1PZOA

Tem-1 beta-lactamase in complex with a novel, core-disrupting, allosteric inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase TEM
publication title Allosteric inhibition through core disruption.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1pzoA00
1LL5A 4KG2A 1Q2PA 4IBRA 1XGIA 2Y2KA 3JYIA 3A3EA 3IWOA 1MKIA 4PM9A 3S22A 4R3JA 2V20A 4DKIA 4BENA 1JTGA 4R23A 3HLCA 1YLZA 1I2WA 3HBRA 3OZHA 4PM6A 2Y2HA 4R1GA 1EI5A 3HLEA 5F1GA 3GRJA 3S1YA 4EQIA 4JLFA 5AQ7A 3UN7A 2XK1A 3IH9A 3G2ZA 3ZVWA 1NRFA 4QU3A 4IEDA 4KZ9A 1S0WA 3VP3A 5M19A 3IQAA 1IYPA 2ZQCA 4HBTA 1DJAA 1M40A 1SKFA 1XXMA 3A3FA 4UA9A 4DRTA 2OSUA 4E3OA 5A93A 4QB8A 5EOOA 4PM5A 4ZTKA 2HP9A 4KZ6A 4N9KA 5FSRA 3UDXA 5JYPA 4GKUA 4GD6A 1PIOA 2Z2LB 1K4EA 4JF6A 3Q7VB 3HVFA 4N1XA 3ITAA 1PWDA 3Q7ZA 4GDNA 4Q8IA 1XPBA 3VFHA 1M6KA 1U60A 3UE1A 1LHYA 5AQAA 3IF5A 2CC1A 1ES5A 5CERA 4FSFA 3IF6B 4GOGA 2EXBA 3ZVTA 1SHVA 2WGWA 4KG6A 4MEZA 3HUNA 3WS1A 4OQIA 4D2OA 1ES3A 2Y2JA 5FAOA 1TVFA 2A3UA 4S2OA 4E3IA 2XGNA 4FCFA 4KZ5A 4P85A 5JYOA 3OCLA 4Y0TA 3HL9A 2A49A 4R0QA 2QPNA 2EXAA 4S2NC 3IHAA 2WUQA 4ZJ2A 1QMEA 3SOIA 2EFUA 3Q81A 1CI8A 4OH0A 3NBLA 5A92A 5BOHA 4WMCD 3ZG8B 4RYEA 1W7FA 3C5AA 3ZHHA 4ID4A 1HTZA 1GHPA 1FCMA 1YLTA 3MKEA 4GD8A 4U0XA 4ZJ3A 4FH2A 1FR1A 4LENA 3UY6A 3LCEA 1L0FA 4PM8A 1FCOA 1LI0A 4WZ5C 1ZC2A 2HDRA 5FAQA 5DF8A 3A3JA 1IKGA 3MXRA 3OPLA 3HLFA 1BZAA 2WKEA 5DTTA 3V39A 3MBZA 5FATA 2VGJA 1K57A 2J7VA 3W4PA 3CG5A 3M2KA 1K56A 5DVAA 1N4OA 3VP2A 1W8QA 3G35A 4S2JA 1WYCA 5GHXA 1SDNA 5FASA 4N1HA 1XKZA 2WADA 4LV1A 5FI6A 4JKTA 1RGYA 2ZQDA 3MZDA 5IHVA 1ERMA 3PBNA 1NZUA 4X55A 3AGFA 3SS5A 1MPLA 3VP4A 2V2FF 3BFFA 2P9VA 5F83A 3N8RA 1J9MA 1YLYA 3GQZA 4UA7A 4BL3A 5A91A 3G4PA 3VFFA 1PYYA 2Y2OA 4S2MA 3BFDA 1KE4A 4KQRA 3GVBA 2DRWA 1RP5A 2H0YA 2OLVA 3HUOA 2X02A 5EECA 3UPPA 3E2KA 3MZEA 3UDIA 3ZG0A 5GLBA 5DF7A 5U47A 4E6WA 1K25A 2ZM0A 1MXOA 2Y2GA 4KQQA 3DTMA 1XGJA 1YLJA 3O88A 4UHUA 5CGXA 1PI4A 4ZDXA 3MKFA 3SS4A 4OQGA 1JTDA 1BLCA 5KSHA 4LV2A 3RJUA 5HL1A 2ZM2A 1ONHA 3FKWA 3UPNA 1CK3A 2PBYA 5HAPA 1JWZA 2DNSA 3DWZA 3BFCA 2ZM8A 1BT5A 4XUXA 4PPRA 1CEGA 2WGWB 3V3RA 4R4RA 3RXWA 4B88A 4C3QA 5E2FA 2HP6A 1W8YA 4WBGA 3WS0A 4E6XA 1MBLA 3DW0A 3OPRA 3SS3A 2P74A 4QHCA 3BEBA 5TGFA 5F1FA 5KSCA 2XLNA 4BD1A 4EBNA 1E4DA 2ZMAA 4MLLA 5GLCA 4EBLA 2XF3A 1E25A 3TSGA 2H10A 5CHJA 4S2NA 4BL2A 1EWZA 1L0EA 1Y54A 3PBRA 3FZCA 2ZC7A 5EPHA 5FQ9A 1XP4A 3ZDJA 1CEFA 4NK3A 3OPPA 3NI9A 5HW3A 5E2GA 5CHUA 3D4FA 3MFDA 2JBFA 4IVIA 4BD0A 2ZQ9A 5FQJA 4GNUA 3C7VA 3HLDA 1N9BA 3UO9A 4PMAA 5EVID 4HESA 3UPOA 1QMFA 5EUAA 1WYBA 4JXSA 2WAFA 4GB7A 4WZ5A 3SH7A 1YMXA 2Y59A 1G68A 2ZC3B 3PAGA 4WELA 4WMCA 4DE2A 5M18A 2XFTA 5CTMA 3HLBA 2JC7A 4E3MA 1XA7A 3AGDA 5F82A 4N92A 2Y91A 2FFYA 4HEFA 5EVIC 2IWCA 4U0TA 3PBTA 5HAIA 3VOYA 4A5RA 4R4SA 2Q9NA 4KZBA 3O3VA 4YINA 4EUZA 4S2KA 3UDFA 2IWDA 2Y2IA 4YFMA 5GL9A 1KGGA 3LO7A 5CRFA 4MNRA 1LL9A 4OONA 1JVJA 2I72A 1ESIA 4XXRA 3HLWA 3O86A 3DWKA 3V5MA 1ES2A 1PWGA 1K4FA 4OOYA 1I2SA 4ZAMA 5E2EA 2WK0A 3P09A 1FSWA 1W5DA 4FH4A 2WZXA 5J8XA 2ZQ8A 5KMWA 3HREA 2XH9A 2WGIA 3N4IA 1BLHA 5HARA 4KG5A 4QY5A 2G2UA 1AXBA 1JWVA 3G2YA 4IVKA 1IYSA 2PU2A 3V3SA 5CGSA 2ZJ9A 2PU4A 2H0TA 1E3UD 1K55C 4L0LA 3NDGA 1PZOA 4Y0UA 4P87A 3EQUA 3QHYA 5EVLA 3UE0A 4OVDA 1NY0A 1YQSA 2ZD8A 1K6RA 2RL3A 5HX9A 1DJCA 1HZOA 2EX6A 1ONGA 2H5SA 3C4OA 3V50A 1VQQA 3AGEA 5CEDA 2OV5A 5GLDA 1KDWA 2VGKA 3S4XA 1O07A 3NIAA 2ZQ7A 4RA7A 2HDSA 1KVMA 1K38A 1EROA 2C5WB 4EBPA 3M2JA 3IXDA 3BFEA 5CHMA 5FI7A 3NCKA 5L2FA 4UAAA 3ITBA 1GHMA 4JBFA 4KQOA 2HDUA 4JXGA 4M3KA 4MBHA 2ZC4B 1O7EA 4OPZA 5DF9A 4NETA 3VP0A 3W8KA 2QZ6A 2XR0A 3IT9A 3VP1A 1FSYA 1CI9A 4BJPA 3N8SA 5FA7A 3Q82A 5FQMA 3MZFA 1NYYA 3MXSA 4S2IA 1KE0A 1YLWA 2XQZA 4LV0A 4ZBEA 1GHIA 5TFQA 4S2LA 1YM1A 4E3JA 4OLDA 1NZOA 2BG1A 3TG9A 4CPKA 3RXXA 1NJ4A 4E3NA 1YT4A 1W79A 3CJMA 4OPRA 4GZBA 4H8RA 4LV3A 2E8IA 4OP8A 1KGEA 4X69A 4Y7PA 1ALQA 1SCWA 3BYDA 3GMWA 1H8ZA 3Q1FA 3QNBA 1G6AA 3PBQA 1HVBA 4X6TA 5EVIA 4R3BA 2ZC5B 1KE3A 1KDSA 2GDNA 3LEZA 4FD8A 4EV4A 1ZG4A 1PI5A 4X53A 2XD1A 5E2HA 3PBOA 1BTLA 2Q9MA 1L0GA 4KZ3A 3HLGA 4MBKA 3IF6C 3FV7A 1Q2QA 5M1AA 2Z2MB 5CECA 3VSKA 2J8YA 5FQKA 1NXYA 1RGZA 1S6RA 1YLPA 3I7JA 3NC8A 4DDSA 4QJGA 3WS4A 4DDYA 3CZDA 5FAPA 3QNCA 2IWBA 1ZKJA 1KGFA 3B3XA 3GTCA 1GCEA 2OLUA 3A3DA 5A90A 1MWRA 3IXBA 3IWQA 2Y2MA 3W4OA 1ERQA 3N8LA 1RCJA 1H5XA 1LLBA 5EOEA 3TOIA 1L2SA 2J9OA 1K54C 3G34A 3GSGA 3E2LA 1K55A 3OPHA 5E43A 5GLAA 2C6WB 4K0XA 1PZPA 2ZLYA 3C7UA 3VMAA 4K91A 3OCNA 4DF6A 1L0DA 4JXVA 5HAQA 5KZHA 4P0MA 2XFSA 1GA0A 2P9VB 3LY3A 3N6IA 2Y2PA 4KZAA 4U3TA 2UWXA 3FKVA 2XEPA 1JWPA 2Y55A 1E3UA 3IXGA 1MWSA 3G30A 4OQ0A 3UE3A 4LCMA 3BLSA 4LCLA 2WGVA 4E3KA 5CEBA 2ZQAA 1WE4A 2Y4AA 5GHZA 1MWUA 2HDQA 1IKIA 5AQBA 4ZJ1A 2QMIA 4DE1A 2Y2NA 3G31A 4X68A 3NY4A 4KZ4A 1BLPA 3N7WA 2G2WA 1LI9A 4QY6A 5GHYA 4JF5A 3A3IA 2ZC6B 3UNWA 5CXWA 3IXHA 5EE8A 5TR7A 3SH8A 1XA1A 1ES4A 5CGWA 1KVLA 2JE5A 4F94A 4UA6A 5FQIA 3ZGAB 3ZFZA 2J9PA 3C4PA 3EQVA 2WKHA 4HBUA 2X71A 4Y0OA 4DXCA 4EWFA 2EX2A 1ESUA 4WZ4A 4KZ7A 4BLMA 2WAEA 4OPQA 3LY4A 1GA9A 3G32A 4CJNA 2XDMA 1XX2A 1FQGA 2DCFA 2R9WA 4PM7A 5EVIB 3SH9A 3VOZA 1I5QA 2B5RA 3ZNYA 4MBFA 5CTNA 1ZG6A 3BLMA 3Q7VA 2XD5A 2V1ZA 5FQQA 3GR2A 4C6YA 2RCXA 4RVAA 4WM9A 4RX3A 1C3BA 3IHBA 1IYQA 3HUMA 4OP5A 3W4QA 1IEMA 3WRZA 1BUEA 1FCNA 4OLGA 3IH8A 3BRMA 2BLSA 1TDGA 1IELA 3Q07A 2EFXA 3IF6A 3ZCZA 4GN2A 2HP5A 4DXBA 2EX8A 1NYMA 1BSGA 3WWXA 4S2PA 4JPMA 2FFFB 3FYZA 1HD8A 1DJBA 4K0WA 4OOMA 1BLSA 1TDLA 4WEKA 4BQMA 1DY6A 3OC2A 1PWCA 5HFOA 4IBXA 2WKIA 4JXWA 2Y2LA 1MWTA 3NDEA 3FWLA 1SDEA 1Z6FA 3ZNTA 4E3LA 4WEJA 3WS2A 4OOLA 1YMSA 3CMZA 5I94A 3O87A 1IYOA 1VM1A 4JF4A 4KENB 4P6BA 2HPBA 1MY8A 4B4XA 4C75A 2EX9A 4OQHA 5D3OA 5AQ9A 1BULA 2WYXA 1K54A 4WYYA 3P98A 4RX2A 1K56D 5DTSA 5FDHA 4OKPA 3WRTA 3WS5A 3VSLA 2WZZA 2JCHA 3ISGA 3BECA 4GDBA 3ZG9B 5DTKA 4DE0A 4KZ8A 1PW8A 4OPYA 1H8YA 1FR6A 3BM6A 1K6SA 3IWIA 4Z9QA 2X01A 4B4ZA 1PW1A 1K57C 5G18A 1FOFA 1TEMA 3M6HA 4N9LA 3ZG7B 5FI2A 3PTEA 2Y2QA 4DE3A 3BFGA 3ZG5A 4QD4A 3PBSA 3GV9A 4X56A 2R9XA 3PAEA 4XUZA 3M6BA 1OMEA 4O7DA
chains in the Genus database with same CATH superfamily
1LL5A 1Q2PA 4ME4A 4PM9A 3H9WA 3OZHA 2Y2HA 2PYPA 4R3AA 3S1YA 4EQIA 2W3DA 1XFNA 4KZ9A 4X25A 3IQAA 1SKFA 1M40A 4R70A 4PM5A 4ZTKA 2HP9A 5FSRA 4EESA 5DFYA 4HJ4A 4JF6A 4HH3A 4Q8IA 3Q7ZA 3QP2A 1K0KA 1H8MA 2MJ6A 3IF5A 4HJ6A 3EOIA 4HH2A 2QYBA 4IJGA 4FSFA 2EXBA 3ZVTA 1SHVA 5IT5A 3WS1A 3HUNA 2NUPC 1ES3A 4E3IA 5JYOA 2XGNA 4P85A 5J3WA 2A49A 3EGXC 2HF6A 2QPNA 4P6ZS 2O9CA 3IHAA 4ZJ2A 2EFUA 3T4LA 5BOHA 3ZG8B 3MKEA 4U0XA 3LCEA 4Z1WA 5DF8A 4II7A 5DTTA 5HWVA 1K57A 3M2KA 3VP2A 4S2JA 1WYCA 5GHXA 4K08A 4N1HA 1RGYA 3SS5A 1MPLA 3BFFA 2J3TD 3KSHA 2HGVA 3G4PA 2Y2OA 3GVBA 1RP5A 3VE3A 2JKRI 4Y3IA 3UPPA 3UDIA 4P6ZM 5U47A 4UQIM 4E6WA 3O88A 4DN0A 3MKFA 4OQGA 3RJUA 5HL1A 1CK3A 2DNSA 4XT2A 1GSXA 3T4JA 2V0UA 2G7UA 2JKRM 4B88A 2W1TA 3T4SA 5E2FA 2NUTC 3DW0A 1S4SA 4QHCA 5KSCA 1L3LA 4BD1A 2ZMAA 2R78A 5CHJA 4MMNA 2B18A 2ZC7A 5FQ9A 1XP4A 3U2AA 3IS2A 3NI9A 5E2GA 3V67A 1T1CA 4IVIA 2JBFA 3VV4A 1SKOA 2IA2A 2PDRA 3NECA 5DJTA 1N9BA 5TJJA 5EUAA 4I39A 4JXSA 4GB7A 1YMXA 1G68A 4DE2A 3NOPC 3SZTA 2JC7A 2VA0A 4E3MA 1XA7A 3AGDA 4N92A 2Y91A 3LR4A 3LIBA 2Q9NA 2W1RA 4KZBA 4S2KA 4HHDA 3LO7A 4OONA 4XXRA 3O86A 3V5MA 3HJIA 4ZAMA 5E2EA 2WK0A 3P09A 1W5DA 3QP1A 4FH4A 2XH9A 1JWVA 3G2YA 2PU2A 1E3UD 1D06A 4Y0UA 3EQUA 3QHYA 2W1TB 1NY0A 1K6RA 1VEUA 2RL3A 2EX6A 5CEDA 2VGKA 3D72A 3S7NA 4EBPA 3IXDA 5FI7A 1GHMA 3PXPA 4QPRA 4OPZA 4NETA 4EEUA 3UB7A 3DAVA 1FSYA 3MZFA 1NYYA 1YLWA 3UB9A 1KOUA 4LV0A 1GHIA 4B93A 3A0SA 4ZRRA 1YT4A 1W79A 4O01A 3CJMA 3MS6A 1KGEA 1ALQA 5L10A 1H8ZA 1G6AA 2JKFA 2ZC5B 4GLQA 1PI5A 2XD1A 5E2HA 2QJ7A 5L09A 1Q2QA 2OOLA 1YLPA 2D01A 5A90A 1MWRA 3IXBA 2Y2MA 3W4OA 1RCJA 1H5XA 4PAUA 5EOEA 5HWTA 3TOIA 1L2SA 1VEUB 3G34A 3OPHA 5E43A 4CLCE 4JGRA 1G6OA 1L0DA 5EFWA 3KSIA 1BYWA 4WUJA 2XFSA 2ZOIA 4L9GA 3IXGA 1JWPA 2GNXA 1E3UA 1MZUA 3G30A 3BLSA 3QP6A 1WE4A 5K5BA 2XRNA 1IKIA 2QKPA 1OTIA 4DE1A 3NY4A 4QY6A 3A0RA 2PD8A 3T1RA 5CXWA 4HP9A 1HLUP 3P01A 5L8MA 3ZGAB 2OAP1 3ZFZA 3C4PA 2WKHA 3UE6A 5DKLA 1ESUA 4WZ4A 4PHTA 1FQGA 1G28A 4CQHA 1I5QA 2W3HA 3BLMA 3BY8A 3Q7VA 4JGPA 3GR2A 2RCXA 4EW7A 1TDGA 3Q07A 5DJUA 3ZCZA 3FYZA 1HD8A 1BLSA 1TDLA 3E4PA 3NDEA 1Z6FA 3ZNTA 1GSVA 3CPTA 4WEJA 4OOLA 3IX4A 3OBFA 3O87A 3P7NA 5J4EA 1IYOA 4JF4A 4KENB 1MY8A 3BWLA 4BWIA 2WYXA 4WYYA 1K56D 3LFVA 3WS5A 2XA7M 2VV8A 3T12B 4KZ8A 1PW8A 1FR6A 4BBUA 2X01A 5G18A 3ZG7B 4N9LA 4LFUA 4H6JA 4PKYA 3KSGA 2YKFA 4QD4A 2R9XA 2Y8HA 4XUZA 3SH7A 2OV5A 1XGIA 3S22A 5TBMA 4R3JA 4DKIA 2JN7A 5F1GA 1I2WA 3ZVWA 3G2ZA 4CLCD 4QU3A 1JNUA 3VP3A 5M19A 1IYPA 3BW6A 1DJAA 3A3FA 4Y2FA 4O0PA 4QB8A 2KLIA 4KZ6A 3T4KA 4CLCC 2Z2LB 1K4EA 4O8GA 1A0KA 3Q7VB 1G5UA 5A8BA 1PWDA 4GDNA 3VFHA 1U60A 3UE1A 1LHYA 4IUHA 2VGLM 3LYXA 3KX0X 2WGWA 4KG6A 1OJGA 1TVFA 2ZBBA 4KZ5A 3FC7A 3OCLA 3D9YA 4Y0TA 1N9NA 5F68A 3R7WB 3CPTB 1W63M 2WUQA 1QMEA 3SOIA 4OH0A 3NBLA 3SW1A 4WMCD 2VV7A 1W7FA 3ZHHA 4ID4A 3KO6A 1YLTA 4GD8A 3K2NA 4ZJ3A 1L0FA 3LIFA 1FCOA 4G3VA 1LI0A 5FAQA 2DMWA 2HV1A 2K31A 3A3JA 3LI8A 3OPLA 2JKGA 1NLZA 1BZAA 4HI4A 4WL9A 2ZMFA 1LSXA 3JVVA 1K56A 5DVAA 5TBMB 1SDNA 4LLOB 2WADA 4LV1A 2ZQDA 3VP4A 2YKHA 3AGFA 3N8RA 1YLYA 4L9FA 3GQZA 4HIAA 3G6OA 3BFDA 3VOLA 3HUOA 2X02A 3MZEA 2ZM0A 4KQQA 5CGXA 5EV0A 1XGJA 4ZDXA 2GZAA 4JGOA 1BLCA 2ACGA 1UWNX 2ZM2A 2O99A 4CLCA 3FKWA 4LGWA 2P04A 3DWZA 1J3WA 5DKKA 3IBRA 1BT5A 4UEYA 4XUXA 2WGWB 3NJAA 5F69A 3V3RA 1XJ3A 5AVFA 4WBGA 3RFBA 4FTXA 3OPRA 3DBAA 3BEBA 1E4DA 5GLCA 4MLLA 3E4QA 4RQ9A 4BL2A 2H10A 1EWZA 3FZCA 5EPHA 4YNRA 3ZDJA 4Y17A 1OPXA 2Q0OA 2B95A 3D4FA 3MFDA 1XJ6A 2ZQ9A 3T4OA 1Z09A 2LB9A 1TS6A 3TRCA 5EVID 4F3LB 4HESA 4GHIA 4LRZE 4KUOA 2Y59A 2ZC3B 2INWA 4WMCA 5L07A 5M18A 4NEED 2XFTA 5CTMA 3HLBA 2KDKA 3HJKA 4NKPA 5EVIC 2IWCA 3VOYA 3PBTA 5HAIA 4R4SA 3DTEA 4I3IA 3O3VA 5I5LA 2HJEA 1JVJA 3E98A 1PWGA 3IX3A 1I2SA 1TS0A 1P9WA 4YWZA 1FSWA 4HQAA 2WZXA 3T4TA 5KMWA 4CLCB 1F9IA 3BJNA 4QWOA 5HARA 4QY5A 3F1OA 4IVKA 3D3OA 1YSPA 1IYSA 3MFXA 2PU4A 2H0TA 4P87A 3UE0A 2ZD8A 1HZOA 1OTAA 4G3KA 5GLDA 2Z6DA 3NIAA 2ZOHA 1EROA 2C5WB 2WKQA 5L2FA 3NCKA 4UAAA 3ITBA 4KQOA 4JXGA 4M3KA 4GCZA 4Q0JA 3W8KA 2J3TC 3VP1A 2V9AA 4MCWA 3N8SA 5FA7A 3Q82A 4NG2A 2P08A 4S2IA 4GHIB 3K3CA 4S2LA 1YM1A 4E3JA 1NJ4A 1S1YA 5FEGA 4GZBA 4H8RA 3MQOA 2E8IA 1SCWA 3BYDA 5EVIA 3Q1FA 3QNBA 4X6TA 1NRJA 2GJ3A 2OWHA 4R3BA 1KE3A 2GDNA 4FD8A 1S4RA 3EWKA 2V1BA 4ARZA 3DTKA 1L0GA 4KZ3A 4HP4A 4L9EA 1LT0A 3FV7A 2ZL1A 1FIKA 3T4QA 1RGZA 3I7JA 5HDDA 3MXQA 4DDYA 5FAPA 3F1OB 1XJ2A 2IWBA 1ZKJA 1KGFA 2VV6A 1ERQA 1LLBA 2J9OA 3GSGA 3E2LA 3RTYA 5GLAA 1PZPA 2ZLYA 3C7UA 3VMAA 3OCNA 4DF6A 4JXVA 2QHKA 3R4KA 4P0MA 1GA0A 1S66L 3LY3A 4KZAA 4U3TA 2I9VA 1YKDA 2XEPA 3CAXA 4LCMA 4I3AA 4E3KA 5CEBA 2Y4AA 5GHZA 2K2NA 5AQBA 3NHQA 4ZJ1A 2QMIA 3LIDA 3G31A 3B33A 3N7WA 2G2WA 3LR3A 5IU1A 1LI9A 5GHYA 4XT2B 5EE8A 4F94A 5FQIA 5LBRA 4HBUA 4DXCA 2WAEA 2M7UA 4CJNA 2XDMA 2DCFA 2R9WA 5EVIB 3VOZA 3EGDC 5AVEA 2B5RA 1ZG6A 3PHYA 2XD5A 4C6YA 4ARZB 4RVAA 3IHBA 3C8CA 4EQ1A 1CQAA 3HUMA 1IEMA 1BUEA 2ZL1B 3IS2B 4OLGA 4NXBA 3BRMA 4GN2A 2HP5A 2W3GA 2EX8A 1BSGA 1SKOB 1YSQA 4Y5FA 4OOMA 2VKSA 3C30A 2L4RA 4IBXA 4JXWA 1SDEA 4X1MA 4IHQA 3MMHA 3UB6A 4OQHA 1BULA 3TJZC 5DTSA 5EM0A 4OKPA 3WRTA 3LIEA 3ISGA 3ZG9B 5HPFA 3NOUC 5IS1A 3IWIA 5FI2A 2Y2QA 4DE3A 3T1QB 1IOUA 4X56A 4MDZA 3M6BA 4KG2A 3TE8A 4IBRA 2Y2KA 1IFQA 3A3EA 3IWOA 1MKIA 4BENA 1YLZA 3HBRA 4R1GA 4ETZA 1EI5A 3HLEA 3GRJA 4JLFA 5AQ7A 3UN7A 3IH9A 4FUWA 1NRFA 4IEDA 4LPZA 1S0WA 4X1LA 1H0MA 4EEPA 4UA9A 4LRYC 4GW9A 4DRTA 4E3OA 2OSUA 5EOOA 4MN6A 5JYPA 4GKUA 1PIOA 2K7SA 3A0VA 3L7HA 3HVFA 4N1XA 3ITAA 1VB6A 5AQAA 2CC1A 1ES5A 1FILA 4Y13A 1S1ZA 5CERA 4GOGA 3F1NA 2VZWA 4D2OA 2Y2JA 5FAOA 2A3UA 4FCFA 3CITA 2BTFP 3HL9A 5AJGA 4R0QA 2EXAA 2WKRA 2W3EA 2EWVA 4RYEA 2QJ5A 4FOFA 3C5AA 1HTZA 1FCMA 1FR1A 4LENA 4BBVA 3UY6A 4PM8A 3CUEC 3PYPA 4WZ5C 1ZC2A 1IKGA 2AVXA 3V39A 3MBZA 2Y79A 2VGJA 2J7VA 3W4PA 1N4OA 3G35A 5HDSA 5FASA 2FH5A 4R6LA 4JKTA 3MZDA 5IHVA 1NZUA 2D02A 4X55A 5MC7A 2P9VA 5F83A 1V9ZA 4UA7A 5A91A 4BL3A 1LSVA 1T1AA 4S2MA 1KE4A 1UWPX 2DRWA 3PR6A 5EECA 3OLOA 2JHEA 4WF0A 2Y2GA 3SS4A 4LV2A 3UPNA 5HAPA 5HWWA 1JWZA 4C3QA 3RXWA 2V0WA 3KYQA 2HP6A 1W8YA 3H7WA 2P74A 5TGFA 5F1FA 2BASA 2XLNA 3CHWP 4EBLA 3LR0A 1E25A 2V8CA 3GDIA 3TSGA 2VEAA 1L0EA 1Y54A 3LICA 4NK3A 3OPPA 4GJ4A 5CHUA 4LRXC 4GNUA 3C7VA 4PMAA 3CUEA 1QMFA 1WYBA 4WZ5A 1PRQA 3PAGA 5FEFA 1P9RA 4WELA 5HZHA 1DP6A 2P7JA 5F82A 5FL3A 2FFYA 4HEFA 5HD5A 1S67L 4U0TA 1XFQA 2EWWA 4EUZA 1X0OA 1DP8A 3UDFA 2IWDA 4EERA 2Y2IA 1OT6A 5CRFA 4MNRA 3FPVA 2I72A 1ESIA 5HSQA 1P97A 1ES2A 4GS9A 2O9AA 2CMNA 3C38A 4I38A 3HREA 4ETXA 3N4IA 1BLHA 4JGQA 4KG5A 3B42A 1DP9A 4H6JB 3V3SA 4AFIA 2ZJ9A 1K55C 2J3WA 1PZOA 5EVLA 2PR6A 3H7WB 5HX9A 1DJCA 3C4OA 5J7EA 3AGEA 3H82A 1KDWA 1O07A 2ZQ7A 2HJ9C 4RA7A 2HDSA 3M2JA 4JBFA 2HDUA 4MBHA 2ZC4B 4YOFA 1O7EA 5DF9A 3IT9A 2GX5A 3LEQA 2W0NA 4BMWA 2XQZA 4ZBEA 1GSWA 4HOIA 5TFQA 2PT7A 4OLDA 2Z6CA 2BG1A 3VE4A 3RXXA 4E3NA 2B02A 3MQQA 3E0YA 4JF5A 3PBQA 1KDSA 3LEZA 4EV4A 4ESPA 4NXGA 2Q9MA 4GS9B 3IF6C 3ZYTA 4DMZA 1D1JA 5M1AA 3VSKA 5FQKA 1S6RA 3NC8A 1Y28A 3WS4A 3CZDA 3QNCA 3CLOA 3B3XA 2O9BA 3N8LA 4HJ3A 3F1PA 5G4YA 1K55A 3H82B 4K0XA 4K91A 2PHYA 2L1MA 5KZHA 4BBTA 3T1XA 3N6IA 2Y2PA 1VETA 1MWSA 3UE3A 4LCLA 2WGVA 2ZQAA 1MWUA 4Q0IA 4MN7A 4X68A 4KZ4A 1BLPA 2KX6A 1Y4OA 4UQIS 3UNWA 3T50A 1PNEA 2VLGA 3IXHA 3SH8A 1XA1A 1ES4A 2OAQ1 2J9PA 4Y0OA 2X71A 5F6AA 2PR5A 3LY4A 1GA9A 3G32A 3SH9A 1CF0A 3ZNYA 4MBFA 3KSFA 5FQQA 3S7PA 4WM9A 1OTDA 4RX3A 1IYQA 4OP5A 3W4QA 3WRZA 5C5KA 1TD5A 3MF0A 2BLSA 2EFXA 3IF6A 4DXBA 5HPIA 1N9LA 4K0WA 4WEKA 4BQMA 1F2KA 1DY6A 4WN5A 5HFOA 2EA9A 2WKIA 2VK3A 3F1PB 1D7EA 3CMZA 5I94A 1VM1A 3B47A 4KUKA 4C75A 2EX9A 5D3OA 4MN5A 3MQ0A 1OTBA 1ACFA 5FDHA 3VSLA 2WZZA 1T18A 5DTKA 1VETB 2PYRA 4OPYA 3S7QA 1K6SA 3IX8A 4Z9QA 4B4ZA 1PW1A 3BY9A 3PTEA 1TS8A 3ZG5A 3GV9A 1AWIA 1TS7A 3PAEA 1MC0A 1OMEA 1ZTUA 3KYZA 4O7DA 1EW0A 3JYIA 1VHMA 2V20A 1JTGA 4R23A 3HLCA 4M4XA 4PM6A 3BQ8A 2KOIA 2XK1A 4I3JA 3LUQA 2ZQCA 4HBTA 1XXMA 5A93A 3LR5A 4N9KA 3UDXA 4GD6A 1PFLA 3LGOA 4KQDA 1XPBA 1SZVA 1M6KA 1F98A 2WKPA 2PRFA 4IUKA 3IF6B 1F5MA 4MEZA 4OQIA 4S2OA 4Y15A 2LB5A 4S2NC 3Q81A 1CI8A 5A92A 3CWFA 1GHPA 2XSSA 4FH2A 2QWSA 1NLYA 2HDRA 3MXRA 3QP5A 3HLFA 2W3FA 2WKEA 5FATA 1V9YA 1W63Q 3CG5A 3DTIA 3ZQ5A 1W8QA 1H3QA 1XKZA 5FI6A 2M1CA 1ERMA 3PBNA 3S7OA 1XJ4A 2V2FF 2J80A 1J9MA 3UB5P 3VFFA 1PYYA 3GECA 4KQRA 2H0YA 2JKTI 2OLVA 5HD3A 3E2KA 3ZG0A 5GLBA 5DF7A 1K25A 1MXOA 3BQAA 3U4LP 3DTMA 1YLJA 4UHUA 1PI4A 1JTDA 5KSHA 1ONHA 2PBYA 1OJ5A 3BFCA 2ZM8A 2JKTM 4NXFA 4PPRA 1CEGA 4R4RA 3QP8A 1LL8A 3WS0A 4E6XA 1MBLA 3SS3A 3ICYA 3OOVA 1T19A 4EBNA 5CX7A 1ZHHB 2XF3A 4D60A 4S2NA 1DRMA 3PBRA 5EM1A 2O0YA 1CEFA 3K3DA 5HW3A 3T1SA 4BD0A 3RH8B 5FQJA 4DJ3A 2FZ0A 3HLDA 2A24A 3UO9A 2V1AA 3UPOA 3MJQA 2WAFA 3KYEA 3LI9A 5DFXA 4A5RA 4YINA 1UGUA 4EETB 4YFMA 5GL9A 1KGGA 1LL9A 1P0ZA 3HLWA 3DWKA 3E4OA 1K4FA 4OOYA 3MSHA 2L0WA 2ZQ8A 2WGIA 1TF1A 3C2WA 2G2UA 1AXBA 2XA7S 3LIAA 5CGSA 4DJ2A 4L0LA 3NDGA 3L9KA 4OVDA 1YQSA 2UV0E 1ONGA 2H5SA 3V50A 1VQQA 1OT9A 3S4XA 4EXOA 3FPWA 1KVMA 1K38A 3BFEA 5CHMA 4E04A 4G3WA 1OTEA 1CJFA 3VP0A 2QZ6A 2XR0A 5FDSA 4NXEA 3HCYA 4HNBA 1CI9A 4BJPA 2A24B 5FQMA 1WA9A 3MXSA 1KE0A 2M7VA 2E8JA 3R7WA 2VX8A 1NZOA 3TG9A 4CPKA 3F1NB 2XROA 3FG8A 3NULA 4OPRA 3UB8A 4LV3A 2VGLS 4OP8A 4X69A 4Y7PA 3GMWA 3W2ZA 1HVBA 5EVEA 2ZMVA 1ZG4A 4X53A 3O5YA 3MR0A 2PBDP 1BTLA 3JVUA 3PBOA 3HLGA 4MBKA 1T1BA 2Z2MB 5CECA 2J8YA 1NXYA 2H28A 4DDSA 4QJGA 4PKYG 4WLAA 4EUVA 3GTCA 1GCEA 2OLUA 3A3DA 3IWQA 5KIZA 5HDCA 1K54C 3UMEA 1N9OA 4Q0HA 2C6WB 5HAQA 2P9VB 2UWXA 3FKVA 3TW8A 2Y55A 4OQ0A 3QP4A 4EU0A 2PAVP 2HDQA 4I5SA 2PD7A 2Y2NA 3JPUA 2V8FA 1ODVA 3A3IA 1STZA 2ZC6B 5TR7A 2OWJA 5CGWA 1KVLA 2JE5A 4UA6A 2VJWA 3EQVA 4EWFA 1LSWA 2EX2A 4KZ7A 3IBJA 4BLMA 4OPQA 1YPRA 1XX2A 4PM7A 5CTNA 4B9OA 2HZ5A 3NOTC 2V1ZA 4F3LA 2A2LA 1C3BA 4HY8A 1FCNA 3IH8A 1NWZA 1IELA 1NYMA 5HL6A 3WWXA 5G4ZA 1YAXA 4S2PA 4JPMA 2FFFB 1DJBA 3OC2A 1PWCA 4E3LA 2Y2LA 1MWTA 5J8XA 3FWLA 3WS2A 1YMSA 3UMDA 4P6BA 4B4XA 5F5YA 2HPBA 5AQ9A 3ULFA 1K54A 3P98A 4RX2A 2W27A 4R38A 2JCHA 3BECA 4GDBA 4DE0A 3CI6A 1H8YA 3BM6A 1MKMA 1K57C 1FOFA 1TEMA 3M6HA 3BFGA 3PBSA 3EEAA 3EEHA
chains in the Genus database with same CATH topology
1LL5A 4KG2A 1Q2PA 4IBRA 1XGIA 2Y2KA 3JYIA 3A3EA 3IWOA 1MKIA 4PM9A 3S22A 4R3JA 2V20A 4DKIA 4BENA 1JTGA 4R23A 3HLCA 1YLZA 1I2WA 3HBRA 3OZHA 4PM6A 2Y2HA 4R1GA 1EI5A 3HLEA 5F1GA 3GRJA 3S1YA 4EQIA 4JLFA 5AQ7A 3UN7A 2XK1A 3IH9A 3G2ZA 3ZVWA 1NRFA 4QU3A 4IEDA 4KZ9A 1S0WA 3VP3A 5M19A 3IQAA 1IYPA 2ZQCA 4HBTA 1DJAA 1M40A 1SKFA 1XXMA 3A3FA 4UA9A 4DRTA 2OSUA 4E3OA 5A93A 4QB8A 5EOOA 4PM5A 4ZTKA 2HP9A 4KZ6A 4N9KA 5FSRA 3UDXA 5JYPA 4GKUA 4GD6A 1PIOA 2Z2LB 1K4EA 4JF6A 3Q7VB 3HVFA 4N1XA 3ITAA 1PWDA 3Q7ZA 4GDNA 4Q8IA 1XPBA 3VFHA 1M6KA 1U60A 3UE1A 1LHYA 5AQAA 3IF5A 2CC1A 1ES5A 5CERA 4FSFA 3IF6B 4GOGA 2EXBA 3ZVTA 1SHVA 2WGWA 4KG6A 4MEZA 3HUNA 3WS1A 4OQIA 4D2OA 1ES3A 2Y2JA 5FAOA 1TVFA 2A3UA 4S2OA 4E3IA 2XGNA 4FCFA 4KZ5A 4P85A 5JYOA 3OCLA 4Y0TA 3HL9A 2A49A 4R0QA 2QPNA 2EXAA 4S2NC 3IHAA 2WUQA 4ZJ2A 1QMEA 3SOIA 2EFUA 3Q81A 1CI8A 4OH0A 3NBLA 5A92A 5BOHA 4WMCD 3ZG8B 4RYEA 1W7FA 3C5AA 3ZHHA 4ID4A 1HTZA 1GHPA 1FCMA 1YLTA 3MKEA 4GD8A 4U0XA 4ZJ3A 4FH2A 1FR1A 4LENA 3UY6A 3LCEA 1L0FA 4PM8A 1FCOA 1LI0A 4WZ5C 1ZC2A 2HDRA 5FAQA 5DF8A 3A3JA 1IKGA 3MXRA 3OPLA 3HLFA 1BZAA 2WKEA 5DTTA 3V39A 3MBZA 5FATA 2VGJA 1K57A 2J7VA 3W4PA 3CG5A 3M2KA 1K56A 5DVAA 1N4OA 3VP2A 1W8QA 3G35A 4S2JA 1WYCA 5GHXA 1SDNA 5FASA 4N1HA 1XKZA 2WADA 4LV1A 5FI6A 4JKTA 1RGYA 2ZQDA 3MZDA 5IHVA 1ERMA 3PBNA 1NZUA 4X55A 3AGFA 3SS5A 1MPLA 3VP4A 2V2FF 3BFFA 2P9VA 5F83A 3N8RA 1J9MA 1YLYA 3GQZA 4UA7A 4BL3A 5A91A 3G4PA 3VFFA 1PYYA 2Y2OA 4S2MA 3BFDA 1KE4A 4KQRA 3GVBA 2DRWA 1RP5A 2H0YA 2OLVA 3HUOA 2X02A 5EECA 3UPPA 3E2KA 3MZEA 3UDIA 3ZG0A 5GLBA 5DF7A 5U47A 4E6WA 1K25A 2ZM0A 1MXOA 2Y2GA 4KQQA 3DTMA 1XGJA 1YLJA 3O88A 4UHUA 5CGXA 1PI4A 4ZDXA 3MKFA 3SS4A 4OQGA 1JTDA 1BLCA 5KSHA 4LV2A 3RJUA 5HL1A 2ZM2A 1ONHA 3FKWA 3UPNA 1CK3A 2PBYA 5HAPA 1JWZA 2DNSA 3DWZA 3BFCA 2ZM8A 1BT5A 4XUXA 4PPRA 1CEGA 2WGWB 3V3RA 4R4RA 3RXWA 4B88A 4C3QA 5E2FA 2HP6A 1W8YA 4WBGA 3WS0A 4E6XA 1MBLA 3DW0A 3OPRA 3SS3A 2P74A 4QHCA 3BEBA 5TGFA 5F1FA 5KSCA 2XLNA 4BD1A 4EBNA 1E4DA 2ZMAA 4MLLA 5GLCA 4EBLA 2XF3A 1E25A 3TSGA 2H10A 5CHJA 4S2NA 4BL2A 1EWZA 1L0EA 1Y54A 3PBRA 3FZCA 2ZC7A 5EPHA 5FQ9A 1XP4A 3ZDJA 1CEFA 4NK3A 3OPPA 3NI9A 5HW3A 5E2GA 5CHUA 3D4FA 3MFDA 2JBFA 4IVIA 4BD0A 2ZQ9A 5FQJA 4GNUA 3C7VA 3HLDA 1N9BA 3UO9A 4PMAA 5EVID 4HESA 3UPOA 1QMFA 5EUAA 1WYBA 4JXSA 2WAFA 4GB7A 4WZ5A 3SH7A 1YMXA 2Y59A 1G68A 2ZC3B 3PAGA 4WELA 4WMCA 4DE2A 5M18A 2XFTA 5CTMA 3HLBA 2JC7A 4E3MA 1XA7A 3AGDA 5F82A 4N92A 2Y91A 2FFYA 4HEFA 5EVIC 2IWCA 4U0TA 3PBTA 5HAIA 3VOYA 4A5RA 4R4SA 2Q9NA 4KZBA 3O3VA 4YINA 4EUZA 4S2KA 3UDFA 2IWDA 2Y2IA 4YFMA 5GL9A 1KGGA 3LO7A 5CRFA 4MNRA 1LL9A 4OONA 1JVJA 2I72A 1ESIA 4XXRA 3HLWA 3O86A 3DWKA 3V5MA 1ES2A 1PWGA 1K4FA 4OOYA 1I2SA 4ZAMA 5E2EA 2WK0A 3P09A 1FSWA 1W5DA 4FH4A 2WZXA 5J8XA 2ZQ8A 5KMWA 3HREA 2XH9A 2WGIA 3N4IA 1BLHA 5HARA 4KG5A 4QY5A 2G2UA 1AXBA 1JWVA 3G2YA 4IVKA 1IYSA 2PU2A 3V3SA 5CGSA 2ZJ9A 2PU4A 2H0TA 1E3UD 1K55C 4L0LA 3NDGA 1PZOA 4Y0UA 4P87A 3EQUA 3QHYA 5EVLA 3UE0A 4OVDA 1NY0A 1YQSA 2ZD8A 1K6RA 2RL3A 5HX9A 1DJCA 1HZOA 2EX6A 1ONGA 2H5SA 3C4OA 3V50A 1VQQA 3AGEA 5CEDA 2OV5A 5GLDA 1KDWA 2VGKA 3S4XA 1O07A 3NIAA 2ZQ7A 4RA7A 2HDSA 1KVMA 1K38A 1EROA 2C5WB 4EBPA 3M2JA 3IXDA 3BFEA 5CHMA 5FI7A 3NCKA 5L2FA 4UAAA 3ITBA 1GHMA 4JBFA 4KQOA 2HDUA 4JXGA 4M3KA 4MBHA 2ZC4B 1O7EA 4OPZA 5DF9A 4NETA 3VP0A 3W8KA 2QZ6A 2XR0A 3IT9A 3VP1A 1FSYA 1CI9A 4BJPA 3N8SA 5FA7A 3Q82A 5FQMA 3MZFA 1NYYA 3MXSA 4S2IA 1KE0A 1YLWA 2XQZA 4LV0A 4ZBEA 1GHIA 5TFQA 4S2LA 1YM1A 4E3JA 4OLDA 1NZOA 2BG1A 3TG9A 4CPKA 3RXXA 1NJ4A 4E3NA 1YT4A 1W79A 3CJMA 4OPRA 4GZBA 4H8RA 4LV3A 2E8IA 4OP8A 1KGEA 4X69A 4Y7PA 1ALQA 1SCWA 3BYDA 3GMWA 1H8ZA 3Q1FA 3QNBA 1G6AA 3PBQA 1HVBA 4X6TA 5EVIA 4R3BA 2ZC5B 1KE3A 1KDSA 2GDNA 3LEZA 4FD8A 4EV4A 1ZG4A 1PI5A 4X53A 2XD1A 5E2HA 3PBOA 1BTLA 2Q9MA 1L0GA 4KZ3A 3HLGA 4MBKA 3IF6C 3FV7A 1Q2QA 5M1AA 2Z2MB 5CECA 3VSKA 2J8YA 5FQKA 1NXYA 1RGZA 1S6RA 1YLPA 3I7JA 3NC8A 4DDSA 4QJGA 3WS4A 4DDYA 3CZDA 5FAPA 3QNCA 2IWBA 1ZKJA 1KGFA 3B3XA 3GTCA 1GCEA 2OLUA 3A3DA 5A90A 1MWRA 3IXBA 3IWQA 2Y2MA 3W4OA 1ERQA 3N8LA 1RCJA 1H5XA 1LLBA 5EOEA 3TOIA 1L2SA 2J9OA 1K54C 3G34A 3GSGA 3E2LA 1K55A 3OPHA 5E43A 5GLAA 2C6WB 4K0XA 1PZPA 2ZLYA 3C7UA 3VMAA 4K91A 3OCNA 4DF6A 1L0DA 4JXVA 5HAQA 5KZHA 4P0MA 2XFSA 1GA0A 2P9VB 3LY3A 3N6IA 2Y2PA 4KZAA 4U3TA 2UWXA 3FKVA 2XEPA 1JWPA 2Y55A 1E3UA 3IXGA 1MWSA 3G30A 4OQ0A 3UE3A 4LCMA 3BLSA 4LCLA 2WGVA 4E3KA 5CEBA 2ZQAA 1WE4A 2Y4AA 5GHZA 1MWUA 2HDQA 1IKIA 5AQBA 4ZJ1A 2QMIA 4DE1A 2Y2NA 3G31A 4X68A 3NY4A 4KZ4A 1BLPA 3N7WA 2G2WA 1LI9A 4QY6A 5GHYA 4JF5A 3A3IA 2ZC6B 3UNWA 5CXWA 3IXHA 5EE8A 5TR7A 3SH8A 1XA1A 1ES4A 5CGWA 1KVLA 2JE5A 4F94A 4UA6A 5FQIA 3ZGAB 3ZFZA 2J9PA 3C4PA 3EQVA 2WKHA 4HBUA 2X71A 4Y0OA 4DXCA 4EWFA 2EX2A 1ESUA 4WZ4A 4KZ7A 4BLMA 2WAEA 4OPQA 3LY4A 1GA9A 3G32A 4CJNA 2XDMA 1XX2A 1FQGA 2DCFA 2R9WA 4PM7A 5EVIB 3SH9A 3VOZA 1I5QA 2B5RA 3ZNYA 4MBFA 5CTNA 1ZG6A 3BLMA 3Q7VA 2XD5A 2V1ZA 5FQQA 3GR2A 4C6YA 2RCXA 4RVAA 4WM9A 4RX3A 1C3BA 3IHBA 1IYQA 3HUMA 4OP5A 3W4QA 1IEMA 3WRZA 1BUEA 1FCNA 4OLGA 3IH8A 3BRMA 2BLSA 1TDGA 1IELA 3Q07A 2EFXA 3IF6A 3ZCZA 4GN2A 2HP5A 4DXBA 2EX8A 1NYMA 1BSGA 3WWXA 4S2PA 4JPMA 2FFFB 3FYZA 1HD8A 1DJBA 4K0WA 4OOMA 1BLSA 1TDLA 4WEKA 4BQMA 1DY6A 3OC2A 1PWCA 5HFOA 4IBXA 2WKIA 4JXWA 2Y2LA 1MWTA 3NDEA 3FWLA 1SDEA 1Z6FA 3ZNTA 4E3LA 4WEJA 3WS2A 4OOLA 1YMSA 3CMZA 5I94A 3O87A 1IYOA 1VM1A 4JF4A 4KENB 4P6BA 2HPBA 1MY8A 4B4XA 4C75A 2EX9A 4OQHA 5D3OA 5AQ9A 1BULA 2WYXA 1K54A 4WYYA 3P98A 4RX2A 1K56D 5DTSA 5FDHA 4OKPA 3WRTA 3WS5A 3VSLA 2WZZA 2JCHA 3ISGA 3BECA 4GDBA 3ZG9B 5DTKA 4DE0A 4KZ8A 1PW8A 4OPYA 1H8YA 1FR6A 3BM6A 1K6SA 3IWIA 4Z9QA 2X01A 4B4ZA 1PW1A 1K57C 5G18A 1FOFA 1TEMA 3M6HA 4N9LA 3ZG7B 5FI2A 3PTEA 2Y2QA 4DE3A 3BFGA 3ZG5A 4QD4A 3PBSA 3GV9A 4X56A 2R9XA 3PAEA 4XUZA 3M6BA 1OMEA 4O7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LL5 A;  4KG2 A;  1Q2P A;  4IBR A;  1XGI A;  2Y2K A;  3JYI A;  3A3E A;  3IWO A;  1MKI A;  4PM9 A;  3S22 A;  4R3J A;  2V20 A;  4DKI A;  4BEN A;  1JTG A;  4R23 A;  3HLC A;  1YLZ A;  1I2W A;  3HBR A;  3OZH A;  4PM6 A;  2Y2H A;  4R1G A;  1EI5 A;  3HLE A;  5F1G A;  3GRJ A;  3S1Y A;  4EQI A;  4JLF A;  5AQ7 A;  3UN7 A;  2XK1 A;  3IH9 A;  3G2Z A;  3ZVW A;  1NRF A;  4QU3 A;  4IED A;  4KZ9 A;  1S0W A;  3VP3 A;  5M19 A;  3IQA A;  1IYP A;  2ZQC A;  4HBT A;  1DJA A;  1M40 A;  1SKF A;  1XXM A;  3A3F A;  4UA9 A;  4DRT A;  2OSU A;  4E3O A;  5A93 A;  4QB8 A;  5EOO A;  4PM5 A;  4ZTK A;  2HP9 A;  4KZ6 A;  4N9K A;  5FSR A;  3UDX A;  5JYP A;  4GKU A;  4GD6 A;  1PIO A;  2Z2L B;  1K4E A;  4JF6 A;  3Q7V B;  3HVF A;  4N1X A;  3ITA A;  1PWD A;  3Q7Z A;  4GDN A;  4Q8I A;  1XPB A;  3VFH A;  1M6K A;  1U60 A;  3UE1 A;  1LHY A;  5AQA A;  3IF5 A;  2CC1 A;  1ES5 A;  5CER A;  4FSF A;  3IF6 B;  4GOG A;  2EXB A;  3ZVT A;  1SHV A;  2WGW A;  4KG6 A;  4MEZ A;  3HUN A;  3WS1 A;  4OQI A;  4D2O A;  1ES3 A;  2Y2J A;  5FAO A;  1TVF A;  2A3U A;  4S2O A;  4E3I A;  2XGN A;  4FCF A;  4KZ5 A;  4P85 A;  5JYO A;  3OCL A;  4Y0T A;  3HL9 A;  2A49 A;  4R0Q A;  2QPN A;  2EXA A;  4S2N C;  3IHA A;  2WUQ A;  4ZJ2 A;  1QME A;  3SOI A;  2EFU A;  3Q81 A;  1CI8 A;  4OH0 A;  3NBL A;  5A92 A;  5BOH A;  4WMC D;  3ZG8 B;  4RYE A;  1W7F A;  3C5A A;  3ZHH A;  4ID4 A;  1HTZ A;  1GHP A;  1FCM A;  1YLT A;  3MKE A;  4GD8 A;  4U0X A;  4ZJ3 A;  4FH2 A;  1FR1 A;  4LEN A;  3UY6 A;  3LCE A;  1L0F A;  4PM8 A;  1FCO A;  1LI0 A;  4WZ5 C;  1ZC2 A;  2HDR A;  5FAQ A;  5DF8 A;  3A3J A;  1IKG A;  3MXR A;  3OPL A;  3HLF A;  1BZA A;  2WKE A;  5DTT A;  3V39 A;  3MBZ A;  5FAT A;  2VGJ A;  1K57 A;  2J7V A;  3W4P A;  3CG5 A;  3M2K A;  1K56 A;  5DVA A;  1N4O A;  3VP2 A;  1W8Q A;  3G35 A;  4S2J A;  1WYC A;  5GHX A;  1SDN A;  5FAS A;  4N1H A;  1XKZ A;  2WAD A;  4LV1 A;  5FI6 A;  4JKT A;  1RGY A;  2ZQD A;  3MZD A;  5IHV A;  1ERM A;  3PBN A;  1NZU A;  4X55 A;  3AGF A;  3SS5 A;  1MPL A;  3VP4 A;  2V2F F;  3BFF A;  2P9V A;  5F83 A;  3N8R A;  1J9M A;  1YLY A;  3GQZ A;  4UA7 A;  4BL3 A;  5A91 A;  3G4P A;  3VFF A;  1PYY A;  2Y2O A;  4S2M A;  3BFD A;  1KE4 A;  4KQR A;  3GVB A;  2DRW A;  1RP5 A;  2H0Y A;  2OLV A;  3HUO A;  2X02 A;  5EEC A;  3UPP A;  3E2K A;  3MZE A;  3UDI A;  3ZG0 A;  5GLB A;  5DF7 A;  5U47 A;  4E6W A;  1K25 A;  2ZM0 A;  1MXO A;  2Y2G A;  4KQQ A;  3DTM A;  1XGJ A;  1YLJ A;  3O88 A;  4UHU A;  5CGX A;  1PI4 A;  4ZDX A;  3MKF A;  3SS4 A;  4OQG A;  1JTD A;  1BLC A;  5KSH A;  4LV2 A;  3RJU A;  5HL1 A;  2ZM2 A;  1ONH A;  3FKW A;  3UPN A;  1CK3 A;  2PBY A;  5HAP A;  1JWZ A;  2DNS A;  3DWZ A;  3BFC A;  2ZM8 A;  1BT5 A;  4XUX A;  4PPR A;  1CEG A;  2WGW B;  3V3R A;  4R4R A;  3RXW A;  4B88 A;  4C3Q A;  5E2F A;  2HP6 A;  1W8Y A;  4WBG A;  3WS0 A;  4E6X A;  1MBL A;  3DW0 A;  3OPR A;  3SS3 A;  2P74 A;  4QHC A;  3BEB A;  5TGF A;  5F1F A;  5KSC A;  2XLN A;  4BD1 A;  4EBN A;  1E4D A;  2ZMA A;  4MLL A;  5GLC A;  4EBL A;  2XF3 A;  1E25 A;  3TSG A;  2H10 A;  5CHJ A;  4S2N A;  4BL2 A;  1EWZ A;  1L0E A;  1Y54 A;  3PBR A;  3FZC A;  2ZC7 A;  5EPH A;  5FQ9 A;  1XP4 A;  3ZDJ A;  1CEF A;  4NK3 A;  3OPP A;  3NI9 A;  5HW3 A;  5E2G A;  5CHU A;  3D4F A;  3MFD A;  2JBF A;  4IVI A;  4BD0 A;  2ZQ9 A;  5FQJ A;  4GNU A;  3C7V A;  3HLD A;  1N9B A;  3UO9 A;  4PMA A;  5EVI D;  4HES A;  3UPO A;  1QMF A;  5EUA A;  1WYB A;  4JXS A;  2WAF A;  4GB7 A;  4WZ5 A;  3SH7 A;  1YMX A;  2Y59 A;  1G68 A;  2ZC3 B;  3PAG A;  4WEL A;  4WMC A;  4DE2 A;  5M18 A;  2XFT A;  5CTM A;  3HLB A;  2JC7 A;  4E3M A;  1XA7 A;  3AGD A;  5F82 A;  4N92 A;  2Y91 A;  2FFY A;  4HEF A;  5EVI C;  2IWC A;  4U0T A;  3PBT A;  5HAI A;  3VOY A;  4A5R A;  4R4S A;  2Q9N A;  4KZB A;  3O3V A;  4YIN A;  4EUZ A;  4S2K A;  3UDF A;  2IWD A;  2Y2I A;  4YFM A;  5GL9 A;  1KGG A;  3LO7 A;  5CRF A;  4MNR A;  1LL9 A;  4OON A;  1JVJ A;  2I72 A;  1ESI A;  4XXR A;  3HLW A;  3O86 A;  3DWK A;  3V5M A;  1ES2 A;  1PWG A;  1K4F A;  4OOY A;  1I2S A;  4ZAM A;  5E2E A;  2WK0 A;  3P09 A;  1FSW A;  1W5D A;  4FH4 A;  2WZX A;  5J8X A;  2ZQ8 A;  5KMW A;  3HRE A;  2XH9 A;  2WGI A;  3N4I A;  1BLH A;  5HAR A;  4KG5 A;  4QY5 A;  2G2U A;  1AXB A;  1JWV A;  3G2Y A;  4IVK A;  1IYS A;  2PU2 A;  3V3S A;  5CGS A;  2ZJ9 A;  2PU4 A;  2H0T A;  1E3U D;  1K55 C;  4L0L A;  3NDG A;  1PZO A;  4Y0U A;  4P87 A;  3EQU A;  3QHY A;  5EVL A;  3UE0 A;  4OVD A;  1NY0 A;  1YQS A;  2ZD8 A;  1K6R A;  2RL3 A;  5HX9 A;  1DJC A;  1HZO A;  2EX6 A;  1ONG A;  2H5S A;  3C4O A;  3V50 A;  1VQQ A;  3AGE A;  5CED A;  2OV5 A;  5GLD A;  1KDW A;  2VGK A;  3S4X A;  1O07 A;  3NIA A;  2ZQ7 A;  4RA7 A;  2HDS A;  1KVM A;  1K38 A;  1ERO A;  2C5W B;  4EBP A;  3M2J A;  3IXD A;  3BFE A;  5CHM A;  5FI7 A;  3NCK A;  5L2F A;  4UAA A;  3ITB A;  1GHM A;  4JBF A;  4KQO A;  2HDU A;  4JXG A;  4M3K A;  4MBH A;  2ZC4 B;  1O7E A;  4OPZ A;  5DF9 A;  4NET A;  3VP0 A;  3W8K A;  2QZ6 A;  2XR0 A;  3IT9 A;  3VP1 A;  1FSY A;  1CI9 A;  4BJP A;  3N8S A;  5FA7 A;  3Q82 A;  5FQM A;  3MZF A;  1NYY A;  3MXS A;  4S2I A;  1KE0 A;  1YLW A;  2XQZ A;  4LV0 A;  4ZBE A;  1GHI A;  5TFQ A;  4S2L A;  1YM1 A;  4E3J A;  4OLD A;  1NZO A;  2BG1 A;  3TG9 A;  4CPK A;  3RXX A;  1NJ4 A;  4E3N A;  1YT4 A;  1W79 A;  3CJM A;  4OPR A;  4GZB A;  4H8R A;  4LV3 A;  2E8I A;  4OP8 A;  1KGE A;  4X69 A;  4Y7P A;  1ALQ A;  1SCW A;  3BYD A;  3GMW A;  1H8Z A;  3Q1F A;  3QNB A;  1G6A A;  3PBQ A;  1HVB A;  4X6T A;  5EVI A;  4R3B A;  2ZC5 B;  1KE3 A;  1KDS A;  2GDN A;  3LEZ A;  4FD8 A;  4EV4 A;  1ZG4 A;  1PI5 A;  4X53 A;  2XD1 A;  5E2H A;  3PBO A;  1BTL A;  2Q9M A;  1L0G A;  4KZ3 A;  3HLG A;  4MBK A;  3IF6 C;  3FV7 A;  1Q2Q A;  5M1A A;  2Z2M B;  5CEC A;  3VSK A;  2J8Y A;  5FQK A;  1NXY A;  1RGZ A;  1S6R A;  1YLP A;  3I7J A;  3NC8 A;  4DDS A;  4QJG A;  3WS4 A;  4DDY A;  3CZD A;  5FAP A;  3QNC A;  2IWB A;  1ZKJ A;  1KGF A;  3B3X A;  3GTC A;  1GCE A;  2OLU A;  3A3D A;  5A90 A;  1MWR A;  3IXB A;  3IWQ A;  2Y2M A;  3W4O A;  1ERQ A;  3N8L A;  1RCJ A;  1H5X A;  1LLB A;  5EOE A;  3TOI A;  1L2S A;  2J9O A;  1K54 C;  3G34 A;  3GSG A;  3E2L A;  1K55 A;  3OPH A;  5E43 A;  5GLA A;  2C6W B;  4K0X A;  1PZP A;  2ZLY A;  3C7U A;  3VMA A;  4K91 A;  3OCN A;  4DF6 A;  1L0D A;  4JXV A;  5HAQ A;  5KZH A;  4P0M A;  2XFS A;  1GA0 A;  2P9V B;  3LY3 A;  3N6I A;  2Y2P A;  4KZA A;  4U3T A;  2UWX A;  3FKV A;  2XEP A;  1JWP A;  2Y55 A;  1E3U A;  3IXG A;  1MWS A;  3G30 A;  4OQ0 A;  3UE3 A;  4LCM A;  3BLS A;  4LCL A;  2WGV A;  4E3K A;  5CEB A;  2ZQA A;  1WE4 A;  2Y4A A;  5GHZ A;  1MWU A;  2HDQ A;  1IKI A;  5AQB A;  4ZJ1 A;  2QMI A;  4DE1 A;  2Y2N A;  3G31 A;  4X68 A;  3NY4 A;  4KZ4 A;  1BLP A;  3N7W A;  2G2W A;  1LI9 A;  4QY6 A;  5GHY A;  4JF5 A;  3A3I A;  2ZC6 B;  3UNW A;  5CXW A;  3IXH A;  5EE8 A;  5TR7 A;  3SH8 A;  1XA1 A;  1ES4 A;  5CGW A;  1KVL A;  2JE5 A;  4F94 A;  4UA6 A;  5FQI A;  3ZGA B;  3ZFZ A;  2J9P A;  3C4P A;  3EQV A;  2WKH A;  4HBU A;  2X71 A;  4Y0O A;  4DXC A;  4EWF A;  2EX2 A;  1ESU A;  4WZ4 A;  4KZ7 A;  4BLM A;  2WAE A;  4OPQ A;  3LY4 A;  1GA9 A;  3G32 A;  4CJN A;  2XDM A;  1XX2 A;  1FQG A;  2DCF A;  2R9W A;  4PM7 A;  5EVI B;  3SH9 A;  3VOZ A;  1I5Q A;  2B5R A;  3ZNY A;  4MBF A;  5CTN A;  1ZG6 A;  3BLM A;  3Q7V A;  2XD5 A;  2V1Z A;  5FQQ A;  3GR2 A;  4C6Y A;  2RCX A;  4RVA A;  4WM9 A;  4RX3 A;  1C3B A;  3IHB A;  1IYQ A;  3HUM A;  4OP5 A;  3W4Q A;  1IEM A;  3WRZ A;  1BUE A;  1FCN A;  4OLG A;  3IH8 A;  3BRM A;  2BLS A;  1TDG A;  1IEL A;  3Q07 A;  2EFX A;  3IF6 A;  3ZCZ A;  4GN2 A;  2HP5 A;  4DXB A;  2EX8 A;  1NYM A;  1BSG A;  3WWX A;  4S2P A;  4JPM A;  2FFF B;  3FYZ A;  1HD8 A;  1DJB A;  4K0W A;  4OOM A;  1BLS A;  1TDL A;  4WEK A;  4BQM A;  1DY6 A;  3OC2 A;  1PWC A;  5HFO A;  4IBX A;  2WKI A;  4JXW A;  2Y2L A;  1MWT A;  3NDE A;  3FWL A;  1SDE A;  1Z6F A;  3ZNT A;  4E3L A;  4WEJ A;  3WS2 A;  4OOL A;  1YMS A;  3CMZ A;  5I94 A;  3O87 A;  1IYO A;  1VM1 A;  4JF4 A;  4KEN B;  4P6B A;  2HPB A;  1MY8 A;  4B4X A;  4C75 A;  2EX9 A;  4OQH A;  5D3O A;  5AQ9 A;  1BUL A;  2WYX A;  1K54 A;  4WYY A;  3P98 A;  4RX2 A;  1K56 D;  5DTS A;  5FDH A;  4OKP A;  3WRT A;  3WS5 A;  3VSL A;  2WZZ A;  2JCH A;  3ISG A;  3BEC A;  4GDB A;  3ZG9 B;  5DTK A;  4DE0 A;  4KZ8 A;  1PW8 A;  4OPY A;  1H8Y A;  1FR6 A;  3BM6 A;  1K6S A;  3IWI A;  4Z9Q A;  2X01 A;  4B4Z A;  1PW1 A;  1K57 C;  5G18 A;  1FOF A;  1TEM A;  3M6H A;  4N9L A;  3ZG7 B;  5FI2 A;  3PTE A;  2Y2Q A;  4DE3 A;  3BFG A;  3ZG5 A;  4QD4 A;  3PBS A;  3GV9 A;  4X56 A;  2R9X A;  3PAE A;  4XUZ A;  3M6B A;  1OME A;  4O7D A; 
#chains in the Genus database with same CATH topology
 1LL5 A;  1Q2P A;  4ME4 A;  4PM9 A;  3H9W A;  3OZH A;  2Y2H A;  2PYP A;  4R3A A;  3S1Y A;  4EQI A;  2W3D A;  1XFN A;  4KZ9 A;  4X25 A;  3IQA A;  1SKF A;  1M40 A;  4R70 A;  4PM5 A;  4ZTK A;  2HP9 A;  5FSR A;  4EES A;  5DFY A;  4HJ4 A;  4JF6 A;  4HH3 A;  4Q8I A;  3Q7Z A;  3QP2 A;  1K0K A;  1H8M A;  2MJ6 A;  3IF5 A;  4HJ6 A;  3EOI A;  4HH2 A;  2QYB A;  4IJG A;  4FSF A;  2EXB A;  3ZVT A;  1SHV A;  5IT5 A;  3WS1 A;  3HUN A;  2NUP C;  1ES3 A;  4E3I A;  5JYO A;  2XGN A;  4P85 A;  5J3W A;  2A49 A;  3EGX C;  2HF6 A;  2QPN A;  4P6Z S;  2O9C A;  3IHA A;  4ZJ2 A;  2EFU A;  3T4L A;  5BOH A;  3ZG8 B;  3MKE A;  4U0X A;  3LCE A;  4Z1W A;  5DF8 A;  4II7 A;  5DTT A;  5HWV A;  1K57 A;  3M2K A;  3VP2 A;  4S2J A;  1WYC A;  5GHX A;  4K08 A;  4N1H A;  1RGY A;  3SS5 A;  1MPL A;  3BFF A;  2J3T D;  3KSH A;  2HGV A;  3G4P A;  2Y2O A;  3GVB A;  1RP5 A;  3VE3 A;  2JKR I;  4Y3I A;  3UPP A;  3UDI A;  4P6Z M;  5U47 A;  4UQI M;  4E6W A;  3O88 A;  4DN0 A;  3MKF A;  4OQG A;  3RJU A;  5HL1 A;  1CK3 A;  2DNS A;  4XT2 A;  1GSX A;  3T4J A;  2V0U A;  2G7U A;  2JKR M;  4B88 A;  2W1T A;  3T4S A;  5E2F A;  2NUT C;  3DW0 A;  1S4S A;  4QHC A;  5KSC A;  1L3L A;  4BD1 A;  2ZMA A;  2R78 A;  5CHJ A;  4MMN A;  2B18 A;  2ZC7 A;  5FQ9 A;  1XP4 A;  3U2A A;  3IS2 A;  3NI9 A;  5E2G A;  3V67 A;  1T1C A;  4IVI A;  2JBF A;  3VV4 A;  1SKO A;  2IA2 A;  2PDR A;  3NEC A;  5DJT A;  1N9B A;  5TJJ A;  5EUA A;  4I39 A;  4JXS A;  4GB7 A;  1YMX A;  1G68 A;  4DE2 A;  3NOP C;  3SZT A;  2JC7 A;  2VA0 A;  4E3M A;  1XA7 A;  3AGD A;  4N92 A;  2Y91 A;  3LR4 A;  3LIB A;  2Q9N A;  2W1R A;  4KZB A;  4S2K A;  4HHD A;  3LO7 A;  4OON A;  4XXR A;  3O86 A;  3V5M A;  3HJI A;  4ZAM A;  5E2E A;  2WK0 A;  3P09 A;  1W5D A;  3QP1 A;  4FH4 A;  2XH9 A;  1JWV A;  3G2Y A;  2PU2 A;  1E3U D;  1D06 A;  4Y0U A;  3EQU A;  3QHY A;  2W1T B;  1NY0 A;  1K6R A;  1VEU A;  2RL3 A;  2EX6 A;  5CED A;  2VGK A;  3D72 A;  3S7N A;  4EBP A;  3IXD A;  5FI7 A;  1GHM A;  3PXP A;  4QPR A;  4OPZ A;  4NET A;  4EEU A;  3UB7 A;  3DAV A;  1FSY A;  3MZF A;  1NYY A;  1YLW A;  3UB9 A;  1KOU A;  4LV0 A;  1GHI A;  4B93 A;  3A0S A;  4ZRR A;  1YT4 A;  1W79 A;  4O01 A;  3CJM A;  3MS6 A;  1KGE A;  1ALQ A;  5L10 A;  1H8Z A;  1G6A A;  2JKF A;  2ZC5 B;  4GLQ A;  1PI5 A;  2XD1 A;  5E2H A;  2QJ7 A;  5L09 A;  1Q2Q A;  2OOL A;  1YLP A;  2D01 A;  5A90 A;  1MWR A;  3IXB A;  2Y2M A;  3W4O A;  1RCJ A;  1H5X A;  4PAU A;  5EOE A;  5HWT A;  3TOI A;  1L2S A;  1VEU B;  3G34 A;  3OPH A;  5E43 A;  4CLC E;  4JGR A;  1G6O A;  1L0D A;  5EFW A;  3KSI A;  1BYW A;  4WUJ A;  2XFS A;  2ZOI A;  4L9G A;  3IXG A;  1JWP A;  2GNX A;  1E3U A;  1MZU A;  3G30 A;  3BLS A;  3QP6 A;  1WE4 A;  5K5B A;  2XRN A;  1IKI A;  2QKP A;  1OTI A;  4DE1 A;  3NY4 A;  4QY6 A;  3A0R A;  2PD8 A;  3T1R A;  5CXW A;  4HP9 A;  1HLU P;  3P01 A;  5L8M A;  3ZGA B;  2OAP 1;  3ZFZ A;  3C4P A;  2WKH A;  3UE6 A;  5DKL A;  1ESU A;  4WZ4 A;  4PHT A;  1FQG A;  1G28 A;  4CQH A;  1I5Q A;  2W3H A;  3BLM A;  3BY8 A;  3Q7V A;  4JGP A;  3GR2 A;  2RCX A;  4EW7 A;  1TDG A;  3Q07 A;  5DJU A;  3ZCZ A;  3FYZ A;  1HD8 A;  1BLS A;  1TDL A;  3E4P A;  3NDE A;  1Z6F A;  3ZNT A;  1GSV A;  3CPT A;  4WEJ A;  4OOL A;  3IX4 A;  3OBF A;  3O87 A;  3P7N A;  5J4E A;  1IYO A;  4JF4 A;  4KEN B;  1MY8 A;  3BWL A;  4BWI A;  2WYX A;  4WYY A;  1K56 D;  3LFV A;  3WS5 A;  2XA7 M;  2VV8 A;  3T12 B;  4KZ8 A;  1PW8 A;  1FR6 A;  4BBU A;  2X01 A;  5G18 A;  3ZG7 B;  4N9L A;  4LFU A;  4H6J A;  4PKY A;  3KSG A;  2YKF A;  4QD4 A;  2R9X A;  2Y8H A;  4XUZ A;  3SH7 A;  2OV5 A;  1XGI A;  3S22 A;  5TBM A;  4R3J A;  4DKI A;  2JN7 A;  5F1G A;  1I2W A;  3ZVW A;  3G2Z A;  4CLC D;  4QU3 A;  1JNU A;  3VP3 A;  5M19 A;  1IYP A;  3BW6 A;  1DJA A;  3A3F A;  4Y2F A;  4O0P A;  4QB8 A;  2KLI A;  4KZ6 A;  3T4K A;  4CLC C;  2Z2L B;  1K4E A;  4O8G A;  1A0K A;  3Q7V B;  1G5U A;  5A8B A;  1PWD A;  4GDN A;  3VFH A;  1U60 A;  3UE1 A;  1LHY A;  4IUH A;  2VGL M;  3LYX A;  3KX0 X;  2WGW A;  4KG6 A;  1OJG A;  1TVF A;  2ZBB A;  4KZ5 A;  3FC7 A;  3OCL A;  3D9Y A;  4Y0T A;  1N9N A;  5F68 A;  3R7W B;  3CPT B;  1W63 M;  2WUQ A;  1QME A;  3SOI A;  4OH0 A;  3NBL A;  3SW1 A;  4WMC D;  2VV7 A;  1W7F A;  3ZHH A;  4ID4 A;  3KO6 A;  1YLT A;  4GD8 A;  3K2N A;  4ZJ3 A;  1L0F A;  3LIF A;  1FCO A;  4G3V A;  1LI0 A;  5FAQ A;  2DMW A;  2HV1 A;  2K31 A;  3A3J A;  3LI8 A;  3OPL A;  2JKG A;  1NLZ A;  1BZA A;  4HI4 A;  4WL9 A;  2ZMF A;  1LSX A;  3JVV A;  1K56 A;  5DVA A;  5TBM B;  1SDN A;  4LLO B;  2WAD A;  4LV1 A;  2ZQD A;  3VP4 A;  2YKH A;  3AGF A;  3N8R A;  1YLY A;  4L9F A;  3GQZ A;  4HIA A;  3G6O A;  3BFD A;  3VOL A;  3HUO A;  2X02 A;  3MZE A;  2ZM0 A;  4KQQ A;  5CGX A;  5EV0 A;  1XGJ A;  4ZDX A;  2GZA A;  4JGO A;  1BLC A;  2ACG A;  1UWN X;  2ZM2 A;  2O99 A;  4CLC A;  3FKW A;  4LGW A;  2P04 A;  3DWZ A;  1J3W A;  5DKK A;  3IBR A;  1BT5 A;  4UEY A;  4XUX A;  2WGW B;  3NJA A;  5F69 A;  3V3R A;  1XJ3 A;  5AVF A;  4WBG A;  3RFB A;  4FTX A;  3OPR A;  3DBA A;  3BEB A;  1E4D A;  5GLC A;  4MLL A;  3E4Q A;  4RQ9 A;  4BL2 A;  2H10 A;  1EWZ A;  3FZC A;  5EPH A;  4YNR A;  3ZDJ A;  4Y17 A;  1OPX A;  2Q0O A;  2B95 A;  3D4F A;  3MFD A;  1XJ6 A;  2ZQ9 A;  3T4O A;  1Z09 A;  2LB9 A;  1TS6 A;  3TRC A;  5EVI D;  4F3L B;  4HES A;  4GHI A;  4LRZ E;  4KUO A;  2Y59 A;  2ZC3 B;  2INW A;  4WMC A;  5L07 A;  5M18 A;  4NEE D;  2XFT A;  5CTM A;  3HLB A;  2KDK A;  3HJK A;  4NKP A;  5EVI C;  2IWC A;  3VOY A;  3PBT A;  5HAI A;  4R4S A;  3DTE A;  4I3I A;  3O3V A;  5I5L A;  2HJE A;  1JVJ A;  3E98 A;  1PWG A;  3IX3 A;  1I2S A;  1TS0 A;  1P9W A;  4YWZ A;  1FSW A;  4HQA A;  2WZX A;  3T4T A;  5KMW A;  4CLC B;  1F9I A;  3BJN A;  4QWO A;  5HAR A;  4QY5 A;  3F1O A;  4IVK A;  3D3O A;  1YSP A;  1IYS A;  3MFX A;  2PU4 A;  2H0T A;  4P87 A;  3UE0 A;  2ZD8 A;  1HZO A;  1OTA A;  4G3K A;  5GLD A;  2Z6D A;  3NIA A;  2ZOH A;  1ERO A;  2C5W B;  2WKQ A;  5L2F A;  3NCK A;  4UAA A;  3ITB A;  4KQO A;  4JXG A;  4M3K A;  4GCZ A;  4Q0J A;  3W8K A;  2J3T C;  3VP1 A;  2V9A A;  4MCW A;  3N8S A;  5FA7 A;  3Q82 A;  4NG2 A;  2P08 A;  4S2I A;  4GHI B;  3K3C A;  4S2L A;  1YM1 A;  4E3J A;  1NJ4 A;  1S1Y A;  5FEG A;  4GZB A;  4H8R A;  3MQO A;  2E8I A;  1SCW A;  3BYD A;  5EVI A;  3Q1F A;  3QNB A;  4X6T A;  1NRJ A;  2GJ3 A;  2OWH A;  4R3B A;  1KE3 A;  2GDN A;  4FD8 A;  1S4R A;  3EWK A;  2V1B A;  4ARZ A;  3DTK A;  1L0G A;  4KZ3 A;  4HP4 A;  4L9E A;  1LT0 A;  3FV7 A;  2ZL1 A;  1FIK A;  3T4Q A;  1RGZ A;  3I7J A;  5HDD A;  3MXQ A;  4DDY A;  5FAP A;  3F1O B;  1XJ2 A;  2IWB A;  1ZKJ A;  1KGF A;  2VV6 A;  1ERQ A;  1LLB A;  2J9O A;  3GSG A;  3E2L A;  3RTY A;  5GLA A;  1PZP A;  2ZLY A;  3C7U A;  3VMA A;  3OCN A;  4DF6 A;  4JXV A;  2QHK A;  3R4K A;  4P0M A;  1GA0 A;  1S66 L;  3LY3 A;  4KZA A;  4U3T A;  2I9V A;  1YKD A;  2XEP A;  3CAX A;  4LCM A;  4I3A A;  4E3K A;  5CEB A;  2Y4A A;  5GHZ A;  2K2N A;  5AQB A;  3NHQ A;  4ZJ1 A;  2QMI A;  3LID A;  3G31 A;  3B33 A;  3N7W A;  2G2W A;  3LR3 A;  5IU1 A;  1LI9 A;  5GHY A;  4XT2 B;  5EE8 A;  4F94 A;  5FQI A;  5LBR A;  4HBU A;  4DXC A;  2WAE A;  2M7U A;  4CJN A;  2XDM A;  2DCF A;  2R9W A;  5EVI B;  3VOZ A;  3EGD C;  5AVE A;  2B5R A;  1ZG6 A;  3PHY A;  2XD5 A;  4C6Y A;  4ARZ B;  4RVA A;  3IHB A;  3C8C A;  4EQ1 A;  1CQA A;  3HUM A;  1IEM A;  1BUE A;  2ZL1 B;  3IS2 B;  4OLG A;  4NXB A;  3BRM A;  4GN2 A;  2HP5 A;  2W3G A;  2EX8 A;  1BSG A;  1SKO B;  1YSQ A;  4Y5F A;  4OOM A;  2VKS A;  3C30 A;  2L4R A;  4IBX A;  4JXW A;  1SDE A;  4X1M A;  4IHQ A;  3MMH A;  3UB6 A;  4OQH A;  1BUL A;  3TJZ C;  5DTS A;  5EM0 A;  4OKP A;  3WRT A;  3LIE A;  3ISG A;  3ZG9 B;  5HPF A;  3NOU C;  5IS1 A;  3IWI A;  5FI2 A;  2Y2Q A;  4DE3 A;  3T1Q B;  1IOU A;  4X56 A;  4MDZ A;  3M6B A;  4KG2 A;  3TE8 A;  4IBR A;  2Y2K A;  1IFQ A;  3A3E A;  3IWO A;  1MKI A;  4BEN A;  1YLZ A;  3HBR A;  4R1G A;  4ETZ A;  1EI5 A;  3HLE A;  3GRJ A;  4JLF A;  5AQ7 A;  3UN7 A;  3IH9 A;  4FUW A;  1NRF A;  4IED A;  4LPZ A;  1S0W A;  4X1L A;  1H0M A;  4EEP A;  4UA9 A;  4LRY C;  4GW9 A;  4DRT A;  4E3O A;  2OSU A;  5EOO A;  4MN6 A;  5JYP A;  4GKU A;  1PIO A;  2K7S A;  3A0V A;  3L7H A;  3HVF A;  4N1X A;  3ITA A;  1VB6 A;  5AQA A;  2CC1 A;  1ES5 A;  1FIL A;  4Y13 A;  1S1Z A;  5CER A;  4GOG A;  3F1N A;  2VZW A;  4D2O A;  2Y2J A;  5FAO A;  2A3U A;  4FCF A;  3CIT A;  2BTF P;  3HL9 A;  5AJG A;  4R0Q A;  2EXA A;  2WKR A;  2W3E A;  2EWV A;  4RYE A;  2QJ5 A;  4FOF A;  3C5A A;  1HTZ A;  1FCM A;  1FR1 A;  4LEN A;  4BBV A;  3UY6 A;  4PM8 A;  3CUE C;  3PYP A;  4WZ5 C;  1ZC2 A;  1IKG A;  2AVX A;  3V39 A;  3MBZ A;  2Y79 A;  2VGJ A;  2J7V A;  3W4P A;  1N4O A;  3G35 A;  5HDS A;  5FAS A;  2FH5 A;  4R6L A;  4JKT A;  3MZD A;  5IHV A;  1NZU A;  2D02 A;  4X55 A;  5MC7 A;  2P9V A;  5F83 A;  1V9Z A;  4UA7 A;  5A91 A;  4BL3 A;  1LSV A;  1T1A A;  4S2M A;  1KE4 A;  1UWP X;  2DRW A;  3PR6 A;  5EEC A;  3OLO A;  2JHE A;  4WF0 A;  2Y2G A;  3SS4 A;  4LV2 A;  3UPN A;  5HAP A;  5HWW A;  1JWZ A;  4C3Q A;  3RXW A;  2V0W A;  3KYQ A;  2HP6 A;  1W8Y A;  3H7W A;  2P74 A;  5TGF A;  5F1F A;  2BAS A;  2XLN A;  3CHW P;  4EBL A;  3LR0 A;  1E25 A;  2V8C A;  3GDI A;  3TSG A;  2VEA A;  1L0E A;  1Y54 A;  3LIC A;  4NK3 A;  3OPP A;  4GJ4 A;  5CHU A;  4LRX C;  4GNU A;  3C7V A;  4PMA A;  3CUE A;  1QMF A;  1WYB A;  4WZ5 A;  1PRQ A;  3PAG A;  5FEF A;  1P9R A;  4WEL A;  5HZH A;  1DP6 A;  2P7J A;  5F82 A;  5FL3 A;  2FFY A;  4HEF A;  5HD5 A;  1S67 L;  4U0T A;  1XFQ A;  2EWW A;  4EUZ A;  1X0O A;  1DP8 A;  3UDF A;  2IWD A;  4EER A;  2Y2I A;  1OT6 A;  5CRF A;  4MNR A;  3FPV A;  2I72 A;  1ESI A;  5HSQ A;  1P97 A;  1ES2 A;  4GS9 A;  2O9A A;  2CMN A;  3C38 A;  4I38 A;  3HRE A;  4ETX A;  3N4I A;  1BLH A;  4JGQ A;  4KG5 A;  3B42 A;  1DP9 A;  4H6J B;  3V3S A;  4AFI A;  2ZJ9 A;  1K55 C;  2J3W A;  1PZO A;  5EVL A;  2PR6 A;  3H7W B;  5HX9 A;  1DJC A;  3C4O A;  5J7E A;  3AGE A;  3H82 A;  1KDW A;  1O07 A;  2ZQ7 A;  2HJ9 C;  4RA7 A;  2HDS A;  3M2J A;  4JBF A;  2HDU A;  4MBH A;  2ZC4 B;  4YOF A;  1O7E A;  5DF9 A;  3IT9 A;  2GX5 A;  3LEQ A;  2W0N A;  4BMW A;  2XQZ A;  4ZBE A;  1GSW A;  4HOI A;  5TFQ A;  2PT7 A;  4OLD A;  2Z6C A;  2BG1 A;  3VE4 A;  3RXX A;  4E3N A;  2B02 A;  3MQQ A;  3E0Y A;  4JF5 A;  3PBQ A;  1KDS A;  3LEZ A;  4EV4 A;  4ESP A;  4NXG A;  2Q9M A;  4GS9 B;  3IF6 C;  3ZYT A;  4DMZ A;  1D1J A;  5M1A A;  3VSK A;  5FQK A;  1S6R A;  3NC8 A;  1Y28 A;  3WS4 A;  3CZD A;  3QNC A;  3CLO A;  3B3X A;  2O9B A;  3N8L A;  4HJ3 A;  3F1P A;  5G4Y A;  1K55 A;  3H82 B;  4K0X A;  4K91 A;  2PHY A;  2L1M A;  5KZH A;  4BBT A;  3T1X A;  3N6I A;  2Y2P A;  1VET A;  1MWS A;  3UE3 A;  4LCL A;  2WGV A;  2ZQA A;  1MWU A;  4Q0I A;  4MN7 A;  4X68 A;  4KZ4 A;  1BLP A;  2KX6 A;  1Y4O A;  4UQI S;  3UNW A;  3T50 A;  1PNE A;  2VLG A;  3IXH A;  3SH8 A;  1XA1 A;  1ES4 A;  2OAQ 1;  2J9P A;  4Y0O A;  2X71 A;  5F6A A;  2PR5 A;  3LY4 A;  1GA9 A;  3G32 A;  3SH9 A;  1CF0 A;  3ZNY A;  4MBF A;  3KSF A;  5FQQ A;  3S7P A;  4WM9 A;  1OTD A;  4RX3 A;  1IYQ A;  4OP5 A;  3W4Q A;  3WRZ A;  5C5K A;  1TD5 A;  3MF0 A;  2BLS A;  2EFX A;  3IF6 A;  4DXB A;  5HPI A;  1N9L A;  4K0W A;  4WEK A;  4BQM A;  1F2K A;  1DY6 A;  4WN5 A;  5HFO A;  2EA9 A;  2WKI A;  2VK3 A;  3F1P B;  1D7E A;  3CMZ A;  5I94 A;  1VM1 A;  3B47 A;  4KUK A;  4C75 A;  2EX9 A;  5D3O A;  4MN5 A;  3MQ0 A;  1OTB A;  1ACF A;  5FDH A;  3VSL A;  2WZZ A;  1T18 A;  5DTK A;  1VET B;  2PYR A;  4OPY A;  3S7Q A;  1K6S A;  3IX8 A;  4Z9Q A;  4B4Z A;  1PW1 A;  3BY9 A;  3PTE A;  1TS8 A;  3ZG5 A;  3GV9 A;  1AWI A;  1TS7 A;  3PAE A;  1MC0 A;  1OME A;  1ZTU A;  3KYZ A;  4O7D A;  1EW0 A;  3JYI A;  1VHM A;  2V20 A;  1JTG A;  4R23 A;  3HLC A;  4M4X A;  4PM6 A;  3BQ8 A;  2KOI A;  2XK1 A;  4I3J A;  3LUQ A;  2ZQC A;  4HBT A;  1XXM A;  5A93 A;  3LR5 A;  4N9K A;  3UDX A;  4GD6 A;  1PFL A;  3LGO A;  4KQD A;  1XPB A;  1SZV A;  1M6K A;  1F98 A;  2WKP A;  2PRF A;  4IUK A;  3IF6 B;  1F5M A;  4MEZ A;  4OQI A;  4S2O A;  4Y15 A;  2LB5 A;  4S2N C;  3Q81 A;  1CI8 A;  5A92 A;  3CWF A;  1GHP A;  2XSS A;  4FH2 A;  2QWS A;  1NLY A;  2HDR A;  3MXR A;  3QP5 A;  3HLF A;  2W3F A;  2WKE A;  5FAT A;  1V9Y A;  1W63 Q;  3CG5 A;  3DTI A;  3ZQ5 A;  1W8Q A;  1H3Q A;  1XKZ A;  5FI6 A;  2M1C A;  1ERM A;  3PBN A;  3S7O A;  1XJ4 A;  2V2F F;  2J80 A;  1J9M A;  3UB5 P;  3VFF A;  1PYY A;  3GEC A;  4KQR A;  2H0Y A;  2JKT I;  2OLV A;  5HD3 A;  3E2K A;  3ZG0 A;  5GLB A;  5DF7 A;  1K25 A;  1MXO A;  3BQA A;  3U4L P;  3DTM A;  1YLJ A;  4UHU A;  1PI4 A;  1JTD A;  5KSH A;  1ONH A;  2PBY A;  1OJ5 A;  3BFC A;  2ZM8 A;  2JKT M;  4NXF A;  4PPR A;  1CEG A;  4R4R A;  3QP8 A;  1LL8 A;  3WS0 A;  4E6X A;  1MBL A;  3SS3 A;  3ICY A;  3OOV A;  1T19 A;  4EBN A;  5CX7 A;  1ZHH B;  2XF3 A;  4D60 A;  4S2N A;  1DRM A;  3PBR A;  5EM1 A;  2O0Y A;  1CEF A;  3K3D A;  5HW3 A;  3T1S A;  4BD0 A;  3RH8 B;  5FQJ A;  4DJ3 A;  2FZ0 A;  3HLD A;  2A24 A;  3UO9 A;  2V1A A;  3UPO A;  3MJQ A;  2WAF A;  3KYE A;  3LI9 A;  5DFX A;  4A5R A;  4YIN A;  1UGU A;  4EET B;  4YFM A;  5GL9 A;  1KGG A;  1LL9 A;  1P0Z A;  3HLW A;  3DWK A;  3E4O A;  1K4F A;  4OOY A;  3MSH A;  2L0W A;  2ZQ8 A;  2WGI A;  1TF1 A;  3C2W A;  2G2U A;  1AXB A;  2XA7 S;  3LIA A;  5CGS A;  4DJ2 A;  4L0L A;  3NDG A;  3L9K A;  4OVD A;  1YQS A;  2UV0 E;  1ONG A;  2H5S A;  3V50 A;  1VQQ A;  1OT9 A;  3S4X A;  4EXO A;  3FPW A;  1KVM A;  1K38 A;  3BFE A;  5CHM A;  4E04 A;  4G3W A;  1OTE A;  1CJF A;  3VP0 A;  2QZ6 A;  2XR0 A;  5FDS A;  4NXE A;  3HCY A;  4HNB A;  1CI9 A;  4BJP A;  2A24 B;  5FQM A;  1WA9 A;  3MXS A;  1KE0 A;  2M7V A;  2E8J A;  3R7W A;  2VX8 A;  1NZO A;  3TG9 A;  4CPK A;  3F1N B;  2XRO A;  3FG8 A;  3NUL A;  4OPR A;  3UB8 A;  4LV3 A;  2VGL S;  4OP8 A;  4X69 A;  4Y7P A;  3GMW A;  3W2Z A;  1HVB A;  5EVE A;  2ZMV A;  1ZG4 A;  4X53 A;  3O5Y A;  3MR0 A;  2PBD P;  1BTL A;  3JVU A;  3PBO A;  3HLG A;  4MBK A;  1T1B A;  2Z2M B;  5CEC A;  2J8Y A;  1NXY A;  2H28 A;  4DDS A;  4QJG A;  4PKY G;  4WLA A;  4EUV A;  3GTC A;  1GCE A;  2OLU A;  3A3D A;  3IWQ A;  5KIZ A;  5HDC A;  1K54 C;  3UME A;  1N9O A;  4Q0H A;  2C6W B;  5HAQ A;  2P9V B;  2UWX A;  3FKV A;  3TW8 A;  2Y55 A;  4OQ0 A;  3QP4 A;  4EU0 A;  2PAV P;  2HDQ A;  4I5S A;  2PD7 A;  2Y2N A;  3JPU A;  2V8F A;  1ODV A;  3A3I A;  1STZ A;  2ZC6 B;  5TR7 A;  2OWJ A;  5CGW A;  1KVL A;  2JE5 A;  4UA6 A;  2VJW A;  3EQV A;  4EWF A;  1LSW A;  2EX2 A;  4KZ7 A;  3IBJ A;  4BLM A;  4OPQ A;  1YPR A;  1XX2 A;  4PM7 A;  5CTN A;  4B9O A;  2HZ5 A;  3NOT C;  2V1Z A;  4F3L A;  2A2L A;  1C3B A;  4HY8 A;  1FCN A;  3IH8 A;  1NWZ A;  1IEL A;  1NYM A;  5HL6 A;  3WWX A;  5G4Z A;  1YAX A;  4S2P A;  4JPM A;  2FFF B;  1DJB A;  3OC2 A;  1PWC A;  4E3L A;  2Y2L A;  1MWT A;  5J8X A;  3FWL A;  3WS2 A;  1YMS A;  3UMD A;  4P6B A;  4B4X A;  5F5Y A;  2HPB A;  5AQ9 A;  3ULF A;  1K54 A;  3P98 A;  4RX2 A;  2W27 A;  4R38 A;  2JCH A;  3BEC A;  4GDB A;  4DE0 A;  3CI6 A;  1H8Y A;  3BM6 A;  1MKM A;  1K57 C;  1FOF A;  1TEM A;  3M6H A;  3BFG A;  3PBS A;  3EEA A;  3EEH A; 
#chains in the Genus database with same CATH homology
 1LL5 A;  4KG2 A;  1Q2P A;  4IBR A;  1XGI A;  2Y2K A;  3JYI A;  3A3E A;  3IWO A;  1MKI A;  4PM9 A;  3S22 A;  4R3J A;  2V20 A;  4DKI A;  4BEN A;  1JTG A;  4R23 A;  3HLC A;  1YLZ A;  1I2W A;  3HBR A;  3OZH A;  4PM6 A;  2Y2H A;  4R1G A;  1EI5 A;  3HLE A;  5F1G A;  3GRJ A;  3S1Y A;  4EQI A;  4JLF A;  5AQ7 A;  3UN7 A;  2XK1 A;  3IH9 A;  3G2Z A;  3ZVW A;  1NRF A;  4QU3 A;  4IED A;  4KZ9 A;  1S0W A;  3VP3 A;  5M19 A;  3IQA A;  1IYP A;  2ZQC A;  4HBT A;  1DJA A;  1M40 A;  1SKF A;  1XXM A;  3A3F A;  4UA9 A;  4DRT A;  2OSU A;  4E3O A;  5A93 A;  4QB8 A;  5EOO A;  4PM5 A;  4ZTK A;  2HP9 A;  4KZ6 A;  4N9K A;  5FSR A;  3UDX A;  5JYP A;  4GKU A;  4GD6 A;  1PIO A;  2Z2L B;  1K4E A;  4JF6 A;  3Q7V B;  3HVF A;  4N1X A;  3ITA A;  1PWD A;  3Q7Z A;  4GDN A;  4Q8I A;  1XPB A;  3VFH A;  1M6K A;  1U60 A;  3UE1 A;  1LHY A;  5AQA A;  3IF5 A;  2CC1 A;  1ES5 A;  5CER A;  4FSF A;  3IF6 B;  4GOG A;  2EXB A;  3ZVT A;  1SHV A;  2WGW A;  4KG6 A;  4MEZ A;  3HUN A;  3WS1 A;  4OQI A;  4D2O A;  1ES3 A;  2Y2J A;  5FAO A;  1TVF A;  2A3U A;  4S2O A;  4E3I A;  2XGN A;  4FCF A;  4KZ5 A;  4P85 A;  5JYO A;  3OCL A;  4Y0T A;  3HL9 A;  2A49 A;  4R0Q A;  2QPN A;  2EXA A;  4S2N C;  3IHA A;  2WUQ A;  4ZJ2 A;  1QME A;  3SOI A;  2EFU A;  3Q81 A;  1CI8 A;  4OH0 A;  3NBL A;  5A92 A;  5BOH A;  4WMC D;  3ZG8 B;  4RYE A;  1W7F A;  3C5A A;  3ZHH A;  4ID4 A;  1HTZ A;  1GHP A;  1FCM A;  1YLT A;  3MKE A;  4GD8 A;  4U0X A;  4ZJ3 A;  4FH2 A;  1FR1 A;  4LEN A;  3UY6 A;  3LCE A;  1L0F A;  4PM8 A;  1FCO A;  1LI0 A;  4WZ5 C;  1ZC2 A;  2HDR A;  5FAQ A;  5DF8 A;  3A3J A;  1IKG A;  3MXR A;  3OPL A;  3HLF A;  1BZA A;  2WKE A;  5DTT A;  3V39 A;  3MBZ A;  5FAT A;  2VGJ A;  1K57 A;  2J7V A;  3W4P A;  3CG5 A;  3M2K A;  1K56 A;  5DVA A;  1N4O A;  3VP2 A;  1W8Q A;  3G35 A;  4S2J A;  1WYC A;  5GHX A;  1SDN A;  5FAS A;  4N1H A;  1XKZ A;  2WAD A;  4LV1 A;  5FI6 A;  4JKT A;  1RGY A;  2ZQD A;  3MZD A;  5IHV A;  1ERM A;  3PBN A;  1NZU A;  4X55 A;  3AGF A;  3SS5 A;  1MPL A;  3VP4 A;  2V2F F;  3BFF A;  2P9V A;  5F83 A;  3N8R A;  1J9M A;  1YLY A;  3GQZ A;  4UA7 A;  4BL3 A;  5A91 A;  3G4P A;  3VFF A;  1PYY A;  2Y2O A;  4S2M A;  3BFD A;  1KE4 A;  4KQR A;  3GVB A;  2DRW A;  1RP5 A;  2H0Y A;  2OLV A;  3HUO A;  2X02 A;  5EEC A;  3UPP A;  3E2K A;  3MZE A;  3UDI A;  3ZG0 A;  5GLB A;  5DF7 A;  5U47 A;  4E6W A;  1K25 A;  2ZM0 A;  1MXO A;  2Y2G A;  4KQQ A;  3DTM A;  1XGJ A;  1YLJ A;  3O88 A;  4UHU A;  5CGX A;  1PI4 A;  4ZDX A;  3MKF A;  3SS4 A;  4OQG A;  1JTD A;  1BLC A;  5KSH A;  4LV2 A;  3RJU A;  5HL1 A;  2ZM2 A;  1ONH A;  3FKW A;  3UPN A;  1CK3 A;  2PBY A;  5HAP A;  1JWZ A;  2DNS A;  3DWZ A;  3BFC A;  2ZM8 A;  1BT5 A;  4XUX A;  4PPR A;  1CEG A;  2WGW B;  3V3R A;  4R4R A;  3RXW A;  4B88 A;  4C3Q A;  5E2F A;  2HP6 A;  1W8Y A;  4WBG A;  3WS0 A;  4E6X A;  1MBL A;  3DW0 A;  3OPR A;  3SS3 A;  2P74 A;  4QHC A;  3BEB A;  5TGF A;  5F1F A;  5KSC A;  2XLN A;  4BD1 A;  4EBN A;  1E4D A;  2ZMA A;  4MLL A;  5GLC A;  4EBL A;  2XF3 A;  1E25 A;  3TSG A;  2H10 A;  5CHJ A;  4S2N A;  4BL2 A;  1EWZ A;  1L0E A;  1Y54 A;  3PBR A;  3FZC A;  2ZC7 A;  5EPH A;  5FQ9 A;  1XP4 A;  3ZDJ A;  1CEF A;  4NK3 A;  3OPP A;  3NI9 A;  5HW3 A;  5E2G A;  5CHU A;  3D4F A;  3MFD A;  2JBF A;  4IVI A;  4BD0 A;  2ZQ9 A;  5FQJ A;  4GNU A;  3C7V A;  3HLD A;  1N9B A;  3UO9 A;  4PMA A;  5EVI D;  4HES A;  3UPO A;  1QMF A;  5EUA A;  1WYB A;  4JXS A;  2WAF A;  4GB7 A;  4WZ5 A;  3SH7 A;  1YMX A;  2Y59 A;  1G68 A;  2ZC3 B;  3PAG A;  4WEL A;  4WMC A;  4DE2 A;  5M18 A;  2XFT A;  5CTM A;  3HLB A;  2JC7 A;  4E3M A;  1XA7 A;  3AGD A;  5F82 A;  4N92 A;  2Y91 A;  2FFY A;  4HEF A;  5EVI C;  2IWC A;  4U0T A;  3PBT A;  5HAI A;  3VOY A;  4A5R A;  4R4S A;  2Q9N A;  4KZB A;  3O3V A;  4YIN A;  4EUZ A;  4S2K A;  3UDF A;  2IWD A;  2Y2I A;  4YFM A;  5GL9 A;  1KGG A;  3LO7 A;  5CRF A;  4MNR A;  1LL9 A;  4OON A;  1JVJ A;  2I72 A;  1ESI A;  4XXR A;  3HLW A;  3O86 A;  3DWK A;  3V5M A;  1ES2 A;  1PWG A;  1K4F A;  4OOY A;  1I2S A;  4ZAM A;  5E2E A;  2WK0 A;  3P09 A;  1FSW A;  1W5D A;  4FH4 A;  2WZX A;  5J8X A;  2ZQ8 A;  5KMW A;  3HRE A;  2XH9 A;  2WGI A;  3N4I A;  1BLH A;  5HAR A;  4KG5 A;  4QY5 A;  2G2U A;  1AXB A;  1JWV A;  3G2Y A;  4IVK A;  1IYS A;  2PU2 A;  3V3S A;  5CGS A;  2ZJ9 A;  2PU4 A;  2H0T A;  1E3U D;  1K55 C;  4L0L A;  3NDG A;  1PZO A;  4Y0U A;  4P87 A;  3EQU A;  3QHY A;  5EVL A;  3UE0 A;  4OVD A;  1NY0 A;  1YQS A;  2ZD8 A;  1K6R A;  2RL3 A;  5HX9 A;  1DJC A;  1HZO A;  2EX6 A;  1ONG A;  2H5S A;  3C4O A;  3V50 A;  1VQQ A;  3AGE A;  5CED A;  2OV5 A;  5GLD A;  1KDW A;  2VGK A;  3S4X A;  1O07 A;  3NIA A;  2ZQ7 A;  4RA7 A;  2HDS A;  1KVM A;  1K38 A;  1ERO A;  2C5W B;  4EBP A;  3M2J A;  3IXD A;  3BFE A;  5CHM A;  5FI7 A;  3NCK A;  5L2F A;  4UAA A;  3ITB A;  1GHM A;  4JBF A;  4KQO A;  2HDU A;  4JXG A;  4M3K A;  4MBH A;  2ZC4 B;  1O7E A;  4OPZ A;  5DF9 A;  4NET A;  3VP0 A;  3W8K A;  2QZ6 A;  2XR0 A;  3IT9 A;  3VP1 A;  1FSY A;  1CI9 A;  4BJP A;  3N8S A;  5FA7 A;  3Q82 A;  5FQM A;  3MZF A;  1NYY A;  3MXS A;  4S2I A;  1KE0 A;  1YLW A;  2XQZ A;  4LV0 A;  4ZBE A;  1GHI A;  5TFQ A;  4S2L A;  1YM1 A;  4E3J A;  4OLD A;  1NZO A;  2BG1 A;  3TG9 A;  4CPK A;  3RXX A;  1NJ4 A;  4E3N A;  1YT4 A;  1W79 A;  3CJM A;  4OPR A;  4GZB A;  4H8R A;  4LV3 A;  2E8I A;  4OP8 A;  1KGE A;  4X69 A;  4Y7P A;  1ALQ A;  1SCW A;  3BYD A;  3GMW A;  1H8Z A;  3Q1F A;  3QNB A;  1G6A A;  3PBQ A;  1HVB A;  4X6T A;  5EVI A;  4R3B A;  2ZC5 B;  1KE3 A;  1KDS A;  2GDN A;  3LEZ A;  4FD8 A;  4EV4 A;  1ZG4 A;  1PI5 A;  4X53 A;  2XD1 A;  5E2H A;  3PBO A;  1BTL A;  2Q9M A;  1L0G A;  4KZ3 A;  3HLG A;  4MBK A;  3IF6 C;  3FV7 A;  1Q2Q A;  5M1A A;  2Z2M B;  5CEC A;  3VSK A;  2J8Y A;  5FQK A;  1NXY A;  1RGZ A;  1S6R A;  1YLP A;  3I7J A;  3NC8 A;  4DDS A;  4QJG A;  3WS4 A;  4DDY A;  3CZD A;  5FAP A;  3QNC A;  2IWB A;  1ZKJ A;  1KGF A;  3B3X A;  3GTC A;  1GCE A;  2OLU A;  3A3D A;  5A90 A;  1MWR A;  3IXB A;  3IWQ A;  2Y2M A;  3W4O A;  1ERQ A;  3N8L A;  1RCJ A;  1H5X A;  1LLB A;  5EOE A;  3TOI A;  1L2S A;  2J9O A;  1K54 C;  3G34 A;  3GSG A;  3E2L A;  1K55 A;  3OPH A;  5E43 A;  5GLA A;  2C6W B;  4K0X A;  1PZP A;  2ZLY A;  3C7U A;  3VMA A;  4K91 A;  3OCN A;  4DF6 A;  1L0D A;  4JXV A;  5HAQ A;  5KZH A;  4P0M A;  2XFS A;  1GA0 A;  2P9V B;  3LY3 A;  3N6I A;  2Y2P A;  4KZA A;  4U3T A;  2UWX A;  3FKV A;  2XEP A;  1JWP A;  2Y55 A;  1E3U A;  3IXG A;  1MWS A;  3G30 A;  4OQ0 A;  3UE3 A;  4LCM A;  3BLS A;  4LCL A;  2WGV A;  4E3K A;  5CEB A;  2ZQA A;  1WE4 A;  2Y4A A;  5GHZ A;  1MWU A;  2HDQ A;  1IKI A;  5AQB A;  4ZJ1 A;  2QMI A;  4DE1 A;  2Y2N A;  3G31 A;  4X68 A;  3NY4 A;  4KZ4 A;  1BLP A;  3N7W A;  2G2W A;  1LI9 A;  4QY6 A;  5GHY A;  4JF5 A;  3A3I A;  2ZC6 B;  3UNW A;  5CXW A;  3IXH A;  5EE8 A;  5TR7 A;  3SH8 A;  1XA1 A;  1ES4 A;  5CGW A;  1KVL A;  2JE5 A;  4F94 A;  4UA6 A;  5FQI A;  3ZGA B;  3ZFZ A;  2J9P A;  3C4P A;  3EQV A;  2WKH A;  4HBU A;  2X71 A;  4Y0O A;  4DXC A;  4EWF A;  2EX2 A;  1ESU A;  4WZ4 A;  4KZ7 A;  4BLM A;  2WAE A;  4OPQ A;  3LY4 A;  1GA9 A;  3G32 A;  4CJN A;  2XDM A;  1XX2 A;  1FQG A;  2DCF A;  2R9W A;  4PM7 A;  5EVI B;  3SH9 A;  3VOZ A;  1I5Q A;  2B5R A;  3ZNY A;  4MBF A;  5CTN A;  1ZG6 A;  3BLM A;  3Q7V A;  2XD5 A;  2V1Z A;  5FQQ A;  3GR2 A;  4C6Y A;  2RCX A;  4RVA A;  4WM9 A;  4RX3 A;  1C3B A;  3IHB A;  1IYQ A;  3HUM A;  4OP5 A;  3W4Q A;  1IEM A;  3WRZ A;  1BUE A;  1FCN A;  4OLG A;  3IH8 A;  3BRM A;  2BLS A;  1TDG A;  1IEL A;  3Q07 A;  2EFX A;  3IF6 A;  3ZCZ A;  4GN2 A;  2HP5 A;  4DXB A;  2EX8 A;  1NYM A;  1BSG A;  3WWX A;  4S2P A;  4JPM A;  2FFF B;  3FYZ A;  1HD8 A;  1DJB A;  4K0W A;  4OOM A;  1BLS A;  1TDL A;  4WEK A;  4BQM A;  1DY6 A;  3OC2 A;  1PWC A;  5HFO A;  4IBX A;  2WKI A;  4JXW A;  2Y2L A;  1MWT A;  3NDE A;  3FWL A;  1SDE A;  1Z6F A;  3ZNT A;  4E3L A;  4WEJ A;  3WS2 A;  4OOL A;  1YMS A;  3CMZ A;  5I94 A;  3O87 A;  1IYO A;  1VM1 A;  4JF4 A;  4KEN B;  4P6B A;  2HPB A;  1MY8 A;  4B4X A;  4C75 A;  2EX9 A;  4OQH A;  5D3O A;  5AQ9 A;  1BUL A;  2WYX A;  1K54 A;  4WYY A;  3P98 A;  4RX2 A;  1K56 D;  5DTS A;  5FDH A;  4OKP A;  3WRT A;  3WS5 A;  3VSL A;  2WZZ A;  2JCH A;  3ISG A;  3BEC A;  4GDB A;  3ZG9 B;  5DTK A;  4DE0 A;  4KZ8 A;  1PW8 A;  4OPY A;  1H8Y A;  1FR6 A;  3BM6 A;  1K6S A;  3IWI A;  4Z9Q A;  2X01 A;  4B4Z A;  1PW1 A;  1K57 C;  5G18 A;  1FOF A;  1TEM A;  3M6H A;  4N9L A;  3ZG7 B;  5FI2 A;  3PTE A;  2Y2Q A;  4DE3 A;  3BFG A;  3ZG5 A;  4QD4 A;  3PBS A;  3GV9 A;  4X56 A;  2R9X A;  3PAE A;  4XUZ A;  3M6B A;  1OME A;  4O7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...