1PZOA

Tem-1 beta-lactamase in complex with a novel, core-disrupting, allosteric inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric inhibition through core disruption.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1pzoA00
2DRWA 1MWRA 2BG1A 4WZ4A 4XUZA 3VP2A 2XFSA 3BFDA 3AGFA 1XA7A 4QJGA 2OLUA 3M2JA 5DTKA 2WKEA 5A92A 3VOZA 3VFFA 4HEFA 3A3EA 3VP3A 4PM9A 5F83A 2GDNA 4S2LA 2C6WB 1XXMA 1LI9A 3IXGA 2XD1A 3IF5A 3CJMA 3MZEA 1BULA 4OOLA 4BENA 1FOFA 3OPLA 1NZUA 5CHMA 1Z6FA 3NDEA 3V39A 4CPKA 4N9LA 1EI5A 3LEZA 1QMEA 3N7WA 2UWXA 4D2OA 4BD0A 4RVAA 3O87A 1W8YA 2Y2IA 1ZG4A 4MBKA 3W4OA 5AQBA 3PBRA 5CRFA 4QD4A 2WGWA 3GMWA 1BTLA 2XF3A 3SH9A 1S6RA 2EXAA 4KQQA 3UDXA 5JYOA 4FH2A 4EBNA 4R3JA 2HDUA 4P0MA 1M6KA 4Y7PA 2EFXA 2G2WA 3MXRA 5KMWA 2V1ZA 5FA7A 3ZFZA 4DE3A 2X71A 3D4FA 3IHBA 1GCEA 2XQZA 4OP8A 2OSUA 3HLCA 3BRMA 4UA9A 3WRZA 3UPPA 4X56A 1IELA 3V5MA 4DF6A 5FI2A 1JWZA 3QNBA 5DTTA 5FQJA 4WBGA 1J9MA 4KZ6A 3IWIA 4QHCA 2WZZA 1ESIA 2HP9A 4OOMA 5FSRA 3ZG5A 4P6BA 2BLSA 2FFFB 1BLHA 3M6HA 4KQRA 5DF7A 2XLNA 3MXSA 3BFFA 3C4PA 4QY6A 3VMAA 3ZCZA 4WYYA 3W4PA 3G2YA 5GHXA 1ES5A 1JWPA 3BFEA 3M2KA 3WS1A 1XX2A 4LV2A 1S0WA 3V3RA 4N92A 3O86A 1GHMA 3HLGA 3NI9A 4IVIA 5TR7A 1ALQA 3Q7VA 4GDNA 4PM6A 4PPRA 5E2GA 3V50A 4WZ5A 5HAPA 2JE5A 3GQZA 3G32A 4DE1A 5CEBA 4FD8A 4KZ9A 3G4PA 3PAGA 3AGEA 3PBNA 2Y59A 2ZQ9A 2ZM2A 2CC1A 4EQIA 1NZOA 1IEMA 4LCMA 3CMZA 5KZHA 1K56D 5GLBA 2RL3A 2OV5A 3ZG7B 4P87A 2HP5A 3Q07A 3IWQA 1LHYA 3RJUA 1ZC2A 3N8SA 3QNCA 4OLDA 2QMIA 4UA6A 1QMFA 1NY0A 3IF6B 3MKEA 2A3UA 1XP4A 1K4FA 4FCFA 4ZJ2A 4NK3A 3VFHA 4N9KA 5F82A 1RCJA 5GLAA 3P09A 3ZDJA 5A93A 3OPHA 3UE1A 2Y2JA 5HAQA 4K0XA 3TG9A 4NETA 3UE3A 3G34A 2R9WA 2VGJA 4PM7A 2JCHA 3MFDA 3WS4A 1AXBA 1KE3A 1K54A 3HL9A 1XKZA 4EBLA 2Z2LB 2Q9MA 1XA1A 3O3VA 3ISGA 1PIOA 2HP6A 5GHYA 1EWZA 5EOOA 1BLPA 2Y2MA 1EROA 1BZAA 4R3BA 4E3NA 3BLMA 3EQUA 1BSGA 2HPBA 2Q9NA 5FQMA 3NIAA 4S2NC 5FASA 2ZC3B 3GV9A 4KZBA 5KSCA 3G35A 4KENB 3WS5A 1GHPA 1HD8A 1XGIA 2J9PA 4JXSA 1K55C 4C6YA 4Y0TA 4BD1A 3WRTA 4OPZA 2ZQCA 1SCWA 3DW0A 4X69A 3G2ZA 2R9XA 1DJAA 2IWBA 4E3MA 5IHVA 2Z2MB 4ZJ1A 3HUMA 4S2JA 3ITAA 4ID4A 3HUOA 4QU3A 5U47A 5I94A 4HESA 1M40A 4E3IA 4S2KA 3BECA 1E3UA 1ONGA 4KZ8A 4E3OA 2ZQDA 5CEDA 2XFTA 3IH8A 2WGVA 3QHYA 3A3FA 1BT5A 2P9VB 1K57C 3N8LA 4JXVA 2QPNA 2H0YA 3W8KA 2V20A 3DWZA 4WM9A 5FAPA 3ZNYA 4MEZA 2Y2PA 2Y2HA 3BYDA 5GLDA 4OVDA 3OZHA 3OPPA 2Y4AA 1KE0A 5GLCA 4O7DA 2Y55A 1KVMA 4F94A 4OP5A 3HREA 1CI8A 4ZAMA 3VP4A 1FR6A 2EX8A 3E2LA 3NC8A 3B3XA 4RX3A 4KZ3A 1SKFA 3O88A 3MKFA 5E2HA 1FSYA 4WEKA 2IWDA 2ZC7A 3SH7A 4GB7A 2WZXA 3MZFA 3GVBA 5EECA 1YMSA 5EUAA 2JC7A 1YM1A 4UAAA 5CGXA 1H8YA 2ZQ8A 5EVIB 1TDLA 3FYZA 4E3JA 4R4SA 4EUZA 4ZDXA 1H5XA 4S2OA 4GD6A 4JBFA 2J8YA 1DJBA 3SS3A 1PWCA 2WAEA 3GR2A 3IXBA 5AQAA 2ZLYA 3WWXA 3A3DA 4OOYA 5AQ9A 1YMXA 2Y2KA 5DTSA 5EPHA 3S22A 2HDQA 5F1FA 4MBHA 3UDIA 3ZHHA 3Q81A 2XK1A 3I7JA 1L0FA 5M18A 4R23A 2X01A 1KGEA 2ZC4B 1RGYA 1YT4A 2ZM0A 1WE4A 4S2NA 5JYPA 1IKIA 1K6RA 3DWKA 1G68A 4N1HA 1MWUA 1U60A 2EXBA 1LL9A 1PI5A 5HARA 1BLSA 1HTZA 5EVIC 1MBLA 3RXWA 4OKPA 4GDBA 3C7UA 1JVJA 4ZJ3A 2ZM8A 2ZQAA 4OLGA 2WYXA 4IBRA 3A3IA 2E8IA 4KQOA 4U0XA 2A49A 5FI7A 2WAFA 4K0WA 1CK3A 5TFQA 4C3QA 2WADA 4WEJA 4GNUA 3UPNA 5FAQA 4IEDA 5DF9A 1FSWA 1ZG6A 2I72A 4MLLA 4S2IA 1IYPA 3P98A 4JXWA 4KZAA 2ZC6B 1ESUA 3HVFA 5GHZA 5EE8A 3FV7A 4IVKA 3UPOA 3BFGA 1OMEA 1YLYA 4OQGA 3IXDA 1YQSA 3PTEA 2HDRA 4C75A 2PU4A 2H10A 2J7VA 3IF6C 1IYQA 2WKHA 3PAEA 3Q7VB 1KE4A 1L0EA 3FZCA 3ZG0A 2WGIA 4OQ0A 1VQQA 3TSGA 3BEBA 3IT9A 5M19A 2ZJ9A 1LLBA 2EX2A 5FAOA 1KDSA 2FFYA 5AQ7A 4DDYA 4PM5A 1YLTA 2ZD8A 5EVLA 1PW8A 5EOEA 3SS4A 2XH9A 4WZ5C 1H8ZA 1ES4A 4U3TA 5TGFA 5KSHA 3MZDA 1ERQA 1BLCA 3IWOA 4H8RA 4QY5A 4R0QA 2XGNA 1K54C 1MXOA 1SHVA 2DCFA 1G6AA 4KZ4A 4XXRA 1Y54A 3TOIA 3WS0A 1N4OA 3FKVA 3PBTA 5CXWA 3VSKA 3ZNTA 1HZOA 5E43A 1IYSA 4KG5A 3N8RA 3VP1A 2H0TA 4LV1A 4PM8A 5L2FA 2OLVA 2P9VA 2P74A 1PYYA 1K38A 1FQGA 3IQAA 5D3OA 1L0DA 3NY4A 3UO9A 3UNWA 3SOIA 3W4QA 5HFOA 1PWGA 4R4RA 5CHUA 3ZG8B 3SS5A 3IHAA 2PU2A 4YFMA 1I5QA 4GN2A 4L0LA 3LY4A 3S4XA 4BLMA 5A90A 3HLFA 3V3SA 1ONHA 1IKGA 5F1GA 2XEPA 4S2PA 3UY6A 4GOGA 4X6TA 5DVAA 3GTCA 4ZBEA 1PZPA 1FR1A 1IYOA 3IF6A 5A91A 3NBLA 2ZMAA 5G18A 1JTGA 4KG2A 5CHJA 3UN7A 4MBFA 3NCKA 1DJCA 4R1GA 1K57A 2Y2GA 1LL5A 3ZG9B 4BJPA 2DNSA 3ZVWA 1CEGA 1K25A 1XGJA 1KVLA 5CGSA 2PBYA 1KDWA 4JLFA 4BL2A 5E2FA 5HL1A 4UHUA 4JF6A 4X68A 3A3JA 3EQVA 3N6IA 3CZDA 4GZBA 3HLDA 5DF8A 1YLJA 3NDGA 1W5DA 1ERMA 1I2SA 1GA9A 4B88A 1PI4A 2WKIA 3OPRA 3HLBA 1RGZA 3IH9A 4HBUA 2WGWB 3MBZA 5FQ9A 2H5SA 2RCXA 4RX2A 1MWSA 4KZ5A 2Y2OA 2X02A 3LO7A 4E3KA 2XD5A 1YLPA 3SH8A 3HLEA 3LCEA 5CECA 3BM6A 1TVFA 4GD8A 4HBTA 4S2MA 4DKIA 1PZOA 4P85A 3CG5A 2WK0A 4JKTA 4FSFA 2B5RA 4DXBA 4CJNA 4OPYA 3E2KA 3OC2A 3ITBA 4QB8A 1W8QA 4RA7A 1HVBA 5FATA 5HW3A 4B4ZA 1LI0A 4WMCA 3C4OA 3G31A 4IBXA 4DE2A 1FCMA 1MWTA 5J8XA 4EWFA 1O7EA 2XDMA 1MPLA 1WYCA 1SDEA 1Q2QA 2G2UA 3ZGAB 3BFCA 4LCLA 3FKWA 5FQQA 1CI9A 1GHIA 1VM1A 2EFUA 1ZKJA 3HBRA 4OPRA 5EVID 1O07A 3UDFA 4DRTA 1MY8A 5EVIA 4BL3A 1ES3A 4X53A 3Q1FA 4Z9QA 4EV4A 1BUEA 4Q8IA 4JF4A 3WS2A 3JYIA 4OPQA 4RYEA 4LV0A 5FQKA 4X55A 3S1YA 1XPBA 1YLZA 2HDSA 3RXXA 3BLSA 4MNRA 5CTNA 3VP0A 1K4EA 4KG6A 2V2FF 1C3BA 1ES2A 1SDNA 5BOHA 2IWCA 4JPMA 5CERA 4M3KA 1FCNA 3M6BA 1W79A 4OQHA 1K55A 1WYBA 2C5WB 2XR0A 3VSLA 2J9OA 1Q2PA 5M1AA 3GSGA 3Q82A 5HX9A 3IXHA 4Y0OA 4KZ7A 5E2EA 1PWDA 1PW1A 2Y91A 2ZQ7A 4PMAA 1MKIA 4UA7A 4E3LA 1JWVA 2Y2QA 5FI6A 1NYYA 4JF5A 1TEMA 4B4XA 1W7FA 2ZC5B 3N4IA 3HLWA 4U0TA 5GL9A 1E4DA 2JBFA 4OQIA 2WUQA 4OONA 1GA0A 3FWLA 1TDGA 1YLWA 4GKUA 3DTMA 3Q7ZA 4N1XA 5CGWA 3LY3A 4OH0A 1NJ4A 3GRJA 4WELA 4XUXA 4DDSA 1K6SA 1KGGA 2Y2LA 1RP5A 3AGDA 1DY6A 1FCOA 3OCLA 3G30A 2EX9A 4DE0A 3ZVTA 4E6XA 4BQMA 5FQIA 5CTMA 4JXGA 1K56A 1L0GA 1JTDA 1KGFA 1CEFA 3PBSA 4WMCD 3PBOA 4YINA 2EX6A 4EBPA 1NYMA 3C5AA 4A5RA 1E3UD 2VGKA 4K91A 1L2SA 5FDHA 3C7VA 1NXYA 2Y2NA 4LENA 3OCNA 4FH4A 3UE0A 1NRFA 3PBQA 4LV3A 4DXCA 3VOYA 4ZTKA 1I2WA 5HAIA 4E6WA 3HUNA 1N9BA 4Y0UA 1E25A 2QZ6A
chains in the Genus database with same CATH superfamily
1F5MA 3R4KA 1MWRA 2XFSA 3P7NA 4HOIA 4O01A 4WUJA 5DTKA 2K2NA 2WKEA 4NKPA 1FIKA 3VP3A 1NRJA 4PM9A 2XRNA 2XD1A 1BULA 3OPLA 1NZUA 5CX7A 4HIAA 2KLIA 4HNBA 2HV1A 3O87A 4JGRA 2Y2IA 5CRFA 2WGWA 4Y17A 2XF3A 3SH9A 2EXAA 3TW8A 1MC0A 4Y3IA 3MXRA 2V9AA 2W3GA 2V1ZA 5FA7A 3A0RA 2XA7M 2ZMFA 3IHBA 2B18A 4OP8A 4X56A 1OPXA 3V5MA 2O0YA 4WBGA 4KZ6A 3S7OA 4OOMA 2FFFB 3F1NB 3CHWP 3TE8A 3M6HA 4QY6A 3C4PA 3VMAA 4WYYA 5GHXA 3WS1A 1XX2A 4EERA 3HLGA 4L9FA 5TR7A 3IS2A 4PM6A 4WZ5A 5HAPA 4CLCC 5CEBA 3G4PA 3T1RA 2ZQ9A 3UB7A 3R7WB 5KZHA 3ZG7B 4P87A 4Z1WA 3IWQA 3D72A 3CUEA 4EETB 1ZC2A 1LL8A 4UA6A 2QMIA 3IF6B 1CF0A 3VFHA 4N9KA 5J4EA 1P97A 1D7EA 3P09A 5A93A 3HCYA 4MDZA 2PRFA 4IUKA 5EM1A 2P7JA 3QP4A 3WS4A 3HL9A 4EW7A 3O3VA 3ISGA 4GS9A 4H6JA 5EOOA 1BLPA 3F1OA 2W0NA 4D60A 5K5BA 1BSGA 4NG2A 3VOLA 5FQMA 3NIAA 2ZC3B 1MKMA 3GV9A 3G35A 1HD8A 4K08A 1LSVA 1IOUA 3WRTA 1DJAA 2IWBA 1VETB 2EWWA 4ID4A 1M40A 3K2NA 4E3OA 5EV0A 1L3LA 3IH8A 3A3FA 1BT5A 2QPNA 3ZNYA 4OVDA 3OPPA 1KVMA 2Y55A 3LR4A 3OBFA 3E2LA 3S7QA 3MR0A 4KZ3A 3KSIA 3P01A 4WEKA 2IWDA 5EECA 1YM1A 5CGXA 4UEYA 2KDKA 2PD8A 4ZDXA 1H5XA 4S2OA 2J8YA 3GR2A 3IXBA 3WWXA 2M1CA 5DTSA 2HDQA 4MBHA 4GJ4A 4F3LB 2XK1A 3G6OA 4R23A 1KGEA 2ZC4B 1YT4A 3PXPA 4S2NA 1K6RA 3DWKA 1MWUA 1U60A 1PI5A 4M4XA 1BLSA 4GDBA 1JVJA 3SZTA 2ZM8A 4I3IA 4IBRA 3A3IA 2E8IA 4KQOA 2HJEA 5TFQA 4C3QA 2WADA 2PYPA 3UPNA 2I72A 4S2IA 3P98A 1STZA 4KZAA 1ESUA 3EEHA 1OTIA 1YLYA 3K3CA 2HDRA 4QWOA 2J7VA 1CJFA 1TF1A 5M19A 1KDSA 4B93A 5AQ7A 2ZD8A 4BBTA 4JGOA 4WZ5C 5HD3A 1OT6A 1XJ2A 4G3VA 1ERQA 4F3LA 3IWOA 1N9LA 3WS0A 1MXOA 2DCFA 3F1PA 1IYSA 3S7NA 3LR0A 1PYYA 1IFQA 4MCWA 5D3OA 1D06A 3NY4A 3UNWA 5CHUA 3K3DA 3ZG8B 3SS5A 1I5QA 4L0LA 3LY4A 1PFLA 5A90A 1ONHA 2XEPA 4GOGA 3IF6A 2V8CA 4I5SA 1JTGA 5CHJA 3NCKA 1DJCA 2QWSA 3ZVWA 1XGJA 1KVLA 2PBYA 1KDWA 2PAVP 4BL2A 5E2FA 2VA0A 3T4TA 3HLDA 2VGLM 1GA9A 2WKIA 3HLBA 1CQAA 4RX2A 4KZ5A 1VHMA 1P9WA 3SH8A 3BM6A 2NUTC 1PZOA 1D1JA 1GSXA 5C5KA 2W3FA 4HY8A 1LI0A 3G31A 4IBXA 1J3WA 2PT7A 2XDMA 2KOIA 1SDEA 3FKWA 3EGDC 1GHIA 4XT2A 2EFUA 2ZBBA 4OPRA 3UDFA 4DRTA 3DTIA 1ES3A 4Z9QA 3VE3A 1XPBA 2HDSA 5F68A 2LB5A 2V2FF 3KYZA 1WYBA 1XFQA 1P0ZA 3CPTB 1OTAA 3C2WA 1PWDA 1PW1A 2Y91A 2ZQ7A 4UA7A 5HWWA 4HH3A 1NYYA 3N4IA 3HJIA 3HLWA 5GL9A 1E4DA 2VKSA 4OQIA 1XFNA 1TDGA 3D3OA 1NJ4A 3GRJA 3T4LA 2VJWA 1K6SA 1FCOA 3G30A 2EX9A 4ME4A 2M7VA 4EXOA 4QPRA 4BBVA 4Y15A 5CTMA 4EBPA 4EEPA 1ZHHB 2JKGA 3PHYA 4A5RA 3MMHA 1L2SA 1NXYA 3OCNA 2Y79A 3UE0A 1T1AA 2AVXA 4Y0UA 5FL3A 3O88A 2DRWA 3QP8A 1T18A 3VP2A 4BWIA 3C38A 2GDNA 4S2LA 2C6WB 1XXMA 4BENA 4OOLA 5CHMA 3LI8A 3NDEA 3V39A 3LEZA 1PRQA 4PKYA 2CMNA 3LEQA 5DJTA 5FEFA 2A24A 4MBKA 3W4OA 5AQBA 2ZOHA 3MXQA 3GMWA 1S66L 3B33A 5DFYA 4HJ6A 3UDXA 1F98A 5JYOA 3ULFA 3LICA 1M6KA 2O9BA 3ZFZA 3QP1A 2W3DA 1GCEA 3WRZA 1VETA 4GHIB 4PHTA 4Y2FA 1ACFA 4DF6A 4R6LA 1J9MA 1ESIA 2BASA 3QP6A 3LFVA 1H3QA 1BLHA 3T4QA 2XLNA 2P08A 2KX6A 3G2YA 3JVVA 4N92A 2VV8A 3MJQA 4PPRA 3V50A 2D01A 3G32A 4FD8A 4KZ9A 5DKKA 2ZM2A 2CC1A 1IEMA 4LCMA 4ZRRA 3ZYTA 5GLBA 2OV5A 3FG8A 3OLOA 1LHYA 3RJUA 2HF6A 4ZJ2A 1K4FA 5GLAA 2EWVA 2Y2JA 2QJ5A 3TRCA 4NETA 3G34A 2R9WA 3IX4A 4I3AA 1KE3A 2B95A 2HP6A 2Y2MA 1EROA 4E3NA 5FASA 2I9VA 1BYWA 2Q9NA 4S2NC 5KSCA 4KZBA 2VZWA 1GHPA 2J9PA 4JXSA 4YOFA 2ZQCA 3DW0A 2Z2MB 4NEED 3ITAA 3HUOA 5U47A 3CAXA 4S2KA 1W63M 1E3UA 1ONGA 4KZ8A 3F1PB 5CEDA 1KOUA 1K57C 4WL9A 3UB6A 2J3TC 1UGUA 3BQAA 2V20A 4MEZA 2Y2HA 3BYDA 2Y4AA 2J3WA 4O7DA 1CI8A 4I38A 1FR6A 2JKRI 4AFIA 4HH2A 3MKFA 5E2HA 4FTXA 1T19A 3SH7A 3MZFA 3KYQA 1YMSA 5EFWA 1H8YA 5EVIB 1LSXA 2Z6CA 4GD6A 1DJBA 3LIAA 1PWCA 3U2AA 3FPWA 3KYEA 5AQ9A 2Y2KA 5F6AA 3S22A 5F1FA 3GDIA 1XJ4A 3UDIA 3ZHHA 3Q81A 4NXGA 2J3TD 5M18A 1RGYA 2EXBA 1LL9A 1SZVA 2PR5A 3RXWA 2ZQAA 4OLGA 1OJGA 1XJ3A 2JHEA 4U0XA 5FI7A 3EWKA 3IX8A 4IEDA 3UB9A 1FSWA 4NXBA 5AJGA 4IVKA 3BFGA 1OMEA 3S7PA 3PTEA 2FZ0A 3IF6C 3PAEA 1L0EA 1TS7A 3FZCA 2WGIA 3TSGA 1ODVA 4EUVA 1G6OA 3BEBA 3IT9A 4ARZA 2FFYA 5MC7A 5EVLA 1PW8A 1OJ5A 1S1YA 2XH9A 3UMDA 3IBRA 2OAP1 1BLCA 4H8RA 4QY5A 1W63Q 4KZ4A 2JKTM 3FKVA 3PBTA 1P9RA 5CXWA 4Q0HA 5E43A 2H0TA 2P74A 1K38A 4JGQA 3IQAA 1L0DA 3UO9A 3W4QA 4R4RA 3IHAA 2PU2A 2PBDP 3S4XA 4BLMA 3HLFA 1UWPX 1IKGA 5F1GA 5DVAA 3GTCA 1PZPA 1FR1A 1IYOA 2PHYA 5A91A 2L1MA 4KUKA 1AWIA 1K57A 1LL5A 2DNSA 1CEGA 4JLFA 4JF6A 3EQVA 4GZBA 3CZDA 3SW1A 4CLCD 3KX0X 5G4ZA 2VLGA 5DF8A 1W5DA 2W1RA 1ERMA 4B88A 1RGZA 4HBUA 2WGWB 4BBUA 3MBZA 3W2ZA 2Y2OA 2X02A 3E98A 1TVFA 4S2MA 1OTEA 3UE6A 4CJNA 3MS6A 1W8QA 5HW3A 4GCZA 3U4LP 4DE2A 1FCMA 1O7EA 1Q2QA 3ZGAB 5HPFA 1VM1A 4P6ZS 4LRYC 1SKOB 3C8CA 1O07A 1S1ZA 5HWVA 4EV4A 4Q8IA 1MZUA 4LV0A 3H82B 3RXXA 3BLSA 3LYXA 4M3KA 4OQHA 1K55A 3VSLA 2C5WB 3RH8B 2XSSA 3JVUA 3GSGA 4Y0OA 4E3LA 1MKIA 1JWVA 2Y2QA 3FC7A 4JF5A 1TEMA 3ZQ5A 1W7FA 5TBMA 1YLWA 3Q7ZA 4WELA 2GX5A 4XUXA 4DJ2A 1H8MA 2Y2LA 5F5YA 3RFBA 3ZVTA 4BMWA 4JXGA 3PBOA 4YINA 5L10A 2GNXA 4MN5A 1E3UD 2VGKA 3NOTC 4K91A 2Y2NA 4LV3A 4ZTKA 2J80A 5IU1A 4WZ4A 4XUZA 3BFDA 3AGFA 1XA7A 2OLUA 2UV0E 3H7WA 3M2JA 2PR6A 5A92A 3VOZA 3VFFA 5J3WA 5F83A 3E0YA 3IXGA 2JN7A 3CJMA 3O5YA 1Z6FA 4G3KA 3UMEA 2V0UA 4L9GA 2B02A 1YSPA 4QD4A 2BTFP 3E4OA 4KQQA 4EBNA 3CPTA 4HHDA 4NXEA 4P0MA 4Y7PA 2G2WA 5KMWA 4YWZA 2O9CA 3D4FA 3HLCA 1IELA 3QNBA 2WKPA 4QHCA 2WZZA 5L09A 2HP9A 3ZG5A 4P6BA 2Q0OA 4X1MA 1G5UA 3ZCZA 2P04A 1JWPA 3NI9A 4LRXC 1ALQA 3LIEA 4GDNA 5E2GA 3MQOA 2JE5A 2L4RA 4LGWA 5HPIA 3PBNA 2Y59A 4EQIA 1NZOA 3CMZA 4HI4A 5F69A 3UB8A 2RL3A 2HP5A 1ZTUA 3N8SA 3NOUC 4NK3A 4GHIA 5F82A 1TS0A 5IT5A 1JNUA 4K0XA 3TG9A 1OTBA 2XROA 2VGJA 4PM7A 1V9ZA 2VV6A 1AXBA 1XKZA 2A2LA 2Z2LB 4EU0A 2Q9MA 2JKRM 5GHYA 1PIOA 1S4SA 2HZ5A 1BZAA 4R3BA 3NHQA 4UQIM 3BLMA 5AVFA 4XT2B 1K55C 4C6YA 4Y0TA 4OPZA 1SCWA 3G2ZA 4DN0A 4E3MA 5IHVA 1NLZA 4S2JA 1YSQA 2EA9A 2IA2A 3CUEC 4QU3A 4E3IA 4Y13A 2ZQDA 2XFTA 3N8LA 4JXVA 4JGPA 2H0YA 3MSHA 5EM0A 4WM9A 5TBMB 5GLDA 2O99A 1HLUP 3VP4A 2INWA 3NC8A 4HJ4A 1YPRA 2VGLS 1FSYA 4GB7A 2WZXA 3H82A 5FDSA 5EUAA 2JC7A 1TDLA 3FYZA 4R4SA 4EUZA 5G4YA 3T4KA 4JBFA 3QP2A 3SS3A 1F2KA 2K31A 4OOYA 2PDRA 1K0KA 5EPHA 4ETZA 2X01A 1TS8A 1WE4A 5JYPA 3VV4A 1IKIA 4N1HA 5HARA 1T1BA 3IBJA 4GW9A 5EVIC 3MFXA 4OKPA 5IS1A 3C7UA 4ZJ3A 2W3EA 5L8MA 4CLCB 2WYXA 1OT9A 1CK3A 4WEJA 5FAQA 5HDCA 2OOLA 3IX3A 4MLLA 2ZC6B 1OTDA 5GHZA 3FV7A 1TS6A 1YQSA 4C75A 2PU4A 2WKHA 4O8GA 3ZG0A 3NULA 4OQ0A 1VQQA 3LUQA 2W3HA 2ZJ9A 1LLBA 2EX2A 2L0WA 5HZHA 1YLTA 5EOEA 3SS4A 5DJUA 2DMWA 1H8ZA 5HL6A 3LIFA 4R0QA 4XXRA 1SHVA 1G6AA 1YAXA 2VEAA 1Y54A 3VSKA 2V1BA 1HZOA 1UWNX 3DBAA 3N8RA 4LV1A 4PM8A 5L2FA 3LIDA 3TJZC 4B9OA 5HFOA 1PWGA 4MN7A 2V0WA 4YFMA 4GN2A 3H9WA 3B47A 3PYPA 4R1GA 3ZG9B 2K7SA 2GZAA 4CLCE 3A3JA 5HWTA 3IH9A 3BY8A 3LO7A 4E3KA 2ZL1B 4HBTA 4GD8A 3T50A 3T4SA 3MQQA 2GJ3A 2H28A 4JKTA 4DXBA 2B5RA 5DFXA 2Y8HA 2OWJA 5I5LA 3ITBA 4RA7A 5FATA 3H7WB 4B4ZA 3BWLA 4WMCA 3C4OA 1MWTA 4EESA 4ETXA 2QYBA 3IS2B 1MPLA 1WYCA 3V67A 2G2UA 1Y4OA 5FQQA 3PR6A 1CI9A 2LB9A 5HD5A 2ZL1A 5EVIA 3DAVA 4BL3A 1BUEA 1DRMA 2FH5A 4OPQA 3D9YA 5FQKA 4X55A 1YLZA 5HSQA 3A0VA 4LLOB 5CTNA 1K4EA 1C3BA 1SDNA 5BOHA 2IWCA 1FCNA 3M6BA 5EVEA 1W79A 3ICYA 2XR0A 5M1AA 3Q82A 4L9EA 4PMAA 4PAUA 3KSHA 3A0SA 3CITA 4E04A 2W1TA 2JBFA 1GA0A 3FWLA 4GKUA 3DTMA 5CGWA 4N1XA 3LY3A 4EQ1A 1KGGA 1RP5A 2WKRA 1DY6A 3OCLA 3B42A 4E6XA 5FQIA 1L0GA 1T1CA 2E8JA 4WMCD 3MF0A 1NYMA 3C5AA 4IJGA 5FDHA 5AVEA 2YKFA 4LENA 3PBQA 4NXFA 3LIBA 1I2WA 4E6WA 3HUNA 1N9BA 2QZ6A 3LGOA 2BG1A 4QJGA 3EOIA 4HEFA 3A3EA 4X1LA 1LI9A 3CLOA 2D02A 2W1TB 3IF5A 3MZEA 4DJ3A 1FOFA 3DTEA 4CPKA 4N9LA 1EI5A 4WN5A 1QMEA 3N7WA 2UWXA 4D2OA 4BD0A 4RVAA 1W8YA 1ZG4A 3PBRA 1BTLA 3QP5A 1S6RA 4GLQA 1VEUA 5A8BA 4FH2A 4R3JA 2HDUA 4EEUA 2EFXA 1DP6A 1F9IA 4DE3A 2V8FA 2X71A 2XQZA 2OSUA 3BRMA 4UA9A 2QHKA 3UPPA 2QJ7A 1JWZA 5DTTA 5FI2A 5FQJA 3IWIA 5FSRA 1VEUB 2BLSA 4R38A 1PNEA 4Y5FA 4KQRA 5DF7A 3MXSA 4WF0A 2NUPC 3BFFA 3R7WA 3W4PA 1ES5A 3M2KA 2JKFA 3BFEA 3MQ0A 4LV2A 1S0WA 3V3RA 3O86A 1GHMA 4IVIA 3Q7VA 5KIZA 3JPUA 3GQZA 4DE1A 1DP9A 3PAGA 3AGEA 3L9KA 2A24B 4HJ3A 1K56D 5HDDA 2VK3A 3Q07A 4ESPA 1H0MA 3QNCA 4OLDA 1QMFA 1NY0A 3MKEA 4FCFA 2A3UA 1XP4A 2MJ6A 2O9AA 2Z6DA 4LRZE 3EGXC 1RCJA 2G7UA 3ZDJA 3OPHA 3UE1A 5HAQA 1S4RA 3NOPC 3UE3A 3E4QA 3CI6A 2JCHA 1FILA 3MFDA 5HDSA 1K54A 4EBLA 1XA1A 1N9OA 1EWZA 3RTYA 3EQUA 3BQ8A 2VX8A 2HPBA 4I3JA 3NECA 4KENB 3BY9A 3WS5A 1XGIA 3FPVA 2HJ9C 4KQDA 4BD1A 4X69A 2R9XA 2YKHA 4ZJ1A 3HUMA 5I94A 4HESA 3BECA 3T1XA 1YKDA 2QKPA 2WGVA 3QHYA 2P9VB 4HP9A 3W8KA 3DWZA 5FAPA 2Y2PA 3OZHA 2JKTI 4PKYG 1KE0A 5GLCA 4F94A 4OP5A 3HREA 4ZAMA 2EX8A 3B3XA 4RX3A 4CQHA 1SKFA 4R70A 2ZC7A 3T4JA 2XA7S 3GVBA 1V9YA 4UAAA 2ZQ8A 4E3JA 3E4PA 2WAEA 3T4OA 5AQAA 2ZLYA 3GECA 3A3DA 4MN6A 1NWZA 1YMXA 4IUHA 2WKQA 1GSVA 4IHQA 4ARZB 3I7JA 1L0FA 4H6JB 2ZM0A 1G68A 3BJNA 2HGVA 1HTZA 1MBLA 5L07A 2OWHA 2A49A 2WAFA 1DP8A 4K0WA 2PD7A 4GNUA 4UQIS 5DF9A 1VB6A 1ZG6A 1IYPA 4JXWA 3HVFA 5EE8A 4R3AA 3UPOA 4OQGA 3IXDA 2H10A 3Q7VB 1IYQA 1KE4A 5FAOA 3L7HA 4DDYA 4PM5A 3VE4A 4RQ9A 1ES4A 4U3TA 5TGFA 5KSHA 3BW6A 3MZDA 2XGNA 1K54C 1SKOA 3T1QB 3TOIA 3F1NA 4GS9B 1N4OA 3ZNTA 4KG5A 3VP1A 2OLVA 2R78A 2P9VA 1FQGA 4YNRA 3SOIA 4Q0IA 4FUWA 5TJJA 4DMZA 1LSWA 2ACGA 3HJKA 3V3SA 4LPZA 4S2PA 3UY6A 4X6TA 4ZBEA 5DKLA 3NBLA 5LBRA 3KSGA 2ZMAA 5G18A 3UN7A 4KG2A 3DTKA 4MBFA 4KUOA 2Y2GA 4II7A 4BJPA 1K25A 5CGSA 5HL1A 4UHUA 4X68A 3LR3A 3N6IA 2ZMVA 2ZOIA 1YLJA 3NDGA 1TD5A 1I2SA 1PI4A 3OPRA 5FQ9A 2H5SA 2RCXA 1MWSA 4I39A 3EEAA 2XD5A 1YLPA 3HLEA 3LCEA 5CECA 4DKIA 4P85A 1NLYA 3CG5A 2WK0A 1N9NA 1G28A 1GSWA 1A0KA 4FSFA 5J7EA 4OPYA 3E2KA 3OC2A 1LT0A 4QB8A 4O0PA 5FEGA 4WLAA 1HVBA 1EW0A 2M7UA 3T1SA 5J8XA 4EWFA 3BFCA 2VV7A 4LCLA 2W27A 3LR5A 4LFUA 1ZKJA 3HBRA 5EVID 3T12B 1MY8A 4X53A 4CLCA 3Q1FA 4JF4A 3C30A 4Q0JA 3WS2A 3JYIA 4RYEA 3S1YA 4MNRA 4MMNA 3VP0A 1Z09A 4KG6A 1ES2A 4JPMA 5CERA 2V1AA 3KO6A 3LI9A 2J9OA 4HQAA 1Q2PA 1Y28A 5HX9A 3IXHA 4KZ7A 5E2EA 5FI6A 2OAQ1 4B4XA 2ZC5B 4U0TA 2PYRA 4HP4A 1XJ6A 4G3WA 2WUQA 1X0OA 4OONA 1S67L 4X25A 3OOVA 4OH0A 3UB5P 4FOFA 4DDSA 3AGDA 4DE0A 4BQMA 1K56A 3KSFA 1JTDA 1KGFA 1CEFA 3PBSA 2EX6A 3C7VA 3F1OB 4FH4A 1NRFA 4DXCA 3CWFA 3VOYA 5HAIA 1WA9A 4P6ZM 3NJAA 1E25A
chains in the Genus database with same CATH topology
2DRWA 1MWRA 2BG1A 4WZ4A 4XUZA 3VP2A 2XFSA 3BFDA 3AGFA 1XA7A 4QJGA 2OLUA 3M2JA 5DTKA 2WKEA 5A92A 3VOZA 3VFFA 4HEFA 3A3EA 3VP3A 4PM9A 5F83A 2GDNA 4S2LA 2C6WB 1XXMA 1LI9A 3IXGA 2XD1A 3IF5A 3CJMA 3MZEA 1BULA 4OOLA 4BENA 1FOFA 3OPLA 1NZUA 5CHMA 1Z6FA 3NDEA 3V39A 4CPKA 4N9LA 1EI5A 3LEZA 1QMEA 3N7WA 2UWXA 4D2OA 4BD0A 4RVAA 3O87A 1W8YA 2Y2IA 1ZG4A 4MBKA 3W4OA 5AQBA 3PBRA 5CRFA 4QD4A 2WGWA 3GMWA 1BTLA 2XF3A 3SH9A 1S6RA 2EXAA 4KQQA 3UDXA 5JYOA 4FH2A 4EBNA 4R3JA 2HDUA 4P0MA 1M6KA 4Y7PA 2EFXA 2G2WA 3MXRA 5KMWA 2V1ZA 5FA7A 3ZFZA 4DE3A 2X71A 3D4FA 3IHBA 1GCEA 2XQZA 4OP8A 2OSUA 3HLCA 3BRMA 4UA9A 3WRZA 3UPPA 4X56A 1IELA 3V5MA 4DF6A 5FI2A 1JWZA 3QNBA 5DTTA 5FQJA 4WBGA 1J9MA 4KZ6A 3IWIA 4QHCA 2WZZA 1ESIA 2HP9A 4OOMA 5FSRA 3ZG5A 4P6BA 2BLSA 2FFFB 1BLHA 3M6HA 4KQRA 5DF7A 2XLNA 3MXSA 3BFFA 3C4PA 4QY6A 3VMAA 3ZCZA 4WYYA 3W4PA 3G2YA 5GHXA 1ES5A 1JWPA 3BFEA 3M2KA 3WS1A 1XX2A 4LV2A 1S0WA 3V3RA 4N92A 3O86A 1GHMA 3HLGA 3NI9A 4IVIA 5TR7A 1ALQA 3Q7VA 4GDNA 4PM6A 4PPRA 5E2GA 3V50A 4WZ5A 5HAPA 2JE5A 3GQZA 3G32A 4DE1A 5CEBA 4FD8A 4KZ9A 3G4PA 3PAGA 3AGEA 3PBNA 2Y59A 2ZQ9A 2ZM2A 2CC1A 4EQIA 1NZOA 1IEMA 4LCMA 3CMZA 5KZHA 1K56D 5GLBA 2RL3A 2OV5A 3ZG7B 4P87A 2HP5A 3Q07A 3IWQA 1LHYA 3RJUA 1ZC2A 3N8SA 3QNCA 4OLDA 2QMIA 4UA6A 1QMFA 1NY0A 3IF6B 3MKEA 2A3UA 1XP4A 1K4FA 4FCFA 4ZJ2A 4NK3A 3VFHA 4N9KA 5F82A 1RCJA 5GLAA 3P09A 3ZDJA 5A93A 3OPHA 3UE1A 2Y2JA 5HAQA 4K0XA 3TG9A 4NETA 3UE3A 3G34A 2R9WA 2VGJA 4PM7A 2JCHA 3MFDA 3WS4A 1AXBA 1KE3A 1K54A 3HL9A 1XKZA 4EBLA 2Z2LB 2Q9MA 1XA1A 3O3VA 3ISGA 1PIOA 2HP6A 5GHYA 1EWZA 5EOOA 1BLPA 2Y2MA 1EROA 1BZAA 4R3BA 4E3NA 3BLMA 3EQUA 1BSGA 2HPBA 2Q9NA 5FQMA 3NIAA 4S2NC 5FASA 2ZC3B 3GV9A 4KZBA 5KSCA 3G35A 4KENB 3WS5A 1GHPA 1HD8A 1XGIA 2J9PA 4JXSA 1K55C 4C6YA 4Y0TA 4BD1A 3WRTA 4OPZA 2ZQCA 1SCWA 3DW0A 4X69A 3G2ZA 2R9XA 1DJAA 2IWBA 4E3MA 5IHVA 2Z2MB 4ZJ1A 3HUMA 4S2JA 3ITAA 4ID4A 3HUOA 4QU3A 5U47A 5I94A 4HESA 1M40A 4E3IA 4S2KA 3BECA 1E3UA 1ONGA 4KZ8A 4E3OA 2ZQDA 5CEDA 2XFTA 3IH8A 2WGVA 3QHYA 3A3FA 1BT5A 2P9VB 1K57C 3N8LA 4JXVA 2QPNA 2H0YA 3W8KA 2V20A 3DWZA 4WM9A 5FAPA 3ZNYA 4MEZA 2Y2PA 2Y2HA 3BYDA 5GLDA 4OVDA 3OZHA 3OPPA 2Y4AA 1KE0A 5GLCA 4O7DA 2Y55A 1KVMA 4F94A 4OP5A 3HREA 1CI8A 4ZAMA 3VP4A 1FR6A 2EX8A 3E2LA 3NC8A 3B3XA 4RX3A 4KZ3A 1SKFA 3O88A 3MKFA 5E2HA 1FSYA 4WEKA 2IWDA 2ZC7A 3SH7A 4GB7A 2WZXA 3MZFA 3GVBA 5EECA 1YMSA 5EUAA 2JC7A 1YM1A 4UAAA 5CGXA 1H8YA 2ZQ8A 5EVIB 1TDLA 3FYZA 4E3JA 4R4SA 4EUZA 4ZDXA 1H5XA 4S2OA 4GD6A 4JBFA 2J8YA 1DJBA 3SS3A 1PWCA 2WAEA 3GR2A 3IXBA 5AQAA 2ZLYA 3WWXA 3A3DA 4OOYA 5AQ9A 1YMXA 2Y2KA 5DTSA 5EPHA 3S22A 2HDQA 5F1FA 4MBHA 3UDIA 3ZHHA 3Q81A 2XK1A 3I7JA 1L0FA 5M18A 4R23A 2X01A 1KGEA 2ZC4B 1RGYA 1YT4A 2ZM0A 1WE4A 4S2NA 5JYPA 1IKIA 1K6RA 3DWKA 1G68A 4N1HA 1MWUA 1U60A 2EXBA 1LL9A 1PI5A 5HARA 1BLSA 1HTZA 5EVIC 1MBLA 3RXWA 4OKPA 4GDBA 3C7UA 1JVJA 4ZJ3A 2ZM8A 2ZQAA 4OLGA 2WYXA 4IBRA 3A3IA 2E8IA 4KQOA 4U0XA 2A49A 5FI7A 2WAFA 4K0WA 1CK3A 5TFQA 4C3QA 2WADA 4WEJA 4GNUA 3UPNA 5FAQA 4IEDA 5DF9A 1FSWA 1ZG6A 2I72A 4MLLA 4S2IA 1IYPA 3P98A 4JXWA 4KZAA 2ZC6B 1ESUA 3HVFA 5GHZA 5EE8A 3FV7A 4IVKA 3UPOA 3BFGA 1OMEA 1YLYA 4OQGA 3IXDA 1YQSA 3PTEA 2HDRA 4C75A 2PU4A 2H10A 2J7VA 3IF6C 1IYQA 2WKHA 3PAEA 3Q7VB 1KE4A 1L0EA 3FZCA 3ZG0A 2WGIA 4OQ0A 1VQQA 3TSGA 3BEBA 3IT9A 5M19A 2ZJ9A 1LLBA 2EX2A 5FAOA 1KDSA 2FFYA 5AQ7A 4DDYA 4PM5A 1YLTA 2ZD8A 5EVLA 1PW8A 5EOEA 3SS4A 2XH9A 4WZ5C 1H8ZA 1ES4A 4U3TA 5TGFA 5KSHA 3MZDA 1ERQA 1BLCA 3IWOA 4H8RA 4QY5A 4R0QA 2XGNA 1K54C 1MXOA 1SHVA 2DCFA 1G6AA 4KZ4A 4XXRA 1Y54A 3TOIA 3WS0A 1N4OA 3FKVA 3PBTA 5CXWA 3VSKA 3ZNTA 1HZOA 5E43A 1IYSA 4KG5A 3N8RA 3VP1A 2H0TA 4LV1A 4PM8A 5L2FA 2OLVA 2P9VA 2P74A 1PYYA 1K38A 1FQGA 3IQAA 5D3OA 1L0DA 3NY4A 3UO9A 3UNWA 3SOIA 3W4QA 5HFOA 1PWGA 4R4RA 5CHUA 3ZG8B 3SS5A 3IHAA 2PU2A 4YFMA 1I5QA 4GN2A 4L0LA 3LY4A 3S4XA 4BLMA 5A90A 3HLFA 3V3SA 1ONHA 1IKGA 5F1GA 2XEPA 4S2PA 3UY6A 4GOGA 4X6TA 5DVAA 3GTCA 4ZBEA 1PZPA 1FR1A 1IYOA 3IF6A 5A91A 3NBLA 2ZMAA 5G18A 1JTGA 4KG2A 5CHJA 3UN7A 4MBFA 3NCKA 1DJCA 4R1GA 1K57A 2Y2GA 1LL5A 3ZG9B 4BJPA 2DNSA 3ZVWA 1CEGA 1K25A 1XGJA 1KVLA 5CGSA 2PBYA 1KDWA 4JLFA 4BL2A 5E2FA 5HL1A 4UHUA 4JF6A 4X68A 3A3JA 3EQVA 3N6IA 3CZDA 4GZBA 3HLDA 5DF8A 1YLJA 3NDGA 1W5DA 1ERMA 1I2SA 1GA9A 4B88A 1PI4A 2WKIA 3OPRA 3HLBA 1RGZA 3IH9A 4HBUA 2WGWB 3MBZA 5FQ9A 2H5SA 2RCXA 4RX2A 1MWSA 4KZ5A 2Y2OA 2X02A 3LO7A 4E3KA 2XD5A 1YLPA 3SH8A 3HLEA 3LCEA 5CECA 3BM6A 1TVFA 4GD8A 4HBTA 4S2MA 4DKIA 1PZOA 4P85A 3CG5A 2WK0A 4JKTA 4FSFA 2B5RA 4DXBA 4CJNA 4OPYA 3E2KA 3OC2A 3ITBA 4QB8A 1W8QA 4RA7A 1HVBA 5FATA 5HW3A 4B4ZA 1LI0A 4WMCA 3C4OA 3G31A 4IBXA 4DE2A 1FCMA 1MWTA 5J8XA 4EWFA 1O7EA 2XDMA 1MPLA 1WYCA 1SDEA 1Q2QA 2G2UA 3ZGAB 3BFCA 4LCLA 3FKWA 5FQQA 1CI9A 1GHIA 1VM1A 2EFUA 1ZKJA 3HBRA 4OPRA 5EVID 1O07A 3UDFA 4DRTA 1MY8A 5EVIA 4BL3A 1ES3A 4X53A 3Q1FA 4Z9QA 4EV4A 1BUEA 4Q8IA 4JF4A 3WS2A 3JYIA 4OPQA 4RYEA 4LV0A 5FQKA 4X55A 3S1YA 1XPBA 1YLZA 2HDSA 3RXXA 3BLSA 4MNRA 5CTNA 3VP0A 1K4EA 4KG6A 2V2FF 1C3BA 1ES2A 1SDNA 5BOHA 2IWCA 4JPMA 5CERA 4M3KA 1FCNA 3M6BA 1W79A 4OQHA 1K55A 1WYBA 2C5WB 2XR0A 3VSLA 2J9OA 1Q2PA 5M1AA 3GSGA 3Q82A 5HX9A 3IXHA 4Y0OA 4KZ7A 5E2EA 1PWDA 1PW1A 2Y91A 2ZQ7A 4PMAA 1MKIA 4UA7A 4E3LA 1JWVA 2Y2QA 5FI6A 1NYYA 4JF5A 1TEMA 4B4XA 1W7FA 2ZC5B 3N4IA 3HLWA 4U0TA 5GL9A 1E4DA 2JBFA 4OQIA 2WUQA 4OONA 1GA0A 3FWLA 1TDGA 1YLWA 4GKUA 3DTMA 3Q7ZA 4N1XA 5CGWA 3LY3A 4OH0A 1NJ4A 3GRJA 4WELA 4XUXA 4DDSA 1K6SA 1KGGA 2Y2LA 1RP5A 3AGDA 1DY6A 1FCOA 3OCLA 3G30A 2EX9A 4DE0A 3ZVTA 4E6XA 4BQMA 5FQIA 5CTMA 4JXGA 1K56A 1L0GA 1JTDA 1KGFA 1CEFA 3PBSA 4WMCD 3PBOA 4YINA 2EX6A 4EBPA 1NYMA 3C5AA 4A5RA 1E3UD 2VGKA 4K91A 1L2SA 5FDHA 3C7VA 1NXYA 2Y2NA 4LENA 3OCNA 4FH4A 3UE0A 1NRFA 3PBQA 4LV3A 4DXCA 3VOYA 4ZTKA 1I2WA 5HAIA 4E6WA 3HUNA 1N9BA 4Y0UA 1E25A 2QZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DRW A;  1MWR A;  2BG1 A;  4WZ4 A;  4XUZ A;  3VP2 A;  2XFS A;  3BFD A;  3AGF A;  1XA7 A;  4QJG A;  2OLU A;  3M2J A;  5DTK A;  2WKE A;  5A92 A;  3VOZ A;  3VFF A;  4HEF A;  3A3E A;  3VP3 A;  4PM9 A;  5F83 A;  2GDN A;  4S2L A;  2C6W B;  1XXM A;  1LI9 A;  3IXG A;  2XD1 A;  3IF5 A;  3CJM A;  3MZE A;  1BUL A;  4OOL A;  4BEN A;  1FOF A;  3OPL A;  1NZU A;  5CHM A;  1Z6F A;  3NDE A;  3V39 A;  4CPK A;  4N9L A;  1EI5 A;  3LEZ A;  1QME A;  3N7W A;  2UWX A;  4D2O A;  4BD0 A;  4RVA A;  3O87 A;  1W8Y A;  2Y2I A;  1ZG4 A;  4MBK A;  3W4O A;  5AQB A;  3PBR A;  5CRF A;  4QD4 A;  2WGW A;  3GMW A;  1BTL A;  2XF3 A;  3SH9 A;  1S6R A;  2EXA A;  4KQQ A;  3UDX A;  5JYO A;  4FH2 A;  4EBN A;  4R3J A;  2HDU A;  4P0M A;  1M6K A;  4Y7P A;  2EFX A;  2G2W A;  3MXR A;  5KMW A;  2V1Z A;  5FA7 A;  3ZFZ A;  4DE3 A;  2X71 A;  3D4F A;  3IHB A;  1GCE A;  2XQZ A;  4OP8 A;  2OSU A;  3HLC A;  3BRM A;  4UA9 A;  3WRZ A;  3UPP A;  4X56 A;  1IEL A;  3V5M A;  4DF6 A;  5FI2 A;  1JWZ A;  3QNB A;  5DTT A;  5FQJ A;  4WBG A;  1J9M A;  4KZ6 A;  3IWI A;  4QHC A;  2WZZ A;  1ESI A;  2HP9 A;  4OOM A;  5FSR A;  3ZG5 A;  4P6B A;  2BLS A;  2FFF B;  1BLH A;  3M6H A;  4KQR A;  5DF7 A;  2XLN A;  3MXS A;  3BFF A;  3C4P A;  4QY6 A;  3VMA A;  3ZCZ A;  4WYY A;  3W4P A;  3G2Y A;  5GHX A;  1ES5 A;  1JWP A;  3BFE A;  3M2K A;  3WS1 A;  1XX2 A;  4LV2 A;  1S0W A;  3V3R A;  4N92 A;  3O86 A;  1GHM A;  3HLG A;  3NI9 A;  4IVI A;  5TR7 A;  1ALQ A;  3Q7V A;  4GDN A;  4PM6 A;  4PPR A;  5E2G A;  3V50 A;  4WZ5 A;  5HAP A;  2JE5 A;  3GQZ A;  3G32 A;  4DE1 A;  5CEB A;  4FD8 A;  4KZ9 A;  3G4P A;  3PAG A;  3AGE A;  3PBN A;  2Y59 A;  2ZQ9 A;  2ZM2 A;  2CC1 A;  4EQI A;  1NZO A;  1IEM A;  4LCM A;  3CMZ A;  5KZH A;  1K56 D;  5GLB A;  2RL3 A;  2OV5 A;  3ZG7 B;  4P87 A;  2HP5 A;  3Q07 A;  3IWQ A;  1LHY A;  3RJU A;  1ZC2 A;  3N8S A;  3QNC A;  4OLD A;  2QMI A;  4UA6 A;  1QMF A;  1NY0 A;  3IF6 B;  3MKE A;  2A3U A;  1XP4 A;  1K4F A;  4FCF A;  4ZJ2 A;  4NK3 A;  3VFH A;  4N9K A;  5F82 A;  1RCJ A;  5GLA A;  3P09 A;  3ZDJ A;  5A93 A;  3OPH A;  3UE1 A;  2Y2J A;  5HAQ A;  4K0X A;  3TG9 A;  4NET A;  3UE3 A;  3G34 A;  2R9W A;  2VGJ A;  4PM7 A;  2JCH A;  3MFD A;  3WS4 A;  1AXB A;  1KE3 A;  1K54 A;  3HL9 A;  1XKZ A;  4EBL A;  2Z2L B;  2Q9M A;  1XA1 A;  3O3V A;  3ISG A;  1PIO A;  2HP6 A;  5GHY A;  1EWZ A;  5EOO A;  1BLP A;  2Y2M A;  1ERO A;  1BZA A;  4R3B A;  4E3N A;  3BLM A;  3EQU A;  1BSG A;  2HPB A;  2Q9N A;  5FQM A;  3NIA A;  4S2N C;  5FAS A;  2ZC3 B;  3GV9 A;  4KZB A;  5KSC A;  3G35 A;  4KEN B;  3WS5 A;  1GHP A;  1HD8 A;  1XGI A;  2J9P A;  4JXS A;  1K55 C;  4C6Y A;  4Y0T A;  4BD1 A;  3WRT A;  4OPZ A;  2ZQC A;  1SCW A;  3DW0 A;  4X69 A;  3G2Z A;  2R9X A;  1DJA A;  2IWB A;  4E3M A;  5IHV A;  2Z2M B;  4ZJ1 A;  3HUM A;  4S2J A;  3ITA A;  4ID4 A;  3HUO A;  4QU3 A;  5U47 A;  5I94 A;  4HES A;  1M40 A;  4E3I A;  4S2K A;  3BEC A;  1E3U A;  1ONG A;  4KZ8 A;  4E3O A;  2ZQD A;  5CED A;  2XFT A;  3IH8 A;  2WGV A;  3QHY A;  3A3F A;  1BT5 A;  2P9V B;  1K57 C;  3N8L A;  4JXV A;  2QPN A;  2H0Y A;  3W8K A;  2V20 A;  3DWZ A;  4WM9 A;  5FAP A;  3ZNY A;  4MEZ A;  2Y2P A;  2Y2H A;  3BYD A;  5GLD A;  4OVD A;  3OZH A;  3OPP A;  2Y4A A;  1KE0 A;  5GLC A;  4O7D A;  2Y55 A;  1KVM A;  4F94 A;  4OP5 A;  3HRE A;  1CI8 A;  4ZAM A;  3VP4 A;  1FR6 A;  2EX8 A;  3E2L A;  3NC8 A;  3B3X A;  4RX3 A;  4KZ3 A;  1SKF A;  3O88 A;  3MKF A;  5E2H A;  1FSY A;  4WEK A;  2IWD A;  2ZC7 A;  3SH7 A;  4GB7 A;  2WZX A;  3MZF A;  3GVB A;  5EEC A;  1YMS A;  5EUA A;  2JC7 A;  1YM1 A;  4UAA A;  5CGX A;  1H8Y A;  2ZQ8 A;  5EVI B;  1TDL A;  3FYZ A;  4E3J A;  4R4S A;  4EUZ A;  4ZDX A;  1H5X A;  4S2O A;  4GD6 A;  4JBF A;  2J8Y A;  1DJB A;  3SS3 A;  1PWC A;  2WAE A;  3GR2 A;  3IXB A;  5AQA A;  2ZLY A;  3WWX A;  3A3D A;  4OOY A;  5AQ9 A;  1YMX A;  2Y2K A;  5DTS A;  5EPH A;  3S22 A;  2HDQ A;  5F1F A;  4MBH A;  3UDI A;  3ZHH A;  3Q81 A;  2XK1 A;  3I7J A;  1L0F A;  5M18 A;  4R23 A;  2X01 A;  1KGE A;  2ZC4 B;  1RGY A;  1YT4 A;  2ZM0 A;  1WE4 A;  4S2N A;  5JYP A;  1IKI A;  1K6R A;  3DWK A;  1G68 A;  4N1H A;  1MWU A;  1U60 A;  2EXB A;  1LL9 A;  1PI5 A;  5HAR A;  1BLS A;  1HTZ A;  5EVI C;  1MBL A;  3RXW A;  4OKP A;  4GDB A;  3C7U A;  1JVJ A;  4ZJ3 A;  2ZM8 A;  2ZQA A;  4OLG A;  2WYX A;  4IBR A;  3A3I A;  2E8I A;  4KQO A;  4U0X A;  2A49 A;  5FI7 A;  2WAF A;  4K0W A;  1CK3 A;  5TFQ A;  4C3Q A;  2WAD A;  4WEJ A;  4GNU A;  3UPN A;  5FAQ A;  4IED A;  5DF9 A;  1FSW A;  1ZG6 A;  2I72 A;  4MLL A;  4S2I A;  1IYP A;  3P98 A;  4JXW A;  4KZA A;  2ZC6 B;  1ESU A;  3HVF A;  5GHZ A;  5EE8 A;  3FV7 A;  4IVK A;  3UPO A;  3BFG A;  1OME A;  1YLY A;  4OQG A;  3IXD A;  1YQS A;  3PTE A;  2HDR A;  4C75 A;  2PU4 A;  2H10 A;  2J7V A;  3IF6 C;  1IYQ A;  2WKH A;  3PAE A;  3Q7V B;  1KE4 A;  1L0E A;  3FZC A;  3ZG0 A;  2WGI A;  4OQ0 A;  1VQQ A;  3TSG A;  3BEB A;  3IT9 A;  5M19 A;  2ZJ9 A;  1LLB A;  2EX2 A;  5FAO A;  1KDS A;  2FFY A;  5AQ7 A;  4DDY A;  4PM5 A;  1YLT A;  2ZD8 A;  5EVL A;  1PW8 A;  5EOE A;  3SS4 A;  2XH9 A;  4WZ5 C;  1H8Z A;  1ES4 A;  4U3T A;  5TGF A;  5KSH A;  3MZD A;  1ERQ A;  1BLC A;  3IWO A;  4H8R A;  4QY5 A;  4R0Q A;  2XGN A;  1K54 C;  1MXO A;  1SHV A;  2DCF A;  1G6A A;  4KZ4 A;  4XXR A;  1Y54 A;  3TOI A;  3WS0 A;  1N4O A;  3FKV A;  3PBT A;  5CXW A;  3VSK A;  3ZNT A;  1HZO A;  5E43 A;  1IYS A;  4KG5 A;  3N8R A;  3VP1 A;  2H0T A;  4LV1 A;  4PM8 A;  5L2F A;  2OLV A;  2P9V A;  2P74 A;  1PYY A;  1K38 A;  1FQG A;  3IQA A;  5D3O A;  1L0D A;  3NY4 A;  3UO9 A;  3UNW A;  3SOI A;  3W4Q A;  5HFO A;  1PWG A;  4R4R A;  5CHU A;  3ZG8 B;  3SS5 A;  3IHA A;  2PU2 A;  4YFM A;  1I5Q A;  4GN2 A;  4L0L A;  3LY4 A;  3S4X A;  4BLM A;  5A90 A;  3HLF A;  3V3S A;  1ONH A;  1IKG A;  5F1G A;  2XEP A;  4S2P A;  3UY6 A;  4GOG A;  4X6T A;  5DVA A;  3GTC A;  4ZBE A;  1PZP A;  1FR1 A;  1IYO A;  3IF6 A;  5A91 A;  3NBL A;  2ZMA A;  5G18 A;  1JTG A;  4KG2 A;  5CHJ A;  3UN7 A;  4MBF A;  3NCK A;  1DJC A;  4R1G A;  1K57 A;  2Y2G A;  1LL5 A;  3ZG9 B;  4BJP A;  2DNS A;  3ZVW A;  1CEG A;  1K25 A;  1XGJ A;  1KVL A;  5CGS A;  2PBY A;  1KDW A;  4JLF A;  4BL2 A;  5E2F A;  5HL1 A;  4UHU A;  4JF6 A;  4X68 A;  3A3J A;  3EQV A;  3N6I A;  3CZD A;  4GZB A;  3HLD A;  5DF8 A;  1YLJ A;  3NDG A;  1W5D A;  1ERM A;  1I2S A;  1GA9 A;  4B88 A;  1PI4 A;  2WKI A;  3OPR A;  3HLB A;  1RGZ A;  3IH9 A;  4HBU A;  2WGW B;  3MBZ A;  5FQ9 A;  2H5S A;  2RCX A;  4RX2 A;  1MWS A;  4KZ5 A;  2Y2O A;  2X02 A;  3LO7 A;  4E3K A;  2XD5 A;  1YLP A;  3SH8 A;  3HLE A;  3LCE A;  5CEC A;  3BM6 A;  1TVF A;  4GD8 A;  4HBT A;  4S2M A;  4DKI A;  1PZO A;  4P85 A;  3CG5 A;  2WK0 A;  4JKT A;  4FSF A;  2B5R A;  4DXB A;  4CJN A;  4OPY A;  3E2K A;  3OC2 A;  3ITB A;  4QB8 A;  1W8Q A;  4RA7 A;  1HVB A;  5FAT A;  5HW3 A;  4B4Z A;  1LI0 A;  4WMC A;  3C4O A;  3G31 A;  4IBX A;  4DE2 A;  1FCM A;  1MWT A;  5J8X A;  4EWF A;  1O7E A;  2XDM A;  1MPL A;  1WYC A;  1SDE A;  1Q2Q A;  2G2U A;  3ZGA B;  3BFC A;  4LCL A;  3FKW A;  5FQQ A;  1CI9 A;  1GHI A;  1VM1 A;  2EFU A;  1ZKJ A;  3HBR A;  4OPR A;  5EVI D;  1O07 A;  3UDF A;  4DRT A;  1MY8 A;  5EVI A;  4BL3 A;  1ES3 A;  4X53 A;  3Q1F A;  4Z9Q A;  4EV4 A;  1BUE A;  4Q8I A;  4JF4 A;  3WS2 A;  3JYI A;  4OPQ A;  4RYE A;  4LV0 A;  5FQK A;  4X55 A;  3S1Y A;  1XPB A;  1YLZ A;  2HDS A;  3RXX A;  3BLS A;  4MNR A;  5CTN A;  3VP0 A;  1K4E A;  4KG6 A;  2V2F F;  1C3B A;  1ES2 A;  1SDN A;  5BOH A;  2IWC A;  4JPM A;  5CER A;  4M3K A;  1FCN A;  3M6B A;  1W79 A;  4OQH A;  1K55 A;  1WYB A;  2C5W B;  2XR0 A;  3VSL A;  2J9O A;  1Q2P A;  5M1A A;  3GSG A;  3Q82 A;  5HX9 A;  3IXH A;  4Y0O A;  4KZ7 A;  5E2E A;  1PWD A;  1PW1 A;  2Y91 A;  2ZQ7 A;  4PMA A;  1MKI A;  4UA7 A;  4E3L A;  1JWV A;  2Y2Q A;  5FI6 A;  1NYY A;  4JF5 A;  1TEM A;  4B4X A;  1W7F A;  2ZC5 B;  3N4I A;  3HLW A;  4U0T A;  5GL9 A;  1E4D A;  2JBF A;  4OQI A;  2WUQ A;  4OON A;  1GA0 A;  3FWL A;  1TDG A;  1YLW A;  4GKU A;  3DTM A;  3Q7Z A;  4N1X A;  5CGW A;  3LY3 A;  4OH0 A;  1NJ4 A;  3GRJ A;  4WEL A;  4XUX A;  4DDS A;  1K6S A;  1KGG A;  2Y2L A;  1RP5 A;  3AGD A;  1DY6 A;  1FCO A;  3OCL A;  3G30 A;  2EX9 A;  4DE0 A;  3ZVT A;  4E6X A;  4BQM A;  5FQI A;  5CTM A;  4JXG A;  1K56 A;  1L0G A;  1JTD A;  1KGF A;  1CEF A;  3PBS A;  4WMC D;  3PBO A;  4YIN A;  2EX6 A;  4EBP A;  1NYM A;  3C5A A;  4A5R A;  1E3U D;  2VGK A;  4K91 A;  1L2S A;  5FDH A;  3C7V A;  1NXY A;  2Y2N A;  4LEN A;  3OCN A;  4FH4 A;  3UE0 A;  1NRF A;  3PBQ A;  4LV3 A;  4DXC A;  3VOY A;  4ZTK A;  1I2W A;  5HAI A;  4E6W A;  3HUN A;  1N9B A;  4Y0U A;  1E25 A;  2QZ6 A; 
#chains in the Genus database with same CATH topology
 1F5M A;  3R4K A;  1MWR A;  2XFS A;  3P7N A;  4HOI A;  4O01 A;  4WUJ A;  5DTK A;  2K2N A;  2WKE A;  4NKP A;  1FIK A;  3VP3 A;  1NRJ A;  4PM9 A;  2XRN A;  2XD1 A;  1BUL A;  3OPL A;  1NZU A;  5CX7 A;  4HIA A;  2KLI A;  4HNB A;  2HV1 A;  3O87 A;  4JGR A;  2Y2I A;  5CRF A;  2WGW A;  4Y17 A;  2XF3 A;  3SH9 A;  2EXA A;  3TW8 A;  1MC0 A;  4Y3I A;  3MXR A;  2V9A A;  2W3G A;  2V1Z A;  5FA7 A;  3A0R A;  2XA7 M;  2ZMF A;  3IHB A;  2B18 A;  4OP8 A;  4X56 A;  1OPX A;  3V5M A;  2O0Y A;  4WBG A;  4KZ6 A;  3S7O A;  4OOM A;  2FFF B;  3F1N B;  3CHW P;  3TE8 A;  3M6H A;  4QY6 A;  3C4P A;  3VMA A;  4WYY A;  5GHX A;  3WS1 A;  1XX2 A;  4EER A;  3HLG A;  4L9F A;  5TR7 A;  3IS2 A;  4PM6 A;  4WZ5 A;  5HAP A;  4CLC C;  5CEB A;  3G4P A;  3T1R A;  2ZQ9 A;  3UB7 A;  3R7W B;  5KZH A;  3ZG7 B;  4P87 A;  4Z1W A;  3IWQ A;  3D72 A;  3CUE A;  4EET B;  1ZC2 A;  1LL8 A;  4UA6 A;  2QMI A;  3IF6 B;  1CF0 A;  3VFH A;  4N9K A;  5J4E A;  1P97 A;  1D7E A;  3P09 A;  5A93 A;  3HCY A;  4MDZ A;  2PRF A;  4IUK A;  5EM1 A;  2P7J A;  3QP4 A;  3WS4 A;  3HL9 A;  4EW7 A;  3O3V A;  3ISG A;  4GS9 A;  4H6J A;  5EOO A;  1BLP A;  3F1O A;  2W0N A;  4D60 A;  5K5B A;  1BSG A;  4NG2 A;  3VOL A;  5FQM A;  3NIA A;  2ZC3 B;  1MKM A;  3GV9 A;  3G35 A;  1HD8 A;  4K08 A;  1LSV A;  1IOU A;  3WRT A;  1DJA A;  2IWB A;  1VET B;  2EWW A;  4ID4 A;  1M40 A;  3K2N A;  4E3O A;  5EV0 A;  1L3L A;  3IH8 A;  3A3F A;  1BT5 A;  2QPN A;  3ZNY A;  4OVD A;  3OPP A;  1KVM A;  2Y55 A;  3LR4 A;  3OBF A;  3E2L A;  3S7Q A;  3MR0 A;  4KZ3 A;  3KSI A;  3P01 A;  4WEK A;  2IWD A;  5EEC A;  1YM1 A;  5CGX A;  4UEY A;  2KDK A;  2PD8 A;  4ZDX A;  1H5X A;  4S2O A;  2J8Y A;  3GR2 A;  3IXB A;  3WWX A;  2M1C A;  5DTS A;  2HDQ A;  4MBH A;  4GJ4 A;  4F3L B;  2XK1 A;  3G6O A;  4R23 A;  1KGE A;  2ZC4 B;  1YT4 A;  3PXP A;  4S2N A;  1K6R A;  3DWK A;  1MWU A;  1U60 A;  1PI5 A;  4M4X A;  1BLS A;  4GDB A;  1JVJ A;  3SZT A;  2ZM8 A;  4I3I A;  4IBR A;  3A3I A;  2E8I A;  4KQO A;  2HJE A;  5TFQ A;  4C3Q A;  2WAD A;  2PYP A;  3UPN A;  2I72 A;  4S2I A;  3P98 A;  1STZ A;  4KZA A;  1ESU A;  3EEH A;  1OTI A;  1YLY A;  3K3C A;  2HDR A;  4QWO A;  2J7V A;  1CJF A;  1TF1 A;  5M19 A;  1KDS A;  4B93 A;  5AQ7 A;  2ZD8 A;  4BBT A;  4JGO A;  4WZ5 C;  5HD3 A;  1OT6 A;  1XJ2 A;  4G3V A;  1ERQ A;  4F3L A;  3IWO A;  1N9L A;  3WS0 A;  1MXO A;  2DCF A;  3F1P A;  1IYS A;  3S7N A;  3LR0 A;  1PYY A;  1IFQ A;  4MCW A;  5D3O A;  1D06 A;  3NY4 A;  3UNW A;  5CHU A;  3K3D A;  3ZG8 B;  3SS5 A;  1I5Q A;  4L0L A;  3LY4 A;  1PFL A;  5A90 A;  1ONH A;  2XEP A;  4GOG A;  3IF6 A;  2V8C A;  4I5S A;  1JTG A;  5CHJ A;  3NCK A;  1DJC A;  2QWS A;  3ZVW A;  1XGJ A;  1KVL A;  2PBY A;  1KDW A;  2PAV P;  4BL2 A;  5E2F A;  2VA0 A;  3T4T A;  3HLD A;  2VGL M;  1GA9 A;  2WKI A;  3HLB A;  1CQA A;  4RX2 A;  4KZ5 A;  1VHM A;  1P9W A;  3SH8 A;  3BM6 A;  2NUT C;  1PZO A;  1D1J A;  1GSX A;  5C5K A;  2W3F A;  4HY8 A;  1LI0 A;  3G31 A;  4IBX A;  1J3W A;  2PT7 A;  2XDM A;  2KOI A;  1SDE A;  3FKW A;  3EGD C;  1GHI A;  4XT2 A;  2EFU A;  2ZBB A;  4OPR A;  3UDF A;  4DRT A;  3DTI A;  1ES3 A;  4Z9Q A;  3VE3 A;  1XPB A;  2HDS A;  5F68 A;  2LB5 A;  2V2F F;  3KYZ A;  1WYB A;  1XFQ A;  1P0Z A;  3CPT B;  1OTA A;  3C2W A;  1PWD A;  1PW1 A;  2Y91 A;  2ZQ7 A;  4UA7 A;  5HWW A;  4HH3 A;  1NYY A;  3N4I A;  3HJI A;  3HLW A;  5GL9 A;  1E4D A;  2VKS A;  4OQI A;  1XFN A;  1TDG A;  3D3O A;  1NJ4 A;  3GRJ A;  3T4L A;  2VJW A;  1K6S A;  1FCO A;  3G30 A;  2EX9 A;  4ME4 A;  2M7V A;  4EXO A;  4QPR A;  4BBV A;  4Y15 A;  5CTM A;  4EBP A;  4EEP A;  1ZHH B;  2JKG A;  3PHY A;  4A5R A;  3MMH A;  1L2S A;  1NXY A;  3OCN A;  2Y79 A;  3UE0 A;  1T1A A;  2AVX A;  4Y0U A;  5FL3 A;  3O88 A;  2DRW A;  3QP8 A;  1T18 A;  3VP2 A;  4BWI A;  3C38 A;  2GDN A;  4S2L A;  2C6W B;  1XXM A;  4BEN A;  4OOL A;  5CHM A;  3LI8 A;  3NDE A;  3V39 A;  3LEZ A;  1PRQ A;  4PKY A;  2CMN A;  3LEQ A;  5DJT A;  5FEF A;  2A24 A;  4MBK A;  3W4O A;  5AQB A;  2ZOH A;  3MXQ A;  3GMW A;  1S66 L;  3B33 A;  5DFY A;  4HJ6 A;  3UDX A;  1F98 A;  5JYO A;  3ULF A;  3LIC A;  1M6K A;  2O9B A;  3ZFZ A;  3QP1 A;  2W3D A;  1GCE A;  3WRZ A;  1VET A;  4GHI B;  4PHT A;  4Y2F A;  1ACF A;  4DF6 A;  4R6L A;  1J9M A;  1ESI A;  2BAS A;  3QP6 A;  3LFV A;  1H3Q A;  1BLH A;  3T4Q A;  2XLN A;  2P08 A;  2KX6 A;  3G2Y A;  3JVV A;  4N92 A;  2VV8 A;  3MJQ A;  4PPR A;  3V50 A;  2D01 A;  3G32 A;  4FD8 A;  4KZ9 A;  5DKK A;  2ZM2 A;  2CC1 A;  1IEM A;  4LCM A;  4ZRR A;  3ZYT A;  5GLB A;  2OV5 A;  3FG8 A;  3OLO A;  1LHY A;  3RJU A;  2HF6 A;  4ZJ2 A;  1K4F A;  5GLA A;  2EWV A;  2Y2J A;  2QJ5 A;  3TRC A;  4NET A;  3G34 A;  2R9W A;  3IX4 A;  4I3A A;  1KE3 A;  2B95 A;  2HP6 A;  2Y2M A;  1ERO A;  4E3N A;  5FAS A;  2I9V A;  1BYW A;  2Q9N A;  4S2N C;  5KSC A;  4KZB A;  2VZW A;  1GHP A;  2J9P A;  4JXS A;  4YOF A;  2ZQC A;  3DW0 A;  2Z2M B;  4NEE D;  3ITA A;  3HUO A;  5U47 A;  3CAX A;  4S2K A;  1W63 M;  1E3U A;  1ONG A;  4KZ8 A;  3F1P B;  5CED A;  1KOU A;  1K57 C;  4WL9 A;  3UB6 A;  2J3T C;  1UGU A;  3BQA A;  2V20 A;  4MEZ A;  2Y2H A;  3BYD A;  2Y4A A;  2J3W A;  4O7D A;  1CI8 A;  4I38 A;  1FR6 A;  2JKR I;  4AFI A;  4HH2 A;  3MKF A;  5E2H A;  4FTX A;  1T19 A;  3SH7 A;  3MZF A;  3KYQ A;  1YMS A;  5EFW A;  1H8Y A;  5EVI B;  1LSX A;  2Z6C A;  4GD6 A;  1DJB A;  3LIA A;  1PWC A;  3U2A A;  3FPW A;  3KYE A;  5AQ9 A;  2Y2K A;  5F6A A;  3S22 A;  5F1F A;  3GDI A;  1XJ4 A;  3UDI A;  3ZHH A;  3Q81 A;  4NXG A;  2J3T D;  5M18 A;  1RGY A;  2EXB A;  1LL9 A;  1SZV A;  2PR5 A;  3RXW A;  2ZQA A;  4OLG A;  1OJG A;  1XJ3 A;  2JHE A;  4U0X A;  5FI7 A;  3EWK A;  3IX8 A;  4IED A;  3UB9 A;  1FSW A;  4NXB A;  5AJG A;  4IVK A;  3BFG A;  1OME A;  3S7P A;  3PTE A;  2FZ0 A;  3IF6 C;  3PAE A;  1L0E A;  1TS7 A;  3FZC A;  2WGI A;  3TSG A;  1ODV A;  4EUV A;  1G6O A;  3BEB A;  3IT9 A;  4ARZ A;  2FFY A;  5MC7 A;  5EVL A;  1PW8 A;  1OJ5 A;  1S1Y A;  2XH9 A;  3UMD A;  3IBR A;  2OAP 1;  1BLC A;  4H8R A;  4QY5 A;  1W63 Q;  4KZ4 A;  2JKT M;  3FKV A;  3PBT A;  1P9R A;  5CXW A;  4Q0H A;  5E43 A;  2H0T A;  2P74 A;  1K38 A;  4JGQ A;  3IQA A;  1L0D A;  3UO9 A;  3W4Q A;  4R4R A;  3IHA A;  2PU2 A;  2PBD P;  3S4X A;  4BLM A;  3HLF A;  1UWP X;  1IKG A;  5F1G A;  5DVA A;  3GTC A;  1PZP A;  1FR1 A;  1IYO A;  2PHY A;  5A91 A;  2L1M A;  4KUK A;  1AWI A;  1K57 A;  1LL5 A;  2DNS A;  1CEG A;  4JLF A;  4JF6 A;  3EQV A;  4GZB A;  3CZD A;  3SW1 A;  4CLC D;  3KX0 X;  5G4Z A;  2VLG A;  5DF8 A;  1W5D A;  2W1R A;  1ERM A;  4B88 A;  1RGZ A;  4HBU A;  2WGW B;  4BBU A;  3MBZ A;  3W2Z A;  2Y2O A;  2X02 A;  3E98 A;  1TVF A;  4S2M A;  1OTE A;  3UE6 A;  4CJN A;  3MS6 A;  1W8Q A;  5HW3 A;  4GCZ A;  3U4L P;  4DE2 A;  1FCM A;  1O7E A;  1Q2Q A;  3ZGA B;  5HPF A;  1VM1 A;  4P6Z S;  4LRY C;  1SKO B;  3C8C A;  1O07 A;  1S1Z A;  5HWV A;  4EV4 A;  4Q8I A;  1MZU A;  4LV0 A;  3H82 B;  3RXX A;  3BLS A;  3LYX A;  4M3K A;  4OQH A;  1K55 A;  3VSL A;  2C5W B;  3RH8 B;  2XSS A;  3JVU A;  3GSG A;  4Y0O A;  4E3L A;  1MKI A;  1JWV A;  2Y2Q A;  3FC7 A;  4JF5 A;  1TEM A;  3ZQ5 A;  1W7F A;  5TBM A;  1YLW A;  3Q7Z A;  4WEL A;  2GX5 A;  4XUX A;  4DJ2 A;  1H8M A;  2Y2L A;  5F5Y A;  3RFB A;  3ZVT A;  4BMW A;  4JXG A;  3PBO A;  4YIN A;  5L10 A;  2GNX A;  4MN5 A;  1E3U D;  2VGK A;  3NOT C;  4K91 A;  2Y2N A;  4LV3 A;  4ZTK A;  2J80 A;  5IU1 A;  4WZ4 A;  4XUZ A;  3BFD A;  3AGF A;  1XA7 A;  2OLU A;  2UV0 E;  3H7W A;  3M2J A;  2PR6 A;  5A92 A;  3VOZ A;  3VFF A;  5J3W A;  5F83 A;  3E0Y A;  3IXG A;  2JN7 A;  3CJM A;  3O5Y A;  1Z6F A;  4G3K A;  3UME A;  2V0U A;  4L9G A;  2B02 A;  1YSP A;  4QD4 A;  2BTF P;  3E4O A;  4KQQ A;  4EBN A;  3CPT A;  4HHD A;  4NXE A;  4P0M A;  4Y7P A;  2G2W A;  5KMW A;  4YWZ A;  2O9C A;  3D4F A;  3HLC A;  1IEL A;  3QNB A;  2WKP A;  4QHC A;  2WZZ A;  5L09 A;  2HP9 A;  3ZG5 A;  4P6B A;  2Q0O A;  4X1M A;  1G5U A;  3ZCZ A;  2P04 A;  1JWP A;  3NI9 A;  4LRX C;  1ALQ A;  3LIE A;  4GDN A;  5E2G A;  3MQO A;  2JE5 A;  2L4R A;  4LGW A;  5HPI A;  3PBN A;  2Y59 A;  4EQI A;  1NZO A;  3CMZ A;  4HI4 A;  5F69 A;  3UB8 A;  2RL3 A;  2HP5 A;  1ZTU A;  3N8S A;  3NOU C;  4NK3 A;  4GHI A;  5F82 A;  1TS0 A;  5IT5 A;  1JNU A;  4K0X A;  3TG9 A;  1OTB A;  2XRO A;  2VGJ A;  4PM7 A;  1V9Z A;  2VV6 A;  1AXB A;  1XKZ A;  2A2L A;  2Z2L B;  4EU0 A;  2Q9M A;  2JKR M;  5GHY A;  1PIO A;  1S4S A;  2HZ5 A;  1BZA A;  4R3B A;  3NHQ A;  4UQI M;  3BLM A;  5AVF A;  4XT2 B;  1K55 C;  4C6Y A;  4Y0T A;  4OPZ A;  1SCW A;  3G2Z A;  4DN0 A;  4E3M A;  5IHV A;  1NLZ A;  4S2J A;  1YSQ A;  2EA9 A;  2IA2 A;  3CUE C;  4QU3 A;  4E3I A;  4Y13 A;  2ZQD A;  2XFT A;  3N8L A;  4JXV A;  4JGP A;  2H0Y A;  3MSH A;  5EM0 A;  4WM9 A;  5TBM B;  5GLD A;  2O99 A;  1HLU P;  3VP4 A;  2INW A;  3NC8 A;  4HJ4 A;  1YPR A;  2VGL S;  1FSY A;  4GB7 A;  2WZX A;  3H82 A;  5FDS A;  5EUA A;  2JC7 A;  1TDL A;  3FYZ A;  4R4S A;  4EUZ A;  5G4Y A;  3T4K A;  4JBF A;  3QP2 A;  3SS3 A;  1F2K A;  2K31 A;  4OOY A;  2PDR A;  1K0K A;  5EPH A;  4ETZ A;  2X01 A;  1TS8 A;  1WE4 A;  5JYP A;  3VV4 A;  1IKI A;  4N1H A;  5HAR A;  1T1B A;  3IBJ A;  4GW9 A;  5EVI C;  3MFX A;  4OKP A;  5IS1 A;  3C7U A;  4ZJ3 A;  2W3E A;  5L8M A;  4CLC B;  2WYX A;  1OT9 A;  1CK3 A;  4WEJ A;  5FAQ A;  5HDC A;  2OOL A;  3IX3 A;  4MLL A;  2ZC6 B;  1OTD A;  5GHZ A;  3FV7 A;  1TS6 A;  1YQS A;  4C75 A;  2PU4 A;  2WKH A;  4O8G A;  3ZG0 A;  3NUL A;  4OQ0 A;  1VQQ A;  3LUQ A;  2W3H A;  2ZJ9 A;  1LLB A;  2EX2 A;  2L0W A;  5HZH A;  1YLT A;  5EOE A;  3SS4 A;  5DJU A;  2DMW A;  1H8Z A;  5HL6 A;  3LIF A;  4R0Q A;  4XXR A;  1SHV A;  1G6A A;  1YAX A;  2VEA A;  1Y54 A;  3VSK A;  2V1B A;  1HZO A;  1UWN X;  3DBA A;  3N8R A;  4LV1 A;  4PM8 A;  5L2F A;  3LID A;  3TJZ C;  4B9O A;  5HFO A;  1PWG A;  4MN7 A;  2V0W A;  4YFM A;  4GN2 A;  3H9W A;  3B47 A;  3PYP A;  4R1G A;  3ZG9 B;  2K7S A;  2GZA A;  4CLC E;  3A3J A;  5HWT A;  3IH9 A;  3BY8 A;  3LO7 A;  4E3K A;  2ZL1 B;  4HBT A;  4GD8 A;  3T50 A;  3T4S A;  3MQQ A;  2GJ3 A;  2H28 A;  4JKT A;  4DXB A;  2B5R A;  5DFX A;  2Y8H A;  2OWJ A;  5I5L A;  3ITB A;  4RA7 A;  5FAT A;  3H7W B;  4B4Z A;  3BWL A;  4WMC A;  3C4O A;  1MWT A;  4EES A;  4ETX A;  2QYB A;  3IS2 B;  1MPL A;  1WYC A;  3V67 A;  2G2U A;  1Y4O A;  5FQQ A;  3PR6 A;  1CI9 A;  2LB9 A;  5HD5 A;  2ZL1 A;  5EVI A;  3DAV A;  4BL3 A;  1BUE A;  1DRM A;  2FH5 A;  4OPQ A;  3D9Y A;  5FQK A;  4X55 A;  1YLZ A;  5HSQ A;  3A0V A;  4LLO B;  5CTN A;  1K4E A;  1C3B A;  1SDN A;  5BOH A;  2IWC A;  1FCN A;  3M6B A;  5EVE A;  1W79 A;  3ICY A;  2XR0 A;  5M1A A;  3Q82 A;  4L9E A;  4PMA A;  4PAU A;  3KSH A;  3A0S A;  3CIT A;  4E04 A;  2W1T A;  2JBF A;  1GA0 A;  3FWL A;  4GKU A;  3DTM A;  5CGW A;  4N1X A;  3LY3 A;  4EQ1 A;  1KGG A;  1RP5 A;  2WKR A;  1DY6 A;  3OCL A;  3B42 A;  4E6X A;  5FQI A;  1L0G A;  1T1C A;  2E8J A;  4WMC D;  3MF0 A;  1NYM A;  3C5A A;  4IJG A;  5FDH A;  5AVE A;  2YKF A;  4LEN A;  3PBQ A;  4NXF A;  3LIB A;  1I2W A;  4E6W A;  3HUN A;  1N9B A;  2QZ6 A;  3LGO A;  2BG1 A;  4QJG A;  3EOI A;  4HEF A;  3A3E A;  4X1L A;  1LI9 A;  3CLO A;  2D02 A;  2W1T B;  3IF5 A;  3MZE A;  4DJ3 A;  1FOF A;  3DTE A;  4CPK A;  4N9L A;  1EI5 A;  4WN5 A;  1QME A;  3N7W A;  2UWX A;  4D2O A;  4BD0 A;  4RVA A;  1W8Y A;  1ZG4 A;  3PBR A;  1BTL A;  3QP5 A;  1S6R A;  4GLQ A;  1VEU A;  5A8B A;  4FH2 A;  4R3J A;  2HDU A;  4EEU A;  2EFX A;  1DP6 A;  1F9I A;  4DE3 A;  2V8F A;  2X71 A;  2XQZ A;  2OSU A;  3BRM A;  4UA9 A;  2QHK A;  3UPP A;  2QJ7 A;  1JWZ A;  5DTT A;  5FI2 A;  5FQJ A;  3IWI A;  5FSR A;  1VEU B;  2BLS A;  4R38 A;  1PNE A;  4Y5F A;  4KQR A;  5DF7 A;  3MXS A;  4WF0 A;  2NUP C;  3BFF A;  3R7W A;  3W4P A;  1ES5 A;  3M2K A;  2JKF A;  3BFE A;  3MQ0 A;  4LV2 A;  1S0W A;  3V3R A;  3O86 A;  1GHM A;  4IVI A;  3Q7V A;  5KIZ A;  3JPU A;  3GQZ A;  4DE1 A;  1DP9 A;  3PAG A;  3AGE A;  3L9K A;  2A24 B;  4HJ3 A;  1K56 D;  5HDD A;  2VK3 A;  3Q07 A;  4ESP A;  1H0M A;  3QNC A;  4OLD A;  1QMF A;  1NY0 A;  3MKE A;  4FCF A;  2A3U A;  1XP4 A;  2MJ6 A;  2O9A A;  2Z6D A;  4LRZ E;  3EGX C;  1RCJ A;  2G7U A;  3ZDJ A;  3OPH A;  3UE1 A;  5HAQ A;  1S4R A;  3NOP C;  3UE3 A;  3E4Q A;  3CI6 A;  2JCH A;  1FIL A;  3MFD A;  5HDS A;  1K54 A;  4EBL A;  1XA1 A;  1N9O A;  1EWZ A;  3RTY A;  3EQU A;  3BQ8 A;  2VX8 A;  2HPB A;  4I3J A;  3NEC A;  4KEN B;  3BY9 A;  3WS5 A;  1XGI A;  3FPV A;  2HJ9 C;  4KQD A;  4BD1 A;  4X69 A;  2R9X A;  2YKH A;  4ZJ1 A;  3HUM A;  5I94 A;  4HES A;  3BEC A;  3T1X A;  1YKD A;  2QKP A;  2WGV A;  3QHY A;  2P9V B;  4HP9 A;  3W8K A;  3DWZ A;  5FAP A;  2Y2P A;  3OZH A;  2JKT I;  4PKY G;  1KE0 A;  5GLC A;  4F94 A;  4OP5 A;  3HRE A;  4ZAM A;  2EX8 A;  3B3X A;  4RX3 A;  4CQH A;  1SKF A;  4R70 A;  2ZC7 A;  3T4J A;  2XA7 S;  3GVB A;  1V9Y A;  4UAA A;  2ZQ8 A;  4E3J A;  3E4P A;  2WAE A;  3T4O A;  5AQA A;  2ZLY A;  3GEC A;  3A3D A;  4MN6 A;  1NWZ A;  1YMX A;  4IUH A;  2WKQ A;  1GSV A;  4IHQ A;  4ARZ B;  3I7J A;  1L0F A;  4H6J B;  2ZM0 A;  1G68 A;  3BJN A;  2HGV A;  1HTZ A;  1MBL A;  5L07 A;  2OWH A;  2A49 A;  2WAF A;  1DP8 A;  4K0W A;  2PD7 A;  4GNU A;  4UQI S;  5DF9 A;  1VB6 A;  1ZG6 A;  1IYP A;  4JXW A;  3HVF A;  5EE8 A;  4R3A A;  3UPO A;  4OQG A;  3IXD A;  2H10 A;  3Q7V B;  1IYQ A;  1KE4 A;  5FAO A;  3L7H A;  4DDY A;  4PM5 A;  3VE4 A;  4RQ9 A;  1ES4 A;  4U3T A;  5TGF A;  5KSH A;  3BW6 A;  3MZD A;  2XGN A;  1K54 C;  1SKO A;  3T1Q B;  3TOI A;  3F1N A;  4GS9 B;  1N4O A;  3ZNT A;  4KG5 A;  3VP1 A;  2OLV A;  2R78 A;  2P9V A;  1FQG A;  4YNR A;  3SOI A;  4Q0I A;  4FUW A;  5TJJ A;  4DMZ A;  1LSW A;  2ACG A;  3HJK A;  3V3S A;  4LPZ A;  4S2P A;  3UY6 A;  4X6T A;  4ZBE A;  5DKL A;  3NBL A;  5LBR A;  3KSG A;  2ZMA A;  5G18 A;  3UN7 A;  4KG2 A;  3DTK A;  4MBF A;  4KUO A;  2Y2G A;  4II7 A;  4BJP A;  1K25 A;  5CGS A;  5HL1 A;  4UHU A;  4X68 A;  3LR3 A;  3N6I A;  2ZMV A;  2ZOI A;  1YLJ A;  3NDG A;  1TD5 A;  1I2S A;  1PI4 A;  3OPR A;  5FQ9 A;  2H5S A;  2RCX A;  1MWS A;  4I39 A;  3EEA A;  2XD5 A;  1YLP A;  3HLE A;  3LCE A;  5CEC A;  4DKI A;  4P85 A;  1NLY A;  3CG5 A;  2WK0 A;  1N9N A;  1G28 A;  1GSW A;  1A0K A;  4FSF A;  5J7E A;  4OPY A;  3E2K A;  3OC2 A;  1LT0 A;  4QB8 A;  4O0P A;  5FEG A;  4WLA A;  1HVB A;  1EW0 A;  2M7U A;  3T1S A;  5J8X A;  4EWF A;  3BFC A;  2VV7 A;  4LCL A;  2W27 A;  3LR5 A;  4LFU A;  1ZKJ A;  3HBR A;  5EVI D;  3T12 B;  1MY8 A;  4X53 A;  4CLC A;  3Q1F A;  4JF4 A;  3C30 A;  4Q0J A;  3WS2 A;  3JYI A;  4RYE A;  3S1Y A;  4MNR A;  4MMN A;  3VP0 A;  1Z09 A;  4KG6 A;  1ES2 A;  4JPM A;  5CER A;  2V1A A;  3KO6 A;  3LI9 A;  2J9O A;  4HQA A;  1Q2P A;  1Y28 A;  5HX9 A;  3IXH A;  4KZ7 A;  5E2E A;  5FI6 A;  2OAQ 1;  4B4X A;  2ZC5 B;  4U0T A;  2PYR A;  4HP4 A;  1XJ6 A;  4G3W A;  2WUQ A;  1X0O A;  4OON A;  1S67 L;  4X25 A;  3OOV A;  4OH0 A;  3UB5 P;  4FOF A;  4DDS A;  3AGD A;  4DE0 A;  4BQM A;  1K56 A;  3KSF A;  1JTD A;  1KGF A;  1CEF A;  3PBS A;  2EX6 A;  3C7V A;  3F1O B;  4FH4 A;  1NRF A;  4DXC A;  3CWF A;  3VOY A;  5HAI A;  1WA9 A;  4P6Z M;  3NJA A;  1E25 A; 
#chains in the Genus database with same CATH homology
 2DRW A;  1MWR A;  2BG1 A;  4WZ4 A;  4XUZ A;  3VP2 A;  2XFS A;  3BFD A;  3AGF A;  1XA7 A;  4QJG A;  2OLU A;  3M2J A;  5DTK A;  2WKE A;  5A92 A;  3VOZ A;  3VFF A;  4HEF A;  3A3E A;  3VP3 A;  4PM9 A;  5F83 A;  2GDN A;  4S2L A;  2C6W B;  1XXM A;  1LI9 A;  3IXG A;  2XD1 A;  3IF5 A;  3CJM A;  3MZE A;  1BUL A;  4OOL A;  4BEN A;  1FOF A;  3OPL A;  1NZU A;  5CHM A;  1Z6F A;  3NDE A;  3V39 A;  4CPK A;  4N9L A;  1EI5 A;  3LEZ A;  1QME A;  3N7W A;  2UWX A;  4D2O A;  4BD0 A;  4RVA A;  3O87 A;  1W8Y A;  2Y2I A;  1ZG4 A;  4MBK A;  3W4O A;  5AQB A;  3PBR A;  5CRF A;  4QD4 A;  2WGW A;  3GMW A;  1BTL A;  2XF3 A;  3SH9 A;  1S6R A;  2EXA A;  4KQQ A;  3UDX A;  5JYO A;  4FH2 A;  4EBN A;  4R3J A;  2HDU A;  4P0M A;  1M6K A;  4Y7P A;  2EFX A;  2G2W A;  3MXR A;  5KMW A;  2V1Z A;  5FA7 A;  3ZFZ A;  4DE3 A;  2X71 A;  3D4F A;  3IHB A;  1GCE A;  2XQZ A;  4OP8 A;  2OSU A;  3HLC A;  3BRM A;  4UA9 A;  3WRZ A;  3UPP A;  4X56 A;  1IEL A;  3V5M A;  4DF6 A;  5FI2 A;  1JWZ A;  3QNB A;  5DTT A;  5FQJ A;  4WBG A;  1J9M A;  4KZ6 A;  3IWI A;  4QHC A;  2WZZ A;  1ESI A;  2HP9 A;  4OOM A;  5FSR A;  3ZG5 A;  4P6B A;  2BLS A;  2FFF B;  1BLH A;  3M6H A;  4KQR A;  5DF7 A;  2XLN A;  3MXS A;  3BFF A;  3C4P A;  4QY6 A;  3VMA A;  3ZCZ A;  4WYY A;  3W4P A;  3G2Y A;  5GHX A;  1ES5 A;  1JWP A;  3BFE A;  3M2K A;  3WS1 A;  1XX2 A;  4LV2 A;  1S0W A;  3V3R A;  4N92 A;  3O86 A;  1GHM A;  3HLG A;  3NI9 A;  4IVI A;  5TR7 A;  1ALQ A;  3Q7V A;  4GDN A;  4PM6 A;  4PPR A;  5E2G A;  3V50 A;  4WZ5 A;  5HAP A;  2JE5 A;  3GQZ A;  3G32 A;  4DE1 A;  5CEB A;  4FD8 A;  4KZ9 A;  3G4P A;  3PAG A;  3AGE A;  3PBN A;  2Y59 A;  2ZQ9 A;  2ZM2 A;  2CC1 A;  4EQI A;  1NZO A;  1IEM A;  4LCM A;  3CMZ A;  5KZH A;  1K56 D;  5GLB A;  2RL3 A;  2OV5 A;  3ZG7 B;  4P87 A;  2HP5 A;  3Q07 A;  3IWQ A;  1LHY A;  3RJU A;  1ZC2 A;  3N8S A;  3QNC A;  4OLD A;  2QMI A;  4UA6 A;  1QMF A;  1NY0 A;  3IF6 B;  3MKE A;  2A3U A;  1XP4 A;  1K4F A;  4FCF A;  4ZJ2 A;  4NK3 A;  3VFH A;  4N9K A;  5F82 A;  1RCJ A;  5GLA A;  3P09 A;  3ZDJ A;  5A93 A;  3OPH A;  3UE1 A;  2Y2J A;  5HAQ A;  4K0X A;  3TG9 A;  4NET A;  3UE3 A;  3G34 A;  2R9W A;  2VGJ A;  4PM7 A;  2JCH A;  3MFD A;  3WS4 A;  1AXB A;  1KE3 A;  1K54 A;  3HL9 A;  1XKZ A;  4EBL A;  2Z2L B;  2Q9M A;  1XA1 A;  3O3V A;  3ISG A;  1PIO A;  2HP6 A;  5GHY A;  1EWZ A;  5EOO A;  1BLP A;  2Y2M A;  1ERO A;  1BZA A;  4R3B A;  4E3N A;  3BLM A;  3EQU A;  1BSG A;  2HPB A;  2Q9N A;  5FQM A;  3NIA A;  4S2N C;  5FAS A;  2ZC3 B;  3GV9 A;  4KZB A;  5KSC A;  3G35 A;  4KEN B;  3WS5 A;  1GHP A;  1HD8 A;  1XGI A;  2J9P A;  4JXS A;  1K55 C;  4C6Y A;  4Y0T A;  4BD1 A;  3WRT A;  4OPZ A;  2ZQC A;  1SCW A;  3DW0 A;  4X69 A;  3G2Z A;  2R9X A;  1DJA A;  2IWB A;  4E3M A;  5IHV A;  2Z2M B;  4ZJ1 A;  3HUM A;  4S2J A;  3ITA A;  4ID4 A;  3HUO A;  4QU3 A;  5U47 A;  5I94 A;  4HES A;  1M40 A;  4E3I A;  4S2K A;  3BEC A;  1E3U A;  1ONG A;  4KZ8 A;  4E3O A;  2ZQD A;  5CED A;  2XFT A;  3IH8 A;  2WGV A;  3QHY A;  3A3F A;  1BT5 A;  2P9V B;  1K57 C;  3N8L A;  4JXV A;  2QPN A;  2H0Y A;  3W8K A;  2V20 A;  3DWZ A;  4WM9 A;  5FAP A;  3ZNY A;  4MEZ A;  2Y2P A;  2Y2H A;  3BYD A;  5GLD A;  4OVD A;  3OZH A;  3OPP A;  2Y4A A;  1KE0 A;  5GLC A;  4O7D A;  2Y55 A;  1KVM A;  4F94 A;  4OP5 A;  3HRE A;  1CI8 A;  4ZAM A;  3VP4 A;  1FR6 A;  2EX8 A;  3E2L A;  3NC8 A;  3B3X A;  4RX3 A;  4KZ3 A;  1SKF A;  3O88 A;  3MKF A;  5E2H A;  1FSY A;  4WEK A;  2IWD A;  2ZC7 A;  3SH7 A;  4GB7 A;  2WZX A;  3MZF A;  3GVB A;  5EEC A;  1YMS A;  5EUA A;  2JC7 A;  1YM1 A;  4UAA A;  5CGX A;  1H8Y A;  2ZQ8 A;  5EVI B;  1TDL A;  3FYZ A;  4E3J A;  4R4S A;  4EUZ A;  4ZDX A;  1H5X A;  4S2O A;  4GD6 A;  4JBF A;  2J8Y A;  1DJB A;  3SS3 A;  1PWC A;  2WAE A;  3GR2 A;  3IXB A;  5AQA A;  2ZLY A;  3WWX A;  3A3D A;  4OOY A;  5AQ9 A;  1YMX A;  2Y2K A;  5DTS A;  5EPH A;  3S22 A;  2HDQ A;  5F1F A;  4MBH A;  3UDI A;  3ZHH A;  3Q81 A;  2XK1 A;  3I7J A;  1L0F A;  5M18 A;  4R23 A;  2X01 A;  1KGE A;  2ZC4 B;  1RGY A;  1YT4 A;  2ZM0 A;  1WE4 A;  4S2N A;  5JYP A;  1IKI A;  1K6R A;  3DWK A;  1G68 A;  4N1H A;  1MWU A;  1U60 A;  2EXB A;  1LL9 A;  1PI5 A;  5HAR A;  1BLS A;  1HTZ A;  5EVI C;  1MBL A;  3RXW A;  4OKP A;  4GDB A;  3C7U A;  1JVJ A;  4ZJ3 A;  2ZM8 A;  2ZQA A;  4OLG A;  2WYX A;  4IBR A;  3A3I A;  2E8I A;  4KQO A;  4U0X A;  2A49 A;  5FI7 A;  2WAF A;  4K0W A;  1CK3 A;  5TFQ A;  4C3Q A;  2WAD A;  4WEJ A;  4GNU A;  3UPN A;  5FAQ A;  4IED A;  5DF9 A;  1FSW A;  1ZG6 A;  2I72 A;  4MLL A;  4S2I A;  1IYP A;  3P98 A;  4JXW A;  4KZA A;  2ZC6 B;  1ESU A;  3HVF A;  5GHZ A;  5EE8 A;  3FV7 A;  4IVK A;  3UPO A;  3BFG A;  1OME A;  1YLY A;  4OQG A;  3IXD A;  1YQS A;  3PTE A;  2HDR A;  4C75 A;  2PU4 A;  2H10 A;  2J7V A;  3IF6 C;  1IYQ A;  2WKH A;  3PAE A;  3Q7V B;  1KE4 A;  1L0E A;  3FZC A;  3ZG0 A;  2WGI A;  4OQ0 A;  1VQQ A;  3TSG A;  3BEB A;  3IT9 A;  5M19 A;  2ZJ9 A;  1LLB A;  2EX2 A;  5FAO A;  1KDS A;  2FFY A;  5AQ7 A;  4DDY A;  4PM5 A;  1YLT A;  2ZD8 A;  5EVL A;  1PW8 A;  5EOE A;  3SS4 A;  2XH9 A;  4WZ5 C;  1H8Z A;  1ES4 A;  4U3T A;  5TGF A;  5KSH A;  3MZD A;  1ERQ A;  1BLC A;  3IWO A;  4H8R A;  4QY5 A;  4R0Q A;  2XGN A;  1K54 C;  1MXO A;  1SHV A;  2DCF A;  1G6A A;  4KZ4 A;  4XXR A;  1Y54 A;  3TOI A;  3WS0 A;  1N4O A;  3FKV A;  3PBT A;  5CXW A;  3VSK A;  3ZNT A;  1HZO A;  5E43 A;  1IYS A;  4KG5 A;  3N8R A;  3VP1 A;  2H0T A;  4LV1 A;  4PM8 A;  5L2F A;  2OLV A;  2P9V A;  2P74 A;  1PYY A;  1K38 A;  1FQG A;  3IQA A;  5D3O A;  1L0D A;  3NY4 A;  3UO9 A;  3UNW A;  3SOI A;  3W4Q A;  5HFO A;  1PWG A;  4R4R A;  5CHU A;  3ZG8 B;  3SS5 A;  3IHA A;  2PU2 A;  4YFM A;  1I5Q A;  4GN2 A;  4L0L A;  3LY4 A;  3S4X A;  4BLM A;  5A90 A;  3HLF A;  3V3S A;  1ONH A;  1IKG A;  5F1G A;  2XEP A;  4S2P A;  3UY6 A;  4GOG A;  4X6T A;  5DVA A;  3GTC A;  4ZBE A;  1PZP A;  1FR1 A;  1IYO A;  3IF6 A;  5A91 A;  3NBL A;  2ZMA A;  5G18 A;  1JTG A;  4KG2 A;  5CHJ A;  3UN7 A;  4MBF A;  3NCK A;  1DJC A;  4R1G A;  1K57 A;  2Y2G A;  1LL5 A;  3ZG9 B;  4BJP A;  2DNS A;  3ZVW A;  1CEG A;  1K25 A;  1XGJ A;  1KVL A;  5CGS A;  2PBY A;  1KDW A;  4JLF A;  4BL2 A;  5E2F A;  5HL1 A;  4UHU A;  4JF6 A;  4X68 A;  3A3J A;  3EQV A;  3N6I A;  3CZD A;  4GZB A;  3HLD A;  5DF8 A;  1YLJ A;  3NDG A;  1W5D A;  1ERM A;  1I2S A;  1GA9 A;  4B88 A;  1PI4 A;  2WKI A;  3OPR A;  3HLB A;  1RGZ A;  3IH9 A;  4HBU A;  2WGW B;  3MBZ A;  5FQ9 A;  2H5S A;  2RCX A;  4RX2 A;  1MWS A;  4KZ5 A;  2Y2O A;  2X02 A;  3LO7 A;  4E3K A;  2XD5 A;  1YLP A;  3SH8 A;  3HLE A;  3LCE A;  5CEC A;  3BM6 A;  1TVF A;  4GD8 A;  4HBT A;  4S2M A;  4DKI A;  1PZO A;  4P85 A;  3CG5 A;  2WK0 A;  4JKT A;  4FSF A;  2B5R A;  4DXB A;  4CJN A;  4OPY A;  3E2K A;  3OC2 A;  3ITB A;  4QB8 A;  1W8Q A;  4RA7 A;  1HVB A;  5FAT A;  5HW3 A;  4B4Z A;  1LI0 A;  4WMC A;  3C4O A;  3G31 A;  4IBX A;  4DE2 A;  1FCM A;  1MWT A;  5J8X A;  4EWF A;  1O7E A;  2XDM A;  1MPL A;  1WYC A;  1SDE A;  1Q2Q A;  2G2U A;  3ZGA B;  3BFC A;  4LCL A;  3FKW A;  5FQQ A;  1CI9 A;  1GHI A;  1VM1 A;  2EFU A;  1ZKJ A;  3HBR A;  4OPR A;  5EVI D;  1O07 A;  3UDF A;  4DRT A;  1MY8 A;  5EVI A;  4BL3 A;  1ES3 A;  4X53 A;  3Q1F A;  4Z9Q A;  4EV4 A;  1BUE A;  4Q8I A;  4JF4 A;  3WS2 A;  3JYI A;  4OPQ A;  4RYE A;  4LV0 A;  5FQK A;  4X55 A;  3S1Y A;  1XPB A;  1YLZ A;  2HDS A;  3RXX A;  3BLS A;  4MNR A;  5CTN A;  3VP0 A;  1K4E A;  4KG6 A;  2V2F F;  1C3B A;  1ES2 A;  1SDN A;  5BOH A;  2IWC A;  4JPM A;  5CER A;  4M3K A;  1FCN A;  3M6B A;  1W79 A;  4OQH A;  1K55 A;  1WYB A;  2C5W B;  2XR0 A;  3VSL A;  2J9O A;  1Q2P A;  5M1A A;  3GSG A;  3Q82 A;  5HX9 A;  3IXH A;  4Y0O A;  4KZ7 A;  5E2E A;  1PWD A;  1PW1 A;  2Y91 A;  2ZQ7 A;  4PMA A;  1MKI A;  4UA7 A;  4E3L A;  1JWV A;  2Y2Q A;  5FI6 A;  1NYY A;  4JF5 A;  1TEM A;  4B4X A;  1W7F A;  2ZC5 B;  3N4I A;  3HLW A;  4U0T A;  5GL9 A;  1E4D A;  2JBF A;  4OQI A;  2WUQ A;  4OON A;  1GA0 A;  3FWL A;  1TDG A;  1YLW A;  4GKU A;  3DTM A;  3Q7Z A;  4N1X A;  5CGW A;  3LY3 A;  4OH0 A;  1NJ4 A;  3GRJ A;  4WEL A;  4XUX A;  4DDS A;  1K6S A;  1KGG A;  2Y2L A;  1RP5 A;  3AGD A;  1DY6 A;  1FCO A;  3OCL A;  3G30 A;  2EX9 A;  4DE0 A;  3ZVT A;  4E6X A;  4BQM A;  5FQI A;  5CTM A;  4JXG A;  1K56 A;  1L0G A;  1JTD A;  1KGF A;  1CEF A;  3PBS A;  4WMC D;  3PBO A;  4YIN A;  2EX6 A;  4EBP A;  1NYM A;  3C5A A;  4A5R A;  1E3U D;  2VGK A;  4K91 A;  1L2S A;  5FDH A;  3C7V A;  1NXY A;  2Y2N A;  4LEN A;  3OCN A;  4FH4 A;  3UE0 A;  1NRF A;  3PBQ A;  4LV3 A;  4DXC A;  3VOY A;  4ZTK A;  1I2W A;  5HAI A;  4E6W A;  3HUN A;  1N9B A;  4Y0U A;  1E25 A;  2QZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...