3P01A

Crystal structure of two-component response regulator from nostoc sp. pcc 7120
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
178
structure length
178
Chain Sequence
QRAAETYDLLKQRTEELRRANAQMSLLTVLVQVTQASNSLEAILTPIATAFAESFAVNACILQMLEGQTLSTIQGFYSQQGTVNNWLNQDPLTNEAIATGQIQVAANIAKDPKLASISQYQDNGIQSHVVIPITYRNEMLGVLSLQWQQPISLREDELTLIHLSAQLVAIALTSSRCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two-component response regulator
publication title Crystal structure of two-component response regulator from Nostoc sp. PCC 7120
rcsb
source organism Nostoc sp.
molecule tags Signaling protein
total genus 51
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.340 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p01A02
3P01A
chains in the Genus database with same CATH superfamily
3BFGA 2ZC3B 2W3HA 3LEQA 3PYPA 3IWOA 1NXYA 3CHWP 4IEDA 4X53A 4NXEA 5EVIB 3VFFA 5AQ7A 1QMFA 2WKPA 4BENA 3LCEA 2ZC6B 5HD5A 3IH8A 2KOIA 2K7SA 1OTAA 3P09A 4BD1A 1H8ZA 3ZNYA 3F1NB 1GSXA 3MS6A 3IXHA 1TDLA 1YAXA 4RVAA 1MY8A 4KZ6A 1NYMA 3VOLA 2HJEA 2Y91A 2Z6CA 4ME4A 3UN7A 4OLDA 3UPNA 1ES2A 1CF0A 1O7EA 5FDSA 1F9IA 2VJWA 2WKEA 3DTKA 2WKIA 1XGIA 1RGZA 1E3UD 1SKOA 1XJ3A 4JGQA 1FIKA 1OJGA 2XF3A 4KZBA 3E4QA 2JKFA 4FSFA 3C7UA 5U47A 5DTTA 1NZOA 4K08A 4PM9A 1VETB 3GMWA 4OLGA 2B02A 2X71A 4WZ5C 5F82A 3HLFA 1GCEA 2ZQ9A 2QMIA 4B93A 2DRWA 2NUTC 3S22A 4Q0IA 3VOZA 3HUMA 1K56D 4F3LB 4WELA 5FQ9A 3EWKA 3CAXA 1XJ6A 1NLZA 4IJGA 4F94A 4DE3A 2E8JA 5EVIA 1D06A 5FQJA 2OWHA 1YSQA 2ZD8A 4JGPA 3UB8A 1K0KA 3PBTA 3PTEA 4PKYG 2ZQAA 3RXWA 3RTYA 1FILA 1N9LA 3F1NA 2I72A 4R38A 3AGDA 4EWFA 2L4RA 2UWXA 1CK3A 3MFDA 3T50A 3VV4A 2VV7A 4WMCD 3BM6A 5GL9A 4DMZA 1G6OA 3W4PA 4ZAMA 4YWZA 5DF8A 1W8QA 4LV3A 4S2PA 1PWGA 2XA7S 5CHMA 5J7EA 1TS7A 3IX4A 2XA7M 2V1AA 1K55C 4QU3A 4O01A 5F83A 1VETA 3NULA 4FH4A 3NI9A 4Z1WA 4Y0TA 4K0WA 2IWCA 3TE8A 5CECA 3BY9A 2PYPA 4OOMA 1IYOA 5A8BA 3KSIA 4F3LA 4S2MA 1YLYA 4LCLA 3HLCA 4JKTA 1GHMA 3IT9A 2A2LA 3OPRA 2L1MA 2IWDA 1WYBA 2H0YA 3V3SA 2UV0E 4KQOA 1VB6A 2WK0A 2HF6A 4EUZA 3M6HA 5EM0A 4JLFA 1ES5A 2LB9A 1VM1A 4H8RA 2EXAA 2O9CA 3LR3A 2B18A 1I5QA 4Y17A 3TOIA 4MEZA 1J9MA 3R7WA 4ZJ3A 2HP9A 3ICYA 2QKPA 3HLEA 5C5KA 3OZHA 3Q7VB 2ZQDA 3A0SA 1PRQA 4OKPA 4GW9A 5GLAA 5A90A 1FOFA 4X25A 3K3DA 1HVBA 2Y2PA 3QP1A 1LI0A 1K57A 5FI6A 1K54A 3HCYA 5FASA 3OCNA 1PYYA 1MPLA 1CJFA 2ZOIA 1F5MA 1YMSA 1K38A 5HWTA 1S66L 1H3QA 1OMEA 5FI7A 3SS3A 2HV1A 4CLCC 3DBAA 4KZ3A 4KZ9A 4O0PA 2V0WA 4YOFA 2FFYA 2J3TD 1FCOA 4OOLA 1ESIA 5FQKA 1Y28A 1XJ4A 1FR1A 3FG8A 1BLPA 4GD6A 2GNXA 3NOUC 3LYXA 4PPRA 3BW6A 2WYXA 3UB9A 2VV8A 3GVBA 3UMEA 1T1CA 4EESA 1FCNA 3A3JA 1GA0A 1MBLA 4K0XA 2YKHA 2Z2MB 4GCZA 3BQAA 3KYZA 2G2WA 4EQIA 3T1RA 1DJBA 4II7A 4H6JB 3QNBA 3LIDA 4MCWA 5E2FA 3FPVA 2A49A 5EVID 1L2SA 1YM1A 2VGKA 1EWZA 2OAP1 3DWZA 5TJJA 3JYIA 3IXBA 2BTFP 3W2ZA 1C3BA 4IVIA 3CUEA 3MKEA 3Q7VA 5L09A 3GV9A 3Q81A 1BYWA 5EECA 3FKWA 4DE0A 3JVVA 4XXRA 3QHYA 3FPWA 3PBOA 3HVFA 2Y2GA 4EBNA 4Y0UA 4WEKA 4R3BA 2ZQCA 1XPBA 4I39A 1CI8A 1HLUP 4HBUA 3WS0A 3NCKA 2GX5A 1LL9A 2WADA 1W63M 5FEGA 1IYQA 3AGFA 3PAEA 2ZMFA 1KE4A 4QPRA 1L0EA 2JHEA 4R1GA 4EBLA 3NOPC 2ZBBA 5J4EA 4MN5A 5CRFA 3IX3A 1BT5A 4LFUA 3N6IA 1W63Q 5DJTA 5HW3A 1ES4A 4LRXC 1ONGA 4BLMA 2VA0A 4H6JA 4DXBA 3RFBA 4CLCD 2O9BA 3NECA 5HWWA 4X1LA 3Q1FA 3P01A 5FQIA 3LIBA 2BASA 1N4OA 3SOIA 3B33A 1XA1A 1S1YA 3BY8A 2WKHA 3LUQA 1YLTA 2EX8A 5AQBA 3IX8A 3A0VA 4LPZA 4BL3A 4YNRA 2OOLA 1SZVA 2HZ5A 3OBFA 3IXDA 3C8CA 2QJ7A 5FEFA 1ONHA 2Y2LA 4PM8A 3KSFA 3BEBA 1UWPX 4EERA 1Q2QA 2XLNA 5FQQA 5HDSA 5AJGA 4HH2A 4NXGA 4KZ8A 1PZPA 2Y59A 3N7WA 4WBGA 2W3GA 2HPBA 4GDBA 4R4RA 4JXWA 3H7WB 1STZA 1Y4OA 2EX9A 1YKDA 2W1TB 3Q82A 3GQZA 3VMAA 2ZC4B 1S67L 3BFEA 3T1QB 4JXSA 3MFXA 2QYBA 3AGEA 5JYOA 4P6BA 2H5SA 4QHCA 2D02A 2RCXA 3T4JA 1JNUA 2WKQA 3SH7A 3C30A 1QMEA 2LB5A 4GB7A 3OC2A 3BRMA 4FOFA 3DAVA 5GLBA 2XRNA 3D72A 4E3MA 2ZC5B 4RX3A 4Y7PA 1N9NA 1PI5A 2WUQA 1ZTUA 1OPXA 1KGEA 3K2NA 3M2JA 1XFNA 1YMXA 3FKVA 4N9KA 5DKKA 5FA7A 1TS8A 5J3WA 4G3WA 5GHZA 3ZVTA 3N4IA 4L9FA 5HAIA 5K5BA 4EEPA 3IF6B 4R3JA 1OTEA 3H7WA 3I7JA 2WGWB 3WRTA 4O7DA 2W1TA 3CZDA 2B5RA 1XKZA 4XUZA 3OOVA 5FSRA 2WZZA 2WZXA 4DXCA 1I2SA 1IEMA 2INWA 1DP9A 2Q0OA 1L0GA 4KZ5A 5TFQA 2OV5A 3B3XA 2GDNA 1PFLA 3HLDA 4HBTA 1JVJA 4HIAA 1T19A 3C5AA 1N9BA 4N1HA 4WZ4A 3IWQA 3U4LP 2P7JA 4ZTKA 3PBSA 4KUOA 1TS6A 3O87A 4DDSA 3QP6A 4S2NA 4WF0A 3RJUA 3V67A 3LIFA 4ETXA 4QB8A 1D7EA 2DMWA 1Z6FA 2X02A 4YINA 1W5DA 2E8IA 1VEUB 2HP5A 1IYSA 2Y2MA 3PR6A 3DTIA 4MMNA 3T1SA 5CGSA 5G4ZA 1T1AA 1ERQA 1X0OA 3MXSA 3LIAA 2KLIA 4ZBEA 2MJ6A 5CGXA 3WS5A 4JGRA 2JC7A 2VK3A 3FZCA 3IF6A 1SKFA 2ZJ9A 2WGWA 2W3FA 3E0YA 4MBHA 1NRFA 3BWLA 4X68A 3WS2A 2ZM0A 1F2KA 4IVKA 1J3WA 4R4SA 4OPZA 2WGVA 2EFXA 2R9WA 5DTKA 2XR0A 2ZQ8A 3C7VA 2PD7A 4UEYA 3EEHA 3HLWA 4U0TA 4ZRRA 3G34A 3TSGA 1YLWA 5LBRA 5HPFA 3T4KA 1SDNA 4JXVA 2XGNA 3BQ8A 3V3RA 4NKPA 5F69A 2W0NA 4LV2A 4UQIS 3MJQA 1VEUA 3SW1A 5TGFA 4NETA 1G68A 3T1XA 4UQIM 4UA7A 1LL8A 3T4LA 3ZHHA 1ERMA 1ALQA 4HJ4A 4BQMA 1UWNX 3EGDC 4CJNA 3M2KA 2G2UA 2Y8HA 3Q7ZA 2XD5A 4C75A 1BZAA 4GLQA 4BMWA 4Y3IA 1DJCA 5KZHA 2Z2LB 1AWIA 5TBMB 4OPQA 2J3TC 3ZVWA 5DF9A 2G7UA 4ZJ2A 4OOYA 1LHYA 2K2NA 3MSHA 1ZG4A 5IU1A 3IWIA 4HJ6A 3SH9A 3LO7A 4MBKA 1Y54A 5CEBA 3VFHA 2QPNA 4Y15A 5F1FA 2XH9A 2BG1A 2VEAA 5EVIC 3CPTB 5TR7A 3ULFA 3E4PA 2M7VA 4RQ9A 5KMWA 4HOIA 4HY8A 3NBLA 4ZJ1A 2PT7A 5BOHA 2V8CA 3ZG7B 1NLYA 3FC7A 2HDUA 2VV6A 2FH5A 4DE1A 2VKSA 4I3AA 3UDIA 3EEAA 1VHMA 4WLAA 4UA6A 1XJ2A 3S7OA 3MZEA 3IQAA 1FSYA 2WAFA 4GNUA 4L9EA 1W79A 1ACFA 3ZG0A 2ZC7A 1S4RA 4LRYC 5EFWA 1BLHA 2H10A 3TRCA 3BLSA 1HZOA 4JPMA 5EV0A 5TBMA 5FAOA 2JKTM 4OPYA 4FD8A 2QZ6A 3UPPA 1NYYA 3OCLA 2PHYA 5HPIA 3S7QA 3ZQ5A 2Y2NA 3K3CA 5EE8A 5FDHA 2PU2A 3A0RA 4E3JA 3HL9A 1FR6A 3CITA 3LR4A 3LR0A 4CQHA 4DKIA 5DFXA 2EWVA 3CPTA 1MWRA 1KE0A 4OONA 3LI9A 4WN5A 5GHYA 5HDCA 1KDWA 1K6SA 1ESUA 5E2HA 2WAEA 3HLGA 5HL6A 3VP3A 1IKIA 4X1MA 3ZG8B 1FQGA 4CPKA 3UB6A 4EW7A 3WWXA 3C2WA 4EXOA 4P6ZS 3ZG5A 1HD8A 4IBRA 4K91A 5DJUA 2WKRA 4WM9A 4PMAA 5HZHA 4OQ0A 4R6LA 4I38A 4N9LA 3T12B 1WYCA 5EPHA 3F1PB 4KQDA 5CTNA 2J80A 3W8KA 1K57C 1K54C 2W27A 5CHJA 1TEMA 1JTDA 2OSUA 3ZYTA 4P0MA 2P9VB 4HEFA 4JF6A 3ZNTA 5J8XA 4U3TA 4LENA 3OLOA 3V5MA 3P7NA 4D2OA 2JE5A 1G5UA 2IWBA 1TDGA 4KQQA 5HL1A 1PIOA 1CEFA 1PZOA 3IF5A 2DCFA 3E98A 4ID4A 2EA9A 4CLCE 2JKTI 5GLDA 3ZGAB 3FYZA 5E43A 3QP4A 3RXXA 4MLLA 4L9GA 4UAAA 5F6AA 4BJPA 5G18A 3S7PA 1PI4A 1HTZA 3IBJA 3UE1A 1DP8A 3O86A 3LGOA 4E3LA 5EVEA 3CUEC 1VQQA 1TS0A 3T4OA 3H9WA 3ZDJA 1OJ5A 4A5RA 4M3KA 2QHKA 5A91A 2R78A 2J3WA 1MWSA 1EW0A 4UA9A 4LV1A 2DNSA 2BLSA 3SS5A 3F1PA 2ACGA 4JF5A 3SH8A 3NIAA 3E2KA 2H0TA 3GSGA 3OPPA 3VSKA 3UDFA 2P9VA 1H8YA 4OQHA 1YQSA 1YLJA 1NRJA 2XROA 3OPHA 2VGJA 1BSGA 3IS2B 1DJAA 3MZFA 1L0FA 1BLCA 5AVEA 2J9OA 4BWIA 3VP1A 1OTBA 3BECA 3D4FA 3IXGA 1YPRA 5M1AA 1SHVA 2Q9MA 3G2ZA 4HP9A 3UE6A 3L9KA 4E6XA 1CQAA 4BD0A 2J7VA 2JKRI 1NWZA 3DW0A 5KSCA 2I9VA 3HUOA 4FUWA 5HWVA 3V39A 2PRFA 3NOTC 2W3EA 2Y2KA 2Y55A 3VP2A 3R4KA 3A3IA 4E3NA 2OWJA 4B9OA 4PAUA 4X6TA 3EGXC 2Q9NA 2YKFA 4OQGA 4G3VA 3F1OB 3G30A 4HI4A 1YT4A 1PWDA 3OPLA 5HAPA 3IBRA 3N8LA 4KG2A 2RL3A 3C38A 1L3LA 4E3OA 3MMHA 1ES3A 5DTSA 1JWPA 3G6OA 4NXFA 4Q0JA 3VP4A 4BL2A 3H82B 4WMCA 1U60A 5FQMA 3MR0A 4R0QA 4Y0OA 2HJ9C 2GJ3A 3IS2A 5I5LA 1XFQA 1WA9A 4KZ4A 4P87A 3IHAA 1SDEA 1EI5A 2CC1A 2HDQA 3UO9A 3QNCA 3UNWA 3PBQA 2HDSA 3KYEA 4IBXA 4E04A 1UGUA 3GECA 2XFTA 1BULA 2PAVP 4IHQA 4PM6A 2K31A 2VZWA 5DKLA 3LY3A 4S2OA 3BJNA 2OAQ1 1WE4A 3B42A 3W4OA 2JKGA 3FV7A 4EV4A 1IFQA 1FCMA 4NG2A 1GSWA 1BTLA 2L0WA 4GKUA 5EOOA 3ISGA 3A3FA 3Q07A 4WZ5A 3MBZA 4GZBA 3F1OA 2PBYA 3UMDA 2X01A 3EOIA 2VGLS 3LICA 1NZUA 4R70A 1XX2A 4KZ7A 3PHYA 2XQZA 3GTCA 2VGLM 2PU4A 1PWCA 3VP0A 2H28A 4D60A 1OTIA 3H82A 2P74A 2A3UA 1W8YA 4OH0A 2O0YA 1XP4A 4M4XA 1P0ZA 3LEZA 3MZDA 5E2EA 2XK1A 1LSVA 1RP5A 3L7HA 1AXBA 3B47A 2PD8A 4FCFA 4PM7A 1EROA 1OT9A 3BFCA 2XEPA 4P85A 4DJ3A 3ZCZA 5MC7A 2ZMAA 2Y2JA 4DE2A 1KVMA 1KVLA 4Y5FA 4QJGA 4QD4A 3KSHA 4RA7A 4DN0A 1K6RA 3LFVA 3UB7A 4ARZB 5CXWA 2HDRA 3TG9A 2A24B 1K55A 2XFSA 3CWFA 3V50A 3WS1A 5HAQA 3PXPA 5AVFA 5EM1A 4GHIB 2Y79A 5DVAA 4S2NC 3MQOA 4KQRA 4RX2A 2XDMA 5L07A 1XXMA 4IUHA 3UE3A 4DDYA 4WEJA 2JN7A 4FTXA 4CLCB 2W3DA 3VOYA 1E4DA 5M19A 2R9XA 3JVUA 2FFFB 2XD1A 5CTMA 1IKGA 3GDIA 3HREA 4PHTA 3G35A 1YSPA 5A92A 2V8FA 4LGWA 5FATA 2D01A 5F68A 2W1RA 5CEDA 2J8YA 3D3OA 3R7WB 1K4EA 1V9YA 3IF6C 4QY6A 4ETZA 1IELA 3BYDA 3SZTA 3WRZA 4BBVA 4X69A 2KDKA 2PBDP 1XA7A 4N1XA 1L0DA 4ARZA 4KZAA 3G32A 4JGOA 3KYQA 4MN7A 5EUAA 1O07A 3UB5P 2QJ5A 1GHPA 1H8MA 3D9YA 2A24A 5FAPA 3ZFZA 3NY4A 3S1YA 2C6WB 2ZM2A 3IH9A 4GDNA 3QP2A 1JWVA 4KENB 4GHIA 4NXBA 1CEGA 1LSXA 4Y2FA 4LCMA 4BBUA 5FI2A 5DF7A 2XSSA 1D1JA 4CLCA 1KDSA 4S2KA 4G3KA 3U2AA 5IHVA 4KG6A 1GHIA 4EEUA 4OVDA 3NJAA 1M40A 3P98A 1A0KA 5L8MA 5F5YA 2P08A 3A3EA 3DTEA 1V9ZA 1PNEA 4R23A 5D3OA 2O99A 3DWKA 1DP6A 4KG5A 3VSLA 3UE0A 1MWTA 3S4XA 5EVLA 3ITBA 4O8GA 4WYYA 1K4FA 3CLOA 1S0WA 1IYPA 2V1BA 2VX8A 1MWUA 2WGIA 4XT2B 5IT5A 4I5SA 5A93A 3HUNA 2OLUA 5FAQA 4HHDA 5L10A 2CMNA 5KIZA 2PR5A 2EWWA 1LL5A 1MC0A 1DY6A 5GLCA 1RGYA 4DJ2A 5EOEA 1S1ZA 2EFUA 4JF4A 1PW8A 3BFFA 4Z9QA 1MKMA 4L0LA 4GD8A 2V2FF 5G4YA 3WS4A 4NK3A 1KOUA 3MQ0A 4U0XA 3VE4A 2V9AA 2Y2IA 3C4PA 3UPOA 4E6WA 3IHBA 4MNRA 4X56A 4P6ZM 3VE3A 3HLBA 3CJMA 4QY5A 5HFOA 3PBRA 4OPRA 2GZAA 3LR5A 3N8SA 3T4TA 4HJ3A 4N92A 2M1CA 2IA2A 4UHUA 1YLZA 4S2IA 5HX9A 4LLOB 1T18A 3G2YA 2ZL1B 3RH8B 1W7FA 3PAGA 3KX0X 1G6AA 1S6RA 2JKRM 3O5YA 1P97A 1T1BA 4I3JA 4DRTA 2NUPC 4C6YA 4XT2A 2VLGA 2ZOHA 4LV0A 2ZQ7A 4HESA 4EU0A 3CG5A 2JCHA 3UDXA 2PR6A 2HGVA 5CGWA 3T4QA 4EQ1A 5F1GA 1OT6A 5DFYA 1IOUA 3S7NA 4S2LA 3JPUA 3E4OA 3BFDA 1PW1A 1XGJA 3E2LA 1H0MA 1RCJA 3PBNA 3EQVA 4I3IA 4YFMA 5I94A 4C3QA 4FH2A 5CERA 5JYPA 2AVXA 1P9RA 2PYRA 2O9AA 2ZLYA 3GR2A 3FWLA 4X55A 4RYEA 2ZM8A 3GRJA 2Y2OA 3LIEA 4Y13A 1KE3A 1ZG6A 2KX6A 4JBFA 3G31A 3O88A 4GS9B 2J9PA 3HJIA 2Y2HA 4NEED 2EX2A 2ZL1A 5E2GA 4JXGA 3TW8A 1BUEA 1BLSA 5KSHA 2EX6A 1TF1A 1P9WA 1E3UA 1NY0A 3A3DA 3ITAA 4GJ4A 5L2FA 1H5XA 4GN2A 4B4XA 1S4SA 4EETB 3ZG9B 3SS4A 5M18A 1LI9A 4XUXA 3KSGA 2V20A 4EBPA 2P04A 1ODVA 1KGFA 2B95A 4OP5A 4OP8A 3LI8A 4R3AA 1JTGA 5HD3A 3NDGA 4DF6A 4HH3A 3LY4A 4Q8IA 2PDRA 1SCWA 1YLPA 3NC8A 4ZDXA 1ZC2A 4S2JA 1K25A 1DRMA 1KGGA 4MN6A 3MQQA 1K56A 3BLMA 5CX7A 1CI9A 2OLVA 5HSQA 4MDZA 3O3VA 1I2WA 2HP6A 1GA9A 3MF0A 2EXBA 1OTDA 3HJKA 2ZMVA 3QP5A 1MZUA 4GS9A 5HARA 5AQ9A 2JBFA 4MBFA 3MXQA 2M7UA 4B88A 1E25A 1MKIA 2V1ZA 5AQAA 1JWZA 1NJ4A 2QWSA 1LLBA 4GOGA 3CI6A 1GSVA 4HQAA 4PKYA 4ESPA 1N9OA 2FZ0A 5CHUA 3C4OA 4IUKA 4OQIA 4WUJA 3MKFA 4HP4A 4LRZE 1TVFA 4Q0HA 4KUKA 5FL3A 4PM5A 1G28A 2V0UA 1TD5A 3CMZA 4E3IA 3KO6A 1LT0A 2Z6DA 3MXRA 1Z09A 1ZHHB 1LSWA 1ZKJA 4B4ZA 3NHQA 3HBRA 3NDEA 3G4PA 2Y2QA 4AFIA 4HNBA 3DTMA 5HDDA 1SKOB 4E3KA 3UY6A 3N8RA 3EQUA 3TJZC 2Y4AA 4EUVA 4BBTA 3T4SA 5GHXA 4WL9A 5IS1A 2C5WB 1M6KA 3W4QA 3M6BA 1MXOA 1F98A 1FSWA 3QP8A 4QWOA 1Q2PA
chains in the Genus database with same CATH topology
4BBVA 2W3HA 3UB6A 2KDKA 3KSFA 3PYPA 4EERA 1UWPX 4EW7A 3C2WA 4EXOA 4ARZA 4NXEA 4JGOA 4P6ZS 3KYQA 4MN7A 5HDSA 2WKPA 2QJ5A 5AJGA 1H8MA 5DJUA 5HD5A 2A24A 2WKRA 4HH2A 2KOIA 2K7SA 4NXGA 1OTAA 5HZHA 4R6LA 4I38A 3F1NB 1GSXA 1YAXA 2W3GA 3F1PB 3VOLA 2HJEA 2Z6CA 4GHIA 3H7WB 4KQDA 4ME4A 1STZA 2J80A 1LSXA 4NXBA 4Y2FA 4BBUA 1YKDA 2W1TB 2W27A 1F9IA 2VJWA 3ZYTA 2XSSA 1S67L 4CLCA 4G3KA 3MFXA 3U2AA 2QYBA 1XJ3A 4JGQA 2D02A 3OLOA 1OJGA 3P7NA 4EEUA 3NJAA 3E4QA 3T4JA 1JNUA 2WKQA 4FSFA 3C30A 5L8MA 2LB5A 4K08A 5F5YA 2P08A 3OC2A 1V9ZA 4FOFA 2B02A 3E98A 2O99A 2EA9A 4CLCE 2XRNA 2JKTI 1DP6A 4B93A 2NUTC 3D72A 4Q0IA 4L9GA 5F6AA 4BJPA 4WELA 4F3LB 1N9NA 3EWKA 3CAXA 1ZTUA 1OPXA 1XJ6A 1NLZA 4IJGA 3S7PA 4O8GA 3CLOA 3IBJA 3K2NA 2V1BA 2VX8A 1D06A 1XFNA 4XT2B 1DP8A 5DKKA 5IT5A 3CUEC 2OWHA 1TS0A 1YSQA 4I5SA 3T4OA 3H9WA 1OJ5A 2QHKA 4JGPA 3UB8A 1TS8A 5J3WA 3PBTA 4PKYG 2R78A 4G3WA 3RTYA 2J3WA 1EW0A 1N9LA 3F1NA 4L9FA 4HHDA 5K5BA 4EEPA 2CMNA 3F1PA 5KIZA 2PR5A 2EWWA 4R38A 1OTEA 3H7WA 1MC0A 2L4RA 2W1TA 4DJ2A 3OOVA 1S1ZA 3T50A 3VV4A 2VV7A 1MKMA 4L0LA 1NRJA 5G4YA 2XROA 2INWA 1DP9A 1KOUA 1G6OA 3MQ0A 4DMZA 4YWZA 3IS2B 3VE4A 2V9AA 2XA7S 5AVEA 5J7EA 4HIAA 4BWIA 1OTBA 1TS7A 1T19A 4P6ZM 2XA7M 2V1AA 4O01A 3VE3A 2P7JA 3PBSA 4KUOA 1TS6A 3PBRA 2GZAA 4WF0A 4Z1WA 3LR5A 3T4TA 3V67A 3LIFA 4ETXA 3UE6A 4HP9A 1D7EA 4HJ3A 2DMWA 2M1CA 3TE8A 2IA2A 3BY9A 2PYPA 4OOMA 4LLOB 1T18A 5A8BA 3KSIA 4F3LA 3RH8B 3KX0X 2JKRI 1NWZA 3PR6A 2JKRM 2I9VA 3O5YA 1P97A 4MMNA 1T1BA 4I3JA 2A2LA 2NUPC 5HWVA 3NOTC 2W3EA 2L1MA 4XT2A 2VLGA 5G4ZA 4KQOA 3R4KA 2ZOHA 1T1AA 1VB6A 1X0OA 2HF6A 3LIAA 2OWJA 4B9OA 2LB9A 4PAUA 2KLIA 3EGXC 2MJ6A 4EU0A 2YKFA 2O9CA 3LR3A 4JGRA 4G3VA 3F1OB 2PR6A 2B18A 2HGVA 4HI4A 3T4QA 4EQ1A 1OT6A 5DFYA 3IBRA 1IOUA 2W3FA 3S7NA 3R7WA 3E4OA 3C38A 3E0YA 3BWLA 3PBNA 3EQVA 3MMHA 4I3IA 3G6OA 3ICYA 4NXFA 4Q0JA 3H82B 2QKPA 5C5KA 3MR0A 2HJ9C 2GJ3A 2PD7A 3A0SA 3IS2A 4GW9A 5I5LA 1XFQA 4UEYA 1WA9A 3EEHA 4ZRRA 1P9RA 2PYRA 2O9AA 5LBRA 3K3DA 3PBQA 5HPFA 3T4KA 4E04A 3HCYA 3LIEA 1UGUA 3OCNA 3GECA 3BQ8A 2KX6A 2ZOIA 1F5MA 4NKPA 5F69A 5HWTA 4GS9B 1S66L 2W0NA 1H3QA 3HJIA 4UQIS 3MJQA 4NEED 4IHQA 3SW1A 2K31A 2VZWA 2HV1A 5DKLA 4CLCC 4UQIM 3DBAA 3TW8A 3BJNA 5KSHA 4O0PA 1LL8A 3T4LA 2V0WA 4YOFA 4HJ4A 2OAQ1 1TF1A 3B42A 1P9WA 1UWNX 3EGDC 1IFQA 2J3TD 2Y8HA 4OOLA 1Y28A 1XJ4A 1GSWA 2L0WA 3FG8A 4GJ4A 2GNXA 3NOUC 3LYXA 4GLQA 3BW6A 4BMWA 3UB9A 1S4SA 4EETB 2VV8A 4Y3IA 3UMEA 1T1CA 4EESA 5TBMB 2J3TC 3F1OA 5DF9A 3KSGA 2YKHA 4GCZA 3KYZA 2G7UA 3BQAA 2P04A 1ODVA 3UMDA 3LI8A 4R3AA 3EOIA 2VGLS 4II7A 5HD3A 3LICA 4H6JB 2K2NA 3LIDA 4MCWA 4HH3A 4R70A 3FPVA 2PDRA 3PHYA 5IU1A 2VGLM 4HJ6A 2OAP1 2H28A 1OTIA 3H82A 5TJJA 1DRMA 4MN6A 3MQQA 3W2ZA 2O0YA 3CUEA 4M4XA 5CX7A 1P0ZA 2VEAA 1LSVA 1BYWA 3ULFA 3B47A 3E4PA 5HSQA 4MDZA 2M7VA 4RQ9A 3JVVA 2PD8A 4HOIA 4HY8A 3FPWA 3MF0A 1OT9A 3PBOA 1OTDA 3HJKA 4WEKA 2PT7A 4DJ3A 5MC7A 2ZMVA 4I39A 1NLYA 3FC7A 2VV6A 2FH5A 1MZUA 2GX5A 4GS9A 2VKSA 4I3AA 4Y5FA 1W63M 3MXQA 3KSHA 2M7UA 4DN0A 3EEAA 1VHMA 3LFVA 4WLAA 3UB7A 2ZMFA 3S7OA 1XJ2A 4QPRA 2QWSA 4ARZB 3CI6A 2JHEA 1GSVA 4HQAA 4PKYA 4L9EA 3NOPC 1N9OA 2FZ0A 1S4RA 2A24B 4LRYC 5EFWA 4IUKA 2ZBBA 5J4EA 4MN5A 4WUJA 3CWFA 3TRCA 4HP4A 4LRZE 3PXPA 5AVFA 1W63Q 5TBMA 4Q0HA 4KUKA 5FL3A 2JKTM 1G28A 2V0UA 4GHIB 1TD5A 5DJTA 4LRXC 2Y79A 3KO6A 3MQOA 1LT0A 2Z6DA 2VA0A 1ZHHB 4IUHA 1LSWA 4H6JA 3UE3A 3NHQA 3RFBA 4CLCD 3OCLA 4WEJA 2JN7A 2O9BA 2PHYA 5HPIA 5HWWA 3S7QA 3ZQ5A 4CLCB 2W3DA 3P01A 4AFIA 4HNBA 3K3CA 5HDDA 3LIBA 2BASA 3JVUA 3A0RA 3CITA 3LR4A 3GDIA 3EQUA 3LR0A 4PHTA 3B33A 3TJZC 1YSPA 4CQHA 4EUVA 1S1YA 3BY8A 5DFXA 2EWVA 4BBTA 3LUQA 2D01A 5F68A 2W1RA 3LI9A 4WN5A 5HDCA 3A0VA 4LPZA 3T4SA 4WL9A 4YNRA 2OOLA 5IS1A 3OBFA 3D3OA 3R7WB 3C8CA 1V9YA 4ETZA 5HL6A 1F98A 2QJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P01 A; 
#chains in the Genus database with same CATH topology
 3BFG A;  2ZC3 B;  2W3H A;  3LEQ A;  3PYP A;  3IWO A;  1NXY A;  3CHW P;  4IED A;  4X53 A;  4NXE A;  5EVI B;  3VFF A;  5AQ7 A;  1QMF A;  2WKP A;  4BEN A;  3LCE A;  2ZC6 B;  5HD5 A;  3IH8 A;  2KOI A;  2K7S A;  1OTA A;  3P09 A;  4BD1 A;  1H8Z A;  3ZNY A;  3F1N B;  1GSX A;  3MS6 A;  3IXH A;  1TDL A;  1YAX A;  4RVA A;  1MY8 A;  4KZ6 A;  1NYM A;  3VOL A;  2HJE A;  2Y91 A;  2Z6C A;  4ME4 A;  3UN7 A;  4OLD A;  3UPN A;  1ES2 A;  1CF0 A;  1O7E A;  5FDS A;  1F9I A;  2VJW A;  2WKE A;  3DTK A;  2WKI A;  1XGI A;  1RGZ A;  1E3U D;  1SKO A;  1XJ3 A;  4JGQ A;  1FIK A;  1OJG A;  2XF3 A;  4KZB A;  3E4Q A;  2JKF A;  4FSF A;  3C7U A;  5U47 A;  5DTT A;  1NZO A;  4K08 A;  4PM9 A;  1VET B;  3GMW A;  4OLG A;  2B02 A;  2X71 A;  4WZ5 C;  5F82 A;  3HLF A;  1GCE A;  2ZQ9 A;  2QMI A;  4B93 A;  2DRW A;  2NUT C;  3S22 A;  4Q0I A;  3VOZ A;  3HUM A;  1K56 D;  4F3L B;  4WEL A;  5FQ9 A;  3EWK A;  3CAX A;  1XJ6 A;  1NLZ A;  4IJG A;  4F94 A;  4DE3 A;  2E8J A;  5EVI A;  1D06 A;  5FQJ A;  2OWH A;  1YSQ A;  2ZD8 A;  4JGP A;  3UB8 A;  1K0K A;  3PBT A;  3PTE A;  4PKY G;  2ZQA A;  3RXW A;  3RTY A;  1FIL A;  1N9L A;  3F1N A;  2I72 A;  4R38 A;  3AGD A;  4EWF A;  2L4R A;  2UWX A;  1CK3 A;  3MFD A;  3T50 A;  3VV4 A;  2VV7 A;  4WMC D;  3BM6 A;  5GL9 A;  4DMZ A;  1G6O A;  3W4P A;  4ZAM A;  4YWZ A;  5DF8 A;  1W8Q A;  4LV3 A;  4S2P A;  1PWG A;  2XA7 S;  5CHM A;  5J7E A;  1TS7 A;  3IX4 A;  2XA7 M;  2V1A A;  1K55 C;  4QU3 A;  4O01 A;  5F83 A;  1VET A;  3NUL A;  4FH4 A;  3NI9 A;  4Z1W A;  4Y0T A;  4K0W A;  2IWC A;  3TE8 A;  5CEC A;  3BY9 A;  2PYP A;  4OOM A;  1IYO A;  5A8B A;  3KSI A;  4F3L A;  4S2M A;  1YLY A;  4LCL A;  3HLC A;  4JKT A;  1GHM A;  3IT9 A;  2A2L A;  3OPR A;  2L1M A;  2IWD A;  1WYB A;  2H0Y A;  3V3S A;  2UV0 E;  4KQO A;  1VB6 A;  2WK0 A;  2HF6 A;  4EUZ A;  3M6H A;  5EM0 A;  4JLF A;  1ES5 A;  2LB9 A;  1VM1 A;  4H8R A;  2EXA A;  2O9C A;  3LR3 A;  2B18 A;  1I5Q A;  4Y17 A;  3TOI A;  4MEZ A;  1J9M A;  3R7W A;  4ZJ3 A;  2HP9 A;  3ICY A;  2QKP A;  3HLE A;  5C5K A;  3OZH A;  3Q7V B;  2ZQD A;  3A0S A;  1PRQ A;  4OKP A;  4GW9 A;  5GLA A;  5A90 A;  1FOF A;  4X25 A;  3K3D A;  1HVB A;  2Y2P A;  3QP1 A;  1LI0 A;  1K57 A;  5FI6 A;  1K54 A;  3HCY A;  5FAS A;  3OCN A;  1PYY A;  1MPL A;  1CJF A;  2ZOI A;  1F5M A;  1YMS A;  1K38 A;  5HWT A;  1S66 L;  1H3Q A;  1OME A;  5FI7 A;  3SS3 A;  2HV1 A;  4CLC C;  3DBA A;  4KZ3 A;  4KZ9 A;  4O0P A;  2V0W A;  4YOF A;  2FFY A;  2J3T D;  1FCO A;  4OOL A;  1ESI A;  5FQK A;  1Y28 A;  1XJ4 A;  1FR1 A;  3FG8 A;  1BLP A;  4GD6 A;  2GNX A;  3NOU C;  3LYX A;  4PPR A;  3BW6 A;  2WYX A;  3UB9 A;  2VV8 A;  3GVB A;  3UME A;  1T1C A;  4EES A;  1FCN A;  3A3J A;  1GA0 A;  1MBL A;  4K0X A;  2YKH A;  2Z2M B;  4GCZ A;  3BQA A;  3KYZ A;  2G2W A;  4EQI A;  3T1R A;  1DJB A;  4II7 A;  4H6J B;  3QNB A;  3LID A;  4MCW A;  5E2F A;  3FPV A;  2A49 A;  5EVI D;  1L2S A;  1YM1 A;  2VGK A;  1EWZ A;  2OAP 1;  3DWZ A;  5TJJ A;  3JYI A;  3IXB A;  2BTF P;  3W2Z A;  1C3B A;  4IVI A;  3CUE A;  3MKE A;  3Q7V A;  5L09 A;  3GV9 A;  3Q81 A;  1BYW A;  5EEC A;  3FKW A;  4DE0 A;  3JVV A;  4XXR A;  3QHY A;  3FPW A;  3PBO A;  3HVF A;  2Y2G A;  4EBN A;  4Y0U A;  4WEK A;  4R3B A;  2ZQC A;  1XPB A;  4I39 A;  1CI8 A;  1HLU P;  4HBU A;  3WS0 A;  3NCK A;  2GX5 A;  1LL9 A;  2WAD A;  1W63 M;  5FEG A;  1IYQ A;  3AGF A;  3PAE A;  2ZMF A;  1KE4 A;  4QPR A;  1L0E A;  2JHE A;  4R1G A;  4EBL A;  3NOP C;  2ZBB A;  5J4E A;  4MN5 A;  5CRF A;  3IX3 A;  1BT5 A;  4LFU A;  3N6I A;  1W63 Q;  5DJT A;  5HW3 A;  1ES4 A;  4LRX C;  1ONG A;  4BLM A;  2VA0 A;  4H6J A;  4DXB A;  3RFB A;  4CLC D;  2O9B A;  3NEC A;  5HWW A;  4X1L A;  3Q1F A;  3P01 A;  5FQI A;  3LIB A;  2BAS A;  1N4O A;  3SOI A;  3B33 A;  1XA1 A;  1S1Y A;  3BY8 A;  2WKH A;  3LUQ A;  1YLT A;  2EX8 A;  5AQB A;  3IX8 A;  3A0V A;  4LPZ A;  4BL3 A;  4YNR A;  2OOL A;  1SZV A;  2HZ5 A;  3OBF A;  3IXD A;  3C8C A;  2QJ7 A;  5FEF A;  1ONH A;  2Y2L A;  4PM8 A;  3KSF A;  3BEB A;  1UWP X;  4EER A;  1Q2Q A;  2XLN A;  5FQQ A;  5HDS A;  5AJG A;  4HH2 A;  4NXG A;  4KZ8 A;  1PZP A;  2Y59 A;  3N7W A;  4WBG A;  2W3G A;  2HPB A;  4GDB A;  4R4R A;  4JXW A;  3H7W B;  1STZ A;  1Y4O A;  2EX9 A;  1YKD A;  2W1T B;  3Q82 A;  3GQZ A;  3VMA A;  2ZC4 B;  1S67 L;  3BFE A;  3T1Q B;  4JXS A;  3MFX A;  2QYB A;  3AGE A;  5JYO A;  4P6B A;  2H5S A;  4QHC A;  2D02 A;  2RCX A;  3T4J A;  1JNU A;  2WKQ A;  3SH7 A;  3C30 A;  1QME A;  2LB5 A;  4GB7 A;  3OC2 A;  3BRM A;  4FOF A;  3DAV A;  5GLB A;  2XRN A;  3D72 A;  4E3M A;  2ZC5 B;  4RX3 A;  4Y7P A;  1N9N A;  1PI5 A;  2WUQ A;  1ZTU A;  1OPX A;  1KGE A;  3K2N A;  3M2J A;  1XFN A;  1YMX A;  3FKV A;  4N9K A;  5DKK A;  5FA7 A;  1TS8 A;  5J3W A;  4G3W A;  5GHZ A;  3ZVT A;  3N4I A;  4L9F A;  5HAI A;  5K5B A;  4EEP A;  3IF6 B;  4R3J A;  1OTE A;  3H7W A;  3I7J A;  2WGW B;  3WRT A;  4O7D A;  2W1T A;  3CZD A;  2B5R A;  1XKZ A;  4XUZ A;  3OOV A;  5FSR A;  2WZZ A;  2WZX A;  4DXC A;  1I2S A;  1IEM A;  2INW A;  1DP9 A;  2Q0O A;  1L0G A;  4KZ5 A;  5TFQ A;  2OV5 A;  3B3X A;  2GDN A;  1PFL A;  3HLD A;  4HBT A;  1JVJ A;  4HIA A;  1T19 A;  3C5A A;  1N9B A;  4N1H A;  4WZ4 A;  3IWQ A;  3U4L P;  2P7J A;  4ZTK A;  3PBS A;  4KUO A;  1TS6 A;  3O87 A;  4DDS A;  3QP6 A;  4S2N A;  4WF0 A;  3RJU A;  3V67 A;  3LIF A;  4ETX A;  4QB8 A;  1D7E A;  2DMW A;  1Z6F A;  2X02 A;  4YIN A;  1W5D A;  2E8I A;  1VEU B;  2HP5 A;  1IYS A;  2Y2M A;  3PR6 A;  3DTI A;  4MMN A;  3T1S A;  5CGS A;  5G4Z A;  1T1A A;  1ERQ A;  1X0O A;  3MXS A;  3LIA A;  2KLI A;  4ZBE A;  2MJ6 A;  5CGX A;  3WS5 A;  4JGR A;  2JC7 A;  2VK3 A;  3FZC A;  3IF6 A;  1SKF A;  2ZJ9 A;  2WGW A;  2W3F A;  3E0Y A;  4MBH A;  1NRF A;  3BWL A;  4X68 A;  3WS2 A;  2ZM0 A;  1F2K A;  4IVK A;  1J3W A;  4R4S A;  4OPZ A;  2WGV A;  2EFX A;  2R9W A;  5DTK A;  2XR0 A;  2ZQ8 A;  3C7V A;  2PD7 A;  4UEY A;  3EEH A;  3HLW A;  4U0T A;  4ZRR A;  3G34 A;  3TSG A;  1YLW A;  5LBR A;  5HPF A;  3T4K A;  1SDN A;  4JXV A;  2XGN A;  3BQ8 A;  3V3R A;  4NKP A;  5F69 A;  2W0N A;  4LV2 A;  4UQI S;  3MJQ A;  1VEU A;  3SW1 A;  5TGF A;  4NET A;  1G68 A;  3T1X A;  4UQI M;  4UA7 A;  1LL8 A;  3T4L A;  3ZHH A;  1ERM A;  1ALQ A;  4HJ4 A;  4BQM A;  1UWN X;  3EGD C;  4CJN A;  3M2K A;  2G2U A;  2Y8H A;  3Q7Z A;  2XD5 A;  4C75 A;  1BZA A;  4GLQ A;  4BMW A;  4Y3I A;  1DJC A;  5KZH A;  2Z2L B;  1AWI A;  5TBM B;  4OPQ A;  2J3T C;  3ZVW A;  5DF9 A;  2G7U A;  4ZJ2 A;  4OOY A;  1LHY A;  2K2N A;  3MSH A;  1ZG4 A;  5IU1 A;  3IWI A;  4HJ6 A;  3SH9 A;  3LO7 A;  4MBK A;  1Y54 A;  5CEB A;  3VFH A;  2QPN A;  4Y15 A;  5F1F A;  2XH9 A;  2BG1 A;  2VEA A;  5EVI C;  3CPT B;  5TR7 A;  3ULF A;  3E4P A;  2M7V A;  4RQ9 A;  5KMW A;  4HOI A;  4HY8 A;  3NBL A;  4ZJ1 A;  2PT7 A;  5BOH A;  2V8C A;  3ZG7 B;  1NLY A;  3FC7 A;  2HDU A;  2VV6 A;  2FH5 A;  4DE1 A;  2VKS A;  4I3A A;  3UDI A;  3EEA A;  1VHM A;  4WLA A;  4UA6 A;  1XJ2 A;  3S7O A;  3MZE A;  3IQA A;  1FSY A;  2WAF A;  4GNU A;  4L9E A;  1W79 A;  1ACF A;  3ZG0 A;  2ZC7 A;  1S4R A;  4LRY C;  5EFW A;  1BLH A;  2H10 A;  3TRC A;  3BLS A;  1HZO A;  4JPM A;  5EV0 A;  5TBM A;  5FAO A;  2JKT M;  4OPY A;  4FD8 A;  2QZ6 A;  3UPP A;  1NYY A;  3OCL A;  2PHY A;  5HPI A;  3S7Q A;  3ZQ5 A;  2Y2N A;  3K3C A;  5EE8 A;  5FDH A;  2PU2 A;  3A0R A;  4E3J A;  3HL9 A;  1FR6 A;  3CIT A;  3LR4 A;  3LR0 A;  4CQH A;  4DKI A;  5DFX A;  2EWV A;  3CPT A;  1MWR A;  1KE0 A;  4OON A;  3LI9 A;  4WN5 A;  5GHY A;  5HDC A;  1KDW A;  1K6S A;  1ESU A;  5E2H A;  2WAE A;  3HLG A;  5HL6 A;  3VP3 A;  1IKI A;  4X1M A;  3ZG8 B;  1FQG A;  4CPK A;  3UB6 A;  4EW7 A;  3WWX A;  3C2W A;  4EXO A;  4P6Z S;  3ZG5 A;  1HD8 A;  4IBR A;  4K91 A;  5DJU A;  2WKR A;  4WM9 A;  4PMA A;  5HZH A;  4OQ0 A;  4R6L A;  4I38 A;  4N9L A;  3T12 B;  1WYC A;  5EPH A;  3F1P B;  4KQD A;  5CTN A;  2J80 A;  3W8K A;  1K57 C;  1K54 C;  2W27 A;  5CHJ A;  1TEM A;  1JTD A;  2OSU A;  3ZYT A;  4P0M A;  2P9V B;  4HEF A;  4JF6 A;  3ZNT A;  5J8X A;  4U3T A;  4LEN A;  3OLO A;  3V5M A;  3P7N A;  4D2O A;  2JE5 A;  1G5U A;  2IWB A;  1TDG A;  4KQQ A;  5HL1 A;  1PIO A;  1CEF A;  1PZO A;  3IF5 A;  2DCF A;  3E98 A;  4ID4 A;  2EA9 A;  4CLC E;  2JKT I;  5GLD A;  3ZGA B;  3FYZ A;  5E43 A;  3QP4 A;  3RXX A;  4MLL A;  4L9G A;  4UAA A;  5F6A A;  4BJP A;  5G18 A;  3S7P A;  1PI4 A;  1HTZ A;  3IBJ A;  3UE1 A;  1DP8 A;  3O86 A;  3LGO A;  4E3L A;  5EVE A;  3CUE C;  1VQQ A;  1TS0 A;  3T4O A;  3H9W A;  3ZDJ A;  1OJ5 A;  4A5R A;  4M3K A;  2QHK A;  5A91 A;  2R78 A;  2J3W A;  1MWS A;  1EW0 A;  4UA9 A;  4LV1 A;  2DNS A;  2BLS A;  3SS5 A;  3F1P A;  2ACG A;  4JF5 A;  3SH8 A;  3NIA A;  3E2K A;  2H0T A;  3GSG A;  3OPP A;  3VSK A;  3UDF A;  2P9V A;  1H8Y A;  4OQH A;  1YQS A;  1YLJ A;  1NRJ A;  2XRO A;  3OPH A;  2VGJ A;  1BSG A;  3IS2 B;  1DJA A;  3MZF A;  1L0F A;  1BLC A;  5AVE A;  2J9O A;  4BWI A;  3VP1 A;  1OTB A;  3BEC A;  3D4F A;  3IXG A;  1YPR A;  5M1A A;  1SHV A;  2Q9M A;  3G2Z A;  4HP9 A;  3UE6 A;  3L9K A;  4E6X A;  1CQA A;  4BD0 A;  2J7V A;  2JKR I;  1NWZ A;  3DW0 A;  5KSC A;  2I9V A;  3HUO A;  4FUW A;  5HWV A;  3V39 A;  2PRF A;  3NOT C;  2W3E A;  2Y2K A;  2Y55 A;  3VP2 A;  3R4K A;  3A3I A;  4E3N A;  2OWJ A;  4B9O A;  4PAU A;  4X6T A;  3EGX C;  2Q9N A;  2YKF A;  4OQG A;  4G3V A;  3F1O B;  3G30 A;  4HI4 A;  1YT4 A;  1PWD A;  3OPL A;  5HAP A;  3IBR A;  3N8L A;  4KG2 A;  2RL3 A;  3C38 A;  1L3L A;  4E3O A;  3MMH A;  1ES3 A;  5DTS A;  1JWP A;  3G6O A;  4NXF A;  4Q0J A;  3VP4 A;  4BL2 A;  3H82 B;  4WMC A;  1U60 A;  5FQM A;  3MR0 A;  4R0Q A;  4Y0O A;  2HJ9 C;  2GJ3 A;  3IS2 A;  5I5L A;  1XFQ A;  1WA9 A;  4KZ4 A;  4P87 A;  3IHA A;  1SDE A;  1EI5 A;  2CC1 A;  2HDQ A;  3UO9 A;  3QNC A;  3UNW A;  3PBQ A;  2HDS A;  3KYE A;  4IBX A;  4E04 A;  1UGU A;  3GEC A;  2XFT A;  1BUL A;  2PAV P;  4IHQ A;  4PM6 A;  2K31 A;  2VZW A;  5DKL A;  3LY3 A;  4S2O A;  3BJN A;  2OAQ 1;  1WE4 A;  3B42 A;  3W4O A;  2JKG A;  3FV7 A;  4EV4 A;  1IFQ A;  1FCM A;  4NG2 A;  1GSW A;  1BTL A;  2L0W A;  4GKU A;  5EOO A;  3ISG A;  3A3F A;  3Q07 A;  4WZ5 A;  3MBZ A;  4GZB A;  3F1O A;  2PBY A;  3UMD A;  2X01 A;  3EOI A;  2VGL S;  3LIC A;  1NZU A;  4R70 A;  1XX2 A;  4KZ7 A;  3PHY A;  2XQZ A;  3GTC A;  2VGL M;  2PU4 A;  1PWC A;  3VP0 A;  2H28 A;  4D60 A;  1OTI A;  3H82 A;  2P74 A;  2A3U A;  1W8Y A;  4OH0 A;  2O0Y A;  1XP4 A;  4M4X A;  1P0Z A;  3LEZ A;  3MZD A;  5E2E A;  2XK1 A;  1LSV A;  1RP5 A;  3L7H A;  1AXB A;  3B47 A;  2PD8 A;  4FCF A;  4PM7 A;  1ERO A;  1OT9 A;  3BFC A;  2XEP A;  4P85 A;  4DJ3 A;  3ZCZ A;  5MC7 A;  2ZMA A;  2Y2J A;  4DE2 A;  1KVM A;  1KVL A;  4Y5F A;  4QJG A;  4QD4 A;  3KSH A;  4RA7 A;  4DN0 A;  1K6R A;  3LFV A;  3UB7 A;  4ARZ B;  5CXW A;  2HDR A;  3TG9 A;  2A24 B;  1K55 A;  2XFS A;  3CWF A;  3V50 A;  3WS1 A;  5HAQ A;  3PXP A;  5AVF A;  5EM1 A;  4GHI B;  2Y79 A;  5DVA A;  4S2N C;  3MQO A;  4KQR A;  4RX2 A;  2XDM A;  5L07 A;  1XXM A;  4IUH A;  3UE3 A;  4DDY A;  4WEJ A;  2JN7 A;  4FTX A;  4CLC B;  2W3D A;  3VOY A;  1E4D A;  5M19 A;  2R9X A;  3JVU A;  2FFF B;  2XD1 A;  5CTM A;  1IKG A;  3GDI A;  3HRE A;  4PHT A;  3G35 A;  1YSP A;  5A92 A;  2V8F A;  4LGW A;  5FAT A;  2D01 A;  5F68 A;  2W1R A;  5CED A;  2J8Y A;  3D3O A;  3R7W B;  1K4E A;  1V9Y A;  3IF6 C;  4QY6 A;  4ETZ A;  1IEL A;  3BYD A;  3SZT A;  3WRZ A;  4BBV A;  4X69 A;  2KDK A;  2PBD P;  1XA7 A;  4N1X A;  1L0D A;  4ARZ A;  4KZA A;  3G32 A;  4JGO A;  3KYQ A;  4MN7 A;  5EUA A;  1O07 A;  3UB5 P;  2QJ5 A;  1GHP A;  1H8M A;  3D9Y A;  2A24 A;  5FAP A;  3ZFZ A;  3NY4 A;  3S1Y A;  2C6W B;  2ZM2 A;  3IH9 A;  4GDN A;  3QP2 A;  1JWV A;  4KEN B;  4GHI A;  4NXB A;  1CEG A;  1LSX A;  4Y2F A;  4LCM A;  4BBU A;  5FI2 A;  5DF7 A;  2XSS A;  1D1J A;  4CLC A;  1KDS A;  4S2K A;  4G3K A;  3U2A A;  5IHV A;  4KG6 A;  1GHI A;  4EEU A;  4OVD A;  3NJA A;  1M40 A;  3P98 A;  1A0K A;  5L8M A;  5F5Y A;  2P08 A;  3A3E A;  3DTE A;  1V9Z A;  1PNE A;  4R23 A;  5D3O A;  2O99 A;  3DWK A;  1DP6 A;  4KG5 A;  3VSL A;  3UE0 A;  1MWT A;  3S4X A;  5EVL A;  3ITB A;  4O8G A;  4WYY A;  1K4F A;  3CLO A;  1S0W A;  1IYP A;  2V1B A;  2VX8 A;  1MWU A;  2WGI A;  4XT2 B;  5IT5 A;  4I5S A;  5A93 A;  3HUN A;  2OLU A;  5FAQ A;  4HHD A;  5L10 A;  2CMN A;  5KIZ A;  2PR5 A;  2EWW A;  1LL5 A;  1MC0 A;  1DY6 A;  5GLC A;  1RGY A;  4DJ2 A;  5EOE A;  1S1Z A;  2EFU A;  4JF4 A;  1PW8 A;  3BFF A;  4Z9Q A;  1MKM A;  4L0L A;  4GD8 A;  2V2F F;  5G4Y A;  3WS4 A;  4NK3 A;  1KOU A;  3MQ0 A;  4U0X A;  3VE4 A;  2V9A A;  2Y2I A;  3C4P A;  3UPO A;  4E6W A;  3IHB A;  4MNR A;  4X56 A;  4P6Z M;  3VE3 A;  3HLB A;  3CJM A;  4QY5 A;  5HFO A;  3PBR A;  4OPR A;  2GZA A;  3LR5 A;  3N8S A;  3T4T A;  4HJ3 A;  4N92 A;  2M1C A;  2IA2 A;  4UHU A;  1YLZ A;  4S2I A;  5HX9 A;  4LLO B;  1T18 A;  3G2Y A;  2ZL1 B;  3RH8 B;  1W7F A;  3PAG A;  3KX0 X;  1G6A A;  1S6R A;  2JKR M;  3O5Y A;  1P97 A;  1T1B A;  4I3J A;  4DRT A;  2NUP C;  4C6Y A;  4XT2 A;  2VLG A;  2ZOH A;  4LV0 A;  2ZQ7 A;  4HES A;  4EU0 A;  3CG5 A;  2JCH A;  3UDX A;  2PR6 A;  2HGV A;  5CGW A;  3T4Q A;  4EQ1 A;  5F1G A;  1OT6 A;  5DFY A;  1IOU A;  3S7N A;  4S2L A;  3JPU A;  3E4O A;  3BFD A;  1PW1 A;  1XGJ A;  3E2L A;  1H0M A;  1RCJ A;  3PBN A;  3EQV A;  4I3I A;  4YFM A;  5I94 A;  4C3Q A;  4FH2 A;  5CER A;  5JYP A;  2AVX A;  1P9R A;  2PYR A;  2O9A A;  2ZLY A;  3GR2 A;  3FWL A;  4X55 A;  4RYE A;  2ZM8 A;  3GRJ A;  2Y2O A;  3LIE A;  4Y13 A;  1KE3 A;  1ZG6 A;  2KX6 A;  4JBF A;  3G31 A;  3O88 A;  4GS9 B;  2J9P A;  3HJI A;  2Y2H A;  4NEE D;  2EX2 A;  2ZL1 A;  5E2G A;  4JXG A;  3TW8 A;  1BUE A;  1BLS A;  5KSH A;  2EX6 A;  1TF1 A;  1P9W A;  1E3U A;  1NY0 A;  3A3D A;  3ITA A;  4GJ4 A;  5L2F A;  1H5X A;  4GN2 A;  4B4X A;  1S4S A;  4EET B;  3ZG9 B;  3SS4 A;  5M18 A;  1LI9 A;  4XUX A;  3KSG A;  2V20 A;  4EBP A;  2P04 A;  1ODV A;  1KGF A;  2B95 A;  4OP5 A;  4OP8 A;  3LI8 A;  4R3A A;  1JTG A;  5HD3 A;  3NDG A;  4DF6 A;  4HH3 A;  3LY4 A;  4Q8I A;  2PDR A;  1SCW A;  1YLP A;  3NC8 A;  4ZDX A;  1ZC2 A;  4S2J A;  1K25 A;  1DRM A;  1KGG A;  4MN6 A;  3MQQ A;  1K56 A;  3BLM A;  5CX7 A;  1CI9 A;  2OLV A;  5HSQ A;  4MDZ A;  3O3V A;  1I2W A;  2HP6 A;  1GA9 A;  3MF0 A;  2EXB A;  1OTD A;  3HJK A;  2ZMV A;  3QP5 A;  1MZU A;  4GS9 A;  5HAR A;  5AQ9 A;  2JBF A;  4MBF A;  3MXQ A;  2M7U A;  4B88 A;  1E25 A;  1MKI A;  2V1Z A;  5AQA A;  1JWZ A;  1NJ4 A;  2QWS A;  1LLB A;  4GOG A;  3CI6 A;  1GSV A;  4HQA A;  4PKY A;  4ESP A;  1N9O A;  2FZ0 A;  5CHU A;  3C4O A;  4IUK A;  4OQI A;  4WUJ A;  3MKF A;  4HP4 A;  4LRZ E;  1TVF A;  4Q0H A;  4KUK A;  5FL3 A;  4PM5 A;  1G28 A;  2V0U A;  1TD5 A;  3CMZ A;  4E3I A;  3KO6 A;  1LT0 A;  2Z6D A;  3MXR A;  1Z09 A;  1ZHH B;  1LSW A;  1ZKJ A;  4B4Z A;  3NHQ A;  3HBR A;  3NDE A;  3G4P A;  2Y2Q A;  4AFI A;  4HNB A;  3DTM A;  5HDD A;  1SKO B;  4E3K A;  3UY6 A;  3N8R A;  3EQU A;  3TJZ C;  2Y4A A;  4EUV A;  4BBT A;  3T4S A;  5GHX A;  4WL9 A;  5IS1 A;  2C5W B;  1M6K A;  3W4Q A;  3M6B A;  1MXO A;  1F98 A;  1FSW A;  3QP8 A;  4QWO A;  1Q2P A; 
#chains in the Genus database with same CATH homology
 4BBV A;  2W3H A;  3UB6 A;  2KDK A;  3KSF A;  3PYP A;  4EER A;  1UWP X;  4EW7 A;  3C2W A;  4EXO A;  4ARZ A;  4NXE A;  4JGO A;  4P6Z S;  3KYQ A;  4MN7 A;  5HDS A;  2WKP A;  2QJ5 A;  5AJG A;  1H8M A;  5DJU A;  5HD5 A;  2A24 A;  2WKR A;  4HH2 A;  2KOI A;  2K7S A;  4NXG A;  1OTA A;  5HZH A;  4R6L A;  4I38 A;  3F1N B;  1GSX A;  1YAX A;  2W3G A;  3F1P B;  3VOL A;  2HJE A;  2Z6C A;  4GHI A;  3H7W B;  4KQD A;  4ME4 A;  1STZ A;  2J80 A;  1LSX A;  4NXB A;  4Y2F A;  4BBU A;  1YKD A;  2W1T B;  2W27 A;  1F9I A;  2VJW A;  3ZYT A;  2XSS A;  1S67 L;  4CLC A;  4G3K A;  3MFX A;  3U2A A;  2QYB A;  1XJ3 A;  4JGQ A;  2D02 A;  3OLO A;  1OJG A;  3P7N A;  4EEU A;  3NJA A;  3E4Q A;  3T4J A;  1JNU A;  2WKQ A;  4FSF A;  3C30 A;  5L8M A;  2LB5 A;  4K08 A;  5F5Y A;  2P08 A;  3OC2 A;  1V9Z A;  4FOF A;  2B02 A;  3E98 A;  2O99 A;  2EA9 A;  4CLC E;  2XRN A;  2JKT I;  1DP6 A;  4B93 A;  2NUT C;  3D72 A;  4Q0I A;  4L9G A;  5F6A A;  4BJP A;  4WEL A;  4F3L B;  1N9N A;  3EWK A;  3CAX A;  1ZTU A;  1OPX A;  1XJ6 A;  1NLZ A;  4IJG A;  3S7P A;  4O8G A;  3CLO A;  3IBJ A;  3K2N A;  2V1B A;  2VX8 A;  1D06 A;  1XFN A;  4XT2 B;  1DP8 A;  5DKK A;  5IT5 A;  3CUE C;  2OWH A;  1TS0 A;  1YSQ A;  4I5S A;  3T4O A;  3H9W A;  1OJ5 A;  2QHK A;  4JGP A;  3UB8 A;  1TS8 A;  5J3W A;  3PBT A;  4PKY G;  2R78 A;  4G3W A;  3RTY A;  2J3W A;  1EW0 A;  1N9L A;  3F1N A;  4L9F A;  4HHD A;  5K5B A;  4EEP A;  2CMN A;  3F1P A;  5KIZ A;  2PR5 A;  2EWW A;  4R38 A;  1OTE A;  3H7W A;  1MC0 A;  2L4R A;  2W1T A;  4DJ2 A;  3OOV A;  1S1Z A;  3T50 A;  3VV4 A;  2VV7 A;  1MKM A;  4L0L A;  1NRJ A;  5G4Y A;  2XRO A;  2INW A;  1DP9 A;  1KOU A;  1G6O A;  3MQ0 A;  4DMZ A;  4YWZ A;  3IS2 B;  3VE4 A;  2V9A A;  2XA7 S;  5AVE A;  5J7E A;  4HIA A;  4BWI A;  1OTB A;  1TS7 A;  1T19 A;  4P6Z M;  2XA7 M;  2V1A A;  4O01 A;  3VE3 A;  2P7J A;  3PBS A;  4KUO A;  1TS6 A;  3PBR A;  2GZA A;  4WF0 A;  4Z1W A;  3LR5 A;  3T4T A;  3V67 A;  3LIF A;  4ETX A;  3UE6 A;  4HP9 A;  1D7E A;  4HJ3 A;  2DMW A;  2M1C A;  3TE8 A;  2IA2 A;  3BY9 A;  2PYP A;  4OOM A;  4LLO B;  1T18 A;  5A8B A;  3KSI A;  4F3L A;  3RH8 B;  3KX0 X;  2JKR I;  1NWZ A;  3PR6 A;  2JKR M;  2I9V A;  3O5Y A;  1P97 A;  4MMN A;  1T1B A;  4I3J A;  2A2L A;  2NUP C;  5HWV A;  3NOT C;  2W3E A;  2L1M A;  4XT2 A;  2VLG A;  5G4Z A;  4KQO A;  3R4K A;  2ZOH A;  1T1A A;  1VB6 A;  1X0O A;  2HF6 A;  3LIA A;  2OWJ A;  4B9O A;  2LB9 A;  4PAU A;  2KLI A;  3EGX C;  2MJ6 A;  4EU0 A;  2YKF A;  2O9C A;  3LR3 A;  4JGR A;  4G3V A;  3F1O B;  2PR6 A;  2B18 A;  2HGV A;  4HI4 A;  3T4Q A;  4EQ1 A;  1OT6 A;  5DFY A;  3IBR A;  1IOU A;  2W3F A;  3S7N A;  3R7W A;  3E4O A;  3C38 A;  3E0Y A;  3BWL A;  3PBN A;  3EQV A;  3MMH A;  4I3I A;  3G6O A;  3ICY A;  4NXF A;  4Q0J A;  3H82 B;  2QKP A;  5C5K A;  3MR0 A;  2HJ9 C;  2GJ3 A;  2PD7 A;  3A0S A;  3IS2 A;  4GW9 A;  5I5L A;  1XFQ A;  4UEY A;  1WA9 A;  3EEH A;  4ZRR A;  1P9R A;  2PYR A;  2O9A A;  5LBR A;  3K3D A;  3PBQ A;  5HPF A;  3T4K A;  4E04 A;  3HCY A;  3LIE A;  1UGU A;  3OCN A;  3GEC A;  3BQ8 A;  2KX6 A;  2ZOI A;  1F5M A;  4NKP A;  5F69 A;  5HWT A;  4GS9 B;  1S66 L;  2W0N A;  1H3Q A;  3HJI A;  4UQI S;  3MJQ A;  4NEE D;  4IHQ A;  3SW1 A;  2K31 A;  2VZW A;  2HV1 A;  5DKL A;  4CLC C;  4UQI M;  3DBA A;  3TW8 A;  3BJN A;  5KSH A;  4O0P A;  1LL8 A;  3T4L A;  2V0W A;  4YOF A;  4HJ4 A;  2OAQ 1;  1TF1 A;  3B42 A;  1P9W A;  1UWN X;  3EGD C;  1IFQ A;  2J3T D;  2Y8H A;  4OOL A;  1Y28 A;  1XJ4 A;  1GSW A;  2L0W A;  3FG8 A;  4GJ4 A;  2GNX A;  3NOU C;  3LYX A;  4GLQ A;  3BW6 A;  4BMW A;  3UB9 A;  1S4S A;  4EET B;  2VV8 A;  4Y3I A;  3UME A;  1T1C A;  4EES A;  5TBM B;  2J3T C;  3F1O A;  5DF9 A;  3KSG A;  2YKH A;  4GCZ A;  3KYZ A;  2G7U A;  3BQA A;  2P04 A;  1ODV A;  3UMD A;  3LI8 A;  4R3A A;  3EOI A;  2VGL S;  4II7 A;  5HD3 A;  3LIC A;  4H6J B;  2K2N A;  3LID A;  4MCW A;  4HH3 A;  4R70 A;  3FPV A;  2PDR A;  3PHY A;  5IU1 A;  2VGL M;  4HJ6 A;  2OAP 1;  2H28 A;  1OTI A;  3H82 A;  5TJJ A;  1DRM A;  4MN6 A;  3MQQ A;  3W2Z A;  2O0Y A;  3CUE A;  4M4X A;  5CX7 A;  1P0Z A;  2VEA A;  1LSV A;  1BYW A;  3ULF A;  3B47 A;  3E4P A;  5HSQ A;  4MDZ A;  2M7V A;  4RQ9 A;  3JVV A;  2PD8 A;  4HOI A;  4HY8 A;  3FPW A;  3MF0 A;  1OT9 A;  3PBO A;  1OTD A;  3HJK A;  4WEK A;  2PT7 A;  4DJ3 A;  5MC7 A;  2ZMV A;  4I39 A;  1NLY A;  3FC7 A;  2VV6 A;  2FH5 A;  1MZU A;  2GX5 A;  4GS9 A;  2VKS A;  4I3A A;  4Y5F A;  1W63 M;  3MXQ A;  3KSH A;  2M7U A;  4DN0 A;  3EEA A;  1VHM A;  3LFV A;  4WLA A;  3UB7 A;  2ZMF A;  3S7O A;  1XJ2 A;  4QPR A;  2QWS A;  4ARZ B;  3CI6 A;  2JHE A;  1GSV A;  4HQA A;  4PKY A;  4L9E A;  3NOP C;  1N9O A;  2FZ0 A;  1S4R A;  2A24 B;  4LRY C;  5EFW A;  4IUK A;  2ZBB A;  5J4E A;  4MN5 A;  4WUJ A;  3CWF A;  3TRC A;  4HP4 A;  4LRZ E;  3PXP A;  5AVF A;  1W63 Q;  5TBM A;  4Q0H A;  4KUK A;  5FL3 A;  2JKT M;  1G28 A;  2V0U A;  4GHI B;  1TD5 A;  5DJT A;  4LRX C;  2Y79 A;  3KO6 A;  3MQO A;  1LT0 A;  2Z6D A;  2VA0 A;  1ZHH B;  4IUH A;  1LSW A;  4H6J A;  3UE3 A;  3NHQ A;  3RFB A;  4CLC D;  3OCL A;  4WEJ A;  2JN7 A;  2O9B A;  2PHY A;  5HPI A;  5HWW A;  3S7Q A;  3ZQ5 A;  4CLC B;  2W3D A;  3P01 A;  4AFI A;  4HNB A;  3K3C A;  5HDD A;  3LIB A;  2BAS A;  3JVU A;  3A0R A;  3CIT A;  3LR4 A;  3GDI A;  3EQU A;  3LR0 A;  4PHT A;  3B33 A;  3TJZ C;  1YSP A;  4CQH A;  4EUV A;  1S1Y A;  3BY8 A;  5DFX A;  2EWV A;  4BBT A;  3LUQ A;  2D01 A;  5F68 A;  2W1R A;  3LI9 A;  4WN5 A;  5HDC A;  3A0V A;  4LPZ A;  3T4S A;  4WL9 A;  4YNR A;  2OOL A;  5IS1 A;  3OBF A;  3D3O A;  3R7W B;  3C8C A;  1V9Y A;  4ETZ A;  5HL6 A;  1F98 A;  2QJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...