3P01A

Crystal structure of two-component response regulator from nostoc sp. pcc 7120
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
178
structure length
178
Chain Sequence
b'QRAAETYDLLKQRTEELRRANAQMSLLTVLVQVTQASNSLEAILTPIATAFAESFAVNACILQMLEGQTLSTIQGFYSQQGTVNNWLNQDPLTNEAIATGQIQVAANIAKDPKLASISQYQDNGIQSHVVIPITYRNEMLGVLSLQWQQPISLREDELTLIHLSAQLVAIALTSSRCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two-component response regulator
publication title Crystal structure of two-component response regulator from Nostoc sp. PCC 7120
rcsb
source organism Nostoc sp.
molecule tags Signaling protein
total genus 51
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.340 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p01A02
3P01A
chains in the Genus database with same CATH superfamily
4WBGA 3T12B 3T4OA 5EECA 3LUQA 2ZQDA 3T4KA 3MQ0A 3OPLA 4KZ9A 1E3UD 1UGUA 1LT0A 1K6RA 4N92A 3UB5P 3ZG8B 2J80A 4MCWA 1WYBA 1BYWA 3QP4A 4K08A 1FILA 1FIKA 2ZD8A 4I5SA 4CQHA 2EA9A 4PM9A 4WZ5C 3WS4A 3CUEC 4OVDA 3O3VA 1DJBA 2BTFP 4QD4A 3TG9A 3TRCA 2HJ9C 4G3WA 3QP2A 4ID4A 4E04A 1FR1A 1CJFA 4YINA 1L0EA 3OOVA 3VP3A 5E2GA 2HJEA 3DTEA 3LY3A 3BFCA 1CK3A 5FI2A 2UV0E 5CEDA 3T4JA 4YOFA 3ZVTA 3BLSA 3IS2A 4KG5A 3UY6A 2Y2PA 3WS2A 3F1OB 3DWZA 2WKQA 2B02A 2G7UA 5HWWA 3DW0A 3D72A 4ARZA 3UDIA 4HJ4A 4BBTA 3LEQA 3A0VA 4ZDXA 3IS2B 3ZVWA 2WZXA 3D3OA 4X25A 4DE2A 1HTZA 1XJ3A 4JXVA 2W1TA 3E2LA 2PYPA 3P98A 3QNBA 5L07A 4ARZB 2WK0A 5J3WA 5HD5A 4E6WA 2ZQ8A 2L4RA 1T1BA 2W1TB 1PI4A 1H8ZA 2HDSA 1RP5A 5HDDA 5J8XA 1Q2PA 2M7UA 3G6OA 4DJ3A 3MR0A 4UA7A 3HLBA 5I94A 2Z6CA 2J3TD 4R3BA 3WRTA 1KDWA 3Q07A 3EWKA 4OLGA 2ZQ7A 3SH7A 3LY4A 5CGWA 1XGIA 3GMWA 3S4XA 2M7VA 1NYMA 3B3XA 4QY6A 4KQRA 2WAFA 3MQOA 1NJ4A 2J9OA 3O5YA 4L9GA 5HWVA 1S67L 2JKTM 3T4QA 5CECA 3G32A 2DNSA 3HBRA 4H8RA 1FQGA 1LL9A 4IUHA 2GZAA 4QJGA 4ZAMA 4Y0TA 1EROA 4GW9A 3RXXA 3F1NB 1IYOA 2IWCA 4MN6A 3HL9A 2JKTI 4MN5A 1OMEA 4HQAA 1T1CA 1OJGA 3DTIA 3T1SA 4QWOA 4S2LA 2OWJA 1K54C 4C75A 3G30A 3GTCA 3IH9A 4Y0UA 3U4LP 4UQIS 4Y13A 1Q2QA 2Y2MA 3I7JA 3FYZA 4N9KA 4LPZA 3MFXA 5KMWA 2RL3A 3TW8A 4WZ5A 1CQAA 2JN7A 4FSFA 2HGVA 1KGEA 4Y7PA 1D7EA 1LL5A 2HDQA 3FPVA 4E3LA 2ZMAA 3GVBA 4JGQA 1PW1A 2XRNA 2VX8A 2WKHA 4S2IA 4F94A 2HDRA 4GNUA 2M1CA 3NULA 5EUAA 2J9PA 1GA0A 4OP8A 4KG6A 3VE3A 4JGPA 1TS6A 4R1GA 3RTYA 1OTDA 3T4LA 5EVIC 1G5UA 1GSXA 1LI9A 1K57C 1S1ZA 3BFEA 4BLMA 4DKIA 5CGXA 1ERMA 3IT9A 1ESUA 1MC0A 3Q7ZA 5FAOA 1W8QA 2RCXA 1BLSA 3L9KA 4KZ7A 1ZC2A 1BUEA 5DVAA 2OAP1 4PM8A 1FCOA 4GDNA 2GDNA 3N8SA 2FZ0A 2W3GA 3MXQA 4IVIA 4K0XA 5K5BA 4ZTKA 4R4SA 4CJNA 4MMNA 2V2FF 5HZHA 4MBKA 3FZCA 4N1XA 4WM9A 1YM1A 5FQJA 5TBMA 3ZNYA 5CTMA 1PWDA 3ITBA 4BD1A 1NZUA 3ZDJA 4X6TA 2V0UA 2PR5A 2R78A 3LIEA 3Q7VA 2C6WB 4G3KA 1FSYA 4FTXA 3NOUC 1J9MA 5TBMB 3RXWA 2R9XA 2QJ7A 4YFMA 3NI9A 3MZEA 3S7NA 5TGFA 3Q7VB 4WN5A 3IF6A 1BTLA 5EVEA 4HI4A 4DE1A 1IELA 2INWA 3V67A 3UNWA 3S7OA 4O8GA 2H0TA 4EESA 1BLPA 1OJ5A 1XKZA 4EW7A 3LI9A 1DP6A 3GSGA 4MEZA 3ZG0A 3IF6B 2P9VA 1GHMA 1V9ZA 1MKIA 3BQAA 3NCKA 4UQIM 3HVFA 3GDIA 3NIAA 4KZBA 1Z09A 2NUPC 1K54A 3LICA 4PKYA 4PMAA 3MXSA 5HAPA 3KYQA 3GV9A 5IU1A 1ES4A 3IXBA 2VGLS 1K38A 2K31A 4LRZE 4M4XA 3BM6A 1HLUP 3W4QA 3CI6A 5FDSA 3LR4A 3WS1A 1XGJA 4HHDA 2B95A 1ES2A 2ZOIA 3PBTA 5AQ9A 5F5YA 4N1HA 3HLGA 3LR5A 1PIOA 3ZNTA 4EEPA 2PT7A 2XA7S 1ZKJA 3LCEA 5KZHA 2PHYA 5A92A 3PYPA 4MN7A 4XUZA 4FOFA 2XROA 3UE3A 3A3FA 1DJCA 4WEKA 2VLGA 4LV2A 3Q81A 3LEZA 4XUXA 4C3QA 1PFLA 2J3WA 1JVJA 2Q9NA 3LYXA 4KQDA 1ONHA 2KDKA 2PD8A 2J8YA 3AGDA 2O99A 1OPXA 2VGKA 2VA0A 3OPPA 1K57A 2WADA 4HEFA 3ICYA 1YSPA 2EXAA 4EXOA 1NZOA 1E4DA 5F1GA 4YWZA 5HPIA 4A5RA 4X55A 3ZQ5A 5FA7A 1JTDA 2FH5A 4NK3A 4I3AA 4NXEA 4K0WA 1M6KA 3NOTC 1HVBA 5GHZA 1IYQA 1L2SA 2XQZA 1LSVA 5DF8A 4HBUA 4LCMA 4PAUA 1K56A 2VKSA 3O88A 4CLCE 2Y79A 1JTGA 2NUTC 3QHYA 2ZL1A 3SS4A 5HDSA 3QP8A 1AWIA 2XFTA 4KZ3A 2JCHA 1P9WA 3IXGA 2Y2QA 4B4ZA 5J4EA 4GD6A 3T4SA 2Y59A 3RJUA 1LLBA 2K2NA 2ZL1B 1VQQA 5DFXA 3LO7A 2GX5A 2EWVA 4GKUA 4KENB 2VK3A 1MXOA 1P97A 1E3UA 3UN7A 3E4PA 4OPZA 4E6XA 1K56D 3FKWA 1FR6A 1TVFA 2ACGA 1LSXA 3IHBA 5J7EA 5MC7A 4IHQA 2VGLM 5EM0A 5GL9A 1J3WA 1Y54A 3UE0A 4OPRA 4LRXC 3MXRA 2BLSA 1VHMA 2WAEA 4OQHA 1G6AA 1MKMA 3MKFA 4KQOA 5EOEA 2QYBA 2XEPA 1XJ6A 3W8KA 1YT4A 2XA7M 5E2FA 4DE3A 4LRYC 3IX4A 4HIAA 1TS7A 2JE5A 5FQIA 3O87A 1IOUA 4P6BA 4BWIA 4OLDA 5F69A 3N8RA 4Z9QA 4EU0A 3HLEA 1HD8A 3AGFA 1YMSA 3GRJA 4WLAA 2VEAA 3O86A 1QMEA 4IJGA 1STZA 2QMIA 4DRTA 4HH2A 4FD8A 3T1RA 2I72A 4LFUA 5DFYA 4JF5A 3BFGA 1YLWA 1EI5A 2P7JA 3BJNA 5GLBA 3NDGA 3OPRA 2BG1A 4WF0A 3WWXA 5EV0A 3NBLA 3F1OA 5DF7A 3A0RA 4OQIA 2JKFA 1O07A 5FSRA 4DE0A 2ZQ9A 4UAAA 4ZJ3A 1XXMA 4UHUA 2G2WA 1LL8A 1MWRA 1UWPX 3VV4A 1ZHHB 4NETA 2OOLA 3UB8A 4B93A 3VP0A 4P6ZS 5HDCA 3HUNA 3VMAA 1S1YA 4X56A 4OPYA 2ZM8A 1S66L 4HY8A 3BLMA 4E3KA 3NDEA 2A49A 5FQ9A 2VV7A 2ZJ9A 3BECA 1XP4A 4IEDA 3GECA 2PR6A 5CGSA 4X69A 1IKGA 5DJTA 2A2LA 5CEBA 1N9LA 3N7WA 4HESA 5HWTA 3H7WB 3SOIA 3UB7A 3LIFA 5L09A 3KSIA 2Y2IA 3UO9A 3MZDA 4RQ9A 5G18A 2IA2A 2IWBA 2ZLYA 4QPRA 3P09A 3G34A 1BSGA 3H82A 4MBHA 2ZMFA 1N9NA 3NC8A 3S22A 5BOHA 5JYPA 2WGWB 2OAQ1 3ZG9B 2G2UA 2K7SA 4ZBEA 5C5KA 1IKIA 1ODVA 1GA9A 3BQ8A 3H82B 4PKYG 2Z6DA 5G4ZA 5AQ7A 2XF3A 1Z6FA 2KX6A 1PYYA 1EW0A 3MFDA 3HJIA 3S7QA 1W79A 2QZ6A 1SDEA 4Y2FA 3F1NA 3IF6C 4OPQA 3BW6A 3QNCA 4GOGA 4M3KA 4KZ8A 1N4OA 5L8MA 4NXBA 1CI8A 5CXWA 1HZOA 4GCZA 4EBLA 3D4FA 3BRMA 4EUZA 5FQQA 4I39A 1D1JA 4BD0A 1OTAA 3GR2A 5AQAA 3PAGA 1L0GA 1KOUA 2OSUA 5CRFA 5L2FA 4WYYA 1DJAA 2QJ5A 3C4OA 2V0WA 4LENA 1FCMA 4DXBA 3G4PA 3ZFZA 2ZC3B 1DP8A 3P01A 4Y3IA 1YLTA 3FWLA 4OKPA 1RGYA 2L0WA 4DXCA 4XXRA 2ZBBA 1K4EA 5FEGA 1IEMA 5DTKA 3V39A 1GHPA 3D9YA 1JWZA 1G68A 2VV8A 3CJMA 1T18A 1K25A 4Z1WA 1IYPA 1ERQA 3LI8A 4K91A 4OOYA 4DMZA 4JLFA 3C4PA 3L7HA 4P6ZM 3V3SA 4GLQA 4EEUA 3HJKA 4BL2A 2Y2NA 5HFOA 2Y2HA 4MBFA 5HW3A 1ZTUA 1E25A 3KSHA 4BQMA 4GS9A 5EM1A 3BWLA 2XFSA 1YAXA 2O9AA 3SH8A 3P7NA 2PU2A 4RYEA 1KE0A 3U2AA 4WL9A 2OV5A 1VEUA 4WUJA 1BLHA 4II7A 3CITA 3EQUA 5DKLA 1O7EA 4LV1A 1A0KA 4HJ6A 3FV7A 4GS9B 5DTSA 3A3IA 3KYZA 3IQAA 3VOYA 3A3EA 4U3TA 1XJ4A 3C2WA 2EWWA 1VEUB 1VB6A 3S1YA 1YPRA 1N9OA 5IT5A 1NY0A 3VP1A 1P9RA 1MWTA 3T1QB 4KZ6A 5FQKA 3FC7A 3HUOA 1FOFA 2CMNA 1TEMA 3N4IA 4RX3A 4X1MA 1XA1A 4B4XA 2DCFA 2XSSA 1H8MA 4HH3A 4S2NC 2E8IA 2B5RA 2DRWA 2X01A 4WMCA 3NECA 2Y91A 5DJUA 4ZRRA 4IBRA 3V50A 1FSWA 1F2KA 5JYOA 4FCFA 4BJPA 1Y4OA 4ZJ1A 4YNRA 5KSCA 1IYSA 5GLCA 3ZHHA 2V1AA 3N6IA 4OOLA 4DDSA 5U47A 3OLOA 3CLOA 1PWGA 3FKVA 3JYIA 4EUVA 5HL1A 2R9WA 4E3NA 3UMEA 4DF6A 2WKRA 4WMCD 5KIZA 4P0MA 2W3HA 2Y2OA 5FL3A 4GJ4A 2EFXA 4L9EA 2OWHA 1XFNA 5F68A 2XK1A 1QMFA 3QP5A 4MLLA 1WE4A 1GCEA 4X68A 1SDNA 5L10A 2H0YA 1KGFA 3G2YA 3T1XA 3E0YA 5A93A 3MKEA 2Y8HA 1JWVA 3N8LA 3FPWA 1MY8A 1F5MA 3TE8A 3DBAA 2ZQAA 4R23A 3NHQA 1ACFA 2WZZA 3B33A 4MNRA 4D2OA 3MJQA 2Q0OA 4HP4A 1XPBA 4NXFA 5FI6A 1W5DA 4KZ4A 3OCNA 1YKDA 2XDMA 3EOIA 5M19A 3A3DA 4O7DA 3PAEA 1PZPA 1WYCA 3IX8A 4R70A 4E3IA 1YLJA 3ULFA 5I5LA 2V1BA 2LB5A 2XD5A 4Y17A 3JPUA 2JKRM 1W8YA 3VFHA 5DKKA 1M40A 1SCWA 4PM5A 4EV4A 1NLYA 5E43A 2JKRI 2EX8A 3KSFA 3Q82A 3UB6A 1KDSA 3ZGAB 3ZG7B 2P74A 3EGDC 4WELA 2ZQCA 3UPNA 2EFUA 4HJ3A 3SH9A 2Y55A 1BLCA 4UEYA 1NRFA 1PRQA 4FUWA 5HSQA 4HNBA 1G6OA 2P08A 3HLWA 4S2NA 4R3AA 3GQZA 3LIBA 2WKPA 2PYRA 2IWDA 5A91A 1L3LA 3M2KA 1ES5A 1IFQA 3WS5A 1DY6A 2I9VA 4JGRA 5F1FA 4X1LA 5GHYA 3SS5A 5CHMA 2CC1A 3KSGA 1RGZA 4LV3A 4RX2A 2VGJA 2HP6A 4R4RA 4EBNA 4BBVA 1PWCA 4OQ0A 5TJJA 1XFQA 5HD3A 3MQQA 3IXDA 4Y5FA 2HZ5A 1V9YA 2YKFA 3IH8A 2ZC6B 1I2WA 4KUOA 4G3VA 4P87A 4Q8IA 1H3QA 4GHIA 3MZFA 3R7WA 3HREA 2O0YA 1P0ZA 1H0MA 1TDLA 1CEFA 3HUMA 4I3IA 4N9LA 2W1RA 3MF0A 4JXSA 2KLIA 3PBQA 3E4QA 5HX9A 4GHIB 3PR6A 5DTTA 3R7WB 3UB9A 5GLAA 5FAQA 3RH8B 1MZUA 4RA7A 5HARA 4ETZA 2PBDP 1OT9A 2ZM0A 3HLDA 5GLDA 4QY5A 3EQVA 2YKHA 3CPTA 4ME4A 4WEJA 2HF6A 3IHAA 5EPHA 5IS1A 2W0NA 4R6LA 4IUKA 3IWQA 4ETXA 4CPKA 2WUQA 2VV6A 3CPTB 4X53A 3CHWP 2H5SA 1MWSA 3BFFA 2VZWA 5CHJA 1H5XA 5IHVA 2PAVP 5HAQA 4JBFA 1ONGA 3M6HA 2X02A 4O0PA 4H6JA 4OONA 1L0DA 3HLFA 4NG2A 1RCJA 4JKTA 5EOOA 3ZCZA 4DJ2A 4LV0A 2E8JA 3H7WA 1F9IA 4OOMA 5FASA 4B9OA 5E2HA 1MPLA 4H6JB 1NYYA 3ZYTA 1PI5A 3IWOA 2DMWA 1KE3A 1MWUA 1SHVA 4KUKA 4EETB 2JKGA 4S2JA 2GNXA 2O9BA 2Y2GA 2HV1A 2WGWA 1SZVA 3LIDA 1BZAA 4DDYA 3QP1A 3DAVA 2D01A 4R0QA 1CEGA 1YQSA 2V20A 2PDRA 3T4TA 5HAIA 4HP9A 5FQMA 5G4YA 5FATA 3BEBA 2HPBA 4OP5A 1S6RA 2XR0A 1TD5A 2HDUA 2XLNA 3G2ZA 3BY8A 2L1MA 3MSHA 1S4RA 3W4PA 5CHUA 2X71A 1W63M 1K55C 2Y2KA 3R4KA 4NKPA 4Q0JA 4CLCA 3UMDA 5HPFA 2LB9A 2A24A 1ESIA 5D3OA 3IX3A 4NXGA 2ZC7A 2Y2LA 3C38A 3LGOA 1LSWA 4GZBA 4S2MA 3V3RA 3M2JA 2W3FA 3G35A 3M6BA 4CLCB 4L0LA 3EEAA 2A24B 3W4OA 2XH9A 5CX7A 1KE4A 2VJWA 3FG8A 1TS0A 3SZTA 3UE6A 4LCLA 5CERA 1S4SA 2V8FA 4LLOB 5FAPA 4CLCD 2Z2LB 3VP2A 1NRJA 4QU3A 1C3BA 4Y0OA 1AXBA 1JNUA 5EVLA 3A0SA 3DTKA 2Z2MB 2W27A 3C7UA 2GJ3A 3CUEA 1OTEA 1PW8A 3EGXC 4Y15A 1GSVA 3CG5A 4EQIA 3PBSA 1LI0A 4ZJ2A 1EWZA 3VOLA 2JBFA 2XGNA 5KSHA 2BASA 4BBUA 5TR7A 1YLPA 3BFDA 2Y4AA 3IF5A 4JPMA 5AVFA 3EEHA 2EX9A 2WYXA 3LIAA 2QHKA 4LGWA 4EERA 1OTIA 3RFBA 3E4OA 4I38A 1I2SA 1YLYA 2KOIA 2Q9MA 2WKEA 4F3LA 4HOIA 4O01A 4OH0A 4FH4A 5EE8A 2V1ZA 2XD1A 3IXHA 3VSKA 1ES3A 3CMZA 3JVVA 3MBZA 1NWZA 3C8CA 2W3DA 4DN0A 1H8YA 3K3CA 3PHYA 3HLCA 4OQGA 4QB8A 4F3LB 4Q0IA 1ALQA 5AJGA 3MS6A 3PTEA 4KQQA 3BYDA 5F6AA 3C5AA 4QHCA 3NOPC 3VP4A 4GD8A 2D02A 2ZMVA 3ITAA 3VFFA 2AVXA 1GHIA 2QKPA 2ZC5B 1OTBA 1T1AA 3OCLA 3UPPA 1YMXA 1YLZA 4RVAA 4GN2A 3S7PA 4E3MA 1U60A 3ISGA 4KZ5A 1VM1A 5FDHA 2A3UA 2OLVA 4UA9A 4E3JA 4C6YA 3ZG5A 1UWNX 4EQ1A 4U0XA 2JHEA 4JGOA 4BMWA 4S2OA 1K55A 5E2EA 3UDXA 2P04A 3UDFA 3W2ZA 2WGVA 3OC2A 1SKOA 3HCYA 3V5MA 4MDZA 3PBNA 2QWSA 3IBRA 5A8BA 1TF1A 4S2PA 3OPHA 3WS0A 1FCNA 5F82A 2PRFA 1D06A 3NY4A 4BENA 1SKOB 1VETA 2ZM2A 1WA9A 3B42A 1I5QA 2PD7A 3CWFA 5FEFA 4NEED 3KO6A 1OT6A 1BULA 3H9WA 4Q0HA 1SKFA 5F83A 1NXYA 1VETB 1MBLA 1Y28A 2C5WB 1XJ2A 1XX2A 3VSLA 1CI9A 4B88A 3PBOA 4ESPA 2P9VB 2J7VA 1W7FA 5CTNA 1LHYA 2FFFB 3UE1A 3SW1A 3Q1FA 4GB7A 4E3OA 5M18A 1KVMA 5A90A 3QP6A 3B47A 5TFQA 5FI7A 3KYEA 3OZHA 4PM6A 2W3EA 4GDBA 3K3DA 1X0OA 3A3JA 2PU4A 4JXWA 3PBRA 5GHXA 2V8CA 1K0KA 3BY9A 3AGEA 1TDGA 2H28A 3LR0A 5EFWA 2B18A 3DTMA 3G31A 4UA6A 5LBRA 4HBTA 2V9AA 3C7VA 4I3JA 1BT5A 3IBJA 3SS3A 2ZOHA 1ZG6A 5EVIA 3C30A 2HP9A 4L9FA 2OLUA 1CF0A 3TSGA 3KX0X 1S0WA 2MJ6A 1TS8A 1PZOA 2EX6A 3UPOA 1L0FA 4D60A 3VOZA 3E98A 5EVIB 3JVUA 4EWFA 2ZC4B 1ZG4A 1KVLA 1DRMA 2PBYA 3LFVA 3K2NA 3CZDA 2WGIA 4JF6A 3CAXA 2J3TC 3NJAA 4AFIA 4JF4A 5EVID 4BL3A 1N9BA 1XA7A 2H10A 1YSQA 2WKIA 5M1AA 4PPRA 4PM7A 1DP9A 2Y2JA 1NLZA 2EXBA 5DF9A 5AVEA 3DWKA 1W63Q 3E2KA 1GSWA 3T50A 2EX2A 2FFYA 2JC7A 4IBXA 4KZAA 2HP5A 4KG2A 4FH2A 3VE4A 2UWXA 4R3JA 4P85A 1T19A 3IWIA 1K4FA 3TOIA 3OBFA 2QPNA 4CLCC 2O9CA 1F98A 4XT2A 1KGGA 1JWPA 3F1PA 3TJZC 4JXGA 1PNEA 3MMHA 1K6SA 1G28A 5AQBA 3WRZA 4U0TA 3PXPA 4WZ4A 4R38A 4XT2B 4PHTA 3F1PB 4S2KA 4IVKA 3LR3A 5HL6A 4EBPA
chains in the Genus database with same CATH topology
2J3WA 1S4RA 3T4OA 3FC7A 3LYXA 4KQDA 2KDKA 2PD8A 3LUQA 3T4KA 3MQ0A 2O99A 1W63M 3R4KA 2CMNA 1OPXA 4NKPA 4Q0JA 4CLCA 3UMDA 5HPFA 2LB9A 2A24A 2VA0A 1UGUA 1LT0A 4NXGA 3ICYA 1YSPA 2J80A 4EXOA 3C38A 4MCWA 2XSSA 1BYWA 1LSWA 4K08A 2W3FA 4YWZA 5HPIA 1H8MA 4HH3A 4CLCB 4I5SA 4L0LA 4CQHA 2EA9A 3EEAA 3ZQ5A 2A24B 5CX7A 2FH5A 2VJWA 4I3AA 3CUEC 3FG8A 4NXEA 1TS0A 5DJUA 3TRCA 3UE6A 3NOTC 4ZRRA 2HJ9C 4G3WA 4E04A 1S4SA 1LSVA 4LLOB 4CLCD 4BJPA 4PAUA 3OOVA 2VKSA 2HJEA 4CLCE 2Y79A 4YNRA 1NRJA 2NUTC 3T4JA 4YOFA 2V1AA 4OOLA 5HDSA 1JNUA 3IS2A 3A0SA 3OLOA 3CLOA 1P9WA 2W27A 3F1OB 2WKQA 4EUVA 2B02A 2G7UA 5J4EA 3T4SA 5HWWA 2GJ3A 3CUEA 1OTEA 3D72A 3EGXC 3UMEA 1GSVA 2WKRA 3PBSA 5KIZA 4ARZA 3VOLA 2W3HA 2K2NA 4HJ4A 5FL3A 5KSHA 4GJ4A 2BASA 4BBUA 4L9EA 2OWHA 4BBTA 3A0VA 3IS2B 1XFNA 5DFXA 5F68A 3D3OA 2GX5A 2EWVA 1XJ3A 2W1TA 1P97A 2PYPA 3EEHA 5AVFA 3E4PA 4ARZB 3LIAA 5J3WA 2QHKA 4EERA 5HD5A 1OTIA 3RFBA 3E4OA 4I38A 1LSXA 5J7EA 5MC7A 2KOIA 4IHQA 4F3LA 3E0YA 2L4RA 4HOIA 2VGLM 1T1BA 2W1TB 2Y8HA 4O01A 3FPWA 1F5MA 3TE8A 3DBAA 5HDDA 3JVVA 4LRXC 1NWZA 1VHMA 3NHQA 3C8CA 2W3DA 3B33A 3K3CA 2M7UA 4DN0A 3PHYA 4F3LB 3G6OA 4DJ3A 1MKMA 3MR0A 4Q0IA 4KQOA 2Z6CA 2QYBA 2J3TD 1XJ6A 5AJGA 3MJQA 2XA7M 4HP4A 4LRYC 4HIAA 1TS7A 4NXFA 3EWKA 3OCNA 1YKDA 5F6AA 3EOIA 3NOPC 1IOUA 4BWIA 2D02A 5F69A 2ZMVA 4EU0A 4R70A 2QKPA 1OTBA 1T1AA 2M7VA 3ULFA 3OCLA 5I5LA 2V1BA 2LB5A 4WLAA 2JKRM 2VEAA 3MQOA 4IJGA 1STZA 5DKKA 4HH2A 3O5YA 3S7PA 4L9GA 5HWVA 1S67L 2JKTM 3T4QA 1NLYA 5DFYA 2JKRI 4IUHA 2GZAA 3KSFA 2P7JA 3UB6A 4GW9A 1UWNX 3BJNA 3F1NB 4MN6A 4EQ1A 2JHEA 4JGOA 4BMWA 2JKTI 4MN5A 3EGDC 4WF0A 4HQAA 1T1CA 4WELA 1OJGA 2P04A 4HJ3A 3W2ZA 2OWJA 3OC2A 3F1OA 4UEYA 3A0RA 3HCYA 4MDZA 4UQIS 3PBNA 2QWSA 3IBRA 5HSQA 5A8BA 1TF1A 1LL8A 4HNBA 1G6OA 2P08A 1UWPX 3VV4A 1ZHHB 2OOLA 3UB8A 4B93A 4LPZA 3MFXA 4P6ZS 4R3AA 1D06A 5HDCA 3TW8A 3LIBA 1S1YA 1WA9A 2JN7A 3B42A 1S66L 2WKPA 4HY8A 2PD7A 3CWFA 4NEED 3KO6A 1OT6A 2PYRA 4FSFA 2HGVA 3H9WA 2VV7A 4Q0HA 1IFQA 3GECA 2PR6A 2I9VA 4JGRA 1D7EA 1Y28A 1XJ2A 3FPVA 4JGQA 2XRNA 2VX8A 3PBOA 5DJTA 3KSGA 2A2LA 1N9LA 5HWTA 3H7WB 3UB7A 3LIFA 3KSIA 2M1CA 3SW1A 4RQ9A 3VE3A 4JGPA 1TS6A 2IA2A 4BBVA 3B47A 3RTYA 1OTDA 5TJJA 1XFQA 5HD3A 3MQQA 4QPRA 3T4LA 4Y5FA 2YKFA 1GSXA 1V9YA 3H82A 4KUOA 4G3VA 1S1ZA 2ZMFA 1H3QA 4GHIA 1N9NA 2W3EA 3K3DA 1X0OA 2OAQ1 3R7WA 2K7SA 1MC0A 2O0YA 1P0ZA 5C5KA 3PBRA 4I3IA 3BY9A 1ODVA 3BQ8A 2W1RA 3MF0A 3H82B 4PKYG 2Z6DA 2KLIA 3PBQA 3E4QA 2H28A 5G4ZA 4GHIB 3PR6A 3LR0A 2KX6A 2OAP1 5EFWA 1EW0A 2B18A 3HJIA 2FZ0A 3S7QA 3R7WB 3UB9A 5LBRA 2V9AA 4I3JA 2W3GA 3MXQA 4Y2FA 3IBJA 3F1NA 5K5BA 3RH8B 1MZUA 3BW6A 2ZOHA 4MMNA 4ETZA 3C30A 4L9FA 5HZHA 1OT9A 5L8MA 4NXBA 5TBMA 4GCZA 3KX0X 2MJ6A 1TS8A 2V0UA 2PR5A 2R78A 3EQVA 3LIEA 2YKHA 3E98A 4I39A 1OTAA 3JVUA 4G3KA 1KOUA 4ME4A 3NOUC 4WEJA 5TBMB 2HF6A 1DRMA 2QJ5A 3LFVA 2W0NA 5IS1A 2QJ7A 3K2NA 4R6LA 4IUKA 2V0WA 3S7NA 4ETXA 2VV6A 3CAXA 2J3TC 4WN5A 4HI4A 1DP8A 3P01A 4Y3IA 2INWA 3V67A 2VZWA 3NJAA 4AFIA 3S7OA 4O8GA 2L0WA 4EESA 1OJ5A 1YSQA 4EW7A 4O0PA 4H6JA 2ZBBA 3LI9A 1DP6A 1DP9A 4DJ2A 1V9ZA 3BQAA 4UQIM 2VV8A 3H7WA 3GDIA 1F9IA 1NLZA 1T18A 4OOMA 5DF9A 4Z1WA 4B9OA 5AVEA 2NUPC 1W63Q 3LICA 1GSWA 4PKYA 3LI8A 4H6JB 3KYQA 4P6ZM 3T50A 4DMZA 3ZYTA 4GLQA 4EEUA 5IU1A 3HJKA 2DMWA 2VGLS 2K31A 4LRZE 4M4XA 4KUKA 1ZTUA 4EETB 3VE4A 3KSHA 3CI6A 2GNXA 4GS9A 3BWLA 3LR4A 2O9BA 1T19A 1YAXA 2O9AA 2HV1A 3P7NA 3LIDA 3OBFA 4HHDA 3U2AA 4WL9A 4CLCC 2ZOIA 3PBTA 4WUJA 5F5YA 2O9CA 1F98A 3CITA 3EQUA 4II7A 2D01A 5DKLA 3LR5A 4XT2A 4HJ6A 3F1PA 4EEPA 2PT7A 2XA7S 4GS9B 3TJZC 2PDRA 2PHYA 3T4TA 3KYZA 3MMHA 4HP9A 3PYPA 4MN7A 4FOFA 1G28A 5G4YA 2XROA 1XJ4A 3C2WA 3UE3A 2EWWA 1VB6A 3PXPA 4R38A 4WEKA 4XT2B 1N9OA 4PHTA 2VLGA 5IT5A 1TD5A 3F1PB 3BY8A 3LR3A 1P9RA 5HL6A 2L1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P01 A; 
#chains in the Genus database with same CATH topology
 4WBG A;  3T12 B;  3T4O A;  5EEC A;  3LUQ A;  2ZQD A;  3T4K A;  3MQ0 A;  3OPL A;  4KZ9 A;  1E3U D;  1UGU A;  1LT0 A;  1K6R A;  4N92 A;  3UB5 P;  3ZG8 B;  2J80 A;  4MCW A;  1WYB A;  1BYW A;  3QP4 A;  4K08 A;  1FIL A;  1FIK A;  2ZD8 A;  4I5S A;  4CQH A;  2EA9 A;  4PM9 A;  4WZ5 C;  3WS4 A;  3CUE C;  4OVD A;  3O3V A;  1DJB A;  2BTF P;  4QD4 A;  3TG9 A;  3TRC A;  2HJ9 C;  4G3W A;  3QP2 A;  4ID4 A;  4E04 A;  1FR1 A;  1CJF A;  4YIN A;  1L0E A;  3OOV A;  3VP3 A;  5E2G A;  2HJE A;  3DTE A;  3LY3 A;  3BFC A;  1CK3 A;  5FI2 A;  2UV0 E;  5CED A;  3T4J A;  4YOF A;  3ZVT A;  3BLS A;  3IS2 A;  4KG5 A;  3UY6 A;  2Y2P A;  3WS2 A;  3F1O B;  3DWZ A;  2WKQ A;  2B02 A;  2G7U A;  5HWW A;  3DW0 A;  3D72 A;  4ARZ A;  3UDI A;  4HJ4 A;  4BBT A;  3LEQ A;  3A0V A;  4ZDX A;  3IS2 B;  3ZVW A;  2WZX A;  3D3O A;  4X25 A;  4DE2 A;  1HTZ A;  1XJ3 A;  4JXV A;  2W1T A;  3E2L A;  2PYP A;  3P98 A;  3QNB A;  5L07 A;  4ARZ B;  2WK0 A;  5J3W A;  5HD5 A;  4E6W A;  2ZQ8 A;  2L4R A;  1T1B A;  2W1T B;  1PI4 A;  1H8Z A;  2HDS A;  1RP5 A;  5HDD A;  5J8X A;  1Q2P A;  2M7U A;  3G6O A;  4DJ3 A;  3MR0 A;  4UA7 A;  3HLB A;  5I94 A;  2Z6C A;  2J3T D;  4R3B A;  3WRT A;  1KDW A;  3Q07 A;  3EWK A;  4OLG A;  2ZQ7 A;  3SH7 A;  3LY4 A;  5CGW A;  1XGI A;  3GMW A;  3S4X A;  2M7V A;  1NYM A;  3B3X A;  4QY6 A;  4KQR A;  2WAF A;  3MQO A;  1NJ4 A;  2J9O A;  3O5Y A;  4L9G A;  5HWV A;  1S67 L;  2JKT M;  3T4Q A;  5CEC A;  3G32 A;  2DNS A;  3HBR A;  4H8R A;  1FQG A;  1LL9 A;  4IUH A;  2GZA A;  4QJG A;  4ZAM A;  4Y0T A;  1ERO A;  4GW9 A;  3RXX A;  3F1N B;  1IYO A;  2IWC A;  4MN6 A;  3HL9 A;  2JKT I;  4MN5 A;  1OME A;  4HQA A;  1T1C A;  1OJG A;  3DTI A;  3T1S A;  4QWO A;  4S2L A;  2OWJ A;  1K54 C;  4C75 A;  3G30 A;  3GTC A;  3IH9 A;  4Y0U A;  3U4L P;  4UQI S;  4Y13 A;  1Q2Q A;  2Y2M A;  3I7J A;  3FYZ A;  4N9K A;  4LPZ A;  3MFX A;  5KMW A;  2RL3 A;  3TW8 A;  4WZ5 A;  1CQA A;  2JN7 A;  4FSF A;  2HGV A;  1KGE A;  4Y7P A;  1D7E A;  1LL5 A;  2HDQ A;  3FPV A;  4E3L A;  2ZMA A;  3GVB A;  4JGQ A;  1PW1 A;  2XRN A;  2VX8 A;  2WKH A;  4S2I A;  4F94 A;  2HDR A;  4GNU A;  2M1C A;  3NUL A;  5EUA A;  2J9P A;  1GA0 A;  4OP8 A;  4KG6 A;  3VE3 A;  4JGP A;  1TS6 A;  4R1G A;  3RTY A;  1OTD A;  3T4L A;  5EVI C;  1G5U A;  1GSX A;  1LI9 A;  1K57 C;  1S1Z A;  3BFE A;  4BLM A;  4DKI A;  5CGX A;  1ERM A;  3IT9 A;  1ESU A;  1MC0 A;  3Q7Z A;  5FAO A;  1W8Q A;  2RCX A;  1BLS A;  3L9K A;  4KZ7 A;  1ZC2 A;  1BUE A;  5DVA A;  2OAP 1;  4PM8 A;  1FCO A;  4GDN A;  2GDN A;  3N8S A;  2FZ0 A;  2W3G A;  3MXQ A;  4IVI A;  4K0X A;  5K5B A;  4ZTK A;  4R4S A;  4CJN A;  4MMN A;  2V2F F;  5HZH A;  4MBK A;  3FZC A;  4N1X A;  4WM9 A;  1YM1 A;  5FQJ A;  5TBM A;  3ZNY A;  5CTM A;  1PWD A;  3ITB A;  4BD1 A;  1NZU A;  3ZDJ A;  4X6T A;  2V0U A;  2PR5 A;  2R78 A;  3LIE A;  3Q7V A;  2C6W B;  4G3K A;  1FSY A;  4FTX A;  3NOU C;  1J9M A;  5TBM B;  3RXW A;  2R9X A;  2QJ7 A;  4YFM A;  3NI9 A;  3MZE A;  3S7N A;  5TGF A;  3Q7V B;  4WN5 A;  3IF6 A;  1BTL A;  5EVE A;  4HI4 A;  4DE1 A;  1IEL A;  2INW A;  3V67 A;  3UNW A;  3S7O A;  4O8G A;  2H0T A;  4EES A;  1BLP A;  1OJ5 A;  1XKZ A;  4EW7 A;  3LI9 A;  1DP6 A;  3GSG A;  4MEZ A;  3ZG0 A;  3IF6 B;  2P9V A;  1GHM A;  1V9Z A;  1MKI A;  3BQA A;  3NCK A;  4UQI M;  3HVF A;  3GDI A;  3NIA A;  4KZB A;  1Z09 A;  2NUP C;  1K54 A;  3LIC A;  4PKY A;  4PMA A;  3MXS A;  5HAP A;  3KYQ A;  3GV9 A;  5IU1 A;  1ES4 A;  3IXB A;  2VGL S;  1K38 A;  2K31 A;  4LRZ E;  4M4X A;  3BM6 A;  1HLU P;  3W4Q A;  3CI6 A;  5FDS A;  3LR4 A;  3WS1 A;  1XGJ A;  4HHD A;  2B95 A;  1ES2 A;  2ZOI A;  3PBT A;  5AQ9 A;  5F5Y A;  4N1H A;  3HLG A;  3LR5 A;  1PIO A;  3ZNT A;  4EEP A;  2PT7 A;  2XA7 S;  1ZKJ A;  3LCE A;  5KZH A;  2PHY A;  5A92 A;  3PYP A;  4MN7 A;  4XUZ A;  4FOF A;  2XRO A;  3UE3 A;  3A3F A;  1DJC A;  4WEK A;  2VLG A;  4LV2 A;  3Q81 A;  3LEZ A;  4XUX A;  4C3Q A;  1PFL A;  2J3W A;  1JVJ A;  2Q9N A;  3LYX A;  4KQD A;  1ONH A;  2KDK A;  2PD8 A;  2J8Y A;  3AGD A;  2O99 A;  1OPX A;  2VGK A;  2VA0 A;  3OPP A;  1K57 A;  2WAD A;  4HEF A;  3ICY A;  1YSP A;  2EXA A;  4EXO A;  1NZO A;  1E4D A;  5F1G A;  4YWZ A;  5HPI A;  4A5R A;  4X55 A;  3ZQ5 A;  5FA7 A;  1JTD A;  2FH5 A;  4NK3 A;  4I3A A;  4NXE A;  4K0W A;  1M6K A;  3NOT C;  1HVB A;  5GHZ A;  1IYQ A;  1L2S A;  2XQZ A;  1LSV A;  5DF8 A;  4HBU A;  4LCM A;  4PAU A;  1K56 A;  2VKS A;  3O88 A;  4CLC E;  2Y79 A;  1JTG A;  2NUT C;  3QHY A;  2ZL1 A;  3SS4 A;  5HDS A;  3QP8 A;  1AWI A;  2XFT A;  4KZ3 A;  2JCH A;  1P9W A;  3IXG A;  2Y2Q A;  4B4Z A;  5J4E A;  4GD6 A;  3T4S A;  2Y59 A;  3RJU A;  1LLB A;  2K2N A;  2ZL1 B;  1VQQ A;  5DFX A;  3LO7 A;  2GX5 A;  2EWV A;  4GKU A;  4KEN B;  2VK3 A;  1MXO A;  1P97 A;  1E3U A;  3UN7 A;  3E4P A;  4OPZ A;  4E6X A;  1K56 D;  3FKW A;  1FR6 A;  1TVF A;  2ACG A;  1LSX A;  3IHB A;  5J7E A;  5MC7 A;  4IHQ A;  2VGL M;  5EM0 A;  5GL9 A;  1J3W A;  1Y54 A;  3UE0 A;  4OPR A;  4LRX C;  3MXR A;  2BLS A;  1VHM A;  2WAE A;  4OQH A;  1G6A A;  1MKM A;  3MKF A;  4KQO A;  5EOE A;  2QYB A;  2XEP A;  1XJ6 A;  3W8K A;  1YT4 A;  2XA7 M;  5E2F A;  4DE3 A;  4LRY C;  3IX4 A;  4HIA A;  1TS7 A;  2JE5 A;  5FQI A;  3O87 A;  1IOU A;  4P6B A;  4BWI A;  4OLD A;  5F69 A;  3N8R A;  4Z9Q A;  4EU0 A;  3HLE A;  1HD8 A;  3AGF A;  1YMS A;  3GRJ A;  4WLA A;  2VEA A;  3O86 A;  1QME A;  4IJG A;  1STZ A;  2QMI A;  4DRT A;  4HH2 A;  4FD8 A;  3T1R A;  2I72 A;  4LFU A;  5DFY A;  4JF5 A;  3BFG A;  1YLW A;  1EI5 A;  2P7J A;  3BJN A;  5GLB A;  3NDG A;  3OPR A;  2BG1 A;  4WF0 A;  3WWX A;  5EV0 A;  3NBL A;  3F1O A;  5DF7 A;  3A0R A;  4OQI A;  2JKF A;  1O07 A;  5FSR A;  4DE0 A;  2ZQ9 A;  4UAA A;  4ZJ3 A;  1XXM A;  4UHU A;  2G2W A;  1LL8 A;  1MWR A;  1UWP X;  3VV4 A;  1ZHH B;  4NET A;  2OOL A;  3UB8 A;  4B93 A;  3VP0 A;  4P6Z S;  5HDC A;  3HUN A;  3VMA A;  1S1Y A;  4X56 A;  4OPY A;  2ZM8 A;  1S66 L;  4HY8 A;  3BLM A;  4E3K A;  3NDE A;  2A49 A;  5FQ9 A;  2VV7 A;  2ZJ9 A;  3BEC A;  1XP4 A;  4IED A;  3GEC A;  2PR6 A;  5CGS A;  4X69 A;  1IKG A;  5DJT A;  2A2L A;  5CEB A;  1N9L A;  3N7W A;  4HES A;  5HWT A;  3H7W B;  3SOI A;  3UB7 A;  3LIF A;  5L09 A;  3KSI A;  2Y2I A;  3UO9 A;  3MZD A;  4RQ9 A;  5G18 A;  2IA2 A;  2IWB A;  2ZLY A;  4QPR A;  3P09 A;  3G34 A;  1BSG A;  3H82 A;  4MBH A;  2ZMF A;  1N9N A;  3NC8 A;  3S22 A;  5BOH A;  5JYP A;  2WGW B;  2OAQ 1;  3ZG9 B;  2G2U A;  2K7S A;  4ZBE A;  5C5K A;  1IKI A;  1ODV A;  1GA9 A;  3BQ8 A;  3H82 B;  4PKY G;  2Z6D A;  5G4Z A;  5AQ7 A;  2XF3 A;  1Z6F A;  2KX6 A;  1PYY A;  1EW0 A;  3MFD A;  3HJI A;  3S7Q A;  1W79 A;  2QZ6 A;  1SDE A;  4Y2F A;  3F1N A;  3IF6 C;  4OPQ A;  3BW6 A;  3QNC A;  4GOG A;  4M3K A;  4KZ8 A;  1N4O A;  5L8M A;  4NXB A;  1CI8 A;  5CXW A;  1HZO A;  4GCZ A;  4EBL A;  3D4F A;  3BRM A;  4EUZ A;  5FQQ A;  4I39 A;  1D1J A;  4BD0 A;  1OTA A;  3GR2 A;  5AQA A;  3PAG A;  1L0G A;  1KOU A;  2OSU A;  5CRF A;  5L2F A;  4WYY A;  1DJA A;  2QJ5 A;  3C4O A;  2V0W A;  4LEN A;  1FCM A;  4DXB A;  3G4P A;  3ZFZ A;  2ZC3 B;  1DP8 A;  3P01 A;  4Y3I A;  1YLT A;  3FWL A;  4OKP A;  1RGY A;  2L0W A;  4DXC A;  4XXR A;  2ZBB A;  1K4E A;  5FEG A;  1IEM A;  5DTK A;  3V39 A;  1GHP A;  3D9Y A;  1JWZ A;  1G68 A;  2VV8 A;  3CJM A;  1T18 A;  1K25 A;  4Z1W A;  1IYP A;  1ERQ A;  3LI8 A;  4K91 A;  4OOY A;  4DMZ A;  4JLF A;  3C4P A;  3L7H A;  4P6Z M;  3V3S A;  4GLQ A;  4EEU A;  3HJK A;  4BL2 A;  2Y2N A;  5HFO A;  2Y2H A;  4MBF A;  5HW3 A;  1ZTU A;  1E25 A;  3KSH A;  4BQM A;  4GS9 A;  5EM1 A;  3BWL A;  2XFS A;  1YAX A;  2O9A A;  3SH8 A;  3P7N A;  2PU2 A;  4RYE A;  1KE0 A;  3U2A A;  4WL9 A;  2OV5 A;  1VEU A;  4WUJ A;  1BLH A;  4II7 A;  3CIT A;  3EQU A;  5DKL A;  1O7E A;  4LV1 A;  1A0K A;  4HJ6 A;  3FV7 A;  4GS9 B;  5DTS A;  3A3I A;  3KYZ A;  3IQA A;  3VOY A;  3A3E A;  4U3T A;  1XJ4 A;  3C2W A;  2EWW A;  1VEU B;  1VB6 A;  3S1Y A;  1YPR A;  1N9O A;  5IT5 A;  1NY0 A;  3VP1 A;  1P9R A;  1MWT A;  3T1Q B;  4KZ6 A;  5FQK A;  3FC7 A;  3HUO A;  1FOF A;  2CMN A;  1TEM A;  3N4I A;  4RX3 A;  4X1M A;  1XA1 A;  4B4X A;  2DCF A;  2XSS A;  1H8M A;  4HH3 A;  4S2N C;  2E8I A;  2B5R A;  2DRW A;  2X01 A;  4WMC A;  3NEC A;  2Y91 A;  5DJU A;  4ZRR A;  4IBR A;  3V50 A;  1FSW A;  1F2K A;  5JYO A;  4FCF A;  4BJP A;  1Y4O A;  4ZJ1 A;  4YNR A;  5KSC A;  1IYS A;  5GLC A;  3ZHH A;  2V1A A;  3N6I A;  4OOL A;  4DDS A;  5U47 A;  3OLO A;  3CLO A;  1PWG A;  3FKV A;  3JYI A;  4EUV A;  5HL1 A;  2R9W A;  4E3N A;  3UME A;  4DF6 A;  2WKR A;  4WMC D;  5KIZ A;  4P0M A;  2W3H A;  2Y2O A;  5FL3 A;  4GJ4 A;  2EFX A;  4L9E A;  2OWH A;  1XFN A;  5F68 A;  2XK1 A;  1QMF A;  3QP5 A;  4MLL A;  1WE4 A;  1GCE A;  4X68 A;  1SDN A;  5L10 A;  2H0Y A;  1KGF A;  3G2Y A;  3T1X A;  3E0Y A;  5A93 A;  3MKE A;  2Y8H A;  1JWV A;  3N8L A;  3FPW A;  1MY8 A;  1F5M A;  3TE8 A;  3DBA A;  2ZQA A;  4R23 A;  3NHQ A;  1ACF A;  2WZZ A;  3B33 A;  4MNR A;  4D2O A;  3MJQ A;  2Q0O A;  4HP4 A;  1XPB A;  4NXF A;  5FI6 A;  1W5D A;  4KZ4 A;  3OCN A;  1YKD A;  2XDM A;  3EOI A;  5M19 A;  3A3D A;  4O7D A;  3PAE A;  1PZP A;  1WYC A;  3IX8 A;  4R70 A;  4E3I A;  1YLJ A;  3ULF A;  5I5L A;  2V1B A;  2LB5 A;  2XD5 A;  4Y17 A;  3JPU A;  2JKR M;  1W8Y A;  3VFH A;  5DKK A;  1M40 A;  1SCW A;  4PM5 A;  4EV4 A;  1NLY A;  5E43 A;  2JKR I;  2EX8 A;  3KSF A;  3Q82 A;  3UB6 A;  1KDS A;  3ZGA B;  3ZG7 B;  2P74 A;  3EGD C;  4WEL A;  2ZQC A;  3UPN A;  2EFU A;  4HJ3 A;  3SH9 A;  2Y55 A;  1BLC A;  4UEY A;  1NRF A;  1PRQ A;  4FUW A;  5HSQ A;  4HNB A;  1G6O A;  2P08 A;  3HLW A;  4S2N A;  4R3A A;  3GQZ A;  3LIB A;  2WKP A;  2PYR A;  2IWD A;  5A91 A;  1L3L A;  3M2K A;  1ES5 A;  1IFQ A;  3WS5 A;  1DY6 A;  2I9V A;  4JGR A;  5F1F A;  4X1L A;  5GHY A;  3SS5 A;  5CHM A;  2CC1 A;  3KSG A;  1RGZ A;  4LV3 A;  4RX2 A;  2VGJ A;  2HP6 A;  4R4R A;  4EBN A;  4BBV A;  1PWC A;  4OQ0 A;  5TJJ A;  1XFQ A;  5HD3 A;  3MQQ A;  3IXD A;  4Y5F A;  2HZ5 A;  1V9Y A;  2YKF A;  3IH8 A;  2ZC6 B;  1I2W A;  4KUO A;  4G3V A;  4P87 A;  4Q8I A;  1H3Q A;  4GHI A;  3MZF A;  3R7W A;  3HRE A;  2O0Y A;  1P0Z A;  1H0M A;  1TDL A;  1CEF A;  3HUM A;  4I3I A;  4N9L A;  2W1R A;  3MF0 A;  4JXS A;  2KLI A;  3PBQ A;  3E4Q A;  5HX9 A;  4GHI B;  3PR6 A;  5DTT A;  3R7W B;  3UB9 A;  5GLA A;  5FAQ A;  3RH8 B;  1MZU A;  4RA7 A;  5HAR A;  4ETZ A;  2PBD P;  1OT9 A;  2ZM0 A;  3HLD A;  5GLD A;  4QY5 A;  3EQV A;  2YKH A;  3CPT A;  4ME4 A;  4WEJ A;  2HF6 A;  3IHA A;  5EPH A;  5IS1 A;  2W0N A;  4R6L A;  4IUK A;  3IWQ A;  4ETX A;  4CPK A;  2WUQ A;  2VV6 A;  3CPT B;  4X53 A;  3CHW P;  2H5S A;  1MWS A;  3BFF A;  2VZW A;  5CHJ A;  1H5X A;  5IHV A;  2PAV P;  5HAQ A;  4JBF A;  1ONG A;  3M6H A;  2X02 A;  4O0P A;  4H6J A;  4OON A;  1L0D A;  3HLF A;  4NG2 A;  1RCJ A;  4JKT A;  5EOO A;  3ZCZ A;  4DJ2 A;  4LV0 A;  2E8J A;  3H7W A;  1F9I A;  4OOM A;  5FAS A;  4B9O A;  5E2H A;  1MPL A;  4H6J B;  1NYY A;  3ZYT A;  1PI5 A;  3IWO A;  2DMW A;  1KE3 A;  1MWU A;  1SHV A;  4KUK A;  4EET B;  2JKG A;  4S2J A;  2GNX A;  2O9B A;  2Y2G A;  2HV1 A;  2WGW A;  1SZV A;  3LID A;  1BZA A;  4DDY A;  3QP1 A;  3DAV A;  2D01 A;  4R0Q A;  1CEG A;  1YQS A;  2V20 A;  2PDR A;  3T4T A;  5HAI A;  4HP9 A;  5FQM A;  5G4Y A;  5FAT A;  3BEB A;  2HPB A;  4OP5 A;  1S6R A;  2XR0 A;  1TD5 A;  2HDU A;  2XLN A;  3G2Z A;  3BY8 A;  2L1M A;  3MSH A;  1S4R A;  3W4P A;  5CHU A;  2X71 A;  1W63 M;  1K55 C;  2Y2K A;  3R4K A;  4NKP A;  4Q0J A;  4CLC A;  3UMD A;  5HPF A;  2LB9 A;  2A24 A;  1ESI A;  5D3O A;  3IX3 A;  4NXG A;  2ZC7 A;  2Y2L A;  3C38 A;  3LGO A;  1LSW A;  4GZB A;  4S2M A;  3V3R A;  3M2J A;  2W3F A;  3G35 A;  3M6B A;  4CLC B;  4L0L A;  3EEA A;  2A24 B;  3W4O A;  2XH9 A;  5CX7 A;  1KE4 A;  2VJW A;  3FG8 A;  1TS0 A;  3SZT A;  3UE6 A;  4LCL A;  5CER A;  1S4S A;  2V8F A;  4LLO B;  5FAP A;  4CLC D;  2Z2L B;  3VP2 A;  1NRJ A;  4QU3 A;  1C3B A;  4Y0O A;  1AXB A;  1JNU A;  5EVL A;  3A0S A;  3DTK A;  2Z2M B;  2W27 A;  3C7U A;  2GJ3 A;  3CUE A;  1OTE A;  1PW8 A;  3EGX C;  4Y15 A;  1GSV A;  3CG5 A;  4EQI A;  3PBS A;  1LI0 A;  4ZJ2 A;  1EWZ A;  3VOL A;  2JBF A;  2XGN A;  5KSH A;  2BAS A;  4BBU A;  5TR7 A;  1YLP A;  3BFD A;  2Y4A A;  3IF5 A;  4JPM A;  5AVF A;  3EEH A;  2EX9 A;  2WYX A;  3LIA A;  2QHK A;  4LGW A;  4EER A;  1OTI A;  3RFB A;  3E4O A;  4I38 A;  1I2S A;  1YLY A;  2KOI A;  2Q9M A;  2WKE A;  4F3L A;  4HOI A;  4O01 A;  4OH0 A;  4FH4 A;  5EE8 A;  2V1Z A;  2XD1 A;  3IXH A;  3VSK A;  1ES3 A;  3CMZ A;  3JVV A;  3MBZ A;  1NWZ A;  3C8C A;  2W3D A;  4DN0 A;  1H8Y A;  3K3C A;  3PHY A;  3HLC A;  4OQG A;  4QB8 A;  4F3L B;  4Q0I A;  1ALQ A;  5AJG A;  3MS6 A;  3PTE A;  4KQQ A;  3BYD A;  5F6A A;  3C5A A;  4QHC A;  3NOP C;  3VP4 A;  4GD8 A;  2D02 A;  2ZMV A;  3ITA A;  3VFF A;  2AVX A;  1GHI A;  2QKP A;  2ZC5 B;  1OTB A;  1T1A A;  3OCL A;  3UPP A;  1YMX A;  1YLZ A;  4RVA A;  4GN2 A;  3S7P A;  4E3M A;  1U60 A;  3ISG A;  4KZ5 A;  1VM1 A;  5FDH A;  2A3U A;  2OLV A;  4UA9 A;  4E3J A;  4C6Y A;  3ZG5 A;  1UWN X;  4EQ1 A;  4U0X A;  2JHE A;  4JGO A;  4BMW A;  4S2O A;  1K55 A;  5E2E A;  3UDX A;  2P04 A;  3UDF A;  3W2Z A;  2WGV A;  3OC2 A;  1SKO A;  3HCY A;  3V5M A;  4MDZ A;  3PBN A;  2QWS A;  3IBR A;  5A8B A;  1TF1 A;  4S2P A;  3OPH A;  3WS0 A;  1FCN A;  5F82 A;  2PRF A;  1D06 A;  3NY4 A;  4BEN A;  1SKO B;  1VET A;  2ZM2 A;  1WA9 A;  3B42 A;  1I5Q A;  2PD7 A;  3CWF A;  5FEF A;  4NEE D;  3KO6 A;  1OT6 A;  1BUL A;  3H9W A;  4Q0H A;  1SKF A;  5F83 A;  1NXY A;  1VET B;  1MBL A;  1Y28 A;  2C5W B;  1XJ2 A;  1XX2 A;  3VSL A;  1CI9 A;  4B88 A;  3PBO A;  4ESP A;  2P9V B;  2J7V A;  1W7F A;  5CTN A;  1LHY A;  2FFF B;  3UE1 A;  3SW1 A;  3Q1F A;  4GB7 A;  4E3O A;  5M18 A;  1KVM A;  5A90 A;  3QP6 A;  3B47 A;  5TFQ A;  5FI7 A;  3KYE A;  3OZH A;  4PM6 A;  2W3E A;  4GDB A;  3K3D A;  1X0O A;  3A3J A;  2PU4 A;  4JXW A;  3PBR A;  5GHX A;  2V8C A;  1K0K A;  3BY9 A;  3AGE A;  1TDG A;  2H28 A;  3LR0 A;  5EFW A;  2B18 A;  3DTM A;  3G31 A;  4UA6 A;  5LBR A;  4HBT A;  2V9A A;  3C7V A;  4I3J A;  1BT5 A;  3IBJ A;  3SS3 A;  2ZOH A;  1ZG6 A;  5EVI A;  3C30 A;  2HP9 A;  4L9F A;  2OLU A;  1CF0 A;  3TSG A;  3KX0 X;  1S0W A;  2MJ6 A;  1TS8 A;  1PZO A;  2EX6 A;  3UPO A;  1L0F A;  4D60 A;  3VOZ A;  3E98 A;  5EVI B;  3JVU A;  4EWF A;  2ZC4 B;  1ZG4 A;  1KVL A;  1DRM A;  2PBY A;  3LFV A;  3K2N A;  3CZD A;  2WGI A;  4JF6 A;  3CAX A;  2J3T C;  3NJA A;  4AFI A;  4JF4 A;  5EVI D;  4BL3 A;  1N9B A;  1XA7 A;  2H10 A;  1YSQ A;  2WKI A;  5M1A A;  4PPR A;  4PM7 A;  1DP9 A;  2Y2J A;  1NLZ A;  2EXB A;  5DF9 A;  5AVE A;  3DWK A;  1W63 Q;  3E2K A;  1GSW A;  3T50 A;  2EX2 A;  2FFY A;  2JC7 A;  4IBX A;  4KZA A;  2HP5 A;  4KG2 A;  4FH2 A;  3VE4 A;  2UWX A;  4R3J A;  4P85 A;  1T19 A;  3IWI A;  1K4F A;  3TOI A;  3OBF A;  2QPN A;  4CLC C;  2O9C A;  1F98 A;  4XT2 A;  1KGG A;  1JWP A;  3F1P A;  3TJZ C;  4JXG A;  1PNE A;  3MMH A;  1K6S A;  1G28 A;  5AQB A;  3WRZ A;  4U0T A;  3PXP A;  4WZ4 A;  4R38 A;  4XT2 B;  4PHT A;  3F1P B;  4S2K A;  4IVK A;  3LR3 A;  5HL6 A;  4EBP A; 
#chains in the Genus database with same CATH homology
 2J3W A;  1S4R A;  3T4O A;  3FC7 A;  3LYX A;  4KQD A;  2KDK A;  2PD8 A;  3LUQ A;  3T4K A;  3MQ0 A;  2O99 A;  1W63 M;  3R4K A;  2CMN A;  1OPX A;  4NKP A;  4Q0J A;  4CLC A;  3UMD A;  5HPF A;  2LB9 A;  2A24 A;  2VA0 A;  1UGU A;  1LT0 A;  4NXG A;  3ICY A;  1YSP A;  2J80 A;  4EXO A;  3C38 A;  4MCW A;  2XSS A;  1BYW A;  1LSW A;  4K08 A;  2W3F A;  4YWZ A;  5HPI A;  1H8M A;  4HH3 A;  4CLC B;  4I5S A;  4L0L A;  4CQH A;  2EA9 A;  3EEA A;  3ZQ5 A;  2A24 B;  5CX7 A;  2FH5 A;  2VJW A;  4I3A A;  3CUE C;  3FG8 A;  4NXE A;  1TS0 A;  5DJU A;  3TRC A;  3UE6 A;  3NOT C;  4ZRR A;  2HJ9 C;  4G3W A;  4E04 A;  1S4S A;  1LSV A;  4LLO B;  4CLC D;  4BJP A;  4PAU A;  3OOV A;  2VKS A;  2HJE A;  4CLC E;  2Y79 A;  4YNR A;  1NRJ A;  2NUT C;  3T4J A;  4YOF A;  2V1A A;  4OOL A;  5HDS A;  1JNU A;  3IS2 A;  3A0S A;  3OLO A;  3CLO A;  1P9W A;  2W27 A;  3F1O B;  2WKQ A;  4EUV A;  2B02 A;  2G7U A;  5J4E A;  3T4S A;  5HWW A;  2GJ3 A;  3CUE A;  1OTE A;  3D72 A;  3EGX C;  3UME A;  1GSV A;  2WKR A;  3PBS A;  5KIZ A;  4ARZ A;  3VOL A;  2W3H A;  2K2N A;  4HJ4 A;  5FL3 A;  5KSH A;  4GJ4 A;  2BAS A;  4BBU A;  4L9E A;  2OWH A;  4BBT A;  3A0V A;  3IS2 B;  1XFN A;  5DFX A;  5F68 A;  3D3O A;  2GX5 A;  2EWV A;  1XJ3 A;  2W1T A;  1P97 A;  2PYP A;  3EEH A;  5AVF A;  3E4P A;  4ARZ B;  3LIA A;  5J3W A;  2QHK A;  4EER A;  5HD5 A;  1OTI A;  3RFB A;  3E4O A;  4I38 A;  1LSX A;  5J7E A;  5MC7 A;  2KOI A;  4IHQ A;  4F3L A;  3E0Y A;  2L4R A;  4HOI A;  2VGL M;  1T1B A;  2W1T B;  2Y8H A;  4O01 A;  3FPW A;  1F5M A;  3TE8 A;  3DBA A;  5HDD A;  3JVV A;  4LRX C;  1NWZ A;  1VHM A;  3NHQ A;  3C8C A;  2W3D A;  3B33 A;  3K3C A;  2M7U A;  4DN0 A;  3PHY A;  4F3L B;  3G6O A;  4DJ3 A;  1MKM A;  3MR0 A;  4Q0I A;  4KQO A;  2Z6C A;  2QYB A;  2J3T D;  1XJ6 A;  5AJG A;  3MJQ A;  2XA7 M;  4HP4 A;  4LRY C;  4HIA A;  1TS7 A;  4NXF A;  3EWK A;  3OCN A;  1YKD A;  5F6A A;  3EOI A;  3NOP C;  1IOU A;  4BWI A;  2D02 A;  5F69 A;  2ZMV A;  4EU0 A;  4R70 A;  2QKP A;  1OTB A;  1T1A A;  2M7V A;  3ULF A;  3OCL A;  5I5L A;  2V1B A;  2LB5 A;  4WLA A;  2JKR M;  2VEA A;  3MQO A;  4IJG A;  1STZ A;  5DKK A;  4HH2 A;  3O5Y A;  3S7P A;  4L9G A;  5HWV A;  1S67 L;  2JKT M;  3T4Q A;  1NLY A;  5DFY A;  2JKR I;  4IUH A;  2GZA A;  3KSF A;  2P7J A;  3UB6 A;  4GW9 A;  1UWN X;  3BJN A;  3F1N B;  4MN6 A;  4EQ1 A;  2JHE A;  4JGO A;  4BMW A;  2JKT I;  4MN5 A;  3EGD C;  4WF0 A;  4HQA A;  1T1C A;  4WEL A;  1OJG A;  2P04 A;  4HJ3 A;  3W2Z A;  2OWJ A;  3OC2 A;  3F1O A;  4UEY A;  3A0R A;  3HCY A;  4MDZ A;  4UQI S;  3PBN A;  2QWS A;  3IBR A;  5HSQ A;  5A8B A;  1TF1 A;  1LL8 A;  4HNB A;  1G6O A;  2P08 A;  1UWP X;  3VV4 A;  1ZHH B;  2OOL A;  3UB8 A;  4B93 A;  4LPZ A;  3MFX A;  4P6Z S;  4R3A A;  1D06 A;  5HDC A;  3TW8 A;  3LIB A;  1S1Y A;  1WA9 A;  2JN7 A;  3B42 A;  1S66 L;  2WKP A;  4HY8 A;  2PD7 A;  3CWF A;  4NEE D;  3KO6 A;  1OT6 A;  2PYR A;  4FSF A;  2HGV A;  3H9W A;  2VV7 A;  4Q0H A;  1IFQ A;  3GEC A;  2PR6 A;  2I9V A;  4JGR A;  1D7E A;  1Y28 A;  1XJ2 A;  3FPV A;  4JGQ A;  2XRN A;  2VX8 A;  3PBO A;  5DJT A;  3KSG A;  2A2L A;  1N9L A;  5HWT A;  3H7W B;  3UB7 A;  3LIF A;  3KSI A;  2M1C A;  3SW1 A;  4RQ9 A;  3VE3 A;  4JGP A;  1TS6 A;  2IA2 A;  4BBV A;  3B47 A;  3RTY A;  1OTD A;  5TJJ A;  1XFQ A;  5HD3 A;  3MQQ A;  4QPR A;  3T4L A;  4Y5F A;  2YKF A;  1GSX A;  1V9Y A;  3H82 A;  4KUO A;  4G3V A;  1S1Z A;  2ZMF A;  1H3Q A;  4GHI A;  1N9N A;  2W3E A;  3K3D A;  1X0O A;  2OAQ 1;  3R7W A;  2K7S A;  1MC0 A;  2O0Y A;  1P0Z A;  5C5K A;  3PBR A;  4I3I A;  3BY9 A;  1ODV A;  3BQ8 A;  2W1R A;  3MF0 A;  3H82 B;  4PKY G;  2Z6D A;  2KLI A;  3PBQ A;  3E4Q A;  2H28 A;  5G4Z A;  4GHI B;  3PR6 A;  3LR0 A;  2KX6 A;  2OAP 1;  5EFW A;  1EW0 A;  2B18 A;  3HJI A;  2FZ0 A;  3S7Q A;  3R7W B;  3UB9 A;  5LBR A;  2V9A A;  4I3J A;  2W3G A;  3MXQ A;  4Y2F A;  3IBJ A;  3F1N A;  5K5B A;  3RH8 B;  1MZU A;  3BW6 A;  2ZOH A;  4MMN A;  4ETZ A;  3C30 A;  4L9F A;  5HZH A;  1OT9 A;  5L8M A;  4NXB A;  5TBM A;  4GCZ A;  3KX0 X;  2MJ6 A;  1TS8 A;  2V0U A;  2PR5 A;  2R78 A;  3EQV A;  3LIE A;  2YKH A;  3E98 A;  4I39 A;  1OTA A;  3JVU A;  4G3K A;  1KOU A;  4ME4 A;  3NOU C;  4WEJ A;  5TBM B;  2HF6 A;  1DRM A;  2QJ5 A;  3LFV A;  2W0N A;  5IS1 A;  2QJ7 A;  3K2N A;  4R6L A;  4IUK A;  2V0W A;  3S7N A;  4ETX A;  2VV6 A;  3CAX A;  2J3T C;  4WN5 A;  4HI4 A;  1DP8 A;  3P01 A;  4Y3I A;  2INW A;  3V67 A;  2VZW A;  3NJA A;  4AFI A;  3S7O A;  4O8G A;  2L0W A;  4EES A;  1OJ5 A;  1YSQ A;  4EW7 A;  4O0P A;  4H6J A;  2ZBB A;  3LI9 A;  1DP6 A;  1DP9 A;  4DJ2 A;  1V9Z A;  3BQA A;  4UQI M;  2VV8 A;  3H7W A;  3GDI A;  1F9I A;  1NLZ A;  1T18 A;  4OOM A;  5DF9 A;  4Z1W A;  4B9O A;  5AVE A;  2NUP C;  1W63 Q;  3LIC A;  1GSW A;  4PKY A;  3LI8 A;  4H6J B;  3KYQ A;  4P6Z M;  3T50 A;  4DMZ A;  3ZYT A;  4GLQ A;  4EEU A;  5IU1 A;  3HJK A;  2DMW A;  2VGL S;  2K31 A;  4LRZ E;  4M4X A;  4KUK A;  1ZTU A;  4EET B;  3VE4 A;  3KSH A;  3CI6 A;  2GNX A;  4GS9 A;  3BWL A;  3LR4 A;  2O9B A;  1T19 A;  1YAX A;  2O9A A;  2HV1 A;  3P7N A;  3LID A;  3OBF A;  4HHD A;  3U2A A;  4WL9 A;  4CLC C;  2ZOI A;  3PBT A;  4WUJ A;  5F5Y A;  2O9C A;  1F98 A;  3CIT A;  3EQU A;  4II7 A;  2D01 A;  5DKL A;  3LR5 A;  4XT2 A;  4HJ6 A;  3F1P A;  4EEP A;  2PT7 A;  2XA7 S;  4GS9 B;  3TJZ C;  2PDR A;  2PHY A;  3T4T A;  3KYZ A;  3MMH A;  4HP9 A;  3PYP A;  4MN7 A;  4FOF A;  1G28 A;  5G4Y A;  2XRO A;  1XJ4 A;  3C2W A;  3UE3 A;  2EWW A;  1VB6 A;  3PXP A;  4R38 A;  4WEK A;  4XT2 B;  1N9O A;  4PHT A;  2VLG A;  5IT5 A;  1TD5 A;  3F1P B;  3BY8 A;  3LR3 A;  1P9R A;  5HL6 A;  2L1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...