3P01A

Crystal structure of two-component response regulator from nostoc sp. pcc 7120
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
178
structure length
178
Chain Sequence
b'QRAAETYDLLKQRTEELRRANAQMSLLTVLVQVTQASNSLEAILTPIATAFAESFAVNACILQMLEGQTLSTIQGFYSQQGTVNNWLNQDPLTNEAIATGQIQVAANIAKDPKLASISQYQDNGIQSHVVIPITYRNEMLGVLSLQWQQPISLREDELTLIHLSAQLVAIALTSSRCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Two-component response regulator
publication title Crystal structure of two-component response regulator from Nostoc sp. PCC 7120
rcsb
source organism Nostoc sp.
molecule tags Signaling protein
total genus 51
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.340 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p01A02
3P01A
chains in the Genus database with same CATH superfamily
4BL2A 2VA0A 3GTCA 4D60A 3KSGA 2XSSA 5CX7A 3SOIA 3A3FA 1U60A 1WE4A 3F1PA 4EEUA 5A92A 1VEUA 3GMWA 3VSLA 1BLHA 3CAXA 4UQIS 1NYMA 2D01A 1EI5A 1KOUA 3M2JA 4OPQA 2QJ5A 1LT0A 5F1FA 2XF3A 1PI5A 2CMNA 4KUKA 1CEGA 1ESUA 3CWFA 1WA9A 3ZGAB 4PHTA 1OTEA 5EVIB 3WRTA 2XQZA 4PAUA 5JYOA 4B9OA 4PM5A 2WKIA 4EQ1A 4S2PA 4UAAA 1I2SA 2PHYA 2L4RA 4KQQA 4ME4A 1L2SA 5E2GA 1UGUA 3KYZA 3S1YA 3IS2A 3BYDA 4DE0A 1W63M 3GV9A 4E3JA 3UB6A 3C8CA 1W8QA 1PWGA 3MZEA 2PR6A 4ZBEA 1SKFA 3C4PA 4BENA 5M18A 2W3DA 4S2NC 3Q07A 3IX3A 2GJ3A 4LFUA 2XLNA 3UN7A 3BQ8A 3DTMA 2IA2A 2XFTA 1TDGA 3EQVA 4YOFA 3CPTB 2J8YA 3DWZA 2ZM2A 1AXBA 1CEFA 3BFCA 3IH9A 3IBJA 5CHJA 2WGWB 3MBZA 4GOGA 2O99A 3H82B 1V9ZA 2VGLS 4R3AA 2JKTI 5HAPA 4NG2A 3IF5A 4IUHA 3DWKA 1PNEA 3G2ZA 3U2AA 1IEMA 1WYBA 1K56D 4I3AA 1CJFA 2WKQA 4E3NA 3GRJA 3PR6A 4WF0A 3EQUA 2JN7A 4ZTKA 4GZBA 3V3SA 3VMAA 1S6RA 3LEZA 1W7FA 3G35A 4KZ7A 3CUEC 4B4ZA 4P87A 1IELA 1JTGA 4XT2B 3UNWA 5EM1A 1SDEA 1FOFA 4Y13A 5CHUA 3E4PA 4KQDA 3ZG9B 3VE3A 2EXBA 4B93A 1KE4A 1ONHA 4WZ5A 3HREA 3BECA 4QB8A 1GSVA 4Y17A 3F1NB 3A3DA 1VHMA 1EWZA 4HNBA 2V0WA 4XUXA 3SS5A 4X1MA 2FH5A 3IF6A 3A0VA 1M40A 4WEKA 4LV0A 3IXGA 1YLZA 2R9XA 4GHIA 5J4EA 4O01A 3ITAA 4I5SA 2ZQDA 2WADA 4WM9A 5J7EA 4R4SA 3QNCA 3ZFZA 2A2LA 5DF8A 1C3BA 4ZJ3A 3H7WB 1P9WA 1J3WA 1RCJA 1BZAA 2EWVA 4B88A 3LO7A 3MFDA 2KX6A 1ZC2A 2DMWA 1UWPX 1Z6FA 4FH2A 4II7A 4GS9A 4KZ3A 5L09A 5HAQA 3NCKA 2Y59A 1N4OA 2P04A 2G7UA 2XD5A 1PZOA 4KZ8A 2EXAA 4L9GA 3Q81A 1IYOA 3JPUA 4MN6A 4WN5A 1SZVA 1TS8A 5HPFA 2E8JA 1TEMA 4X25A 4R6LA 4OQ0A 5L10A 3I7JA 2R9WA 1VM1A 4HY8A 2ZQCA 1ESIA 2X02A 5EV0A 4PM8A 1FIKA 3D9YA 4NETA 4O0PA 3WS4A 3S7QA 5EVEA 3O86A 2W1TA 1MWSA 1XJ3A 5JYPA 3BQAA 2Y2PA 1OJGA 2M7UA 4KZ4A 4BD1A 1H0MA 4JKTA 3BFGA 2W3FA 4JLFA 5DTSA 1D7EA 1FQGA 4R1GA 4GD8A 1YSQA 5AQBA 2JE5A 2ZD8A 1KGGA 4GCZA 2V1ZA 2PAVP 4IVIA 1LL9A 1O7EA 2HDSA 2ZQ7A 3C30A 1PWCA 2A3UA 4PM6A 1NRFA 4KZAA 3UB9A 4DMZA 3N8RA 3T4QA 3A3JA 1MWRA 5AQAA 3CITA 3LY3A 1DP9A 4Z9QA 3HBRA 1KVMA 4MEZA 3K3CA 2Y2NA 3S4XA 4C75A 3CG5A 1N9LA 1ACFA 4PKYG 1KGEA 5DTTA 5EVIA 3IX8A 3OCLA 4HP4A 1MY8A 4IBXA 1F9IA 3OC2A 1ZG6A 3PAEA 4X55A 4R38A 3OPPA 4DXBA 1N9BA 1D1JA 4N9KA 1LSWA 2VV8A 2P08A 5F5YA 5HD3A 4PM9A 5GL9A 3A3EA 2PD8A 2W3EA 2XA7M 3IXBA 4IEDA 2ZC6B 3MKFA 2Q9NA 2KLIA 1L0FA 3Q7ZA 4QY5A 4HESA 3E2LA 1MXOA 1PW1A 3M2KA 3BFEA 4KENB 3H9WA 2DNSA 2BLSA 1CQAA 1YMXA 1Q2PA 3NECA 3P98A 3S22A 1BLPA 4X56A 3CPTA 1XJ4A 4JGRA 1K54A 2ZL1B 4GDNA 2IWBA 2XD1A 3MMHA 2WZXA 4LCMA 2WGWA 3H82A 3DTKA 5EECA 1T18A 3WRZA 2WZZA 3VOLA 2HGVA 1DY6A 2HDRA 1T1BA 3V5MA 4H6JB 2J80A 3O87A 1K38A 1T19A 3LGOA 3JYIA 2WKEA 1ERQA 1GHPA 1H8MA 3T4JA 4DXCA 4CJNA 4Q0JA 2ZOIA 3WS1A 1KE3A 4X68A 3ZHHA 4DE3A 5KIZA 2EX2A 4GNUA 3O5YA 2J9OA 4MNRA 1MZUA 3L9KA 2VK3A 4E6WA 1Y28A 2VV6A 4PKYA 4E3LA 3BM6A 4XT2A 3KX0X 5IT5A 3UB7A 1IOUA 2WKHA 3VFFA 5DKKA 4KZBA 2Y2MA 3UPPA 1KDSA 5KZHA 2Y4AA 2Y2KA 1H8ZA 5CHMA 2HP5A 3F1NA 2PT7A 4X69A 4KQRA 4JF5A 5FI7A 5A91A 3HJIA 2XROA 1K4FA 1K0KA 3BRMA 3N4IA 1Q2QA 5HDCA 3LR3A 3NI9A 1KGFA 3QP4A 4N1HA 1BUEA 5EVLA 5CTNA 1XA7A 1K25A 2ZQAA 2I9VA 3P09A 1YLYA 3H7WA 3PYPA 2XR0A 1P0ZA 4HBTA 4E3KA 5DF9A 1KE0A 4E3MA 2Y2HA 3C7VA 1I2WA 1ES5A 5F69A 1V9YA 2J9PA 2HJ9C 3MZDA 3D3OA 4N9LA 4GJ4A 2PRFA 3ISGA 4HQAA 4QPRA 3VOZA 2W1RA 3EEAA 4KG2A 3TOIA 4I38A 5F68A 3MSHA 3N8LA 1HTZA 2G2UA 4Z1WA 3HCYA 1LSVA 2H5SA 1Y54A 3FPVA 1FCNA 2ZC4B 1TDLA 1J9MA 1SCWA 4WZ4A 2V20A 2VX8A 3UE6A 2Y2OA 1BULA 2V8CA 4PM7A 5E2HA 1TS7A 4WBGA 5TFQA 1MC0A 2XEPA 3QP6A 4G3VA 2ZMFA 1FR1A 1E3UA 3UDXA 1TS0A 2XFSA 4WUJA 2X71A 1LL5A 2D02A 2OWJA 3JVUA 1ES4A 4BD0A 4RYEA 2R78A 2OLVA 3QP8A 4KG5A 1YKDA 3MQOA 1E25A 4RX2A 1NZOA 1XGJA 3BY8A 2M1CA 4S2IA 2JC7A 3EGXC 1CI8A 5GHYA 3LY4A 5TGFA 2EWWA 2QJ7A 5FA7A 3ZDJA 5HL6A 3BFDA 4P6ZM 5AVFA 4EBNA 4JGPA 1FSWA 2QWSA 3MJQA 1T1CA 4HEFA 2OSUA 3OBFA 3NY4A 2DRWA 4OLDA 2WAFA 4MN5A 3T1SA 4ETZA 2GDNA 4WELA 3IQAA 5EOEA 5HWTA 1JWVA 4S2JA 3NOUC 4KZ5A 2V1BA 5KSCA 5EM0A 1FILA 2C5WB 4WZ5C 1DJCA 4BWIA 4LRZE 3UE3A 2QYBA 2K2NA 3IH8A 2BG1A 1K6RA 2EX6A 3LFVA 1NZUA 5GHZA 1VETB 5FI6A 5FEFA 3PBSA 1TVFA 4D2OA 1N9NA 3IF6C 4GD6A 2A49A 1XPBA 5F83A 3V39A 4ARZB 1YAXA 5FASA 3T1RA 5L2FA 1D06A 2HP6A 1ES3A 3VFHA 1NRJA 4UEYA 5I5LA 2Y2IA 4JXSA 4MCWA 4JF6A 3G6OA 4UA6A 2EX9A 1EW0A 4R3BA 4NK3A 3G31A 2ZL1A 4BQMA 1SHVA 3SW1A 4E04A 4EU0A 4Y0UA 5FEGA 1YMSA 3W8KA 2VGJA 2J3TD 1WYCA 4L9FA 4H6JA 4UA9A 1VQQA 3OPRA 2Y2LA 3IT9A 2Y2QA 3F1OB 3DAVA 5CXWA 4KZ9A 2QHKA 5FQQA 5FDHA 3LI8A 2IWDA 4WLAA 3QNBA 1MKMA 2VLGA 3LICA 5FAQA 3B3XA 4JXGA 4R4RA 3G32A 1G6AA 1K57A 5FATA 1OTDA 1ZKJA 1NYYA 3KSIA 2HF6A 5L07A 2HJEA 2GNXA 2ZC3B 3IX4A 4Y2FA 5KMWA 2J3WA 5HX9A 1BT5A 1LI0A 1DJAA 3PXPA 4R23A 4DDYA 4CLCB 4EV4A 3OOVA 3HLWA 2L1MA 3HLCA 3BW6A 4MMNA 3WS5A 1F98A 1ONGA 5MC7A 4H8RA 1PIOA 1SDNA 4FH4A 3IWIA 4DRTA 4K0WA 1F5MA 4HIAA 3SS3A 4ETXA 2JKTM 2G2WA 3B33A 2XRNA 2P9VB 4HH3A 3TRCA 2JHEA 4RX3A 4QD4A 2H0TA 4K0XA 3A3IA 4JGOA 3MXQA 3W4OA 5EVIC 5DTKA 4S2LA 4HJ4A 3LIFA 1VEUB 4O7DA 2JKRM 2XK1A 5KSHA 5FL3A 4OPZA 2VJWA 4S2MA 1YT4A 3CHWP 2P7JA 5CECA 3ZNTA 4LRYC 5EVID 1X0OA 4GDBA 4R70A 4RA7A 2JBFA 1ES2A 4EW7A 4X1LA 5F1GA 3TJZC 1DP6A 3W4PA 2O9BA 4DDSA 2Z6DA 5E43A 2B02A 1K54C 4MBKA 2RL3A 2ZOHA 3KYQA 1JNUA 4N1XA 3LIAA 4LLOB 4FD8A 5HZHA 2PD7A 2A24B 3N6IA 2XA7S 2V0UA 2OAP1 2YKHA 2DCFA 2WK0A 4HJ6A 5DKLA 4Y3IA 1GSWA 1DP8A 3IXHA 3SH7A 3N8SA 4Q0HA 3D4FA 3OPHA 3EGDC 2WUQA 4OONA 2FFYA 5HDSA 2Y55A 2Y91A 1BSGA 3QP5A 1PYYA 1H8YA 2ZM0A 3NOTC 4Y5FA 4DF6A 1EROA 2KOIA 1L0DA 1HZOA 3K3DA 3PBNA 4I3JA 4DJ3A 3QHYA 5TBMB 2Z2MB 2LB5A 4DJ2A 5HDDA 1KDWA 3UB5P 1ZG4A 4XXRA 4OOYA 5E2EA 4NEED 3HLEA 4KUOA 2BASA 2HDQA 2LB9A 1GSXA 3S7PA 2FZ0A 3TW8A 2K7SA 1VETA 1IYPA 1NXYA 4HH2A 4F3LB 3HLBA 3C7UA 3ZCZA 4MLLA 5DF7A 4ARZA 2V8FA 4P85A 4Y15A 1BLSA 4LPZA 5GLDA 4BBUA 2EA9A 1RGZA 1IKIA 4Y7PA 1ZHHB 3PAGA 4NXBA 1H3QA 1BYWA 4JPMA 2ZQ9A 5GLCA 3NDEA 2IWCA 1OTAA 4E3OA 2FFFB 3BJNA 3NULA 5HSQA 1GA9A 5FAPA 5U47A 1K55A 3D72A 5FQ9A 4EESA 5HWVA 3LR5A 5CGXA 2Z6CA 4BMWA 4IJGA 4DE2A 4Q8IA 3G2YA 2PU2A 5GHXA 5IU1A 3Q1FA 3IHBA 4NXGA 4CPKA 2QPNA 4R3JA 3T4OA 5A93A 4GB7A 5HW3A 3M6BA 4KQOA 3F1OA 4LV3A 3Q7VB 3JVVA 1NJ4A 4G3KA 4WL9A 4YFMA 3G4PA 3DW0A 1QMEA 1N9OA 1GHIA 3LYXA 4QY6A 5CGSA 4CLCD 1PZPA 3NOPC 1I5QA 5FI2A 1K4EA 4UA7A 4Y0TA 3WWXA 2ZM8A 1FCOA 3SZTA 3ZG8B 3MR0A 4QJGA 1BTLA 1E3UD 1NWZA 3UB8A 3BWLA 3T4KA 2Y2JA 3MS6A 5I94A 4KZ6A 3IWQA 4HI4A 1NLZA 4PMAA 1PI4A 2VV7A 4MDZA 4N92A 4CLCA 3FYZA 2VZWA 4LV2A 2NUPC 4BJPA 5AQ9A 2XDMA 2M7VA 4EEPA 2V9AA 1OTIA 4HBUA 4NXEA 3T1QB 3PBTA 4UHUA 3ZG0A 1IFQA 2UV0E 4IVKA 1G68A 4EWFA 5DJUA 5TR7A 2P9VA 5HD5A 3KYEA 1XP4A 2VEAA 3L7HA 1QMFA 1CI9A 3T4LA 4P6ZS 2PU4A 4I39A 1Z09A 1ODVA 4S2OA 4HHDA 5J3WA 5E2FA 3LR0A 4Q0IA 3GQZA 5DJTA 4OQHA 2I72A 4OLGA 5M1AA 5FDSA 5EUAA 3CLOA 2HPBA 3EWKA 1NY0A 4PPRA 5J8XA 4JXVA 3RFBA 1AWIA 3UE0A 3DBAA 2ZJ9A 4UQIM 3UMEA 5F82A 5K5BA 1E4DA 4OQGA 1IYQA 3HLDA 3GR2A 4CQHA 3NC8A 2QMIA 2QZ6A 4S2KA 3RH8B 3E2KA 1P9RA 3VP1A 3SS4A 4IBRA 1S4SA 5HL1A 3FWLA 3LR4A 3MQQA 2A24A 5CRFA 3T50A 2ZMVA 3T12B 2ZC7A 3OPLA 4OQIA 1FR6A 2L0WA 4FTXA 2K31A 3GSGA 2H0YA 5EFWA 1ZTUA 3ZG7B 3E4QA 2EX8A 3ICYA 2PDRA 1NLYA 3BY9A 4ZRRA 5TBMA 4QU3A 2J3TC 3CI6A 1K57C 4OH0A 3IWOA 1OJ5A 4ID4A 2Z2LB 4GKUA 2MJ6A 3SH8A 5M19A 3VSKA 5HPIA 2VGLM 2JKRI 4OP8A 4R0QA 4FSFA 3RXXA 3WS0A 1W8YA 3CZDA 5LBRA 4EUZA 2BTFP 4S2NA 3IHAA 4DKIA 3QP2A 4ESPA 1O07A 1W63Q 3KO6A 4F3LA 1ERMA 1LLBA 5DFYA 1CK3A 1K56A 3A0SA 3N7WA 3KSFA 2JCHA 3TE8A 2EFUA 5IHVA 5G18A 1YSPA 2ZMAA 5IS1A 4Y0OA 1LHYA 3OCNA 1XGIA 2KDKA 1HVBA 1S1ZA 1VB6A 3NDGA 3Q82A 1PRQA 2PYRA 1MPLA 4OKPA 3PTEA 1F2KA 5FQKA 5HWWA 1W79A 4XUZA 4GLQA 3W4QA 4OVDA 3BEBA 4JGQA 2B5RA 1KVLA 3LUQA 4ZJ2A 4P0MA 3CUEA 1LSXA 3G34A 1SKOB 1XFNA 3BFFA 3OZHA 1XJ6A 4AFIA 2WYXA 4NXFA 2PR5A 1G28A 4ZJ1A 4HOIA 4BLMA 4L0LA 1H5XA 3HUOA 5A8BA 3Q7VA 4I3IA 3VP3A 1BLCA 1S66L 3ITBA 5G4ZA 5BOHA 1YLTA 1L0EA 1L3LA 4FCFA 3P7NA 3PHYA 1P97A 4L9EA 3AGFA 3B42A 1GA0A 4IUKA 4RVAA 2XGNA 3C2WA 1S0WA 3MXRA 3NIAA 2XH9A 5HARA 5DFXA 1HD8A 3BLSA 4JBFA 5AVEA 3VP4A 3U4LP 1GCEA 2OLUA 3R7WB 3FKVA 2INWA 4QHCA 1YLPA 4LCLA 3MF0A 2PYPA 4EBPA 3E98A 2OWHA 3GDIA 3V50A 4MN7A 3F1PB 4JF4A 5EE8A 3M6HA 3UMDA 3VP0A 2H10A 3FPWA 3WS2A 4K91A 3FZCA 4EERA 1XXMA 1OMEA 5AQ7A 3RTYA 2B18A 4OP5A 5CERA 3PBRA 3GECA 2AVXA 4KG6A 3LIBA 3LI9A 2OOLA 3HUMA 4X53A 3G30A 4A5RA 1YM1A 1JTDA 3SH9A 3ZVWA 3EEHA 4GN2A 3FKWA 2HZ5A 4OPYA 3E4OA 1PW8A 5FQMA 1YPRA 4O8GA 3V3RA 2WKPA 5CTMA 3PBOA 1FSYA 3IS2B 1IYSA 1MWUA 4OOLA 3ZYTA 4EQIA 2Q9MA 3C5AA 1HLUP 5CEDA 4YINA 3HVFA 4ZDXA 3B47A 2GZAA 1OT6A 4M4XA 3IBRA 3HL9A 3NBLA 2EFXA 3C4OA 2GX5A 4F94A 1LI9A 1JVJA 1G6OA 3GVBA 1RGYA 3VE4A 2E8IA 2WGVA 4EBLA 3AGEA 2JKFA 1CF0A 2ZLYA 4E3IA 3ZQ5A 3LEQA 2X01A 4U3TA 2ACGA 3VP2A 3BLMA 4QWOA 4BBTA 3K2NA 2WGIA 1TD5A 4X6TA 4C3QA 1OTBA 4EETB 2Y2GA 1YQSA 3HJKA 4MBFA 1K55C 1PWDA 2CC1A 2B95A 1S4RA 2ZC5B 5A90A 2HP9A 4EXOA 3VV4A 4YNRA 3MZFA 4HP9A 5AJGA 5EOOA 3UPOA 5FQIA 3NHQA 2H28A 3HLFA 4OPRA 4RQ9A 3ULFA 2VGKA 3MKEA 1OT9A 4WMCD 3ZNYA 2RCXA 3IXDA 1XA1A 3QP1A 3HUNA 4LGWA 3MQ0A 4BBVA 4BL3A 5G4YA 3OLOA 5EPHA 1IKGA 1M6KA 2V2FF 1YLJA 2W27A 3EOIA 2W3HA 1DRMA 5GLAA 2VKSA 2P74A 2OV5A 3P01A 3RJUA 3CMZA 1XJ2A 4B4XA 5C5KA 3FC7A 1UWNX 1STZA 3UY6A 5FAOA 5HAIA 2Q0OA 2O9AA 3IF6B 4NKPA 1XX2A 4WMCA 5F6AA 3LIEA 3V67A 5L8MA 2YKFA 4LENA 5D3OA 3VOYA 4WEJA 2J7VA 4GHIB 3C38A 1LL8A 5FQJA 3ZVTA 4C6YA 1K6SA 1TS6A 2Y79A 2C6WB 1ALQA 4U0XA 5GLBA 4G3WA 3ZG5A 1JWPA 1Y4OA 3RXWA 1FCMA 2ZQ8A 3S7NA 3O88A 4CLCC 3FV7A 2WAEA 2Y8HA 3FG8A 3KSHA 4GS9B 1OPXA 1G5UA 2V1AA 4JXWA 5HFOA 2JKGA 2WKRA 3R4KA 3UDIA 4HJ3A 1RP5A 1A0KA 3DTIA 4K08A 4MBHA 3T4TA 2NUTC 1TF1A 4FUWA 3MXSA 1L0GA 4DE1A 5CEBA 5TJJA 1DJBA 4CLCE 2O9CA 2W0NA 3PBQA 3MFXA 5FSRA 2HV1A 1GHMA 1MKIA 4DN0A 3S7OA 4ZAMA 4U0TA 4EUVA 4P6BA 2OAQ1 3DTEA 2PBDP 3T1XA 4YWZA 4WYYA 2ZBBA 3LCEA 1SKOA 3CJMA 3TG9A 2W1TB 3UO9A 3W2ZA 4GW9A 1MBLA 3E0YA 3HLGA 3O3VA 2W3GA 1JWZA 3UPNA 5CGWA 2QKPA 3TSGA 1XFQA 5DVAA 3A0RA 1XKZA 2UWXA 4LV1A 4IHQA 1PFLA 4LRXC 3T4SA 2PBYA 1T1AA 3UDFA 3AGDA 2O0YA 3LIDA 4M3KA 1W5DA 4FOFA 2HDUA 3UE1A 1S1YA 3R7WA 4E6XA 1S67L 3NJAA 1YLWA 1MWTA 4OOMA
chains in the Genus database with same CATH topology
2VA0A 4Q0JA 2ZOIA 3KSGA 2XSSA 5CX7A 2P7JA 5KIZA 1W63Q 3KO6A 3F1PA 4EEUA 4F3LA 4LRYC 3O5YA 1MZUA 3CAXA 5DFYA 1X0OA 1Y28A 4UQIS 2VV6A 4PKYA 3A0SA 3KSFA 2D01A 1KOUA 3TE8A 4R70A 1YSPA 4XT2A 2QJ5A 1LT0A 4EW7A 3KX0X 5IT5A 3UB7A 3TJZC 1DP6A 5IS1A 1IOUA 2CMNA 4KUKA 5DKKA 2O9BA 3CWFA 1WA9A 3OCNA 2Z6DA 4PHTA 1OTEA 4PAUA 2B02A 2KDKA 4B9OA 1S1ZA 3F1NA 1VB6A 2PT7A 4EQ1A 2PYRA 2ZOHA 3KYQA 1JNUA 2PHYA 3LIAA 2L4RA 4LLOB 5HZHA 5HWWA 2PD7A 4ME4A 2A24B 1UGUA 3HJIA 3KYZA 2XROA 2XA7S 2V0UA 4GLQA 3IS2A 2OAP1 2YKHA 4JGQA 4HJ6A 3LUQA 1W63M 5HDCA 3LR3A 3CUEA 1LSXA 3C8CA 5DKLA 3UB6A 4Y3IA 1GSWA 2PR6A 1DP8A 1XFNA 4Q0HA 3EGDC 1XJ6A 4AFIA 4NXFA 2W3DA 2PR5A 1G28A 4HOIA 4L0LA 5HDSA 2I9VA 2GJ3A 5A8BA 4I3IA 1S66L 3H7WA 3NOTC 3PYPA 4Y5FA 5G4ZA 3BQ8A 1P0ZA 2IA2A 3EQVA 4YOFA 2KOIA 3P7NA 3K3DA 3PBNA 5DF9A 4I3JA 3PHYA 1P97A 4L9EA 3B42A 4IUKA 4DJ3A 5TBMB 3IBJA 3C2WA 2O99A 3H82B 2LB5A 4DJ2A 1V9ZA 2VGLS 4R3AA 5F69A 1V9YA 2JKTI 5HDDA 2HJ9C 3D3OA 4IUHA 5DFXA 5AVEA 3U2AA 4GJ4A 4QPRA 4HQAA 2W1RA 3EEAA 2INWA 3R7WB 4I38A 4I3AA 4NEED 5F68A 4KUOA 2BASA 2WKQA 2LB9A 1GSXA 3MF0A 4Z1WA 3S7PA 2PYPA 2FZ0A 3HCYA 1LSVA 3PR6A 4WF0A 3EQUA 3E98A 2K7SA 3TW8A 2OWHA 3GDIA 2JN7A 4MN7A 3F1PB 4HH2A 4F3LB 3FPVA 3UMDA 3FPWA 3CUEC 2VX8A 4ARZA 3UE6A 4LPZA 4EERA 4BBUA 2EA9A 4XT2B 3RTYA 2B18A 1TS7A 3PBRA 1MC0A 3GECA 1ZHHB 3LIBA 3LI9A 3E4PA 4KQDA 4G3VA 2ZMFA 3VE3A 2OOLA 4B93A 1TS0A 4WUJA 4NXBA 1H3QA 1BYWA 2D02A 2OWJA 1OTAA 1GSVA 3EEHA 3JVUA 3F1NB 3BJNA 5HSQA 2R78A 1VHMA 3E4OA 4HNBA 3D72A 3T4JA 4EESA 5HWVA 1YKDA 3LR5A 3MQOA 2V0WA 4O8GA 2WKPA 2Z6CA 4BMWA 4IJGA 3PBOA 3IS2B 3BY8A 2M1CA 3EGXC 4OOLA 3ZYTA 2FH5A 3A0VA 5IU1A 2EWWA 2QJ7A 4WEKA 4NXGA 3B47A 5HL6A 3T4OA 2GZAA 4GHIA 4P6ZM 5AVFA 1OT6A 4JGPA 4O01A 5J4EA 4M4XA 3IBRA 4I5SA 2QWSA 3MJQA 1T1CA 4KQOA 3F1OA 5J7EA 3OBFA 3JVVA 2A2LA 3H7WB 2GX5A 4G3KA 1P9WA 4MN5A 4ETZA 4WL9A 1G6OA 4WELA 3VE4A 2EWVA 2KX6A 2DMWA 1N9OA 1UWPX 5HWTA 3LYXA 4II7A 3NOUC 4GS9A 4CLCD 2V1BA 3NOPC 3ZQ5A 2P04A 2G7UA 4BWIA 4LRZE 4BBTA 3K2NA 3UE3A 1TD5A 2QYBA 1OTBA 4L9GA 4EETB 2K2NA 3HJKA 4MN6A 4WN5A 1TS8A 5HPFA 3LFVA 4R6LA 3MR0A 1S4RA 4EXOA 3VV4A 3PBSA 4YNRA 4HY8A 1NWZA 4HP9A 5AJGA 1N9NA 3UB8A 3BWLA 3T4KA 3NHQA 2H28A 4HI4A 1NLZA 4RQ9A 3ULFA 4ARZB 2VV7A 1YAXA 4MDZA 4O0PA 1OT9A 4CLCA 3S7QA 2VZWA 2NUPC 3MQ0A 4BBVA 4BJPA 2W1TA 1XJ3A 3BQAA 1D06A 2M7VA 5G4YA 4EEPA 3OLOA 1OJGA 2M7UA 1NRJA 4UEYA 2V9AA 1OTIA 5I5LA 4NXEA 2W27A 3EOIA 2W3HA 1DRMA 2W3FA 3PBTA 4MCWA 3G6OA 2VKSA 1IFQA 3P01A 1D7EA 1EW0A 1XJ2A 5C5KA 3FC7A 1UWNX 1STZA 5DJUA 1YSQA 3SW1A 4E04A 5HD5A 4EU0A 2VEAA 2O9AA 2J3TD 4NKPA 4L9FA 3T4LA 5F6AA 3LIEA 4P6ZS 4GCZA 4H6JA 3V67A 5L8MA 2YKFA 4WEJA 4GHIB 4I39A 3C38A 1LL8A 1TS6A 1ODVA 4HHDA 5J3WA 2Y79A 3LR0A 4Q0IA 3F1OB 5DJTA 4G3WA 2QHKA 3C30A 3LI8A 4DMZA 3UB9A 3T4QA 3CLOA 3EWKA 4WLAA 1MKMA 2VLGA 3CITA 3LICA 3S7NA 4CLCC 1DP9A 2Y8HA 3RFBA 3FG8A 3KSHA 4GS9B 3DBAA 1OPXA 3K3CA 4UQIM 3UMEA 2V1AA 1N9LA 5K5BA 1OTDA 2WKRA 3R4KA 4PKYG 4HJ3A 4CQHA 3OCLA 4HP4A 3KSIA 2HF6A 3RH8B 4K08A 1P9RA 3T4TA 1F9IA 3OC2A 2NUTC 1TF1A 1S4SA 4R38A 5TJJA 2HJEA 4CLCE 2O9CA 2GNXA 2W0NA 3PBQA 3MFXA 2HV1A 3LR4A 4DN0A 4Y2FA 3S7OA 3MQQA 1LSWA 2VV8A 4EUVA 2J3WA 2A24A 2OAQ1 2P08A 3T50A 5F5YA 2ZMVA 5HD3A 4YWZA 3PXPA 2ZBBA 2PD8A 2W3EA 2L0WA 2XA7M 4CLCB 3OOVA 2KLIA 2W1TB 2L1MA 3BW6A 4MMNA 2K31A 5EFWA 1F98A 1ZTUA 3W2ZA 3E4QA 4GW9A 3H9WA 5MC7A 3E0YA 3ICYA 1F5MA 2W3GA 2PDRA 2QKPA 4HIAA 1NLYA 1XFQA 1XJ4A 4ETXA 2JKTM 4JGRA 3BY9A 3A0RA 4ZRRA 3B33A 5TBMA 2XRNA 3MMHA 4IHQA 2J3TC 3CI6A 4LRXC 4HH3A 3H82A 3T4SA 1T1AA 3TRCA 2JHEA 1OJ5A 2O0YA 3LIDA 1T18A 2MJ6A 4JGOA 3MXQA 3VOLA 4FOFA 2HGVA 5HPIA 1T1BA 2VGLM 2J80A 4H6JB 2JKRI 1T19A 4FSFA 1S1YA 3LIFA 4HJ4A 3R7WA 1S67L 3NJAA 2JKRM 5KSHA 5FL3A 5LBRA 1H8MA 2VJWA 4OOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P01 A; 
#chains in the Genus database with same CATH topology
 4BL2 A;  2VA0 A;  3GTC A;  4D60 A;  3KSG A;  2XSS A;  5CX7 A;  3SOI A;  3A3F A;  1U60 A;  1WE4 A;  3F1P A;  4EEU A;  5A92 A;  1VEU A;  3GMW A;  3VSL A;  1BLH A;  3CAX A;  4UQI S;  1NYM A;  2D01 A;  1EI5 A;  1KOU A;  3M2J A;  4OPQ A;  2QJ5 A;  1LT0 A;  5F1F A;  2XF3 A;  1PI5 A;  2CMN A;  4KUK A;  1CEG A;  1ESU A;  3CWF A;  1WA9 A;  3ZGA B;  4PHT A;  1OTE A;  5EVI B;  3WRT A;  2XQZ A;  4PAU A;  5JYO A;  4B9O A;  4PM5 A;  2WKI A;  4EQ1 A;  4S2P A;  4UAA A;  1I2S A;  2PHY A;  2L4R A;  4KQQ A;  4ME4 A;  1L2S A;  5E2G A;  1UGU A;  3KYZ A;  3S1Y A;  3IS2 A;  3BYD A;  4DE0 A;  1W63 M;  3GV9 A;  4E3J A;  3UB6 A;  3C8C A;  1W8Q A;  1PWG A;  3MZE A;  2PR6 A;  4ZBE A;  1SKF A;  3C4P A;  4BEN A;  5M18 A;  2W3D A;  4S2N C;  3Q07 A;  3IX3 A;  2GJ3 A;  4LFU A;  2XLN A;  3UN7 A;  3BQ8 A;  3DTM A;  2IA2 A;  2XFT A;  1TDG A;  3EQV A;  4YOF A;  3CPT B;  2J8Y A;  3DWZ A;  2ZM2 A;  1AXB A;  1CEF A;  3BFC A;  3IH9 A;  3IBJ A;  5CHJ A;  2WGW B;  3MBZ A;  4GOG A;  2O99 A;  3H82 B;  1V9Z A;  2VGL S;  4R3A A;  2JKT I;  5HAP A;  4NG2 A;  3IF5 A;  4IUH A;  3DWK A;  1PNE A;  3G2Z A;  3U2A A;  1IEM A;  1WYB A;  1K56 D;  4I3A A;  1CJF A;  2WKQ A;  4E3N A;  3GRJ A;  3PR6 A;  4WF0 A;  3EQU A;  2JN7 A;  4ZTK A;  4GZB A;  3V3S A;  3VMA A;  1S6R A;  3LEZ A;  1W7F A;  3G35 A;  4KZ7 A;  3CUE C;  4B4Z A;  4P87 A;  1IEL A;  1JTG A;  4XT2 B;  3UNW A;  5EM1 A;  1SDE A;  1FOF A;  4Y13 A;  5CHU A;  3E4P A;  4KQD A;  3ZG9 B;  3VE3 A;  2EXB A;  4B93 A;  1KE4 A;  1ONH A;  4WZ5 A;  3HRE A;  3BEC A;  4QB8 A;  1GSV A;  4Y17 A;  3F1N B;  3A3D A;  1VHM A;  1EWZ A;  4HNB A;  2V0W A;  4XUX A;  3SS5 A;  4X1M A;  2FH5 A;  3IF6 A;  3A0V A;  1M40 A;  4WEK A;  4LV0 A;  3IXG A;  1YLZ A;  2R9X A;  4GHI A;  5J4E A;  4O01 A;  3ITA A;  4I5S A;  2ZQD A;  2WAD A;  4WM9 A;  5J7E A;  4R4S A;  3QNC A;  3ZFZ A;  2A2L A;  5DF8 A;  1C3B A;  4ZJ3 A;  3H7W B;  1P9W A;  1J3W A;  1RCJ A;  1BZA A;  2EWV A;  4B88 A;  3LO7 A;  3MFD A;  2KX6 A;  1ZC2 A;  2DMW A;  1UWP X;  1Z6F A;  4FH2 A;  4II7 A;  4GS9 A;  4KZ3 A;  5L09 A;  5HAQ A;  3NCK A;  2Y59 A;  1N4O A;  2P04 A;  2G7U A;  2XD5 A;  1PZO A;  4KZ8 A;  2EXA A;  4L9G A;  3Q81 A;  1IYO A;  3JPU A;  4MN6 A;  4WN5 A;  1SZV A;  1TS8 A;  5HPF A;  2E8J A;  1TEM A;  4X25 A;  4R6L A;  4OQ0 A;  5L10 A;  3I7J A;  2R9W A;  1VM1 A;  4HY8 A;  2ZQC A;  1ESI A;  2X02 A;  5EV0 A;  4PM8 A;  1FIK A;  3D9Y A;  4NET A;  4O0P A;  3WS4 A;  3S7Q A;  5EVE A;  3O86 A;  2W1T A;  1MWS A;  1XJ3 A;  5JYP A;  3BQA A;  2Y2P A;  1OJG A;  2M7U A;  4KZ4 A;  4BD1 A;  1H0M A;  4JKT A;  3BFG A;  2W3F A;  4JLF A;  5DTS A;  1D7E A;  1FQG A;  4R1G A;  4GD8 A;  1YSQ A;  5AQB A;  2JE5 A;  2ZD8 A;  1KGG A;  4GCZ A;  2V1Z A;  2PAV P;  4IVI A;  1LL9 A;  1O7E A;  2HDS A;  2ZQ7 A;  3C30 A;  1PWC A;  2A3U A;  4PM6 A;  1NRF A;  4KZA A;  3UB9 A;  4DMZ A;  3N8R A;  3T4Q A;  3A3J A;  1MWR A;  5AQA A;  3CIT A;  3LY3 A;  1DP9 A;  4Z9Q A;  3HBR A;  1KVM A;  4MEZ A;  3K3C A;  2Y2N A;  3S4X A;  4C75 A;  3CG5 A;  1N9L A;  1ACF A;  4PKY G;  1KGE A;  5DTT A;  5EVI A;  3IX8 A;  3OCL A;  4HP4 A;  1MY8 A;  4IBX A;  1F9I A;  3OC2 A;  1ZG6 A;  3PAE A;  4X55 A;  4R38 A;  3OPP A;  4DXB A;  1N9B A;  1D1J A;  4N9K A;  1LSW A;  2VV8 A;  2P08 A;  5F5Y A;  5HD3 A;  4PM9 A;  5GL9 A;  3A3E A;  2PD8 A;  2W3E A;  2XA7 M;  3IXB A;  4IED A;  2ZC6 B;  3MKF A;  2Q9N A;  2KLI A;  1L0F A;  3Q7Z A;  4QY5 A;  4HES A;  3E2L A;  1MXO A;  1PW1 A;  3M2K A;  3BFE A;  4KEN B;  3H9W A;  2DNS A;  2BLS A;  1CQA A;  1YMX A;  1Q2P A;  3NEC A;  3P98 A;  3S22 A;  1BLP A;  4X56 A;  3CPT A;  1XJ4 A;  4JGR A;  1K54 A;  2ZL1 B;  4GDN A;  2IWB A;  2XD1 A;  3MMH A;  2WZX A;  4LCM A;  2WGW A;  3H82 A;  3DTK A;  5EEC A;  1T18 A;  3WRZ A;  2WZZ A;  3VOL A;  2HGV A;  1DY6 A;  2HDR A;  1T1B A;  3V5M A;  4H6J B;  2J80 A;  3O87 A;  1K38 A;  1T19 A;  3LGO A;  3JYI A;  2WKE A;  1ERQ A;  1GHP A;  1H8M A;  3T4J A;  4DXC A;  4CJN A;  4Q0J A;  2ZOI A;  3WS1 A;  1KE3 A;  4X68 A;  3ZHH A;  4DE3 A;  5KIZ A;  2EX2 A;  4GNU A;  3O5Y A;  2J9O A;  4MNR A;  1MZU A;  3L9K A;  2VK3 A;  4E6W A;  1Y28 A;  2VV6 A;  4PKY A;  4E3L A;  3BM6 A;  4XT2 A;  3KX0 X;  5IT5 A;  3UB7 A;  1IOU A;  2WKH A;  3VFF A;  5DKK A;  4KZB A;  2Y2M A;  3UPP A;  1KDS A;  5KZH A;  2Y4A A;  2Y2K A;  1H8Z A;  5CHM A;  2HP5 A;  3F1N A;  2PT7 A;  4X69 A;  4KQR A;  4JF5 A;  5FI7 A;  5A91 A;  3HJI A;  2XRO A;  1K4F A;  1K0K A;  3BRM A;  3N4I A;  1Q2Q A;  5HDC A;  3LR3 A;  3NI9 A;  1KGF A;  3QP4 A;  4N1H A;  1BUE A;  5EVL A;  5CTN A;  1XA7 A;  1K25 A;  2ZQA A;  2I9V A;  3P09 A;  1YLY A;  3H7W A;  3PYP A;  2XR0 A;  1P0Z A;  4HBT A;  4E3K A;  5DF9 A;  1KE0 A;  4E3M A;  2Y2H A;  3C7V A;  1I2W A;  1ES5 A;  5F69 A;  1V9Y A;  2J9P A;  2HJ9 C;  3MZD A;  3D3O A;  4N9L A;  4GJ4 A;  2PRF A;  3ISG A;  4HQA A;  4QPR A;  3VOZ A;  2W1R A;  3EEA A;  4KG2 A;  3TOI A;  4I38 A;  5F68 A;  3MSH A;  3N8L A;  1HTZ A;  2G2U A;  4Z1W A;  3HCY A;  1LSV A;  2H5S A;  1Y54 A;  3FPV A;  1FCN A;  2ZC4 B;  1TDL A;  1J9M A;  1SCW A;  4WZ4 A;  2V20 A;  2VX8 A;  3UE6 A;  2Y2O A;  1BUL A;  2V8C A;  4PM7 A;  5E2H A;  1TS7 A;  4WBG A;  5TFQ A;  1MC0 A;  2XEP A;  3QP6 A;  4G3V A;  2ZMF A;  1FR1 A;  1E3U A;  3UDX A;  1TS0 A;  2XFS A;  4WUJ A;  2X71 A;  1LL5 A;  2D02 A;  2OWJ A;  3JVU A;  1ES4 A;  4BD0 A;  4RYE A;  2R78 A;  2OLV A;  3QP8 A;  4KG5 A;  1YKD A;  3MQO A;  1E25 A;  4RX2 A;  1NZO A;  1XGJ A;  3BY8 A;  2M1C A;  4S2I A;  2JC7 A;  3EGX C;  1CI8 A;  5GHY A;  3LY4 A;  5TGF A;  2EWW A;  2QJ7 A;  5FA7 A;  3ZDJ A;  5HL6 A;  3BFD A;  4P6Z M;  5AVF A;  4EBN A;  4JGP A;  1FSW A;  2QWS A;  3MJQ A;  1T1C A;  4HEF A;  2OSU A;  3OBF A;  3NY4 A;  2DRW A;  4OLD A;  2WAF A;  4MN5 A;  3T1S A;  4ETZ A;  2GDN A;  4WEL A;  3IQA A;  5EOE A;  5HWT A;  1JWV A;  4S2J A;  3NOU C;  4KZ5 A;  2V1B A;  5KSC A;  5EM0 A;  1FIL A;  2C5W B;  4WZ5 C;  1DJC A;  4BWI A;  4LRZ E;  3UE3 A;  2QYB A;  2K2N A;  3IH8 A;  2BG1 A;  1K6R A;  2EX6 A;  3LFV A;  1NZU A;  5GHZ A;  1VET B;  5FI6 A;  5FEF A;  3PBS A;  1TVF A;  4D2O A;  1N9N A;  3IF6 C;  4GD6 A;  2A49 A;  1XPB A;  5F83 A;  3V39 A;  4ARZ B;  1YAX A;  5FAS A;  3T1R A;  5L2F A;  1D06 A;  2HP6 A;  1ES3 A;  3VFH A;  1NRJ A;  4UEY A;  5I5L A;  2Y2I A;  4JXS A;  4MCW A;  4JF6 A;  3G6O A;  4UA6 A;  2EX9 A;  1EW0 A;  4R3B A;  4NK3 A;  3G31 A;  2ZL1 A;  4BQM A;  1SHV A;  3SW1 A;  4E04 A;  4EU0 A;  4Y0U A;  5FEG A;  1YMS A;  3W8K A;  2VGJ A;  2J3T D;  1WYC A;  4L9F A;  4H6J A;  4UA9 A;  1VQQ A;  3OPR A;  2Y2L A;  3IT9 A;  2Y2Q A;  3F1O B;  3DAV A;  5CXW A;  4KZ9 A;  2QHK A;  5FQQ A;  5FDH A;  3LI8 A;  2IWD A;  4WLA A;  3QNB A;  1MKM A;  2VLG A;  3LIC A;  5FAQ A;  3B3X A;  4JXG A;  4R4R A;  3G32 A;  1G6A A;  1K57 A;  5FAT A;  1OTD A;  1ZKJ A;  1NYY A;  3KSI A;  2HF6 A;  5L07 A;  2HJE A;  2GNX A;  2ZC3 B;  3IX4 A;  4Y2F A;  5KMW A;  2J3W A;  5HX9 A;  1BT5 A;  1LI0 A;  1DJA A;  3PXP A;  4R23 A;  4DDY A;  4CLC B;  4EV4 A;  3OOV A;  3HLW A;  2L1M A;  3HLC A;  3BW6 A;  4MMN A;  3WS5 A;  1F98 A;  1ONG A;  5MC7 A;  4H8R A;  1PIO A;  1SDN A;  4FH4 A;  3IWI A;  4DRT A;  4K0W A;  1F5M A;  4HIA A;  3SS3 A;  4ETX A;  2JKT M;  2G2W A;  3B33 A;  2XRN A;  2P9V B;  4HH3 A;  3TRC A;  2JHE A;  4RX3 A;  4QD4 A;  2H0T A;  4K0X A;  3A3I A;  4JGO A;  3MXQ A;  3W4O A;  5EVI C;  5DTK A;  4S2L A;  4HJ4 A;  3LIF A;  1VEU B;  4O7D A;  2JKR M;  2XK1 A;  5KSH A;  5FL3 A;  4OPZ A;  2VJW A;  4S2M A;  1YT4 A;  3CHW P;  2P7J A;  5CEC A;  3ZNT A;  4LRY C;  5EVI D;  1X0O A;  4GDB A;  4R70 A;  4RA7 A;  2JBF A;  1ES2 A;  4EW7 A;  4X1L A;  5F1G A;  3TJZ C;  1DP6 A;  3W4P A;  2O9B A;  4DDS A;  2Z6D A;  5E43 A;  2B02 A;  1K54 C;  4MBK A;  2RL3 A;  2ZOH A;  3KYQ A;  1JNU A;  4N1X A;  3LIA A;  4LLO B;  4FD8 A;  5HZH A;  2PD7 A;  2A24 B;  3N6I A;  2XA7 S;  2V0U A;  2OAP 1;  2YKH A;  2DCF A;  2WK0 A;  4HJ6 A;  5DKL A;  4Y3I A;  1GSW A;  1DP8 A;  3IXH A;  3SH7 A;  3N8S A;  4Q0H A;  3D4F A;  3OPH A;  3EGD C;  2WUQ A;  4OON A;  2FFY A;  5HDS A;  2Y55 A;  2Y91 A;  1BSG A;  3QP5 A;  1PYY A;  1H8Y A;  2ZM0 A;  3NOT C;  4Y5F A;  4DF6 A;  1ERO A;  2KOI A;  1L0D A;  1HZO A;  3K3D A;  3PBN A;  4I3J A;  4DJ3 A;  3QHY A;  5TBM B;  2Z2M B;  2LB5 A;  4DJ2 A;  5HDD A;  1KDW A;  3UB5 P;  1ZG4 A;  4XXR A;  4OOY A;  5E2E A;  4NEE D;  3HLE A;  4KUO A;  2BAS A;  2HDQ A;  2LB9 A;  1GSX A;  3S7P A;  2FZ0 A;  3TW8 A;  2K7S A;  1VET A;  1IYP A;  1NXY A;  4HH2 A;  4F3L B;  3HLB A;  3C7U A;  3ZCZ A;  4MLL A;  5DF7 A;  4ARZ A;  2V8F A;  4P85 A;  4Y15 A;  1BLS A;  4LPZ A;  5GLD A;  4BBU A;  2EA9 A;  1RGZ A;  1IKI A;  4Y7P A;  1ZHH B;  3PAG A;  4NXB A;  1H3Q A;  1BYW A;  4JPM A;  2ZQ9 A;  5GLC A;  3NDE A;  2IWC A;  1OTA A;  4E3O A;  2FFF B;  3BJN A;  3NUL A;  5HSQ A;  1GA9 A;  5FAP A;  5U47 A;  1K55 A;  3D72 A;  5FQ9 A;  4EES A;  5HWV A;  3LR5 A;  5CGX A;  2Z6C A;  4BMW A;  4IJG A;  4DE2 A;  4Q8I A;  3G2Y A;  2PU2 A;  5GHX A;  5IU1 A;  3Q1F A;  3IHB A;  4NXG A;  4CPK A;  2QPN A;  4R3J A;  3T4O A;  5A93 A;  4GB7 A;  5HW3 A;  3M6B A;  4KQO A;  3F1O A;  4LV3 A;  3Q7V B;  3JVV A;  1NJ4 A;  4G3K A;  4WL9 A;  4YFM A;  3G4P A;  3DW0 A;  1QME A;  1N9O A;  1GHI A;  3LYX A;  4QY6 A;  5CGS A;  4CLC D;  1PZP A;  3NOP C;  1I5Q A;  5FI2 A;  1K4E A;  4UA7 A;  4Y0T A;  3WWX A;  2ZM8 A;  1FCO A;  3SZT A;  3ZG8 B;  3MR0 A;  4QJG A;  1BTL A;  1E3U D;  1NWZ A;  3UB8 A;  3BWL A;  3T4K A;  2Y2J A;  3MS6 A;  5I94 A;  4KZ6 A;  3IWQ A;  4HI4 A;  1NLZ A;  4PMA A;  1PI4 A;  2VV7 A;  4MDZ A;  4N92 A;  4CLC A;  3FYZ A;  2VZW A;  4LV2 A;  2NUP C;  4BJP A;  5AQ9 A;  2XDM A;  2M7V A;  4EEP A;  2V9A A;  1OTI A;  4HBU A;  4NXE A;  3T1Q B;  3PBT A;  4UHU A;  3ZG0 A;  1IFQ A;  2UV0 E;  4IVK A;  1G68 A;  4EWF A;  5DJU A;  5TR7 A;  2P9V A;  5HD5 A;  3KYE A;  1XP4 A;  2VEA A;  3L7H A;  1QMF A;  1CI9 A;  3T4L A;  4P6Z S;  2PU4 A;  4I39 A;  1Z09 A;  1ODV A;  4S2O A;  4HHD A;  5J3W A;  5E2F A;  3LR0 A;  4Q0I A;  3GQZ A;  5DJT A;  4OQH A;  2I72 A;  4OLG A;  5M1A A;  5FDS A;  5EUA A;  3CLO A;  2HPB A;  3EWK A;  1NY0 A;  4PPR A;  5J8X A;  4JXV A;  3RFB A;  1AWI A;  3UE0 A;  3DBA A;  2ZJ9 A;  4UQI M;  3UME A;  5F82 A;  5K5B A;  1E4D A;  4OQG A;  1IYQ A;  3HLD A;  3GR2 A;  4CQH A;  3NC8 A;  2QMI A;  2QZ6 A;  4S2K A;  3RH8 B;  3E2K A;  1P9R A;  3VP1 A;  3SS4 A;  4IBR A;  1S4S A;  5HL1 A;  3FWL A;  3LR4 A;  3MQQ A;  2A24 A;  5CRF A;  3T50 A;  2ZMV A;  3T12 B;  2ZC7 A;  3OPL A;  4OQI A;  1FR6 A;  2L0W A;  4FTX A;  2K31 A;  3GSG A;  2H0Y A;  5EFW A;  1ZTU A;  3ZG7 B;  3E4Q A;  2EX8 A;  3ICY A;  2PDR A;  1NLY A;  3BY9 A;  4ZRR A;  5TBM A;  4QU3 A;  2J3T C;  3CI6 A;  1K57 C;  4OH0 A;  3IWO A;  1OJ5 A;  4ID4 A;  2Z2L B;  4GKU A;  2MJ6 A;  3SH8 A;  5M19 A;  3VSK A;  5HPI A;  2VGL M;  2JKR I;  4OP8 A;  4R0Q A;  4FSF A;  3RXX A;  3WS0 A;  1W8Y A;  3CZD A;  5LBR A;  4EUZ A;  2BTF P;  4S2N A;  3IHA A;  4DKI A;  3QP2 A;  4ESP A;  1O07 A;  1W63 Q;  3KO6 A;  4F3L A;  1ERM A;  1LLB A;  5DFY A;  1CK3 A;  1K56 A;  3A0S A;  3N7W A;  3KSF A;  2JCH A;  3TE8 A;  2EFU A;  5IHV A;  5G18 A;  1YSP A;  2ZMA A;  5IS1 A;  4Y0O A;  1LHY A;  3OCN A;  1XGI A;  2KDK A;  1HVB A;  1S1Z A;  1VB6 A;  3NDG A;  3Q82 A;  1PRQ A;  2PYR A;  1MPL A;  4OKP A;  3PTE A;  1F2K A;  5FQK A;  5HWW A;  1W79 A;  4XUZ A;  4GLQ A;  3W4Q A;  4OVD A;  3BEB A;  4JGQ A;  2B5R A;  1KVL A;  3LUQ A;  4ZJ2 A;  4P0M A;  3CUE A;  1LSX A;  3G34 A;  1SKO B;  1XFN A;  3BFF A;  3OZH A;  1XJ6 A;  4AFI A;  2WYX A;  4NXF A;  2PR5 A;  1G28 A;  4ZJ1 A;  4HOI A;  4BLM A;  4L0L A;  1H5X A;  3HUO A;  5A8B A;  3Q7V A;  4I3I A;  3VP3 A;  1BLC A;  1S66 L;  3ITB A;  5G4Z A;  5BOH A;  1YLT A;  1L0E A;  1L3L A;  4FCF A;  3P7N A;  3PHY A;  1P97 A;  4L9E A;  3AGF A;  3B42 A;  1GA0 A;  4IUK A;  4RVA A;  2XGN A;  3C2W A;  1S0W A;  3MXR A;  3NIA A;  2XH9 A;  5HAR A;  5DFX A;  1HD8 A;  3BLS A;  4JBF A;  5AVE A;  3VP4 A;  3U4L P;  1GCE A;  2OLU A;  3R7W B;  3FKV A;  2INW A;  4QHC A;  1YLP A;  4LCL A;  3MF0 A;  2PYP A;  4EBP A;  3E98 A;  2OWH A;  3GDI A;  3V50 A;  4MN7 A;  3F1P B;  4JF4 A;  5EE8 A;  3M6H A;  3UMD A;  3VP0 A;  2H10 A;  3FPW A;  3WS2 A;  4K91 A;  3FZC A;  4EER A;  1XXM A;  1OME A;  5AQ7 A;  3RTY A;  2B18 A;  4OP5 A;  5CER A;  3PBR A;  3GEC A;  2AVX A;  4KG6 A;  3LIB A;  3LI9 A;  2OOL A;  3HUM A;  4X53 A;  3G30 A;  4A5R A;  1YM1 A;  1JTD A;  3SH9 A;  3ZVW A;  3EEH A;  4GN2 A;  3FKW A;  2HZ5 A;  4OPY A;  3E4O A;  1PW8 A;  5FQM A;  1YPR A;  4O8G A;  3V3R A;  2WKP A;  5CTM A;  3PBO A;  1FSY A;  3IS2 B;  1IYS A;  1MWU A;  4OOL A;  3ZYT A;  4EQI A;  2Q9M A;  3C5A A;  1HLU P;  5CED A;  4YIN A;  3HVF A;  4ZDX A;  3B47 A;  2GZA A;  1OT6 A;  4M4X A;  3IBR A;  3HL9 A;  3NBL A;  2EFX A;  3C4O A;  2GX5 A;  4F94 A;  1LI9 A;  1JVJ A;  1G6O A;  3GVB A;  1RGY A;  3VE4 A;  2E8I A;  2WGV A;  4EBL A;  3AGE A;  2JKF A;  1CF0 A;  2ZLY A;  4E3I A;  3ZQ5 A;  3LEQ A;  2X01 A;  4U3T A;  2ACG A;  3VP2 A;  3BLM A;  4QWO A;  4BBT A;  3K2N A;  2WGI A;  1TD5 A;  4X6T A;  4C3Q A;  1OTB A;  4EET B;  2Y2G A;  1YQS A;  3HJK A;  4MBF A;  1K55 C;  1PWD A;  2CC1 A;  2B95 A;  1S4R A;  2ZC5 B;  5A90 A;  2HP9 A;  4EXO A;  3VV4 A;  4YNR A;  3MZF A;  4HP9 A;  5AJG A;  5EOO A;  3UPO A;  5FQI A;  3NHQ A;  2H28 A;  3HLF A;  4OPR A;  4RQ9 A;  3ULF A;  2VGK A;  3MKE A;  1OT9 A;  4WMC D;  3ZNY A;  2RCX A;  3IXD A;  1XA1 A;  3QP1 A;  3HUN A;  4LGW A;  3MQ0 A;  4BBV A;  4BL3 A;  5G4Y A;  3OLO A;  5EPH A;  1IKG A;  1M6K A;  2V2F F;  1YLJ A;  2W27 A;  3EOI A;  2W3H A;  1DRM A;  5GLA A;  2VKS A;  2P74 A;  2OV5 A;  3P01 A;  3RJU A;  3CMZ A;  1XJ2 A;  4B4X A;  5C5K A;  3FC7 A;  1UWN X;  1STZ A;  3UY6 A;  5FAO A;  5HAI A;  2Q0O A;  2O9A A;  3IF6 B;  4NKP A;  1XX2 A;  4WMC A;  5F6A A;  3LIE A;  3V67 A;  5L8M A;  2YKF A;  4LEN A;  5D3O A;  3VOY A;  4WEJ A;  2J7V A;  4GHI B;  3C38 A;  1LL8 A;  5FQJ A;  3ZVT A;  4C6Y A;  1K6S A;  1TS6 A;  2Y79 A;  2C6W B;  1ALQ A;  4U0X A;  5GLB A;  4G3W A;  3ZG5 A;  1JWP A;  1Y4O A;  3RXW A;  1FCM A;  2ZQ8 A;  3S7N A;  3O88 A;  4CLC C;  3FV7 A;  2WAE A;  2Y8H A;  3FG8 A;  3KSH A;  4GS9 B;  1OPX A;  1G5U A;  2V1A A;  4JXW A;  5HFO A;  2JKG A;  2WKR A;  3R4K A;  3UDI A;  4HJ3 A;  1RP5 A;  1A0K A;  3DTI A;  4K08 A;  4MBH A;  3T4T A;  2NUT C;  1TF1 A;  4FUW A;  3MXS A;  1L0G A;  4DE1 A;  5CEB A;  5TJJ A;  1DJB A;  4CLC E;  2O9C A;  2W0N A;  3PBQ A;  3MFX A;  5FSR A;  2HV1 A;  1GHM A;  1MKI A;  4DN0 A;  3S7O A;  4ZAM A;  4U0T A;  4EUV A;  4P6B A;  2OAQ 1;  3DTE A;  2PBD P;  3T1X A;  4YWZ A;  4WYY A;  2ZBB A;  3LCE A;  1SKO A;  3CJM A;  3TG9 A;  2W1T B;  3UO9 A;  3W2Z A;  4GW9 A;  1MBL A;  3E0Y A;  3HLG A;  3O3V A;  2W3G A;  1JWZ A;  3UPN A;  5CGW A;  2QKP A;  3TSG A;  1XFQ A;  5DVA A;  3A0R A;  1XKZ A;  2UWX A;  4LV1 A;  4IHQ A;  1PFL A;  4LRX C;  3T4S A;  2PBY A;  1T1A A;  3UDF A;  3AGD A;  2O0Y A;  3LID A;  4M3K A;  1W5D A;  4FOF A;  2HDU A;  3UE1 A;  1S1Y A;  3R7W A;  4E6X A;  1S67 L;  3NJA A;  1YLW A;  1MWT A;  4OOM A; 
#chains in the Genus database with same CATH homology
 2VA0 A;  4Q0J A;  2ZOI A;  3KSG A;  2XSS A;  5CX7 A;  2P7J A;  5KIZ A;  1W63 Q;  3KO6 A;  3F1P A;  4EEU A;  4F3L A;  4LRY C;  3O5Y A;  1MZU A;  3CAX A;  5DFY A;  1X0O A;  1Y28 A;  4UQI S;  2VV6 A;  4PKY A;  3A0S A;  3KSF A;  2D01 A;  1KOU A;  3TE8 A;  4R70 A;  1YSP A;  4XT2 A;  2QJ5 A;  1LT0 A;  4EW7 A;  3KX0 X;  5IT5 A;  3UB7 A;  3TJZ C;  1DP6 A;  5IS1 A;  1IOU A;  2CMN A;  4KUK A;  5DKK A;  2O9B A;  3CWF A;  1WA9 A;  3OCN A;  2Z6D A;  4PHT A;  1OTE A;  4PAU A;  2B02 A;  2KDK A;  4B9O A;  1S1Z A;  3F1N A;  1VB6 A;  2PT7 A;  4EQ1 A;  2PYR A;  2ZOH A;  3KYQ A;  1JNU A;  2PHY A;  3LIA A;  2L4R A;  4LLO B;  5HZH A;  5HWW A;  2PD7 A;  4ME4 A;  2A24 B;  1UGU A;  3HJI A;  3KYZ A;  2XRO A;  2XA7 S;  2V0U A;  4GLQ A;  3IS2 A;  2OAP 1;  2YKH A;  4JGQ A;  4HJ6 A;  3LUQ A;  1W63 M;  5HDC A;  3LR3 A;  3CUE A;  1LSX A;  3C8C A;  5DKL A;  3UB6 A;  4Y3I A;  1GSW A;  2PR6 A;  1DP8 A;  1XFN A;  4Q0H A;  3EGD C;  1XJ6 A;  4AFI A;  4NXF A;  2W3D A;  2PR5 A;  1G28 A;  4HOI A;  4L0L A;  5HDS A;  2I9V A;  2GJ3 A;  5A8B A;  4I3I A;  1S66 L;  3H7W A;  3NOT C;  3PYP A;  4Y5F A;  5G4Z A;  3BQ8 A;  1P0Z A;  2IA2 A;  3EQV A;  4YOF A;  2KOI A;  3P7N A;  3K3D A;  3PBN A;  5DF9 A;  4I3J A;  3PHY A;  1P97 A;  4L9E A;  3B42 A;  4IUK A;  4DJ3 A;  5TBM B;  3IBJ A;  3C2W A;  2O99 A;  3H82 B;  2LB5 A;  4DJ2 A;  1V9Z A;  2VGL S;  4R3A A;  5F69 A;  1V9Y A;  2JKT I;  5HDD A;  2HJ9 C;  3D3O A;  4IUH A;  5DFX A;  5AVE A;  3U2A A;  4GJ4 A;  4QPR A;  4HQA A;  2W1R A;  3EEA A;  2INW A;  3R7W B;  4I38 A;  4I3A A;  4NEE D;  5F68 A;  4KUO A;  2BAS A;  2WKQ A;  2LB9 A;  1GSX A;  3MF0 A;  4Z1W A;  3S7P A;  2PYP A;  2FZ0 A;  3HCY A;  1LSV A;  3PR6 A;  4WF0 A;  3EQU A;  3E98 A;  2K7S A;  3TW8 A;  2OWH A;  3GDI A;  2JN7 A;  4MN7 A;  3F1P B;  4HH2 A;  4F3L B;  3FPV A;  3UMD A;  3FPW A;  3CUE C;  2VX8 A;  4ARZ A;  3UE6 A;  4LPZ A;  4EER A;  4BBU A;  2EA9 A;  4XT2 B;  3RTY A;  2B18 A;  1TS7 A;  3PBR A;  1MC0 A;  3GEC A;  1ZHH B;  3LIB A;  3LI9 A;  3E4P A;  4KQD A;  4G3V A;  2ZMF A;  3VE3 A;  2OOL A;  4B93 A;  1TS0 A;  4WUJ A;  4NXB A;  1H3Q A;  1BYW A;  2D02 A;  2OWJ A;  1OTA A;  1GSV A;  3EEH A;  3JVU A;  3F1N B;  3BJN A;  5HSQ A;  2R78 A;  1VHM A;  3E4O A;  4HNB A;  3D72 A;  3T4J A;  4EES A;  5HWV A;  1YKD A;  3LR5 A;  3MQO A;  2V0W A;  4O8G A;  2WKP A;  2Z6C A;  4BMW A;  4IJG A;  3PBO A;  3IS2 B;  3BY8 A;  2M1C A;  3EGX C;  4OOL A;  3ZYT A;  2FH5 A;  3A0V A;  5IU1 A;  2EWW A;  2QJ7 A;  4WEK A;  4NXG A;  3B47 A;  5HL6 A;  3T4O A;  2GZA A;  4GHI A;  4P6Z M;  5AVF A;  1OT6 A;  4JGP A;  4O01 A;  5J4E A;  4M4X A;  3IBR A;  4I5S A;  2QWS A;  3MJQ A;  1T1C A;  4KQO A;  3F1O A;  5J7E A;  3OBF A;  3JVV A;  2A2L A;  3H7W B;  2GX5 A;  4G3K A;  1P9W A;  4MN5 A;  4ETZ A;  4WL9 A;  1G6O A;  4WEL A;  3VE4 A;  2EWV A;  2KX6 A;  2DMW A;  1N9O A;  1UWP X;  5HWT A;  3LYX A;  4II7 A;  3NOU C;  4GS9 A;  4CLC D;  2V1B A;  3NOP C;  3ZQ5 A;  2P04 A;  2G7U A;  4BWI A;  4LRZ E;  4BBT A;  3K2N A;  3UE3 A;  1TD5 A;  2QYB A;  1OTB A;  4L9G A;  4EET B;  2K2N A;  3HJK A;  4MN6 A;  4WN5 A;  1TS8 A;  5HPF A;  3LFV A;  4R6L A;  3MR0 A;  1S4R A;  4EXO A;  3VV4 A;  3PBS A;  4YNR A;  4HY8 A;  1NWZ A;  4HP9 A;  5AJG A;  1N9N A;  3UB8 A;  3BWL A;  3T4K A;  3NHQ A;  2H28 A;  4HI4 A;  1NLZ A;  4RQ9 A;  3ULF A;  4ARZ B;  2VV7 A;  1YAX A;  4MDZ A;  4O0P A;  1OT9 A;  4CLC A;  3S7Q A;  2VZW A;  2NUP C;  3MQ0 A;  4BBV A;  4BJP A;  2W1T A;  1XJ3 A;  3BQA A;  1D06 A;  2M7V A;  5G4Y A;  4EEP A;  3OLO A;  1OJG A;  2M7U A;  1NRJ A;  4UEY A;  2V9A A;  1OTI A;  5I5L A;  4NXE A;  2W27 A;  3EOI A;  2W3H A;  1DRM A;  2W3F A;  3PBT A;  4MCW A;  3G6O A;  2VKS A;  1IFQ A;  3P01 A;  1D7E A;  1EW0 A;  1XJ2 A;  5C5K A;  3FC7 A;  1UWN X;  1STZ A;  5DJU A;  1YSQ A;  3SW1 A;  4E04 A;  5HD5 A;  4EU0 A;  2VEA A;  2O9A A;  2J3T D;  4NKP A;  4L9F A;  3T4L A;  5F6A A;  3LIE A;  4P6Z S;  4GCZ A;  4H6J A;  3V67 A;  5L8M A;  2YKF A;  4WEJ A;  4GHI B;  4I39 A;  3C38 A;  1LL8 A;  1TS6 A;  1ODV A;  4HHD A;  5J3W A;  2Y79 A;  3LR0 A;  4Q0I A;  3F1O B;  5DJT A;  4G3W A;  2QHK A;  3C30 A;  3LI8 A;  4DMZ A;  3UB9 A;  3T4Q A;  3CLO A;  3EWK A;  4WLA A;  1MKM A;  2VLG A;  3CIT A;  3LIC A;  3S7N A;  4CLC C;  1DP9 A;  2Y8H A;  3RFB A;  3FG8 A;  3KSH A;  4GS9 B;  3DBA A;  1OPX A;  3K3C A;  4UQI M;  3UME A;  2V1A A;  1N9L A;  5K5B A;  1OTD A;  2WKR A;  3R4K A;  4PKY G;  4HJ3 A;  4CQH A;  3OCL A;  4HP4 A;  3KSI A;  2HF6 A;  3RH8 B;  4K08 A;  1P9R A;  3T4T A;  1F9I A;  3OC2 A;  2NUT C;  1TF1 A;  1S4S A;  4R38 A;  5TJJ A;  2HJE A;  4CLC E;  2O9C A;  2GNX A;  2W0N A;  3PBQ A;  3MFX A;  2HV1 A;  3LR4 A;  4DN0 A;  4Y2F A;  3S7O A;  3MQQ A;  1LSW A;  2VV8 A;  4EUV A;  2J3W A;  2A24 A;  2OAQ 1;  2P08 A;  3T50 A;  5F5Y A;  2ZMV A;  5HD3 A;  4YWZ A;  3PXP A;  2ZBB A;  2PD8 A;  2W3E A;  2L0W A;  2XA7 M;  4CLC B;  3OOV A;  2KLI A;  2W1T B;  2L1M A;  3BW6 A;  4MMN A;  2K31 A;  5EFW A;  1F98 A;  1ZTU A;  3W2Z A;  3E4Q A;  4GW9 A;  3H9W A;  5MC7 A;  3E0Y A;  3ICY A;  1F5M A;  2W3G A;  2PDR A;  2QKP A;  4HIA A;  1NLY A;  1XFQ A;  1XJ4 A;  4ETX A;  2JKT M;  4JGR A;  3BY9 A;  3A0R A;  4ZRR A;  3B33 A;  5TBM A;  2XRN A;  3MMH A;  4IHQ A;  2J3T C;  3CI6 A;  4LRX C;  4HH3 A;  3H82 A;  3T4S A;  1T1A A;  3TRC A;  2JHE A;  1OJ5 A;  2O0Y A;  3LID A;  1T18 A;  2MJ6 A;  4JGO A;  3MXQ A;  3VOL A;  4FOF A;  2HGV A;  5HPI A;  1T1B A;  2VGL M;  2J80 A;  4H6J B;  2JKR I;  1T19 A;  4FSF A;  1S1Y A;  3LIF A;  4HJ4 A;  3R7W A;  1S67 L;  3NJA A;  2JKR M;  5KSH A;  5FL3 A;  5LBR A;  1H8M A;  2VJW A;  4OOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...