3P01A

Crystal structure of two-component response regulator from nostoc sp. pcc 7120
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
178
structure length
178
Chain Sequence
QRAAETYDLLKQRTEELRRANAQMSLLTVLVQVTQASNSLEAILTPIATAFAESFAVNACILQMLEGQTLSTIQGFYSQQGTVNNWLNQDPLTNEAIATGQIQVAANIAKDPKLASISQYQDNGIQSHVVIPITYRNEMLGVLSLQWQQPISLREDELTLIHLSAQLVAIALTSSRCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Two-component response regulator
publication title Crystal structure of two-component response regulator from Nostoc sp. PCC 7120
rcsb
source organism Nostoc sp.
total genus 51
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.340 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p01A02
3P01A
chains in the Genus database with same CATH superfamily
2OLVA 2A24A 4WL9A 4P0MA 4BBTA 4FD8A 3E2LA 5HL6A 3SH8A 4GLQA 5A90A 2BASA 5F69A 3T4TA 3N6IA 4I38A 3G4PA 3A0VA 4I5SA 3NDEA 4EUVA 5TBMB 3QP2A 4GHIB 2PHYA 4K08A 1PZPA 3SS4A 2IWCA 2LB5A 1K54A 1G68A 2ZM0A 4H8RA 4BWIA 1XJ2A 1NYMA 2OWHA 4OPRA 5BOHA 1XXMA 4X69A 3LGOA 3LICA 5GLDA 3CG5A 5GLBA 1IYOA 3IWOA 3CJMA 4OVDA 3CHWP 4YINA 3QP1A 3RTYA 4IEDA 2G7UA 5GLAA 4OOMA 2QZ6A 3CPTB 4ESPA 4IBXA 3CAXA 3DTKA 1ACFA 1TEMA 2W1TA 2I9VA 5EECA 1O7EA 5FI2A 4GN2A 2NUTC 3OPHA 3MS6A 4OP8A 2V1AA 5L10A 5CERA 4LRYC 3D4FA 3O5YA 4P6ZS 5FATA 1NXYA 3QNCA 5AQAA 4ZDXA 1YMSA 3BJNA 4KZ9A 4WZ5C 3IWIA 1L0EA 4EV4A 1S1ZA 1G6AA 4KUKA 1SHVA 3GECA 4QY5A 3MQQA 5JYOA 4CLCE 4YOFA 1Q2PA 4CLCD 1C3BA 2HP5A 1W63Q 3HLFA 3W4OA 1K56D 3N4IA 3BFDA 1PWCA 3PBNA 1QMEA 5F83A 3VE4A 2H0TA 1YLTA 2M1CA 3ZG9B 3LIDA 5DKLA 1XP4A 3IF5A 2VGLM 4ARZB 1FR1A 4IVIA 1L0FA 5M19A 5F68A 5TJJA 2IA2A 1YLJA 3G30A 5HDDA 4P87A 4PPRA 3BFGA 2BG1A 4HEFA 3DWKA 2XFTA 2JCHA 3ZVTA 5GHXA 4E3IA 1ZC2A 4NXEA 3UPPA 1BULA 1BSGA 1STZA 4OQGA 4N1XA 3M6HA 1TF1A 3IBRA 3G2YA 2HZ5A 4O7DA 4GOGA 3LYXA 4Q8IA 2W1RA 2B18A 2OSUA 5KZHA 2XR0A 2V0WA 4EBLA 3GRJA 4HESA 3UB7A 1PW1A 2J3WA 3OCNA 1TVFA 1JWPA 1TD5A 3V50A 4X1LA 2KOIA 2HDSA 5J3WA 3UO9A 1JWVA 3ZFZA 1IYQA 1NRFA 2PAVP 4OPQA 2KLIA 2VX8A 1VEUA 2FH5A 5M18A 1D06A 5TGFA 3KSFA 2PD7A 2Y2LA 5FI7A 4BENA 3NIAA 1ZG6A 5CXWA 5IU1A 4DE1A 1D7EA 5AQ9A 3Q81A 3WS2A 4ID4A 4O01A 4ETZA 1ONHA 4YNRA 3LR4A 2GDNA 1IKIA 2H10A 2ZQAA 3SOIA 4HH3A 3GSGA 1FQGA 3MQ0A 1CK3A 5HARA 2HF6A 1WYCA 1Q2QA 4R3BA 1OTAA 1VM1A 2B95A 1J9MA 2Y55A 3KYZA 4LV0A 5EE8A 2FFYA 3CUEA 1PW8A 4BD1A 4GZBA 4N1HA 1K4EA 3LIFA 1SZVA 2WK0A 2JKRM 1JVJA 4EETB 3D3OA 1KE3A 4HBTA 2V2FF 3BECA 4Y0OA 2PBDP 5EM0A 1DP9A 3M6BA 3L9KA 5HL1A 4BD0A 1CQAA 3HL9A 3KSGA 2PU2A 1CI8A 3MZFA 1FOFA 4XUZA 1MKMA 3HCYA 1P9WA 4JGRA 1K54C 1XJ4A 3HLEA 2Y2GA 3IH9A 3E4PA 2PR5A 4MN6A 5GHZA 3CITA 2ZL1B 4E04A 1T1BA 1GHMA 4ZBEA 3TJZC 2J3TC 3DWZA 5FAPA 1LL5A 1YSQA 2HDUA 3KYQA 1FILA 3MSHA 5HPFA 1K56A 4I3JA 2OWJA 4FUWA 4RYEA 1GSWA 2AVXA 1KGEA 2PYRA 2Z6DA 4NKPA 5DTKA 5A93A 3QHYA 2W0NA 5FDHA 1H8ZA 5L09A 2XRNA 2A2LA 5EUAA 2H28A 5HPIA 4CPKA 1K38A 1YKDA 3ZG8B 1F98A 3MZDA 5FA7A 2Z6CA 1MWSA 2JKTI 3UDFA 4R4RA 4RX3A 3HJIA 3PAEA 2E8JA 1Y54A 3KSIA 3P7NA 4Y0UA 3NCKA 5EVIB 1H3QA 3N8SA 3FKVA 3ZVWA 1MY8A 4WEJA 5CRFA 5AVFA 5D3OA 5EVEA 2WUQA 3F1PA 1VQQA 1IEMA 1N9OA 3BFEA 1IOUA 2ZQCA 5TR7A 4KUOA 4DKIA 1ES5A 2Y2JA 2XD5A 4B88A 1Z6FA 3Q07A 3BLSA 2VEAA 1A0KA 4IBRA 1WE4A 1N9LA 2ZQDA 3LEQA 1T19A 4ETXA 5AQ7A 2ZC6B 4HJ4A 4X25A 3HLDA 3EEAA 4JXGA 1LI0A 1MPLA 5DTTA 3WS5A 3S7NA 1KVMA 4M3KA 2V8FA 5EOOA 4K0WA 1UWNX 3NECA 4QWOA 4WLAA 1IKGA 1XFQA 4DDSA 5CEBA 2GJ3A 1HZOA 1YLPA 2DMWA 1VETB 4UA7A 2WADA 2WKQA 4JGPA 5HWVA 3JPUA 4BMWA 3O88A 2XFSA 1OJGA 3UMDA 5FQ9A 3R4KA 4R23A 5FQIA 4PM7A 1ZHHB 3EOIA 3ZNYA 3LR5A 3PBRA 4JXSA 4X68A 3MXSA 3NC8A 4MBFA 2KDKA 4S2NC 1W8YA 1D1JA 1AWIA 1YLWA 3KSHA 1PI4A 1ZG4A 4L9FA 4EQ1A 3JVVA 1PFLA 4DXBA 1L3LA 5HD3A 1K55A 4GCZA 3IT9A 3R7WA 3PXPA 4KZBA 4GS9B 3C5AA 1OJ5A 3NOTC 1P97A 4S2PA 1GSVA 5DVAA 3HUNA 2OLUA 2W3HA 3T4OA 1IYSA 4WELA 5DF9A 2HJ9C 4PMAA 1V9YA 1T1CA 3IF6A 3RXWA 4R4SA 2ZLYA 1YM1A 1BLCA 4MDZA 2M7VA 3SS5A 4UEYA 4DXCA 3ZYTA 2Y2OA 3B42A 4S2MA 2K31A 2ZMVA 1FCNA 4I3AA 1H8YA 3RXXA 4I39A 1V9ZA 4FSFA 4Y5FA 5DKKA 4GD6A 5FEFA 3PBTA 3WRZA 1BYWA 2GX5A 3NULA 5CHUA 3ZG7B 2PBYA 4JF5A 1L0DA 1TDGA 4DE0A 1WYBA 1G5UA 2P08A 3U4LP 3ZNTA 1K0KA 4HBUA 4E3LA 1K57C 4E3OA 1XGIA 3S7PA 3UDIA 4LCLA 3LY3A 5HAIA 1T1AA 4MBKA 2VK3A 1LT0A 1SKOB 4DN0A 1S66L 2Z2LB 4JXVA 2E8IA 3CZDA 3FYZA 5FQJA 4OP5A 4MLLA 3F1NA 4H6JB 2UV0E 3PR6A 5F6AA 4EBPA 4ZRRA 4QJGA 1S1YA 3QP4A 2LB9A 3E4QA 1EWZA 3I7JA 3UE6A 1EROA 4F3LB 2PT7A 2HPBA 4DMZA 3BEBA 4DE2A 4CLCC 2D02A 5FASA 3ISGA 1P0ZA 3KX0X 3G34A 3OLOA 3B3XA 2ZOHA 3OPPA 2QJ5A 1HD8A 4MNRA 1ALQA 1N9NA 2V20A 1W5DA 4QY6A 3BQAA 4IVKA 3H7WB 2WAEA 2XK1A 4KZ3A 4LGWA 4O8GA 3OC2A 2IWBA 3IS2B 1XFNA 5A92A 1PI5A 1CI9A 3FV7A 2R9WA 3T4LA 3ULFA 2PDRA 5KMWA 1HLUP 2ZQ8A 2GNXA 2VJWA 3GQZA 2P9VA 3M2JA 4EU0A 4S2KA 2VV6A 2JBFA 1NZOA 4HIAA 4DE3A 3MKEA 5IS1A 3N8LA 3VFFA 2R9XA 1OMEA 4WZ4A 2O99A 3QP8A 2ZM8A 1L2SA 2O9AA 2Y79A 2V8CA 3V3SA 4KQRA 3VOYA 1PRQA 5EFWA 4BJPA 4B4XA 3E0YA 3MXQA 3G31A 3ITBA 3HVFA 4OPYA 1NWZA 3F1OA 5LBRA 4EWFA 5MC7A 3PTEA 2QWSA 2Y2MA 3W4QA 4QHCA 3P09A 1YMXA 3PAGA 1ESIA 4MCWA 2ZMFA 5FQMA 4E3NA 3T1QB 1IFQA 3SW1A 4BQMA 5AVEA 2YKFA 4Z1WA 2ZM2A 1OPXA 4QU3A 2O0YA 2K7SA 3FC7A 1GHPA 4XUXA 3GMWA 3T12B 1BUEA 1OTDA 3Q7VB 2XEPA 4KG5A 1HVBA 1MXOA 5AJGA 3O3VA 3S7OA 3LY4A 4D60A 1K6SA 2ZC7A 1JTDA 2I72A 1PNEA 3OZHA 2JKGA 4IUHA 3MJQA 2DRWA 3FZCA 1LI9A 1MC0A 4QPRA 4Q0JA 5J4EA 1YSPA 3PBOA 1CF0A 2WGWA 1EI5A 1JTGA 4OQIA 4XT2B 2X01A 3UY6A 1L0GA 2WZZA 1WA9A 1SDNA 2VV7A 4LV1A 3Q7ZA 2V1ZA 1KDWA 2PR6A 1Y28A 5DJUA 5U47A 4G3VA 1OT9A 4K0XA 4HNBA 5EVLA 2XH9A 3U2AA 3HLBA 3IF6C 1DP6A 3SH9A 4LV3A 4HJ3A 1GHIA 1HTZA 3VSKA 4N9LA 3LIAA 3Q1FA 3HUOA 1K4FA 5FAOA 4FH2A 4S2LA 3P01A 1XJ3A 3M2KA 2JKFA 4F94A 3H82B 2HDQA 1NJ4A 5CHMA 5TBMA 2J9OA 4GHIA 2WKIA 3PBSA 5HFOA 5IHVA 4S2IA 4B4ZA 3VP0A 4X56A 3IH8A 5F1FA 4NXBA 2PD8A 4Y17A 2VKSA 5HDSA 3ITAA 3OCLA 1MWTA 4P85A 3C30A 4LV2A 4X6TA 4RQ9A 2A24B 1U60A 5KSHA 5DTSA 2HP9A 3B33A 4IJGA 5CGSA 2O9BA 3HUMA 1FR6A 3CPTA 5F82A 1KGFA 4R38A 2ZC4B 3IHAA 2Y2IA 3NOUC 5L8MA 4P6BA 1NZUA 5I5LA 3E4OA 4DJ3A 3BYDA 4WBGA 3WS4A 4KZAA 3TOIA 1GSXA 5HAQA 2ACGA 3C2WA 1F9IA 1I2SA 3VP4A 2Y2KA 4Q0HA 1FIKA 3DTMA 3UE0A 2Y4AA 1N9BA 1LL9A 1ODVA 3QP5A 2XA7M 3BFFA 1AXBA 3TG9A 1W7FA 2ZOIA 4Z9QA 2W1TB 4WZ5A 1DP8A 2L4RA 2X02A 1S6RA 4ARZA 4N92A 3LI8A 5C5KA 5EOEA 2L1MA 4JF6A 4WEKA 4X1MA 2A3UA 4Y3IA 4NEED 5HD5A 3WS0A 4Y7PA 1RP5A 5CECA 1NY0A 4C6YA 4AFIA 4JKTA 2FFFB 5FL3A 4A5RA 3C7UA 3C7VA 3LIBA 5EVID 3TSGA 2ZC5B 2QPNA 1LSVA 4Q0IA 5GHYA 2JKRI 3T4KA 4UQIM 3T1XA 3KO6A 2WAFA 1TS0A 4MMNA 3B47A 2WGIA 2C6WB 5E2EA 4OLGA 2VLGA 4PM9A 1LSXA 3BY9A 3TE8A 2W3FA 5DF7A 3G2ZA 4HI4A 3NY4A 1ERQA 4OQHA 3IHBA 4S2OA 4I3IA 4O0PA 5A91A 3MFDA 3MZEA 4PM5A 2XROA 5EV0A 5HAPA 1DJBA 1K6RA 2JN7A 4E3JA 3TRCA 2HDRA 2HJEA 2PYPA 2HV1A 4KZ6A 1I2WA 3A0RA 3A3JA 2A49A 2VGLS 2Q0OA 4KQQA 4M4XA 2R78A 2H5SA 1PYYA 3CWFA 2QYBA 4UA6A 5EPHA 5M1AA 2Y2HA 5HDCA 3GR2A 3EQVA 1VB6A 4EXOA 4MN7A 1QMFA 4BLMA 1W8QA 1YT4A 2XLNA 2B5RA 4GKUA 3LR3A 2RCXA 4EEUA 3NDGA 2D01A 3GDIA 3T4QA 1DJCA 2J8YA 5FQQA 2XD1A 4DDYA 4FCFA 1BZAA 3T50A 4KZ7A 1YAXA 1VEUB 2YKHA 3N7WA 3LO7A 2JHEA 1S67L 1NRJA 2V1BA 2C5WB 3AGEA 2OAQ1 3GV9A 3MFXA 4LRZE 4CQHA 5K5BA 4U0TA 3CUEC 4B93A 4UAAA 4KZ4A 4HHDA 4LLOB 1MKIA 3MMHA 4L9GA 3VFHA 1LSWA 2WGVA 4R70A 3OPLA 2Y91A 2HGVA 1DY6A 1BLSA 1UGUA 1IYPA 1OT6A 2MJ6A 3C8CA 3VOLA 3WRTA 1BT5A 2B02A 1JNUA 1E25A 2ZL1A 3NBLA 1I5QA 3UB6A 4R3AA 5TFQA 1ZTUA 3EGDC 5GLCA 5E2GA 4X53A 4EW7A 4U3TA 3TW8A 4HP4A 1FSWA 4XXRA 3WS1A 1ERMA 3EQUA 4E3KA 3FKWA 4EERA 5HSQA 2PRFA 1S0WA 3DBAA 4PHTA 2J7VA 3S22A 4PKYG 2G2WA 4HOIA 1NLYA 2O9CA 4R6LA 5DJTA 3FWLA 4R0QA 4WUJA 2P7JA 4OH0A 4HJ6A 2RL3A 2VZWA 3BW6A 1VHMA 4QB8A 1TDLA 4GNUA 4NK3A 4LENA 2Q9MA 5L2FA 2DCFA 3UMEA 1BTLA 1ESUA 3OBFA 1GCEA 5J8XA 2X71A 1DRMA 5DFXA 3UB8A 3C4PA 3SS3A 5EVIA 3LI9A 5FAQA 4CJNA 4CLCB 5KSCA 4BBUA 2JE5A 5CEDA 4EESA 1PZOA 3UE3A 1KGGA 4FOFA 1KVLA 2FZ0A 3VE3A 3G6OA 2XDMA 1LHYA 3K3CA 3QP6A 4JLFA 1H8MA 3VSLA 3ZG0A 1XPBA 4GW9A 3UB9A 2V9AA 4UA9A 4GDBA 4PM8A 2Q9NA 4ZJ1A 2HP6A 1P9RA 1LL8A 2VA0A 3MBZA 1NYYA 4GJ4A 1RGZA 4FH4A 1PWDA 3L7HA 5FEGA 2KX6A 3HJKA 2P74A 3V5MA 3DTIA 2INWA 3T1SA 1VETA 3F1PB 5DF8A 5HWWA 3LFVA 4KZ8A 2M7UA 2DNSA 4FTXA 3CMZA 2WKPA 4YWZA 3AGFA 4QD4A 3LUQA 4GB7A 4ME4A 3G32A 5G18A 2XA7S 4JXWA 3HBRA 4K91A 5G4YA 2UWXA 3UB5P 4R3JA 4Y0TA 5AQBA 4KQDA 3CLOA 3NHQA 2Y2NA 4R1GA 3VV4A 1W63M 2W27A 2XGNA 5HZHA 1E4DA 2WZXA 3LCEA 3V3RA 3VOZA 4BL2A 5F1GA 1DJAA 1SCWA 3T4JA 3NOPC 1TS8A 4OKPA 1W79A 1CEGA 2EX6A 5L07A 2NUPC 3RJUA 2WYXA 3IXDA 4NG2A 1ONGA 2EWVA 2ZQ9A 4GS9A 3UPNA 1E3UD 2OAP1 4UQIS 2XQZA 4DJ2A 3DW0A 4IHQA 4HQAA 4JGOA 4S2NA 1IELA 1K55C 5E2FA 3S1YA 3FG8A 2EXAA 5EM1A 4KG6A 4G3KA 4KENB 4ZJ2A 2VGKA 1M6KA 4PM6A 3WWXA 3GTCA 4N9KA 1KE4A 4PAUA 2WKRA 3Q82A 5DFYA 1OTIA 4JPMA 4LRXC 4WN5A 1ES2A 4KG2A 3AGDA 3JVUA 3UPOA 2JKTM 3E2KA 2PU4A 3KYEA 5FSRA 3T1RA 1GA0A 1S4RA 3R7WB 1CEFA 3VP1A 3BY8A 1FSYA 4WMCD 3QNBA 2QMIA 1J3WA 2W3EA 3OOVA 3JYIA 3UDXA 1F5MA 4RX2A 2Z2MB 3C38A 2K2NA 3ICYA 3P98A 1XA7A 3A0SA 3IX4A 5CX7A 3IXBA 3BRMA 3IF6B 1H0MA 5KIZA 5CTNA 3BWLA 3IX8A 3MR0A 1SKOA 1FCOA 4P6ZM 3IXHA 2VGJA 1JWZA 4BL3A 4E6XA 5A8BA 1KE0A 4H6JA 1MWUA 3OPRA 4ZAMA 1BLHA 1FCMA 3PHYA 3O86A 2EA9A 2WKEA 5HX9A 2L0WA 4KQOA 4OLDA 1K57A 5CHJA 1NLZA 2JC7A 4F3LA 1G28A 4OQ0A 1ES3A 3H9WA 1YLYA 3MXRA 4EUZA 3V39A 1XA1A 3S7QA 3D9YA 5E2HA 4PKYA 3MF0A 3IX3A 2EFXA 1XJ6A 4UHUA 3ZGAB 4GDNA 2EFUA 2VV8A 3H7WA 4RA7A 2V0UA 3VMAA 1YQSA 4EBNA 3IS2A 3ZQ5A 3SH7A 3SZTA 3S4XA 4X55A 3ZHHA 3MQOA 5FDSA 4WYYA 2CC1A 3BM6A 2ZBBA 1OTBA 3F1NB 2EXBA 4JF4A 4CLCA 4GD8A 3A3FA 3IXGA 3ZDJA 2OV5A 2Y2PA 2CMNA 3BLMA 1LLBA 2W3DA 5E43A 2EX2A 1OTEA 1ZKJA 5EVIC 3G35A 1X0OA 2J80A 4JBFA 2J3TD 4C3QA 1TS6A 3NJAA 4S2JA 5GL9A 2H0YA 5F5YA 1XX2A 2ZQ7A 3RH8B 3C4OA 5CTMA 2OOLA 3FPWA 3FPVA 3DTEA 3LR0A 4C75A 3RFBA 2ZMAA 1MBLA 1RGYA 1PIOA 2EWWA 2QKPA 1XKZA 5IT5A 1RCJA 2QJ7A 3GVBA 3VP3A 1YPRA 4II7A 3MKFA 4DF6A 3W2ZA 2P9VB 2Y59A 4OPZA 3PYPA 3O87A 2G2UA 4NETA 1Z09A 1PWGA 4MEZA 4U0XA 2QHKA 3UNWA 1CJFA 1K25A 5FQKA 4WM9A 1O07A 3IQAA 1XGJA 1BLPA 3ZG5A 3HREA 3EWKA 4NXFA 4WF0A 2XSSA 3VP2A 2ZD8A 3Q7VA 4RVAA 2EX9A 1UWPX 3UN7A 3T4SA 2W3GA 2ZJ9A 4L0LA 3K2NA 1SDEA 3HLGA 5G4ZA 4DRTA 3BFCA 4OOLA 1EW0A 2ZC3B 2XF3A 4KZ5A 4MBHA 3F1OB 1SKFA 2Y2QA 3K3DA 1E3UA 4EQIA 1M40A 3CI6A 3A3EA 1H5XA 3D72A 4YFMA 1YLZA 4HY8A 4LFUA 3BQ8A 4LCMA 4D2OA 3A3IA 4LPZA 2J9PA 4NXGA 1GA9A 4OONA 1N4OA 1S4SA 1F2KA 4IUKA 3V67A 4Y13A 3HLWA 4XT2A 2WKHA 3EGXC 4B9OA 5CGXA 3EEHA 4BBVA 3IWQA 4ZTKA 5FI6A 3N8RA 2Y8HA 1KOUA 4L9EA 4E3MA 4HP9A 4WMCA 1ES4A 1KDSA 1MWRA 3A3DA 3W4PA 1MZUA 3DAVA 5J7EA 2GZAA 3E98A 5HWTA 4ZJ3A 3W8KA 3HLCA 5I94A 4EEPA 3PBQA 4G3WA 4OOYA 5JYPA 3LIEA 2WGWB 2IWDA 2P04A 3IBJA 4HH2A 1T18A 3H82A 3LEZA 3ZCZA 3UE1A 5HW3A 2EX8A 4MN5A 3NI9A 2BLSA 2BTFP 4E6WA 4Y2FA 5CGWA 1TS7A 1G6OA 1Y4OA 4JGQA 4Y15A
chains in the Genus database with same CATH topology
5TBMA 3HJKA 4GHIA 2INWA 2A24A 4WL9A 1N9LA 4BBTA 1T19A 5HL6A 3PBSA 4GLQA 4ETXA 4HJ4A 3F1PB 5HWWA 2BASA 3LFVA 3EEAA 2M7UA 2WKPA 5F69A 4YWZA 3S7NA 3T4TA 4I38A 3LUQA 4ME4A 4NXBA 2PD8A 3A0VA 2XA7S 4I5SA 1UWNX 2VKSA 5HDSA 4WLAA 4EUVA 3OCLA 1XFQA 5TBMB 3C30A 5G4YA 4RQ9A 4GHIB 2GJ3A 2PHYA 2A24B 2DMWA 5KSHA 4K08A 4KQDA 3CLOA 3B33A 3NHQA 4IJGA 2LB5A 2O9BA 2WKQA 3VV4A 4JGPA 5HWVA 4R38A 4BMWA 1OJGA 3NOUC 3UMDA 4BWIA 1XJ2A 2OWHA 1W63M 2W27A 5HZHA 3R4KA 5L8MA 1ZHHB 3EOIA 3LICA 3LR5A 3PBRA 3T4JA 3NOPC 5I5LA 1TS8A 3E4OA 3RTYA 2G7UA 2NUPC 4DJ3A 4OOMA 2EWVA 3CAXA 1GSXA 4GS9A 2KDKA 2W1TA 2I9VA 3C2WA 1F9IA 2OAP1 2NUTC 4UQIS 4DJ2A 4IHQA 3KSHA 2V1AA 4HQAA 4JGOA 4LRYC 4L9FA 3O5YA 4P6ZS 4EQ1A 3JVVA 4Q0HA 3FG8A 4G3KA 5HD3A 1ODVA 3BJNA 4GCZA 2XA7M 3R7WA 3PXPA 1S1ZA 4PAUA 2ZOIA 4GS9B 2WKRA 4KUKA 1OJ5A 2W1TB 3NOTC 1P97A 3GECA 5DFYA 1OTIA 1GSVA 1DP8A 3MQQA 2L4RA 4LRXC 4WN5A 4ARZA 3LI8A 4CLCE 5C5KA 4YOFA 4CLCD 2L1MA 1W63Q 4WEKA 2W3HA 3T4OA 4WELA 5DF9A 2HJ9C 4Y3IA 4NEED 5HD5A 3JVUA 2JKTM 1V9YA 1T1CA 3PBNA 3VE4A 1S4RA 3R7WB 3BY8A 4MDZA 2M7VA 4AFIA 4UEYA 3ZYTA 2M1CA 5FL3A 3LIDA 3B42A 5DKLA 2K31A 2ZMVA 2VGLM 2W3EA 4ARZB 3LIBA 4I3AA 3OOVA 1F5MA 3C38A 5F68A 4I39A 1V9ZA 4FSFA 4Y5FA 5TJJA 5DKKA 2K2NA 3ICYA 1LSVA 3A0SA 4Q0IA 2IA2A 5CX7A 3PBTA 2JKRI 5HDDA 3T4KA 4UQIM 1BYWA 3KO6A 5KIZA 1TS0A 2GX5A 3BWLA 4MMNA 3B47A 3MR0A 4P6ZM 2VLGA 2P08A 1LSXA 5A8BA 3BY9A 3TE8A 4NXEA 2W3FA 4H6JA 1STZA 1TF1A 3IBRA 3PHYA 4HI4A 2EA9A 3S7PA 2L0WA 1T1AA 4KQOA 3LYXA 4I3IA 1NLZA 4O0PA 4F3LA 2W1RA 1LT0A 1G28A 2B18A 4DN0A 1S66L 2V0WA 2XROA 3H9WA 2JN7A 3S7QA 3TRCA 2HJEA 2PYPA 3F1NA 4H6JB 3MF0A 4PKYA 3PR6A 5F6AA 2HV1A 4ZRRA 1S1YA 3UB7A 3A0RA 1XJ6A 2LB9A 3E4QA 3UE6A 2VGLS 2J3WA 2VV8A 3H7WA 3OCNA 4M4XA 2R78A 2V0UA 4F3LB 1TD5A 2PT7A 3CWFA 3IS2A 4DMZA 3ZQ5A 2QYBA 3MQOA 2KOIA 5J3WA 5HDCA 4CLCC 2D02A 1P0ZA 3EQVA 3KX0X 1VB6A 3OLOA 2ZBBA 4EXOA 1OTBA 3F1NB 2ZOHA 2QJ5A 4MN7A 4CLCA 1N9NA 2KLIA 2VX8A 3BQAA 3H7WB 2FH5A 2CMNA 1D06A 3KSFA 2PD7A 4O8GA 3OC2A 2W3DA 3IS2B 3LR3A 1OTEA 4EEUA 1XFNA 2D01A 5IU1A 1X0OA 3GDIA 1D7EA 2J80A 2J3TD 3T4LA 3T4QA 3ULFA 2PDRA 1TS6A 4O01A 3NJAA 5F5YA 2GNXA 3T50A 2VJWA 1YAXA 4ETZA 3RH8B 2YKHA 4YNRA 2OOLA 3FPWA 4EU0A 3LR4A 3FPVA 3LR0A 2VV6A 2JHEA 3RFBA 1S67L 4HIAA 1NRJA 4HH3A 2V1BA 5IS1A 3MQ0A 2EWWA 2QKPA 2OAQ1 2HF6A 3MFXA 4LRZE 2O99A 4CQHA 5IT5A 2QJ7A 5K5BA 1OTAA 3CUEC 4B93A 2O9AA 3KYZA 2Y79A 4II7A 3W2ZA 5EFWA 4HHDA 4LLOB 3MMHA 3CUEA 4L9GA 4BJPA 3PYPA 1LSWA 3E0YA 3MXQA 4R70A 3LIFA 2QHKA 1NWZA 3F1OA 5LBRA 2HGVA 5MC7A 2JKRM 2QWSA 4EETB 3D3OA 1UGUA 1OT6A 2MJ6A 3C8CA 3EWKA 3VOLA 4NXFA 4WF0A 4MCWA 1DP9A 2ZMFA 2XSSA 2B02A 1JNUA 1UWPX 1IFQA 3T4SA 3SW1A 2W3GA 4L0LA 3K2NA 5G4ZA 5AVEA 2YKFA 4Z1WA 3KSGA 1EW0A 4OOLA 3UB6A 4R3AA 1OPXA 1ZTUA 3F1OB 3K3DA 2O0YA 3EGDC 2K7SA 3CI6A 3FC7A 1MKMA 3HCYA 4EW7A 1P9WA 4JGRA 3D72A 3TW8A 4HP4A 1XJ4A 1OTDA 4HY8A 3BQ8A 3EQUA 3E4PA 2PR5A 4MN6A 4EERA 5HSQA 3CITA 4E04A 4LPZA 5AJGA 1T1BA 3DBAA 4NXGA 3S7OA 4PHTA 1S4SA 3TJZC 2J3TC 4PKYG 4HOIA 4IUKA 3V67A 1NLYA 2O9CA 4R6LA 1YSQA 3KYQA 4XT2A 5DJTA 3EGXC 4B9OA 5HPFA 4WUJA 2P7JA 2OWJA 3EEHA 4HJ6A 2VZWA 4I3JA 4BBVA 4IUHA 3MJQA 3BW6A 1VHMA 1GSWA 2Y8HA 1KOUA 1MC0A 4QPRA 4L9EA 2PYRA 2Z6DA 4NKPA 4Q0JA 1YSPA 5J4EA 3PBOA 4HP9A 3UMEA 2W0NA 3OBFA 1DRMA 1MZUA 2XRNA 2A2LA 5DFXA 3UB8A 5J7EA 2GZAA 3LI9A 3E98A 4XT2B 4CLCB 4BBUA 5HWTA 2H28A 4EESA 5HPIA 1WA9A 2VV7A 1YKDA 4EEPA 3UE3A 1F98A 2Z6CA 4FOFA 3PBQA 2JKTI 2PR6A 2FZ0A 1Y28A 4G3WA 5DJUA 3HJIA 4G3VA 1OT9A 3LIEA 2P04A 3IBJA 4HNBA 4HH2A 3KSIA 3U2AA 1DP6A 1T18A 3G6OA 3H82A 3P7NA 3VE3A 3K3CA 1H8MA 1H3QA 4GW9A 4HJ3A 3UB9A 2V9AA 4MN5A 4WEJA 3LIAA 5AVFA 3F1PA 1N9OA 1P9RA 3P01A 4Y2FA 1IOUA 4KUOA 1LL8A 2VA0A 1XJ3A 4GJ4A 1TS7A 1G6OA 2VEAA 4JGQA 3H82B 2KX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P01 A; 
#chains in the Genus database with same CATH topology
 2OLV A;  2A24 A;  4WL9 A;  4P0M A;  4BBT A;  4FD8 A;  3E2L A;  5HL6 A;  3SH8 A;  4GLQ A;  5A90 A;  2BAS A;  5F69 A;  3T4T A;  3N6I A;  4I38 A;  3G4P A;  3A0V A;  4I5S A;  3NDE A;  4EUV A;  5TBM B;  3QP2 A;  4GHI B;  2PHY A;  4K08 A;  1PZP A;  3SS4 A;  2IWC A;  2LB5 A;  1K54 A;  1G68 A;  2ZM0 A;  4H8R A;  4BWI A;  1XJ2 A;  1NYM A;  2OWH A;  4OPR A;  5BOH A;  1XXM A;  4X69 A;  3LGO A;  3LIC A;  5GLD A;  3CG5 A;  5GLB A;  1IYO A;  3IWO A;  3CJM A;  4OVD A;  3CHW P;  4YIN A;  3QP1 A;  3RTY A;  4IED A;  2G7U A;  5GLA A;  4OOM A;  2QZ6 A;  3CPT B;  4ESP A;  4IBX A;  3CAX A;  3DTK A;  1ACF A;  1TEM A;  2W1T A;  2I9V A;  5EEC A;  1O7E A;  5FI2 A;  4GN2 A;  2NUT C;  3OPH A;  3MS6 A;  4OP8 A;  2V1A A;  5L10 A;  5CER A;  4LRY C;  3D4F A;  3O5Y A;  4P6Z S;  5FAT A;  1NXY A;  3QNC A;  5AQA A;  4ZDX A;  1YMS A;  3BJN A;  4KZ9 A;  4WZ5 C;  3IWI A;  1L0E A;  4EV4 A;  1S1Z A;  1G6A A;  4KUK A;  1SHV A;  3GEC A;  4QY5 A;  3MQQ A;  5JYO A;  4CLC E;  4YOF A;  1Q2P A;  4CLC D;  1C3B A;  2HP5 A;  1W63 Q;  3HLF A;  3W4O A;  1K56 D;  3N4I A;  3BFD A;  1PWC A;  3PBN A;  1QME A;  5F83 A;  3VE4 A;  2H0T A;  1YLT A;  2M1C A;  3ZG9 B;  3LID A;  5DKL A;  1XP4 A;  3IF5 A;  2VGL M;  4ARZ B;  1FR1 A;  4IVI A;  1L0F A;  5M19 A;  5F68 A;  5TJJ A;  2IA2 A;  1YLJ A;  3G30 A;  5HDD A;  4P87 A;  4PPR A;  3BFG A;  2BG1 A;  4HEF A;  3DWK A;  2XFT A;  2JCH A;  3ZVT A;  5GHX A;  4E3I A;  1ZC2 A;  4NXE A;  3UPP A;  1BUL A;  1BSG A;  1STZ A;  4OQG A;  4N1X A;  3M6H A;  1TF1 A;  3IBR A;  3G2Y A;  2HZ5 A;  4O7D A;  4GOG A;  3LYX A;  4Q8I A;  2W1R A;  2B18 A;  2OSU A;  5KZH A;  2XR0 A;  2V0W A;  4EBL A;  3GRJ A;  4HES A;  3UB7 A;  1PW1 A;  2J3W A;  3OCN A;  1TVF A;  1JWP A;  1TD5 A;  3V50 A;  4X1L A;  2KOI A;  2HDS A;  5J3W A;  3UO9 A;  1JWV A;  3ZFZ A;  1IYQ A;  1NRF A;  2PAV P;  4OPQ A;  2KLI A;  2VX8 A;  1VEU A;  2FH5 A;  5M18 A;  1D06 A;  5TGF A;  3KSF A;  2PD7 A;  2Y2L A;  5FI7 A;  4BEN A;  3NIA A;  1ZG6 A;  5CXW A;  5IU1 A;  4DE1 A;  1D7E A;  5AQ9 A;  3Q81 A;  3WS2 A;  4ID4 A;  4O01 A;  4ETZ A;  1ONH A;  4YNR A;  3LR4 A;  2GDN A;  1IKI A;  2H10 A;  2ZQA A;  3SOI A;  4HH3 A;  3GSG A;  1FQG A;  3MQ0 A;  1CK3 A;  5HAR A;  2HF6 A;  1WYC A;  1Q2Q A;  4R3B A;  1OTA A;  1VM1 A;  2B95 A;  1J9M A;  2Y55 A;  3KYZ A;  4LV0 A;  5EE8 A;  2FFY A;  3CUE A;  1PW8 A;  4BD1 A;  4GZB A;  4N1H A;  1K4E A;  3LIF A;  1SZV A;  2WK0 A;  2JKR M;  1JVJ A;  4EET B;  3D3O A;  1KE3 A;  4HBT A;  2V2F F;  3BEC A;  4Y0O A;  2PBD P;  5EM0 A;  1DP9 A;  3M6B A;  3L9K A;  5HL1 A;  4BD0 A;  1CQA A;  3HL9 A;  3KSG A;  2PU2 A;  1CI8 A;  3MZF A;  1FOF A;  4XUZ A;  1MKM A;  3HCY A;  1P9W A;  4JGR A;  1K54 C;  1XJ4 A;  3HLE A;  2Y2G A;  3IH9 A;  3E4P A;  2PR5 A;  4MN6 A;  5GHZ A;  3CIT A;  2ZL1 B;  4E04 A;  1T1B A;  1GHM A;  4ZBE A;  3TJZ C;  2J3T C;  3DWZ A;  5FAP A;  1LL5 A;  1YSQ A;  2HDU A;  3KYQ A;  1FIL A;  3MSH A;  5HPF A;  1K56 A;  4I3J A;  2OWJ A;  4FUW A;  4RYE A;  1GSW A;  2AVX A;  1KGE A;  2PYR A;  2Z6D A;  4NKP A;  5DTK A;  5A93 A;  3QHY A;  2W0N A;  5FDH A;  1H8Z A;  5L09 A;  2XRN A;  2A2L A;  5EUA A;  2H28 A;  5HPI A;  4CPK A;  1K38 A;  1YKD A;  3ZG8 B;  1F98 A;  3MZD A;  5FA7 A;  2Z6C A;  1MWS A;  2JKT I;  3UDF A;  4R4R A;  4RX3 A;  3HJI A;  3PAE A;  2E8J A;  1Y54 A;  3KSI A;  3P7N A;  4Y0U A;  3NCK A;  5EVI B;  1H3Q A;  3N8S A;  3FKV A;  3ZVW A;  1MY8 A;  4WEJ A;  5CRF A;  5AVF A;  5D3O A;  5EVE A;  2WUQ A;  3F1P A;  1VQQ A;  1IEM A;  1N9O A;  3BFE A;  1IOU A;  2ZQC A;  5TR7 A;  4KUO A;  4DKI A;  1ES5 A;  2Y2J A;  2XD5 A;  4B88 A;  1Z6F A;  3Q07 A;  3BLS A;  2VEA A;  1A0K A;  4IBR A;  1WE4 A;  1N9L A;  2ZQD A;  3LEQ A;  1T19 A;  4ETX A;  5AQ7 A;  2ZC6 B;  4HJ4 A;  4X25 A;  3HLD A;  3EEA A;  4JXG A;  1LI0 A;  1MPL A;  5DTT A;  3WS5 A;  3S7N A;  1KVM A;  4M3K A;  2V8F A;  5EOO A;  4K0W A;  1UWN X;  3NEC A;  4QWO A;  4WLA A;  1IKG A;  1XFQ A;  4DDS A;  5CEB A;  2GJ3 A;  1HZO A;  1YLP A;  2DMW A;  1VET B;  4UA7 A;  2WAD A;  2WKQ A;  4JGP A;  5HWV A;  3JPU A;  4BMW A;  3O88 A;  2XFS A;  1OJG A;  3UMD A;  5FQ9 A;  3R4K A;  4R23 A;  5FQI A;  4PM7 A;  1ZHH B;  3EOI A;  3ZNY A;  3LR5 A;  3PBR A;  4JXS A;  4X68 A;  3MXS A;  3NC8 A;  4MBF A;  2KDK A;  4S2N C;  1W8Y A;  1D1J A;  1AWI A;  1YLW A;  3KSH A;  1PI4 A;  1ZG4 A;  4L9F A;  4EQ1 A;  3JVV A;  1PFL A;  4DXB A;  1L3L A;  5HD3 A;  1K55 A;  4GCZ A;  3IT9 A;  3R7W A;  3PXP A;  4KZB A;  4GS9 B;  3C5A A;  1OJ5 A;  3NOT C;  1P97 A;  4S2P A;  1GSV A;  5DVA A;  3HUN A;  2OLU A;  2W3H A;  3T4O A;  1IYS A;  4WEL A;  5DF9 A;  2HJ9 C;  4PMA A;  1V9Y A;  1T1C A;  3IF6 A;  3RXW A;  4R4S A;  2ZLY A;  1YM1 A;  1BLC A;  4MDZ A;  2M7V A;  3SS5 A;  4UEY A;  4DXC A;  3ZYT A;  2Y2O A;  3B42 A;  4S2M A;  2K31 A;  2ZMV A;  1FCN A;  4I3A A;  1H8Y A;  3RXX A;  4I39 A;  1V9Z A;  4FSF A;  4Y5F A;  5DKK A;  4GD6 A;  5FEF A;  3PBT A;  3WRZ A;  1BYW A;  2GX5 A;  3NUL A;  5CHU A;  3ZG7 B;  2PBY A;  4JF5 A;  1L0D A;  1TDG A;  4DE0 A;  1WYB A;  1G5U A;  2P08 A;  3U4L P;  3ZNT A;  1K0K A;  4HBU A;  4E3L A;  1K57 C;  4E3O A;  1XGI A;  3S7P A;  3UDI A;  4LCL A;  3LY3 A;  5HAI A;  1T1A A;  4MBK A;  2VK3 A;  1LT0 A;  1SKO B;  4DN0 A;  1S66 L;  2Z2L B;  4JXV A;  2E8I A;  3CZD A;  3FYZ A;  5FQJ A;  4OP5 A;  4MLL A;  3F1N A;  4H6J B;  2UV0 E;  3PR6 A;  5F6A A;  4EBP A;  4ZRR A;  4QJG A;  1S1Y A;  3QP4 A;  2LB9 A;  3E4Q A;  1EWZ A;  3I7J A;  3UE6 A;  1ERO A;  4F3L B;  2PT7 A;  2HPB A;  4DMZ A;  3BEB A;  4DE2 A;  4CLC C;  2D02 A;  5FAS A;  3ISG A;  1P0Z A;  3KX0 X;  3G34 A;  3OLO A;  3B3X A;  2ZOH A;  3OPP A;  2QJ5 A;  1HD8 A;  4MNR A;  1ALQ A;  1N9N A;  2V20 A;  1W5D A;  4QY6 A;  3BQA A;  4IVK A;  3H7W B;  2WAE A;  2XK1 A;  4KZ3 A;  4LGW A;  4O8G A;  3OC2 A;  2IWB A;  3IS2 B;  1XFN A;  5A92 A;  1PI5 A;  1CI9 A;  3FV7 A;  2R9W A;  3T4L A;  3ULF A;  2PDR A;  5KMW A;  1HLU P;  2ZQ8 A;  2GNX A;  2VJW A;  3GQZ A;  2P9V A;  3M2J A;  4EU0 A;  4S2K A;  2VV6 A;  2JBF A;  1NZO A;  4HIA A;  4DE3 A;  3MKE A;  5IS1 A;  3N8L A;  3VFF A;  2R9X A;  1OME A;  4WZ4 A;  2O99 A;  3QP8 A;  2ZM8 A;  1L2S A;  2O9A A;  2Y79 A;  2V8C A;  3V3S A;  4KQR A;  3VOY A;  1PRQ A;  5EFW A;  4BJP A;  4B4X A;  3E0Y A;  3MXQ A;  3G31 A;  3ITB A;  3HVF A;  4OPY A;  1NWZ A;  3F1O A;  5LBR A;  4EWF A;  5MC7 A;  3PTE A;  2QWS A;  2Y2M A;  3W4Q A;  4QHC A;  3P09 A;  1YMX A;  3PAG A;  1ESI A;  4MCW A;  2ZMF A;  5FQM A;  4E3N A;  3T1Q B;  1IFQ A;  3SW1 A;  4BQM A;  5AVE A;  2YKF A;  4Z1W A;  2ZM2 A;  1OPX A;  4QU3 A;  2O0Y A;  2K7S A;  3FC7 A;  1GHP A;  4XUX A;  3GMW A;  3T12 B;  1BUE A;  1OTD A;  3Q7V B;  2XEP A;  4KG5 A;  1HVB A;  1MXO A;  5AJG A;  3O3V A;  3S7O A;  3LY4 A;  4D60 A;  1K6S A;  2ZC7 A;  1JTD A;  2I72 A;  1PNE A;  3OZH A;  2JKG A;  4IUH A;  3MJQ A;  2DRW A;  3FZC A;  1LI9 A;  1MC0 A;  4QPR A;  4Q0J A;  5J4E A;  1YSP A;  3PBO A;  1CF0 A;  2WGW A;  1EI5 A;  1JTG A;  4OQI A;  4XT2 B;  2X01 A;  3UY6 A;  1L0G A;  2WZZ A;  1WA9 A;  1SDN A;  2VV7 A;  4LV1 A;  3Q7Z A;  2V1Z A;  1KDW A;  2PR6 A;  1Y28 A;  5DJU A;  5U47 A;  4G3V A;  1OT9 A;  4K0X A;  4HNB A;  5EVL A;  2XH9 A;  3U2A A;  3HLB A;  3IF6 C;  1DP6 A;  3SH9 A;  4LV3 A;  4HJ3 A;  1GHI A;  1HTZ A;  3VSK A;  4N9L A;  3LIA A;  3Q1F A;  3HUO A;  1K4F A;  5FAO A;  4FH2 A;  4S2L A;  3P01 A;  1XJ3 A;  3M2K A;  2JKF A;  4F94 A;  3H82 B;  2HDQ A;  1NJ4 A;  5CHM A;  5TBM A;  2J9O A;  4GHI A;  2WKI A;  3PBS A;  5HFO A;  5IHV A;  4S2I A;  4B4Z A;  3VP0 A;  4X56 A;  3IH8 A;  5F1F A;  4NXB A;  2PD8 A;  4Y17 A;  2VKS A;  5HDS A;  3ITA A;  3OCL A;  1MWT A;  4P85 A;  3C30 A;  4LV2 A;  4X6T A;  4RQ9 A;  2A24 B;  1U60 A;  5KSH A;  5DTS A;  2HP9 A;  3B33 A;  4IJG A;  5CGS A;  2O9B A;  3HUM A;  1FR6 A;  3CPT A;  5F82 A;  1KGF A;  4R38 A;  2ZC4 B;  3IHA A;  2Y2I A;  3NOU C;  5L8M A;  4P6B A;  1NZU A;  5I5L A;  3E4O A;  4DJ3 A;  3BYD A;  4WBG A;  3WS4 A;  4KZA A;  3TOI A;  1GSX A;  5HAQ A;  2ACG A;  3C2W A;  1F9I A;  1I2S A;  3VP4 A;  2Y2K A;  4Q0H A;  1FIK A;  3DTM A;  3UE0 A;  2Y4A A;  1N9B A;  1LL9 A;  1ODV A;  3QP5 A;  2XA7 M;  3BFF A;  1AXB A;  3TG9 A;  1W7F A;  2ZOI A;  4Z9Q A;  2W1T B;  4WZ5 A;  1DP8 A;  2L4R A;  2X02 A;  1S6R A;  4ARZ A;  4N92 A;  3LI8 A;  5C5K A;  5EOE A;  2L1M A;  4JF6 A;  4WEK A;  4X1M A;  2A3U A;  4Y3I A;  4NEE D;  5HD5 A;  3WS0 A;  4Y7P A;  1RP5 A;  5CEC A;  1NY0 A;  4C6Y A;  4AFI A;  4JKT A;  2FFF B;  5FL3 A;  4A5R A;  3C7U A;  3C7V A;  3LIB A;  5EVI D;  3TSG A;  2ZC5 B;  2QPN A;  1LSV A;  4Q0I A;  5GHY A;  2JKR I;  3T4K A;  4UQI M;  3T1X A;  3KO6 A;  2WAF A;  1TS0 A;  4MMN A;  3B47 A;  2WGI A;  2C6W B;  5E2E A;  4OLG A;  2VLG A;  4PM9 A;  1LSX A;  3BY9 A;  3TE8 A;  2W3F A;  5DF7 A;  3G2Z A;  4HI4 A;  3NY4 A;  1ERQ A;  4OQH A;  3IHB A;  4S2O A;  4I3I A;  4O0P A;  5A91 A;  3MFD A;  3MZE A;  4PM5 A;  2XRO A;  5EV0 A;  5HAP A;  1DJB A;  1K6R A;  2JN7 A;  4E3J A;  3TRC A;  2HDR A;  2HJE A;  2PYP A;  2HV1 A;  4KZ6 A;  1I2W A;  3A0R A;  3A3J A;  2A49 A;  2VGL S;  2Q0O A;  4KQQ A;  4M4X A;  2R78 A;  2H5S A;  1PYY A;  3CWF A;  2QYB A;  4UA6 A;  5EPH A;  5M1A A;  2Y2H A;  5HDC A;  3GR2 A;  3EQV A;  1VB6 A;  4EXO A;  4MN7 A;  1QMF A;  4BLM A;  1W8Q A;  1YT4 A;  2XLN A;  2B5R A;  4GKU A;  3LR3 A;  2RCX A;  4EEU A;  3NDG A;  2D01 A;  3GDI A;  3T4Q A;  1DJC A;  2J8Y A;  5FQQ A;  2XD1 A;  4DDY A;  4FCF A;  1BZA A;  3T50 A;  4KZ7 A;  1YAX A;  1VEU B;  2YKH A;  3N7W A;  3LO7 A;  2JHE A;  1S67 L;  1NRJ A;  2V1B A;  2C5W B;  3AGE A;  2OAQ 1;  3GV9 A;  3MFX A;  4LRZ E;  4CQH A;  5K5B A;  4U0T A;  3CUE C;  4B93 A;  4UAA A;  4KZ4 A;  4HHD A;  4LLO B;  1MKI A;  3MMH A;  4L9G A;  3VFH A;  1LSW A;  2WGV A;  4R70 A;  3OPL A;  2Y91 A;  2HGV A;  1DY6 A;  1BLS A;  1UGU A;  1IYP A;  1OT6 A;  2MJ6 A;  3C8C A;  3VOL A;  3WRT A;  1BT5 A;  2B02 A;  1JNU A;  1E25 A;  2ZL1 A;  3NBL A;  1I5Q A;  3UB6 A;  4R3A A;  5TFQ A;  1ZTU A;  3EGD C;  5GLC A;  5E2G A;  4X53 A;  4EW7 A;  4U3T A;  3TW8 A;  4HP4 A;  1FSW A;  4XXR A;  3WS1 A;  1ERM A;  3EQU A;  4E3K A;  3FKW A;  4EER A;  5HSQ A;  2PRF A;  1S0W A;  3DBA A;  4PHT A;  2J7V A;  3S22 A;  4PKY G;  2G2W A;  4HOI A;  1NLY A;  2O9C A;  4R6L A;  5DJT A;  3FWL A;  4R0Q A;  4WUJ A;  2P7J A;  4OH0 A;  4HJ6 A;  2RL3 A;  2VZW A;  3BW6 A;  1VHM A;  4QB8 A;  1TDL A;  4GNU A;  4NK3 A;  4LEN A;  2Q9M A;  5L2F A;  2DCF A;  3UME A;  1BTL A;  1ESU A;  3OBF A;  1GCE A;  5J8X A;  2X71 A;  1DRM A;  5DFX A;  3UB8 A;  3C4P A;  3SS3 A;  5EVI A;  3LI9 A;  5FAQ A;  4CJN A;  4CLC B;  5KSC A;  4BBU A;  2JE5 A;  5CED A;  4EES A;  1PZO A;  3UE3 A;  1KGG A;  4FOF A;  1KVL A;  2FZ0 A;  3VE3 A;  3G6O A;  2XDM A;  1LHY A;  3K3C A;  3QP6 A;  4JLF A;  1H8M A;  3VSL A;  3ZG0 A;  1XPB A;  4GW9 A;  3UB9 A;  2V9A A;  4UA9 A;  4GDB A;  4PM8 A;  2Q9N A;  4ZJ1 A;  2HP6 A;  1P9R A;  1LL8 A;  2VA0 A;  3MBZ A;  1NYY A;  4GJ4 A;  1RGZ A;  4FH4 A;  1PWD A;  3L7H A;  5FEG A;  2KX6 A;  3HJK A;  2P74 A;  3V5M A;  3DTI A;  2INW A;  3T1S A;  1VET A;  3F1P B;  5DF8 A;  5HWW A;  3LFV A;  4KZ8 A;  2M7U A;  2DNS A;  4FTX A;  3CMZ A;  2WKP A;  4YWZ A;  3AGF A;  4QD4 A;  3LUQ A;  4GB7 A;  4ME4 A;  3G32 A;  5G18 A;  2XA7 S;  4JXW A;  3HBR A;  4K91 A;  5G4Y A;  2UWX A;  3UB5 P;  4R3J A;  4Y0T A;  5AQB A;  4KQD A;  3CLO A;  3NHQ A;  2Y2N A;  4R1G A;  3VV4 A;  1W63 M;  2W27 A;  2XGN A;  5HZH A;  1E4D A;  2WZX A;  3LCE A;  3V3R A;  3VOZ A;  4BL2 A;  5F1G A;  1DJA A;  1SCW A;  3T4J A;  3NOP C;  1TS8 A;  4OKP A;  1W79 A;  1CEG A;  2EX6 A;  5L07 A;  2NUP C;  3RJU A;  2WYX A;  3IXD A;  4NG2 A;  1ONG A;  2EWV A;  2ZQ9 A;  4GS9 A;  3UPN A;  1E3U D;  2OAP 1;  4UQI S;  2XQZ A;  4DJ2 A;  3DW0 A;  4IHQ A;  4HQA A;  4JGO A;  4S2N A;  1IEL A;  1K55 C;  5E2F A;  3S1Y A;  3FG8 A;  2EXA A;  5EM1 A;  4KG6 A;  4G3K A;  4KEN B;  4ZJ2 A;  2VGK A;  1M6K A;  4PM6 A;  3WWX A;  3GTC A;  4N9K A;  1KE4 A;  4PAU A;  2WKR A;  3Q82 A;  5DFY A;  1OTI A;  4JPM A;  4LRX C;  4WN5 A;  1ES2 A;  4KG2 A;  3AGD A;  3JVU A;  3UPO A;  2JKT M;  3E2K A;  2PU4 A;  3KYE A;  5FSR A;  3T1R A;  1GA0 A;  1S4R A;  3R7W B;  1CEF A;  3VP1 A;  3BY8 A;  1FSY A;  4WMC D;  3QNB A;  2QMI A;  1J3W A;  2W3E A;  3OOV A;  3JYI A;  3UDX A;  1F5M A;  4RX2 A;  2Z2M B;  3C38 A;  2K2N A;  3ICY A;  3P98 A;  1XA7 A;  3A0S A;  3IX4 A;  5CX7 A;  3IXB A;  3BRM A;  3IF6 B;  1H0M A;  5KIZ A;  5CTN A;  3BWL A;  3IX8 A;  3MR0 A;  1SKO A;  1FCO A;  4P6Z M;  3IXH A;  2VGJ A;  1JWZ A;  4BL3 A;  4E6X A;  5A8B A;  1KE0 A;  4H6J A;  1MWU A;  3OPR A;  4ZAM A;  1BLH A;  1FCM A;  3PHY A;  3O86 A;  2EA9 A;  2WKE A;  5HX9 A;  2L0W A;  4KQO A;  4OLD A;  1K57 A;  5CHJ A;  1NLZ A;  2JC7 A;  4F3L A;  1G28 A;  4OQ0 A;  1ES3 A;  3H9W A;  1YLY A;  3MXR A;  4EUZ A;  3V39 A;  1XA1 A;  3S7Q A;  3D9Y A;  5E2H A;  4PKY A;  3MF0 A;  3IX3 A;  2EFX A;  1XJ6 A;  4UHU A;  3ZGA B;  4GDN A;  2EFU A;  2VV8 A;  3H7W A;  4RA7 A;  2V0U A;  3VMA A;  1YQS A;  4EBN A;  3IS2 A;  3ZQ5 A;  3SH7 A;  3SZT A;  3S4X A;  4X55 A;  3ZHH A;  3MQO A;  5FDS A;  4WYY A;  2CC1 A;  3BM6 A;  2ZBB A;  1OTB A;  3F1N B;  2EXB A;  4JF4 A;  4CLC A;  4GD8 A;  3A3F A;  3IXG A;  3ZDJ A;  2OV5 A;  2Y2P A;  2CMN A;  3BLM A;  1LLB A;  2W3D A;  5E43 A;  2EX2 A;  1OTE A;  1ZKJ A;  5EVI C;  3G35 A;  1X0O A;  2J80 A;  4JBF A;  2J3T D;  4C3Q A;  1TS6 A;  3NJA A;  4S2J A;  5GL9 A;  2H0Y A;  5F5Y A;  1XX2 A;  2ZQ7 A;  3RH8 B;  3C4O A;  5CTM A;  2OOL A;  3FPW A;  3FPV A;  3DTE A;  3LR0 A;  4C75 A;  3RFB A;  2ZMA A;  1MBL A;  1RGY A;  1PIO A;  2EWW A;  2QKP A;  1XKZ A;  5IT5 A;  1RCJ A;  2QJ7 A;  3GVB A;  3VP3 A;  1YPR A;  4II7 A;  3MKF A;  4DF6 A;  3W2Z A;  2P9V B;  2Y59 A;  4OPZ A;  3PYP A;  3O87 A;  2G2U A;  4NET A;  1Z09 A;  1PWG A;  4MEZ A;  4U0X A;  2QHK A;  3UNW A;  1CJF A;  1K25 A;  5FQK A;  4WM9 A;  1O07 A;  3IQA A;  1XGJ A;  1BLP A;  3ZG5 A;  3HRE A;  3EWK A;  4NXF A;  4WF0 A;  2XSS A;  3VP2 A;  2ZD8 A;  3Q7V A;  4RVA A;  2EX9 A;  1UWP X;  3UN7 A;  3T4S A;  2W3G A;  2ZJ9 A;  4L0L A;  3K2N A;  1SDE A;  3HLG A;  5G4Z A;  4DRT A;  3BFC A;  4OOL A;  1EW0 A;  2ZC3 B;  2XF3 A;  4KZ5 A;  4MBH A;  3F1O B;  1SKF A;  2Y2Q A;  3K3D A;  1E3U A;  4EQI A;  1M40 A;  3CI6 A;  3A3E A;  1H5X A;  3D72 A;  4YFM A;  1YLZ A;  4HY8 A;  4LFU A;  3BQ8 A;  4LCM A;  4D2O A;  3A3I A;  4LPZ A;  2J9P A;  4NXG A;  1GA9 A;  4OON A;  1N4O A;  1S4S A;  1F2K A;  4IUK A;  3V67 A;  4Y13 A;  3HLW A;  4XT2 A;  2WKH A;  3EGX C;  4B9O A;  5CGX A;  3EEH A;  4BBV A;  3IWQ A;  4ZTK A;  5FI6 A;  3N8R A;  2Y8H A;  1KOU A;  4L9E A;  4E3M A;  4HP9 A;  4WMC A;  1ES4 A;  1KDS A;  1MWR A;  3A3D A;  3W4P A;  1MZU A;  3DAV A;  5J7E A;  2GZA A;  3E98 A;  5HWT A;  4ZJ3 A;  3W8K A;  3HLC A;  5I94 A;  4EEP A;  3PBQ A;  4G3W A;  4OOY A;  5JYP A;  3LIE A;  2WGW B;  2IWD A;  2P04 A;  3IBJ A;  4HH2 A;  1T18 A;  3H82 A;  3LEZ A;  3ZCZ A;  3UE1 A;  5HW3 A;  2EX8 A;  4MN5 A;  3NI9 A;  2BLS A;  2BTF P;  4E6W A;  4Y2F A;  5CGW A;  1TS7 A;  1G6O A;  1Y4O A;  4JGQ A;  4Y15 A; 
#chains in the Genus database with same CATH homology
 5TBM A;  3HJK A;  4GHI A;  2INW A;  2A24 A;  4WL9 A;  1N9L A;  4BBT A;  1T19 A;  5HL6 A;  3PBS A;  4GLQ A;  4ETX A;  4HJ4 A;  3F1P B;  5HWW A;  2BAS A;  3LFV A;  3EEA A;  2M7U A;  2WKP A;  5F69 A;  4YWZ A;  3S7N A;  3T4T A;  4I38 A;  3LUQ A;  4ME4 A;  4NXB A;  2PD8 A;  3A0V A;  2XA7 S;  4I5S A;  1UWN X;  2VKS A;  5HDS A;  4WLA A;  4EUV A;  3OCL A;  1XFQ A;  5TBM B;  3C30 A;  5G4Y A;  4RQ9 A;  4GHI B;  2GJ3 A;  2PHY A;  2A24 B;  2DMW A;  5KSH A;  4K08 A;  4KQD A;  3CLO A;  3B33 A;  3NHQ A;  4IJG A;  2LB5 A;  2O9B A;  2WKQ A;  3VV4 A;  4JGP A;  5HWV A;  4R38 A;  4BMW A;  1OJG A;  3NOU C;  3UMD A;  4BWI A;  1XJ2 A;  2OWH A;  1W63 M;  2W27 A;  5HZH A;  3R4K A;  5L8M A;  1ZHH B;  3EOI A;  3LIC A;  3LR5 A;  3PBR A;  3T4J A;  3NOP C;  5I5L A;  1TS8 A;  3E4O A;  3RTY A;  2G7U A;  2NUP C;  4DJ3 A;  4OOM A;  2EWV A;  3CAX A;  1GSX A;  4GS9 A;  2KDK A;  2W1T A;  2I9V A;  3C2W A;  1F9I A;  2OAP 1;  2NUT C;  4UQI S;  4DJ2 A;  4IHQ A;  3KSH A;  2V1A A;  4HQA A;  4JGO A;  4LRY C;  4L9F A;  3O5Y A;  4P6Z S;  4EQ1 A;  3JVV A;  4Q0H A;  3FG8 A;  4G3K A;  5HD3 A;  1ODV A;  3BJN A;  4GCZ A;  2XA7 M;  3R7W A;  3PXP A;  1S1Z A;  4PAU A;  2ZOI A;  4GS9 B;  2WKR A;  4KUK A;  1OJ5 A;  2W1T B;  3NOT C;  1P97 A;  3GEC A;  5DFY A;  1OTI A;  1GSV A;  1DP8 A;  3MQQ A;  2L4R A;  4LRX C;  4WN5 A;  4ARZ A;  3LI8 A;  4CLC E;  5C5K A;  4YOF A;  4CLC D;  2L1M A;  1W63 Q;  4WEK A;  2W3H A;  3T4O A;  4WEL A;  5DF9 A;  2HJ9 C;  4Y3I A;  4NEE D;  5HD5 A;  3JVU A;  2JKT M;  1V9Y A;  1T1C A;  3PBN A;  3VE4 A;  1S4R A;  3R7W B;  3BY8 A;  4MDZ A;  2M7V A;  4AFI A;  4UEY A;  3ZYT A;  2M1C A;  5FL3 A;  3LID A;  3B42 A;  5DKL A;  2K31 A;  2ZMV A;  2VGL M;  2W3E A;  4ARZ B;  3LIB A;  4I3A A;  3OOV A;  1F5M A;  3C38 A;  5F68 A;  4I39 A;  1V9Z A;  4FSF A;  4Y5F A;  5TJJ A;  5DKK A;  2K2N A;  3ICY A;  1LSV A;  3A0S A;  4Q0I A;  2IA2 A;  5CX7 A;  3PBT A;  2JKR I;  5HDD A;  3T4K A;  4UQI M;  1BYW A;  3KO6 A;  5KIZ A;  1TS0 A;  2GX5 A;  3BWL A;  4MMN A;  3B47 A;  3MR0 A;  4P6Z M;  2VLG A;  2P08 A;  1LSX A;  5A8B A;  3BY9 A;  3TE8 A;  4NXE A;  2W3F A;  4H6J A;  1STZ A;  1TF1 A;  3IBR A;  3PHY A;  4HI4 A;  2EA9 A;  3S7P A;  2L0W A;  1T1A A;  4KQO A;  3LYX A;  4I3I A;  1NLZ A;  4O0P A;  4F3L A;  2W1R A;  1LT0 A;  1G28 A;  2B18 A;  4DN0 A;  1S66 L;  2V0W A;  2XRO A;  3H9W A;  2JN7 A;  3S7Q A;  3TRC A;  2HJE A;  2PYP A;  3F1N A;  4H6J B;  3MF0 A;  4PKY A;  3PR6 A;  5F6A A;  2HV1 A;  4ZRR A;  1S1Y A;  3UB7 A;  3A0R A;  1XJ6 A;  2LB9 A;  3E4Q A;  3UE6 A;  2VGL S;  2J3W A;  2VV8 A;  3H7W A;  3OCN A;  4M4X A;  2R78 A;  2V0U A;  4F3L B;  1TD5 A;  2PT7 A;  3CWF A;  3IS2 A;  4DMZ A;  3ZQ5 A;  2QYB A;  3MQO A;  2KOI A;  5J3W A;  5HDC A;  4CLC C;  2D02 A;  1P0Z A;  3EQV A;  3KX0 X;  1VB6 A;  3OLO A;  2ZBB A;  4EXO A;  1OTB A;  3F1N B;  2ZOH A;  2QJ5 A;  4MN7 A;  4CLC A;  1N9N A;  2KLI A;  2VX8 A;  3BQA A;  3H7W B;  2FH5 A;  2CMN A;  1D06 A;  3KSF A;  2PD7 A;  4O8G A;  3OC2 A;  2W3D A;  3IS2 B;  3LR3 A;  1OTE A;  4EEU A;  1XFN A;  2D01 A;  5IU1 A;  1X0O A;  3GDI A;  1D7E A;  2J80 A;  2J3T D;  3T4L A;  3T4Q A;  3ULF A;  2PDR A;  1TS6 A;  4O01 A;  3NJA A;  5F5Y A;  2GNX A;  3T50 A;  2VJW A;  1YAX A;  4ETZ A;  3RH8 B;  2YKH A;  4YNR A;  2OOL A;  3FPW A;  4EU0 A;  3LR4 A;  3FPV A;  3LR0 A;  2VV6 A;  2JHE A;  3RFB A;  1S67 L;  4HIA A;  1NRJ A;  4HH3 A;  2V1B A;  5IS1 A;  3MQ0 A;  2EWW A;  2QKP A;  2OAQ 1;  2HF6 A;  3MFX A;  4LRZ E;  2O99 A;  4CQH A;  5IT5 A;  2QJ7 A;  5K5B A;  1OTA A;  3CUE C;  4B93 A;  2O9A A;  3KYZ A;  2Y79 A;  4II7 A;  3W2Z A;  5EFW A;  4HHD A;  4LLO B;  3MMH A;  3CUE A;  4L9G A;  4BJP A;  3PYP A;  1LSW A;  3E0Y A;  3MXQ A;  4R70 A;  3LIF A;  2QHK A;  1NWZ A;  3F1O A;  5LBR A;  2HGV A;  5MC7 A;  2JKR M;  2QWS A;  4EET B;  3D3O A;  1UGU A;  1OT6 A;  2MJ6 A;  3C8C A;  3EWK A;  3VOL A;  4NXF A;  4WF0 A;  4MCW A;  1DP9 A;  2ZMF A;  2XSS A;  2B02 A;  1JNU A;  1UWP X;  1IFQ A;  3T4S A;  3SW1 A;  2W3G A;  4L0L A;  3K2N A;  5G4Z A;  5AVE A;  2YKF A;  4Z1W A;  3KSG A;  1EW0 A;  4OOL A;  3UB6 A;  4R3A A;  1OPX A;  1ZTU A;  3F1O B;  3K3D A;  2O0Y A;  3EGD C;  2K7S A;  3CI6 A;  3FC7 A;  1MKM A;  3HCY A;  4EW7 A;  1P9W A;  4JGR A;  3D72 A;  3TW8 A;  4HP4 A;  1XJ4 A;  1OTD A;  4HY8 A;  3BQ8 A;  3EQU A;  3E4P A;  2PR5 A;  4MN6 A;  4EER A;  5HSQ A;  3CIT A;  4E04 A;  4LPZ A;  5AJG A;  1T1B A;  3DBA A;  4NXG A;  3S7O A;  4PHT A;  1S4S A;  3TJZ C;  2J3T C;  4PKY G;  4HOI A;  4IUK A;  3V67 A;  1NLY A;  2O9C A;  4R6L A;  1YSQ A;  3KYQ A;  4XT2 A;  5DJT A;  3EGX C;  4B9O A;  5HPF A;  4WUJ A;  2P7J A;  2OWJ A;  3EEH A;  4HJ6 A;  2VZW A;  4I3J A;  4BBV A;  4IUH A;  3MJQ A;  3BW6 A;  1VHM A;  1GSW A;  2Y8H A;  1KOU A;  1MC0 A;  4QPR A;  4L9E A;  2PYR A;  2Z6D A;  4NKP A;  4Q0J A;  1YSP A;  5J4E A;  3PBO A;  4HP9 A;  3UME A;  2W0N A;  3OBF A;  1DRM A;  1MZU A;  2XRN A;  2A2L A;  5DFX A;  3UB8 A;  5J7E A;  2GZA A;  3LI9 A;  3E98 A;  4XT2 B;  4CLC B;  4BBU A;  5HWT A;  2H28 A;  4EES A;  5HPI A;  1WA9 A;  2VV7 A;  1YKD A;  4EEP A;  3UE3 A;  1F98 A;  2Z6C A;  4FOF A;  3PBQ A;  2JKT I;  2PR6 A;  2FZ0 A;  1Y28 A;  4G3W A;  5DJU A;  3HJI A;  4G3V A;  1OT9 A;  3LIE A;  2P04 A;  3IBJ A;  4HNB A;  4HH2 A;  3KSI A;  3U2A A;  1DP6 A;  1T18 A;  3G6O A;  3H82 A;  3P7N A;  3VE3 A;  3K3C A;  1H8M A;  1H3Q A;  4GW9 A;  4HJ3 A;  3UB9 A;  2V9A A;  4MN5 A;  4WEJ A;  3LIA A;  5AVF A;  3F1P A;  1N9O A;  1P9R A;  3P01 A;  4Y2F A;  1IOU A;  4KUO A;  1LL8 A;  2VA0 A;  1XJ3 A;  4GJ4 A;  1TS7 A;  1G6O A;  2VEA A;  4JGQ A;  3H82 B;  2KX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...