3VE4A 1TEMA 1JWVA 5EE8A 2OOLA 5EOOA 5FI2A 2WGWB 3VMAA 1PWDA 2EFXA 4L9GA 4OQIA 2ZMVA 4OQGA 4U3TA 3S22A 2VV6A 4UA9A 3TE8A 2EWVA 2P04A 4FTXA 4PM7A 3MR0A 4G3WA 5HZHA 1T1AA 2R78A 4KZAA 3N8SA 4GS9A 1VEUA 2D02A 1MXOA 3OPRA 3O3VA 3IF5A 1TS6A 4QU3A 3ZYTA 5AQ9A 4LV0A 2V1BA 4UAAA 1XGIA 3HREA 3NECA 1ONHA 3WS0A 4X53A 4WL9A 2KLIA 3PBOA 2EX9A 5DF7A 4AFIA 1P9RA 2FFFB 4CJNA 2QKPA 2OAQ1 5EUAA 5EFWA 2Q9NA 1STZA 1LI9A 1BYWA 4MBKA 4RYEA 3HJIA 3S7OA 1LL5A 3JVVA 3QP6A 4OOYA 4OP5A 1BTLA 5AVFA 3G30A 2WADA 3MBZA 5CXWA 4N9KA 4CLCE 2JCHA 4CLCB 2Y2GA 1KGGA 5HWWA 1K57C 3G35A 5DF8A 3T4OA 3F1NB 1M40A 3NOUC 1FQGA 2Y2IA 5TR7A 1MZUA 4KQRA 4YINA 5J3WA 3EEAA 1F9IA 3TRCA 4JXWA 3ZQ5A 1LSWA 2IWCA 3QP8A 3CUEC 3BFEA 4MEZA 2QHKA 5CTMA 4I3IA 3UPOA 1XJ3A 3ZHHA 1NLYA 5HWVA 3VP2A 3ZG0A 3HUOA 3UY6A 4PAUA 3LI8A 3KYEA 2ZBBA 4CLCD 2YKFA 4X6TA 5CTNA 2Y2PA 2J9PA 1XJ2A 1X0OA 2A24A 3WS2A 4EEUA 3KSFA 1TS0A 4WZ5A 3M2JA 2J8YA 2Y2HA 4FD8A 3RTYA 1BULA 4P6ZM 2D01A 2OAP1 1GA9A 1AWIA 1T1CA 4E6XA 4XT2B 1MKMA 1CF0A 2DNSA 1D06A 3K2NA 4C3QA 5F1FA 2W1RA 4E3MA 1W79A 4DXCA 4OH0A 2XK1A 1YSPA 3OPPA 4Y0OA 4DE3A 2RL3A 4IVIA 2EXAA 3GDIA 3SS4A 4JGQA 5CHJA 4JF6A 4DF6A 4UQIM 3TW8A 3ZVWA 5FQMA 2C5WB 3ZFZA 4L9EA 5EM0A 3N8RA 4R6LA 3G31A 1XJ4A 3A3JA 2ZQAA 4OONA 5AQAA 4HY8A 4FUWA 1L2SA 1LT0A 4FSFA 5CERA 4R1GA 4WMCA 5HAPA 3T4KA 4PMAA 2EXBA 1ZKJA 3SH7A 1LLBA 4F3LA 3MF0A 2Q9MA 4S2LA 3E0YA 3BWLA 2WYXA 4BBVA 5E2GA 3IH9A 5IU1A 4GW9A 1OTDA 2ZC7A 1VETB 1SKFA 3EOIA 2R9XA 4GOGA 4HNBA 5AQ7A 1NRFA 5F5YA 2Y79A 5GL9A 1DJCA 3T4QA 2L1MA 4X69A 1NXYA 2P7JA 1DJBA 2W3HA 3H82A 1KGFA 2PR6A 2JBFA 4LCMA 4O7DA 3Q07A 3CUEA 2X01A 1OMEA 1TDLA 2A2LA 3IWIA 1PRQA 3G4PA 5FAPA 5HL6A 2ZM8A 1MY8A 3W4QA 4Y0UA 3H9WA 4QPRA 3LEZA 1VM1A 3KX0X 2B5RA 2Z2LB 4OPZA 1NRJA 4EBNA 2ZQ9A 1ALQA 4HP4A 2VK3A 3LO7A 4JKTA 3K3DA 2QJ5A 3VOZA 4P85A 4QB8A 1S1ZA 4Q8IA 4IHQA 2C6WB 4WUJA 1PWGA 1SDEA 1XA7A 2ZL1B 2P9VA 1YQSA 4BL2A 3NDEA 3VFHA 5CRFA 1GHIA 3QP5A 3W4OA 3GSGA 2QPNA 3S7PA 4Y7PA 5M1AA 3L7HA 4OLGA 1WA9A 3OCLA 4PM9A 5A91A 4B4XA 2XD1A 2RCXA 1GHMA 2VEAA 4O0PA 4S2JA 2G2WA 5FEGA 4DJ2A 1GSWA 2QJ7A 2V8CA 2PRFA 3R4KA 3O86A 2HDUA 1UWPX 3R7WA 1L3LA 5DKKA 4IVKA 2V8FA 5DJTA 1MWSA 3MKFA 3OPHA 4O8GA 4GS9B 5I94A 4DKIA 2CC1A 2O99A 5F69A 3OC2A 1LHYA 4EETB 4OOLA 1ES2A 4IEDA 4II7A 2XFSA 4OQHA 1SZVA 2Y2LA 5AJGA 4NETA 5E2FA 3TOIA 3JVUA 2WKHA 1YT4A 1J3WA 2ZQDA 1Q2QA 1UWNX 4HJ3A 4I3JA 3CWFA 5G4ZA 1I2SA 1YLWA 1G6OA 4DXBA 2CMNA 4KG5A 4DRTA 3CLOA 4P87A 3IWOA 3OZHA 2EX2A 3E4OA 4MN5A 2JKTI 4B9OA 2W0NA 2HDSA 2HPBA 3OCNA 2Y55A 2QMIA 1K6RA 1S4RA 4K91A 3VP4A 5HPFA 5JYPA 4BD1A 3VFFA 4HHDA 3LR5A 2FFYA 1FSYA 2Y2QA 4WYYA 3C8CA 3W4PA 1HTZA 2J3TD 4OLDA 4EXOA 1VHMA 4HI4A 5FEFA 1XXMA 2XR0A 1Q2PA 1ESUA 3WWXA 4FOFA 3ZDJA 4KQOA 4ZAMA 3AGEA 3BJNA 4R70A 2PR5A 5HDDA 3A3FA 2QZ6A 2BLSA 3T12B 3NBLA 2JE5A 5FL3A 1OT9A 3H7WA 5HAQA 3ZGAB 3LI9A 4ARZA 5FQJA 1ESIA 4MN6A 3IT9A 5E2EA 4H6JA 3D3OA 1S1YA 2VGKA 5FASA 3V50A 5FDHA 3UDIA 4D2OA 2J3TC 1YPRA 4HESA 3BW6A 3PTEA 1CEFA 1HVBA 1W63Q 2PAVP 2WAFA 2Y2JA 4OP8A 2K7SA 4F94A 4C75A 1SDNA 2KOIA 5DF9A 1NY0A 3ZNTA 4L9FA 2UWXA 3RJUA 2M1CA 5L10A 4EV4A 3FV7A 1K6SA 1OPXA 4WBGA 3VV4A 1MWUA 2W3DA 4S2MA 1PZOA 4N1XA 1ACFA 2B95A 3CAXA 2HF6A 1YLYA 1PIOA 3BFFA 5FAOA 2XDMA 1S4SA 3ISGA 1VB6A 4WZ5C 3IHAA 4E3JA 5FA7A 2PU4A 3BEBA 1BLCA 3U2AA 3HL9A 4KG6A 4GD6A 4DE0A 3WS5A 4PM8A 3H82B 4ZJ1A 2LB5A 1KE3A 3IXHA 2VJWA 1W5DA 2XA7M 3BLMA 3FPVA 3UMDA 2GX5A 4WF0A 5FSRA 1DRMA 1E3UD 1NYYA 5EVIA 3MXQA 4QWOA 2IWBA 3FC7A 1I2WA 2V2FF 3TJZC 4XUZA 3VE3A 2WKQA 3LIEA 3BM6A 3BECA 4JXSA 3V5MA 4EUZA 5HDCA 1H3QA 3CPTB 1YLTA 4UA7A 1TS7A 4YNRA 3UN7A 1SCWA 4N9LA 4NKPA 5KMWA 4MLLA 4WZ4A 3W8KA 2WKIA 1YM1A 2Y91A 1IELA 4GN2A 5CEDA 4Y17A 3G6OA 3IH8A 5FQKA 3HLWA 2PYPA 5IS1A 4GKUA 1F98A 2ZOHA 4Y2FA 4O01A 3UE3A 4EWFA 5G18A 2OSUA 1G5UA 2VLGA 3A3DA 1UGUA 2G7UA 1W63M 3VSLA 3RH8B 4KG2A 2L4RA 3E4QA 2EX8A 3F1OB 3R7WB 2WK0A 1T1BA 5DJUA 1N9NA 2XGNA 4YFMA 3T1RA 4JF4A 1BUEA 2KDKA 3S1YA 3LR4A 5FQQA 2HDQA 3VP3A 1Z09A 3MJQA 5L09A 4JBFA 3P98A 2Z2MB 4PHTA 1XP4A 1O07A 2NUTC 5CHMA 4ETXA 3SS5A 3B42A 4Y3IA 5FATA 1C3BA 5DTSA 3TG9A 3BLSA 3UB9A 1K54C 3FKVA 2NUPC 1QMFA 1F5MA 1ODVA 5DFXA 3VP0A 1SKOB 1L0GA 1OJGA 3MKEA 3LIAA 4I5SA 3T4SA 4LV2A 4GDNA 2W27A 3SH8A 2ZOIA 2WGVA 4JGOA 3IF6A 2K2NA 3Q7VA 2W1TB 3B3XA 5DVAA 3WS4A 1PYYA 2XH9A 2PHYA 3LY4A 5TGFA 3Q81A 5LBRA 3C5AA 4KQQA 3RFBA 4LRXC 1YMSA 3CITA 3UB6A 1CI8A 4MMNA 2ZMFA 1K4FA 2AVXA 2W3EA 4QD4A 4KENB 4S2NA 3QNCA 1H8ZA 3FKWA 2B18A 4GHIA 3UE6A 2IA2A 3EWKA 3Q82A 1JNUA 1L0EA 1W8YA 3IS2B 1GA0A 3ICYA 4ID4A 4WEKA 1PFLA 5GHYA 4EBLA 3IQAA 2P08A 3UMEA 3FWLA 3G32A 1BLPA 1MC0A 4P6ZS 1JVJA 3GECA 1QMEA 4S2OA 4RX3A 5HARA 2PT7A 3HUMA 2ACGA 4GJ4A 1DP8A 2HGVA 1L0DA 5A90A 1T18A 3T4LA 4DJ3A 4ZTKA 3HVFA 2OLUA 2BG1A 4G3KA 5F1GA 5HX9A 4H6JB 2Y8HA 4R3BA 1HD8A 1TS8A 2Z6CA 3MXSA 1WYCA 1RGYA 3BYDA 4UQIS 2X71A 1T19A 1DP6A 2VZWA 4OKPA 2GZAA 2L0WA 4PM5A 3IX4A 2V1AA 4BQMA 4EU0A 1P0ZA 2HP5A 4DE2A 3F1PB 2OV5A 4GCZA 2JKRI 4KZ3A 2JKTM 5F82A 2WGWA 3RXWA 1L0FA 3K3CA 1K54A 5FAQA 1S6RA 1Z6FA 1G6AA 1NZOA 4HP9A 1FIKA 2Y2NA 3LIDA 1LI0A 2Y2KA 3FG8A 3LCEA 4KZ7A 4NG2A 1EW0A 1IYOA 4ZRRA 3T4JA 2VGLM 4LGWA 2FZ0A 1BSGA 1YLJA 3S7NA 4ZDXA 2P74A 4BLMA 2HP6A 1S67L 4MNRA 1ZHHB 4P6BA 2O9CA 5DFYA 2H0YA 4A5RA 3LFVA 1KE0A 1RCJA 5CHUA 3NC8A 4EW7A 4PKYA 3GQZA 4Q0JA 3A0VA 3CG5A 2I72A 2HV1A 1CK3A 4JGPA 3WRZA 1DP9A 5EVIB 3CI6A 4R4SA 2WKPA 3EGDC 1H5XA 5IHVA 4KZBA 4MBHA 4RVAA 1VEUB 3OPLA 3UPNA 3NIAA 2W3FA 4CLCA 3OBFA 3LR0A 3WRTA 2O9AA 1GHPA 2J80A 4IBRA 4XXRA 3LY3A 4Y0TA 4MN7A 1A0KA 5HFOA 5DTTA 2XEPA 1YMXA 3BFGA 3DWZA 5D3OA 5EVID 4K0WA 4E3OA 1RP5A 4GLQA 4BENA 1E25A 5BOHA 4HJ6A 2Y59A 1ES4A 1P97A 3NOTC 3SW1A 4R23A 5E2HA 2HZ5A 3PBTA 4FCFA 4LV1A 3ZG8B 3AGFA 1H0MA 3DTKA 4OQ0A 5AQBA 4FH4A 2H5SA 3MZFA 3V3RA 4GNUA 1G28A 1FSWA 3BFCA 3LUQA 4NK3A 4EQIA 3A0RA 1ZG6A 3KSGA 4K08A 1XFNA 2W3GA 4Y5FA 4U0TA 1ES3A 5EVIC 5TBMA 2XSSA 3DWKA 3E2LA 1KVLA 1KGEA 4DE1A 1O7EA 4DDSA 5A93A 3ZG7B 1Y28A 4ZJ2A 3M6HA 5IT5A 2ZLYA 3GTCA 3IBJA 5JYOA 3LR3A 2A24B 5CEBA 2BTFP 2G2UA 1ERMA 5EM1A 1LL8A 4OPYA 3A0SA 2YKHA 1JTGA 3BY8A 2WKRA 3KO6A 5C5KA 3L9KA 2ZQ7A 4X1MA 3V39A 4ZBEA 4DDYA 1U60A 3UB7A 3GV9A 2ZC6B 3NY4A 4ETZA 3Q7VB 2VKSA 2QWSA 3IXGA 5M18A 3KYZA 1FR6A 3SH9A 3G34A 3OOVA 1VETA 3SZTA 3UDFA 3M6BA 4JLFA 1XPBA 4Z1WA 4HBTA 5HWTA 2E8IA 3DBAA 4KUOA 1D7EA 2A49A 2BASA 2IWDA 1K55A 3E2KA 4OOMA 1KE4A 2J9OA 4WELA 5GLAA 4E3LA 4I39A 3UE1A 4E3KA 1J9MA 5FI6A 2WZZA 1KDWA 3G2ZA 4GHIB 2UV0E 1W7FA 1LSXA 4QY6A 3BQ8A 4EERA 2PYRA 4F3LB 3C4PA 1GSVA 4EQ1A 2ZQCA 1JTDA 4UA6A 1E4DA 4GDBA 1HZOA 2ZC5B 2ZM0A 5FI7A 1MBLA 4E6WA 3KSHA 2V9AA 3NOPC 3PAGA 3QP4A 5TFQA 4YOFA 3IBRA 3BY9A 2WGIA 4BJPA 3N4IA 4WMCD 5EV0A 5FQ9A 5FDSA 3D4FA 3IXDA 2J7VA 2PU2A 1EROA 3C2WA 3WS1A 3IX8A 1IYPA 4CPKA 3IF6C 2HJ9C 1K25A 3G2YA 2XRNA 4X68A 4Q0HA 5HDSA 2EFUA 1W8QA 3PYPA 3ZCZA 1TDGA 2JKGA 5J4EA 3C38A 4K0XA 4S2NC 2H28A 1BLSA 2JN7A 1XA1A 1IYSA 4IUHA 3NULA 4X1LA 4KZ6A 1FILA 4GD8A 4LRZE 3BFDA 3OLOA 5GHZA 3UO9A 5GLBA 1CJFA 2P9VB 4YWZA 3S7QA 1PZPA 2LB9A 4R3AA 3UB8A 2VGJA 2ZMAA 3DTIA 3B47A 4EESA 4WN5A 4S2KA 4X56A 3PBQA 2V20A 4QY5A 2PD8A 3HLEA 5KZHA 2Y4AA 3CJMA 3MSHA 4B88A 2XA7S 2B02A 3E4PA 4X55A 5GLCA 4Y15A 1M6KA 3CHWP 4DN0A 2VX8A 1ZTUA 3EQVA 2FH5A 4GB7A 4U0XA 2OWHA 1YLZA 5HD5A 1PW8A 2VV7A 3VSKA 2DCFA 5KSCA 5A92A 3DTEA 4LRYC 4BBTA 3HUNA 1K4EA 4JPMA 1FCOA 3PAEA 4LCLA 3QP1A 2JKRM 5CGWA 4DMZA 1S66L 1YAXA 2GJ3A 1BZAA 3VOLA 1IEMA 2M7UA 2J3WA 5GHXA 3DAVA 4Y13A 4H8RA 5HSQA 2E8JA 1TF1A 3HBRA 5G4YA 4NXGA 3AGDA 5HL1A 2K31A 4OPRA 1FCMA 3PHYA 1SHVA 3GMWA 2XLNA 1LL9A 2HP9A 1IFQA 3IX3A 4ESPA 5U47A 1IYQA 3UE0A 3KYQA 5K5BA 1N4OA 1JWZA 1IKIA 5CGSA 5L07A 2ZD8A 3ZVTA 4HH3A 1FR1A 1D1JA 1BLHA 2HJEA 3NHQA 2O0YA 4Q0IA 5TBMB 2XF3A 3JYIA 3SS3A 3C30A 3VOYA 3NCKA 5EOEA 3PBNA 1IKGA 4UEYA 1N9LA 5L8MA 4JXGA 5KSHA
chains in the Genus database with same CATH topology
4UAAA 5EVIB 1XGIA 3HREA 4B4ZA 4R4SA 4S2PA 5HAQA 3ZGAB 3M2KA 1ONHA 4C6YA 4HBUA 3WS0A 5FQJA 4X53A 1ESIA 1H5XA 5IHVA 4KZBA 4MBHA 3IT9A 2EX9A 3PBOA 4RVAA 3Q1FA 5DF7A 2FFFB 3OPLA 5E2EA 3UPNA 3NIAA 4CJNA 2VGKA 5FASA 2ZM2A 5EUAA 3WRTA 4EWFA 2Q9NA 1WE4A 1GHPA 3O87A 3V50A 1K56A 4IBRA 5FDHA 4MBKA 1LI9A 4XXRA 3GRJA 4RYEA 3UDIA 3LY3A 3Q7ZA 4D2OA 4Y0TA 3IWQA 4HEFA 1LL5A 4KZ5A 4HESA 5HFOA 3PTEA 3DW0A 1CEFA 3TSGA 4OOYA 1HVBA 1NJ4A 4OP5A 3FZCA 5DTTA 4F94A 2WAFA 2XEPA 1ERQA 2Y2JA 4OP8A 1YMXA 3A3IA 4C75A 1K38A 1SDNA 5DF9A 1BTLA 3BFGA 3DWZA 5D3OA 1NY0A 3G30A 2WADA 4RA7A 1AXBA 3CMZA 5DTKA 5EVID 3ZNTA 3MBZA 5CXWA 4N9KA 2UWXA 4K0WA 4E3OA 2JCHA 3RJUA 2Y2GA 1RP5A 1KGGA 4EV4A 1E3UA 3FV7A 1K57C 4BENA 1K6SA 3G35A 5DF8A 4WBGA 1E25A 1M40A 5BOHA 1FQGA 1MWUA 2Y2IA 2Y59A 5TR7A 1ES4A 4S2MA 1PZOA 4KQRA 4E3IA 4YINA 3HLFA 2H10A 4N1XA 4JXWA 4R0QA 5EECA 1YLYA 1PIOA 2IWCA 4R23A 1K57A 1Y54A 3PBRA 5E2HA 3PBTA 3BFFA 4FCFA 2XDMA 3BFEA 4LV1A 4MEZA 5FAOA 3ZG8B 3AGFA 5CTMA 1I5QA 1PI4A 4OQ0A 5AQBA 3UPOA 4FH4A 3ZHHA 3ISGA 2H5SA 3MZFA 3VP2A 3ZG0A 3HUOA 3V3RA 3UY6A 4GNUA 1FSWA 4WZ5C 5L2FA 3IHAA 3BFCA 4E3JA 5GLDA 1ZG4A 4X6TA 5CTNA 1CI9A 2Y2PA 2J9PA 3C7UA 4NK3A 5FA7A 2PU4A 4EQIA 1ZG6A 1MPLA 2XD5A 3BEBA 1BLCA 3NI9A 3N8LA 3WS2A 3HL9A 4KG6A 4PPRA 4GD6A 3M2JA 4U0TA 2J8YA 4WZ5A 1ES3A 5EVIC 1KVMA 4DE0A 2Y2HA 3DWKA 3WS5A 4PM8A 3E2LA 4FD8A 1KVLA 1KGEA 4ZJ1A 4DE1A 1BULA 1KE3A 3IXHA 2DRWA 1GA9A 1O7EA 1W5DA 4DDSA 3BLMA 3HLCA 4E6XA 3ZG7B 5A93A 5FSRA 1DY6A 4OPQA 2DNSA 4M3KA 4ZJ2A 1E3UD 3M6HA 4C3QA 1NYYA 2ZLYA 3GTCA 5EVIA 5F1FA 3ZG9B 3HLDA 2IWBA 4N1HA 4E3MA 1YLPA 3UNWA 1W79A 5FQIA 1I2WA 2V2FF 4OH0A 4DXCA 2XK1A 4XUZA 5JYOA 5CEBA 3GR2A 2G2UA 3OPPA 3BM6A 1ONGA 4XUXA 1ERMA 3BECA 5CGXA 1GCEA 4Y0OA 4JXSA 4DE3A 3V5MA 4EUZA 2RL3A 3V3SA 4IVIA 4OPYA 4QJGA 1YLTA 4UA7A 4BL3A 2EXAA 1JTGA 1DJAA 3SS4A 3UN7A 5CHJA 4JF6A 1SCWA 2ZQ7A 3V39A 4N9LA 4ZBEA 3IXBA 4DDYA 1U60A 4DF6A 5HAIA 5KMWA 3GV9A 4MLLA 3ZVWA 2ZC6B 5FQMA 4P0MA 3NY4A 2C5WB 3ZFZA 2XFTA 3CZDA 3N8RA 4WZ4A 3Q7VB 2WKIA 3W8KA 3FYZA 3G31A 2PBYA 3IXGA 4BD0A 1YM1A 5M18A 3A3JA 2Y91A 1IELA 4GN2A 2ZQAA 5CEDA 4OONA 1FR6A 3A3EA 5AQAA 3C4OA 3SH9A 3C7VA 1K55C 1L2SA 3IH8A 4FSFA 5FQKA 3HLWA 5CERA 4R1GA 3G34A 4WMCA 3UDFA 5HAPA 3HLBA 3M6BA 4JLFA 1XPBA 4PMAA 2EXBA 5HW3A 4ZJ3A 4E3NA 1ZKJA 4GKUA 1LLBA 3SH7A 5M19A 4QHCA 4HBTA 4JF5A 2E8IA 4LENA 1NYMA 2Q9MA 4S2LA 3O88A 2A49A 2IWDA 4FH2A 1K55A 1PI5A 2WYXA 3E2KA 2WKEA 4MBFA 4OOMA 1KE4A 2J9OA 4WELA 5GLAA 3UE3A 4E3LA 5G18A 2OSUA 3IH9A 5E2GA 4LV3A 3UE1A 4E3KA 3ZG5A 1J9MA 3A3DA 5FI6A 2WZZA 3ZNYA 1KDWA 3G2ZA 2ZC7A 1SKFA 3VSLA 1W7FA 2R9XA 4GOGA 4QY6A 4JXVA 4KG2A 2WZXA 1TVFA 5AQ7A 1NRFA 2EX8A 3C4PA 5GL9A 1MWRA 2WAEA 2WK0A 3IHBA 3I7JA 2ZQCA 1JTDA 2XGNA 1DJCA 1E4DA 4S2IA 4UA6A 4GDBA 4YFMA 1HZOA 3DTMA 2V1ZA 2ZC5B 4JF4A 1BUEA 2ZM0A 4X69A 3S1YA 5FI7A 1NXYA 5FQQA 2HDQA 1MBLA 3VP3A 4E6WA 1DJBA 1G68A 3PAGA 3HLGA 4JBFA 2H0TA 5TFQA 3P98A 2Z2MB 1KGFA 2WGIA 1XP4A 4EBPA 1O07A 2JBFA 5CHMA 4BJPA 3N4IA 3SS5A 4LCMA 4O7DA 3Q07A 2X01A 4WMCD 1OMEA 5E43A 5FATA 1C3BA 5EPHA 1TDLA 3MZEA 5FQ9A 3IWIA 5DTSA 3G4PA 4PM6A 3BLSA 3D4FA 4KZ9A 3TG9A 1K54C 3IXDA 2J7VA 2PU2A 3FKVA 5FAPA 2ZM8A 1MY8A 1EROA 3W4QA 3MXRA 2Y2OA 1QMFA 4Y0UA 4RX2A 1PW1A 3WS1A 3VP0A 1IYPA 4CPKA 1L0GA 2OLVA 3IF6C 3LEZA 1H8YA 1VM1A 2B5RA 2Z2LB 1ZC2A 4OPZA 3MKEA 3RXXA 4EBNA 1K25A 2ZQ9A 1ALQA 4LV2A 2GDNA 3G2YA 3LO7A 4GDNA 4R4RA 3SH8A 3QNBA 4JKTA 2ZC3B 3NDGA 2WGVA 4X68A 3IF6A 3Q7VA 3B3XA 3VOZA 2EFUA 5DVAA 1W8QA 3ZCZA 1ES5A 4P85A 4QB8A 3WS4A 1BT5A 1PYYA 1TDGA 4Q8IA 2ZJ9A 2XH9A 2C6WB 5F83A 3LY4A 5TGFA 2ZQ8A 1XKZA 3Q81A 1XGJA 4OVDA 3C5AA 1MKIA 4K0XA 1PWGA 1PWCA 1SDEA 1XA7A 4KQQA 2P9VA 4S2NC 1YQSA 4BL2A 3NDEA 3UPPA 1BLSA 2X02A 1YMSA 2JC7A 1CI8A 3VFHA 1XA1A 5CRFA 1GHIA 4Z9QA 3W4OA 1K4FA 1IYSA 3QHYA 3GSGA 4QD4A 2A3UA 2QPNA 4Y7PA 3IF6B 4KENB 4IBXA 4KZ6A 4UHUA 4S2NA 5M1AA 4OLGA 4WM9A 4GD8A 1EWZA 3OCLA 3BFDA 1S0WA 4PM9A 5GHZA 3PBSA 5A91A 3UO9A 2XD1A 3N7WA 3QNCA 2RCXA 1H8ZA 3FKWA 4B4XA 1N9BA 1GHMA 5GLBA 2P9VB 4S2JA 2G2WA 3N6IA 1PZPA 3Q82A 1L0EA 1W8YA 3ITBA 1GA0A 3O86A 4ID4A 2HDUA 2VGJA 2ZMAA 4IVKA 4WEKA 5GHYA 2WUQA 4EBLA 3UDXA 1MWSA 4S2KA 3IQAA 4X56A 3PBQA 1XX2A 3MKFA 2V20A 3OPHA 4L0LA 4QY5A 3FWLA 3G32A 4DKIA 3HLEA 1BLPA 5I94A 1JVJA 5KZHA 2CC1A 1QMEA 2Y4AA 3CJMA 4S2OA 4RX3A 5HARA 4B88A 3HUMA 4X55A 5GLCA 3OC2A 1LHYA 1M6KA 3MFDA 1L0DA 4GZBA 1RGZA 1NZUA 1VQQA 2R9WA 4OOLA 5A90A 1ES2A 4KZ4A 4IEDA 4ZTKA 3EQVA 3HVFA 2OLUA 3SOIA 2BG1A 4GB7A 2XFSA 4OQHA 4U0XA 5F1GA 1CEGA 1FCNA 1KDSA 2Y2LA 4NETA 5HX9A 1YLZA 1MWTA 5E2FA 3TOIA 1PW8A 1EI5A 1WYBA 1HD8A 2WKHA 4R3BA 3VSKA 1YT4A 2DCFA 2Y2MA 3BRMA 3MXSA 2ZQDA 1WYCA 5KSCA 1RGYA 3BYDA 3S4XA 1Q2QA 4KZ8A 5A92A 5CECA 2EX6A 4R3JA 2X71A 3HUNA 1FOFA 4N92A 1I2SA 1YLWA 1K4EA 4OKPA 4JPMA 1FCOA 4PM5A 3PAEA 4DXBA 4BQMA 3EQUA 4LCLA 4KG5A 4DRTA 2HP5A 4DE2A 2OV5A 5CGWA 4P87A 3IWOA 1BZAA 1IEMA 4KZ3A 5F82A 5EVLA 2WGWA 3OZHA 2EX2A 3P09A 3RXWA 3ITAA 5GHXA 2XQZA 4WEJA 1L0FA 2HDSA 2HPBA 4H8RA 3VP1A 2HDRA 3OCNA 2Y55A 1K54A 3HBRA 3MZDA 5FAQA 2QMIA 1S6RA 5J8XA 1JWPA 3GVBA 1K6RA 1Z6FA 4K91A 1K56D 1G6AA 1NZOA 2ZC4B 3VP4A 2Y2NA 5JYPA 1LI0A 2Y2KA 4KZ7A 1TEMA 3LCEA 4LV0A 3AGDA 3VFFA 4BD1A 5HL1A 1JWVA 1IYOA 5EE8A 4OPRA 1FCMA 5EOOA 1SHVA 3GMWA 2FFYA 1BSGA 5FI2A 1FSYA 2WGWB 1YLJA 3VMAA 2XLNA 1LL9A 4ZDXA 1PWDA 2HP9A 2Y2QA 2EFXA 2P74A 4BLMA 4WYYA 4OQIA 2HP6A 3W4PA 5U47A 1HTZA 1IYQA 4OLDA 3UE0A 4OQGA 1N4OA 1JWZA 4MNRA 1IKIA 4P6BA 5CGSA 4U3TA 3S22A 2ZD8A 3ZVTA 2H0YA 4UA9A 4A5RA 1XXMA 1FR1A 2XR0A 4PM7A 1Q2PA 1BLHA 1KE0A 1RCJA 5CHUA 1ESUA 3NC8A 3WWXA 3ZDJA 4KZAA 3GQZA 3N8SA 2XF3A 4KQOA 4ZAMA 3AGEA 3JYIA 3SS3A 1MXOA 3A3FA 2QZ6A 3CG5A 2BLSA 3OPRA 2I72A 3O3VA 3NCKA 5EOEA 3VOYA 3IF5A 3PBNA 3NBLA 1IKGA 1CK3A 4QU3A 2JE5A 5AQ9A 4JXGA 5KSHA 3WRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UAA A;  5EVI B;  1XGI A;  3HRE A;  4B4Z A;  4R4S A;  4S2P A;  5HAQ A;  3ZGA B;  3M2K A;  1ONH A;  4C6Y A;  4HBU A;  3WS0 A;  5FQJ A;  4X53 A;  1ESI A;  1H5X A;  5IHV A;  4KZB A;  4MBH A;  3IT9 A;  2EX9 A;  3PBO A;  4RVA A;  3Q1F A;  5DF7 A;  2FFF B;  3OPL A;  5E2E A;  3UPN A;  3NIA A;  4CJN A;  2VGK A;  5FAS A;  2ZM2 A;  5EUA A;  3WRT A;  4EWF A;  2Q9N A;  1WE4 A;  1GHP A;  3O87 A;  3V50 A;  1K56 A;  4IBR A;  5FDH A;  4MBK A;  1LI9 A;  4XXR A;  3GRJ A;  4RYE A;  3UDI A;  3LY3 A;  3Q7Z A;  4D2O A;  4Y0T A;  3IWQ A;  4HEF A;  1LL5 A;  4KZ5 A;  4HES A;  5HFO A;  3PTE A;  3DW0 A;  1CEF A;  3TSG A;  4OOY A;  1HVB A;  1NJ4 A;  4OP5 A;  3FZC A;  5DTT A;  4F94 A;  2WAF A;  2XEP A;  1ERQ A;  2Y2J A;  4OP8 A;  1YMX A;  3A3I A;  4C75 A;  1K38 A;  1SDN A;  5DF9 A;  1BTL A;  3BFG A;  3DWZ A;  5D3O A;  1NY0 A;  3G30 A;  2WAD A;  4RA7 A;  1AXB A;  3CMZ A;  5DTK A;  5EVI D;  3ZNT A;  3MBZ A;  5CXW A;  4N9K A;  2UWX A;  4K0W A;  4E3O A;  2JCH A;  3RJU A;  2Y2G A;  1RP5 A;  1KGG A;  4EV4 A;  1E3U A;  3FV7 A;  1K57 C;  4BEN A;  1K6S A;  3G35 A;  5DF8 A;  4WBG A;  1E25 A;  1M40 A;  5BOH A;  1FQG A;  1MWU A;  2Y2I A;  2Y59 A;  5TR7 A;  1ES4 A;  4S2M A;  1PZO A;  4KQR A;  4E3I A;  4YIN A;  3HLF A;  2H10 A;  4N1X A;  4JXW A;  4R0Q A;  5EEC A;  1YLY A;  1PIO A;  2IWC A;  4R23 A;  1K57 A;  1Y54 A;  3PBR A;  5E2H A;  3PBT A;  3BFF A;  4FCF A;  2XDM A;  3BFE A;  4LV1 A;  4MEZ A;  5FAO A;  3ZG8 B;  3AGF A;  5CTM A;  1I5Q A;  1PI4 A;  4OQ0 A;  5AQB A;  3UPO A;  4FH4 A;  3ZHH A;  3ISG A;  2H5S A;  3MZF A;  3VP2 A;  3ZG0 A;  3HUO A;  3V3R A;  3UY6 A;  4GNU A;  1FSW A;  4WZ5 C;  5L2F A;  3IHA A;  3BFC A;  4E3J A;  5GLD A;  1ZG4 A;  4X6T A;  5CTN A;  1CI9 A;  2Y2P A;  2J9P A;  3C7U A;  4NK3 A;  5FA7 A;  2PU4 A;  4EQI A;  1ZG6 A;  1MPL A;  2XD5 A;  3BEB A;  1BLC A;  3NI9 A;  3N8L A;  3WS2 A;  3HL9 A;  4KG6 A;  4PPR A;  4GD6 A;  3M2J A;  4U0T A;  2J8Y A;  4WZ5 A;  1ES3 A;  5EVI C;  1KVM A;  4DE0 A;  2Y2H A;  3DWK A;  3WS5 A;  4PM8 A;  3E2L A;  4FD8 A;  1KVL A;  1KGE A;  4ZJ1 A;  4DE1 A;  1BUL A;  1KE3 A;  3IXH A;  2DRW A;  1GA9 A;  1O7E A;  1W5D A;  4DDS A;  3BLM A;  3HLC A;  4E6X A;  3ZG7 B;  5A93 A;  5FSR A;  1DY6 A;  4OPQ A;  2DNS A;  4M3K A;  4ZJ2 A;  1E3U D;  3M6H A;  4C3Q A;  1NYY A;  2ZLY A;  3GTC A;  5EVI A;  5F1F A;  3ZG9 B;  3HLD A;  2IWB A;  4N1H A;  4E3M A;  1YLP A;  3UNW A;  1W79 A;  5FQI A;  1I2W A;  2V2F F;  4OH0 A;  4DXC A;  2XK1 A;  4XUZ A;  5JYO A;  5CEB A;  3GR2 A;  2G2U A;  3OPP A;  3BM6 A;  1ONG A;  4XUX A;  1ERM A;  3BEC A;  5CGX A;  1GCE A;  4Y0O A;  4JXS A;  4DE3 A;  3V5M A;  4EUZ A;  2RL3 A;  3V3S A;  4IVI A;  4OPY A;  4QJG A;  1YLT A;  4UA7 A;  4BL3 A;  2EXA A;  1JTG A;  1DJA A;  3SS4 A;  3UN7 A;  5CHJ A;  4JF6 A;  1SCW A;  2ZQ7 A;  3V39 A;  4N9L A;  4ZBE A;  3IXB A;  4DDY A;  1U60 A;  4DF6 A;  5HAI A;  5KMW A;  3GV9 A;  4MLL A;  3ZVW A;  2ZC6 B;  5FQM A;  4P0M A;  3NY4 A;  2C5W B;  3ZFZ A;  2XFT A;  3CZD A;  3N8R A;  4WZ4 A;  3Q7V B;  2WKI A;  3W8K A;  3FYZ A;  3G31 A;  2PBY A;  3IXG A;  4BD0 A;  1YM1 A;  5M18 A;  3A3J A;  2Y91 A;  1IEL A;  4GN2 A;  2ZQA A;  5CED A;  4OON A;  1FR6 A;  3A3E A;  5AQA A;  3C4O A;  3SH9 A;  3C7V A;  1K55 C;  1L2S A;  3IH8 A;  4FSF A;  5FQK A;  3HLW A;  5CER A;  4R1G A;  3G34 A;  4WMC A;  3UDF A;  5HAP A;  3HLB A;  3M6B A;  4JLF A;  1XPB A;  4PMA A;  2EXB A;  5HW3 A;  4ZJ3 A;  4E3N A;  1ZKJ A;  4GKU A;  1LLB A;  3SH7 A;  5M19 A;  4QHC A;  4HBT A;  4JF5 A;  2E8I A;  4LEN A;  1NYM A;  2Q9M A;  4S2L A;  3O88 A;  2A49 A;  2IWD A;  4FH2 A;  1K55 A;  1PI5 A;  2WYX A;  3E2K A;  2WKE A;  4MBF A;  4OOM A;  1KE4 A;  2J9O A;  4WEL A;  5GLA A;  3UE3 A;  4E3L A;  5G18 A;  2OSU A;  3IH9 A;  5E2G A;  4LV3 A;  3UE1 A;  4E3K A;  3ZG5 A;  1J9M A;  3A3D A;  5FI6 A;  2WZZ A;  3ZNY A;  1KDW A;  3G2Z A;  2ZC7 A;  1SKF A;  3VSL A;  1W7F A;  2R9X A;  4GOG A;  4QY6 A;  4JXV A;  4KG2 A;  2WZX A;  1TVF A;  5AQ7 A;  1NRF A;  2EX8 A;  3C4P A;  5GL9 A;  1MWR A;  2WAE A;  2WK0 A;  3IHB A;  3I7J A;  2ZQC A;  1JTD A;  2XGN A;  1DJC A;  1E4D A;  4S2I A;  4UA6 A;  4GDB A;  4YFM A;  1HZO A;  3DTM A;  2V1Z A;  2ZC5 B;  4JF4 A;  1BUE A;  2ZM0 A;  4X69 A;  3S1Y A;  5FI7 A;  1NXY A;  5FQQ A;  2HDQ A;  1MBL A;  3VP3 A;  4E6W A;  1DJB A;  1G68 A;  3PAG A;  3HLG A;  4JBF A;  2H0T A;  5TFQ A;  3P98 A;  2Z2M B;  1KGF A;  2WGI A;  1XP4 A;  4EBP A;  1O07 A;  2JBF A;  5CHM A;  4BJP A;  3N4I A;  3SS5 A;  4LCM A;  4O7D A;  3Q07 A;  2X01 A;  4WMC D;  1OME A;  5E43 A;  5FAT A;  1C3B A;  5EPH A;  1TDL A;  3MZE A;  5FQ9 A;  3IWI A;  5DTS A;  3G4P A;  4PM6 A;  3BLS A;  3D4F A;  4KZ9 A;  3TG9 A;  1K54 C;  3IXD A;  2J7V A;  2PU2 A;  3FKV A;  5FAP A;  2ZM8 A;  1MY8 A;  1ERO A;  3W4Q A;  3MXR A;  2Y2O A;  1QMF A;  4Y0U A;  4RX2 A;  1PW1 A;  3WS1 A;  3VP0 A;  1IYP A;  4CPK A;  1L0G A;  2OLV A;  3IF6 C;  3LEZ A;  1H8Y A;  1VM1 A;  2B5R A;  2Z2L B;  1ZC2 A;  4OPZ A;  3MKE A;  3RXX A;  4EBN A;  1K25 A;  2ZQ9 A;  1ALQ A;  4LV2 A;  2GDN A;  3G2Y A;  3LO7 A;  4GDN A;  4R4R A;  3SH8 A;  3QNB A;  4JKT A;  2ZC3 B;  3NDG A;  2WGV A;  4X68 A;  3IF6 A;  3Q7V A;  3B3X A;  3VOZ A;  2EFU A;  5DVA A;  1W8Q A;  3ZCZ A;  1ES5 A;  4P85 A;  4QB8 A;  3WS4 A;  1BT5 A;  1PYY A;  1TDG A;  4Q8I A;  2ZJ9 A;  2XH9 A;  2C6W B;  5F83 A;  3LY4 A;  5TGF A;  2ZQ8 A;  1XKZ A;  3Q81 A;  1XGJ A;  4OVD A;  3C5A A;  1MKI A;  4K0X A;  1PWG A;  1PWC A;  1SDE A;  1XA7 A;  4KQQ A;  2P9V A;  4S2N C;  1YQS A;  4BL2 A;  3NDE A;  3UPP A;  1BLS A;  2X02 A;  1YMS A;  2JC7 A;  1CI8 A;  3VFH A;  1XA1 A;  5CRF A;  1GHI A;  4Z9Q A;  3W4O A;  1K4F A;  1IYS A;  3QHY A;  3GSG A;  4QD4 A;  2A3U A;  2QPN A;  4Y7P A;  3IF6 B;  4KEN B;  4IBX A;  4KZ6 A;  4UHU A;  4S2N A;  5M1A A;  4OLG A;  4WM9 A;  4GD8 A;  1EWZ A;  3OCL A;  3BFD A;  1S0W A;  4PM9 A;  5GHZ A;  3PBS A;  5A91 A;  3UO9 A;  2XD1 A;  3N7W A;  3QNC A;  2RCX A;  1H8Z A;  3FKW A;  4B4X A;  1N9B A;  1GHM A;  5GLB A;  2P9V B;  4S2J A;  2G2W A;  3N6I A;  1PZP A;  3Q82 A;  1L0E A;  1W8Y A;  3ITB A;  1GA0 A;  3O86 A;  4ID4 A;  2HDU A;  2VGJ A;  2ZMA A;  4IVK A;  4WEK A;  5GHY A;  2WUQ A;  4EBL A;  3UDX A;  1MWS A;  4S2K A;  3IQA A;  4X56 A;  3PBQ A;  1XX2 A;  3MKF A;  2V20 A;  3OPH A;  4L0L A;  4QY5 A;  3FWL A;  3G32 A;  4DKI A;  3HLE A;  1BLP A;  5I94 A;  1JVJ A;  5KZH A;  2CC1 A;  1QME A;  2Y4A A;  3CJM A;  4S2O A;  4RX3 A;  5HAR A;  4B88 A;  3HUM A;  4X55 A;  5GLC A;  3OC2 A;  1LHY A;  1M6K A;  3MFD A;  1L0D A;  4GZB A;  1RGZ A;  1NZU A;  1VQQ A;  2R9W A;  4OOL A;  5A90 A;  1ES2 A;  4KZ4 A;  4IED A;  4ZTK A;  3EQV A;  3HVF A;  2OLU A;  3SOI A;  2BG1 A;  4GB7 A;  2XFS A;  4OQH A;  4U0X A;  5F1G A;  1CEG A;  1FCN A;  1KDS A;  2Y2L A;  4NET A;  5HX9 A;  1YLZ A;  1MWT A;  5E2F A;  3TOI A;  1PW8 A;  1EI5 A;  1WYB A;  1HD8 A;  2WKH A;  4R3B A;  3VSK A;  1YT4 A;  2DCF A;  2Y2M A;  3BRM A;  3MXS A;  2ZQD A;  1WYC A;  5KSC A;  1RGY A;  3BYD A;  3S4X A;  1Q2Q A;  4KZ8 A;  5A92 A;  5CEC A;  2EX6 A;  4R3J A;  2X71 A;  3HUN A;  1FOF A;  4N92 A;  1I2S A;  1YLW A;  1K4E A;  4OKP A;  4JPM A;  1FCO A;  4PM5 A;  3PAE A;  4DXB A;  4BQM A;  3EQU A;  4LCL A;  4KG5 A;  4DRT A;  2HP5 A;  4DE2 A;  2OV5 A;  5CGW A;  4P87 A;  3IWO A;  1BZA A;  1IEM A;  4KZ3 A;  5F82 A;  5EVL A;  2WGW A;  3OZH A;  2EX2 A;  3P09 A;  3RXW A;  3ITA A;  5GHX A;  2XQZ A;  4WEJ A;  1L0F A;  2HDS A;  2HPB A;  4H8R A;  3VP1 A;  2HDR A;  3OCN A;  2Y55 A;  1K54 A;  3HBR A;  3MZD A;  5FAQ A;  2QMI A;  1S6R A;  5J8X A;  1JWP A;  3GVB A;  1K6R A;  1Z6F A;  4K91 A;  1K56 D;  1G6A A;  1NZO A;  2ZC4 B;  3VP4 A;  2Y2N A;  5JYP A;  1LI0 A;  2Y2K A;  4KZ7 A;  1TEM A;  3LCE A;  4LV0 A;  3AGD A;  3VFF A;  4BD1 A;  5HL1 A;  1JWV A;  1IYO A;  5EE8 A;  4OPR A;  1FCM A;  5EOO A;  1SHV A;  3GMW A;  2FFY A;  1BSG A;  5FI2 A;  1FSY A;  2WGW B;  1YLJ A;  3VMA A;  2XLN A;  1LL9 A;  4ZDX A;  1PWD A;  2HP9 A;  2Y2Q A;  2EFX A;  2P74 A;  4BLM A;  4WYY A;  4OQI A;  2HP6 A;  3W4P A;  5U47 A;  1HTZ A;  1IYQ A;  4OLD A;  3UE0 A;  4OQG A;  1N4O A;  1JWZ A;  4MNR A;  1IKI A;  4P6B A;  5CGS A;  4U3T A;  3S22 A;  2ZD8 A;  3ZVT A;  2H0Y A;  4UA9 A;  4A5R A;  1XXM A;  1FR1 A;  2XR0 A;  4PM7 A;  1Q2P A;  1BLH A;  1KE0 A;  1RCJ A;  5CHU A;  1ESU A;  3NC8 A;  3WWX A;  3ZDJ A;  4KZA A;  3GQZ A;  3N8S A;  2XF3 A;  4KQO A;  4ZAM A;  3AGE A;  3JYI A;  3SS3 A;  1MXO A;  3A3F A;  2QZ6 A;  3CG5 A;  2BLS A;  3OPR A;  2I72 A;  3O3V A;  3NCK A;  5EOE A;  3VOY A;  3IF5 A;  3PBN A;  3NBL A;  1IKG A;  1CK3 A;  4QU3 A;  2JE5 A;  5AQ9 A;  4JXG A;  5KSH A;  3WRZ A; 
#chains in the Genus database with same CATH topology
 1OTE A;  4BBU A;  4CLC C;  3T4T A;  4B4Z A;  4S2P A;  3M2K A;  4C6Y A;  4HBU A;  3MQQ A;  4HIA A;  3Q1F A;  2O9B A;  2ZM2 A;  1WE4 A;  3O87 A;  1K56 A;  3LEQ A;  3GRJ A;  4M4X A;  1OJ5 A;  3Q7Z A;  3IWQ A;  4HEF A;  3H7W B;  4KZ5 A;  3DW0 A;  4X25 A;  3TSG A;  1NJ4 A;  3FZC A;  1ERQ A;  3A3I A;  4ARZ B;  1K38 A;  3E98 A;  4RA7 A;  1AXB A;  3CMZ A;  5DTK A;  4KQD A;  3HCY A;  1OT6 A;  1E3U A;  2JKF A;  3T1Q B;  4HH2 A;  2DMW A;  3MS6 A;  5HD3 A;  1H8M A;  2Z6D A;  2OWJ A;  4NXE A;  4E3I A;  3HLF A;  2H10 A;  3JPU A;  5EEC A;  4R0Q A;  1K57 A;  3MMH A;  1Y54 A;  3PBR A;  3ULF A;  1I5Q A;  1PI4 A;  1CQA A;  5L2F A;  3T50 A;  5GLD A;  1ZG4 A;  1CI9 A;  1OTI A;  3C7U A;  4R38 A;  5KIZ A;  4MCW A;  4RQ9 A;  1MPL A;  2XD5 A;  3NI9 A;  3N8L A;  5F68 A;  4PPR A;  4I38 A;  1KVM A;  3LYX A;  3CPT A;  4PKY G;  2DRW A;  3HLC A;  5HPI A;  1DY6 A;  4OPQ A;  4M3K A;  5CX7 A;  3MFX A;  5MC7 A;  3ZG9 B;  3HLD A;  4N1H A;  1YLP A;  3UNW A;  5FQI A;  1Y4O A;  2EWW A;  2GNX A;  3GR2 A;  4XUX A;  5CGX A;  1ONG A;  1GCE A;  1P9W A;  3V3S A;  1YKD A;  4QJG A;  4BL3 A;  1DJA A;  4D60 A;  1GSX A;  5F6A A;  3IXB A;  5HAI A;  4P0M A;  3KSI A;  2XFT A;  3CZD A;  3FYZ A;  5I5L A;  5J7E A;  2PBY A;  3EGX C;  4BD0 A;  3A3E A;  3C4O A;  1KOU A;  3C7V A;  1K55 C;  2I9V A;  4EUV A;  3HLB A;  5HW3 A;  4ZJ3 A;  4E3N A;  3F1N A;  5M19 A;  2Q0O A;  4QHC A;  4BWI A;  3NJA A;  1K0K A;  4JF5 A;  4LEN A;  1NYM A;  3F1O A;  3O88 A;  4LFU A;  2VGL S;  1NWZ A;  4FH2 A;  1PI5 A;  2WKE A;  4NXB A;  4MBF A;  4LV3 A;  3ZG5 A;  3ZNY A;  2EA9 A;  4HQA A;  4E04 A;  4JXV A;  2WZX A;  2INW A;  2PBD P;  1TVF A;  3U4L P;  1HLU P;  1MWR A;  2WAE A;  3IHB A;  3I7J A;  4S2I A;  2PDR A;  3PR6 A;  1XFQ A;  2V1Z A;  3DTM A;  5DKL A;  4IJG A;  4LLO B;  4KUK A;  1V9Y A;  3MQO A;  1SKO A;  1G68 A;  4ME4 A;  3HLG A;  2H0T A;  2MJ6 A;  3BQA A;  4EBP A;  4XT2 A;  5E43 A;  5EPH A;  3MZE A;  4HJ4 A;  4PM6 A;  4KZ9 A;  3MQ0 A;  4IUK A;  3EEH A;  3MXR A;  2W1T A;  2Y2O A;  3LIC A;  5EVE A;  4RX2 A;  1PW1 A;  2OLV A;  1H8Y A;  2KX6 A;  1ZC2 A;  4NXF A;  3RXX A;  3W2Z A;  3LIB A;  4NEE D;  2GDN A;  2JHE A;  4R4R A;  4MDZ A;  3QNB A;  2ZC3 B;  3NDG A;  1F2K A;  4EEP A;  1ES5 A;  1BT5 A;  2ZJ9 A;  3PXP A;  5F83 A;  2ZQ8 A;  1XKZ A;  4OVD A;  1XGJ A;  1MKI A;  3LIF A;  1PWC A;  5A8B A;  3UPP A;  2X02 A;  4HOI A;  2JC7 A;  3IS2 A;  3D72 A;  4Z9Q A;  3QHY A;  4BMW A;  2A3U A;  3IF6 B;  4JGR A;  4IBX A;  4UHU A;  1LSV A;  4WM9 A;  1EWZ A;  1PNE A;  1S0W A;  3PBS A;  5TJJ A;  3N7W A;  1N9B A;  3V67 A;  3N6I A;  2XRO A;  3ITB A;  3P7N A;  4I3A A;  2VV8 A;  2WUQ A;  3UDX A;  1XJ6 A;  1XX2 A;  4L0L A;  1OTB A;  3B33 A;  3T1X A;  3MFD A;  4GZB A;  1RGZ A;  1NZU A;  1VQQ A;  2R9W A;  4G3V A;  4KZ4 A;  4WLA A;  2VA0 A;  3SOI A;  1CEG A;  1NLZ A;  4CQH A;  1FCN A;  1OTA A;  1KDS A;  1V9Z A;  1MWT A;  3QP2 A;  2QYB A;  3F1P A;  4LPZ A;  1EI5 A;  1WYB A;  5AVE A;  2PD7 A;  2Y2M A;  3BRM A;  4B93 A;  3S4X A;  5CEC A;  4KZ8 A;  3LGO A;  2EX6 A;  4R3J A;  2V0W A;  1FOF A;  3T1S A;  4N92 A;  2M7V A;  1TD5 A;  3EQU A;  1YSQ A;  3P01 A;  5EVL A;  1IOU A;  3FPW A;  2V0U A;  3P09 A;  3ITA A;  3D9Y A;  2XQZ A;  4WEJ A;  3VP1 A;  2HDR A;  2ZL1 A;  3UB5 P;  3MZD A;  5J8X A;  3O5Y A;  1JWP A;  3GVB A;  3HJK A;  1K56 D;  2ZC4 B;  1N9O A;  3VE4 A;  1TEM A;  1JWV A;  5EE8 A;  2OOL A;  5EOO A;  5FI2 A;  2WGW B;  3VMA A;  1PWD A;  2EFX A;  4L9G A;  4OQI A;  2ZMV A;  4OQG A;  4U3T A;  3S22 A;  2VV6 A;  4UA9 A;  3TE8 A;  2EWV A;  2P04 A;  4FTX A;  4PM7 A;  3MR0 A;  4G3W A;  5HZH A;  1T1A A;  2R78 A;  4KZA A;  3N8S A;  4GS9 A;  1VEU A;  2D02 A;  1MXO A;  3OPR A;  3O3V A;  3IF5 A;  1TS6 A;  4QU3 A;  3ZYT A;  5AQ9 A;  4LV0 A;  2V1B A;  4UAA A;  1XGI A;  3HRE A;  3NEC A;  1ONH A;  3WS0 A;  4X53 A;  4WL9 A;  2KLI A;  3PBO A;  2EX9 A;  5DF7 A;  4AFI A;  1P9R A;  2FFF B;  4CJN A;  2QKP A;  2OAQ 1;  5EUA A;  5EFW A;  2Q9N A;  1STZ A;  1LI9 A;  1BYW A;  4MBK A;  4RYE A;  3HJI A;  3S7O A;  1LL5 A;  3JVV A;  3QP6 A;  4OOY A;  4OP5 A;  1BTL A;  5AVF A;  3G30 A;  2WAD A;  3MBZ A;  5CXW A;  4N9K A;  4CLC E;  2JCH A;  4CLC B;  2Y2G A;  1KGG A;  5HWW A;  1K57 C;  3G35 A;  5DF8 A;  3T4O A;  3F1N B;  1M40 A;  3NOU C;  1FQG A;  2Y2I A;  5TR7 A;  1MZU A;  4KQR A;  4YIN A;  5J3W A;  3EEA A;  1F9I A;  3TRC A;  4JXW A;  3ZQ5 A;  1LSW A;  2IWC A;  3QP8 A;  3CUE C;  3BFE A;  4MEZ A;  2QHK A;  5CTM A;  4I3I A;  3UPO A;  1XJ3 A;  3ZHH A;  1NLY A;  5HWV A;  3VP2 A;  3ZG0 A;  3HUO A;  3UY6 A;  4PAU A;  3LI8 A;  3KYE A;  2ZBB A;  4CLC D;  2YKF A;  4X6T A;  5CTN A;  2Y2P A;  2J9P A;  1XJ2 A;  1X0O A;  2A24 A;  3WS2 A;  4EEU A;  3KSF A;  1TS0 A;  4WZ5 A;  3M2J A;  2J8Y A;  2Y2H A;  4FD8 A;  3RTY A;  1BUL A;  4P6Z M;  2D01 A;  2OAP 1;  1GA9 A;  1AWI A;  1T1C A;  4E6X A;  4XT2 B;  1MKM A;  1CF0 A;  2DNS A;  1D06 A;  3K2N A;  4C3Q A;  5F1F A;  2W1R A;  4E3M A;  1W79 A;  4DXC A;  4OH0 A;  2XK1 A;  1YSP A;  3OPP A;  4Y0O A;  4DE3 A;  2RL3 A;  4IVI A;  2EXA A;  3GDI A;  3SS4 A;  4JGQ A;  5CHJ A;  4JF6 A;  4DF6 A;  4UQI M;  3TW8 A;  3ZVW A;  5FQM A;  2C5W B;  3ZFZ A;  4L9E A;  5EM0 A;  3N8R A;  4R6L A;  3G31 A;  1XJ4 A;  3A3J A;  2ZQA A;  4OON A;  5AQA A;  4HY8 A;  4FUW A;  1L2S A;  1LT0 A;  4FSF A;  5CER A;  4R1G A;  4WMC A;  5HAP A;  3T4K A;  4PMA A;  2EXB A;  1ZKJ A;  3SH7 A;  1LLB A;  4F3L A;  3MF0 A;  2Q9M A;  4S2L A;  3E0Y A;  3BWL A;  2WYX A;  4BBV A;  5E2G A;  3IH9 A;  5IU1 A;  4GW9 A;  1OTD A;  2ZC7 A;  1VET B;  1SKF A;  3EOI A;  2R9X A;  4GOG A;  4HNB A;  5AQ7 A;  1NRF A;  5F5Y A;  2Y79 A;  5GL9 A;  1DJC A;  3T4Q A;  2L1M A;  4X69 A;  1NXY A;  2P7J A;  1DJB A;  2W3H A;  3H82 A;  1KGF A;  2PR6 A;  2JBF A;  4LCM A;  4O7D A;  3Q07 A;  3CUE A;  2X01 A;  1OME A;  1TDL A;  2A2L A;  3IWI A;  1PRQ A;  3G4P A;  5FAP A;  5HL6 A;  2ZM8 A;  1MY8 A;  3W4Q A;  4Y0U A;  3H9W A;  4QPR A;  3LEZ A;  1VM1 A;  3KX0 X;  2B5R A;  2Z2L B;  4OPZ A;  1NRJ A;  4EBN A;  2ZQ9 A;  1ALQ A;  4HP4 A;  2VK3 A;  3LO7 A;  4JKT A;  3K3D A;  2QJ5 A;  3VOZ A;  4P85 A;  4QB8 A;  1S1Z A;  4Q8I A;  4IHQ A;  2C6W B;  4WUJ A;  1PWG A;  1SDE A;  1XA7 A;  2ZL1 B;  2P9V A;  1YQS A;  4BL2 A;  3NDE A;  3VFH A;  5CRF A;  1GHI A;  3QP5 A;  3W4O A;  3GSG A;  2QPN A;  3S7P A;  4Y7P A;  5M1A A;  3L7H A;  4OLG A;  1WA9 A;  3OCL A;  4PM9 A;  5A91 A;  4B4X A;  2XD1 A;  2RCX A;  1GHM A;  2VEA A;  4O0P A;  4S2J A;  2G2W A;  5FEG A;  4DJ2 A;  1GSW A;  2QJ7 A;  2V8C A;  2PRF A;  3R4K A;  3O86 A;  2HDU A;  1UWP X;  3R7W A;  1L3L A;  5DKK A;  4IVK A;  2V8F A;  5DJT A;  1MWS A;  3MKF A;  3OPH A;  4O8G A;  4GS9 B;  5I94 A;  4DKI A;  2CC1 A;  2O99 A;  5F69 A;  3OC2 A;  1LHY A;  4EET B;  4OOL A;  1ES2 A;  4IED A;  4II7 A;  2XFS A;  4OQH A;  1SZV A;  2Y2L A;  5AJG A;  4NET A;  5E2F A;  3TOI A;  3JVU A;  2WKH A;  1YT4 A;  1J3W A;  2ZQD A;  1Q2Q A;  1UWN X;  4HJ3 A;  4I3J A;  3CWF A;  5G4Z A;  1I2S A;  1YLW A;  1G6O A;  4DXB A;  2CMN A;  4KG5 A;  4DRT A;  3CLO A;  4P87 A;  3IWO A;  3OZH A;  2EX2 A;  3E4O A;  4MN5 A;  2JKT I;  4B9O A;  2W0N A;  2HDS A;  2HPB A;  3OCN A;  2Y55 A;  2QMI A;  1K6R A;  1S4R A;  4K91 A;  3VP4 A;  5HPF A;  5JYP A;  4BD1 A;  3VFF A;  4HHD A;  3LR5 A;  2FFY A;  1FSY A;  2Y2Q A;  4WYY A;  3C8C A;  3W4P A;  1HTZ A;  2J3T D;  4OLD A;  4EXO A;  1VHM A;  4HI4 A;  5FEF A;  1XXM A;  2XR0 A;  1Q2P A;  1ESU A;  3WWX A;  4FOF A;  3ZDJ A;  4KQO A;  4ZAM A;  3AGE A;  3BJN A;  4R70 A;  2PR5 A;  5HDD A;  3A3F A;  2QZ6 A;  2BLS A;  3T12 B;  3NBL A;  2JE5 A;  5FL3 A;  1OT9 A;  3H7W A;  5HAQ A;  3ZGA B;  3LI9 A;  4ARZ A;  5FQJ A;  1ESI A;  4MN6 A;  3IT9 A;  5E2E A;  4H6J A;  3D3O A;  1S1Y A;  2VGK A;  5FAS A;  3V50 A;  5FDH A;  3UDI A;  4D2O A;  2J3T C;  1YPR A;  4HES A;  3BW6 A;  3PTE A;  1CEF A;  1HVB A;  1W63 Q;  2PAV P;  2WAF A;  2Y2J A;  4OP8 A;  2K7S A;  4F94 A;  4C75 A;  1SDN A;  2KOI A;  5DF9 A;  1NY0 A;  3ZNT A;  4L9F A;  2UWX A;  3RJU A;  2M1C A;  5L10 A;  4EV4 A;  3FV7 A;  1K6S A;  1OPX A;  4WBG A;  3VV4 A;  1MWU A;  2W3D A;  4S2M A;  1PZO A;  4N1X A;  1ACF A;  2B95 A;  3CAX A;  2HF6 A;  1YLY A;  1PIO A;  3BFF A;  5FAO A;  2XDM A;  1S4S A;  3ISG A;  1VB6 A;  4WZ5 C;  3IHA A;  4E3J A;  5FA7 A;  2PU4 A;  3BEB A;  1BLC A;  3U2A A;  3HL9 A;  4KG6 A;  4GD6 A;  4DE0 A;  3WS5 A;  4PM8 A;  3H82 B;  4ZJ1 A;  2LB5 A;  1KE3 A;  3IXH A;  2VJW A;  1W5D A;  2XA7 M;  3BLM A;  3FPV A;  3UMD A;  2GX5 A;  4WF0 A;  5FSR A;  1DRM A;  1E3U D;  1NYY A;  5EVI A;  3MXQ A;  4QWO A;  2IWB A;  3FC7 A;  1I2W A;  2V2F F;  3TJZ C;  4XUZ A;  3VE3 A;  2WKQ A;  3LIE A;  3BM6 A;  3BEC A;  4JXS A;  3V5M A;  4EUZ A;  5HDC A;  1H3Q A;  3CPT B;  1YLT A;  4UA7 A;  1TS7 A;  4YNR A;  3UN7 A;  1SCW A;  4N9L A;  4NKP A;  5KMW A;  4MLL A;  4WZ4 A;  3W8K A;  2WKI A;  1YM1 A;  2Y91 A;  1IEL A;  4GN2 A;  5CED A;  4Y17 A;  3G6O A;  3IH8 A;  5FQK A;  3HLW A;  2PYP A;  5IS1 A;  4GKU A;  1F98 A;  2ZOH A;  4Y2F A;  4O01 A;  3UE3 A;  4EWF A;  5G18 A;  2OSU A;  1G5U A;  2VLG A;  3A3D A;  1UGU A;  2G7U A;  1W63 M;  3VSL A;  3RH8 B;  4KG2 A;  2L4R A;  3E4Q A;  2EX8 A;  3F1O B;  3R7W B;  2WK0 A;  1T1B A;  5DJU A;  1N9N A;  2XGN A;  4YFM A;  3T1R A;  4JF4 A;  1BUE A;  2KDK A;  3S1Y A;  3LR4 A;  5FQQ A;  2HDQ A;  3VP3 A;  1Z09 A;  3MJQ A;  5L09 A;  4JBF A;  3P98 A;  2Z2M B;  4PHT A;  1XP4 A;  1O07 A;  2NUT C;  5CHM A;  4ETX A;  3SS5 A;  3B42 A;  4Y3I A;  5FAT A;  1C3B A;  5DTS A;  3TG9 A;  3BLS A;  3UB9 A;  1K54 C;  3FKV A;  2NUP C;  1QMF A;  1F5M A;  1ODV A;  5DFX A;  3VP0 A;  1SKO B;  1L0G A;  1OJG A;  3MKE A;  3LIA A;  4I5S A;  3T4S A;  4LV2 A;  4GDN A;  2W27 A;  3SH8 A;  2ZOI A;  2WGV A;  4JGO A;  3IF6 A;  2K2N A;  3Q7V A;  2W1T B;  3B3X A;  5DVA A;  3WS4 A;  1PYY A;  2XH9 A;  2PHY A;  3LY4 A;  5TGF A;  3Q81 A;  5LBR A;  3C5A A;  4KQQ A;  3RFB A;  4LRX C;  1YMS A;  3CIT A;  3UB6 A;  1CI8 A;  4MMN A;  2ZMF A;  1K4F A;  2AVX A;  2W3E A;  4QD4 A;  4KEN B;  4S2N A;  3QNC A;  1H8Z A;  3FKW A;  2B18 A;  4GHI A;  3UE6 A;  2IA2 A;  3EWK A;  3Q82 A;  1JNU A;  1L0E A;  1W8Y A;  3IS2 B;  1GA0 A;  3ICY A;  4ID4 A;  4WEK A;  1PFL A;  5GHY A;  4EBL A;  3IQA A;  2P08 A;  3UME A;  3FWL A;  3G32 A;  1BLP A;  1MC0 A;  4P6Z S;  1JVJ A;  3GEC A;  1QME A;  4S2O A;  4RX3 A;  5HAR A;  2PT7 A;  3HUM A;  2ACG A;  4GJ4 A;  1DP8 A;  2HGV A;  1L0D A;  5A90 A;  1T18 A;  3T4L A;  4DJ3 A;  4ZTK A;  3HVF A;  2OLU A;  2BG1 A;  4G3K A;  5F1G A;  5HX9 A;  4H6J B;  2Y8H A;  4R3B A;  1HD8 A;  1TS8 A;  2Z6C A;  3MXS A;  1WYC A;  1RGY A;  3BYD A;  4UQI S;  2X71 A;  1T19 A;  1DP6 A;  2VZW A;  4OKP A;  2GZA A;  2L0W A;  4PM5 A;  3IX4 A;  2V1A A;  4BQM A;  4EU0 A;  1P0Z A;  2HP5 A;  4DE2 A;  3F1P B;  2OV5 A;  4GCZ A;  2JKR I;  4KZ3 A;  2JKT M;  5F82 A;  2WGW A;  3RXW A;  1L0F A;  3K3C A;  1K54 A;  5FAQ A;  1S6R A;  1Z6F A;  1G6A A;  1NZO A;  4HP9 A;  1FIK A;  2Y2N A;  3LID A;  1LI0 A;  2Y2K A;  3FG8 A;  3LCE A;  4KZ7 A;  4NG2 A;  1EW0 A;  1IYO A;  4ZRR A;  3T4J A;  2VGL M;  4LGW A;  2FZ0 A;  1BSG A;  1YLJ A;  3S7N A;  4ZDX A;  2P74 A;  4BLM A;  2HP6 A;  1S67 L;  4MNR A;  1ZHH B;  4P6B A;  2O9C A;  5DFY A;  2H0Y A;  4A5R A;  3LFV A;  1KE0 A;  1RCJ A;  5CHU A;  3NC8 A;  4EW7 A;  4PKY A;  3GQZ A;  4Q0J A;  3A0V A;  3CG5 A;  2I72 A;  2HV1 A;  1CK3 A;  4JGP A;  3WRZ A;  1DP9 A;  5EVI B;  3CI6 A;  4R4S A;  2WKP A;  3EGD C;  1H5X A;  5IHV A;  4KZB A;  4MBH A;  4RVA A;  1VEU B;  3OPL A;  3UPN A;  3NIA A;  2W3F A;  4CLC A;  3OBF A;  3LR0 A;  3WRT A;  2O9A A;  1GHP A;  2J80 A;  4IBR A;  4XXR A;  3LY3 A;  4Y0T A;  4MN7 A;  1A0K A;  5HFO A;  5DTT A;  2XEP A;  1YMX A;  3BFG A;  3DWZ A;  5D3O A;  5EVI D;  4K0W A;  4E3O A;  1RP5 A;  4GLQ A;  4BEN A;  1E25 A;  5BOH A;  4HJ6 A;  2Y59 A;  1ES4 A;  1P97 A;  3NOT C;  3SW1 A;  4R23 A;  5E2H A;  2HZ5 A;  3PBT A;  4FCF A;  4LV1 A;  3ZG8 B;  3AGF A;  1H0M A;  3DTK A;  4OQ0 A;  5AQB A;  4FH4 A;  2H5S A;  3MZF A;  3V3R A;  4GNU A;  1G28 A;  1FSW A;  3BFC A;  3LUQ A;  4NK3 A;  4EQI A;  3A0R A;  1ZG6 A;  3KSG A;  4K08 A;  1XFN A;  2W3G A;  4Y5F A;  4U0T A;  1ES3 A;  5EVI C;  5TBM A;  2XSS A;  3DWK A;  3E2L A;  1KVL A;  1KGE A;  4DE1 A;  1O7E A;  4DDS A;  5A93 A;  3ZG7 B;  1Y28 A;  4ZJ2 A;  3M6H A;  5IT5 A;  2ZLY A;  3GTC A;  3IBJ A;  5JYO A;  3LR3 A;  2A24 B;  5CEB A;  2BTF P;  2G2U A;  1ERM A;  5EM1 A;  1LL8 A;  4OPY A;  3A0S A;  2YKH A;  1JTG A;  3BY8 A;  2WKR A;  3KO6 A;  5C5K A;  3L9K A;  2ZQ7 A;  4X1M A;  3V39 A;  4ZBE A;  4DDY A;  1U60 A;  3UB7 A;  3GV9 A;  2ZC6 B;  3NY4 A;  4ETZ A;  3Q7V B;  2VKS A;  2QWS A;  3IXG A;  5M18 A;  3KYZ A;  1FR6 A;  3SH9 A;  3G34 A;  3OOV A;  1VET A;  3SZT A;  3UDF A;  3M6B A;  4JLF A;  1XPB A;  4Z1W A;  4HBT A;  5HWT A;  2E8I A;  3DBA A;  4KUO A;  1D7E A;  2A49 A;  2BAS A;  2IWD A;  1K55 A;  3E2K A;  4OOM A;  1KE4 A;  2J9O A;  4WEL A;  5GLA A;  4E3L A;  4I39 A;  3UE1 A;  4E3K A;  1J9M A;  5FI6 A;  2WZZ A;  1KDW A;  3G2Z A;  4GHI B;  2UV0 E;  1W7F A;  1LSX A;  4QY6 A;  3BQ8 A;  4EER A;  2PYR A;  4F3L B;  3C4P A;  1GSV A;  4EQ1 A;  2ZQC A;  1JTD A;  4UA6 A;  1E4D A;  4GDB A;  1HZO A;  2ZC5 B;  2ZM0 A;  5FI7 A;  1MBL A;  4E6W A;  3KSH A;  2V9A A;  3NOP C;  3PAG A;  3QP4 A;  5TFQ A;  4YOF A;  3IBR A;  3BY9 A;  2WGI A;  4BJP A;  3N4I A;  4WMC D;  5EV0 A;  5FQ9 A;  5FDS A;  3D4F A;  3IXD A;  2J7V A;  2PU2 A;  1ERO A;  3C2W A;  3WS1 A;  3IX8 A;  1IYP A;  4CPK A;  3IF6 C;  2HJ9 C;  1K25 A;  3G2Y A;  2XRN A;  4X68 A;  4Q0H A;  5HDS A;  2EFU A;  1W8Q A;  3PYP A;  3ZCZ A;  1TDG A;  2JKG A;  5J4E A;  3C38 A;  4K0X A;  4S2N C;  2H28 A;  1BLS A;  2JN7 A;  1XA1 A;  1IYS A;  4IUH A;  3NUL A;  4X1L A;  4KZ6 A;  1FIL A;  4GD8 A;  4LRZ E;  3BFD A;  3OLO A;  5GHZ A;  3UO9 A;  5GLB A;  1CJF A;  2P9V B;  4YWZ A;  3S7Q A;  1PZP A;  2LB9 A;  4R3A A;  3UB8 A;  2VGJ A;  2ZMA A;  3DTI A;  3B47 A;  4EES A;  4WN5 A;  4S2K A;  4X56 A;  3PBQ A;  2V20 A;  4QY5 A;  2PD8 A;  3HLE A;  5KZH A;  2Y4A A;  3CJM A;  3MSH A;  4B88 A;  2XA7 S;  2B02 A;  3E4P A;  4X55 A;  5GLC A;  4Y15 A;  1M6K A;  3CHW P;  4DN0 A;  2VX8 A;  1ZTU A;  3EQV A;  2FH5 A;  4GB7 A;  4U0X A;  2OWH A;  1YLZ A;  5HD5 A;  1PW8 A;  2VV7 A;  3VSK A;  2DCF A;  5KSC A;  5A92 A;  3DTE A;  4LRY C;  4BBT A;  3HUN A;  1K4E A;  4JPM A;  1FCO A;  3PAE A;  4LCL A;  3QP1 A;  2JKR M;  5CGW A;  4DMZ A;  1S66 L;  1YAX A;  2GJ3 A;  1BZA A;  3VOL A;  1IEM A;  2M7U A;  2J3W A;  5GHX A;  3DAV A;  4Y13 A;  4H8R A;  5HSQ A;  2E8J A;  1TF1 A;  3HBR A;  5G4Y A;  4NXG A;  3AGD A;  5HL1 A;  2K31 A;  4OPR A;  1FCM A;  3PHY A;  1SHV A;  3GMW A;  2XLN A;  1LL9 A;  2HP9 A;  1IFQ A;  3IX3 A;  4ESP A;  5U47 A;  1IYQ A;  3UE0 A;  3KYQ A;  5K5B A;  1N4O A;  1JWZ A;  1IKI A;  5CGS A;  5L07 A;  2ZD8 A;  3ZVT A;  4HH3 A;  1FR1 A;  1D1J A;  1BLH A;  2HJE A;  3NHQ A;  2O0Y A;  4Q0I A;  5TBM B;  2XF3 A;  3JYI A;  3SS3 A;  3C30 A;  3VOY A;  3NCK A;  5EOE A;  3PBN A;  1IKG A;  4UEY A;  1N9L A;  5L8M A;  4JXG A;  5KSH A; 
#chains in the Genus database with same CATH homology
 4UAA A;  5EVI B;  1XGI A;  3HRE A;  4B4Z A;  4R4S A;  4S2P A;  5HAQ A;  3ZGA B;  3M2K A;  1ONH A;  4C6Y A;  4HBU A;  3WS0 A;  5FQJ A;  4X53 A;  1ESI A;  1H5X A;  5IHV A;  4KZB A;  4MBH A;  3IT9 A;  2EX9 A;  3PBO A;  4RVA A;  3Q1F A;  5DF7 A;  2FFF B;  3OPL A;  5E2E A;  3UPN A;  3NIA A;  4CJN A;  2VGK A;  5FAS A;  2ZM2 A;  5EUA A;  3WRT A;  4EWF A;  2Q9N A;  1WE4 A;  1GHP A;  3O87 A;  3V50 A;  1K56 A;  4IBR A;  5FDH A;  4MBK A;  1LI9 A;  4XXR A;  3GRJ A;  4RYE A;  3UDI A;  3LY3 A;  3Q7Z A;  4D2O A;  4Y0T A;  3IWQ A;  4HEF A;  1LL5 A;  4KZ5 A;  4HES A;  5HFO A;  3PTE A;  3DW0 A;  1CEF A;  3TSG A;  4OOY A;  1HVB A;  1NJ4 A;  4OP5 A;  3FZC A;  5DTT A;  4F94 A;  2WAF A;  2XEP A;  1ERQ A;  2Y2J A;  4OP8 A;  1YMX A;  3A3I A;  4C75 A;  1K38 A;  1SDN A;  5DF9 A;  1BTL A;  3BFG A;  3DWZ A;  5D3O A;  1NY0 A;  3G30 A;  2WAD A;  4RA7 A;  1AXB A;  3CMZ A;  5DTK A;  5EVI D;  3ZNT A;  3MBZ A;  5CXW A;  4N9K A;  2UWX A;  4K0W A;  4E3O A;  2JCH A;  3RJU A;  2Y2G A;  1RP5 A;  1KGG A;  4EV4 A;  1E3U A;  3FV7 A;  1K57 C;  4BEN A;  1K6S A;  3G35 A;  5DF8 A;  4WBG A;  1E25 A;  1M40 A;  5BOH A;  1FQG A;  1MWU A;  2Y2I A;  2Y59 A;  5TR7 A;  1ES4 A;  4S2M A;  1PZO A;  4KQR A;  4E3I A;  4YIN A;  3HLF A;  2H10 A;  4N1X A;  4JXW A;  4R0Q A;  5EEC A;  1YLY A;  1PIO A;  2IWC A;  4R23 A;  1K57 A;  1Y54 A;  3PBR A;  5E2H A;  3PBT A;  3BFF A;  4FCF A;  2XDM A;  3BFE A;  4LV1 A;  4MEZ A;  5FAO A;  3ZG8 B;  3AGF A;  5CTM A;  1I5Q A;  1PI4 A;  4OQ0 A;  5AQB A;  3UPO A;  4FH4 A;  3ZHH A;  3ISG A;  2H5S A;  3MZF A;  3VP2 A;  3ZG0 A;  3HUO A;  3V3R A;  3UY6 A;  4GNU A;  1FSW A;  4WZ5 C;  5L2F A;  3IHA A;  3BFC A;  4E3J A;  5GLD A;  1ZG4 A;  4X6T A;  5CTN A;  1CI9 A;  2Y2P A;  2J9P A;  3C7U A;  4NK3 A;  5FA7 A;  2PU4 A;  4EQI A;  1ZG6 A;  1MPL A;  2XD5 A;  3BEB A;  1BLC A;  3NI9 A;  3N8L A;  3WS2 A;  3HL9 A;  4KG6 A;  4PPR A;  4GD6 A;  3M2J A;  4U0T A;  2J8Y A;  4WZ5 A;  1ES3 A;  5EVI C;  1KVM A;  4DE0 A;  2Y2H A;  3DWK A;  3WS5 A;  4PM8 A;  3E2L A;  4FD8 A;  1KVL A;  1KGE A;  4ZJ1 A;  4DE1 A;  1BUL A;  1KE3 A;  3IXH A;  2DRW A;  1GA9 A;  1O7E A;  1W5D A;  4DDS A;  3BLM A;  3HLC A;  4E6X A;  3ZG7 B;  5A93 A;  5FSR A;  1DY6 A;  4OPQ A;  2DNS A;  4M3K A;  4ZJ2 A;  1E3U D;  3M6H A;  4C3Q A;  1NYY A;  2ZLY A;  3GTC A;  5EVI A;  5F1F A;  3ZG9 B;  3HLD A;  2IWB A;  4N1H A;  4E3M A;  1YLP A;  3UNW A;  1W79 A;  5FQI A;  1I2W A;  2V2F F;  4OH0 A;  4DXC A;  2XK1 A;  4XUZ A;  5JYO A;  5CEB A;  3GR2 A;  2G2U A;  3OPP A;  3BM6 A;  1ONG A;  4XUX A;  1ERM A;  3BEC A;  5CGX A;  1GCE A;  4Y0O A;  4JXS A;  4DE3 A;  3V5M A;  4EUZ A;  2RL3 A;  3V3S A;  4IVI A;  4OPY A;  4QJG A;  1YLT A;  4UA7 A;  4BL3 A;  2EXA A;  1JTG A;  1DJA A;  3SS4 A;  3UN7 A;  5CHJ A;  4JF6 A;  1SCW A;  2ZQ7 A;  3V39 A;  4N9L A;  4ZBE A;  3IXB A;  4DDY A;  1U60 A;  4DF6 A;  5HAI A;  5KMW A;  3GV9 A;  4MLL A;  3ZVW A;  2ZC6 B;  5FQM A;  4P0M A;  3NY4 A;  2C5W B;  3ZFZ A;  2XFT A;  3CZD A;  3N8R A;  4WZ4 A;  3Q7V B;  2WKI A;  3W8K A;  3FYZ A;  3G31 A;  2PBY A;  3IXG A;  4BD0 A;  1YM1 A;  5M18 A;  3A3J A;  2Y91 A;  1IEL A;  4GN2 A;  2ZQA A;  5CED A;  4OON A;  1FR6 A;  3A3E A;  5AQA A;  3C4O A;  3SH9 A;  3C7V A;  1K55 C;  1L2S A;  3IH8 A;  4FSF A;  5FQK A;  3HLW A;  5CER A;  4R1G A;  3G34 A;  4WMC A;  3UDF A;  5HAP A;  3HLB A;  3M6B A;  4JLF A;  1XPB A;  4PMA A;  2EXB A;  5HW3 A;  4ZJ3 A;  4E3N A;  1ZKJ A;  4GKU A;  1LLB A;  3SH7 A;  5M19 A;  4QHC A;  4HBT A;  4JF5 A;  2E8I A;  4LEN A;  1NYM A;  2Q9M A;  4S2L A;  3O88 A;  2A49 A;  2IWD A;  4FH2 A;  1K55 A;  1PI5 A;  2WYX A;  3E2K A;  2WKE A;  4MBF A;  4OOM A;  1KE4 A;  2J9O A;  4WEL A;  5GLA A;  3UE3 A;  4E3L A;  5G18 A;  2OSU A;  3IH9 A;  5E2G A;  4LV3 A;  3UE1 A;  4E3K A;  3ZG5 A;  1J9M A;  3A3D A;  5FI6 A;  2WZZ A;  3ZNY A;  1KDW A;  3G2Z A;  2ZC7 A;  1SKF A;  3VSL A;  1W7F A;  2R9X A;  4GOG A;  4QY6 A;  4JXV A;  4KG2 A;  2WZX A;  1TVF A;  5AQ7 A;  1NRF A;  2EX8 A;  3C4P A;  5GL9 A;  1MWR A;  2WAE A;  2WK0 A;  3IHB A;  3I7J A;  2ZQC A;  1JTD A;  2XGN A;  1DJC A;  1E4D A;  4S2I A;  4UA6 A;  4GDB A;  4YFM A;  1HZO A;  3DTM A;  2V1Z A;  2ZC5 B;  4JF4 A;  1BUE A;  2ZM0 A;  4X69 A;  3S1Y A;  5FI7 A;  1NXY A;  5FQQ A;  2HDQ A;  1MBL A;  3VP3 A;  4E6W A;  1DJB A;  1G68 A;  3PAG A;  3HLG A;  4JBF A;  2H0T A;  5TFQ A;  3P98 A;  2Z2M B;  1KGF A;  2WGI A;  1XP4 A;  4EBP A;  1O07 A;  2JBF A;  5CHM A;  4BJP A;  3N4I A;  3SS5 A;  4LCM A;  4O7D A;  3Q07 A;  2X01 A;  4WMC D;  1OME A;  5E43 A;  5FAT A;  1C3B A;  5EPH A;  1TDL A;  3MZE A;  5FQ9 A;  3IWI A;  5DTS A;  3G4P A;  4PM6 A;  3BLS A;  3D4F A;  4KZ9 A;  3TG9 A;  1K54 C;  3IXD A;  2J7V A;  2PU2 A;  3FKV A;  5FAP A;  2ZM8 A;  1MY8 A;  1ERO A;  3W4Q A;  3MXR A;  2Y2O A;  1QMF A;  4Y0U A;  4RX2 A;  1PW1 A;  3WS1 A;  3VP0 A;  1IYP A;  4CPK A;  1L0G A;  2OLV A;  3IF6 C;  3LEZ A;  1H8Y A;  1VM1 A;  2B5R A;  2Z2L B;  1ZC2 A;  4OPZ A;  3MKE A;  3RXX A;  4EBN A;  1K25 A;  2ZQ9 A;  1ALQ A;  4LV2 A;  2GDN A;  3G2Y A;  3LO7 A;  4GDN A;  4R4R A;  3SH8 A;  3QNB A;  4JKT A;  2ZC3 B;  3NDG A;  2WGV A;  4X68 A;  3IF6 A;  3Q7V A;  3B3X A;  3VOZ A;  2EFU A;  5DVA A;  1W8Q A;  3ZCZ A;  1ES5 A;  4P85 A;  4QB8 A;  3WS4 A;  1BT5 A;  1PYY A;  1TDG A;  4Q8I A;  2ZJ9 A;  2XH9 A;  2C6W B;  5F83 A;  3LY4 A;  5TGF A;  2ZQ8 A;  1XKZ A;  3Q81 A;  1XGJ A;  4OVD A;  3C5A A;  1MKI A;  4K0X A;  1PWG A;  1PWC A;  1SDE A;  1XA7 A;  4KQQ A;  2P9V A;  4S2N C;  1YQS A;  4BL2 A;  3NDE A;  3UPP A;  1BLS A;  2X02 A;  1YMS A;  2JC7 A;  1CI8 A;  3VFH A;  1XA1 A;  5CRF A;  1GHI A;  4Z9Q A;  3W4O A;  1K4F A;  1IYS A;  3QHY A;  3GSG A;  4QD4 A;  2A3U A;  2QPN A;  4Y7P A;  3IF6 B;  4KEN B;  4IBX A;  4KZ6 A;  4UHU A;  4S2N A;  5M1A A;  4OLG A;  4WM9 A;  4GD8 A;  1EWZ A;  3OCL A;  3BFD A;  1S0W A;  4PM9 A;  5GHZ A;  3PBS A;  5A91 A;  3UO9 A;  2XD1 A;  3N7W A;  3QNC A;  2RCX A;  1H8Z A;  3FKW A;  4B4X A;  1N9B A;  1GHM A;  5GLB A;  2P9V B;  4S2J A;  2G2W A;  3N6I A;  1PZP A;  3Q82 A;  1L0E A;  1W8Y A;  3ITB A;  1GA0 A;  3O86 A;  4ID4 A;  2HDU A;  2VGJ A;  2ZMA A;  4IVK A;  4WEK A;  5GHY A;  2WUQ A;  4EBL A;  3UDX A;  1MWS A;  4S2K A;  3IQA A;  4X56 A;  3PBQ A;  1XX2 A;  3MKF A;  2V20 A;  3OPH A;  4L0L A;  4QY5 A;  3FWL A;  3G32 A;  4DKI A;  3HLE A;  1BLP A;  5I94 A;  1JVJ A;  5KZH A;  2CC1 A;  1QME A;  2Y4A A;  3CJM A;  4S2O A;  4RX3 A;  5HAR A;  4B88 A;  3HUM A;  4X55 A;  5GLC A;  3OC2 A;  1LHY A;  1M6K A;  3MFD A;  1L0D A;  4GZB A;  1RGZ A;  1NZU A;  1VQQ A;  2R9W A;  4OOL A;  5A90 A;  1ES2 A;  4KZ4 A;  4IED A;  4ZTK A;  3EQV A;  3HVF A;  2OLU A;  3SOI A;  2BG1 A;  4GB7 A;  2XFS A;  4OQH A;  4U0X A;  5F1G A;  1CEG A;  1FCN A;  1KDS A;  2Y2L A;  4NET A;  5HX9 A;  1YLZ A;  1MWT A;  5E2F A;  3TOI A;  1PW8 A;  1EI5 A;  1WYB A;  1HD8 A;  2WKH A;  4R3B A;  3VSK A;  1YT4 A;  2DCF A;  2Y2M A;  3BRM A;  3MXS A;  2ZQD A;  1WYC A;  5KSC A;  1RGY A;  3BYD A;  3S4X A;  1Q2Q A;  4KZ8 A;  5A92 A;  5CEC A;  2EX6 A;  4R3J A;  2X71 A;  3HUN A;  1FOF A;  4N92 A;  1I2S A;  1YLW A;  1K4E A;  4OKP A;  4JPM A;  1FCO A;  4PM5 A;  3PAE A;  4DXB A;  4BQM A;  3EQU A;  4LCL A;  4KG5 A;  4DRT A;  2HP5 A;  4DE2 A;  2OV5 A;  5CGW A;  4P87 A;  3IWO A;  1BZA A;  1IEM A;  4KZ3 A;  5F82 A;  5EVL A;  2WGW A;  3OZH A;  2EX2 A;  3P09 A;  3RXW A;  3ITA A;  5GHX A;  2XQZ A;  4WEJ A;  1L0F A;  2HDS A;  2HPB A;  4H8R A;  3VP1 A;  2HDR A;  3OCN A;  2Y55 A;  1K54 A;  3HBR A;  3MZD A;  5FAQ A;  2QMI A;  1S6R A;  5J8X A;  1JWP A;  3GVB A;  1K6R A;  1Z6F A;  4K91 A;  1K56 D;  1G6A A;  1NZO A;  2ZC4 B;  3VP4 A;  2Y2N A;  5JYP A;  1LI0 A;  2Y2K A;  4KZ7 A;  1TEM A;  3LCE A;  4LV0 A;  3AGD A;  3VFF A;  4BD1 A;  5HL1 A;  1JWV A;  1IYO A;  5EE8 A;  4OPR A;  1FCM A;  5EOO A;  1SHV A;  3GMW A;  2FFY A;  1BSG A;  5FI2 A;  1FSY A;  2WGW B;  1YLJ A;  3VMA A;  2XLN A;  1LL9 A;  4ZDX A;  1PWD A;  2HP9 A;  2Y2Q A;  2EFX A;  2P74 A;  4BLM A;  4WYY A;  4OQI A;  2HP6 A;  3W4P A;  5U47 A;  1HTZ A;  1IYQ A;  4OLD A;  3UE0 A;  4OQG A;  1N4O A;  1JWZ A;  4MNR A;  1IKI A;  4P6B A;  5CGS A;  4U3T A;  3S22 A;  2ZD8 A;  3ZVT A;  2H0Y A;  4UA9 A;  4A5R A;  1XXM A;  1FR1 A;  2XR0 A;  4PM7 A;  1Q2P A;  1BLH A;  1KE0 A;  1RCJ A;  5CHU A;  1ESU A;  3NC8 A;  3WWX A;  3ZDJ A;  4KZA A;  3GQZ A;  3N8S A;  2XF3 A;  4KQO A;  4ZAM A;  3AGE A;  3JYI A;  3SS3 A;  1MXO A;  3A3F A;  2QZ6 A;  3CG5 A;  2BLS A;  3OPR A;  2I72 A;  3O3V A;  3NCK A;  5EOE A;  3VOY A;  3IF5 A;  3PBN A;  3NBL A;  1IKG A;  1CK3 A;  4QU3 A;  2JE5 A;  5AQ9 A;  4JXG A;  5KSH A;  3WRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...