1PZOA

Tem-1 beta-lactamase in complex with a novel, core-disrupting, allosteric inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
publication title Allosteric inhibition through core disruption.
pubmed doi rcsb
source organism Escherichia coli
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1pzoA00
3EQUA 4NK3A 5CTMA 5HARA 3V39A 1AXBA 2ZC3B 3DWKA 4E3OA 4OQ0A 5FQ9A 1PWCA 2EXAA 2EX8A 4GNUA 5CXWA 3RXWA 4BJPA 4R4SA 4DE3A 4MBHA 3VFFA 5GLAA 2ZQ8A 1NXYA 1YM1A 3SH8A 4KZAA 1BZAA 4FCFA 3G2YA 4WZ4A 1WYCA 1XA7A 1HZOA 3UPPA 1SKFA 4IBXA 5JYOA 3PAGA 1C3BA 5CGSA 1TVFA 3A3JA 2Y2IA 1GCEA 3VSKA 2PU2A 2ZQ9A 4GDNA 4S2OA 5E2GA 5FA7A 1KVLA 1LL5A 4EV4A 1KVMA 5EPHA 1LI9A 4R3BA 3FV7A 4EUZA 3WS5A 1FQGA 3ZCZA 2XGNA 4EBLA 2J7VA 4E3MA 5M19A 1XGIA 1G6AA 1TDLA 1ZG4A 2C5WB 2Y2HA 4LV1A 2WGVA 1JWZA 4M3KA 2G2WA 4ZBEA 3MXSA 1YLYA 1OMEA 4PM9A 4X55A 3TOIA 2XH9A 3Q07A 3ITBA 1BUEA 4X69A 1ONGA 1ESIA 3CG5A 1XXMA 4KENB 3BFFA 3QHYA 4MNRA 1DJCA 5EVIA 1BTLA 4OPYA 3GMWA 1E3UD 2DRWA 3MZDA 3WRZA 2ZQCA 2Y2NA 1CEFA 1E4DA 4GKUA 1XPBA 2Q9NA 1WE4A 5AQ7A 4OLGA 4K0WA 3AGDA 1CI9A 1YLTA 3DWZA 1IYQA 2ZQ7A 2RL3A 3WWXA 4R3JA 4XUZA 4ID4A 1YMSA 3G31A 3IH8A 3P09A 5GLDA 4KQRA 5I94A 4S2NA 3Q7ZA 4X53A 3BLMA 4O7DA 2GDNA 4FD8A 4H8RA 4QB8A 4U0TA 2G2UA 1K54A 5F1GA 3IWQA 4QHCA 2XFSA 5FATA 3IF6A 4N9KA 3M6HA 3ZNTA 2QMIA 4PM8A 1BULA 3BRMA 2E8IA 4GDBA 2V1ZA 3M2JA 3PBNA 3A3FA 1ES5A 3A3IA 2ZJ9A 4KG5A 3IXHA 4Y0OA 4A5RA 1IYOA 1XGJA 1K57A 3VP0A 2EFXA 2FFYA 1DY6A 4GN2A 3O86A 4UA9A 1K6SA 1MY8A 3ISGA 1U60A 1BLSA 3QNBA 4MBFA 5EVID 1KGFA 1PWGA 3I7JA 5CEBA 3WS0A 4PM7A 3GSGA 2P74A 4DRTA 3N8LA 2HDSA 4DF6A 1GHIA 3VSLA 1SDNA 1YQSA 2HDUA 3G32A 3IH9A 2Z2MB 3V50A 2EFUA 3VOYA 3O87A 2EX2A 2WGWB 3Q7VA 4U3TA 2B5RA 2WZZA 4S2IA 4FH2A 3DTMA 1BT5A 3WS4A 1MWRA 2EX6A 1JTDA 2XFTA 3UE3A 3WS1A 2HPBA 3OPLA 4E3IA 4JXGA 4ZJ3A 4DDYA 4WEKA 3VP4A 3ZG0A 3V5MA 2Y2QA 3CMZA 4N1XA 2QPNA 4WEJA 3UDIA 4IVKA 1L0EA 5DTSA 2XD1A 5D3OA 2ZC6B 5FAPA 2RCXA 4FSFA 4ZDXA 1CI8A 5A93A 4GZBA 4RX3A 2JE5A 2Z2LB 4PPRA 3TG9A 1TEMA 5EVIB 4D2OA 1FSWA 1PZOA 3BM6A 3HUMA 3Q1FA 3OPPA 1ERQA 2V20A 3SH9A 5TGFA 3OZHA 3LEZA 5EVIC 3HLDA 3A3EA 1Y54A 1L0GA 3UDXA 3HBRA 3MZFA 4IEDA 1KGGA 2Y2KA 1WYBA 2HP6A 2WAFA 4MLLA 5CEDA 1EI5A 1SHVA 1JWPA 2XQZA 5BOHA 1NYYA 1LL9A 1YLPA 3BEBA 4P0MA 1FCMA 1MWSA 5DF7A 5HAPA 4ZJ1A 2WUQA 3CZDA 2ZM0A 3D4FA 3BFDA 3W4PA 4CJNA 5HAQA 4JPMA 2X71A 4S2NC 5GLBA 3V3SA 1IEMA 3HLFA 3IF6B 3PAEA 4BQMA 5HW3A 3C7VA 4HBUA 4WZ5A 5A91A 5FASA 4RYEA 1K54C 1I5QA 4LV2A 3NDGA 5GHXA 3HUOA 3IF6C 4OOMA 5U47A 4HBTA 3VP1A 3ZGAB 4P6BA 5FAOA 2Y2JA 1K25A 3BYDA 1NY0A 1K6RA 1W8QA 3IT9A 4LV0A 2OSUA 2Y59A 3GTCA 1CK3A 3V3RA 4B4ZA 1N4OA 4C3QA 1EWZA 1MKIA 5GHZA 2EX9A 5KSHA 5FDHA 3IXGA 3MKFA 1K57C 4L0LA 4QY6A 4XXRA 4P85A 3CJMA 3RJUA 1BLPA 1ESUA 4UAAA 5M18A 1GHMA 1KDWA 1XKZA 3O3VA 5CHUA 3SS3A 4F94A 4KZ4A 3SH7A 3NI9A 2PU4A 3UDFA 4C6YA 4KG6A 1KDSA 4N9LA 2C6WB 4P87A 1FCOA 1TDGA 5GHYA 4N1HA 2JCHA 3PBQA 4NETA 5A90A 5EUAA 1NRFA 4WMCA 4FH4A 3W4QA 1NZOA 4E3NA 1K4FA 1ZG6A 3Q7VB 4ZJ2A 1PI4A 4JXWA 3MBZA 4E3KA 5J8XA 4PM5A 2IWCA 4HESA 2ZQAA 2XDMA 4X56A 5FQQA 5AQ9A 2HDQA 1G68A 2DNSA 2JC7A 4R23A 1FR6A 2Y2GA 4MEZA 2P9VA 3P98A 4HEFA 4DE1A 5KSCA 2UWXA 2R9WA 3B3XA 3BLSA 4OH0A 5DF8A 2Y55A 3PTEA 3PBSA 3G30A 5M1AA 1GHPA 5L2FA 2WKIA 5HL1A 4PMAA 3HLEA 4S2PA 2QZ6A 3GQZA 1VM1A 4X6TA 4OVDA 1FR1A 4Z9QA 3N6IA 2HP5A 3N7WA 1ZKJA 5AQAA 4GOGA 3HLCA 4QU3A 3MFDA 3Q81A 3NCKA 1VQQA 3S22A 5CECA 2R9XA 1S0WA 3HVFA 3HUNA 3WRTA 4S2MA 2WGIA 3G4PA 1GA0A 2X02A 2J8YA 1ES4A 1YMXA 3IWIA 3NIAA 3G2ZA 2HP9A 3UY6A 3RXXA 4OOLA 3ZNYA 1SCWA 2ZMAA 4MBKA 3AGEA 3ZHHA 3JYIA 4OP5A 4K0XA 5E2EA 1YLWA 4LV3A 4WMCD 1KE3A 1MWTA 1PYYA 2OLVA 5CTNA 2I72A 5GL9A 3C7UA 3QNCA 3E2KA 5EECA 5FQMA 3OPHA 3HLWA 5DVAA 1EROA 1IYSA 1FSYA 1HTZA 2ZC4B 4WZ5C 1K56A 1MBLA 1PWDA 1RCJA 5FQJA 4OQIA 5IHVA 4E3LA 5JYPA 5CERA 2WZXA 1PW1A 2Y4AA 3PBRA 1PI5A 5E2HA 4OPQA 2A3UA 4YFMA 1XP4A 4DE0A 1JWVA 4S2LA 5F82A 3ZDJA 2H10A 1PW8A 2J9PA 4OQGA 2Y2PA 1O07A 3N8RA 5FI6A 4BD1A 3A3DA 3FKWA 4RA7A 4ZAMA 5CRFA 3UNWA 5CGWA 4KG2A 1MXOA 2DCFA 4KQOA 4KZBA 4E6XA 4R1GA 5F1FA 4DKIA 2Q9MA 3BFGA 3HLBA 3ZVWA 4DXCA 2IWDA 1E3UA 2ZC7A 2WKHA 4OQHA 5FSRA 3W4OA 2XEPA 1H8YA 3UPNA 3LY4A 1O7EA 3NDEA 1K38A 2FFFB 2HDRA 3ITAA 4GD6A 1W79A 2WADA 3E2LA 4OONA 4Y0TA 2XLNA 2Y2OA 2V2FF 3VP2A 3WS2A 1RGZA 2WYXA 4IVIA 2H0TA 5FI2A 2P9VB 3NBLA 1E25A 1FOFA 1M6KA 4OP8A 5CHMA 3UE1A 4BLMA 2OV5A 5HAIA 4JXSA 1IKIA 5FI7A 2XR0A 2Y91A 3HREA 1W7FA 4R0QA 3BECA 1K55A 2ZM2A 4KZ5A 5FAQA 2WGWA 1K56D 3FKVA 2IWBA 4E3JA 5GLCA 2Y2LA 5TFQA 1J9MA 1ES2A 4BENA 1ALQA 3BFCA 5EOEA 3SS4A 3W8KA 4UA6A 5DF9A 3PBTA 3GVBA 2WKEA 5HX9A 4LCLA 4PM6A 1NJ4A 3S1YA 1XX2A 3VP3A 4LENA 4N92A 4KZ3A 4QD4A 4ZTKA 3GR2A 4EQIA 2JBFA 5E2FA 3AGFA 3N8SA 4XUXA 1KE4A 1GA9A 1HVBA 4OLDA 4GB7A 1LLBA 4RX2A 1KE0A 3OCNA 5A92A 3FYZA 4JF5A 1JVJA 5KMWA 3NY4A 3IWOA 2A49A 3ZG7B 3MKEA 4BL3A 3M6BA 4R4RA 4B4XA 5TR7A 1K4EA 1L0DA 1SDEA 2VGJA 2EXBA 3S4XA 5KZHA 4KZ8A 3VMAA 3DW0A 5CGXA 4WELA 3SS5A 3BFEA 5F83A 4K91A 3C5AA 3IQAA 4OPRA 4JXVA 4LCMA 4JF6A 4DXBA 4JF4A 1JTGA 1IKGA 1KGEA 1L2SA 3G34A 3VFHA 3FWLA 4WM9A 1BLCA 3UPOA 1RGYA 1ZC2A 2BLSA 2J9OA 2VGKA 1CEGA 3O88A 5DTTA 3TSGA 4EBNA 3FZCA 1BSGA 2WK0A 3MXRA 5E43A 3SOIA 3PBOA 3ZG5A 2H0YA 1LHYA 1MPLA 3LCEA 3UO9A 2PBYA 1NZUA 1FCNA 1YLZA 4C75A 4YINA 3UN7A 3ZG8B 4Y0UA 3ZFZA 4CPKA 2X01A 4DE2A 2ZQDA 4KZ9A 3M2KA 5AQBA 5DTKA 4B88A 1IYPA 3EQVA 2H5SA 4OPZA 4IBRA 4U0XA 3LY3A 2XK1A 4QJGA 4KZ7A 4OKPA 1I2WA 1DJAA 4WYYA 4KZ6A 4BL2A 4UHUA 3GRJA 4UA7A 1PIOA 3LO7A 2WAEA 3C4OA 1S6RA 1L0FA 1N9BA 1RP5A 4KQQA 5FQIA 3UE0A 1ES3A 4JLFA 4RVAA 1DJBA 3NC8A 1QMEA 5HFOA 3Q82A 3N4IA 4EBPA 1H5XA 4JBFA 3C4PA 5FQKA 1Q2QA 3IXBA 4BD0A 3IF5A 5EOOA 3VOZA 4Q8IA 2ZD8A 2ZM8A 1MWUA 2XF3A 4X68A 3IHBA 3OCLA 4S2KA 4E6WA 1HD8A 4JKTA 4OOYA 4Y7PA 2ZLYA 1ERMA 4DDSA 1PZPA 3ZG9B 3IXDA 4S2JA 1W8YA 1Z6FA 1H8ZA 4EWFA 1I2SA 1K55C 1IELA 3OPRA 5CHJA 5EE8A 1Q2PA 3HL9A 2Y2MA 1LI0A 3GV9A 1ONHA 2BG1A 5EVLA 1W5DA 3G35A 1YT4A 3ZVTA 4GD8A 1QMFA 2CC1A 3MZEA 1YLJA 3HLGA 1XA1A 1BLHA 2XD5A 3IHAA 3OC2A 4WBGA 5G18A 4QY5A 2OLUA 2ZC5B 1M40A 1NYMA
chains in the Genus database with same CATH superfamily
4NK3A 1S4SA 2ZC3B 3SW1A 4NG2A 5CXWA 3T1RA 5GLAA 3SH8A 1YM1A 1ACFA 1BZAA 4FCFA 3UPPA 3PAGA 3VOLA 1GCEA 1KVLA 1LL5A 5HWTA 1FQGA 3C38A 5M19A 4H6JB 1TDLA 2WGVA 1JWZA 4M3KA 2G2WA 2O9BA 4ZRRA 1OMEA 2H28A 1BUEA 2W3EA 3BFFA 2XA7S 1DJCA 5K5BA 1BTLA 4PKYG 4Y13A 1E3UD 1JNUA 2M1CA 3BW6A 2ZQCA 4GKUA 2Q9NA 1WE4A 3MXQA 4X25A 1CI9A 1YLTA 3BY8A 2PD7A 3P09A 1S4RA 4X53A 4O7DA 2GDNA 2HV1A 1G28A 5F1GA 2ZOHA 2E8IA 4GDBA 2V1ZA 3M2JA 2VV7A 4QWOA 3KSIA 2EFXA 2PAVP 3QNBA 4MBFA 5EVID 3LFVA 5CEBA 4I38A 2QKPA 4PAUA 1GHIA 2Z2MB 3RH8B 2V0UA 2WGWB 3Q7VA 4U3TA 4G3WA 1BT5A 1CQAA 2EX6A 2L4RA 3EWKA 2GZAA 4E3IA 4GCZA 1TS0A 4R38A 3VP4A 5A8BA 4IVKA 1FILA 5D3OA 5FAPA 2P04A 2JE5A 3TG9A 1D06A 3BM6A 3PHYA 4LRYC 2V20A 3SH9A 5TGFA 2KOIA 3A3EA 5IU1A 1V9YA 3S7NA 3HBRA 3MZFA 1KGGA 4MLLA 5CEDA 1EI5A 1JWPA 1LL9A 4ZJ1A 4WN5A 2WUQA 4D60A 1LSVA 2ZMFA 3BFDA 3W4PA 2VJWA 3V3SA 4S2NC 5GLBA 3HLFA 4JGPA 4EQ1A 3IBRA 1K54C 4JGQA 1VHMA 2VKSA 2Y8HA 5FAOA 2W0NA 2Y2JA 1K25A 3LR3A 2Y59A 4B4ZA 1EW0A 5FDHA 2PDRA 4QY6A 5M18A 4UAAA 1GHMA 2V1AA 3CPTA 1KDWA 3NECA 2V8FA 5CHUA 3SS3A 4C6YA 5L09A 2OOLA 1SKOA 1KDSA 4WF0A 4P87A 3F1PB 1FCOA 2Z6DA 4NETA 1TF1A 4HP9A 1DP9A 3KYQA 5A90A 4FH4A 5DFXA 3W2ZA 5FQQA 5AQ9A 2HDQA 4L9GA 3CUEC 4DE1A 3S7PA 2UWXA 3BLSA 3PTEA 3PBSA 5M1AA 1VEUB 4PMAA 2FZ0A 5IT5A 3R4KA 3FPWA 1OPXA 4Q0IA 2HP5A 3DTKA 2PD8A 3MMHA 3HLCA 3T1SA 5CECA 3HUNA 2WGIA 3G4PA 2J8YA 1YMXA 3NIAA 3G2ZA 2HP9A 4OOLA 3T50A 1SCWA 2VK3A 3JYIA 5E2EA 3C2WA 3K3CA 5DKKA 3QNCA 3OPHA 3HLWA 3CHWP 2ZC4B 3H7WA 3C30A 4QPRA 1GSWA 4Q0HA 1K56A 5FEGA 4E3LA 3O5YA 3MJQA 4OPQA 4Y5FA 1S66L 4S2LA 4Y3IA 5F82A 3H82A 1PW8A 2V8CA 3PXPA 3UNWA 4NXBA 3D9YA 4KQOA 4Q0JA 3LI8A 1S1ZA 4DKIA 5HD5A 2Q9MA 3BFGA 1E3UA 2ZC7A 4OQHA 5FSRA 5DJUA 2XSSA 1DP8A 2V2FF 5DJTA 4IVIA 1N9OA 4L9EA 5FI2A 2P9VB 2OV5A 3UB9A 4JXSA 3T12B 3HREA 1W7FA 3BECA 2HZ5A 1ES2A 2Z6CA 4UA6A 3C8CA 4GS9A 4ZTKA 3K2NA 3N8SA 4XUXA 1GA9A 3E98A 4GB7A 2I9VA 3FYZA 4JF5A 4O8GA 3NY4A 3MKEA 4B4XA 4ESPA 1SDEA 5KZHA 2EXBA 3VMAA 5F83A 3C5AA 3KSGA 4OPRA 2D01A 4JF4A 3VFHA 1IKGA 3FWLA 3UPOA 2BLSA 4EBNA 3TSGA 3L7HA 1BSGA 3MXRA 1MPLA 2FH5A 3UN7A 3OLOA 1Y4OA 4DE2A 5AQBA 4B88A 2H5SA 4U0XA 3LY3A 3LEQA 4QJGA 1I2WA 1DJAA 4KZ6A 2WAEA 1N9BA 1RP5A 4HNBA 3NC8A 5J7EA 3Q82A 5HSQA 3IXBA 2PHYA 3IF5A 4Q8IA 2ZD8A 1NLZA 3CITA 3IHBA 4II7A 1HD8A 4Y7PA 2VX8A 1ERMA 1UWNX 3ZG9B 3IXDA 4EWFA 1K55C 1IELA 1Q2PA 3CPTB 2BG1A 3CAXA 3G35A 1TS6A 1SKOB 4GD8A 1QMFA 1XA1A 1X0OA 3IHAA 4WBGA 3D72A 4JGRA 2VV6A 5CTMA 4CLCD 5L8MA 5HARA 3DWKA 4E3OA 3OOVA 4OQ0A 4BJPA 2ZQ8A 1HZOA 3TJZC 5JYOA 3VSKA 3LIBA 2NUTC 5FA7A 4O01A 3ZYTA 2GNXA 5DFYA 3ZCZA 2C5WB 4ZBEA 1YLYA 4PM9A 3TOIA 4B93A 1TS7A 3ITBA 4LGWA 3CG5A 4KENB 2W27A 4KUOA 2VA0A 1XFNA 2ZOIA 3GDIA 1N9NA 1F5MA 4MN5A 1E4DA 5EM1A 3H7WB 1YSQA 2RL3A 4R3JA 4ID4A 2PBDP 5I94A 3CWFA 4S2NA 3H82B 4U0TA 1K54A 2PR5A 4PM8A 3PBNA 3T4TA 4KG5A 4A5RA 1IYOA 3RTYA 1DY6A 3O86A 1K6SA 1MY8A 1PWGA 3I7JA 3WS0A 2WKPA 3GSGA 2P74A 4DRTA 3IH9A 1MKMA 3T4QA 5I5LA 4FH2A 4WL9A 3WS4A 4YOFA 2XFTA 3UB5P 3CUEA 4JXGA 3H9WA 4N1XA 3UDIA 1MC0A 2J3WA 2RCXA 5A93A 1OTIA 4RX3A 5AVEA 1TEMA 5EVIB 4D2OA 3HUMA 3OPPA 3OZHA 3LEZA 3DTEA 5EVIC 4IHQA 3HLDA 4NXEA 2B18A 2B95A 3KO6A 2XQZA 1YLPA 5CX7A 4P0MA 1FCMA 1MWSA 4HJ4A 2OWJA 5DF7A 3CZDA 3F1OA 5HAQA 4M4XA 2X71A 3IF6B 3PAEA 4RYEA 4ARZB 4DJ3A 2WKQA 3IF6C 4HBTA 3VP1A 3ZGAB 3EEHA 1F98A 2UV0E 3RFBA 5GHZA 3FPVA 1OJGA 2EA9A 1XKZA 3O3VA 3SH7A 3NI9A 4NEED 2K2NA 4UEYA 3LYXA 5EUAA 1NRFA 4WMCA 3W4QA 1CF0A 4E3NA 1PFLA 2BTFP 2W3GA 4E3KA 2IWCA 4HESA 2VLGA 2LB9A 2XDMA 4X56A 2JC7A 2PYPA 2P9VA 2NUPC 2W1TA 5KSCA 3B3XA 2JKTI 1T18A 4HOIA 2W1RA 4NXGA 3DBAA 2PT7A 2QZ6A 3SZTA 4OVDA 3D3OA 2JKRI 3N7WA 4G3KA 1ZKJA 5AQAA 1VETA 3Q81A 3U2AA 3S22A 2R9XA 1S0WA 3HVFA 4GHIA 4ME4A 3WRTA 1GA0A 1ES4A 3IWIA 3PYPA 3LUQA 4MBKA 1OTDA 2O0YA 3ZHHA 2V1BA 4I3JA 1KE3A 1MWTA 1P9WA 2ACGA 4ETZA 1KOUA 5EECA 3JPUA 4YNRA 3A0VA 4WZ5C 3IX8A 2VV8A 1OJ5A 1MBLA 4I3AA 4OQIA 5JYPA 4MN6A 1HLUP 1PW1A 5E2HA 1PI5A 4GLQA 2H10A 2A24B 3UE6A 4Y17A 2XROA 4OQGA 2Y2PA 3N8RA 5CRFA 3ICYA 1MXOA 2CMNA 5F1FA 1FIKA 2QJ5A 3HLBA 2IWDA 2HGVA 1H8YA 2R78A 2JKFA 3LY4A 3NDEA 1H0MA 3PR6A 1K38A 5HL6A 3QP2A 2HDRA 4GD6A 4OONA 4Y0TA 2XLNA 2PR6A 3VP2A 3WS2A 2WYXA 2QYBA 3UE1A 1E25A 1M6KA 2JHEA 4I3IA 1P97A 4BBUA 4X1MA 2XR0A 2VGLM 4R0QA 1K55A 1P9RA 2ZM2A 2QJ7A 2IWBA 5F68A 4E3JA 5GLCA 5TFQA 1J9MA 4BENA 3IBJA 3BFCA 3SS4A 3LIAA 3PBTA 3GVBA 1H3QA 5EVEA 2WKEA 5HX9A 3S1YA 1NJ4A 4N92A 3GR2A 2JBFA 5E2FA 3V67A 1KE4A 3BY9A 4OLDA 4RX2A 3OCNA 5A92A 2G7UA 1JVJA 3ZG7B 2A49A 3UB7A 3M6BA 3FC7A 5TR7A 3NOPC 4WLAA 5CGXA 3BFEA 1ZHHB 5C5KA 4LCMA 4JF6A 3NOUC 1TD5A 1BLCA 4Y2FA 1RGYA 2VGKA 3LGOA 3FZCA 5E43A 1YKDA 3PBOA 2L0WA 1LHYA 3NJAA 4PKYA 4EXOA 3NOTC 3UO9A 3ULFA 1YLZA 4C75A 3ZG8B 3ZFZA 2JKTM 4CPKA 2ZQDA 1IYPA 2DMWA 2LB5A 4HHDA 3C4OA 3F1OB 2JKRM 4G3VA 4RVAA 3EGXC 3N4IA 4EBPA 1H5XA 4JBFA 3C4PA 5FQKA 1Q2QA 5L10A 4X68A 2W3FA 4O0PA 1LSWA 2KDKA 2ZLYA 4Z1WA 1PZPA 1W63Q 4S2JA 1I2SA 2V9AA 3GV9A 4EU0A 3EOIA 4HIAA 2CC1A 3MZEA 2XD5A 4KQDA 4QY5A 1PWCA 4GNUA 4BBTA 4R4SA 4MBHA 3VFFA 1WYCA 5EFWA 4JGOA 1SKFA 4IBXA 2W1TB 1C3BA 5CGSA 1TVFA 3A3JA 2Y2IA 4UQIM 2ZQ9A 4PHTA 4S2OA 5E2GA 1KVMA 5EPHA 1LI9A 4R3BA 4EUZA 3WS5A 2XGNA 4EBLA 4E3MA 1H8MA 1XGIA 3A0RA 1VETB 2ZMVA 4HH2A 1V9ZA 3Q07A 4GHIB 3JVUA 4R3AA 3LIEA 1ONGA 4CLCC 4BMWA 3KX0X 1LT0A 5EVIA 4HJ6A 3NHQA 4OPYA 3MZDA 1P0ZA 5AQ7A 4OLGA 2Y79A 4K0WA 3DWZA 1IYQA 2ZQ7A 4XUZA 1YMSA 4MCWA 3MQOA 5GLDA 2OAP1 3Q7ZA 3BLMA 4FD8A 4H8RA 4QB8A 2G2UA 3BWLA 3IWQA 2J3TD 5MC7A 5FATA 3IF6A 3M6HA 3ZNTA 2OWHA 2QMIA 4ARZA 3G6OA 3MQ0A 1ES5A 3T4LA 2ZJ9A 3IXHA 4Y0OA 4EETB 1XGJA 2HJEA 2P7JA 3NULA 3MF0A 4PM7A 3N8LA 2HDSA 4DF6A 3VSLA 1SDNA 2HDUA 1IFQA 3VOYA 5AVFA 3FG8A 2EX2A 1PRQA 2E8JA 2WZZA 3VE4A 3DTMA 1MWRA 5HWVA 3LR5A 3UE3A 3WS1A 2HPBA 3OPLA 3ZG0A 3V5MA 2Y2QA 3CMZA 2QPNA 3T4KA 2PRFA 1L0EA 2XD1A 1T1CA 2ZC6B 1ODVA 4FSFA 1CI8A 4EERA 4PPRA 4MDZA 2GJ3A 1PZOA 3LICA 3Q1FA 5HD3A 4HY8A 3F1NB 1NWZA 1CJFA 2O99A 5HPIA 3UDXA 5HDSA 4IEDA 1WYBA 2HP6A 2WAFA 1SHVA 3MR0A 1UGUA 1STZA 2ZBBA 3QP8A 2ZM0A 3D4FA 3QP1A 1F9IA 2K31A 3QP5A 3P7NA 5HW3A 3C7VA 4HBUA 4WZ5A 5A91A 5FASA 5GHXA 1I5QA 3NDGA 4EESA 4OOMA 3A0SA 4P6BA 3BYDA 2IA2A 4HJ3A 1W8QA 3GTCA 1CK3A 3V3RA 4RQ9A 1N4OA 5L07A 1EWZA 1T1AA 1MKIA 2EX9A 5J4EA 4P6ZM 3IXGA 2A24A 1K57C 3MKFA 4L0LA 4XXRA 3RJUA 1ESUA 3LIFA 3B42A 4F94A 4KZ4A 5G4ZA 2PU4A 3UDFA 1AWIA 4KG6A 3BQAA 4N9LA 3MQQA 1TDGA 4N1HA 3R7WA 2JKGA 1ZG6A 1IOUA 4ZJ2A 1PI4A 4JXWA 3MBZA 4EUVA 5F6AA 5J8XA 4LLOB 2ZQAA 1G68A 3MFXA 2DNSA 1FR6A 2Y2GA 4HEFA 2R9WA 5DF8A 4LFUA 3G30A 2EWVA 4P6ZS 5L2FA 5HL1A 3HLEA 3IX3A 1VM1A 1FR1A 3OBFA 4QU3A 1VQQA 4S2MA 4NXFA 3UY6A 5HZHA 3ZNYA 3AGEA 3UMEA 4OP5A 4K0XA 1S1YA 5CTNA 3U4LP 3TW8A 3C7UA 4F3LA 3L9KA 5FQMA 5DVAA 1EROA 1IYSA 1XJ2A 1RCJA 5FQJA 5IHVA 2Y4AA 3IS2B 1JWVA 4YWZA 2J9PA 3KYZA 2O9CA 3DTIA 1O07A 4BD1A 3A3DA 3FKWA 2W3HA 3T4SA 3EGDC 5CGWA 4KG2A 2DCFA 4KZBA 4E6XA 4R1GA 3EEAA 2WKHA 3W4OA 5AJGA 3UPNA 1O7EA 3T4OA 2Q0OA 3ITAA 1W79A 2XA7M 3E2LA 2Y2OA 1DRMA 1RGZA 2H0TA 3NBLA 1FOFA 4OP8A 3UMDA 3JVVA 4XT2A 4KZ5A 5FAQA 1K56D 1Z09A 2Y2LA 1ALQA 5DF9A 4X1LA 3VP3A 4PM6A 4LENA 1G5UA 4KZ3A 3AGFA 3HJKA 1LLBA 5DKLA 1GSXA 4NKPA 5KMWA 3IWOA 3E4PA 4BL3A 4R4RA 2M7VA 2VGJA 4KZ8A 3BQ8A 4WELA 3IQAA 4JXVA 1JTGA 3G34A 3HCYA 1XJ6A 1ZC2A 2J9OA 3LI9A 3O88A 3S7QA 2H0YA 4EEPA 1NZUA 1FCNA 1D7EA 4CLCA 1YSPA 5DTKA 3EQVA 4OPZA 2XK1A 4OKPA 3GRJA 1SZVA 3VV4A 4MMNA 1L0FA 1VB6A 2YKFA 4KQQA 5FQIA 3UE0A 4FTXA 5HFOA 3ZQ5A 3VOZA 2ZM8A 1MWUA 1K0KA 2XF3A 3OCLA 4R70A 4S2KA 1XJ3A 4WUJA 4JKTA 4EW7A 5FEFA 1W8YA 1Z6FA 3HL9A 2Y2MA 1ONHA 5EVLA 2GX5A 2ZL1A 1YT4A 1OT9A 3E4OA 5HDCA 3ZVTA 1YLJA 1BYWA 5G18A 2ZC5B 3R7WB 3EQUA 3V39A 1AXBA 2INWA 4I5SA 5FQ9A 1T19A 2EXAA 2EX8A 5LBRA 3RXWA 4DE3A 1NXYA 4KZAA 3QP6A 2J80A 4WZ4A 3G2YA 1XA7A 3LR0A 2PU2A 4GDNA 1ZTUA 4EV4A 4HH3A 3FV7A 2QWSA 2J7VA 2Y2HA 1G6AA 1ZG4A 3MS6A 4LV1A 4Y15A 2D02A 3MXSA 5F69A 4X55A 3UB8A 2XH9A 4KUKA 4X69A 1ESIA 1XXMA 3QHYA 4MNRA 1LL8A 3GMWA 3F1NA 4DJ2A 2DRWA 3WRZA 2AVXA 4F3LB 1W63M 2Y2NA 1CEFA 1XPBA 3AGDA 2VGLS 3WWXA 3G31A 3IH8A 4KQRA 4HQAA 1L3LA 4QHCA 2XFSA 3T1QB 4N9KA 4LPZA 1BULA 3BRMA 1MZUA 1OT6A 4ETXA 3IX4A 4DN0A 4IUKA 3A3FA 3A3IA 4E04A 5F5YA 3HJIA 1K57A 3VP0A 2FFYA 4GN2A 4UA9A 3ISGA 1U60A 1BLSA 1KGFA 2JN7A 2KX6A 1YQSA 3G32A 3V50A 2EFUA 4DMZA 4XT2B 4BBVA 4L9FA 3O87A 2B5RA 4S2IA 3TE8A 1JTDA 2J3TC 2M7UA 4ZJ3A 4R6LA 4DDYA 4WEKA 2WKRA 4WEJA 5DTSA 4ZDXA 4GZBA 2Z2LB 1FSWA 1T1BA 1ERQA 3B47A 2A2LA 5KIZA 1Y54A 1L0GA 1N9LA 2Y2KA 3GECA 2VEAA 1G6OA 5BOHA 1NYYA 3BEBA 3DAVA 5HAPA 1LSXA 2KLIA 4CJNA 4HI4A 4JPMA 1IEMA 4BQMA 3UB6A 3VE3A 4LV2A 3T4JA 3HUOA 4CLCB 5U47A 5FDSA 1NY0A 1K6RA 3IT9A 4LV0A 2OSUA 5FL3A 4C3QA 3IS2A 5KSHA 1OTAA 4P85A 3CJMA 5TBMA 1BLPA 4UQIS 4FOFA 4MN7A 4IJGA 2C6WB 5GHYA 2JCHA 3E4QA 3PBQA 1PNEA 5EM0A 1NZOA 1K4FA 3Q7VB 2OAQ1 4PM5A 1XJ4A 4CLCE 3BJNA 2ZL1B 4R23A 4MEZA 3P98A 3CLOA 4OH0A 2Y55A 1GHPA 2WKIA 4S2PA 2P08A 3GQZA 4X6TA 4Z9QA 4H6JA 3N6IA 4CQHA 1OTBA 4GOGA 3MFDA 3B33A 3NCKA 2V0WA 2X02A 4LRXC 3RXXA 2ZMAA 2YKHA 1YLWA 4LV3A 4WMCD 5GL9A 2XRNA 1PYYA 2OLVA 3KSFA 2I72A 5G4YA 4IUHA 3E2KA 4GJ4A 1FSYA 1HTZA 1PWDA 5HWWA 5CERA 2WZXA 3PBRA 2A3UA 3T1XA 3TRCA 1DP6A 4YFMA 1XP4A 4DE0A 2B02A 3ZDJA 2QHKA 5HPFA 4BWIA 5FI6A 4ZAMA 4RA7A 1GSVA 2K7SA 5TJJA 3ZVWA 4DXCA 3LR4A 2XEPA 2L1MA 2FFFB 3P01A 3S7OA 2WADA 3K3DA 3MSHA 5CHMA 4BLMA 4I39A 5HAIA 1IKIA 5FI7A 4FUWA 2Y91A 1NLYA 2WGWA 3FKVA 1WA9A 4B9OA 5EOEA 3W8KA 2PYRA 4LCLA 2HJ9C 3CI6A 1XX2A 1J3WA 5EV0A 4QD4A 4EQIA 1D1JA 1A0KA 1HVBA 1KE0A 3KYEA 4LRZE 2W3DA 1K4EA 1L0DA 3S4XA 2VZWA 3DW0A 3SS5A 1S67L 4K91A 4GW9A 4DXBA 1KGEA 1L2SA 4WM9A 4HP4A 5DTTA 1CEGA 2WK0A 3SOIA 3ZG5A 3E0YA 1VEUA 1YAXA 3QP4A 3LCEA 2O9AA 2PBYA 2HF6A 4YINA 4Y0UA 2X01A 4KZ9A 3M2KA 1Y28A 4IBRA 1OTEA 4K08A 4KZ7A 4WYYA 5J3WA 5HDDA 4BL2A 4UHUA 4UA7A 1PIOA 3LO7A 1S6RA 1ES3A 4JLFA 2EWWA 1DJBA 1QMEA 4AFIA 3KSHA 4BD0A 5EOOA 2MJ6A 3F1PA 1NRJA 1XFQA 3LIDA 4E6WA 1YPRA 4OOYA 1F2KA 4EEUA 4DDSA 1H8ZA 5EE8A 3OPRA 5CHJA 5TBMB 1UWPX 1LI0A 1W5DA 4GS9B 1TS8A 3HLGA 1BLHA 3OC2A 2BASA 2OLUA 1M40A 1NYMA 5IS1A
chains in the Genus database with same CATH topology
3EQUA 4NK3A 5CTMA 5HARA 3V39A 1AXBA 2ZC3B 3DWKA 4E3OA 4OQ0A 5FQ9A 1PWCA 2EXAA 2EX8A 4GNUA 5CXWA 3RXWA 4BJPA 4R4SA 4DE3A 4MBHA 3VFFA 5GLAA 2ZQ8A 1NXYA 1YM1A 3SH8A 4KZAA 1BZAA 4FCFA 3G2YA 4WZ4A 1WYCA 1XA7A 1HZOA 3UPPA 1SKFA 4IBXA 5JYOA 3PAGA 1C3BA 5CGSA 1TVFA 3A3JA 2Y2IA 1GCEA 3VSKA 2PU2A 2ZQ9A 4GDNA 4S2OA 5E2GA 5FA7A 1KVLA 1LL5A 4EV4A 1KVMA 5EPHA 1LI9A 4R3BA 3FV7A 4EUZA 3WS5A 1FQGA 3ZCZA 2XGNA 4EBLA 2J7VA 4E3MA 5M19A 1XGIA 1G6AA 1TDLA 1ZG4A 2C5WB 2Y2HA 4LV1A 2WGVA 1JWZA 4M3KA 2G2WA 4ZBEA 3MXSA 1YLYA 1OMEA 4PM9A 4X55A 3TOIA 2XH9A 3Q07A 3ITBA 1BUEA 4X69A 1ONGA 1ESIA 3CG5A 1XXMA 4KENB 3BFFA 3QHYA 4MNRA 1DJCA 5EVIA 1BTLA 4OPYA 3GMWA 1E3UD 2DRWA 3MZDA 3WRZA 2ZQCA 2Y2NA 1CEFA 1E4DA 4GKUA 1XPBA 2Q9NA 1WE4A 5AQ7A 4OLGA 4K0WA 3AGDA 1CI9A 1YLTA 3DWZA 1IYQA 2ZQ7A 2RL3A 3WWXA 4R3JA 4XUZA 4ID4A 1YMSA 3G31A 3IH8A 3P09A 5GLDA 4KQRA 5I94A 4S2NA 3Q7ZA 4X53A 3BLMA 4O7DA 2GDNA 4FD8A 4H8RA 4QB8A 4U0TA 2G2UA 1K54A 5F1GA 3IWQA 4QHCA 2XFSA 5FATA 3IF6A 4N9KA 3M6HA 3ZNTA 2QMIA 4PM8A 1BULA 3BRMA 2E8IA 4GDBA 2V1ZA 3M2JA 3PBNA 3A3FA 1ES5A 3A3IA 2ZJ9A 4KG5A 3IXHA 4Y0OA 4A5RA 1IYOA 1XGJA 1K57A 3VP0A 2EFXA 2FFYA 1DY6A 4GN2A 3O86A 4UA9A 1K6SA 1MY8A 3ISGA 1U60A 1BLSA 3QNBA 4MBFA 5EVID 1KGFA 1PWGA 3I7JA 5CEBA 3WS0A 4PM7A 3GSGA 2P74A 4DRTA 3N8LA 2HDSA 4DF6A 1GHIA 3VSLA 1SDNA 1YQSA 2HDUA 3G32A 3IH9A 2Z2MB 3V50A 2EFUA 3VOYA 3O87A 2EX2A 2WGWB 3Q7VA 4U3TA 2B5RA 2WZZA 4S2IA 4FH2A 3DTMA 1BT5A 3WS4A 1MWRA 2EX6A 1JTDA 2XFTA 3UE3A 3WS1A 2HPBA 3OPLA 4E3IA 4JXGA 4ZJ3A 4DDYA 4WEKA 3VP4A 3ZG0A 3V5MA 2Y2QA 3CMZA 4N1XA 2QPNA 4WEJA 3UDIA 4IVKA 1L0EA 5DTSA 2XD1A 5D3OA 2ZC6B 5FAPA 2RCXA 4FSFA 4ZDXA 1CI8A 5A93A 4GZBA 4RX3A 2JE5A 2Z2LB 4PPRA 3TG9A 1TEMA 5EVIB 4D2OA 1FSWA 1PZOA 3BM6A 3HUMA 3Q1FA 3OPPA 1ERQA 2V20A 3SH9A 5TGFA 3OZHA 3LEZA 5EVIC 3HLDA 3A3EA 1Y54A 1L0GA 3UDXA 3HBRA 3MZFA 4IEDA 1KGGA 2Y2KA 1WYBA 2HP6A 2WAFA 4MLLA 5CEDA 1EI5A 1SHVA 1JWPA 2XQZA 5BOHA 1NYYA 1LL9A 1YLPA 3BEBA 4P0MA 1FCMA 1MWSA 5DF7A 5HAPA 4ZJ1A 2WUQA 3CZDA 2ZM0A 3D4FA 3BFDA 3W4PA 4CJNA 5HAQA 4JPMA 2X71A 4S2NC 5GLBA 3V3SA 1IEMA 3HLFA 3IF6B 3PAEA 4BQMA 5HW3A 3C7VA 4HBUA 4WZ5A 5A91A 5FASA 4RYEA 1K54C 1I5QA 4LV2A 3NDGA 5GHXA 3HUOA 3IF6C 4OOMA 5U47A 4HBTA 3VP1A 3ZGAB 4P6BA 5FAOA 2Y2JA 1K25A 3BYDA 1NY0A 1K6RA 1W8QA 3IT9A 4LV0A 2OSUA 2Y59A 3GTCA 1CK3A 3V3RA 4B4ZA 1N4OA 4C3QA 1EWZA 1MKIA 5GHZA 2EX9A 5KSHA 5FDHA 3IXGA 3MKFA 1K57C 4L0LA 4QY6A 4XXRA 4P85A 3CJMA 3RJUA 1BLPA 1ESUA 4UAAA 5M18A 1GHMA 1KDWA 1XKZA 3O3VA 5CHUA 3SS3A 4F94A 4KZ4A 3SH7A 3NI9A 2PU4A 3UDFA 4C6YA 4KG6A 1KDSA 4N9LA 2C6WB 4P87A 1FCOA 1TDGA 5GHYA 4N1HA 2JCHA 3PBQA 4NETA 5A90A 5EUAA 1NRFA 4WMCA 4FH4A 3W4QA 1NZOA 4E3NA 1K4FA 1ZG6A 3Q7VB 4ZJ2A 1PI4A 4JXWA 3MBZA 4E3KA 5J8XA 4PM5A 2IWCA 4HESA 2ZQAA 2XDMA 4X56A 5FQQA 5AQ9A 2HDQA 1G68A 2DNSA 2JC7A 4R23A 1FR6A 2Y2GA 4MEZA 2P9VA 3P98A 4HEFA 4DE1A 5KSCA 2UWXA 2R9WA 3B3XA 3BLSA 4OH0A 5DF8A 2Y55A 3PTEA 3PBSA 3G30A 5M1AA 1GHPA 5L2FA 2WKIA 5HL1A 4PMAA 3HLEA 4S2PA 2QZ6A 3GQZA 1VM1A 4X6TA 4OVDA 1FR1A 4Z9QA 3N6IA 2HP5A 3N7WA 1ZKJA 5AQAA 4GOGA 3HLCA 4QU3A 3MFDA 3Q81A 3NCKA 1VQQA 3S22A 5CECA 2R9XA 1S0WA 3HVFA 3HUNA 3WRTA 4S2MA 2WGIA 3G4PA 1GA0A 2X02A 2J8YA 1ES4A 1YMXA 3IWIA 3NIAA 3G2ZA 2HP9A 3UY6A 3RXXA 4OOLA 3ZNYA 1SCWA 2ZMAA 4MBKA 3AGEA 3ZHHA 3JYIA 4OP5A 4K0XA 5E2EA 1YLWA 4LV3A 4WMCD 1KE3A 1MWTA 1PYYA 2OLVA 5CTNA 2I72A 5GL9A 3C7UA 3QNCA 3E2KA 5EECA 5FQMA 3OPHA 3HLWA 5DVAA 1EROA 1IYSA 1FSYA 1HTZA 2ZC4B 4WZ5C 1K56A 1MBLA 1PWDA 1RCJA 5FQJA 4OQIA 5IHVA 4E3LA 5JYPA 5CERA 2WZXA 1PW1A 2Y4AA 3PBRA 1PI5A 5E2HA 4OPQA 2A3UA 4YFMA 1XP4A 4DE0A 1JWVA 4S2LA 5F82A 3ZDJA 2H10A 1PW8A 2J9PA 4OQGA 2Y2PA 1O07A 3N8RA 5FI6A 4BD1A 3A3DA 3FKWA 4RA7A 4ZAMA 5CRFA 3UNWA 5CGWA 4KG2A 1MXOA 2DCFA 4KQOA 4KZBA 4E6XA 4R1GA 5F1FA 4DKIA 2Q9MA 3BFGA 3HLBA 3ZVWA 4DXCA 2IWDA 1E3UA 2ZC7A 2WKHA 4OQHA 5FSRA 3W4OA 2XEPA 1H8YA 3UPNA 3LY4A 1O7EA 3NDEA 1K38A 2FFFB 2HDRA 3ITAA 4GD6A 1W79A 2WADA 3E2LA 4OONA 4Y0TA 2XLNA 2Y2OA 2V2FF 3VP2A 3WS2A 1RGZA 2WYXA 4IVIA 2H0TA 5FI2A 2P9VB 3NBLA 1E25A 1FOFA 1M6KA 4OP8A 5CHMA 3UE1A 4BLMA 2OV5A 5HAIA 4JXSA 1IKIA 5FI7A 2XR0A 2Y91A 3HREA 1W7FA 4R0QA 3BECA 1K55A 2ZM2A 4KZ5A 5FAQA 2WGWA 1K56D 3FKVA 2IWBA 4E3JA 5GLCA 2Y2LA 5TFQA 1J9MA 1ES2A 4BENA 1ALQA 3BFCA 5EOEA 3SS4A 3W8KA 4UA6A 5DF9A 3PBTA 3GVBA 2WKEA 5HX9A 4LCLA 4PM6A 1NJ4A 3S1YA 1XX2A 3VP3A 4LENA 4N92A 4KZ3A 4QD4A 4ZTKA 3GR2A 4EQIA 2JBFA 5E2FA 3AGFA 3N8SA 4XUXA 1KE4A 1GA9A 1HVBA 4OLDA 4GB7A 1LLBA 4RX2A 1KE0A 3OCNA 5A92A 3FYZA 4JF5A 1JVJA 5KMWA 3NY4A 3IWOA 2A49A 3ZG7B 3MKEA 4BL3A 3M6BA 4R4RA 4B4XA 5TR7A 1K4EA 1L0DA 1SDEA 2VGJA 2EXBA 3S4XA 5KZHA 4KZ8A 3VMAA 3DW0A 5CGXA 4WELA 3SS5A 3BFEA 5F83A 4K91A 3C5AA 3IQAA 4OPRA 4JXVA 4LCMA 4JF6A 4DXBA 4JF4A 1JTGA 1IKGA 1KGEA 1L2SA 3G34A 3VFHA 3FWLA 4WM9A 1BLCA 3UPOA 1RGYA 1ZC2A 2BLSA 2J9OA 2VGKA 1CEGA 3O88A 5DTTA 3TSGA 4EBNA 3FZCA 1BSGA 2WK0A 3MXRA 5E43A 3SOIA 3PBOA 3ZG5A 2H0YA 1LHYA 1MPLA 3LCEA 3UO9A 2PBYA 1NZUA 1FCNA 1YLZA 4C75A 4YINA 3UN7A 3ZG8B 4Y0UA 3ZFZA 4CPKA 2X01A 4DE2A 2ZQDA 4KZ9A 3M2KA 5AQBA 5DTKA 4B88A 1IYPA 3EQVA 2H5SA 4OPZA 4IBRA 4U0XA 3LY3A 2XK1A 4QJGA 4KZ7A 4OKPA 1I2WA 1DJAA 4WYYA 4KZ6A 4BL2A 4UHUA 3GRJA 4UA7A 1PIOA 3LO7A 2WAEA 3C4OA 1S6RA 1L0FA 1N9BA 1RP5A 4KQQA 5FQIA 3UE0A 1ES3A 4JLFA 4RVAA 1DJBA 3NC8A 1QMEA 5HFOA 3Q82A 3N4IA 4EBPA 1H5XA 4JBFA 3C4PA 5FQKA 1Q2QA 3IXBA 4BD0A 3IF5A 5EOOA 3VOZA 4Q8IA 2ZD8A 2ZM8A 1MWUA 2XF3A 4X68A 3IHBA 3OCLA 4S2KA 4E6WA 1HD8A 4JKTA 4OOYA 4Y7PA 2ZLYA 1ERMA 4DDSA 1PZPA 3ZG9B 3IXDA 4S2JA 1W8YA 1Z6FA 1H8ZA 4EWFA 1I2SA 1K55C 1IELA 3OPRA 5CHJA 5EE8A 1Q2PA 3HL9A 2Y2MA 1LI0A 3GV9A 1ONHA 2BG1A 5EVLA 1W5DA 3G35A 1YT4A 3ZVTA 4GD8A 1QMFA 2CC1A 3MZEA 1YLJA 3HLGA 1XA1A 1BLHA 2XD5A 3IHAA 3OC2A 4WBGA 5G18A 4QY5A 2OLUA 2ZC5B 1M40A 1NYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQU A;  4NK3 A;  5CTM A;  5HAR A;  3V39 A;  1AXB A;  2ZC3 B;  3DWK A;  4E3O A;  4OQ0 A;  5FQ9 A;  1PWC A;  2EXA A;  2EX8 A;  4GNU A;  5CXW A;  3RXW A;  4BJP A;  4R4S A;  4DE3 A;  4MBH A;  3VFF A;  5GLA A;  2ZQ8 A;  1NXY A;  1YM1 A;  3SH8 A;  4KZA A;  1BZA A;  4FCF A;  3G2Y A;  4WZ4 A;  1WYC A;  1XA7 A;  1HZO A;  3UPP A;  1SKF A;  4IBX A;  5JYO A;  3PAG A;  1C3B A;  5CGS A;  1TVF A;  3A3J A;  2Y2I A;  1GCE A;  3VSK A;  2PU2 A;  2ZQ9 A;  4GDN A;  4S2O A;  5E2G A;  5FA7 A;  1KVL A;  1LL5 A;  4EV4 A;  1KVM A;  5EPH A;  1LI9 A;  4R3B A;  3FV7 A;  4EUZ A;  3WS5 A;  1FQG A;  3ZCZ A;  2XGN A;  4EBL A;  2J7V A;  4E3M A;  5M19 A;  1XGI A;  1G6A A;  1TDL A;  1ZG4 A;  2C5W B;  2Y2H A;  4LV1 A;  2WGV A;  1JWZ A;  4M3K A;  2G2W A;  4ZBE A;  3MXS A;  1YLY A;  1OME A;  4PM9 A;  4X55 A;  3TOI A;  2XH9 A;  3Q07 A;  3ITB A;  1BUE A;  4X69 A;  1ONG A;  1ESI A;  3CG5 A;  1XXM A;  4KEN B;  3BFF A;  3QHY A;  4MNR A;  1DJC A;  5EVI A;  1BTL A;  4OPY A;  3GMW A;  1E3U D;  2DRW A;  3MZD A;  3WRZ A;  2ZQC A;  2Y2N A;  1CEF A;  1E4D A;  4GKU A;  1XPB A;  2Q9N A;  1WE4 A;  5AQ7 A;  4OLG A;  4K0W A;  3AGD A;  1CI9 A;  1YLT A;  3DWZ A;  1IYQ A;  2ZQ7 A;  2RL3 A;  3WWX A;  4R3J A;  4XUZ A;  4ID4 A;  1YMS A;  3G31 A;  3IH8 A;  3P09 A;  5GLD A;  4KQR A;  5I94 A;  4S2N A;  3Q7Z A;  4X53 A;  3BLM A;  4O7D A;  2GDN A;  4FD8 A;  4H8R A;  4QB8 A;  4U0T A;  2G2U A;  1K54 A;  5F1G A;  3IWQ A;  4QHC A;  2XFS A;  5FAT A;  3IF6 A;  4N9K A;  3M6H A;  3ZNT A;  2QMI A;  4PM8 A;  1BUL A;  3BRM A;  2E8I A;  4GDB A;  2V1Z A;  3M2J A;  3PBN A;  3A3F A;  1ES5 A;  3A3I A;  2ZJ9 A;  4KG5 A;  3IXH A;  4Y0O A;  4A5R A;  1IYO A;  1XGJ A;  1K57 A;  3VP0 A;  2EFX A;  2FFY A;  1DY6 A;  4GN2 A;  3O86 A;  4UA9 A;  1K6S A;  1MY8 A;  3ISG A;  1U60 A;  1BLS A;  3QNB A;  4MBF A;  5EVI D;  1KGF A;  1PWG A;  3I7J A;  5CEB A;  3WS0 A;  4PM7 A;  3GSG A;  2P74 A;  4DRT A;  3N8L A;  2HDS A;  4DF6 A;  1GHI A;  3VSL A;  1SDN A;  1YQS A;  2HDU A;  3G32 A;  3IH9 A;  2Z2M B;  3V50 A;  2EFU A;  3VOY A;  3O87 A;  2EX2 A;  2WGW B;  3Q7V A;  4U3T A;  2B5R A;  2WZZ A;  4S2I A;  4FH2 A;  3DTM A;  1BT5 A;  3WS4 A;  1MWR A;  2EX6 A;  1JTD A;  2XFT A;  3UE3 A;  3WS1 A;  2HPB A;  3OPL A;  4E3I A;  4JXG A;  4ZJ3 A;  4DDY A;  4WEK A;  3VP4 A;  3ZG0 A;  3V5M A;  2Y2Q A;  3CMZ A;  4N1X A;  2QPN A;  4WEJ A;  3UDI A;  4IVK A;  1L0E A;  5DTS A;  2XD1 A;  5D3O A;  2ZC6 B;  5FAP A;  2RCX A;  4FSF A;  4ZDX A;  1CI8 A;  5A93 A;  4GZB A;  4RX3 A;  2JE5 A;  2Z2L B;  4PPR A;  3TG9 A;  1TEM A;  5EVI B;  4D2O A;  1FSW A;  1PZO A;  3BM6 A;  3HUM A;  3Q1F A;  3OPP A;  1ERQ A;  2V20 A;  3SH9 A;  5TGF A;  3OZH A;  3LEZ A;  5EVI C;  3HLD A;  3A3E A;  1Y54 A;  1L0G A;  3UDX A;  3HBR A;  3MZF A;  4IED A;  1KGG A;  2Y2K A;  1WYB A;  2HP6 A;  2WAF A;  4MLL A;  5CED A;  1EI5 A;  1SHV A;  1JWP A;  2XQZ A;  5BOH A;  1NYY A;  1LL9 A;  1YLP A;  3BEB A;  4P0M A;  1FCM A;  1MWS A;  5DF7 A;  5HAP A;  4ZJ1 A;  2WUQ A;  3CZD A;  2ZM0 A;  3D4F A;  3BFD A;  3W4P A;  4CJN A;  5HAQ A;  4JPM A;  2X71 A;  4S2N C;  5GLB A;  3V3S A;  1IEM A;  3HLF A;  3IF6 B;  3PAE A;  4BQM A;  5HW3 A;  3C7V A;  4HBU A;  4WZ5 A;  5A91 A;  5FAS A;  4RYE A;  1K54 C;  1I5Q A;  4LV2 A;  3NDG A;  5GHX A;  3HUO A;  3IF6 C;  4OOM A;  5U47 A;  4HBT A;  3VP1 A;  3ZGA B;  4P6B A;  5FAO A;  2Y2J A;  1K25 A;  3BYD A;  1NY0 A;  1K6R A;  1W8Q A;  3IT9 A;  4LV0 A;  2OSU A;  2Y59 A;  3GTC A;  1CK3 A;  3V3R A;  4B4Z A;  1N4O A;  4C3Q A;  1EWZ A;  1MKI A;  5GHZ A;  2EX9 A;  5KSH A;  5FDH A;  3IXG A;  3MKF A;  1K57 C;  4L0L A;  4QY6 A;  4XXR A;  4P85 A;  3CJM A;  3RJU A;  1BLP A;  1ESU A;  4UAA A;  5M18 A;  1GHM A;  1KDW A;  1XKZ A;  3O3V A;  5CHU A;  3SS3 A;  4F94 A;  4KZ4 A;  3SH7 A;  3NI9 A;  2PU4 A;  3UDF A;  4C6Y A;  4KG6 A;  1KDS A;  4N9L A;  2C6W B;  4P87 A;  1FCO A;  1TDG A;  5GHY A;  4N1H A;  2JCH A;  3PBQ A;  4NET A;  5A90 A;  5EUA A;  1NRF A;  4WMC A;  4FH4 A;  3W4Q A;  1NZO A;  4E3N A;  1K4F A;  1ZG6 A;  3Q7V B;  4ZJ2 A;  1PI4 A;  4JXW A;  3MBZ A;  4E3K A;  5J8X A;  4PM5 A;  2IWC A;  4HES A;  2ZQA A;  2XDM A;  4X56 A;  5FQQ A;  5AQ9 A;  2HDQ A;  1G68 A;  2DNS A;  2JC7 A;  4R23 A;  1FR6 A;  2Y2G A;  4MEZ A;  2P9V A;  3P98 A;  4HEF A;  4DE1 A;  5KSC A;  2UWX A;  2R9W A;  3B3X A;  3BLS A;  4OH0 A;  5DF8 A;  2Y55 A;  3PTE A;  3PBS A;  3G30 A;  5M1A A;  1GHP A;  5L2F A;  2WKI A;  5HL1 A;  4PMA A;  3HLE A;  4S2P A;  2QZ6 A;  3GQZ A;  1VM1 A;  4X6T A;  4OVD A;  1FR1 A;  4Z9Q A;  3N6I A;  2HP5 A;  3N7W A;  1ZKJ A;  5AQA A;  4GOG A;  3HLC A;  4QU3 A;  3MFD A;  3Q81 A;  3NCK A;  1VQQ A;  3S22 A;  5CEC A;  2R9X A;  1S0W A;  3HVF A;  3HUN A;  3WRT A;  4S2M A;  2WGI A;  3G4P A;  1GA0 A;  2X02 A;  2J8Y A;  1ES4 A;  1YMX A;  3IWI A;  3NIA A;  3G2Z A;  2HP9 A;  3UY6 A;  3RXX A;  4OOL A;  3ZNY A;  1SCW A;  2ZMA A;  4MBK A;  3AGE A;  3ZHH A;  3JYI A;  4OP5 A;  4K0X A;  5E2E A;  1YLW A;  4LV3 A;  4WMC D;  1KE3 A;  1MWT A;  1PYY A;  2OLV A;  5CTN A;  2I72 A;  5GL9 A;  3C7U A;  3QNC A;  3E2K A;  5EEC A;  5FQM A;  3OPH A;  3HLW A;  5DVA A;  1ERO A;  1IYS A;  1FSY A;  1HTZ A;  2ZC4 B;  4WZ5 C;  1K56 A;  1MBL A;  1PWD A;  1RCJ A;  5FQJ A;  4OQI A;  5IHV A;  4E3L A;  5JYP A;  5CER A;  2WZX A;  1PW1 A;  2Y4A A;  3PBR A;  1PI5 A;  5E2H A;  4OPQ A;  2A3U A;  4YFM A;  1XP4 A;  4DE0 A;  1JWV A;  4S2L A;  5F82 A;  3ZDJ A;  2H10 A;  1PW8 A;  2J9P A;  4OQG A;  2Y2P A;  1O07 A;  3N8R A;  5FI6 A;  4BD1 A;  3A3D A;  3FKW A;  4RA7 A;  4ZAM A;  5CRF A;  3UNW A;  5CGW A;  4KG2 A;  1MXO A;  2DCF A;  4KQO A;  4KZB A;  4E6X A;  4R1G A;  5F1F A;  4DKI A;  2Q9M A;  3BFG A;  3HLB A;  3ZVW A;  4DXC A;  2IWD A;  1E3U A;  2ZC7 A;  2WKH A;  4OQH A;  5FSR A;  3W4O A;  2XEP A;  1H8Y A;  3UPN A;  3LY4 A;  1O7E A;  3NDE A;  1K38 A;  2FFF B;  2HDR A;  3ITA A;  4GD6 A;  1W79 A;  2WAD A;  3E2L A;  4OON A;  4Y0T A;  2XLN A;  2Y2O A;  2V2F F;  3VP2 A;  3WS2 A;  1RGZ A;  2WYX A;  4IVI A;  2H0T A;  5FI2 A;  2P9V B;  3NBL A;  1E25 A;  1FOF A;  1M6K A;  4OP8 A;  5CHM A;  3UE1 A;  4BLM A;  2OV5 A;  5HAI A;  4JXS A;  1IKI A;  5FI7 A;  2XR0 A;  2Y91 A;  3HRE A;  1W7F A;  4R0Q A;  3BEC A;  1K55 A;  2ZM2 A;  4KZ5 A;  5FAQ A;  2WGW A;  1K56 D;  3FKV A;  2IWB A;  4E3J A;  5GLC A;  2Y2L A;  5TFQ A;  1J9M A;  1ES2 A;  4BEN A;  1ALQ A;  3BFC A;  5EOE A;  3SS4 A;  3W8K A;  4UA6 A;  5DF9 A;  3PBT A;  3GVB A;  2WKE A;  5HX9 A;  4LCL A;  4PM6 A;  1NJ4 A;  3S1Y A;  1XX2 A;  3VP3 A;  4LEN A;  4N92 A;  4KZ3 A;  4QD4 A;  4ZTK A;  3GR2 A;  4EQI A;  2JBF A;  5E2F A;  3AGF A;  3N8S A;  4XUX A;  1KE4 A;  1GA9 A;  1HVB A;  4OLD A;  4GB7 A;  1LLB A;  4RX2 A;  1KE0 A;  3OCN A;  5A92 A;  3FYZ A;  4JF5 A;  1JVJ A;  5KMW A;  3NY4 A;  3IWO A;  2A49 A;  3ZG7 B;  3MKE A;  4BL3 A;  3M6B A;  4R4R A;  4B4X A;  5TR7 A;  1K4E A;  1L0D A;  1SDE A;  2VGJ A;  2EXB A;  3S4X A;  5KZH A;  4KZ8 A;  3VMA A;  3DW0 A;  5CGX A;  4WEL A;  3SS5 A;  3BFE A;  5F83 A;  4K91 A;  3C5A A;  3IQA A;  4OPR A;  4JXV A;  4LCM A;  4JF6 A;  4DXB A;  4JF4 A;  1JTG A;  1IKG A;  1KGE A;  1L2S A;  3G34 A;  3VFH A;  3FWL A;  4WM9 A;  1BLC A;  3UPO A;  1RGY A;  1ZC2 A;  2BLS A;  2J9O A;  2VGK A;  1CEG A;  3O88 A;  5DTT A;  3TSG A;  4EBN A;  3FZC A;  1BSG A;  2WK0 A;  3MXR A;  5E43 A;  3SOI A;  3PBO A;  3ZG5 A;  2H0Y A;  1LHY A;  1MPL A;  3LCE A;  3UO9 A;  2PBY A;  1NZU A;  1FCN A;  1YLZ A;  4C75 A;  4YIN A;  3UN7 A;  3ZG8 B;  4Y0U A;  3ZFZ A;  4CPK A;  2X01 A;  4DE2 A;  2ZQD A;  4KZ9 A;  3M2K A;  5AQB A;  5DTK A;  4B88 A;  1IYP A;  3EQV A;  2H5S A;  4OPZ A;  4IBR A;  4U0X A;  3LY3 A;  2XK1 A;  4QJG A;  4KZ7 A;  4OKP A;  1I2W A;  1DJA A;  4WYY A;  4KZ6 A;  4BL2 A;  4UHU A;  3GRJ A;  4UA7 A;  1PIO A;  3LO7 A;  2WAE A;  3C4O A;  1S6R A;  1L0F A;  1N9B A;  1RP5 A;  4KQQ A;  5FQI A;  3UE0 A;  1ES3 A;  4JLF A;  4RVA A;  1DJB A;  3NC8 A;  1QME A;  5HFO A;  3Q82 A;  3N4I A;  4EBP A;  1H5X A;  4JBF A;  3C4P A;  5FQK A;  1Q2Q A;  3IXB A;  4BD0 A;  3IF5 A;  5EOO A;  3VOZ A;  4Q8I A;  2ZD8 A;  2ZM8 A;  1MWU A;  2XF3 A;  4X68 A;  3IHB A;  3OCL A;  4S2K A;  4E6W A;  1HD8 A;  4JKT A;  4OOY A;  4Y7P A;  2ZLY A;  1ERM A;  4DDS A;  1PZP A;  3ZG9 B;  3IXD A;  4S2J A;  1W8Y A;  1Z6F A;  1H8Z A;  4EWF A;  1I2S A;  1K55 C;  1IEL A;  3OPR A;  5CHJ A;  5EE8 A;  1Q2P A;  3HL9 A;  2Y2M A;  1LI0 A;  3GV9 A;  1ONH A;  2BG1 A;  5EVL A;  1W5D A;  3G35 A;  1YT4 A;  3ZVT A;  4GD8 A;  1QMF A;  2CC1 A;  3MZE A;  1YLJ A;  3HLG A;  1XA1 A;  1BLH A;  2XD5 A;  3IHA A;  3OC2 A;  4WBG A;  5G18 A;  4QY5 A;  2OLU A;  2ZC5 B;  1M40 A;  1NYM A; 
#chains in the Genus database with same CATH topology
 4NK3 A;  1S4S A;  2ZC3 B;  3SW1 A;  4NG2 A;  5CXW A;  3T1R A;  5GLA A;  3SH8 A;  1YM1 A;  1ACF A;  1BZA A;  4FCF A;  3UPP A;  3PAG A;  3VOL A;  1GCE A;  1KVL A;  1LL5 A;  5HWT A;  1FQG A;  3C38 A;  5M19 A;  4H6J B;  1TDL A;  2WGV A;  1JWZ A;  4M3K A;  2G2W A;  2O9B A;  4ZRR A;  1OME A;  2H28 A;  1BUE A;  2W3E A;  3BFF A;  2XA7 S;  1DJC A;  5K5B A;  1BTL A;  4PKY G;  4Y13 A;  1E3U D;  1JNU A;  2M1C A;  3BW6 A;  2ZQC A;  4GKU A;  2Q9N A;  1WE4 A;  3MXQ A;  4X25 A;  1CI9 A;  1YLT A;  3BY8 A;  2PD7 A;  3P09 A;  1S4R A;  4X53 A;  4O7D A;  2GDN A;  2HV1 A;  1G28 A;  5F1G A;  2ZOH A;  2E8I A;  4GDB A;  2V1Z A;  3M2J A;  2VV7 A;  4QWO A;  3KSI A;  2EFX A;  2PAV P;  3QNB A;  4MBF A;  5EVI D;  3LFV A;  5CEB A;  4I38 A;  2QKP A;  4PAU A;  1GHI A;  2Z2M B;  3RH8 B;  2V0U A;  2WGW B;  3Q7V A;  4U3T A;  4G3W A;  1BT5 A;  1CQA A;  2EX6 A;  2L4R A;  3EWK A;  2GZA A;  4E3I A;  4GCZ A;  1TS0 A;  4R38 A;  3VP4 A;  5A8B A;  4IVK A;  1FIL A;  5D3O A;  5FAP A;  2P04 A;  2JE5 A;  3TG9 A;  1D06 A;  3BM6 A;  3PHY A;  4LRY C;  2V20 A;  3SH9 A;  5TGF A;  2KOI A;  3A3E A;  5IU1 A;  1V9Y A;  3S7N A;  3HBR A;  3MZF A;  1KGG A;  4MLL A;  5CED A;  1EI5 A;  1JWP A;  1LL9 A;  4ZJ1 A;  4WN5 A;  2WUQ A;  4D60 A;  1LSV A;  2ZMF A;  3BFD A;  3W4P A;  2VJW A;  3V3S A;  4S2N C;  5GLB A;  3HLF A;  4JGP A;  4EQ1 A;  3IBR A;  1K54 C;  4JGQ A;  1VHM A;  2VKS A;  2Y8H A;  5FAO A;  2W0N A;  2Y2J A;  1K25 A;  3LR3 A;  2Y59 A;  4B4Z A;  1EW0 A;  5FDH A;  2PDR A;  4QY6 A;  5M18 A;  4UAA A;  1GHM A;  2V1A A;  3CPT A;  1KDW A;  3NEC A;  2V8F A;  5CHU A;  3SS3 A;  4C6Y A;  5L09 A;  2OOL A;  1SKO A;  1KDS A;  4WF0 A;  4P87 A;  3F1P B;  1FCO A;  2Z6D A;  4NET A;  1TF1 A;  4HP9 A;  1DP9 A;  3KYQ A;  5A90 A;  4FH4 A;  5DFX A;  3W2Z A;  5FQQ A;  5AQ9 A;  2HDQ A;  4L9G A;  3CUE C;  4DE1 A;  3S7P A;  2UWX A;  3BLS A;  3PTE A;  3PBS A;  5M1A A;  1VEU B;  4PMA A;  2FZ0 A;  5IT5 A;  3R4K A;  3FPW A;  1OPX A;  4Q0I A;  2HP5 A;  3DTK A;  2PD8 A;  3MMH A;  3HLC A;  3T1S A;  5CEC A;  3HUN A;  2WGI A;  3G4P A;  2J8Y A;  1YMX A;  3NIA A;  3G2Z A;  2HP9 A;  4OOL A;  3T50 A;  1SCW A;  2VK3 A;  3JYI A;  5E2E A;  3C2W A;  3K3C A;  5DKK A;  3QNC A;  3OPH A;  3HLW A;  3CHW P;  2ZC4 B;  3H7W A;  3C30 A;  4QPR A;  1GSW A;  4Q0H A;  1K56 A;  5FEG A;  4E3L A;  3O5Y A;  3MJQ A;  4OPQ A;  4Y5F A;  1S66 L;  4S2L A;  4Y3I A;  5F82 A;  3H82 A;  1PW8 A;  2V8C A;  3PXP A;  3UNW A;  4NXB A;  3D9Y A;  4KQO A;  4Q0J A;  3LI8 A;  1S1Z A;  4DKI A;  5HD5 A;  2Q9M A;  3BFG A;  1E3U A;  2ZC7 A;  4OQH A;  5FSR A;  5DJU A;  2XSS A;  1DP8 A;  2V2F F;  5DJT A;  4IVI A;  1N9O A;  4L9E A;  5FI2 A;  2P9V B;  2OV5 A;  3UB9 A;  4JXS A;  3T12 B;  3HRE A;  1W7F A;  3BEC A;  2HZ5 A;  1ES2 A;  2Z6C A;  4UA6 A;  3C8C A;  4GS9 A;  4ZTK A;  3K2N A;  3N8S A;  4XUX A;  1GA9 A;  3E98 A;  4GB7 A;  2I9V A;  3FYZ A;  4JF5 A;  4O8G A;  3NY4 A;  3MKE A;  4B4X A;  4ESP A;  1SDE A;  5KZH A;  2EXB A;  3VMA A;  5F83 A;  3C5A A;  3KSG A;  4OPR A;  2D01 A;  4JF4 A;  3VFH A;  1IKG A;  3FWL A;  3UPO A;  2BLS A;  4EBN A;  3TSG A;  3L7H A;  1BSG A;  3MXR A;  1MPL A;  2FH5 A;  3UN7 A;  3OLO A;  1Y4O A;  4DE2 A;  5AQB A;  4B88 A;  2H5S A;  4U0X A;  3LY3 A;  3LEQ A;  4QJG A;  1I2W A;  1DJA A;  4KZ6 A;  2WAE A;  1N9B A;  1RP5 A;  4HNB A;  3NC8 A;  5J7E A;  3Q82 A;  5HSQ A;  3IXB A;  2PHY A;  3IF5 A;  4Q8I A;  2ZD8 A;  1NLZ A;  3CIT A;  3IHB A;  4II7 A;  1HD8 A;  4Y7P A;  2VX8 A;  1ERM A;  1UWN X;  3ZG9 B;  3IXD A;  4EWF A;  1K55 C;  1IEL A;  1Q2P A;  3CPT B;  2BG1 A;  3CAX A;  3G35 A;  1TS6 A;  1SKO B;  4GD8 A;  1QMF A;  1XA1 A;  1X0O A;  3IHA A;  4WBG A;  3D72 A;  4JGR A;  2VV6 A;  5CTM A;  4CLC D;  5L8M A;  5HAR A;  3DWK A;  4E3O A;  3OOV A;  4OQ0 A;  4BJP A;  2ZQ8 A;  1HZO A;  3TJZ C;  5JYO A;  3VSK A;  3LIB A;  2NUT C;  5FA7 A;  4O01 A;  3ZYT A;  2GNX A;  5DFY A;  3ZCZ A;  2C5W B;  4ZBE A;  1YLY A;  4PM9 A;  3TOI A;  4B93 A;  1TS7 A;  3ITB A;  4LGW A;  3CG5 A;  4KEN B;  2W27 A;  4KUO A;  2VA0 A;  1XFN A;  2ZOI A;  3GDI A;  1N9N A;  1F5M A;  4MN5 A;  1E4D A;  5EM1 A;  3H7W B;  1YSQ A;  2RL3 A;  4R3J A;  4ID4 A;  2PBD P;  5I94 A;  3CWF A;  4S2N A;  3H82 B;  4U0T A;  1K54 A;  2PR5 A;  4PM8 A;  3PBN A;  3T4T A;  4KG5 A;  4A5R A;  1IYO A;  3RTY A;  1DY6 A;  3O86 A;  1K6S A;  1MY8 A;  1PWG A;  3I7J A;  3WS0 A;  2WKP A;  3GSG A;  2P74 A;  4DRT A;  3IH9 A;  1MKM A;  3T4Q A;  5I5L A;  4FH2 A;  4WL9 A;  3WS4 A;  4YOF A;  2XFT A;  3UB5 P;  3CUE A;  4JXG A;  3H9W A;  4N1X A;  3UDI A;  1MC0 A;  2J3W A;  2RCX A;  5A93 A;  1OTI A;  4RX3 A;  5AVE A;  1TEM A;  5EVI B;  4D2O A;  3HUM A;  3OPP A;  3OZH A;  3LEZ A;  3DTE A;  5EVI C;  4IHQ A;  3HLD A;  4NXE A;  2B18 A;  2B95 A;  3KO6 A;  2XQZ A;  1YLP A;  5CX7 A;  4P0M A;  1FCM A;  1MWS A;  4HJ4 A;  2OWJ A;  5DF7 A;  3CZD A;  3F1O A;  5HAQ A;  4M4X A;  2X71 A;  3IF6 B;  3PAE A;  4RYE A;  4ARZ B;  4DJ3 A;  2WKQ A;  3IF6 C;  4HBT A;  3VP1 A;  3ZGA B;  3EEH A;  1F98 A;  2UV0 E;  3RFB A;  5GHZ A;  3FPV A;  1OJG A;  2EA9 A;  1XKZ A;  3O3V A;  3SH7 A;  3NI9 A;  4NEE D;  2K2N A;  4UEY A;  3LYX A;  5EUA A;  1NRF A;  4WMC A;  3W4Q A;  1CF0 A;  4E3N A;  1PFL A;  2BTF P;  2W3G A;  4E3K A;  2IWC A;  4HES A;  2VLG A;  2LB9 A;  2XDM A;  4X56 A;  2JC7 A;  2PYP A;  2P9V A;  2NUP C;  2W1T A;  5KSC A;  3B3X A;  2JKT I;  1T18 A;  4HOI A;  2W1R A;  4NXG A;  3DBA A;  2PT7 A;  2QZ6 A;  3SZT A;  4OVD A;  3D3O A;  2JKR I;  3N7W A;  4G3K A;  1ZKJ A;  5AQA A;  1VET A;  3Q81 A;  3U2A A;  3S22 A;  2R9X A;  1S0W A;  3HVF A;  4GHI A;  4ME4 A;  3WRT A;  1GA0 A;  1ES4 A;  3IWI A;  3PYP A;  3LUQ A;  4MBK A;  1OTD A;  2O0Y A;  3ZHH A;  2V1B A;  4I3J A;  1KE3 A;  1MWT A;  1P9W A;  2ACG A;  4ETZ A;  1KOU A;  5EEC A;  3JPU A;  4YNR A;  3A0V A;  4WZ5 C;  3IX8 A;  2VV8 A;  1OJ5 A;  1MBL A;  4I3A A;  4OQI A;  5JYP A;  4MN6 A;  1HLU P;  1PW1 A;  5E2H A;  1PI5 A;  4GLQ A;  2H10 A;  2A24 B;  3UE6 A;  4Y17 A;  2XRO A;  4OQG A;  2Y2P A;  3N8R A;  5CRF A;  3ICY A;  1MXO A;  2CMN A;  5F1F A;  1FIK A;  2QJ5 A;  3HLB A;  2IWD A;  2HGV A;  1H8Y A;  2R78 A;  2JKF A;  3LY4 A;  3NDE A;  1H0M A;  3PR6 A;  1K38 A;  5HL6 A;  3QP2 A;  2HDR A;  4GD6 A;  4OON A;  4Y0T A;  2XLN A;  2PR6 A;  3VP2 A;  3WS2 A;  2WYX A;  2QYB A;  3UE1 A;  1E25 A;  1M6K A;  2JHE A;  4I3I A;  1P97 A;  4BBU A;  4X1M A;  2XR0 A;  2VGL M;  4R0Q A;  1K55 A;  1P9R A;  2ZM2 A;  2QJ7 A;  2IWB A;  5F68 A;  4E3J A;  5GLC A;  5TFQ A;  1J9M A;  4BEN A;  3IBJ A;  3BFC A;  3SS4 A;  3LIA A;  3PBT A;  3GVB A;  1H3Q A;  5EVE A;  2WKE A;  5HX9 A;  3S1Y A;  1NJ4 A;  4N92 A;  3GR2 A;  2JBF A;  5E2F A;  3V67 A;  1KE4 A;  3BY9 A;  4OLD A;  4RX2 A;  3OCN A;  5A92 A;  2G7U A;  1JVJ A;  3ZG7 B;  2A49 A;  3UB7 A;  3M6B A;  3FC7 A;  5TR7 A;  3NOP C;  4WLA A;  5CGX A;  3BFE A;  1ZHH B;  5C5K A;  4LCM A;  4JF6 A;  3NOU C;  1TD5 A;  1BLC A;  4Y2F A;  1RGY A;  2VGK A;  3LGO A;  3FZC A;  5E43 A;  1YKD A;  3PBO A;  2L0W A;  1LHY A;  3NJA A;  4PKY A;  4EXO A;  3NOT C;  3UO9 A;  3ULF A;  1YLZ A;  4C75 A;  3ZG8 B;  3ZFZ A;  2JKT M;  4CPK A;  2ZQD A;  1IYP A;  2DMW A;  2LB5 A;  4HHD A;  3C4O A;  3F1O B;  2JKR M;  4G3V A;  4RVA A;  3EGX C;  3N4I A;  4EBP A;  1H5X A;  4JBF A;  3C4P A;  5FQK A;  1Q2Q A;  5L10 A;  4X68 A;  2W3F A;  4O0P A;  1LSW A;  2KDK A;  2ZLY A;  4Z1W A;  1PZP A;  1W63 Q;  4S2J A;  1I2S A;  2V9A A;  3GV9 A;  4EU0 A;  3EOI A;  4HIA A;  2CC1 A;  3MZE A;  2XD5 A;  4KQD A;  4QY5 A;  1PWC A;  4GNU A;  4BBT A;  4R4S A;  4MBH A;  3VFF A;  1WYC A;  5EFW A;  4JGO A;  1SKF A;  4IBX A;  2W1T B;  1C3B A;  5CGS A;  1TVF A;  3A3J A;  2Y2I A;  4UQI M;  2ZQ9 A;  4PHT A;  4S2O A;  5E2G A;  1KVM A;  5EPH A;  1LI9 A;  4R3B A;  4EUZ A;  3WS5 A;  2XGN A;  4EBL A;  4E3M A;  1H8M A;  1XGI A;  3A0R A;  1VET B;  2ZMV A;  4HH2 A;  1V9Z A;  3Q07 A;  4GHI B;  3JVU A;  4R3A A;  3LIE A;  1ONG A;  4CLC C;  4BMW A;  3KX0 X;  1LT0 A;  5EVI A;  4HJ6 A;  3NHQ A;  4OPY A;  3MZD A;  1P0Z A;  5AQ7 A;  4OLG A;  2Y79 A;  4K0W A;  3DWZ A;  1IYQ A;  2ZQ7 A;  4XUZ A;  1YMS A;  4MCW A;  3MQO A;  5GLD A;  2OAP 1;  3Q7Z A;  3BLM A;  4FD8 A;  4H8R A;  4QB8 A;  2G2U A;  3BWL A;  3IWQ A;  2J3T D;  5MC7 A;  5FAT A;  3IF6 A;  3M6H A;  3ZNT A;  2OWH A;  2QMI A;  4ARZ A;  3G6O A;  3MQ0 A;  1ES5 A;  3T4L A;  2ZJ9 A;  3IXH A;  4Y0O A;  4EET B;  1XGJ A;  2HJE A;  2P7J A;  3NUL A;  3MF0 A;  4PM7 A;  3N8L A;  2HDS A;  4DF6 A;  3VSL A;  1SDN A;  2HDU A;  1IFQ A;  3VOY A;  5AVF A;  3FG8 A;  2EX2 A;  1PRQ A;  2E8J A;  2WZZ A;  3VE4 A;  3DTM A;  1MWR A;  5HWV A;  3LR5 A;  3UE3 A;  3WS1 A;  2HPB A;  3OPL A;  3ZG0 A;  3V5M A;  2Y2Q A;  3CMZ A;  2QPN A;  3T4K A;  2PRF A;  1L0E A;  2XD1 A;  1T1C A;  2ZC6 B;  1ODV A;  4FSF A;  1CI8 A;  4EER A;  4PPR A;  4MDZ A;  2GJ3 A;  1PZO A;  3LIC A;  3Q1F A;  5HD3 A;  4HY8 A;  3F1N B;  1NWZ A;  1CJF A;  2O99 A;  5HPI A;  3UDX A;  5HDS A;  4IED A;  1WYB A;  2HP6 A;  2WAF A;  1SHV A;  3MR0 A;  1UGU A;  1STZ A;  2ZBB A;  3QP8 A;  2ZM0 A;  3D4F A;  3QP1 A;  1F9I A;  2K31 A;  3QP5 A;  3P7N A;  5HW3 A;  3C7V A;  4HBU A;  4WZ5 A;  5A91 A;  5FAS A;  5GHX A;  1I5Q A;  3NDG A;  4EES A;  4OOM A;  3A0S A;  4P6B A;  3BYD A;  2IA2 A;  4HJ3 A;  1W8Q A;  3GTC A;  1CK3 A;  3V3R A;  4RQ9 A;  1N4O A;  5L07 A;  1EWZ A;  1T1A A;  1MKI A;  2EX9 A;  5J4E A;  4P6Z M;  3IXG A;  2A24 A;  1K57 C;  3MKF A;  4L0L A;  4XXR A;  3RJU A;  1ESU A;  3LIF A;  3B42 A;  4F94 A;  4KZ4 A;  5G4Z A;  2PU4 A;  3UDF A;  1AWI A;  4KG6 A;  3BQA A;  4N9L A;  3MQQ A;  1TDG A;  4N1H A;  3R7W A;  2JKG A;  1ZG6 A;  1IOU A;  4ZJ2 A;  1PI4 A;  4JXW A;  3MBZ A;  4EUV A;  5F6A A;  5J8X A;  4LLO B;  2ZQA A;  1G68 A;  3MFX A;  2DNS A;  1FR6 A;  2Y2G A;  4HEF A;  2R9W A;  5DF8 A;  4LFU A;  3G30 A;  2EWV A;  4P6Z S;  5L2F A;  5HL1 A;  3HLE A;  3IX3 A;  1VM1 A;  1FR1 A;  3OBF A;  4QU3 A;  1VQQ A;  4S2M A;  4NXF A;  3UY6 A;  5HZH A;  3ZNY A;  3AGE A;  3UME A;  4OP5 A;  4K0X A;  1S1Y A;  5CTN A;  3U4L P;  3TW8 A;  3C7U A;  4F3L A;  3L9K A;  5FQM A;  5DVA A;  1ERO A;  1IYS A;  1XJ2 A;  1RCJ A;  5FQJ A;  5IHV A;  2Y4A A;  3IS2 B;  1JWV A;  4YWZ A;  2J9P A;  3KYZ A;  2O9C A;  3DTI A;  1O07 A;  4BD1 A;  3A3D A;  3FKW A;  2W3H A;  3T4S A;  3EGD C;  5CGW A;  4KG2 A;  2DCF A;  4KZB A;  4E6X A;  4R1G A;  3EEA A;  2WKH A;  3W4O A;  5AJG A;  3UPN A;  1O7E A;  3T4O A;  2Q0O A;  3ITA A;  1W79 A;  2XA7 M;  3E2L A;  2Y2O A;  1DRM A;  1RGZ A;  2H0T A;  3NBL A;  1FOF A;  4OP8 A;  3UMD A;  3JVV A;  4XT2 A;  4KZ5 A;  5FAQ A;  1K56 D;  1Z09 A;  2Y2L A;  1ALQ A;  5DF9 A;  4X1L A;  3VP3 A;  4PM6 A;  4LEN A;  1G5U A;  4KZ3 A;  3AGF A;  3HJK A;  1LLB A;  5DKL A;  1GSX A;  4NKP A;  5KMW A;  3IWO A;  3E4P A;  4BL3 A;  4R4R A;  2M7V A;  2VGJ A;  4KZ8 A;  3BQ8 A;  4WEL A;  3IQA A;  4JXV A;  1JTG A;  3G34 A;  3HCY A;  1XJ6 A;  1ZC2 A;  2J9O A;  3LI9 A;  3O88 A;  3S7Q A;  2H0Y A;  4EEP A;  1NZU A;  1FCN A;  1D7E A;  4CLC A;  1YSP A;  5DTK A;  3EQV A;  4OPZ A;  2XK1 A;  4OKP A;  3GRJ A;  1SZV A;  3VV4 A;  4MMN A;  1L0F A;  1VB6 A;  2YKF A;  4KQQ A;  5FQI A;  3UE0 A;  4FTX A;  5HFO A;  3ZQ5 A;  3VOZ A;  2ZM8 A;  1MWU A;  1K0K A;  2XF3 A;  3OCL A;  4R70 A;  4S2K A;  1XJ3 A;  4WUJ A;  4JKT A;  4EW7 A;  5FEF A;  1W8Y A;  1Z6F A;  3HL9 A;  2Y2M A;  1ONH A;  5EVL A;  2GX5 A;  2ZL1 A;  1YT4 A;  1OT9 A;  3E4O A;  5HDC A;  3ZVT A;  1YLJ A;  1BYW A;  5G18 A;  2ZC5 B;  3R7W B;  3EQU A;  3V39 A;  1AXB A;  2INW A;  4I5S A;  5FQ9 A;  1T19 A;  2EXA A;  2EX8 A;  5LBR A;  3RXW A;  4DE3 A;  1NXY A;  4KZA A;  3QP6 A;  2J80 A;  4WZ4 A;  3G2Y A;  1XA7 A;  3LR0 A;  2PU2 A;  4GDN A;  1ZTU A;  4EV4 A;  4HH3 A;  3FV7 A;  2QWS A;  2J7V A;  2Y2H A;  1G6A A;  1ZG4 A;  3MS6 A;  4LV1 A;  4Y15 A;  2D02 A;  3MXS A;  5F69 A;  4X55 A;  3UB8 A;  2XH9 A;  4KUK A;  4X69 A;  1ESI A;  1XXM A;  3QHY A;  4MNR A;  1LL8 A;  3GMW A;  3F1N A;  4DJ2 A;  2DRW A;  3WRZ A;  2AVX A;  4F3L B;  1W63 M;  2Y2N A;  1CEF A;  1XPB A;  3AGD A;  2VGL S;  3WWX A;  3G31 A;  3IH8 A;  4KQR A;  4HQA A;  1L3L A;  4QHC A;  2XFS A;  3T1Q B;  4N9K A;  4LPZ A;  1BUL A;  3BRM A;  1MZU A;  1OT6 A;  4ETX A;  3IX4 A;  4DN0 A;  4IUK A;  3A3F A;  3A3I A;  4E04 A;  5F5Y A;  3HJI A;  1K57 A;  3VP0 A;  2FFY A;  4GN2 A;  4UA9 A;  3ISG A;  1U60 A;  1BLS A;  1KGF A;  2JN7 A;  2KX6 A;  1YQS A;  3G32 A;  3V50 A;  2EFU A;  4DMZ A;  4XT2 B;  4BBV A;  4L9F A;  3O87 A;  2B5R A;  4S2I A;  3TE8 A;  1JTD A;  2J3T C;  2M7U A;  4ZJ3 A;  4R6L A;  4DDY A;  4WEK A;  2WKR A;  4WEJ A;  5DTS A;  4ZDX A;  4GZB A;  2Z2L B;  1FSW A;  1T1B A;  1ERQ A;  3B47 A;  2A2L A;  5KIZ A;  1Y54 A;  1L0G A;  1N9L A;  2Y2K A;  3GEC A;  2VEA A;  1G6O A;  5BOH A;  1NYY A;  3BEB A;  3DAV A;  5HAP A;  1LSX A;  2KLI A;  4CJN A;  4HI4 A;  4JPM A;  1IEM A;  4BQM A;  3UB6 A;  3VE3 A;  4LV2 A;  3T4J A;  3HUO A;  4CLC B;  5U47 A;  5FDS A;  1NY0 A;  1K6R A;  3IT9 A;  4LV0 A;  2OSU A;  5FL3 A;  4C3Q A;  3IS2 A;  5KSH A;  1OTA A;  4P85 A;  3CJM A;  5TBM A;  1BLP A;  4UQI S;  4FOF A;  4MN7 A;  4IJG A;  2C6W B;  5GHY A;  2JCH A;  3E4Q A;  3PBQ A;  1PNE A;  5EM0 A;  1NZO A;  1K4F A;  3Q7V B;  2OAQ 1;  4PM5 A;  1XJ4 A;  4CLC E;  3BJN A;  2ZL1 B;  4R23 A;  4MEZ A;  3P98 A;  3CLO A;  4OH0 A;  2Y55 A;  1GHP A;  2WKI A;  4S2P A;  2P08 A;  3GQZ A;  4X6T A;  4Z9Q A;  4H6J A;  3N6I A;  4CQH A;  1OTB A;  4GOG A;  3MFD A;  3B33 A;  3NCK A;  2V0W A;  2X02 A;  4LRX C;  3RXX A;  2ZMA A;  2YKH A;  1YLW A;  4LV3 A;  4WMC D;  5GL9 A;  2XRN A;  1PYY A;  2OLV A;  3KSF A;  2I72 A;  5G4Y A;  4IUH A;  3E2K A;  4GJ4 A;  1FSY A;  1HTZ A;  1PWD A;  5HWW A;  5CER A;  2WZX A;  3PBR A;  2A3U A;  3T1X A;  3TRC A;  1DP6 A;  4YFM A;  1XP4 A;  4DE0 A;  2B02 A;  3ZDJ A;  2QHK A;  5HPF A;  4BWI A;  5FI6 A;  4ZAM A;  4RA7 A;  1GSV A;  2K7S A;  5TJJ A;  3ZVW A;  4DXC A;  3LR4 A;  2XEP A;  2L1M A;  2FFF B;  3P01 A;  3S7O A;  2WAD A;  3K3D A;  3MSH A;  5CHM A;  4BLM A;  4I39 A;  5HAI A;  1IKI A;  5FI7 A;  4FUW A;  2Y91 A;  1NLY A;  2WGW A;  3FKV A;  1WA9 A;  4B9O A;  5EOE A;  3W8K A;  2PYR A;  4LCL A;  2HJ9 C;  3CI6 A;  1XX2 A;  1J3W A;  5EV0 A;  4QD4 A;  4EQI A;  1D1J A;  1A0K A;  1HVB A;  1KE0 A;  3KYE A;  4LRZ E;  2W3D A;  1K4E A;  1L0D A;  3S4X A;  2VZW A;  3DW0 A;  3SS5 A;  1S67 L;  4K91 A;  4GW9 A;  4DXB A;  1KGE A;  1L2S A;  4WM9 A;  4HP4 A;  5DTT A;  1CEG A;  2WK0 A;  3SOI A;  3ZG5 A;  3E0Y A;  1VEU A;  1YAX A;  3QP4 A;  3LCE A;  2O9A A;  2PBY A;  2HF6 A;  4YIN A;  4Y0U A;  2X01 A;  4KZ9 A;  3M2K A;  1Y28 A;  4IBR A;  1OTE A;  4K08 A;  4KZ7 A;  4WYY A;  5J3W A;  5HDD A;  4BL2 A;  4UHU A;  4UA7 A;  1PIO A;  3LO7 A;  1S6R A;  1ES3 A;  4JLF A;  2EWW A;  1DJB A;  1QME A;  4AFI A;  3KSH A;  4BD0 A;  5EOO A;  2MJ6 A;  3F1P A;  1NRJ A;  1XFQ A;  3LID A;  4E6W A;  1YPR A;  4OOY A;  1F2K A;  4EEU A;  4DDS A;  1H8Z A;  5EE8 A;  3OPR A;  5CHJ A;  5TBM B;  1UWP X;  1LI0 A;  1W5D A;  4GS9 B;  1TS8 A;  3HLG A;  1BLH A;  3OC2 A;  2BAS A;  2OLU A;  1M40 A;  1NYM A;  5IS1 A; 
#chains in the Genus database with same CATH homology
 3EQU A;  4NK3 A;  5CTM A;  5HAR A;  3V39 A;  1AXB A;  2ZC3 B;  3DWK A;  4E3O A;  4OQ0 A;  5FQ9 A;  1PWC A;  2EXA A;  2EX8 A;  4GNU A;  5CXW A;  3RXW A;  4BJP A;  4R4S A;  4DE3 A;  4MBH A;  3VFF A;  5GLA A;  2ZQ8 A;  1NXY A;  1YM1 A;  3SH8 A;  4KZA A;  1BZA A;  4FCF A;  3G2Y A;  4WZ4 A;  1WYC A;  1XA7 A;  1HZO A;  3UPP A;  1SKF A;  4IBX A;  5JYO A;  3PAG A;  1C3B A;  5CGS A;  1TVF A;  3A3J A;  2Y2I A;  1GCE A;  3VSK A;  2PU2 A;  2ZQ9 A;  4GDN A;  4S2O A;  5E2G A;  5FA7 A;  1KVL A;  1LL5 A;  4EV4 A;  1KVM A;  5EPH A;  1LI9 A;  4R3B A;  3FV7 A;  4EUZ A;  3WS5 A;  1FQG A;  3ZCZ A;  2XGN A;  4EBL A;  2J7V A;  4E3M A;  5M19 A;  1XGI A;  1G6A A;  1TDL A;  1ZG4 A;  2C5W B;  2Y2H A;  4LV1 A;  2WGV A;  1JWZ A;  4M3K A;  2G2W A;  4ZBE A;  3MXS A;  1YLY A;  1OME A;  4PM9 A;  4X55 A;  3TOI A;  2XH9 A;  3Q07 A;  3ITB A;  1BUE A;  4X69 A;  1ONG A;  1ESI A;  3CG5 A;  1XXM A;  4KEN B;  3BFF A;  3QHY A;  4MNR A;  1DJC A;  5EVI A;  1BTL A;  4OPY A;  3GMW A;  1E3U D;  2DRW A;  3MZD A;  3WRZ A;  2ZQC A;  2Y2N A;  1CEF A;  1E4D A;  4GKU A;  1XPB A;  2Q9N A;  1WE4 A;  5AQ7 A;  4OLG A;  4K0W A;  3AGD A;  1CI9 A;  1YLT A;  3DWZ A;  1IYQ A;  2ZQ7 A;  2RL3 A;  3WWX A;  4R3J A;  4XUZ A;  4ID4 A;  1YMS A;  3G31 A;  3IH8 A;  3P09 A;  5GLD A;  4KQR A;  5I94 A;  4S2N A;  3Q7Z A;  4X53 A;  3BLM A;  4O7D A;  2GDN A;  4FD8 A;  4H8R A;  4QB8 A;  4U0T A;  2G2U A;  1K54 A;  5F1G A;  3IWQ A;  4QHC A;  2XFS A;  5FAT A;  3IF6 A;  4N9K A;  3M6H A;  3ZNT A;  2QMI A;  4PM8 A;  1BUL A;  3BRM A;  2E8I A;  4GDB A;  2V1Z A;  3M2J A;  3PBN A;  3A3F A;  1ES5 A;  3A3I A;  2ZJ9 A;  4KG5 A;  3IXH A;  4Y0O A;  4A5R A;  1IYO A;  1XGJ A;  1K57 A;  3VP0 A;  2EFX A;  2FFY A;  1DY6 A;  4GN2 A;  3O86 A;  4UA9 A;  1K6S A;  1MY8 A;  3ISG A;  1U60 A;  1BLS A;  3QNB A;  4MBF A;  5EVI D;  1KGF A;  1PWG A;  3I7J A;  5CEB A;  3WS0 A;  4PM7 A;  3GSG A;  2P74 A;  4DRT A;  3N8L A;  2HDS A;  4DF6 A;  1GHI A;  3VSL A;  1SDN A;  1YQS A;  2HDU A;  3G32 A;  3IH9 A;  2Z2M B;  3V50 A;  2EFU A;  3VOY A;  3O87 A;  2EX2 A;  2WGW B;  3Q7V A;  4U3T A;  2B5R A;  2WZZ A;  4S2I A;  4FH2 A;  3DTM A;  1BT5 A;  3WS4 A;  1MWR A;  2EX6 A;  1JTD A;  2XFT A;  3UE3 A;  3WS1 A;  2HPB A;  3OPL A;  4E3I A;  4JXG A;  4ZJ3 A;  4DDY A;  4WEK A;  3VP4 A;  3ZG0 A;  3V5M A;  2Y2Q A;  3CMZ A;  4N1X A;  2QPN A;  4WEJ A;  3UDI A;  4IVK A;  1L0E A;  5DTS A;  2XD1 A;  5D3O A;  2ZC6 B;  5FAP A;  2RCX A;  4FSF A;  4ZDX A;  1CI8 A;  5A93 A;  4GZB A;  4RX3 A;  2JE5 A;  2Z2L B;  4PPR A;  3TG9 A;  1TEM A;  5EVI B;  4D2O A;  1FSW A;  1PZO A;  3BM6 A;  3HUM A;  3Q1F A;  3OPP A;  1ERQ A;  2V20 A;  3SH9 A;  5TGF A;  3OZH A;  3LEZ A;  5EVI C;  3HLD A;  3A3E A;  1Y54 A;  1L0G A;  3UDX A;  3HBR A;  3MZF A;  4IED A;  1KGG A;  2Y2K A;  1WYB A;  2HP6 A;  2WAF A;  4MLL A;  5CED A;  1EI5 A;  1SHV A;  1JWP A;  2XQZ A;  5BOH A;  1NYY A;  1LL9 A;  1YLP A;  3BEB A;  4P0M A;  1FCM A;  1MWS A;  5DF7 A;  5HAP A;  4ZJ1 A;  2WUQ A;  3CZD A;  2ZM0 A;  3D4F A;  3BFD A;  3W4P A;  4CJN A;  5HAQ A;  4JPM A;  2X71 A;  4S2N C;  5GLB A;  3V3S A;  1IEM A;  3HLF A;  3IF6 B;  3PAE A;  4BQM A;  5HW3 A;  3C7V A;  4HBU A;  4WZ5 A;  5A91 A;  5FAS A;  4RYE A;  1K54 C;  1I5Q A;  4LV2 A;  3NDG A;  5GHX A;  3HUO A;  3IF6 C;  4OOM A;  5U47 A;  4HBT A;  3VP1 A;  3ZGA B;  4P6B A;  5FAO A;  2Y2J A;  1K25 A;  3BYD A;  1NY0 A;  1K6R A;  1W8Q A;  3IT9 A;  4LV0 A;  2OSU A;  2Y59 A;  3GTC A;  1CK3 A;  3V3R A;  4B4Z A;  1N4O A;  4C3Q A;  1EWZ A;  1MKI A;  5GHZ A;  2EX9 A;  5KSH A;  5FDH A;  3IXG A;  3MKF A;  1K57 C;  4L0L A;  4QY6 A;  4XXR A;  4P85 A;  3CJM A;  3RJU A;  1BLP A;  1ESU A;  4UAA A;  5M18 A;  1GHM A;  1KDW A;  1XKZ A;  3O3V A;  5CHU A;  3SS3 A;  4F94 A;  4KZ4 A;  3SH7 A;  3NI9 A;  2PU4 A;  3UDF A;  4C6Y A;  4KG6 A;  1KDS A;  4N9L A;  2C6W B;  4P87 A;  1FCO A;  1TDG A;  5GHY A;  4N1H A;  2JCH A;  3PBQ A;  4NET A;  5A90 A;  5EUA A;  1NRF A;  4WMC A;  4FH4 A;  3W4Q A;  1NZO A;  4E3N A;  1K4F A;  1ZG6 A;  3Q7V B;  4ZJ2 A;  1PI4 A;  4JXW A;  3MBZ A;  4E3K A;  5J8X A;  4PM5 A;  2IWC A;  4HES A;  2ZQA A;  2XDM A;  4X56 A;  5FQQ A;  5AQ9 A;  2HDQ A;  1G68 A;  2DNS A;  2JC7 A;  4R23 A;  1FR6 A;  2Y2G A;  4MEZ A;  2P9V A;  3P98 A;  4HEF A;  4DE1 A;  5KSC A;  2UWX A;  2R9W A;  3B3X A;  3BLS A;  4OH0 A;  5DF8 A;  2Y55 A;  3PTE A;  3PBS A;  3G30 A;  5M1A A;  1GHP A;  5L2F A;  2WKI A;  5HL1 A;  4PMA A;  3HLE A;  4S2P A;  2QZ6 A;  3GQZ A;  1VM1 A;  4X6T A;  4OVD A;  1FR1 A;  4Z9Q A;  3N6I A;  2HP5 A;  3N7W A;  1ZKJ A;  5AQA A;  4GOG A;  3HLC A;  4QU3 A;  3MFD A;  3Q81 A;  3NCK A;  1VQQ A;  3S22 A;  5CEC A;  2R9X A;  1S0W A;  3HVF A;  3HUN A;  3WRT A;  4S2M A;  2WGI A;  3G4P A;  1GA0 A;  2X02 A;  2J8Y A;  1ES4 A;  1YMX A;  3IWI A;  3NIA A;  3G2Z A;  2HP9 A;  3UY6 A;  3RXX A;  4OOL A;  3ZNY A;  1SCW A;  2ZMA A;  4MBK A;  3AGE A;  3ZHH A;  3JYI A;  4OP5 A;  4K0X A;  5E2E A;  1YLW A;  4LV3 A;  4WMC D;  1KE3 A;  1MWT A;  1PYY A;  2OLV A;  5CTN A;  2I72 A;  5GL9 A;  3C7U A;  3QNC A;  3E2K A;  5EEC A;  5FQM A;  3OPH A;  3HLW A;  5DVA A;  1ERO A;  1IYS A;  1FSY A;  1HTZ A;  2ZC4 B;  4WZ5 C;  1K56 A;  1MBL A;  1PWD A;  1RCJ A;  5FQJ A;  4OQI A;  5IHV A;  4E3L A;  5JYP A;  5CER A;  2WZX A;  1PW1 A;  2Y4A A;  3PBR A;  1PI5 A;  5E2H A;  4OPQ A;  2A3U A;  4YFM A;  1XP4 A;  4DE0 A;  1JWV A;  4S2L A;  5F82 A;  3ZDJ A;  2H10 A;  1PW8 A;  2J9P A;  4OQG A;  2Y2P A;  1O07 A;  3N8R A;  5FI6 A;  4BD1 A;  3A3D A;  3FKW A;  4RA7 A;  4ZAM A;  5CRF A;  3UNW A;  5CGW A;  4KG2 A;  1MXO A;  2DCF A;  4KQO A;  4KZB A;  4E6X A;  4R1G A;  5F1F A;  4DKI A;  2Q9M A;  3BFG A;  3HLB A;  3ZVW A;  4DXC A;  2IWD A;  1E3U A;  2ZC7 A;  2WKH A;  4OQH A;  5FSR A;  3W4O A;  2XEP A;  1H8Y A;  3UPN A;  3LY4 A;  1O7E A;  3NDE A;  1K38 A;  2FFF B;  2HDR A;  3ITA A;  4GD6 A;  1W79 A;  2WAD A;  3E2L A;  4OON A;  4Y0T A;  2XLN A;  2Y2O A;  2V2F F;  3VP2 A;  3WS2 A;  1RGZ A;  2WYX A;  4IVI A;  2H0T A;  5FI2 A;  2P9V B;  3NBL A;  1E25 A;  1FOF A;  1M6K A;  4OP8 A;  5CHM A;  3UE1 A;  4BLM A;  2OV5 A;  5HAI A;  4JXS A;  1IKI A;  5FI7 A;  2XR0 A;  2Y91 A;  3HRE A;  1W7F A;  4R0Q A;  3BEC A;  1K55 A;  2ZM2 A;  4KZ5 A;  5FAQ A;  2WGW A;  1K56 D;  3FKV A;  2IWB A;  4E3J A;  5GLC A;  2Y2L A;  5TFQ A;  1J9M A;  1ES2 A;  4BEN A;  1ALQ A;  3BFC A;  5EOE A;  3SS4 A;  3W8K A;  4UA6 A;  5DF9 A;  3PBT A;  3GVB A;  2WKE A;  5HX9 A;  4LCL A;  4PM6 A;  1NJ4 A;  3S1Y A;  1XX2 A;  3VP3 A;  4LEN A;  4N92 A;  4KZ3 A;  4QD4 A;  4ZTK A;  3GR2 A;  4EQI A;  2JBF A;  5E2F A;  3AGF A;  3N8S A;  4XUX A;  1KE4 A;  1GA9 A;  1HVB A;  4OLD A;  4GB7 A;  1LLB A;  4RX2 A;  1KE0 A;  3OCN A;  5A92 A;  3FYZ A;  4JF5 A;  1JVJ A;  5KMW A;  3NY4 A;  3IWO A;  2A49 A;  3ZG7 B;  3MKE A;  4BL3 A;  3M6B A;  4R4R A;  4B4X A;  5TR7 A;  1K4E A;  1L0D A;  1SDE A;  2VGJ A;  2EXB A;  3S4X A;  5KZH A;  4KZ8 A;  3VMA A;  3DW0 A;  5CGX A;  4WEL A;  3SS5 A;  3BFE A;  5F83 A;  4K91 A;  3C5A A;  3IQA A;  4OPR A;  4JXV A;  4LCM A;  4JF6 A;  4DXB A;  4JF4 A;  1JTG A;  1IKG A;  1KGE A;  1L2S A;  3G34 A;  3VFH A;  3FWL A;  4WM9 A;  1BLC A;  3UPO A;  1RGY A;  1ZC2 A;  2BLS A;  2J9O A;  2VGK A;  1CEG A;  3O88 A;  5DTT A;  3TSG A;  4EBN A;  3FZC A;  1BSG A;  2WK0 A;  3MXR A;  5E43 A;  3SOI A;  3PBO A;  3ZG5 A;  2H0Y A;  1LHY A;  1MPL A;  3LCE A;  3UO9 A;  2PBY A;  1NZU A;  1FCN A;  1YLZ A;  4C75 A;  4YIN A;  3UN7 A;  3ZG8 B;  4Y0U A;  3ZFZ A;  4CPK A;  2X01 A;  4DE2 A;  2ZQD A;  4KZ9 A;  3M2K A;  5AQB A;  5DTK A;  4B88 A;  1IYP A;  3EQV A;  2H5S A;  4OPZ A;  4IBR A;  4U0X A;  3LY3 A;  2XK1 A;  4QJG A;  4KZ7 A;  4OKP A;  1I2W A;  1DJA A;  4WYY A;  4KZ6 A;  4BL2 A;  4UHU A;  3GRJ A;  4UA7 A;  1PIO A;  3LO7 A;  2WAE A;  3C4O A;  1S6R A;  1L0F A;  1N9B A;  1RP5 A;  4KQQ A;  5FQI A;  3UE0 A;  1ES3 A;  4JLF A;  4RVA A;  1DJB A;  3NC8 A;  1QME A;  5HFO A;  3Q82 A;  3N4I A;  4EBP A;  1H5X A;  4JBF A;  3C4P A;  5FQK A;  1Q2Q A;  3IXB A;  4BD0 A;  3IF5 A;  5EOO A;  3VOZ A;  4Q8I A;  2ZD8 A;  2ZM8 A;  1MWU A;  2XF3 A;  4X68 A;  3IHB A;  3OCL A;  4S2K A;  4E6W A;  1HD8 A;  4JKT A;  4OOY A;  4Y7P A;  2ZLY A;  1ERM A;  4DDS A;  1PZP A;  3ZG9 B;  3IXD A;  4S2J A;  1W8Y A;  1Z6F A;  1H8Z A;  4EWF A;  1I2S A;  1K55 C;  1IEL A;  3OPR A;  5CHJ A;  5EE8 A;  1Q2P A;  3HL9 A;  2Y2M A;  1LI0 A;  3GV9 A;  1ONH A;  2BG1 A;  5EVL A;  1W5D A;  3G35 A;  1YT4 A;  3ZVT A;  4GD8 A;  1QMF A;  2CC1 A;  3MZE A;  1YLJ A;  3HLG A;  1XA1 A;  1BLH A;  2XD5 A;  3IHA A;  3OC2 A;  4WBG A;  5G18 A;  4QY5 A;  2OLU A;  2ZC5 B;  1M40 A;  1NYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...