3P01A

Crystal structure of two-component response regulator from nostoc sp. pcc 7120
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
178
structure length
178
Chain Sequence
QRAAETYDLLKQRTEELRRANAQMSLLTVLVQVTQASNSLEAILTPIATAFAESFAVNACILQMLEGQTLSTIQGFYSQQGTVNNWLNQDPLTNEAIATGQIQVAANIAKDPKLASISQYQDNGIQSHVVIPITYRNEMLGVLSLQWQQPISLREDELTLIHLSAQLVAIALTSSRCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of two-component response regulator from Nostoc sp. PCC 7120
rcsb
source organism Nostoc sp.
molecule tags Signaling protein
molecule keywords Two-component response regulator
total genus 51
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.340 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p01A02
3P01A
chains in the Genus database with same CATH superfamily
3B33A 4HJ4A 3VP0A 5L07A 4YFMA 1OJ5A 3RFBA 1K57C 4ESPA 4JPMA 3C30A 2XA7S 4LLOB 3S7OA 1E25A 3SS5A 4PM9A 5AQ9A 4OP5A 3T4SA 4N9LA 4LFUA 3HREA 3C8CA 3BY8A 3ZYTA 1EROA 3GMWA 3VP2A 4ZJ1A 3MJQA 4EESA 4BBTA 3QP2A 4EWFA 1KE3A 3H9WA 4R23A 2ZMFA 5EVIC 2FFYA 3EQUA 3N6IA 1YLWA 2ZD8A 3PAGA 4N1XA 2Y2GA 1ESUA 5HZHA 1DP8A 4K0XA 2XF3A 5FASA 3TW8A 4CJNA 3UB9A 5CEDA 5MC7A 3UMEA 3BECA 1WYBA 3PBSA 5AQ7A 2FH5A 2GX5A 1T19A 3EGXC 2P74A 4Z1WA 4O0PA 3S7NA 1YLZA 4CLCE 3PYPA 5FA7A 5DTSA 2Y55A 2ZM0A 4N1HA 4OPZA 4EU0A 4JF5A 4I3AA 1G5UA 1ZTUA 2W3HA 3JPUA 4WL9A 2E8IA 4A5RA 5F82A 4BENA 3G2ZA 2ZMVA 3N7WA 3NHQA 1G6AA 3T4JA 4JKTA 4WUJA 3N8LA 4WZ5A 2IWBA 3VP4A 1S0WA 3A3EA 2V20A 3E4PA 4GLQA 2C6WB 4XUZA 5HWWA 4EBNA 1S67L 4RX2A 2W3GA 5FQQA 3IF6A 3A3DA 1PYYA 3T1RA 3IXBA 2VGLM 1BSGA 4G3WA 5F83A 3FPVA 2ZC5B 5M19A 5FEFA 1ES3A 2Z6DA 1BULA 5FAOA 3U2AA 2WKEA 3ICYA 2IA2A 4KG6A 1KE4A 4MBKA 2NUTC 4IBRA 3B3XA 4CLCA 4EEPA 2OSUA 2WUQA 4RYEA 4JBFA 4F94A 2EX8A 4E04A 2UWXA 3OC2A 4WN5A 1CI9A 2Y2IA 4Y7PA 2IWCA 3MQOA 2WKHA 4DMZA 5HD5A 4QB8A 3CHWP 3M6BA 4PAUA 1W8QA 1OT9A 1O07A 2EXBA 2PAVP 1CQAA 4M4XA 1FCMA 3FKWA 2JKGA 3E4OA 4KUKA 3ZVWA 4HJ6A 2WGWA 1PW1A 5M18A 2VZWA 3Q81A 5IU1A 3V3RA 2Y2PA 3OZHA 1VB6A 1M6KA 1NRJA 1TF1A 3T1SA 5CTNA 2WGWB 1NJ4A 4QU3A 1KGEA 3BFDA 4WELA 1JTDA 1UGUA 3VSLA 3G4PA 4DF6A 2DMWA 3QP1A 1XFNA 3HUMA 4I3JA 3D3OA 1EW0A 4OQHA 4NXGA 1FILA 1L0FA 1J9MA 1I2SA 3KSFA 4LRZE 2ZC6B 3S22A 4C6YA 2EFXA 3CPTA 4UA6A 4WEKA 4XT2B 1HVBA 4FCFA 1RCJA 3MFDA 1LI0A 4UAAA 4KZ6A 5L2FA 3S7PA 2INWA 2DRWA 2M7UA 3SS4A 2D01A 1K4EA 3N8RA 5G4ZA 3NDGA 1ZG6A 5GLCA 3PBRA 3ZG5A 2PD8A 3PBTA 3PXPA 5EM0A 1KOUA 1STZA 1HD8A 4I39A 3TE8A 1OTIA 2PHYA 3FG8A 2O9AA 1FCOA 2W3FA 4FTXA 3N8SA 4LCMA 4DDYA 3V67A 1JVJA 2KX6A 5FI6A 4RA7A 3F1PA 3W4PA 2O0YA 4N92A 1YT4A 3A0RA 4WYYA 3FV7A 3KX0X 3IX4A 3OCNA 5CHJA 1DP6A 1S4SA 2L0WA 2Z2LB 3T4OA 4NK3A 3RTYA 5KSCA 3DTEA 3NOUC 1Y28A 3L9KA 5CEBA 4GZBA 4DRTA 3BFGA 1TDLA 2KOIA 3RXXA 2Y2MA 3P09A 4HNBA 1ZG4A 4UQIS 3UE0A 1KGFA 5HAIA 3ZQ5A 2EFUA 3BWLA 2JKFA 2ZM8A 1O7EA 4I3IA 1VETA 3WS4A 4BBVA 1YSPA 4OQIA 3A0VA 2VX8A 5EECA 3VOLA 1L0DA 3UE1A 1SKOB 2ZQDA 5A90A 3IHBA 1TD5A 2LB5A 5HW3A 4LRXC 5F69A 4JXVA 3JVUA 1IYQA 3LY4A 4MNRA 2V0UA 4QY5A 3W2ZA 3IS2B 3LIAA 3ZG7B 2VJWA 2UV0E 3WS0A 3CUEC 5FQJA 4KZBA 5HDCA 1NYYA 5EE8A 3CWFA 2QYBA 5KIZA 3SS3A 4E3LA 2OLUA 5DFYA 3GR2A 4OP8A 4K08A 1DJCA 2H0YA 3MQ0A 3R7WA 4MN7A 1BLHA 1Z09A 3VSKA 1W5DA 1H3QA 4EXOA 2PYRA 2WZXA 5C5KA 4S2LA 1PW8A 3BQ8A 1I5QA 1FOFA 2X01A 5HARA 4E3MA 4EETB 1NLZA 2HP5A 2Y2JA 1JWPA 4L9FA 2PT7A 3GV9A 5AVFA 1PWDA 3H7WA 3RH8B 2VEAA 3IWQA 5FEGA 5FSRA 2XSSA 4UA9A 4DJ2A 4QWOA 4MCWA 4PKYG 4WZ5C 4N9KA 4C3QA 3PR6A 2QKPA 3BEBA 4DDSA 3G30A 1VHMA 3IBRA 3VV4A 1ONGA 1GHIA 4PM7A 1I2WA 2ZQ8A 2V2FF 3SH7A 3OLOA 1LT0A 1E4DA 3HJIA 3G2YA 4GB7A 4EQ1A 2P9VB 1MY8A 1ES2A 3O3VA 2VA0A 2XA7M 3UDXA 1K54A 1S4RA 4B88A 4MEZA 2XD5A 4BL3A 1BZAA 2A24B 2W27A 4GS9B 4S2JA 3ZGAB 4O01A 1IKGA 4I5SA 3OCLA 4MLLA 4E3OA 5HFOA 2DCFA 2A2LA 3BFFA 5EV0A 5KZHA 1D1JA 2ZC4B 2BLSA 5F68A 4S2OA 3CZDA 2HDQA 3C7VA 4JXGA 4S2MA 3N4IA 4I38A 4K91A 4BLMA 3DTIA 3GSGA 4X1MA 5HWVA 3BY9A 4F3LB 3UPOA 3HUOA 1W63M 4ARZB 1MBLA 1D06A 3ITAA 3LR5A 4Y3IA 3TSGA 5CHMA 5DJTA 4ARZA 1P0ZA 2QWSA 3Q1FA 5I94A 4HH3A 1HZOA 4OQGA 4JF6A 5CECA 4Y13A 2OAP1 2P7JA 3MZEA 1YLPA 3ULFA 4B4XA 1H0MA 5L10A 4MBFA 2JCHA 4GDBA 1N9BA 4H6JB 4JLFA 3A0SA 1H5XA 2GJ3A 1FR6A 2OWHA 3BQAA 5HDSA 4ME4A 2XDMA 4C75A 1NZUA 4GD8A 3GTCA 3OPRA 3ZFZA 4S2NC 4MDZA 4KZ5A 4QPRA 2PD7A 2Y2KA 3UO9A 4E3NA 3S1YA 2ZOIA 3E98A 1NWZA 5GLAA 4KQOA 4IHQA 2L4RA 4E3KA 3A3IA 1XFQA 2WKIA 3A3FA 4JGRA 3VFHA 3F1OB 4WBGA 1T1AA 1BUEA 4JXWA 2PR6A 4Y0TA 1ODVA 4OOMA 4WM9A 2W3EA 2CC1A 3NC8A 1KE0A 1MXOA 3QNBA 3MSHA 1OPXA 4JGQA 5L8MA 1ES5A 4M3KA 3LCEA 3UDFA 5HAPA 3VMAA 1PNEA 4DE3A 2W1TB 4OLGA 5TBMA 3FPWA 2QPNA 3OPLA 4GJ4A 3HBRA 4HESA 4B93A 3JYIA 2Y2QA 1XA7A 5CERA 1XJ3A 3TJZC 3CITA 1OMEA 2ZQ9A 2A49A 2Y8HA 4XXRA 4PPRA 3CMZA 2G2WA 5FDHA 1SCWA 3CG5A 3OOVA 3FZCA 4K0WA 2V1BA 3ZDJA 1YLJA 4ZJ2A 4HHDA 4OPRA 3NOPC 4X68A 2ACGA 5DJUA 4ZAMA 4D60A 1K0KA 2V9AA 5HL1A 1SDEA 3ZG8B 3IQAA 3HLGA 1OT6A 1QMFA 4PM8A 1TS7A 2JBFA 5IHVA 3A3JA 3P01A 2VGLS 4IVIA 2JKTM 2C5WB 1LL5A 3LIEA 1CEFA 1K25A 4X25A 2VKSA 1OTEA 3QP6A 2PDRA 3CAXA 3O87A 3MZFA 3Q7VA 4R4RA 5E2EA 4X53A 4NXFA 2ZC7A 4Q0HA 1ZKJA 2VGKA 3BJNA 3K2NA 2J7VA 5HPIA 1TS6A 4E6WA 3UB5P 1MWRA 1BLCA 4DE2A 3KO6A 3P7NA 3Q07A 3T4TA 1V9YA 1IYOA 1ERMA 3G34A 3G31A 2J9OA 3GQZA 4Q0JA 3UE3A 2V8CA 2ZMAA 5FATA 3ISGA 2XGNA 1KVLA 3HUNA 3BFCA 5AQBA 4FSFA 1PFLA 4ETXA 1NRFA 3KSGA 4L0LA 1Y54A 5J3WA 2G2UA 5AQAA 3GVBA 3IH8A 4U0XA 2FFFB 4DE1A 2VV8A 4P0MA 1DP9A 4GKUA 1NYMA 2ZQAA 2GZAA 3UDIA 3G6OA 4IBXA 2OAQ1 3RJUA 5HDDA 1JWZA 4R3AA 3DWKA 5CHUA 2QMIA 3LY3A 3T1QB 4S2NA 3VP1A 5JYOA 3MR0A 2J80A 1PI5A 3LR3A 1K54C 1H8MA 2JC7A 4LV3A 1GA0A 2Y2NA 4FUWA 1D7EA 1DY6A 3HCYA 4ID4A 1NXYA 4GD6A 5L09A 5FAPA 2WK0A 3E2LA 5EVEA 4KQQA 1J3WA 2OV5A 3MS6A 3LIBA 2Y4AA 3M6HA 4PHTA 2I9VA 3NI9A 3TOIA 1RP5A 4KZ9A 1Q2PA 1OTDA 4LV0A 3B47A 3MXQA 2WGIA 3UN7A 4XT2A 4HOIA 4GNUA 2V0WA 5FQKA 1DJAA 5EFWA 1KVMA 4DXCA 3E2KA 4KQRA 4NKPA 3T4QA 3CI6A 3L7HA 1G28A 3IF6C 4OH0A 5KMWA 4R3BA 3M2KA 1XKZA 3ZG0A 3QP5A 4NG2A 3PAEA 4ZJ3A 1TVFA 5IT5A 1ONHA 4KZ4A 4UEYA 4IUKA 3Q82A 1LSXA 2P04A 4PM6A 4OPQA 1XX2A 3MQQA 2YKHA 2E8JA 3W8KA 3UB7A 1FQGA 2R9WA 3H82A 4BWIA 3C4PA 2ZJ9A 3W4QA 3V39A 3BYDA 2HGVA 3MF0A 2VLGA 5CGXA 5EOEA 4FOFA 1YLYA 4WMCD 2HV1A 1FSWA 4EW7A 4UHUA 4UQIM 1BLPA 1P97A 1K55A 3IHAA 4HP4A 1ALQA 5HWTA 2K2NA 2ZC3B 4U3TA 3LO7A 4R70A 3NOTC 2XQZA 3WRZA 4HIAA 1XA1A 3KYQA 4PKYA 2D02A 3T1XA 3NIAA 2PR5A 3HLCA 1VETB 1V9ZA 5G18A 5DVAA 4PM5A 2R9XA 2WKPA 3VFFA 5F1GA 3LEQA 5EPHA 4E3IA 2B02A 4P87A 4B4ZA 5J4EA 5F1FA 1LL9A 5J8XA 3KYZA 5EVLA 3O5YA 1LSVA 3I7JA 2LB9A 4HBTA 2JN7A 2VK3A 4CQHA 1HTZA 5GHZA 5DKKA 1YPRA 5CTMA 5FL3A 5HX9A 1CJFA 1H8YA 5TJJA 5EUAA 2B18A 4ZTKA 5FDSA 2FZ0A 4WZ4A 4MBHA 2B5RA 5DF9A 2J8YA 1MWUA 1CK3A 3E4QA 4R0QA 4P6BA 3C4OA 2HZ5A 2WKRA 3UY6A 4NXBA 1DRMA 5GLDA 5JYPA 4HJ3A 5A92A 5K5BA 5HAQA 1E3UD 3SZTA 4BL2A 2PYPA 4OONA 3LR4A 3Q7ZA 1IKIA 5F5YA 1NLYA 2CMNA 3K3DA 3IF6B 2WGVA 3ZHHA 4YNRA 1GHPA 4ETZA 2H0TA 3H82B 1KDSA 3ZNYA 2JE5A 3H7WB 2Q0OA 3O86A 5D3OA 4GHIB 4BQMA 1S1YA 2EWWA 2O9BA 4R3JA 3HLWA 5EVIA 2ZQCA 3WRTA 1S1ZA 3R4KA 4NXEA 3SH8A 3K3CA 4IVKA 4Y5FA 5DF8A 1PRQA 5CGWA 3IWOA 5EVIB 3UPNA 2MJ6A 1IELA 1CF0A 4IUHA 1LSWA 1FR1A 2PBYA 4HQAA 1F9IA 4GOGA 4IEDA 3MFXA 4II7A 4EV4A 1GSWA 1LHYA 1IOUA 5FQMA 3S4XA 2XD1A 5AJGA 1K55C 1X0OA 4GW9A 1YM1A 1LL8A 2Y2HA 3WS1A 1ERQA 3CLOA 3DAVA 4XUXA 3EQVA 4L9GA 1N4OA 1VM1A 2XFSA 4OVDA 2M1CA 4EUVA 2GDNA 5EOOA 3ZVTA 4KENB 5FI2A 2EX9A 2QHKA 4MN5A 3EEHA 4WLAA 4YOFA 3TG9A 3SW1A 4Y0UA 1K4FA 3ZCZA 1SKOA 4X69A 2EXAA 1IYSA 1F5MA 3CJMA 4OQ0A 5DF7A 4Q8IA 1YMSA 5DTKA 1A0KA 2HDSA 3HLBA 1QMEA 2J3WA 4F3LA 4HP9A 4OOLA 3IS2A 2NUPC 1PWGA 2Q9MA 1MWTA 4EERA 3BM6A 2K7SA 3IH9A 2G7UA 1L3LA 3UB8A 2OLVA 3OPHA 1MPLA 5AVEA 2WAEA 2XROA 3NDEA 1GA9A 1XJ4A 3IT9A 4R38A 2EX6A 5HPFA 1YSQA 2HF6A 2BG1A 5CRFA 2Y79A 1GCEA 1XXMA 1Z6FA 3F1PB 2JKRM 1ESIA 2KDKA 4JGPA 2ZLYA 1F98A 4UA7A 1GSVA 2GNXA 5GHXA 3KYEA 1Y4OA 3HL9A 2L1MA 3CUEA 4KQDA 2I72A 1P9RA 3LIFA 4CLCC 1T1CA 4AFIA 1XP4A 3PBQA 4G3VA 4GHIA 5I5LA 2Y2OA 4WF0A 3MZDA 5HSQA 4S2PA 3ITBA 1JNUA 3AGDA 3DTKA 4CLCB 2Z2MB 4ZDXA 3HVFA 1K56D 4FH4A 3BLMA 3UNWA 4HY8A 4G3KA 3GDIA 2HDUA 3S7QA 4S2KA 3T12B 1K57A 1JWVA 1LI9A 3C5AA 3LGOA 3DTMA 1OTAA 1Q2QA 4OLDA 4HEFA 4KZ8A 1YKDA 4IJGA 2P9VA 3VOZA 4D2OA 3QP8A 2W3DA 3OPPA 1U60A 5TBMB 3NULA 5CX7A 1K38A 1BT5A 2HJEA 2W1RA 5A8BA 3OBFA 4S2IA 2A24A 1LLBA 4GS9A 1EWZA 1CEGA 1YQSA 4HI4A 3G32A 3EGDC 3EEAA 5DTTA 3C7UA 1PWCA 4QHCA 4WMCA 3LR0A 1XJ2A 1MKIA 4KZAA 1E3UA 2EA9A 5M1AA 3NECA 4P6ZM 2EX2A 4Y15A 3CPTB 3NJAA 3VE4A 1NY0A 4JXSA 2WADA 3IWIA 4DN0A 2QZ6A 3HLEA 2DNSA 1RGZA 5F6AA 1N9OA 1M40A 3D72A 3M2JA 3MBZA 3ZG9B 3PTEA 3FKVA 2Q9NA 4CLCD 1IYPA 5FQIA 5EVID 2PBDP 1VEUB 1L0GA 1S6RA 1VQQA 2Y91A 4LV2A 3F1NA 1S66L 3DWZA 3P98A 1FSYA 4BD1A 2JHEA 3UMDA 3MKFA 5BOHA 3HLFA 3SH9A 3LI9A 1HLUP 3F1NB 4QD4A 4KZ7A 5HL6A 3V50A 1IFQA 2VGJA 2H5SA 3VE3A 3FWLA 1PZPA 4DJ3A 1K6RA 2OOLA 1XJ6A 4MMNA 2ZQ7A 1C3BA 3LEZA 5J7EA 2HP6A 1DJBA 4LGWA 1BLSA 3RXWA 1WYCA 4OOYA 3G35A 4R1GA 1CI8A 3BRMA 5E43A 1KDWA 2Z6CA 4LPZA 3B42A 1KGGA 5TFQA 4EBLA 4RQ9A 3F1OA 4MN6A 5CXWA 1FCNA 3IXDA 1L2SA 3MMHA 4EQIA 3PBNA 1F2KA 3IBJA 2V1AA 2RCXA 4KZ3A 3IXHA 4YWZA 5GHYA 1AWIA 2BASA 4RX3A 4YINA 3LICA 4GN2A 3O88A 2XRNA 1N9NA 2ZM2A 3T50A 3V5MA 1TS0A 5A91A 5A93A 1BTLA 4EUZA 1G68A 3E0YA 2W1TA 2M7VA 4RVAA 4QJGA 1OJGA 2VV7A 5LBRA 2W0NA 3LIDA 2H28A 4BBUA 2OWJA 3PHYA 1N9LA 3LYXA 1P9WA 5DFXA 2K31A 1WE4A 2WZZA 3HJKA 3JVVA 2WYXA 2ZL1B 2X71A 3WWXA 3BW6A 4BMWA 3WS2A 1AXBA 2O99A 1T18A 4BD0A 1XGIA 3DBAA 2ZL1A 3D9YA 1L0EA 4PMAA 5IS1A 1GSXA 1ES4A 2HDRA 4X6TA 4LENA 3AGFA 4EBPA 4FH2A 3LUQA 3EWKA 1GHMA 2IWDA 5FAQA 4E6XA 4HBUA 2XEPA 1VEUA 1W79A 4KG2A 5FI7A 2RL3A 3R7WB 4LV1A 4O8GA 5EM1A 2A3UA 2VV6A 2YKFA 4NETA 3FC7A 3GRJA 3DW0A 4H6JA 2J3TD 1K56A 2H10A 4B9OA 2QJ7A 1XGJA 1TDGA 1PI4A 2B95A 1ZC2A 1MC0A 5DKLA 4EEUA 3MKEA 1IEMA 3WS5A 1TS8A 2Y59A 3NCKA 4U0TA 3EOIA 1EI5A 3Q7VB 3T4LA 1H8ZA 4NEED 3KSIA 1SHVA 3ZNTA 2JKRI 3MXSA 3NBLA 4DKIA 2WKQA 1TEMA 2J9PA 1UWPX 2O9CA 4P6ZS 4DE0A 5G4YA 4BJPA 4JF4A 4P85A 2BTFP 2J3TC 3SOIA 3QHYA 3BLSA 3VOYA 1G6OA 4Y0OA 4HH2A 1BYWA 4GDNA 1MWSA 2AVXA 2JKTI 3PBOA 2ZOHA 4KG5A 3NY4A 5TR7A 3UE6A 3TRCA 1FIKA 4L9EA 2WAFA 4Z9QA 3C38A 3GECA 3IX3A 3MXRA 3UPPA 2HJ9C 1SDNA 1WA9A 2Y2LA 3C2WA 1ZHHB 4LCLA 3IX8A 4ZRRA 3UB6A 4R4SA 1SZVA 2QJ5A 4Q0IA 3LFVA 4X55A 3QP4A 2XK1A 2HP9A 2V8FA 1ACFA 5TGFA 2PU2A 4KUOA 2R78A 4CPKA 4Y17A 4QY6A 5GL9A 3V3SA 1XPBA 4OKPA 3KSHA 1PIOA 3QNCA 4E3JA 5E2FA 3W4OA 3IXGA 4GCZA 4JGOA 1UWNX 1MZUA 1JTGA 4WEJA 4DXBA 2P08A 2PRFA 1W8YA 3IF5A 5E2GA 2ZBBA 4X56A 1YLTA 3D4FA 4FD8A 3U4LP 1YAXA 1W63Q 4OPYA 1RGYA 4H8RA 2V1ZA 3HLDA 1NZOA 4LRYC 3T4KA 2KLIA 1K6SA 5U47A 1W7FA 5CGSA 3LI8A 5GLBA 2XH9A 2EWVA 1PZOA 2X02A 5KSHA 1MKMA 3AGEA 5HD3A 5E2HA 1T1BA 2HPBA 4Y2FA 3FYZA 3VP3A 2PU4A 4ZBEA 5FQ9A 2XFTA 1SKFA 2XR0A 4R6LA 1YMXA 4O7DA 4X1LA 2XLNA 1OTBA 3BFEA
chains in the Genus database with same CATH topology
3B33A 5DFYA 4HJ4A 1OTAA 4K08A 3MQ0A 3R7WA 1OJ5A 3RFBA 1YKDA 4IJGA 3LIBA 4MN7A 1H3QA 4EXOA 2PYRA 2W3DA 4PHTA 3C30A 2XA7S 5TBMB 4LLOB 5CX7A 2I9VA 3S7OA 5C5KA 2HJEA 2W1RA 3BQ8A 5A8BA 3OBFA 3T4SA 1OTDA 2A24A 4GS9A 3B47A 3MXQA 4EETB 4HI4A 1NLZA 4XT2A 3C8CA 3BY8A 3EGDC 3EEAA 4HOIA 2V0WA 4L9FA 2PT7A 3ZYTA 3LR0A 5EFWA 5AVFA 1XJ2A 3H7WA 3RH8B 2VEAA 3MJQA 4NKPA 3T4QA 3CI6A 2XSSA 1G28A 4EESA 2EA9A 4BBTA 4DJ2A 4MCWA 3H9WA 4P6ZM 4PKYG 2ZMFA 3PR6A 3NJAA 5IT5A 3VE4A 2QKPA 3EQUA 1VHMA 3IBRA 3VV4A 4DN0A 4UEYA 4IUKA 5HZHA 1DP8A 3OLOA 1LSXA 5F6AA 1LT0A 2P04A 1N9OA 3HJIA 3D72A 3TW8A 4EQ1A 3UB9A 3MQQA 4CLCD 2YKHA 2VA0A 5MC7A 3UMEA 3UB7A 2XA7M 1S4RA 3H82A 4BWIA 3F1NA 1S66L 2A24B 2W27A 4GS9B 3PBSA 2FH5A 2GX5A 1T19A 3EGXC 4O01A 2JHEA 3UMDA 2HGVA 3LI9A 2VLGA 3MF0A 4I5SA 3F1NB 3OCLA 4FOFA 5HL6A 1IFQA 2HV1A 4Z1WA 4O0PA 2A2LA 3S7NA 4EW7A 3VE3A 4UQIM 4DJ3A 5F68A 4CLCE 1P97A 2OOLA 3PYPA 1XJ6A 4MMNA 4EU0A 4I38A 5J7EA 4HP4A 4I3AA 1ZTUA 2W3HA 2K2NA 5HWTA 4WL9A 5HWVA 3BY9A 4F3LB 4R70A 3NOTC 2ZMVA 1W63M 4HIAA 3NHQA 3KYQA 4ARZB 4PKYA 1D06A 2Z6CA 2D02A 3T4JA 4LPZA 3B42A 4WUJA 3LR5A 4Y3IA 2PR5A 4RQ9A 3F1OA 1V9ZA 4MN6A 5DJTA 3E4PA 4ARZA 1P0ZA 2QWSA 2WKPA 4GLQA 3MMHA 2B02A 3PBNA 3IBJA 4HH3A 2V1AA 5HWWA 5J4EA 3KYZA 1S67L 2W3GA 3O5YA 4YWZA 1LSVA 2BASA 2OAP1 2VGLM 4G3WA 2P7JA 3LICA 3FPVA 3ULFA 2LB9A 2JN7A 2Z6DA 2XRNA 3U2AA 1N9NA 3ICYA 2IA2A 3T50A 4CQHA 1TS0A 4H6JB 3A0SA 5DKKA 3E0YA 2GJ3A 2W1TA 2NUTC 2OWHA 3BQAA 5HDSA 2M7VA 4ME4A 4CLCA 4EEPA 5FL3A 1OJGA 2VV7A 5LBRA 2W0NA 3LIDA 2H28A 4E04A 4BBUA 2OWJA 3PHYA 1N9LA 3LYXA 1P9WA 3OC2A 4WN5A 5DFXA 4MDZA 2K31A 3MQOA 4QPRA 2B18A 5TJJA 2PD7A 2FZ0A 4DMZA 5HD5A 5DF9A 4PAUA 3HJKA 3JVVA 2ZOIA 1OT9A 3E98A 1NWZA 3BW6A 4KQOA 4IHQA 3E4QA 4BMWA 2O99A 1T18A 2L4RA 4M4XA 1XFQA 2WKRA 4NXBA 1DRMA 4JGRA 3DBAA 4HJ3A 3F1OB 1T1AA 3E4OA 5K5BA 5IS1A 4KUKA 1GSXA 4HJ6A 2PR6A 2PYPA 1ODVA 4OOMA 2VZWA 3LR4A 2W3EA 5IU1A 3LUQA 5F5YA 3EWKA 1NLYA 2CMNA 3K3DA 1VB6A 1NRJA 1TF1A 4YNRA 1OPXA 4JGQA 5L8MA 4ETZA 4WELA 3R7WB 4O8GA 1UGUA 3H82B 2VV6A 2YKFA 2DMWA 3FC7A 3H7WB 1XFNA 2J3TD 4H6JA 4I3JA 4B9OA 3D3OA 2QJ7A 2W1TB 5TBMA 4GHIB 3FPWA 1EW0A 1S1YA 2EWWA 2O9BA 4NXGA 1MC0A 4GJ4A 5DKLA 4EEUA 4B93A 3KSFA 1TS8A 4LRZE 1S1ZA 3EOIA 3R4KA 4NXEA 3K3CA 4Y5FA 4WEKA 4XT2B 3T4LA 4NEED 3KSIA 2MJ6A 1XJ3A 2JKRI 3TJZC 4IUHA 1LSWA 2WKQA 3CITA 3S7PA 2Y8HA 4HQAA 1F9IA 2INWA 1UWPX 2O9CA 3MFXA 4II7A 4P6ZS 5G4YA 1GSWA 1IOUA 2M7UA 4BJPA 2D01A 3OOVA 5AJGA 5G4ZA 1X0OA 2J3TC 4GW9A 2V1BA 1LL8A 3PBRA 2PD8A 3PBTA 3PXPA 1KOUA 1STZA 4I39A 3TE8A 4HHDA 1G6OA 4HH2A 1BYWA 1OTIA 2PHYA 3FG8A 3NOPC 2O9AA 3CLOA 2JKTI 3PBOA 5DJUA 2ZOHA 3EQVA 2V9AA 2W3FA 4L9GA 3UE6A 3TRCA 3V67A 2KX6A 1OT6A 2M1CA 4EUVA 1TS7A 3P01A 4L9EA 2VGLS 3C38A 3GECA 2JKTM 3F1PA 2O0YA 2QHKA 2HJ9C 4MN5A 1WA9A 3C2WA 3EEHA 1ZHHB 3A0RA 4WLAA 4YOFA 3LIEA 3SW1A 3KX0X 2VKSA 3OCNA 4ZRRA 1DP6A 3UB6A 1S4SA 1OTEA 1F5MA 2QJ5A 2PDRA 2L0WA 4Q0IA 3CAXA 3T4OA 3LFVA 2J3WA 4NXFA 4F3LA 3RTYA 4HP9A 4OOLA 4Q0HA 3BJNA 3K2NA 4KUOA 3NOUC 1Y28A 3IS2A 2NUPC 2R78A 5HPIA 1TS6A 4EERA 2KOIA 3KSHA 2K7SA 3KO6A 2G7UA 3P7NA 4GCZA 3T4TA 1V9YA 4HNBA 4JGOA 3UB8A 4UQIS 1UWNX 1MZUA 4Q0JA 5AVEA 3UE3A 3ZQ5A 4WEJA 2XROA 3BWLA 2P08A 1XJ4A 4R38A 2ZBBA 5HPFA 1YSQA 4FSFA 2HF6A 4ETXA 2Y79A 3KSGA 1YAXA 4L0LA 1W63Q 4I3IA 5J3WA 4BBVA 3F1PB 4LRYC 2JKRM 3T4KA 1YSPA 2KLIA 3A0VA 2KDKA 2VX8A 4JGPA 3VOLA 1F98A 2VV8A 1GSVA 2GNXA 1DP9A 2L1MA 3CUEA 2GZAA 4KQDA 1TD5A 1P9RA 3LIFA 4CLCC 3LI8A 1T1CA 2EWVA 2LB5A 4G3VA 3PBQA 5I5LA 4GHIA 4AFIA 3G6OA 4LRXC 5KSHA 5F69A 2OAQ1 1MKMA 5HD3A 5HDDA 4WF0A 4R3AA 1T1BA 3JVUA 2V0UA 5HSQA 4Y2FA 3W2ZA 3IS2B 3LIAA 2VJWA 1JNUA 4CLCB 3MR0A 3CUEC 2J80A 5HDCA 3LR3A 1H8MA 4HY8A 4G3KA 3GDIA 3CWFA 2QYBA 4R6LA 3S7QA 5KIZA 1D7EA 1OTBA 3HCYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P01 A; 
#chains in the Genus database with same CATH topology
 3B33 A;  4HJ4 A;  3VP0 A;  5L07 A;  4YFM A;  1OJ5 A;  3RFB A;  1K57 C;  4ESP A;  4JPM A;  3C30 A;  2XA7 S;  4LLO B;  3S7O A;  1E25 A;  3SS5 A;  4PM9 A;  5AQ9 A;  4OP5 A;  3T4S A;  4N9L A;  4LFU A;  3HRE A;  3C8C A;  3BY8 A;  3ZYT A;  1ERO A;  3GMW A;  3VP2 A;  4ZJ1 A;  3MJQ A;  4EES A;  4BBT A;  3QP2 A;  4EWF A;  1KE3 A;  3H9W A;  4R23 A;  2ZMF A;  5EVI C;  2FFY A;  3EQU A;  3N6I A;  1YLW A;  2ZD8 A;  3PAG A;  4N1X A;  2Y2G A;  1ESU A;  5HZH A;  1DP8 A;  4K0X A;  2XF3 A;  5FAS A;  3TW8 A;  4CJN A;  3UB9 A;  5CED A;  5MC7 A;  3UME A;  3BEC A;  1WYB A;  3PBS A;  5AQ7 A;  2FH5 A;  2GX5 A;  1T19 A;  3EGX C;  2P74 A;  4Z1W A;  4O0P A;  3S7N A;  1YLZ A;  4CLC E;  3PYP A;  5FA7 A;  5DTS A;  2Y55 A;  2ZM0 A;  4N1H A;  4OPZ A;  4EU0 A;  4JF5 A;  4I3A A;  1G5U A;  1ZTU A;  2W3H A;  3JPU A;  4WL9 A;  2E8I A;  4A5R A;  5F82 A;  4BEN A;  3G2Z A;  2ZMV A;  3N7W A;  3NHQ A;  1G6A A;  3T4J A;  4JKT A;  4WUJ A;  3N8L A;  4WZ5 A;  2IWB A;  3VP4 A;  1S0W A;  3A3E A;  2V20 A;  3E4P A;  4GLQ A;  2C6W B;  4XUZ A;  5HWW A;  4EBN A;  1S67 L;  4RX2 A;  2W3G A;  5FQQ A;  3IF6 A;  3A3D A;  1PYY A;  3T1R A;  3IXB A;  2VGL M;  1BSG A;  4G3W A;  5F83 A;  3FPV A;  2ZC5 B;  5M19 A;  5FEF A;  1ES3 A;  2Z6D A;  1BUL A;  5FAO A;  3U2A A;  2WKE A;  3ICY A;  2IA2 A;  4KG6 A;  1KE4 A;  4MBK A;  2NUT C;  4IBR A;  3B3X A;  4CLC A;  4EEP A;  2OSU A;  2WUQ A;  4RYE A;  4JBF A;  4F94 A;  2EX8 A;  4E04 A;  2UWX A;  3OC2 A;  4WN5 A;  1CI9 A;  2Y2I A;  4Y7P A;  2IWC A;  3MQO A;  2WKH A;  4DMZ A;  5HD5 A;  4QB8 A;  3CHW P;  3M6B A;  4PAU A;  1W8Q A;  1OT9 A;  1O07 A;  2EXB A;  2PAV P;  1CQA A;  4M4X A;  1FCM A;  3FKW A;  2JKG A;  3E4O A;  4KUK A;  3ZVW A;  4HJ6 A;  2WGW A;  1PW1 A;  5M18 A;  2VZW A;  3Q81 A;  5IU1 A;  3V3R A;  2Y2P A;  3OZH A;  1VB6 A;  1M6K A;  1NRJ A;  1TF1 A;  3T1S A;  5CTN A;  2WGW B;  1NJ4 A;  4QU3 A;  1KGE A;  3BFD A;  4WEL A;  1JTD A;  1UGU A;  3VSL A;  3G4P A;  4DF6 A;  2DMW A;  3QP1 A;  1XFN A;  3HUM A;  4I3J A;  3D3O A;  1EW0 A;  4OQH A;  4NXG A;  1FIL A;  1L0F A;  1J9M A;  1I2S A;  3KSF A;  4LRZ E;  2ZC6 B;  3S22 A;  4C6Y A;  2EFX A;  3CPT A;  4UA6 A;  4WEK A;  4XT2 B;  1HVB A;  4FCF A;  1RCJ A;  3MFD A;  1LI0 A;  4UAA A;  4KZ6 A;  5L2F A;  3S7P A;  2INW A;  2DRW A;  2M7U A;  3SS4 A;  2D01 A;  1K4E A;  3N8R A;  5G4Z A;  3NDG A;  1ZG6 A;  5GLC A;  3PBR A;  3ZG5 A;  2PD8 A;  3PBT A;  3PXP A;  5EM0 A;  1KOU A;  1STZ A;  1HD8 A;  4I39 A;  3TE8 A;  1OTI A;  2PHY A;  3FG8 A;  2O9A A;  1FCO A;  2W3F A;  4FTX A;  3N8S A;  4LCM A;  4DDY A;  3V67 A;  1JVJ A;  2KX6 A;  5FI6 A;  4RA7 A;  3F1P A;  3W4P A;  2O0Y A;  4N92 A;  1YT4 A;  3A0R A;  4WYY A;  3FV7 A;  3KX0 X;  3IX4 A;  3OCN A;  5CHJ A;  1DP6 A;  1S4S A;  2L0W A;  2Z2L B;  3T4O A;  4NK3 A;  3RTY A;  5KSC A;  3DTE A;  3NOU C;  1Y28 A;  3L9K A;  5CEB A;  4GZB A;  4DRT A;  3BFG A;  1TDL A;  2KOI A;  3RXX A;  2Y2M A;  3P09 A;  4HNB A;  1ZG4 A;  4UQI S;  3UE0 A;  1KGF A;  5HAI A;  3ZQ5 A;  2EFU A;  3BWL A;  2JKF A;  2ZM8 A;  1O7E A;  4I3I A;  1VET A;  3WS4 A;  4BBV A;  1YSP A;  4OQI A;  3A0V A;  2VX8 A;  5EEC A;  3VOL A;  1L0D A;  3UE1 A;  1SKO B;  2ZQD A;  5A90 A;  3IHB A;  1TD5 A;  2LB5 A;  5HW3 A;  4LRX C;  5F69 A;  4JXV A;  3JVU A;  1IYQ A;  3LY4 A;  4MNR A;  2V0U A;  4QY5 A;  3W2Z A;  3IS2 B;  3LIA A;  3ZG7 B;  2VJW A;  2UV0 E;  3WS0 A;  3CUE C;  5FQJ A;  4KZB A;  5HDC A;  1NYY A;  5EE8 A;  3CWF A;  2QYB A;  5KIZ A;  3SS3 A;  4E3L A;  2OLU A;  5DFY A;  3GR2 A;  4OP8 A;  4K08 A;  1DJC A;  2H0Y A;  3MQ0 A;  3R7W A;  4MN7 A;  1BLH A;  1Z09 A;  3VSK A;  1W5D A;  1H3Q A;  4EXO A;  2PYR A;  2WZX A;  5C5K A;  4S2L A;  1PW8 A;  3BQ8 A;  1I5Q A;  1FOF A;  2X01 A;  5HAR A;  4E3M A;  4EET B;  1NLZ A;  2HP5 A;  2Y2J A;  1JWP A;  4L9F A;  2PT7 A;  3GV9 A;  5AVF A;  1PWD A;  3H7W A;  3RH8 B;  2VEA A;  3IWQ A;  5FEG A;  5FSR A;  2XSS A;  4UA9 A;  4DJ2 A;  4QWO A;  4MCW A;  4PKY G;  4WZ5 C;  4N9K A;  4C3Q A;  3PR6 A;  2QKP A;  3BEB A;  4DDS A;  3G30 A;  1VHM A;  3IBR A;  3VV4 A;  1ONG A;  1GHI A;  4PM7 A;  1I2W A;  2ZQ8 A;  2V2F F;  3SH7 A;  3OLO A;  1LT0 A;  1E4D A;  3HJI A;  3G2Y A;  4GB7 A;  4EQ1 A;  2P9V B;  1MY8 A;  1ES2 A;  3O3V A;  2VA0 A;  2XA7 M;  3UDX A;  1K54 A;  1S4R A;  4B88 A;  4MEZ A;  2XD5 A;  4BL3 A;  1BZA A;  2A24 B;  2W27 A;  4GS9 B;  4S2J A;  3ZGA B;  4O01 A;  1IKG A;  4I5S A;  3OCL A;  4MLL A;  4E3O A;  5HFO A;  2DCF A;  2A2L A;  3BFF A;  5EV0 A;  5KZH A;  1D1J A;  2ZC4 B;  2BLS A;  5F68 A;  4S2O A;  3CZD A;  2HDQ A;  3C7V A;  4JXG A;  4S2M A;  3N4I A;  4I38 A;  4K91 A;  4BLM A;  3DTI A;  3GSG A;  4X1M A;  5HWV A;  3BY9 A;  4F3L B;  3UPO A;  3HUO A;  1W63 M;  4ARZ B;  1MBL A;  1D06 A;  3ITA A;  3LR5 A;  4Y3I A;  3TSG A;  5CHM A;  5DJT A;  4ARZ A;  1P0Z A;  2QWS A;  3Q1F A;  5I94 A;  4HH3 A;  1HZO A;  4OQG A;  4JF6 A;  5CEC A;  4Y13 A;  2OAP 1;  2P7J A;  3MZE A;  1YLP A;  3ULF A;  4B4X A;  1H0M A;  5L10 A;  4MBF A;  2JCH A;  4GDB A;  1N9B A;  4H6J B;  4JLF A;  3A0S A;  1H5X A;  2GJ3 A;  1FR6 A;  2OWH A;  3BQA A;  5HDS A;  4ME4 A;  2XDM A;  4C75 A;  1NZU A;  4GD8 A;  3GTC A;  3OPR A;  3ZFZ A;  4S2N C;  4MDZ A;  4KZ5 A;  4QPR A;  2PD7 A;  2Y2K A;  3UO9 A;  4E3N A;  3S1Y A;  2ZOI A;  3E98 A;  1NWZ A;  5GLA A;  4KQO A;  4IHQ A;  2L4R A;  4E3K A;  3A3I A;  1XFQ A;  2WKI A;  3A3F A;  4JGR A;  3VFH A;  3F1O B;  4WBG A;  1T1A A;  1BUE A;  4JXW A;  2PR6 A;  4Y0T A;  1ODV A;  4OOM A;  4WM9 A;  2W3E A;  2CC1 A;  3NC8 A;  1KE0 A;  1MXO A;  3QNB A;  3MSH A;  1OPX A;  4JGQ A;  5L8M A;  1ES5 A;  4M3K A;  3LCE A;  3UDF A;  5HAP A;  3VMA A;  1PNE A;  4DE3 A;  2W1T B;  4OLG A;  5TBM A;  3FPW A;  2QPN A;  3OPL A;  4GJ4 A;  3HBR A;  4HES A;  4B93 A;  3JYI A;  2Y2Q A;  1XA7 A;  5CER A;  1XJ3 A;  3TJZ C;  3CIT A;  1OME A;  2ZQ9 A;  2A49 A;  2Y8H A;  4XXR A;  4PPR A;  3CMZ A;  2G2W A;  5FDH A;  1SCW A;  3CG5 A;  3OOV A;  3FZC A;  4K0W A;  2V1B A;  3ZDJ A;  1YLJ A;  4ZJ2 A;  4HHD A;  4OPR A;  3NOP C;  4X68 A;  2ACG A;  5DJU A;  4ZAM A;  4D60 A;  1K0K A;  2V9A A;  5HL1 A;  1SDE A;  3ZG8 B;  3IQA A;  3HLG A;  1OT6 A;  1QMF A;  4PM8 A;  1TS7 A;  2JBF A;  5IHV A;  3A3J A;  3P01 A;  2VGL S;  4IVI A;  2JKT M;  2C5W B;  1LL5 A;  3LIE A;  1CEF A;  1K25 A;  4X25 A;  2VKS A;  1OTE A;  3QP6 A;  2PDR A;  3CAX A;  3O87 A;  3MZF A;  3Q7V A;  4R4R A;  5E2E A;  4X53 A;  4NXF A;  2ZC7 A;  4Q0H A;  1ZKJ A;  2VGK A;  3BJN A;  3K2N A;  2J7V A;  5HPI A;  1TS6 A;  4E6W A;  3UB5 P;  1MWR A;  1BLC A;  4DE2 A;  3KO6 A;  3P7N A;  3Q07 A;  3T4T A;  1V9Y A;  1IYO A;  1ERM A;  3G34 A;  3G31 A;  2J9O A;  3GQZ A;  4Q0J A;  3UE3 A;  2V8C A;  2ZMA A;  5FAT A;  3ISG A;  2XGN A;  1KVL A;  3HUN A;  3BFC A;  5AQB A;  4FSF A;  1PFL A;  4ETX A;  1NRF A;  3KSG A;  4L0L A;  1Y54 A;  5J3W A;  2G2U A;  5AQA A;  3GVB A;  3IH8 A;  4U0X A;  2FFF B;  4DE1 A;  2VV8 A;  4P0M A;  1DP9 A;  4GKU A;  1NYM A;  2ZQA A;  2GZA A;  3UDI A;  3G6O A;  4IBX A;  2OAQ 1;  3RJU A;  5HDD A;  1JWZ A;  4R3A A;  3DWK A;  5CHU A;  2QMI A;  3LY3 A;  3T1Q B;  4S2N A;  3VP1 A;  5JYO A;  3MR0 A;  2J80 A;  1PI5 A;  3LR3 A;  1K54 C;  1H8M A;  2JC7 A;  4LV3 A;  1GA0 A;  2Y2N A;  4FUW A;  1D7E A;  1DY6 A;  3HCY A;  4ID4 A;  1NXY A;  4GD6 A;  5L09 A;  5FAP A;  2WK0 A;  3E2L A;  5EVE A;  4KQQ A;  1J3W A;  2OV5 A;  3MS6 A;  3LIB A;  2Y4A A;  3M6H A;  4PHT A;  2I9V A;  3NI9 A;  3TOI A;  1RP5 A;  4KZ9 A;  1Q2P A;  1OTD A;  4LV0 A;  3B47 A;  3MXQ A;  2WGI A;  3UN7 A;  4XT2 A;  4HOI A;  4GNU A;  2V0W A;  5FQK A;  1DJA A;  5EFW A;  1KVM A;  4DXC A;  3E2K A;  4KQR A;  4NKP A;  3T4Q A;  3CI6 A;  3L7H A;  1G28 A;  3IF6 C;  4OH0 A;  5KMW A;  4R3B A;  3M2K A;  1XKZ A;  3ZG0 A;  3QP5 A;  4NG2 A;  3PAE A;  4ZJ3 A;  1TVF A;  5IT5 A;  1ONH A;  4KZ4 A;  4UEY A;  4IUK A;  3Q82 A;  1LSX A;  2P04 A;  4PM6 A;  4OPQ A;  1XX2 A;  3MQQ A;  2YKH A;  2E8J A;  3W8K A;  3UB7 A;  1FQG A;  2R9W A;  3H82 A;  4BWI A;  3C4P A;  2ZJ9 A;  3W4Q A;  3V39 A;  3BYD A;  2HGV A;  3MF0 A;  2VLG A;  5CGX A;  5EOE A;  4FOF A;  1YLY A;  4WMC D;  2HV1 A;  1FSW A;  4EW7 A;  4UHU A;  4UQI M;  1BLP A;  1P97 A;  1K55 A;  3IHA A;  4HP4 A;  1ALQ A;  5HWT A;  2K2N A;  2ZC3 B;  4U3T A;  3LO7 A;  4R70 A;  3NOT C;  2XQZ A;  3WRZ A;  4HIA A;  1XA1 A;  3KYQ A;  4PKY A;  2D02 A;  3T1X A;  3NIA A;  2PR5 A;  3HLC A;  1VET B;  1V9Z A;  5G18 A;  5DVA A;  4PM5 A;  2R9X A;  2WKP A;  3VFF A;  5F1G A;  3LEQ A;  5EPH A;  4E3I A;  2B02 A;  4P87 A;  4B4Z A;  5J4E A;  5F1F A;  1LL9 A;  5J8X A;  3KYZ A;  5EVL A;  3O5Y A;  1LSV A;  3I7J A;  2LB9 A;  4HBT A;  2JN7 A;  2VK3 A;  4CQH A;  1HTZ A;  5GHZ A;  5DKK A;  1YPR A;  5CTM A;  5FL3 A;  5HX9 A;  1CJF A;  1H8Y A;  5TJJ A;  5EUA A;  2B18 A;  4ZTK A;  5FDS A;  2FZ0 A;  4WZ4 A;  4MBH A;  2B5R A;  5DF9 A;  2J8Y A;  1MWU A;  1CK3 A;  3E4Q A;  4R0Q A;  4P6B A;  3C4O A;  2HZ5 A;  2WKR A;  3UY6 A;  4NXB A;  1DRM A;  5GLD A;  5JYP A;  4HJ3 A;  5A92 A;  5K5B A;  5HAQ A;  1E3U D;  3SZT A;  4BL2 A;  2PYP A;  4OON A;  3LR4 A;  3Q7Z A;  1IKI A;  5F5Y A;  1NLY A;  2CMN A;  3K3D A;  3IF6 B;  2WGV A;  3ZHH A;  4YNR A;  1GHP A;  4ETZ A;  2H0T A;  3H82 B;  1KDS A;  3ZNY A;  2JE5 A;  3H7W B;  2Q0O A;  3O86 A;  5D3O A;  4GHI B;  4BQM A;  1S1Y A;  2EWW A;  2O9B A;  4R3J A;  3HLW A;  5EVI A;  2ZQC A;  3WRT A;  1S1Z A;  3R4K A;  4NXE A;  3SH8 A;  3K3C A;  4IVK A;  4Y5F A;  5DF8 A;  1PRQ A;  5CGW A;  3IWO A;  5EVI B;  3UPN A;  2MJ6 A;  1IEL A;  1CF0 A;  4IUH A;  1LSW A;  1FR1 A;  2PBY A;  4HQA A;  1F9I A;  4GOG A;  4IED A;  3MFX A;  4II7 A;  4EV4 A;  1GSW A;  1LHY A;  1IOU A;  5FQM A;  3S4X A;  2XD1 A;  5AJG A;  1K55 C;  1X0O A;  4GW9 A;  1YM1 A;  1LL8 A;  2Y2H A;  3WS1 A;  1ERQ A;  3CLO A;  3DAV A;  4XUX A;  3EQV A;  4L9G A;  1N4O A;  1VM1 A;  2XFS A;  4OVD A;  2M1C A;  4EUV A;  2GDN A;  5EOO A;  3ZVT A;  4KEN B;  5FI2 A;  2EX9 A;  2QHK A;  4MN5 A;  3EEH A;  4WLA A;  4YOF A;  3TG9 A;  3SW1 A;  4Y0U A;  1K4F A;  3ZCZ A;  1SKO A;  4X69 A;  2EXA A;  1IYS A;  1F5M A;  3CJM A;  4OQ0 A;  5DF7 A;  4Q8I A;  1YMS A;  5DTK A;  1A0K A;  2HDS A;  3HLB A;  1QME A;  2J3W A;  4F3L A;  4HP9 A;  4OOL A;  3IS2 A;  2NUP C;  1PWG A;  2Q9M A;  1MWT A;  4EER A;  3BM6 A;  2K7S A;  3IH9 A;  2G7U A;  1L3L A;  3UB8 A;  2OLV A;  3OPH A;  1MPL A;  5AVE A;  2WAE A;  2XRO A;  3NDE A;  1GA9 A;  1XJ4 A;  3IT9 A;  4R38 A;  2EX6 A;  5HPF A;  1YSQ A;  2HF6 A;  2BG1 A;  5CRF A;  2Y79 A;  1GCE A;  1XXM A;  1Z6F A;  3F1P B;  2JKR M;  1ESI A;  2KDK A;  4JGP A;  2ZLY A;  1F98 A;  4UA7 A;  1GSV A;  2GNX A;  5GHX A;  3KYE A;  1Y4O A;  3HL9 A;  2L1M A;  3CUE A;  4KQD A;  2I72 A;  1P9R A;  3LIF A;  4CLC C;  1T1C A;  4AFI A;  1XP4 A;  3PBQ A;  4G3V A;  4GHI A;  5I5L A;  2Y2O A;  4WF0 A;  3MZD A;  5HSQ A;  4S2P A;  3ITB A;  1JNU A;  3AGD A;  3DTK A;  4CLC B;  2Z2M B;  4ZDX A;  3HVF A;  1K56 D;  4FH4 A;  3BLM A;  3UNW A;  4HY8 A;  4G3K A;  3GDI A;  2HDU A;  3S7Q A;  4S2K A;  3T12 B;  1K57 A;  1JWV A;  1LI9 A;  3C5A A;  3LGO A;  3DTM A;  1OTA A;  1Q2Q A;  4OLD A;  4HEF A;  4KZ8 A;  1YKD A;  4IJG A;  2P9V A;  3VOZ A;  4D2O A;  3QP8 A;  2W3D A;  3OPP A;  1U60 A;  5TBM B;  3NUL A;  5CX7 A;  1K38 A;  1BT5 A;  2HJE A;  2W1R A;  5A8B A;  3OBF A;  4S2I A;  2A24 A;  1LLB A;  4GS9 A;  1EWZ A;  1CEG A;  1YQS A;  4HI4 A;  3G32 A;  3EGD C;  3EEA A;  5DTT A;  3C7U A;  1PWC A;  4QHC A;  4WMC A;  3LR0 A;  1XJ2 A;  1MKI A;  4KZA A;  1E3U A;  2EA9 A;  5M1A A;  3NEC A;  4P6Z M;  2EX2 A;  4Y15 A;  3CPT B;  3NJA A;  3VE4 A;  1NY0 A;  4JXS A;  2WAD A;  3IWI A;  4DN0 A;  2QZ6 A;  3HLE A;  2DNS A;  1RGZ A;  5F6A A;  1N9O A;  1M40 A;  3D72 A;  3M2J A;  3MBZ A;  3ZG9 B;  3PTE A;  3FKV A;  2Q9N A;  4CLC D;  1IYP A;  5FQI A;  5EVI D;  2PBD P;  1VEU B;  1L0G A;  1S6R A;  1VQQ A;  2Y91 A;  4LV2 A;  3F1N A;  1S66 L;  3DWZ A;  3P98 A;  1FSY A;  4BD1 A;  2JHE A;  3UMD A;  3MKF A;  5BOH A;  3HLF A;  3SH9 A;  3LI9 A;  1HLU P;  3F1N B;  4QD4 A;  4KZ7 A;  5HL6 A;  3V50 A;  1IFQ A;  2VGJ A;  2H5S A;  3VE3 A;  3FWL A;  1PZP A;  4DJ3 A;  1K6R A;  2OOL A;  1XJ6 A;  4MMN A;  2ZQ7 A;  1C3B A;  3LEZ A;  5J7E A;  2HP6 A;  1DJB A;  4LGW A;  1BLS A;  3RXW A;  1WYC A;  4OOY A;  3G35 A;  4R1G A;  1CI8 A;  3BRM A;  5E43 A;  1KDW A;  2Z6C A;  4LPZ A;  3B42 A;  1KGG A;  5TFQ A;  4EBL A;  4RQ9 A;  3F1O A;  4MN6 A;  5CXW A;  1FCN A;  3IXD A;  1L2S A;  3MMH A;  4EQI A;  3PBN A;  1F2K A;  3IBJ A;  2V1A A;  2RCX A;  4KZ3 A;  3IXH A;  4YWZ A;  5GHY A;  1AWI A;  2BAS A;  4RX3 A;  4YIN A;  3LIC A;  4GN2 A;  3O88 A;  2XRN A;  1N9N A;  2ZM2 A;  3T50 A;  3V5M A;  1TS0 A;  5A91 A;  5A93 A;  1BTL A;  4EUZ A;  1G68 A;  3E0Y A;  2W1T A;  2M7V A;  4RVA A;  4QJG A;  1OJG A;  2VV7 A;  5LBR A;  2W0N A;  3LID A;  2H28 A;  4BBU A;  2OWJ A;  3PHY A;  1N9L A;  3LYX A;  1P9W A;  5DFX A;  2K31 A;  1WE4 A;  2WZZ A;  3HJK A;  3JVV A;  2WYX A;  2ZL1 B;  2X71 A;  3WWX A;  3BW6 A;  4BMW A;  3WS2 A;  1AXB A;  2O99 A;  1T18 A;  4BD0 A;  1XGI A;  3DBA A;  2ZL1 A;  3D9Y A;  1L0E A;  4PMA A;  5IS1 A;  1GSX A;  1ES4 A;  2HDR A;  4X6T A;  4LEN A;  3AGF A;  4EBP A;  4FH2 A;  3LUQ A;  3EWK A;  1GHM A;  2IWD A;  5FAQ A;  4E6X A;  4HBU A;  2XEP A;  1VEU A;  1W79 A;  4KG2 A;  5FI7 A;  2RL3 A;  3R7W B;  4LV1 A;  4O8G A;  5EM1 A;  2A3U A;  2VV6 A;  2YKF A;  4NET A;  3FC7 A;  3GRJ A;  3DW0 A;  4H6J A;  2J3T D;  1K56 A;  2H10 A;  4B9O A;  2QJ7 A;  1XGJ A;  1TDG A;  1PI4 A;  2B95 A;  1ZC2 A;  1MC0 A;  5DKL A;  4EEU A;  3MKE A;  1IEM A;  3WS5 A;  1TS8 A;  2Y59 A;  3NCK A;  4U0T A;  3EOI A;  1EI5 A;  3Q7V B;  3T4L A;  1H8Z A;  4NEE D;  3KSI A;  1SHV A;  3ZNT A;  2JKR I;  3MXS A;  3NBL A;  4DKI A;  2WKQ A;  1TEM A;  2J9P A;  1UWP X;  2O9C A;  4P6Z S;  4DE0 A;  5G4Y A;  4BJP A;  4JF4 A;  4P85 A;  2BTF P;  2J3T C;  3SOI A;  3QHY A;  3BLS A;  3VOY A;  1G6O A;  4Y0O A;  4HH2 A;  1BYW A;  4GDN A;  1MWS A;  2AVX A;  2JKT I;  3PBO A;  2ZOH A;  4KG5 A;  3NY4 A;  5TR7 A;  3UE6 A;  3TRC A;  1FIK A;  4L9E A;  2WAF A;  4Z9Q A;  3C38 A;  3GEC A;  3IX3 A;  3MXR A;  3UPP A;  2HJ9 C;  1SDN A;  1WA9 A;  2Y2L A;  3C2W A;  1ZHH B;  4LCL A;  3IX8 A;  4ZRR A;  3UB6 A;  4R4S A;  1SZV A;  2QJ5 A;  4Q0I A;  3LFV A;  4X55 A;  3QP4 A;  2XK1 A;  2HP9 A;  2V8F A;  1ACF A;  5TGF A;  2PU2 A;  4KUO A;  2R78 A;  4CPK A;  4Y17 A;  4QY6 A;  5GL9 A;  3V3S A;  1XPB A;  4OKP A;  3KSH A;  1PIO A;  3QNC A;  4E3J A;  5E2F A;  3W4O A;  3IXG A;  4GCZ A;  4JGO A;  1UWN X;  1MZU A;  1JTG A;  4WEJ A;  4DXB A;  2P08 A;  2PRF A;  1W8Y A;  3IF5 A;  5E2G A;  2ZBB A;  4X56 A;  1YLT A;  3D4F A;  4FD8 A;  3U4L P;  1YAX A;  1W63 Q;  4OPY A;  1RGY A;  4H8R A;  2V1Z A;  3HLD A;  1NZO A;  4LRY C;  3T4K A;  2KLI A;  1K6S A;  5U47 A;  1W7F A;  5CGS A;  3LI8 A;  5GLB A;  2XH9 A;  2EWV A;  1PZO A;  2X02 A;  5KSH A;  1MKM A;  3AGE A;  5HD3 A;  5E2H A;  1T1B A;  2HPB A;  4Y2F A;  3FYZ A;  3VP3 A;  2PU4 A;  4ZBE A;  5FQ9 A;  2XFT A;  1SKF A;  2XR0 A;  4R6L A;  1YMX A;  4O7D A;  4X1L A;  2XLN A;  1OTB A;  3BFE A; 
#chains in the Genus database with same CATH homology
 3B33 A;  5DFY A;  4HJ4 A;  1OTA A;  4K08 A;  3MQ0 A;  3R7W A;  1OJ5 A;  3RFB A;  1YKD A;  4IJG A;  3LIB A;  4MN7 A;  1H3Q A;  4EXO A;  2PYR A;  2W3D A;  4PHT A;  3C30 A;  2XA7 S;  5TBM B;  4LLO B;  5CX7 A;  2I9V A;  3S7O A;  5C5K A;  2HJE A;  2W1R A;  3BQ8 A;  5A8B A;  3OBF A;  3T4S A;  1OTD A;  2A24 A;  4GS9 A;  3B47 A;  3MXQ A;  4EET B;  4HI4 A;  1NLZ A;  4XT2 A;  3C8C A;  3BY8 A;  3EGD C;  3EEA A;  4HOI A;  2V0W A;  4L9F A;  2PT7 A;  3ZYT A;  3LR0 A;  5EFW A;  5AVF A;  1XJ2 A;  3H7W A;  3RH8 B;  2VEA A;  3MJQ A;  4NKP A;  3T4Q A;  3CI6 A;  2XSS A;  1G28 A;  4EES A;  2EA9 A;  4BBT A;  4DJ2 A;  4MCW A;  3H9W A;  4P6Z M;  4PKY G;  2ZMF A;  3PR6 A;  3NJA A;  5IT5 A;  3VE4 A;  2QKP A;  3EQU A;  1VHM A;  3IBR A;  3VV4 A;  4DN0 A;  4UEY A;  4IUK A;  5HZH A;  1DP8 A;  3OLO A;  1LSX A;  5F6A A;  1LT0 A;  2P04 A;  1N9O A;  3HJI A;  3D72 A;  3TW8 A;  4EQ1 A;  3UB9 A;  3MQQ A;  4CLC D;  2YKH A;  2VA0 A;  5MC7 A;  3UME A;  3UB7 A;  2XA7 M;  1S4R A;  3H82 A;  4BWI A;  3F1N A;  1S66 L;  2A24 B;  2W27 A;  4GS9 B;  3PBS A;  2FH5 A;  2GX5 A;  1T19 A;  3EGX C;  4O01 A;  2JHE A;  3UMD A;  2HGV A;  3LI9 A;  2VLG A;  3MF0 A;  4I5S A;  3F1N B;  3OCL A;  4FOF A;  5HL6 A;  1IFQ A;  2HV1 A;  4Z1W A;  4O0P A;  2A2L A;  3S7N A;  4EW7 A;  3VE3 A;  4UQI M;  4DJ3 A;  5F68 A;  4CLC E;  1P97 A;  2OOL A;  3PYP A;  1XJ6 A;  4MMN A;  4EU0 A;  4I38 A;  5J7E A;  4HP4 A;  4I3A A;  1ZTU A;  2W3H A;  2K2N A;  5HWT A;  4WL9 A;  5HWV A;  3BY9 A;  4F3L B;  4R70 A;  3NOT C;  2ZMV A;  1W63 M;  4HIA A;  3NHQ A;  3KYQ A;  4ARZ B;  4PKY A;  1D06 A;  2Z6C A;  2D02 A;  3T4J A;  4LPZ A;  3B42 A;  4WUJ A;  3LR5 A;  4Y3I A;  2PR5 A;  4RQ9 A;  3F1O A;  1V9Z A;  4MN6 A;  5DJT A;  3E4P A;  4ARZ A;  1P0Z A;  2QWS A;  2WKP A;  4GLQ A;  3MMH A;  2B02 A;  3PBN A;  3IBJ A;  4HH3 A;  2V1A A;  5HWW A;  5J4E A;  3KYZ A;  1S67 L;  2W3G A;  3O5Y A;  4YWZ A;  1LSV A;  2BAS A;  2OAP 1;  2VGL M;  4G3W A;  2P7J A;  3LIC A;  3FPV A;  3ULF A;  2LB9 A;  2JN7 A;  2Z6D A;  2XRN A;  3U2A A;  1N9N A;  3ICY A;  2IA2 A;  3T50 A;  4CQH A;  1TS0 A;  4H6J B;  3A0S A;  5DKK A;  3E0Y A;  2GJ3 A;  2W1T A;  2NUT C;  2OWH A;  3BQA A;  5HDS A;  2M7V A;  4ME4 A;  4CLC A;  4EEP A;  5FL3 A;  1OJG A;  2VV7 A;  5LBR A;  2W0N A;  3LID A;  2H28 A;  4E04 A;  4BBU A;  2OWJ A;  3PHY A;  1N9L A;  3LYX A;  1P9W A;  3OC2 A;  4WN5 A;  5DFX A;  4MDZ A;  2K31 A;  3MQO A;  4QPR A;  2B18 A;  5TJJ A;  2PD7 A;  2FZ0 A;  4DMZ A;  5HD5 A;  5DF9 A;  4PAU A;  3HJK A;  3JVV A;  2ZOI A;  1OT9 A;  3E98 A;  1NWZ A;  3BW6 A;  4KQO A;  4IHQ A;  3E4Q A;  4BMW A;  2O99 A;  1T18 A;  2L4R A;  4M4X A;  1XFQ A;  2WKR A;  4NXB A;  1DRM A;  4JGR A;  3DBA A;  4HJ3 A;  3F1O B;  1T1A A;  3E4O A;  5K5B A;  5IS1 A;  4KUK A;  1GSX A;  4HJ6 A;  2PR6 A;  2PYP A;  1ODV A;  4OOM A;  2VZW A;  3LR4 A;  2W3E A;  5IU1 A;  3LUQ A;  5F5Y A;  3EWK A;  1NLY A;  2CMN A;  3K3D A;  1VB6 A;  1NRJ A;  1TF1 A;  4YNR A;  1OPX A;  4JGQ A;  5L8M A;  4ETZ A;  4WEL A;  3R7W B;  4O8G A;  1UGU A;  3H82 B;  2VV6 A;  2YKF A;  2DMW A;  3FC7 A;  3H7W B;  1XFN A;  2J3T D;  4H6J A;  4I3J A;  4B9O A;  3D3O A;  2QJ7 A;  2W1T B;  5TBM A;  4GHI B;  3FPW A;  1EW0 A;  1S1Y A;  2EWW A;  2O9B A;  4NXG A;  1MC0 A;  4GJ4 A;  5DKL A;  4EEU A;  4B93 A;  3KSF A;  1TS8 A;  4LRZ E;  1S1Z A;  3EOI A;  3R4K A;  4NXE A;  3K3C A;  4Y5F A;  4WEK A;  4XT2 B;  3T4L A;  4NEE D;  3KSI A;  2MJ6 A;  1XJ3 A;  2JKR I;  3TJZ C;  4IUH A;  1LSW A;  2WKQ A;  3CIT A;  3S7P A;  2Y8H A;  4HQA A;  1F9I A;  2INW A;  1UWP X;  2O9C A;  3MFX A;  4II7 A;  4P6Z S;  5G4Y A;  1GSW A;  1IOU A;  2M7U A;  4BJP A;  2D01 A;  3OOV A;  5AJG A;  5G4Z A;  1X0O A;  2J3T C;  4GW9 A;  2V1B A;  1LL8 A;  3PBR A;  2PD8 A;  3PBT A;  3PXP A;  1KOU A;  1STZ A;  4I39 A;  3TE8 A;  4HHD A;  1G6O A;  4HH2 A;  1BYW A;  1OTI A;  2PHY A;  3FG8 A;  3NOP C;  2O9A A;  3CLO A;  2JKT I;  3PBO A;  5DJU A;  2ZOH A;  3EQV A;  2V9A A;  2W3F A;  4L9G A;  3UE6 A;  3TRC A;  3V67 A;  2KX6 A;  1OT6 A;  2M1C A;  4EUV A;  1TS7 A;  3P01 A;  4L9E A;  2VGL S;  3C38 A;  3GEC A;  2JKT M;  3F1P A;  2O0Y A;  2QHK A;  2HJ9 C;  4MN5 A;  1WA9 A;  3C2W A;  3EEH A;  1ZHH B;  3A0R A;  4WLA A;  4YOF A;  3LIE A;  3SW1 A;  3KX0 X;  2VKS A;  3OCN A;  4ZRR A;  1DP6 A;  3UB6 A;  1S4S A;  1OTE A;  1F5M A;  2QJ5 A;  2PDR A;  2L0W A;  4Q0I A;  3CAX A;  3T4O A;  3LFV A;  2J3W A;  4NXF A;  4F3L A;  3RTY A;  4HP9 A;  4OOL A;  4Q0H A;  3BJN A;  3K2N A;  4KUO A;  3NOU C;  1Y28 A;  3IS2 A;  2NUP C;  2R78 A;  5HPI A;  1TS6 A;  4EER A;  2KOI A;  3KSH A;  2K7S A;  3KO6 A;  2G7U A;  3P7N A;  4GCZ A;  3T4T A;  1V9Y A;  4HNB A;  4JGO A;  3UB8 A;  4UQI S;  1UWN X;  1MZU A;  4Q0J A;  5AVE A;  3UE3 A;  3ZQ5 A;  4WEJ A;  2XRO A;  3BWL A;  2P08 A;  1XJ4 A;  4R38 A;  2ZBB A;  5HPF A;  1YSQ A;  4FSF A;  2HF6 A;  4ETX A;  2Y79 A;  3KSG A;  1YAX A;  4L0L A;  1W63 Q;  4I3I A;  5J3W A;  4BBV A;  3F1P B;  4LRY C;  2JKR M;  3T4K A;  1YSP A;  2KLI A;  3A0V A;  2KDK A;  2VX8 A;  4JGP A;  3VOL A;  1F98 A;  2VV8 A;  1GSV A;  2GNX A;  1DP9 A;  2L1M A;  3CUE A;  2GZA A;  4KQD A;  1TD5 A;  1P9R A;  3LIF A;  4CLC C;  3LI8 A;  1T1C A;  2EWV A;  2LB5 A;  4G3V A;  3PBQ A;  5I5L A;  4GHI A;  4AFI A;  3G6O A;  4LRX C;  5KSH A;  5F69 A;  2OAQ 1;  1MKM A;  5HD3 A;  5HDD A;  4WF0 A;  4R3A A;  1T1B A;  3JVU A;  2V0U A;  5HSQ A;  4Y2F A;  3W2Z A;  3IS2 B;  3LIA A;  2VJW A;  1JNU A;  4CLC B;  3MR0 A;  3CUE C;  2J80 A;  5HDC A;  3LR3 A;  1H8M A;  4HY8 A;  4G3K A;  3GDI A;  3CWF A;  2QYB A;  4R6L A;  3S7Q A;  5KIZ A;  1D7E A;  1OTB A;  3HCY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...