3P01A

Crystal structure of two-component response regulator from nostoc sp. pcc 7120
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
178
structure length
178
Chain Sequence
QRAAETYDLLKQRTEELRRANAQMSLLTVLVQVTQASNSLEAILTPIATAFAESFAVNACILQMLEGQTLSTIQGFYSQQGTVNNWLNQDPLTNEAIATGQIQVAANIAKDPKLASISQYQDNGIQSHVVIPITYRNEMLGVLSLQWQQPISLREDELTLIHLSAQLVAIALTSSRCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of two-component response regulator from Nostoc sp. PCC 7120
rcsb
source organism Nostoc sp.
molecule tags Signaling protein
molecule keywords Two-component response regulator
total genus 51
structure length 178
sequence length 178
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.340 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3p01A02
3P01A
chains in the Genus database with same CATH superfamily
2H10A 5CEBA 4HJ4A 3EWKA 4B4ZA 3C4PA 3HUMA 2X02A 4ARZA 3MFXA 5CHUA 5EVIC 1KGGA 4X56A 3WS4A 4K0XA 1JNUA 4M4XA 5JYPA 4X53A 1JVJA 3H7WB 2HV1A 5GLBA 3HUOA 4PM5A 4WL9A 5IT5A 2WKIA 3KSIA 1S67L 2Q9MA 2HZ5A 3WWXA 3SS4A 1OTDA 4YFMA 2EWVA 2W1TA 4NKPA 2QMIA 5CGXA 1GHMA 4BBVA 2PHYA 5TBMB 1XA1A 2MJ6A 4L0LA 1FOFA 4HIAA 4OPZA 2XA7M 5KMWA 4Y3IA 5J3WA 2O99A 3G4PA 1ZKJA 4RX3A 1EWZA 5HD3A 4R3JA 4R1GA 3UNWA 2FFFB 3OPPA 2VEAA 4GKUA 5KSCA 5CHMA 2HJEA 3EEAA 4MBKA 3H82B 1MKMA 1BLPA 1K55C 3UE0A 2OAP1 4CQHA 4YOFA 2V8FA 2GX5A 3ZNTA 2QJ7A 4WELA 3U4LP 2ZC4B 3E4PA 1LSWA 3RXXA 3BFEA 3IHAA 4C6YA 1VQQA 4EUVA 3R4KA 5FEGA 1VM1A 3BFCA 4Z9QA 1HLUP 4EESA 3B3XA 3NBLA 4PM9A 3SH7A 2H28A 3N8SA 5EOOA 5AJGA 4EU0A 3UE1A 3OPLA 5TR7A 3EGXC 4XXRA 4GD6A 3Q1FA 3T4TA 2XK1A 2B5RA 2V8CA 5A91A 2Y2LA 4PHTA 1GSXA 2W3HA 4YNRA 2C6WB 3W4QA 2JBFA 4NXBA 3O86A 5HDSA 2PYRA 3UO9A 1K25A 3B42A 5HDCA 1SKFA 4PM6A 4S2NA 2V1AA 4S2NC 2WAFA 3Q7VB 4LCMA 4EBNA 1W63M 1XKZA 1T1CA 1YLJA 5CGWA 3KYZA 1H8ZA 4OLGA 4LCLA 4OOLA 3UE3A 3N6IA 2H5SA 4PM8A 3KSGA 2A49A 5L2FA 2P9VA 5EVIB 2P74A 5L09A 4MEZA 4E3MA 5E2EA 3DTEA 2IWBA 1XFNA 4LFUA 3PR6A 1ESIA 4UA6A 1XJ6A 2L1MA 3IXDA 3AGEA 1NLYA 5LBRA 5DF9A 2ZJ9A 1DP8A 4E04A 1NY0A 5F83A 1FCMA 1K55A 1M6KA 4QJGA 1DRMA 1EI5A 2WGIA 3TW8A 3BEBA 3HLBA 4EEUA 1NLZA 5EVID 1H3QA 3ZYTA 1H0MA 5FQJA 1PYYA 3Q82A 1LSVA 3QP2A 4O8GA 4S2JA 1VEUA 4OLDA 2G7UA 1PIOA 4E3IA 3GQZA 2P7JA 3F1OB 2VV6A 1CJFA 1PZOA 2IWCA 2VLGA 2J3TC 3A0RA 4GJ4A 5FSRA 4OONA 1SDNA 3V39A 4R70A 3C30A 4KQDA 3OCNA 4OP5A 3WS5A 3LEQA 5KZHA 3NY4A 1ONHA 5EVIA 1XP4A 1C3BA 2KLIA 1YM1A 4KZ7A 3LO7A 3HJKA 5A92A 2O9BA 3KYEA 3HBRA 3N8RA 1T18A 2VK3A 3T4OA 3GV9A 4QY5A 5JYOA 5DTKA 1I5QA 3V67A 1F9IA 3M2JA 4LV0A 3SW1A 3NC8A 2IA2A 2EA9A 3S1YA 5L10A 1YLPA 1PZPA 2KDKA 2X01A 4CLCA 3IX8A 2WK0A 2OV5A 2QZ6A 5EOEA 1W63Q 2WGVA 2KOIA 3MQOA 3A3IA 1UGUA 1FIKA 4HNBA 3JVUA 3F1PA 1D1JA 3OBFA 3OZHA 2V20A 2VV7A 4Y7PA 4AFIA 2VGJA 1PI5A 5U47A 3IBRA 3CZDA 3QP4A 5M1AA 5DJTA 2FH5A 5HW3A 3SOIA 1W8QA 5GHYA 4R3BA 3GVBA 1FR1A 2ZQAA 3A0VA 3MQQA 4JF6A 5A90A 5FEFA 2RL3A 3MXRA 2ZC6B 4LGWA 1T1BA 3FKVA 4EERA 4Q0IA 4FCFA 4P87A 3HLWA 3VOLA 1RP5A 1W79A 2XDMA 4Q0HA 3W4OA 1GSVA 1DP9A 4QY6A 1VEUB 2BG1A 2I72A 2OLUA 2K31A 1LI9A 1W8YA 2QHKA 3ZG7B 2OAQ1 1BT5A 4MN7A 2HP5A 5DF8A 2X71A 1WE4A 1G28A 4JXGA 4WM9A 3L9KA 3T1RA 1FQGA 3T4QA 2BASA 2Y2HA 4OKPA 5HSQA 1E3UA 5BOHA 5DKKA 2H0TA 2JKRM 1IYOA 4N9KA 4H6JA 2QYBA 2Y55A 1VB6A 3LIAA 1J3WA 2K7SA 2XF3A 1GHPA 2WKPA 3ZQ5A 3KSHA 3HLDA 5EVLA 1LL8A 1BYWA 3U2AA 3T12B 3OOVA 5CGSA 4P85A 2D02A 4NG2A 3PBSA 4KUOA 4DXBA 5J4EA 2PRFA 4QU3A 1STZA 2E8IA 2J9PA 3E4QA 1OJGA 3LI9A 2Y2MA 3ISGA 5DJUA 3QP1A 1YQSA 3G6OA 3KSFA 4JXVA 2Y4AA 2W3GA 1S4SA 3LY4A 2ZD8A 1NRFA 2DCFA 1HTZA 3FV7A 2ZMFA 3C2WA 1BULA 3BLMA 2J3WA 3UE6A 4MBHA 2WAEA 2ZC7A 4R6LA 4EWFA 3BFGA 3BY8A 3CLOA 3LR3A 4CJNA 3WRTA 2VZWA 1MXOA 3HLGA 4F3LB 1IYQA 3NDEA 1HZOA 3VFHA 1UWPX 3T4JA 4MLLA 3MSHA 4S2OA 3EOIA 5GLAA 3KYQA 5G4YA 2HGVA 4K0WA 3ULFA 1CK3A 4BLMA 3IF6A 4BWIA 4I5SA 3IBJA 5HL1A 2J8YA 3F1PB 3NOUC 2Y59A 4E3LA 4OP8A 3BQAA 1FSYA 4OQIA 5GHZA 4EUZA 4I38A 4U0XA 4Y13A 1NZUA 5FI7A 4RYEA 1TF1A 1RGZA 1JWVA 1EROA 4OPYA 2Q9NA 4H8RA 2WZZA 4FSFA 2EX9A 1CQAA 3G34A 5FDHA 4MCWA 3BW6A 2NUPC 3UB6A 4EEPA 5F1FA 5HAQA 3DBAA 3PBNA 1TDGA 4F94A 4GD8A 5I94A 3CUEA 4S2PA 1S1YA 1DP6A 3N7WA 1MC0A 2FFYA 1OTEA 3ZG9B 5AVEA 2M7UA 3CPTB 1OT9A 1VETA 4ME4A 3W8KA 1K56D 4RA7A 4DKIA 3LIDA 3D72A 4R4RA 2IWDA 3IS2B 1K54A 4UQIM 3NOTC 1Z6FA 3T1QB 4GZBA 2ZM0A 2XFTA 4GDNA 4K08A 2PD7A 3LGOA 1FR6A 3PBQA 3ZG8B 4QHCA 4X1MA 2WGWA 5DVAA 3PHYA 4N9LA 4P6ZS 4NXFA 4WF0A 1K57A 2PBYA 2QWSA 4X68A 4Q0JA 4LV1A 4WZ5C 4DMZA 2Z2MB 3LEZA 4E3OA 1I2WA 3BFDA 3VP0A 1TEMA 4Y0UA 4IHQA 5TBMA 4RVAA 3B47A 4R0QA 1ERQA 2JKTM 4XT2A 3Q81A 1PI4A 3R7WA 3A3FA 3QP6A 2Z6CA 2H0YA 1RCJA 3JVVA 5EUAA 3G30A 3OCLA 2J3TD 1TDLA 4CLCE 2PDRA 1DJCA 1PW8A 2Y2KA 1TS0A 4LV2A 3VSLA 2XSSA 3UB9A 3M6HA 1L0GA 2HP6A 3T1XA 4Y17A 5FAOA 2D01A 4BBUA 5M19A 3T50A 2EX8A 3VOZA 3TOIA 4ZRRA 4WUJA 3VE3A 2ZLYA 3EGDC 2Q0OA 3OLOA 2V0UA 3P98A 3UPOA 2HDQA 3RJUA 3CHWP 3HCYA 5E43A 1YLTA 2ZM2A 4L9FA 4B9OA 3NHQA 4DE3A 3K2NA 4P6ZM 4XUZA 5MC7A 2KX6A 4L9EA 4S2KA 1PFLA 1MY8A 3GECA 5DTSA 4EXOA 1W7FA 3CG5A 2PR6A 4JGRA 3OC2A 3ZNYA 3S7NA 2HP9A 4NXEA 2HDUA 5FQQA 3UB5P 4UQIS 2QPNA 3NOPC 4G3VA 4BD1A 3VFFA 1YKDA 2B18A 2B95A 3IWIA 4HI4A 5HWWA 2HDSA 2J9OA 1AWIA 4YWZA 2ZMVA 1K6SA 4X1LA 4XUXA 1JTDA 1QMEA 4JKTA 5FASA 4I3AA 4ESPA 5E2FA 4HH3A 2V1ZA 1KVMA 3W4PA 3G31A 4EQIA 4UA9A 2ZOIA 3LR4A 2XGNA 2EX6A 2ZQ8A 3A3JA 1K4FA 1G68A 3MZDA 3DWKA 1T1AA 2W1RA 3C4OA 2XD5A 1XJ3A 2EFXA 3BM6A 4JXWA 4HY8A 1NZOA 4Y5FA 3N4IA 3NULA 3G35A 1N9OA 1L0EA 4DE1A 1HVBA 3UMEA 4FUWA 4GHIA 2JCHA 3CJMA 4ID4A 1BLCA 4ZJ1A 1KE4A 2A2LA 1WYBA 3K3CA 1TS8A 3DW0A 1NRJA 3VMAA 2Y2PA 3T1SA 4KG5A 1YMXA 1HD8A 4JPMA 4A5RA 5EVEA 3JYIA 5DF7A 3BFFA 4PMAA 5FAQA 3MQ0A 1SDEA 2QKPA 3BQ8A 1O7EA 4KZ5A 2WKEA 3T4SA 5M18A 4MDZA 5GLCA 2ZL1B 5G18A 2W1TB 1GSWA 4GS9B 4JXSA 2XROA 4I3JA 2QJ5A 3ITAA 1LLBA 3RH8B 1XPBA 2GJ3A 4NK3A 4NETA 3DTKA 2V0WA 3HLFA 4FD8A 1BUEA 3PTEA 2GZAA 2JE5A 3QNCA 2A24B 3FKWA 3T4LA 5AVFA 4II7A 3S4XA 1Q2PA 3S22A 3RFBA 1KDSA 3ZGAB 2Y2OA 2R9XA 5CXWA 1SKOB 3NDGA 3M2KA 3NIAA 3P09A 1PNEA 2W3EA 5HAPA 4F3LA 2ZQDA 4NEED 2DMWA 4IBRA 3ZG0A 4FOFA 4DE2A 4WEKA 3PAGA 3V50A 3NCKA 4MN6A 5FI6A 2JN7A 1ONGA 1K4EA 2HPBA 1PW1A 1U60A 4KQOA 2EX2A 4EETB 3E2KA 1KE0A 1ZG6A 2O0YA 3IXHA 3LCEA 3ZVWA 1P9RA 5EM0A 3BJNA 1SKOA 4JGPA 3ZFZA 2XLNA 4N1HA 2ZQCA 2W3DA 4M3KA 4OH0A 3C5AA 4BL2A 4E3KA 1NWZA 4G3KA 3FC7A 3CITA 3LUQA 3LR0A 1N9LA 3TE8A 2ZQ9A 1MKIA 1S4RA 3F1NA 1E4DA 4IJGA 3VE4A 3A0SA 4CPKA 4HESA 4IVKA 5A93A 2WZXA 4GCZA 3ZVTA 4R3AA 1WYCA 1XGIA 4S2IA 5CEDA 2BLSA 1DJBA 2E8JA 2Y79A 2VV8A 3ITBA 3W2ZA 2OSUA 4D60A 2WYXA 2XD1A 4HEFA 2XQZA 2DRWA 3P7NA 5FQ9A 3Q7VA 2G2UA 2W27A 3WS1A 5HWVA 5F5YA 2PU4A 3L7HA 3WRZA 2WKRA 3LIBA 2INWA 5HWTA 3UN7A 2VGLS 3T4KA 1IKIA 4KZ6A 4BQMA 3MS6A 4QD4A 5HL6A 1NYMA 1OPXA 2YKFA 1MWUA 4BENA 1I2SA 3LI8A 4MBFA 1RGYA 5DFYA 5CTNA 1YT4A 1K0KA 3F1NB 4DDYA 4ARZB 3FZCA 4DF6A 5EE8A 1Q2QA 3IS2A 2UWXA 4C75A 1K56A 1YLZA 3K3DA 2Y2IA 1MPLA 5TFQA 1VETB 3OPHA 4FH4A 4WLAA 4U3TA 4EW7A 4LLOB 1OTIA 2XA7S 2JHEA 5AQBA 4O01A 4JF5A 1L0DA 4OPRA 5DKLA 5FQKA 2PBDP 4HJ6A 4BBTA 5C5KA 4OQGA 1N9NA 2RCXA 1M40A 5EM1A 1YAXA 5J8XA 5F69A 3IF5A 4GB7A 2WKQA 1OJ5A 2NUTC 5GL9A 3GMWA 1IKGA 1BZAA 3QP5A 3UPPA 4UA7A 4FH2A 4GHIB 3D3OA 3QHYA 4KUKA 2FZ0A 3VP4A 4X55A 1G6AA 1LSXA 3IXGA 4KZ9A 3V3RA 2G2WA 3RTYA 2GDNA 3PBOA 2EXAA 3MXSA 4OQ0A 1CEFA 1H5XA 5L07A 4XT2B 3DTIA 1GCEA 3LR5A 1KGFA 1OTAA 3DWZA 4DJ2A 3MKFA 4E3NA 3SZTA 2M1CA 2LB5A 2WUQA 3C38A 3IH9A 4H6JB 1LT0A 1ESUA 1MZUA 2P9VB 2J80A 1Y28A 2VX8A 4KZ3A 3MZEA 3E4OA 1G6OA 3H7WA 3SS5A 1D7EA 3MR0A 3WS0A 3VP2A 3RXWA 2YKHA 1ZTUA 4D2OA 2M7VA 1IOUA 4WBGA 3EQUA 5EECA 4LRZE 3IT9A 1PRQA 4R38A 4BL3A 3PBTA 2JKGA 4ZDXA 3A3DA 3P01A 4GOGA 1GA0A 3Q7ZA 1NXYA 1ES5A 4B4XA 2OWJA 2J7VA 2JKFA 5IS1A 1BLHA 2ZMAA 3MBZA 2OWHA 3MKEA 3S7OA 4ZTKA 1OT6A 3MZFA 3HREA 2CMNA 4KQQA 3G2ZA 3E98A 4FTXA 2Z2LB 4PKYG 4X25A 1S66L 1F5MA 2LB9A 1N4OA 1A0KA 3CMZA 4ETZA 5HD5A 1IYSA 1PWCA 5EV0A 5KSHA 4YINA 2DNSA 1T19A 2PR5A 3HVFA 5FI2A 1YLWA 1JWPA 5CERA 3EQVA 5F1GA 4KZ8A 3O88A 4WMCA 4CLCD 3LICA 2XR0A 4S2MA 4WEJA 5A8BA 3VSKA 3D4FA 3BRMA 1BLSA 1IFQA 1YSQA 3FPWA 4WMCD 2XH9A 4JBFA 1XFQA 4JGOA 5EFWA 1Z09A 3CAXA 1W5DA 4BMWA 4KZBA 1FILA 4OOMA 5IU1A 4Y0TA 1BSGA 3FYZA 4N1XA 4MNRA 4L9GA 1LL5A 1ES2A 5HPIA 4Y15A 5AQAA 3MFDA 3BYDA 3HJIA 3G32A 3MMHA 3V5MA 5E2GA 2PT7A 3PYPA 4OQHA 2C5WB 5FQIA 5E2HA 3UY6A 3PXPA 1L2SA 2VA0A 4JLFA 4IEDA 4S2LA 4EV4A 1P0ZA 3O3VA 2Y2GA 4UAAA 4GLQA 1EW0A 2UV0E 4MMNA 1ZG4A 4PM7A 4HBUA 2VGLM 2PU2A 4PAUA 5GHXA 3ZDJA 5L8MA 3UB7A 1SHVA 3LYXA 3IQAA 2BTFP 1E25A 4QB8A 1LI0A 1MBLA 4Z1WA 4UEYA 1PWDA 1MWTA 4Y2FA 3VOYA 3CPTA 4HJ3A 3BWLA 4LRXC 4KQRA 5AQ7A 2V9AA 2W3FA 3GRJA 1MWSA 3GR2A 3OPRA 3TSGA 3R7WB 1YPRA 2AVXA 2OOLA 3TG9A 1OMEA 2JC7A 3H82A 3E0YA 1D06A 1GA9A 1WA9A 3QP8A 1V9ZA 4HQAA 4JF4A 3DTMA 4EQ1A 1JTGA 1SCWA 4RX2A 3IWQA 1VHMA 1L3LA 3Q07A 5FA7A 3KO6A 4HP9A 4GN2A 3IX3A 4Y0OA 1E3UD 5G4ZA 3WS2A 4CLCB 1BTLA 3KX0X 2VGKA 5F6AA 2HJ9C 2K2NA 4IVIA 4ZBEA 3O5YA 3F1OA 1S0WA 5FAPA 3VP1A 3MXQA 2B02A 4HBTA 1XX2A 3IF6B 3N8LA 5EPHA 3BY9A 2WADA 3VV4A 1XA7A 4WZ5A 4IBXA 2Y2QA 1K57C 4DXCA 3C7VA 4LV3A 1H8MA 1TVFA 3PAEA 3ICYA 1ODVA 4EBPA 2HDRA 3HL9A 1GHIA 4O7DA 1ACFA 3V3SA 2Y8HA 2ZC5B 1IEMA 4JGQA 3HLEA 1FCNA 1N9BA 4I39A 4BD0A 5F82A 1K54C 2ZBBA 5TGFA 4HH2A 3FG8A 5HFOA 2PYPA 2GNXA 1QMFA 4KENB 2W0NA 3UDXA 2WGWB 3UMDA 2Z6DA 4OPQA 3TRCA 3HUNA 3SH8A 1F98A 2Y91A 5KIZA 1JWZA 3CUEC 3C8CA 4OVDA 3LFVA 1IELA 4WYYA 1P9WA 1ZC2A 5FDSA 3JPUA 2PAVP 5FQMA 1SZVA 3HLCA 5CX7A 2V1BA 3QNBA 1NJ4A 2VJWA 1S6RA 1XXMA 1L0FA 4R4SA 1ES3A 4QPRA 2ZL1A 5FL3A 3UPNA 1IYPA 2I9VA 5CHJA 1NYYA 1KE3A 3ZG5A 4WN5A 4U0TA 3C7UA 1X0OA 4DN0A 2EWWA 2R78A 3BLSA 1K38A 3O87A 4MN5A 5K5BA 3IF6C 1P97A 1LL9A 3FWLA 1YMSA 2WKHA 2JKRI 1ERMA 2P08A 1KVLA 3IWOA 4E6WA 5HARA 4GS9A 3ZHHA 2EFUA 4WZ4A 2ZC3B 1ALQA 5J7EA 2OLVA 3SS3A 2CC1A 3PBRA 3SH9A 1DJAA 1XJ4A 1Y4OA 3CI6A 3LY3A 1MWRA 3MF0A 3AGFA 4X69A 1KOUA 3UDFA 4I3IA 5CECA 4G3WA 1XJ2A 3D9YA 4ZAMA 4LRYC 5F68A 1AXBA 2A3UA 4KG6A 3G2YA 3UB8A 4BJPA 3H9WA 3IHBA 5HAIA 3IX4A 3DAVA 4X6TA 1ZHHB 2XRNA 1FSWA 3GDIA 3I7JA 2ZOHA 5DFXA 4ETXA 2V2FF 2ZQ7A 4RQ9A 2VKSA 4LPZA 3A3EA 5DTTA 3VP3A 5GLDA 3IH8A 4IUKA 2L4RA 3CWFA 1F2KA 3B33A 1CI8A 3E2LA 3MJQA 2ACGA 5AQ9A 1LHYA 4ZJ2A 4R23A 1V9YA 4LENA 2L0WA 4KG2A 2PD8A 4P6BA 4PPRA 4DRTA 3NECA 1YSPA 4DJ3A 4NXGA 2Y2NA 3EEHA 1CI9A 4C3QA 4DE0A 2Y2JA 3GSGA 2O9AA 3S7PA 3IXBA 1UWNX 3M6BA 4PKYA 1KGEA 1Y54A 3BECA 5HX9A 1PWGA 2XEPA 4UHUA 2JKTI 4GDBA 1O07A 4HOIA 1KDWA 1XGJA 5HZHA 3FPVA 3UDIA 4N92A 4KZ4A 4B88A 3GTCA 2XFSA 4QWOA 1J9MA 1G5UA 3AGDA 1TS7A 4HHDA 4KZAA 4DDSA 4HP4A 1TD5A 3TJZC 4OOYA 2A24A 2O9CA 4EBLA 1ES4A 4IUHA 3NJAA 1FCOA 1YLYA 2R9WA 5I5LA 4B93A 5IHVA 4E3JA 4ZJ3A 4GW9A 4P0MA 4O0PA 1TS6A 4K91A 3LIEA 1S1ZA 2HF6A 4Q8IA 5D3OA 5HDDA 3S7QA 5TJJA 1CEGA 3LIFA 4GNUA 4E6XA 1CF0A 3NI9A 1K6RA 5CTMA 1DY6A 1H8YA 4CLCC 2ZM8A 3ZCZA 2P04A 2EXBA 1OTBA 5CRFA 5HPFA 5FATA
chains in the Genus database with same CATH topology
1LL8A 1BYWA 2GZAA 4MMNA 4HJ4A 3EWKA 2VGLM 3U2AA 2A24B 3OOVA 4PAUA 3T4LA 5AVFA 4II7A 4ARZA 3MFXA 5L8MA 3UB7A 3LYXA 3RFBA 2D02A 1JNUA 4M4XA 3PBSA 4KUOA 5J4EA 4UEYA 4Z1WA 3H7WB 4Y2FA 1STZA 2HV1A 4HJ3A 3BWLA 3E4QA 4WL9A 1OJGA 3LI9A 4LRXC 5IT5A 2V9AA 2W3FA 3KSIA 1S67L 2W3EA 3R7WB 5DJUA 4F3LA 4NEED 2DMWA 2OOLA 4FOFA 1OTDA 4WEKA 2EWVA 3G6OA 3H82A 2W1TA 3KSFA 4NKPA 3E0YA 4MN6A 1D06A 2JN7A 2W3GA 4BBVA 1S4SA 1WA9A 2PHYA 5TBMB 1V9ZA 4HQAA 4KQOA 2MJ6A 4EETB 4EQ1A 4L0LA 4HIAA 2XA7M 4Y3IA 2ZMFA 3C2WA 1VHMA 5J3WA 2O99A 2O0YA 3KO6A 4HP9A 2J3WA 5HD3A 3UE6A 1P9RA 2VEAA 4R6LA 3BJNA 2HJEA 5G4ZA 4JGPA 4CLCB 3EEAA 3KX0X 5F6AA 3BY8A 3CLOA 3H82B 1MKMA 2HJ9C 3LR3A 2K2NA 2OAP1 2VZWA 4CQHA 4YOFA 3O5YA 4F3LB 3F1OA 3MXQA 1UWPX 3T4JA 2GX5A 2B02A 2QJ7A 4WELA 2W3DA 1NWZA 3EOIA 3BY9A 4G3KA 3E4PA 3VV4A 3KYQA 1LSWA 3FC7A 5G4YA 2HGVA 3CITA 3LUQA 3ULFA 3LR0A 1N9LA 4BWIA 4I5SA 3IBJA 3TE8A 4EUVA 3R4KA 1S4RA 3F1NA 4IJGA 1H8MA 3F1PB 3NOUC 3VE4A 3ICYA 3A0SA 1ODVA 3BQAA 4EESA 4GCZA 4R3AA 4I38A 2H28A 2Y79A 2VV8A 2Y8HA 5AJGA 4EU0A 4JGQA 3W2ZA 1TF1A 4I39A 3EGXC 3P7NA 3T4TA 2ZBBA 4HH2A 3FG8A 2PYPA 4FSFA 2GNXA 2W27A 5HWVA 5F5YA 2W0NA 4PHTA 1GSXA 2W3HA 4YNRA 4MCWA 3BW6A 4NXBA 2NUPC 3UB6A 3UMDA 4EEPA 2WKRA 3LIBA 5HDSA 2Z6DA 2INWA 2PYRA 5HWTA 3B42A 3TRCA 2VGLS 3DBAA 3PBNA 5HDCA 3T4KA 1F98A 3CUEA 2V1AA 1S1YA 5KIZA 1DP6A 3C8CA 3CUEC 1MC0A 3LFVA 5HL6A 1OTEA 1OPXA 2YKFA 5AVEA 2M7UA 3LI8A 1OT9A 5DFYA 1P9WA 4ME4A 1W63M 1T1CA 3LIDA 3F1NB 3KYZA 4ARZB 3D72A 4OOLA 5CX7A 2V1BA 3UE3A 3IS2B 4UQIM 2VJWA 3IS2A 3KSGA 3NOTC 4QPRA 5FL3A 2I9VA 3K3DA 4K08A 2PD7A 3PBQA 4WN5A 4WLAA 1X0OA 4LLOB 4EW7A 1OTIA 2XA7S 2JHEA 4DN0A 4O01A 2EWWA 2R78A 3PHYA 4MN5A 5K5BA 4P6ZS 4NXFA 5DKLA 2QWSA 1XFNA 4WF0A 4HJ6A 3PR6A 4Q0JA 4BBTA 5C5KA 1P97A 4DMZA 1XJ6A 2L1MA 1NLYA 5LBRA 5DF9A 1N9NA 4IHQA 1DP8A 5TBMA 1YAXA 4E04A 3B47A 5F69A 2JKRI 2WKQA 1OJ5A 2P08A 2NUTC 2JKTM 4XT2A 1DRMA 4GS9A 3R7WA 4GHIB 3TW8A 3D3OA 4KUKA 4EEUA 2FZ0A 1NLZA 3ZYTA 1H3QA 1LSXA 5J7EA 2Z6CA 3JVVA 1LSVA 3OCLA 2J3TD 4O8GA 4CLCE 2PDRA 3RTYA 1TS0A 3PBOA 3PBRA 2G7UA 2XSSA 3UB9A 1XJ4A 3CI6A 2P7JA 3F1OB 2VV6A 2D01A 4BBUA 3T50A 2VLGA 3MF0A 2J3TC 4ZRRA 4XT2B 4WUJA 3VE3A 3A0RA 1KOUA 3LR5A 4GJ4A 4I3IA 1OTAA 3EGDC 4DJ2A 3OLOA 2V0UA 4G3WA 1XJ2A 5F68A 4LRYC 2M1CA 4R70A 3C30A 2LB5A 4KQDA 3OCNA 3HCYA 3C38A 4H6JB 1LT0A 3UB8A 4BJPA 4L9FA 4B9OA 3H9WA 3NHQA 1MZUA 3K2NA 1ZHHB 4P6ZM 2KLIA 2J80A 2XRNA 5MC7A 3HJKA 1Y28A 2VX8A 3GDIA 2O9BA 2KX6A 4L9EA 1T18A 2ZOHA 5DFXA 3E4OA 3T4OA 4ETXA 1G6OA 3H7WA 4RQ9A 3GECA 1D7EA 3MR0A 2VKSA 4LPZA 4EXOA 2YKHA 3V67A 1ZTUA 1F9IA 2M7VA 1IOUA 2PR6A 4JGRA 3OC2A 3SW1A 2IA2A 4IUKA 3S7NA 2EA9A 3EQUA 2L4RA 4NXEA 3CWFA 2KDKA 3B33A 4LRZE 4UQIS 4R38A 3NOPC 4CLCA 4G3VA 4GLQA 3MJQA 3PBTA 1YKDA 2B18A 3P01A 1W63Q 1V9YA 2KOIA 4HI4A 5HWWA 2L0WA 2OWJA 2PD8A 3MQOA 4YWZA 5IS1A 2ZMVA 1UGUA 2OWHA 4HNBA 1YSPA 3S7OA 4DJ3A 1OT6A 3JVUA 3F1PA 4I3AA 4NXGA 3OBFA 4HH3A 2CMNA 3EEHA 2VV7A 3E98A 4AFIA 4PKYG 1S66L 1F5MA 2LB9A 2ZOIA 3LR4A 4ETZA 3IBRA 2O9AA 5HD5A 3S7PA 1UWNX 5DJTA 2FH5A 5KSHA 4PKYA 1T19A 2PR5A 1T1AA 3A0VA 3MQQA 2W1RA 3EQVA 2JKTI 4HOIA 1XJ3A 5HZHA 3FPVA 1T1BA 4CLCD 4HY8A 3LICA 4Y5FA 4EERA 4Q0IA 1N9OA 3VOLA 4Q0HA 4WEJA 1TS7A 3UMEA 5A8BA 4HHDA 1GSVA 4GHIA 1DP9A 1TD5A 4HP4A 3TJZC 1IFQA 1YSQA 2A24A 2O9CA 3FPWA 2K31A 1XFQA 4JGOA 2A2LA 3K3CA 4IUHA 1TS8A 5EFWA 1NRJA 3CAXA 3NJAA 2QHKA 5I5LA 4B93A 2OAQ1 4BMWA 4MN7A 4GW9A 4OOMA 4O0PA 5IU1A 1TS6A 4L9GA 5HPIA 3LIEA 1G28A 1S1ZA 2HF6A 3MQ0A 3T4QA 2BASA 5HDDA 2QKPA 3BQ8A 3HJIA 3S7QA 5TJJA 3MMHA 5HSQA 3LIFA 3T4SA 2PT7A 3PYPA 4MDZA 2W1TB 1GSWA 4GS9B 4CLCC 2XROA 3PXPA 4I3JA 5DKKA 2QJ5A 2JKRM 2VA0A 3RH8B 4H6JA 2P04A 2QYBA 1OTBA 2GJ3A 1P0ZA 1VB6A 3LIAA 2K7SA 2V0WA 2WKPA 3ZQ5A 3KSHA 5HPFA 1EW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P01 A; 
#chains in the Genus database with same CATH topology
 2H10 A;  5CEB A;  4HJ4 A;  3EWK A;  4B4Z A;  3C4P A;  3HUM A;  2X02 A;  4ARZ A;  3MFX A;  5CHU A;  5EVI C;  1KGG A;  4X56 A;  3WS4 A;  4K0X A;  1JNU A;  4M4X A;  5JYP A;  4X53 A;  1JVJ A;  3H7W B;  2HV1 A;  5GLB A;  3HUO A;  4PM5 A;  4WL9 A;  5IT5 A;  2WKI A;  3KSI A;  1S67 L;  2Q9M A;  2HZ5 A;  3WWX A;  3SS4 A;  1OTD A;  4YFM A;  2EWV A;  2W1T A;  4NKP A;  2QMI A;  5CGX A;  1GHM A;  4BBV A;  2PHY A;  5TBM B;  1XA1 A;  2MJ6 A;  4L0L A;  1FOF A;  4HIA A;  4OPZ A;  2XA7 M;  5KMW A;  4Y3I A;  5J3W A;  2O99 A;  3G4P A;  1ZKJ A;  4RX3 A;  1EWZ A;  5HD3 A;  4R3J A;  4R1G A;  3UNW A;  2FFF B;  3OPP A;  2VEA A;  4GKU A;  5KSC A;  5CHM A;  2HJE A;  3EEA A;  4MBK A;  3H82 B;  1MKM A;  1BLP A;  1K55 C;  3UE0 A;  2OAP 1;  4CQH A;  4YOF A;  2V8F A;  2GX5 A;  3ZNT A;  2QJ7 A;  4WEL A;  3U4L P;  2ZC4 B;  3E4P A;  1LSW A;  3RXX A;  3BFE A;  3IHA A;  4C6Y A;  1VQQ A;  4EUV A;  3R4K A;  5FEG A;  1VM1 A;  3BFC A;  4Z9Q A;  1HLU P;  4EES A;  3B3X A;  3NBL A;  4PM9 A;  3SH7 A;  2H28 A;  3N8S A;  5EOO A;  5AJG A;  4EU0 A;  3UE1 A;  3OPL A;  5TR7 A;  3EGX C;  4XXR A;  4GD6 A;  3Q1F A;  3T4T A;  2XK1 A;  2B5R A;  2V8C A;  5A91 A;  2Y2L A;  4PHT A;  1GSX A;  2W3H A;  4YNR A;  2C6W B;  3W4Q A;  2JBF A;  4NXB A;  3O86 A;  5HDS A;  2PYR A;  3UO9 A;  1K25 A;  3B42 A;  5HDC A;  1SKF A;  4PM6 A;  4S2N A;  2V1A A;  4S2N C;  2WAF A;  3Q7V B;  4LCM A;  4EBN A;  1W63 M;  1XKZ A;  1T1C A;  1YLJ A;  5CGW A;  3KYZ A;  1H8Z A;  4OLG A;  4LCL A;  4OOL A;  3UE3 A;  3N6I A;  2H5S A;  4PM8 A;  3KSG A;  2A49 A;  5L2F A;  2P9V A;  5EVI B;  2P74 A;  5L09 A;  4MEZ A;  4E3M A;  5E2E A;  3DTE A;  2IWB A;  1XFN A;  4LFU A;  3PR6 A;  1ESI A;  4UA6 A;  1XJ6 A;  2L1M A;  3IXD A;  3AGE A;  1NLY A;  5LBR A;  5DF9 A;  2ZJ9 A;  1DP8 A;  4E04 A;  1NY0 A;  5F83 A;  1FCM A;  1K55 A;  1M6K A;  4QJG A;  1DRM A;  1EI5 A;  2WGI A;  3TW8 A;  3BEB A;  3HLB A;  4EEU A;  1NLZ A;  5EVI D;  1H3Q A;  3ZYT A;  1H0M A;  5FQJ A;  1PYY A;  3Q82 A;  1LSV A;  3QP2 A;  4O8G A;  4S2J A;  1VEU A;  4OLD A;  2G7U A;  1PIO A;  4E3I A;  3GQZ A;  2P7J A;  3F1O B;  2VV6 A;  1CJF A;  1PZO A;  2IWC A;  2VLG A;  2J3T C;  3A0R A;  4GJ4 A;  5FSR A;  4OON A;  1SDN A;  3V39 A;  4R70 A;  3C30 A;  4KQD A;  3OCN A;  4OP5 A;  3WS5 A;  3LEQ A;  5KZH A;  3NY4 A;  1ONH A;  5EVI A;  1XP4 A;  1C3B A;  2KLI A;  1YM1 A;  4KZ7 A;  3LO7 A;  3HJK A;  5A92 A;  2O9B A;  3KYE A;  3HBR A;  3N8R A;  1T18 A;  2VK3 A;  3T4O A;  3GV9 A;  4QY5 A;  5JYO A;  5DTK A;  1I5Q A;  3V67 A;  1F9I A;  3M2J A;  4LV0 A;  3SW1 A;  3NC8 A;  2IA2 A;  2EA9 A;  3S1Y A;  5L10 A;  1YLP A;  1PZP A;  2KDK A;  2X01 A;  4CLC A;  3IX8 A;  2WK0 A;  2OV5 A;  2QZ6 A;  5EOE A;  1W63 Q;  2WGV A;  2KOI A;  3MQO A;  3A3I A;  1UGU A;  1FIK A;  4HNB A;  3JVU A;  3F1P A;  1D1J A;  3OBF A;  3OZH A;  2V20 A;  2VV7 A;  4Y7P A;  4AFI A;  2VGJ A;  1PI5 A;  5U47 A;  3IBR A;  3CZD A;  3QP4 A;  5M1A A;  5DJT A;  2FH5 A;  5HW3 A;  3SOI A;  1W8Q A;  5GHY A;  4R3B A;  3GVB A;  1FR1 A;  2ZQA A;  3A0V A;  3MQQ A;  4JF6 A;  5A90 A;  5FEF A;  2RL3 A;  3MXR A;  2ZC6 B;  4LGW A;  1T1B A;  3FKV A;  4EER A;  4Q0I A;  4FCF A;  4P87 A;  3HLW A;  3VOL A;  1RP5 A;  1W79 A;  2XDM A;  4Q0H A;  3W4O A;  1GSV A;  1DP9 A;  4QY6 A;  1VEU B;  2BG1 A;  2I72 A;  2OLU A;  2K31 A;  1LI9 A;  1W8Y A;  2QHK A;  3ZG7 B;  2OAQ 1;  1BT5 A;  4MN7 A;  2HP5 A;  5DF8 A;  2X71 A;  1WE4 A;  1G28 A;  4JXG A;  4WM9 A;  3L9K A;  3T1R A;  1FQG A;  3T4Q A;  2BAS A;  2Y2H A;  4OKP A;  5HSQ A;  1E3U A;  5BOH A;  5DKK A;  2H0T A;  2JKR M;  1IYO A;  4N9K A;  4H6J A;  2QYB A;  2Y55 A;  1VB6 A;  3LIA A;  1J3W A;  2K7S A;  2XF3 A;  1GHP A;  2WKP A;  3ZQ5 A;  3KSH A;  3HLD A;  5EVL A;  1LL8 A;  1BYW A;  3U2A A;  3T12 B;  3OOV A;  5CGS A;  4P85 A;  2D02 A;  4NG2 A;  3PBS A;  4KUO A;  4DXB A;  5J4E A;  2PRF A;  4QU3 A;  1STZ A;  2E8I A;  2J9P A;  3E4Q A;  1OJG A;  3LI9 A;  2Y2M A;  3ISG A;  5DJU A;  3QP1 A;  1YQS A;  3G6O A;  3KSF A;  4JXV A;  2Y4A A;  2W3G A;  1S4S A;  3LY4 A;  2ZD8 A;  1NRF A;  2DCF A;  1HTZ A;  3FV7 A;  2ZMF A;  3C2W A;  1BUL A;  3BLM A;  2J3W A;  3UE6 A;  4MBH A;  2WAE A;  2ZC7 A;  4R6L A;  4EWF A;  3BFG A;  3BY8 A;  3CLO A;  3LR3 A;  4CJN A;  3WRT A;  2VZW A;  1MXO A;  3HLG A;  4F3L B;  1IYQ A;  3NDE A;  1HZO A;  3VFH A;  1UWP X;  3T4J A;  4MLL A;  3MSH A;  4S2O A;  3EOI A;  5GLA A;  3KYQ A;  5G4Y A;  2HGV A;  4K0W A;  3ULF A;  1CK3 A;  4BLM A;  3IF6 A;  4BWI A;  4I5S A;  3IBJ A;  5HL1 A;  2J8Y A;  3F1P B;  3NOU C;  2Y59 A;  4E3L A;  4OP8 A;  3BQA A;  1FSY A;  4OQI A;  5GHZ A;  4EUZ A;  4I38 A;  4U0X A;  4Y13 A;  1NZU A;  5FI7 A;  4RYE A;  1TF1 A;  1RGZ A;  1JWV A;  1ERO A;  4OPY A;  2Q9N A;  4H8R A;  2WZZ A;  4FSF A;  2EX9 A;  1CQA A;  3G34 A;  5FDH A;  4MCW A;  3BW6 A;  2NUP C;  3UB6 A;  4EEP A;  5F1F A;  5HAQ A;  3DBA A;  3PBN A;  1TDG A;  4F94 A;  4GD8 A;  5I94 A;  3CUE A;  4S2P A;  1S1Y A;  1DP6 A;  3N7W A;  1MC0 A;  2FFY A;  1OTE A;  3ZG9 B;  5AVE A;  2M7U A;  3CPT B;  1OT9 A;  1VET A;  4ME4 A;  3W8K A;  1K56 D;  4RA7 A;  4DKI A;  3LID A;  3D72 A;  4R4R A;  2IWD A;  3IS2 B;  1K54 A;  4UQI M;  3NOT C;  1Z6F A;  3T1Q B;  4GZB A;  2ZM0 A;  2XFT A;  4GDN A;  4K08 A;  2PD7 A;  3LGO A;  1FR6 A;  3PBQ A;  3ZG8 B;  4QHC A;  4X1M A;  2WGW A;  5DVA A;  3PHY A;  4N9L A;  4P6Z S;  4NXF A;  4WF0 A;  1K57 A;  2PBY A;  2QWS A;  4X68 A;  4Q0J A;  4LV1 A;  4WZ5 C;  4DMZ A;  2Z2M B;  3LEZ A;  4E3O A;  1I2W A;  3BFD A;  3VP0 A;  1TEM A;  4Y0U A;  4IHQ A;  5TBM A;  4RVA A;  3B47 A;  4R0Q A;  1ERQ A;  2JKT M;  4XT2 A;  3Q81 A;  1PI4 A;  3R7W A;  3A3F A;  3QP6 A;  2Z6C A;  2H0Y A;  1RCJ A;  3JVV A;  5EUA A;  3G30 A;  3OCL A;  2J3T D;  1TDL A;  4CLC E;  2PDR A;  1DJC A;  1PW8 A;  2Y2K A;  1TS0 A;  4LV2 A;  3VSL A;  2XSS A;  3UB9 A;  3M6H A;  1L0G A;  2HP6 A;  3T1X A;  4Y17 A;  5FAO A;  2D01 A;  4BBU A;  5M19 A;  3T50 A;  2EX8 A;  3VOZ A;  3TOI A;  4ZRR A;  4WUJ A;  3VE3 A;  2ZLY A;  3EGD C;  2Q0O A;  3OLO A;  2V0U A;  3P98 A;  3UPO A;  2HDQ A;  3RJU A;  3CHW P;  3HCY A;  5E43 A;  1YLT A;  2ZM2 A;  4L9F A;  4B9O A;  3NHQ A;  4DE3 A;  3K2N A;  4P6Z M;  4XUZ A;  5MC7 A;  2KX6 A;  4L9E A;  4S2K A;  1PFL A;  1MY8 A;  3GEC A;  5DTS A;  4EXO A;  1W7F A;  3CG5 A;  2PR6 A;  4JGR A;  3OC2 A;  3ZNY A;  3S7N A;  2HP9 A;  4NXE A;  2HDU A;  5FQQ A;  3UB5 P;  4UQI S;  2QPN A;  3NOP C;  4G3V A;  4BD1 A;  3VFF A;  1YKD A;  2B18 A;  2B95 A;  3IWI A;  4HI4 A;  5HWW A;  2HDS A;  2J9O A;  1AWI A;  4YWZ A;  2ZMV A;  1K6S A;  4X1L A;  4XUX A;  1JTD A;  1QME A;  4JKT A;  5FAS A;  4I3A A;  4ESP A;  5E2F A;  4HH3 A;  2V1Z A;  1KVM A;  3W4P A;  3G31 A;  4EQI A;  4UA9 A;  2ZOI A;  3LR4 A;  2XGN A;  2EX6 A;  2ZQ8 A;  3A3J A;  1K4F A;  1G68 A;  3MZD A;  3DWK A;  1T1A A;  2W1R A;  3C4O A;  2XD5 A;  1XJ3 A;  2EFX A;  3BM6 A;  4JXW A;  4HY8 A;  1NZO A;  4Y5F A;  3N4I A;  3NUL A;  3G35 A;  1N9O A;  1L0E A;  4DE1 A;  1HVB A;  3UME A;  4FUW A;  4GHI A;  2JCH A;  3CJM A;  4ID4 A;  1BLC A;  4ZJ1 A;  1KE4 A;  2A2L A;  1WYB A;  3K3C A;  1TS8 A;  3DW0 A;  1NRJ A;  3VMA A;  2Y2P A;  3T1S A;  4KG5 A;  1YMX A;  1HD8 A;  4JPM A;  4A5R A;  5EVE A;  3JYI A;  5DF7 A;  3BFF A;  4PMA A;  5FAQ A;  3MQ0 A;  1SDE A;  2QKP A;  3BQ8 A;  1O7E A;  4KZ5 A;  2WKE A;  3T4S A;  5M18 A;  4MDZ A;  5GLC A;  2ZL1 B;  5G18 A;  2W1T B;  1GSW A;  4GS9 B;  4JXS A;  2XRO A;  4I3J A;  2QJ5 A;  3ITA A;  1LLB A;  3RH8 B;  1XPB A;  2GJ3 A;  4NK3 A;  4NET A;  3DTK A;  2V0W A;  3HLF A;  4FD8 A;  1BUE A;  3PTE A;  2GZA A;  2JE5 A;  3QNC A;  2A24 B;  3FKW A;  3T4L A;  5AVF A;  4II7 A;  3S4X A;  1Q2P A;  3S22 A;  3RFB A;  1KDS A;  3ZGA B;  2Y2O A;  2R9X A;  5CXW A;  1SKO B;  3NDG A;  3M2K A;  3NIA A;  3P09 A;  1PNE A;  2W3E A;  5HAP A;  4F3L A;  2ZQD A;  4NEE D;  2DMW A;  4IBR A;  3ZG0 A;  4FOF A;  4DE2 A;  4WEK A;  3PAG A;  3V50 A;  3NCK A;  4MN6 A;  5FI6 A;  2JN7 A;  1ONG A;  1K4E A;  2HPB A;  1PW1 A;  1U60 A;  4KQO A;  2EX2 A;  4EET B;  3E2K A;  1KE0 A;  1ZG6 A;  2O0Y A;  3IXH A;  3LCE A;  3ZVW A;  1P9R A;  5EM0 A;  3BJN A;  1SKO A;  4JGP A;  3ZFZ A;  2XLN A;  4N1H A;  2ZQC A;  2W3D A;  4M3K A;  4OH0 A;  3C5A A;  4BL2 A;  4E3K A;  1NWZ A;  4G3K A;  3FC7 A;  3CIT A;  3LUQ A;  3LR0 A;  1N9L A;  3TE8 A;  2ZQ9 A;  1MKI A;  1S4R A;  3F1N A;  1E4D A;  4IJG A;  3VE4 A;  3A0S A;  4CPK A;  4HES A;  4IVK A;  5A93 A;  2WZX A;  4GCZ A;  3ZVT A;  4R3A A;  1WYC A;  1XGI A;  4S2I A;  5CED A;  2BLS A;  1DJB A;  2E8J A;  2Y79 A;  2VV8 A;  3ITB A;  3W2Z A;  2OSU A;  4D60 A;  2WYX A;  2XD1 A;  4HEF A;  2XQZ A;  2DRW A;  3P7N A;  5FQ9 A;  3Q7V A;  2G2U A;  2W27 A;  3WS1 A;  5HWV A;  5F5Y A;  2PU4 A;  3L7H A;  3WRZ A;  2WKR A;  3LIB A;  2INW A;  5HWT A;  3UN7 A;  2VGL S;  3T4K A;  1IKI A;  4KZ6 A;  4BQM A;  3MS6 A;  4QD4 A;  5HL6 A;  1NYM A;  1OPX A;  2YKF A;  1MWU A;  4BEN A;  1I2S A;  3LI8 A;  4MBF A;  1RGY A;  5DFY A;  5CTN A;  1YT4 A;  1K0K A;  3F1N B;  4DDY A;  4ARZ B;  3FZC A;  4DF6 A;  5EE8 A;  1Q2Q A;  3IS2 A;  2UWX A;  4C75 A;  1K56 A;  1YLZ A;  3K3D A;  2Y2I A;  1MPL A;  5TFQ A;  1VET B;  3OPH A;  4FH4 A;  4WLA A;  4U3T A;  4EW7 A;  4LLO B;  1OTI A;  2XA7 S;  2JHE A;  5AQB A;  4O01 A;  4JF5 A;  1L0D A;  4OPR A;  5DKL A;  5FQK A;  2PBD P;  4HJ6 A;  4BBT A;  5C5K A;  4OQG A;  1N9N A;  2RCX A;  1M40 A;  5EM1 A;  1YAX A;  5J8X A;  5F69 A;  3IF5 A;  4GB7 A;  2WKQ A;  1OJ5 A;  2NUT C;  5GL9 A;  3GMW A;  1IKG A;  1BZA A;  3QP5 A;  3UPP A;  4UA7 A;  4FH2 A;  4GHI B;  3D3O A;  3QHY A;  4KUK A;  2FZ0 A;  3VP4 A;  4X55 A;  1G6A A;  1LSX A;  3IXG A;  4KZ9 A;  3V3R A;  2G2W A;  3RTY A;  2GDN A;  3PBO A;  2EXA A;  3MXS A;  4OQ0 A;  1CEF A;  1H5X A;  5L07 A;  4XT2 B;  3DTI A;  1GCE A;  3LR5 A;  1KGF A;  1OTA A;  3DWZ A;  4DJ2 A;  3MKF A;  4E3N A;  3SZT A;  2M1C A;  2LB5 A;  2WUQ A;  3C38 A;  3IH9 A;  4H6J B;  1LT0 A;  1ESU A;  1MZU A;  2P9V B;  2J80 A;  1Y28 A;  2VX8 A;  4KZ3 A;  3MZE A;  3E4O A;  1G6O A;  3H7W A;  3SS5 A;  1D7E A;  3MR0 A;  3WS0 A;  3VP2 A;  3RXW A;  2YKH A;  1ZTU A;  4D2O A;  2M7V A;  1IOU A;  4WBG A;  3EQU A;  5EEC A;  4LRZ E;  3IT9 A;  1PRQ A;  4R38 A;  4BL3 A;  3PBT A;  2JKG A;  4ZDX A;  3A3D A;  3P01 A;  4GOG A;  1GA0 A;  3Q7Z A;  1NXY A;  1ES5 A;  4B4X A;  2OWJ A;  2J7V A;  2JKF A;  5IS1 A;  1BLH A;  2ZMA A;  3MBZ A;  2OWH A;  3MKE A;  3S7O A;  4ZTK A;  1OT6 A;  3MZF A;  3HRE A;  2CMN A;  4KQQ A;  3G2Z A;  3E98 A;  4FTX A;  2Z2L B;  4PKY G;  4X25 A;  1S66 L;  1F5M A;  2LB9 A;  1N4O A;  1A0K A;  3CMZ A;  4ETZ A;  5HD5 A;  1IYS A;  1PWC A;  5EV0 A;  5KSH A;  4YIN A;  2DNS A;  1T19 A;  2PR5 A;  3HVF A;  5FI2 A;  1YLW A;  1JWP A;  5CER A;  3EQV A;  5F1G A;  4KZ8 A;  3O88 A;  4WMC A;  4CLC D;  3LIC A;  2XR0 A;  4S2M A;  4WEJ A;  5A8B A;  3VSK A;  3D4F A;  3BRM A;  1BLS A;  1IFQ A;  1YSQ A;  3FPW A;  4WMC D;  2XH9 A;  4JBF A;  1XFQ A;  4JGO A;  5EFW A;  1Z09 A;  3CAX A;  1W5D A;  4BMW A;  4KZB A;  1FIL A;  4OOM A;  5IU1 A;  4Y0T A;  1BSG A;  3FYZ A;  4N1X A;  4MNR A;  4L9G A;  1LL5 A;  1ES2 A;  5HPI A;  4Y15 A;  5AQA A;  3MFD A;  3BYD A;  3HJI A;  3G32 A;  3MMH A;  3V5M A;  5E2G A;  2PT7 A;  3PYP A;  4OQH A;  2C5W B;  5FQI A;  5E2H A;  3UY6 A;  3PXP A;  1L2S A;  2VA0 A;  4JLF A;  4IED A;  4S2L A;  4EV4 A;  1P0Z A;  3O3V A;  2Y2G A;  4UAA A;  4GLQ A;  1EW0 A;  2UV0 E;  4MMN A;  1ZG4 A;  4PM7 A;  4HBU A;  2VGL M;  2PU2 A;  4PAU A;  5GHX A;  3ZDJ A;  5L8M A;  3UB7 A;  1SHV A;  3LYX A;  3IQA A;  2BTF P;  1E25 A;  4QB8 A;  1LI0 A;  1MBL A;  4Z1W A;  4UEY A;  1PWD A;  1MWT A;  4Y2F A;  3VOY A;  3CPT A;  4HJ3 A;  3BWL A;  4LRX C;  4KQR A;  5AQ7 A;  2V9A A;  2W3F A;  3GRJ A;  1MWS A;  3GR2 A;  3OPR A;  3TSG A;  3R7W B;  1YPR A;  2AVX A;  2OOL A;  3TG9 A;  1OME A;  2JC7 A;  3H82 A;  3E0Y A;  1D06 A;  1GA9 A;  1WA9 A;  3QP8 A;  1V9Z A;  4HQA A;  4JF4 A;  3DTM A;  4EQ1 A;  1JTG A;  1SCW A;  4RX2 A;  3IWQ A;  1VHM A;  1L3L A;  3Q07 A;  5FA7 A;  3KO6 A;  4HP9 A;  4GN2 A;  3IX3 A;  4Y0O A;  1E3U D;  5G4Z A;  3WS2 A;  4CLC B;  1BTL A;  3KX0 X;  2VGK A;  5F6A A;  2HJ9 C;  2K2N A;  4IVI A;  4ZBE A;  3O5Y A;  3F1O A;  1S0W A;  5FAP A;  3VP1 A;  3MXQ A;  2B02 A;  4HBT A;  1XX2 A;  3IF6 B;  3N8L A;  5EPH A;  3BY9 A;  2WAD A;  3VV4 A;  1XA7 A;  4WZ5 A;  4IBX A;  2Y2Q A;  1K57 C;  4DXC A;  3C7V A;  4LV3 A;  1H8M A;  1TVF A;  3PAE A;  3ICY A;  1ODV A;  4EBP A;  2HDR A;  3HL9 A;  1GHI A;  4O7D A;  1ACF A;  3V3S A;  2Y8H A;  2ZC5 B;  1IEM A;  4JGQ A;  3HLE A;  1FCN A;  1N9B A;  4I39 A;  4BD0 A;  5F82 A;  1K54 C;  2ZBB A;  5TGF A;  4HH2 A;  3FG8 A;  5HFO A;  2PYP A;  2GNX A;  1QMF A;  4KEN B;  2W0N A;  3UDX A;  2WGW B;  3UMD A;  2Z6D A;  4OPQ A;  3TRC A;  3HUN A;  3SH8 A;  1F98 A;  2Y91 A;  5KIZ A;  1JWZ A;  3CUE C;  3C8C A;  4OVD A;  3LFV A;  1IEL A;  4WYY A;  1P9W A;  1ZC2 A;  5FDS A;  3JPU A;  2PAV P;  5FQM A;  1SZV A;  3HLC A;  5CX7 A;  2V1B A;  3QNB A;  1NJ4 A;  2VJW A;  1S6R A;  1XXM A;  1L0F A;  4R4S A;  1ES3 A;  4QPR A;  2ZL1 A;  5FL3 A;  3UPN A;  1IYP A;  2I9V A;  5CHJ A;  1NYY A;  1KE3 A;  3ZG5 A;  4WN5 A;  4U0T A;  3C7U A;  1X0O A;  4DN0 A;  2EWW A;  2R78 A;  3BLS A;  1K38 A;  3O87 A;  4MN5 A;  5K5B A;  3IF6 C;  1P97 A;  1LL9 A;  3FWL A;  1YMS A;  2WKH A;  2JKR I;  1ERM A;  2P08 A;  1KVL A;  3IWO A;  4E6W A;  5HAR A;  4GS9 A;  3ZHH A;  2EFU A;  4WZ4 A;  2ZC3 B;  1ALQ A;  5J7E A;  2OLV A;  3SS3 A;  2CC1 A;  3PBR A;  3SH9 A;  1DJA A;  1XJ4 A;  1Y4O A;  3CI6 A;  3LY3 A;  1MWR A;  3MF0 A;  3AGF A;  4X69 A;  1KOU A;  3UDF A;  4I3I A;  5CEC A;  4G3W A;  1XJ2 A;  3D9Y A;  4ZAM A;  4LRY C;  5F68 A;  1AXB A;  2A3U A;  4KG6 A;  3G2Y A;  3UB8 A;  4BJP A;  3H9W A;  3IHB A;  5HAI A;  3IX4 A;  3DAV A;  4X6T A;  1ZHH B;  2XRN A;  1FSW A;  3GDI A;  3I7J A;  2ZOH A;  5DFX A;  4ETX A;  2V2F F;  2ZQ7 A;  4RQ9 A;  2VKS A;  4LPZ A;  3A3E A;  5DTT A;  3VP3 A;  5GLD A;  3IH8 A;  4IUK A;  2L4R A;  3CWF A;  1F2K A;  3B33 A;  1CI8 A;  3E2L A;  3MJQ A;  2ACG A;  5AQ9 A;  1LHY A;  4ZJ2 A;  4R23 A;  1V9Y A;  4LEN A;  2L0W A;  4KG2 A;  2PD8 A;  4P6B A;  4PPR A;  4DRT A;  3NEC A;  1YSP A;  4DJ3 A;  4NXG A;  2Y2N A;  3EEH A;  1CI9 A;  4C3Q A;  4DE0 A;  2Y2J A;  3GSG A;  2O9A A;  3S7P A;  3IXB A;  1UWN X;  3M6B A;  4PKY A;  1KGE A;  1Y54 A;  3BEC A;  5HX9 A;  1PWG A;  2XEP A;  4UHU A;  2JKT I;  4GDB A;  1O07 A;  4HOI A;  1KDW A;  1XGJ A;  5HZH A;  3FPV A;  3UDI A;  4N92 A;  4KZ4 A;  4B88 A;  3GTC A;  2XFS A;  4QWO A;  1J9M A;  1G5U A;  3AGD A;  1TS7 A;  4HHD A;  4KZA A;  4DDS A;  4HP4 A;  1TD5 A;  3TJZ C;  4OOY A;  2A24 A;  2O9C A;  4EBL A;  1ES4 A;  4IUH A;  3NJA A;  1FCO A;  1YLY A;  2R9W A;  5I5L A;  4B93 A;  5IHV A;  4E3J A;  4ZJ3 A;  4GW9 A;  4P0M A;  4O0P A;  1TS6 A;  4K91 A;  3LIE A;  1S1Z A;  2HF6 A;  4Q8I A;  5D3O A;  5HDD A;  3S7Q A;  5TJJ A;  1CEG A;  3LIF A;  4GNU A;  4E6X A;  1CF0 A;  3NI9 A;  1K6R A;  5CTM A;  1DY6 A;  1H8Y A;  4CLC C;  2ZM8 A;  3ZCZ A;  2P04 A;  2EXB A;  1OTB A;  5CRF A;  5HPF A;  5FAT A; 
#chains in the Genus database with same CATH homology
 1LL8 A;  1BYW A;  2GZA A;  4MMN A;  4HJ4 A;  3EWK A;  2VGL M;  3U2A A;  2A24 B;  3OOV A;  4PAU A;  3T4L A;  5AVF A;  4II7 A;  4ARZ A;  3MFX A;  5L8M A;  3UB7 A;  3LYX A;  3RFB A;  2D02 A;  1JNU A;  4M4X A;  3PBS A;  4KUO A;  5J4E A;  4UEY A;  4Z1W A;  3H7W B;  4Y2F A;  1STZ A;  2HV1 A;  4HJ3 A;  3BWL A;  3E4Q A;  4WL9 A;  1OJG A;  3LI9 A;  4LRX C;  5IT5 A;  2V9A A;  2W3F A;  3KSI A;  1S67 L;  2W3E A;  3R7W B;  5DJU A;  4F3L A;  4NEE D;  2DMW A;  2OOL A;  4FOF A;  1OTD A;  4WEK A;  2EWV A;  3G6O A;  3H82 A;  2W1T A;  3KSF A;  4NKP A;  3E0Y A;  4MN6 A;  1D06 A;  2JN7 A;  2W3G A;  4BBV A;  1S4S A;  1WA9 A;  2PHY A;  5TBM B;  1V9Z A;  4HQA A;  4KQO A;  2MJ6 A;  4EET B;  4EQ1 A;  4L0L A;  4HIA A;  2XA7 M;  4Y3I A;  2ZMF A;  3C2W A;  1VHM A;  5J3W A;  2O99 A;  2O0Y A;  3KO6 A;  4HP9 A;  2J3W A;  5HD3 A;  3UE6 A;  1P9R A;  2VEA A;  4R6L A;  3BJN A;  2HJE A;  5G4Z A;  4JGP A;  4CLC B;  3EEA A;  3KX0 X;  5F6A A;  3BY8 A;  3CLO A;  3H82 B;  1MKM A;  2HJ9 C;  3LR3 A;  2K2N A;  2OAP 1;  2VZW A;  4CQH A;  4YOF A;  3O5Y A;  4F3L B;  3F1O A;  3MXQ A;  1UWP X;  3T4J A;  2GX5 A;  2B02 A;  2QJ7 A;  4WEL A;  2W3D A;  1NWZ A;  3EOI A;  3BY9 A;  4G3K A;  3E4P A;  3VV4 A;  3KYQ A;  1LSW A;  3FC7 A;  5G4Y A;  2HGV A;  3CIT A;  3LUQ A;  3ULF A;  3LR0 A;  1N9L A;  4BWI A;  4I5S A;  3IBJ A;  3TE8 A;  4EUV A;  3R4K A;  1S4R A;  3F1N A;  4IJG A;  1H8M A;  3F1P B;  3NOU C;  3VE4 A;  3ICY A;  3A0S A;  1ODV A;  3BQA A;  4EES A;  4GCZ A;  4R3A A;  4I38 A;  2H28 A;  2Y79 A;  2VV8 A;  2Y8H A;  5AJG A;  4EU0 A;  4JGQ A;  3W2Z A;  1TF1 A;  4I39 A;  3EGX C;  3P7N A;  3T4T A;  2ZBB A;  4HH2 A;  3FG8 A;  2PYP A;  4FSF A;  2GNX A;  2W27 A;  5HWV A;  5F5Y A;  2W0N A;  4PHT A;  1GSX A;  2W3H A;  4YNR A;  4MCW A;  3BW6 A;  4NXB A;  2NUP C;  3UB6 A;  3UMD A;  4EEP A;  2WKR A;  3LIB A;  5HDS A;  2Z6D A;  2INW A;  2PYR A;  5HWT A;  3B42 A;  3TRC A;  2VGL S;  3DBA A;  3PBN A;  5HDC A;  3T4K A;  1F98 A;  3CUE A;  2V1A A;  1S1Y A;  5KIZ A;  1DP6 A;  3C8C A;  3CUE C;  1MC0 A;  3LFV A;  5HL6 A;  1OTE A;  1OPX A;  2YKF A;  5AVE A;  2M7U A;  3LI8 A;  1OT9 A;  5DFY A;  1P9W A;  4ME4 A;  1W63 M;  1T1C A;  3LID A;  3F1N B;  3KYZ A;  4ARZ B;  3D72 A;  4OOL A;  5CX7 A;  2V1B A;  3UE3 A;  3IS2 B;  4UQI M;  2VJW A;  3IS2 A;  3KSG A;  3NOT C;  4QPR A;  5FL3 A;  2I9V A;  3K3D A;  4K08 A;  2PD7 A;  3PBQ A;  4WN5 A;  4WLA A;  1X0O A;  4LLO B;  4EW7 A;  1OTI A;  2XA7 S;  2JHE A;  4DN0 A;  4O01 A;  2EWW A;  2R78 A;  3PHY A;  4MN5 A;  5K5B A;  4P6Z S;  4NXF A;  5DKL A;  2QWS A;  1XFN A;  4WF0 A;  4HJ6 A;  3PR6 A;  4Q0J A;  4BBT A;  5C5K A;  1P97 A;  4DMZ A;  1XJ6 A;  2L1M A;  1NLY A;  5LBR A;  5DF9 A;  1N9N A;  4IHQ A;  1DP8 A;  5TBM A;  1YAX A;  4E04 A;  3B47 A;  5F69 A;  2JKR I;  2WKQ A;  1OJ5 A;  2P08 A;  2NUT C;  2JKT M;  4XT2 A;  1DRM A;  4GS9 A;  3R7W A;  4GHI B;  3TW8 A;  3D3O A;  4KUK A;  4EEU A;  2FZ0 A;  1NLZ A;  3ZYT A;  1H3Q A;  1LSX A;  5J7E A;  2Z6C A;  3JVV A;  1LSV A;  3OCL A;  2J3T D;  4O8G A;  4CLC E;  2PDR A;  3RTY A;  1TS0 A;  3PBO A;  3PBR A;  2G7U A;  2XSS A;  3UB9 A;  1XJ4 A;  3CI6 A;  2P7J A;  3F1O B;  2VV6 A;  2D01 A;  4BBU A;  3T50 A;  2VLG A;  3MF0 A;  2J3T C;  4ZRR A;  4XT2 B;  4WUJ A;  3VE3 A;  3A0R A;  1KOU A;  3LR5 A;  4GJ4 A;  4I3I A;  1OTA A;  3EGD C;  4DJ2 A;  3OLO A;  2V0U A;  4G3W A;  1XJ2 A;  5F68 A;  4LRY C;  2M1C A;  4R70 A;  3C30 A;  2LB5 A;  4KQD A;  3OCN A;  3HCY A;  3C38 A;  4H6J B;  1LT0 A;  3UB8 A;  4BJP A;  4L9F A;  4B9O A;  3H9W A;  3NHQ A;  1MZU A;  3K2N A;  1ZHH B;  4P6Z M;  2KLI A;  2J80 A;  2XRN A;  5MC7 A;  3HJK A;  1Y28 A;  2VX8 A;  3GDI A;  2O9B A;  2KX6 A;  4L9E A;  1T18 A;  2ZOH A;  5DFX A;  3E4O A;  3T4O A;  4ETX A;  1G6O A;  3H7W A;  4RQ9 A;  3GEC A;  1D7E A;  3MR0 A;  2VKS A;  4LPZ A;  4EXO A;  2YKH A;  3V67 A;  1ZTU A;  1F9I A;  2M7V A;  1IOU A;  2PR6 A;  4JGR A;  3OC2 A;  3SW1 A;  2IA2 A;  4IUK A;  3S7N A;  2EA9 A;  3EQU A;  2L4R A;  4NXE A;  3CWF A;  2KDK A;  3B33 A;  4LRZ E;  4UQI S;  4R38 A;  3NOP C;  4CLC A;  4G3V A;  4GLQ A;  3MJQ A;  3PBT A;  1YKD A;  2B18 A;  3P01 A;  1W63 Q;  1V9Y A;  2KOI A;  4HI4 A;  5HWW A;  2L0W A;  2OWJ A;  2PD8 A;  3MQO A;  4YWZ A;  5IS1 A;  2ZMV A;  1UGU A;  2OWH A;  4HNB A;  1YSP A;  3S7O A;  4DJ3 A;  1OT6 A;  3JVU A;  3F1P A;  4I3A A;  4NXG A;  3OBF A;  4HH3 A;  2CMN A;  3EEH A;  2VV7 A;  3E98 A;  4AFI A;  4PKY G;  1S66 L;  1F5M A;  2LB9 A;  2ZOI A;  3LR4 A;  4ETZ A;  3IBR A;  2O9A A;  5HD5 A;  3S7P A;  1UWN X;  5DJT A;  2FH5 A;  5KSH A;  4PKY A;  1T19 A;  2PR5 A;  1T1A A;  3A0V A;  3MQQ A;  2W1R A;  3EQV A;  2JKT I;  4HOI A;  1XJ3 A;  5HZH A;  3FPV A;  1T1B A;  4CLC D;  4HY8 A;  3LIC A;  4Y5F A;  4EER A;  4Q0I A;  1N9O A;  3VOL A;  4Q0H A;  4WEJ A;  1TS7 A;  3UME A;  5A8B A;  4HHD A;  1GSV A;  4GHI A;  1DP9 A;  1TD5 A;  4HP4 A;  3TJZ C;  1IFQ A;  1YSQ A;  2A24 A;  2O9C A;  3FPW A;  2K31 A;  1XFQ A;  4JGO A;  2A2L A;  3K3C A;  4IUH A;  1TS8 A;  5EFW A;  1NRJ A;  3CAX A;  3NJA A;  2QHK A;  5I5L A;  4B93 A;  2OAQ 1;  4BMW A;  4MN7 A;  4GW9 A;  4OOM A;  4O0P A;  5IU1 A;  1TS6 A;  4L9G A;  5HPI A;  3LIE A;  1G28 A;  1S1Z A;  2HF6 A;  3MQ0 A;  3T4Q A;  2BAS A;  5HDD A;  2QKP A;  3BQ8 A;  3HJI A;  3S7Q A;  5TJJ A;  3MMH A;  5HSQ A;  3LIF A;  3T4S A;  2PT7 A;  3PYP A;  4MDZ A;  2W1T B;  1GSW A;  4GS9 B;  4CLC C;  2XRO A;  3PXP A;  4I3J A;  5DKK A;  2QJ5 A;  2JKR M;  2VA0 A;  3RH8 B;  4H6J A;  2P04 A;  2QYB A;  1OTB A;  2GJ3 A;  1P0Z A;  1VB6 A;  3LIA A;  2K7S A;  2V0W A;  2WKP A;  3ZQ5 A;  3KSH A;  5HPF A;  1EW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...