1PZOA

Tem-1 beta-lactamase in complex with a novel, core-disrupting, allosteric inhibitor
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
263
structure length
263
Chain Sequence
HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTTPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric inhibition through core disruption.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase TEM
total genus 96
structure length 263
sequence length 263
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2003-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1pzoA00
4Z9QA 4E3KA 1ZC2A 4S2IA 5AQ9A 3C4OA 4MEZA 5FATA 5GHYA 3G31A 1YLYA 1ZG6A 4GDNA 5J8XA 5A92A 1K55A 4QY6A 2Y2PA 2ZQCA 3MKFA 1IYSA 4S2MA 2EX8A 2WADA 4PM6A 3CG5A 5DF7A 1KVMA 1LHYA 4RVAA 2EX6A 4DE0A 1E25A 2Y2OA 4R23A 1ONHA 5F83A 3DW0A 4WEKA 4ZTKA 1N4OA 3NDEA 2QPNA 3DWZA 1JVJA 1Q2PA 3P98A 4OONA 4KZ7A 3IF5A 2A3UA 3Q81A 2IWCA 3FKVA 5M18A 2XFSA 2HDSA 1K25A 5TFQA 1E4DA 1IEMA 1E3UA 2PBYA 2Z2MB 1JTGA 1E3UD 2Y4AA 2ZC3B 1I2SA 3QNBA 3M6BA 1HZOA 3IQAA 2H10A 1SDNA 1SCWA 4ID4A 4PM5A 3BRMA 4S2LA 3A3IA 3ZGAB 1GA9A 1ONGA 5FA7A 1XGIA 4C75A 2J7VA 2X71A 3OPRA 4HBUA 2VGKA 4HBTA 4JF5A 4MBKA 4S2PA 4RX3A 4EBPA 1SKFA 1L0EA 3A3FA 4OLGA 3SS5A 4LV1A 1W8QA 4ZJ2A 3V5MA 1GA0A 1OMEA 3N8LA 5EVIC 4ZBEA 3QHYA 1ERMA 2ZC4B 1CEGA 2C5WB 3PBQA 1RCJA 1BULA 3IXBA 1K54A 3UE3A 5BOHA 1BSGA 1L2SA 3AGEA 4BL2A 3WS5A 1YLJA 5EE8A 2EXBA 3V39A 5FDHA 3UE0A 4EUZA 4N92A 3VOZA 2XH9A 3CZDA 4WM9A 4DRTA 1TDLA 5FASA 1XA1A 3BM6A 4KZ6A 1IKGA 1CEFA 3C5AA 5CHJA 5EPHA 2OV5A 4KZ9A 5GL9A 4K0WA 5HL1A 2H5SA 3UPOA 5TR7A 5GLCA 4KZ4A 2ZM8A 1Z6FA 3M2KA 2DRWA 1ALQA 2P74A 2Y2KA 2ZQDA 4RX2A 1W5DA 3VMAA 3W4PA 5CEBA 5HAQA 3Q1FA 4GKUA 3PBOA 3O3VA 1I5QA 4FH4A 4R3BA 1QMFA 4ZJ3A 3RJUA 3NY4A 2ZQ7A 3GQZA 4GNUA 5FQJA 3OZHA 3BEBA 4R4SA 5TGFA 4PM9A 1IELA 4OOLA 1K6RA 4QY5A 3HVFA 3BLMA 4JBFA 1NZOA 3OCLA 2A49A 3CMZA 3GR2A 1YQSA 5FQIA 1H5XA 1H8ZA 2I72A 3GSGA 3M6HA 3LCEA 4H8RA 4EWFA 5E2FA 3HBRA 4KZAA 4YINA 4D2OA 3IXHA 2X02A 5FAPA 1VM1A 3Q7VA 2XQZA 5M1AA 1PI5A 3G32A 3S4XA 1ESIA 1M6KA 4GZBA 3LO7A 5FAQA 3VP2A 5KMWA 3IT9A 4GD8A 1MWTA 2Z2LB 5FQMA 3O86A 2HDUA 2R9XA 3QNCA 2BLSA 3IWQA 4Y0TA 4LV2A 3P09A 1VQQA 3UDFA 1BZAA 4OP8A 4MBFA 3SOIA 3PBRA 5HARA 5CTNA 2WKHA 3TSGA 2WGVA 3ISGA 1K38A 3IXDA 1XP4A 3HUMA 2V20A 1FSYA 4WZ5A 4E6XA 2ZC5B 5EUAA 2XEPA 5HX9A 1S0WA 2RCXA 1MBLA 4LV0A 1EWZA 1NY0A 3V3SA 3ZG0A 4S2NA 4B4ZA 3ZHHA 2ZMAA 1LLBA 1AXBA 4E3OA 3HLGA 2XR0A 1CI8A 4DDYA 5HFOA 2XF3A 4E6WA 1ZKJA 3NIAA 3EQUA 3GRJA 4R4RA 1XXMA 1C3BA 2WYXA 1U60A 1K56D 2IWBA 4OPYA 4M3KA 1W8YA 1K56A 2ZC6B 3SS3A 5A93A 4S2JA 3BFDA 3G34A 2XLNA 1H8YA 4OPZA 1K4EA 1PYYA 4EV4A 2Y55A 3HUNA 4FD8A 4GD6A 4OOMA 5GHZA 3RXWA 1WE4A 4Y0UA 2Y2IA 4OP5A 4B88A 3MFDA 3O88A 4GN2A 3W4QA 4IVIA 5FQ9A 3ITAA 1BT5A 4JPMA 3GMWA 3PAEA 1FOFA 4KQQA 2EX9A 1ES5A 3Q07A 4N9LA 4WBGA 3OC2A 3HLFA 1L0FA 1CK3A 1O7EA 2C6WB 1NZUA 3HLWA 1MPLA 4C6YA 4U3TA 4WEJA 4KG2A 1JWPA 3VFFA 2RL3A 3AGFA 2Y2LA 5FI6A 3SH7A 1KVLA 1DY6A 1YMSA 3W8KA 1KGGA 4LENA 4OQ0A 4PM7A 2WUQA 4P85A 3S22A 3OPLA 3IWIA 1RGZA 1NXYA 3HREA 3G4PA 4QU3A 2CC1A 3WWXA 3WRTA 4DF6A 2GDNA 2WK0A 2ZD8A 3C7UA 5M19A 3BFCA 5E43A 4WMCA 2H0TA 3UPPA 1PW8A 3BFGA 2OSUA 1FCMA 2JC7A 2ZQAA 4RYEA 3WS1A 2OLVA 3D4FA 5A90A 1DJCA 4XUXA 3ZFZA 3PTEA 1K6SA 4PPRA 4R0QA 1KDWA 4BLMA 4DKIA 5KZHA 2J9PA 5EECA 4KG5A 4RA7A 2R9WA 5FAOA 1PW1A 1LL9A 4O7DA 1LI0A 4DE1A 4QJGA 4OQHA 3NBLA 3MZDA 4C3QA 3BFEA 1GHIA 3JYIA 1W79A 4JF4A 5DVAA 3VSKA 1MWUA 3TOIA 3PBSA 2H0YA 1NYMA 2WZZA 5L2FA 1S6RA 4FH2A 2EXAA 3ZG5A 4P0MA 2WAEA 3UN7A 3B3XA 5F1GA 5E2GA 3G35A 2HPBA 5G18A 3ZG9B 4ZAMA 3Q7ZA 4UA6A 5CERA 1FSWA 1XGJA 2EX2A 3NI9A 4K91A 2Q9NA 4ZDXA 4K0XA 5E2EA 3PBTA 2PU2A 1JTDA 1PZOA 3VSLA 3UDIA 1GHPA 3ZG8B 3HL9A 3WS2A 3SH9A 4BD1A 3IWOA 5JYPA 3SH8A 5IHVA 1GHMA 1YLTA 4JLFA 2G2WA 5CECA 2Y2QA 1HTZA 4BL3A 1G68A 4JKTA 3TG9A 3OPPA 1PWGA 1IYQA 4PM8A 2Y2JA 2HP6A 3GVBA 3PBNA 4Y7PA 1GCEA 4OLDA 5CRFA 4BQMA 5FQQA 5FSRA 2ZC7A 4DDSA 2JE5A 3HUOA 3N7WA 4OQIA 4QD4A 3I7JA 2V2FF 5CGWA 5I94A 3MKEA 4DE2A 3LEZA 3M2JA 1CI9A 4NK3A 1FR1A 2J8YA 5HAPA 5GLDA 4R3JA 5FI2A 5CHMA 2IWDA 4KG6A 5EVIA 5HW3A 4UA7A 1ESUA 1PWCA 3FWLA 3BFFA 3LY3A 2ZM0A 5DF8A 3VOYA 2X01A 2XD5A 4QHCA 2Y2NA 3VP0A 5GLAA 2DNSA 2WGIA 1Q2QA 2VGJA 3E2KA 4IBRA 5FQKA 1FCNA 4NETA 4U0XA 1IYOA 1K57A 1FQGA 3ITBA 1KE4A 3IXGA 4N9KA 4XXRA 4S2KA 2XD1A 2ZM2A 3OCNA 2WAFA 1MKIA 3GTCA 5F1FA 2Y59A 1K4FA 2XDMA 4OKPA 3G2YA 3HLBA 3LY4A 4LCLA 1KDSA 4S2NC 5U47A 1XA7A 2WGWB 2WZXA 3RXXA 3GV9A 4Q8IA 2V1ZA 3WRZA 2WKIA 1L0GA 4GOGA 4E3NA 2XK1A 1YT4A 4WMCD 2J9OA 1SDEA 1TVFA 3MXSA 3MZEA 4DXCA 2QMIA 2HP9A 3A3JA 3IHAA 5DTKA 1Y54A 4OQGA 3A3EA 4JXVA 3BYDA 4KZ5A 4KZ3A 5A91A 4MLLA 2Y91A 1LI9A 3UE1A 5D3OA 4FCFA 3ZVWA 1LL5A 4EBLA 1DJAA 2JCHA 5CGXA 3VP3A 3W4OA 4DE3A 4IEDA 5AQBA 1K55C 3V50A 1BLPA 1M40A 4IVKA 5AQAA 5CTMA 3ZNYA 3BLSA 3Q7VB 1G6AA 4GB7A 1PZPA 3UPNA 4B4XA 5CXWA 4KZBA 4OH0A 4WZ5C 5E2HA 4N1HA 4P87A 3C7VA 3O87A 1WYCA 3VP1A 3ZDJA 3IH9A 4S2OA 3UY6A 5DTTA 3S1YA 1JWZA 4PMAA 2ZQ8A 3Q82A 1KGEA 1YM1A 2EFUA 3FYZA 4JF6A 3BECA 2P9VA 4Y0OA 2ZQ9A 4BJPA 5EVID 4E3MA 3IF6B 2HDRA 2EFXA 3EQVA 4LCMA 3IF6C 4E3LA 3N4IA 1RP5A 3A3DA 4HESA 2PU4A 3ZNTA 1L0DA 4N1XA 4YFMA 4DXBA 4JXSA 1TEMA 1PWDA 3ZCZA 1BTLA 4JXWA 1BUEA 4EQIA 1BLHA 2ZJ9A 4X55A 3UDXA 2FFFB 4OOYA 3IH8A 3SS4A 1IYPA 4R1GA 4X6TA 1NRFA 1BLSA 2FFYA 3NC8A 2P9VB 4IBXA 4OVDA 5FI7A 5HAIA 4KQRA 4CPKA 3ZVTA 2BG1A 4KZ8A 5AQ7A 4KENB 4U0TA 3WS0A 4UAAA 3OPHA 3NDGA 3FZCA 1N9BA 2Q9MA 3HLDA 3IHBA 1KGFA 1IKIA 3G30A 4X69A 4XUZA 2JBFA 1EI5A 3ZG7B 3WS4A 4OPQA 4F94A 2WGWA 2WKEA 4QB8A 1I2WA 5KSCA 1BLCA 1SHVA 1ES3A 2UWXA 3N8SA 5GHXA 2E8IA 5EOOA 1YLWA 4JXGA 4KQOA 1NYYA 1KE0A 4X56A 1K57C 3AGDA 1ERQA 3N6IA 4P6BA 4GDBA 1ES4A 4BENA 4EBNA 1MWSA 1NJ4A 4FSFA 5DTSA 3G2ZA 3MBZA 1MWRA 1FR6A 4A5RA 2Y2MA 4E3IA 1W7FA 3VP4A 4OPRA 1FCOA 4ZJ1A 3IF6A 2G2UA 5EVIB 3V3RA 5JYOA 4MNRA 1JWVA 4BD0A 3DWKA 1MXOA 5DF9A 5CGSA 2XFTA 4X53A 1PI4A 3UO9A 3MZFA 5CHUA 3PAGA 4L0LA 1O07A 2QZ6A 1XX2A 2B5RA 1HVBA 1DJBA 4HEFA 1KE3A 3NCKA 4X68A 4CJNA 5GLBA 2Y2HA 3HLCA 2HP5A 5EVLA 3FKWA 1YLZA 4LV3A 5KSHA 1MY8A 4MBHA 3FV7A 1EROA 4WYYA 1J9MA 4UHUA 4E3JA 1PIOA 5CEDA 2XGNA 2DCFA 4WELA 1RGYA 2Y2GA 1WYBA 3VFHA 1XPBA 5F82A 1ES2A 3C4PA 1TDGA 4WZ4A 2HDQA 1K54C 3UNWA 1XKZA 2ZLYA 3E2LA 3DTMA 3N8RA 1YMXA 1YLPA 1QMEA 3CJMA 4UA9A 1ZG4A 2OLUA 1HD8A 3HLEA 3MXRA 5EOEA
chains in the Genus database with same CATH superfamily
5FATA 3T4LA 1ZG6A 4GDNA 4QY6A 4Q0JA 1IYSA 2EX8A 5DF7A 1LHYA 2VV7A 4RVAA 1E25A 3B42A 4R23A 3MXQA 5F83A 2W27A 1Y28A 1Q2PA 5IT5A 1YKDA 4KZ7A 2HF6A 1H3QA 2QYBA 1VEUB 5TFQA 1JTGA 2Y4AA 3M6BA 3IQAA 1MZUA 4S2LA 3A3IA 1GA9A 1ZTUA 4HBUA 4RX3A 3PBQA 3D72A 3UE3A 5C5KA 1OTEA 4BL2A 5EE8A 2EXBA 3V39A 1G5UA 1UGUA 4R38A 4EUZA 3VOZA 3CZDA 1JNUA 5CHJA 4R6LA 1D06A 5HL1A 2H5SA 3OLOA 5GLCA 1Z6FA 5CEBA 2PYPA 3VMAA 3W4PA 1I5QA 4FH4A 4ZJ3A 1QMFA 3GQZA 3BEBA 5TGFA 4BWIA 1NZOA 3OCLA 1STZA 2A49A 1YQSA 4EWFA 4HOIA 4KZAA 4D2OA 2X02A 3Q7VA 4LPZA 1PI5A 3S4XA 3VP2A 2ZL1B 3IX3A 3IT9A 3P09A 4MBFA 3SOIA 5HARA 5CTNA 1TD5A 1K38A 1XP4A 5DFYA 4LV0A 3V3SA 2W1TB 2AVXA 1T1BA 2XR0A 4ESPA 1SKOA 2VGLM 3EQUA 3GRJA 4R4RA 1W63M 1W8YA 2ZC6B 1UWNX 3A0RA 4OPZA 1K4EA 2D02A 2OWHA 4EV4A 3EGDC 3RXWA 5GHZA 4Y0UA 4B88A 2QJ7A 2INWA 4I3JA 1BT5A 4II7A 2EX9A 2OOLA 3OC2A 2EWVA 3QP2A 4C6YA 2KLIA 4WEJA 4KG2A 1JWPA 2J3TD 2YKFA 3AGFA 4Y2FA 3LR4A 1DY6A 2ZMFA 4OQ0A 1L3LA 3S22A 3IWIA 3HREA 4LFUA 3U2AA 2WK0A 2H0TA 1FCMA 2ZQAA 3WS1A 3D4FA 4XUXA 4L9FA 4BLMA 1K6SA 4PPRA 4DKIA 2J9PA 5EECA 2ACGA 5FAOA 1PW1A 2JN7A 1LI0A 3KO6A 3NBLA 1S66L 3MZDA 4P6ZM 2J3TC 4GJ4A 3VSKA 3EGXC 2WZZA 1NYMA 1S6RA 3ZG5A 4P0MA 2WAEA 3B3XA 5F1GA 1OTBA 3FPWA 5E2GA 2Z6DA 2H28A 4I5SA 1S1YA 1FSWA 1PNEA 4X1MA 2LB9A 4KQDA 5E2EA 3UDIA 2WKQA 3HL9A 3SH9A 4FOFA 1YLTA 2HZ5A 1KOUA 3PBNA 4GW9A 5CRFA 4BQMA 5FQQA 2ZC7A 3HUOA 2V2FF 1T18A 1CI9A 1FR1A 2J8YA 4R3JA 3C8CA 3T4JA 1TS7A 3KSFA 2W3HA 3QP8A 2WGIA 1Q2QA 2VGJA 5FQKA 1F2KA 1FCNA 5EVEA 1FQGA 4LRYC 2WAFA 4KUOA 5HD5A 5F1FA 1SKOB 2XDMA 3HLBA 3LY4A 1KDSA 3GV9A 3CUEC 4MN5A 4WMCD 1SDEA 3PYPA 4UQIS 2PD7A 5EFWA 2Y91A 2PD8A 3UE1A 3BQAA 1DJAA 3SZTA 3W4OA 3LIBA 4DE3A 1UWPX 1M40A 5AQAA 5CTMA 4HH3A 3FPVA 3UPNA 4B4XA 5E2HA 1OJGA 3C7VA 3VP1A 3ZDJA 3IH9A 3UY6A 2BASA 1JWZA 3UB6A 3BECA 2ZQ9A 3KX0X 3E98A 3EQVA 2OAQ1 4LCMA 1RP5A 4N1XA 4JXSA 1TEMA 1PWDA 1BTLA 2KDKA 4ETZA 2Z6CA 2ZJ9A 3MS6A 4X55A 2FFFB 5EV0A 4R1GA 4MN6A 2B18A 4PAUA 4OVDA 3H7WB 5HWWA 4PKYA 2BG1A 3T1XA 4U0TA 4UAAA 3QP5A 3NDGA 4GHIB 3T4QA 2Q9MA 1KGFA 3G30A 3T4KA 3LIFA 3LR5A 5L8MA 4EQ1A 3WS4A 1I2WA 5KSCA 1SHVA 4H6JB 1ES3A 3BW6A 1KE0A 4CQHA 3N6IA 2V0WA 4P6BA 4EBNA 1VETB 1VEUA 2OAP1 1MWRA 1FR6A 5L07A 3L9KA 1FCOA 3V3RA 3R4KA 1JWVA 3DWKA 1MXOA 1A0KA 5CGSA 4NXFA 3UO9A 2ZOHA 4LRXC 4NEED 3PAGA 4L0LA 1O07A 1VETA 1HVBA 3NCKA 2Y2HA 2M7UA 2HP5A 4ME4A 5KSHA 3MR0A 3FV7A 4WYYA 1J9MA 4UHUA 3S7PA 1PIOA 3DAVA 5CEDA 4WELA 2Y2GA 4X1LA 4WUJA 4PHTA 1EW0A 3UNWA 1XKZA 3DTMA 1S4RA 2VV8A 3RTYA 5DKLA 4Z9QA 3C4OA 4AFIA 5GHYA 3G31A 4HQAA 1YLYA 2FH5A 5J8XA 4B93A 3F1NB 2Y2PA 4Y13A 5TJJA 4S2MA 5FEGA 2ZMVA 1ONHA 3LR3A 4JGOA 4ZTKA 3H7WA 2K7SA 3NDEA 3DWZA 4L9GA 3P98A 3IF5A 2A3UA 3T50A 4DN0A 3FKVA 1BYWA 4WN5A 1K25A 1IEMA 1S4SA 2PBYA 1E3UD 2QHKA 2LB5A 2H10A 1SDNA 1SCWA 2WKPA 1ONGA 2PR5A 1PRQA 1VB6A 3CPTA 2X71A 3OPRA 4EBPA 4JF5A 3A3FA 3SS5A 4FTXA 4LV1A 1W8QA 5EVIC 4ZBEA 1V9YA 3QHYA 1ERMA 2XROA 2C5WB 3IXBA 1K54A 2A24A 4GS9A 3S7NA 4WM9A 5FASA 1XA1A 4KZ6A 4KZ9A 5GL9A 4K0WA 3LEQA 4HY8A 2P74A 1ALQA 5HAQA 2W3GA 4GKUA 3O3VA 4BMWA 3RJUA 4R3BA 2ZQ7A 1IFQA 3UB8A 3NOTC 5FQIA 1H5XA 1H8ZA 4DJ2A 3GSGA 3CUEA 2O9BA 4YINA 5MC7A 2B02A 3IXHA 2OWJA 4GS9B 1ESIA 5KMWA 4XT2B 3NOPC 2BLSA 3IWQA 4Y0TA 4LV2A 1BZAA 1CF0A 2WKHA 3IXDA 2QWSA 3HUMA 1FSYA 1XJ6A 2ZC5B 4YOFA 5HX9A 1S0WA 1MBLA 1EWZA 3ZG0A 3ZHHA 1AXBA 1T1AA 3HLGA 3CWFA 1CI8A 4DDYA 3NIAA 2YKHA 1C3BA 1U60A 2IWBA 1K56A 3RFBA 3SS3A 1H8YA 4OOMA 3HUNA 4FD8A 4GD6A 4NXEA 4QPRA 4OP5A 5HDDA 3O88A 3ULFA 4IVIA 4IJGA 5HSQA 4HI4A 3OBFA 4EERA 3GMWA 4UQIM 4WF0A 1NZUA 2FZ0A 4Y3IA 3VFFA 5HL6A 3TJZC 1YMSA 3B47A 1KGGA 4LRZE 3PR6A 3OPLA 3CI6A 2QJ5A 4DF6A 2GDNA 3C7UA 5M19A 3BFCA 3UPPA 3EEHA 1PW8A 1DJCA 4HP4A 1MC0A 4R0QA 5KZHA 4KG5A 4LLOB 4OQHA 3B33A 5AJGA 3VE3A 1N9LA 4L9EA 1MWUA 5L2FA 5DJUA 4CLCA 2EXAA 3S7QA 3UN7A 2HPBA 4ZAMA 4UEYA 3QP6A 3LI8A 5CERA 3LIAA 2EX2A 3ZYTA 4ZDXA 2W0NA 3VSLA 1GHPA 3W2ZA 3WS2A 2V1AA 2G2WA 1HTZA 4BL3A 4JKTA 3TG9A 2XSSA 1PWGA 4PM8A 5L10A 4DDSA 3O5YA 3JVUA 3N7WA 2XRNA 3BQ8A 3M2JA 4JGQA 5CHMA 1YAXA 2IWDA 4UA7A 3VOYA 2X01A 2ZOIA 4QHCA 3E2KA 4IBRA 4NETA 4U0XA 1F5MA 2V9AA 3ITBA 4QWOA 3DBAA 2XD1A 5L09A 2ZM2A 3OCNA 4MN7A 3K2NA 4OKPA 1XA7A 2WGWB 3RXXA 4Q8IA 5DFXA 1DP6A 3EEAA 2XK1A 1YT4A 2J9OA 1TVFA 2HP9A 3IHAA 3A3EA 4JXVA 1S1ZA 4MLLA 1PFLA 3T4SA 4FCFA 3VP3A 4EETB 4D60A 3ZNYA 3BLSA 1G6AA 4GB7A 3T1RA 1YSPA 4CLCD 4WZ5C 1YSQA 2V1BA 5CX7A 4RQ9A 5DTTA 4Y0OA 3Q82A 1KGEA 4JF6A 4F3LB 1F98A 3IF6C 3N4IA 2PU4A 5J3WA 1L0DA 3ZNTA 4YFMA 1DP8A 2NUPC 3ZCZA 4EQIA 5EM0A 3UDXA 3SS4A 4X6TA 1NRFA 4IBXA 1H8MA 3BY8A 5AQ7A 3WS0A 2PT7A 3OPHA 3FZCA 3KYZA 3HLDA 5F5YA 1OTIA 4XUZA 2A2LA 1EI5A 4OPQA 2WGWA 4IUHA 3VOLA 2UWXA 5GHXA 1YLWA 4JXGA 4PKYG 5TBMA 4X56A 1ERQA 2JHEA 2HV1A 1MWSA 5DTSA 3G2ZA 3T12B 3MBZA 2WKRA 4A5RA 2Y2MA 4ZJ1A 3K3DA 2G2UA 5JYOA 4ZRRA 4MNRA 2HJEA 4X53A 3MZFA 2QZ6A 2Q0OA 3MQ0A 1XJ2A 3L7HA 3FKWA 4MBHA 1TS6A 2PR6A 1RGYA 3VFHA 2EA9A 1P97A 1ES2A 1TDGA 2HDQA 2EWWA 4EEPA 4WL9A 3CJMA 1ZG4A 1HD8A 3MXRA 2PAVP 1D1JA 1ZC2A 2P08A 4S2IA 5AQ9A 4E3KA 1N9OA 5A92A 4E04A 3LGOA 2ZQCA 4PM6A 3CG5A 1OT9A 3UB5P 4Y15A 4DE0A 2Y2OA 3E4PA 4WEKA 3TE8A 3E0YA 3MF0A 4HJ6A 4M4XA 4BBTA 5M18A 2HDSA 1E4DA 4MDZA 1LT0A 3QNBA 1I2SA 4LGWA 5HWTA 4EXOA 4PM5A 2JKTM 3BRMA 3ZGAB 1XGIA 4H6JA 2GZAA 2J7VA 4HBTA 4MBKA 4S2PA 1SKFA 1L0EA 3S7OA 4ZJ2A 3V5MA 1GA0A 1CQAA 1OMEA 3N8LA 5I5LA 2M7VA 1CEGA 1RCJA 5BOHA 1L2SA 2W3DA 5FDHA 3UE0A 4B9OA 1TS8A 4N92A 4ARZB 4DRTA 1TDLA 4O8GA 3BM6A 2OV5A 3C5AA 5EPHA 1OPXA 3F1OB 4KZ4A 2DRWA 2Y2KA 2ZQDA 4RX2A 1W5DA 3Q1FA 3IBJA 3NY4A 5FQJA 3OZHA 3P7NA 1IELA 4OOLA 3BWLA 3C30A 3HVFA 3CMZA 2I72A 1X0OA 4Y17A 4EW7A 3LCEA 3GECA 5E2FA 3HBRA 2K2NA 5FAPA 2XQZA 5M1AA 3G32A 3CLOA 1M6KA 5F68A 4GD8A 2Z2LB 5FQMA 2JKRM 3O86A 2HDUA 3QNCA 2KX6A 3R7WA 1VQQA 2JKFA 3TSGA 3ISGA 1AWIA 1N9NA 2V20A 4WZ5A 5EUAA 2RCXA 4B4ZA 4S2NA 5DKKA 2XF3A 1NRJA 2CMNA 2HJ9C 1D7EA 4M3KA 1CJFA 1XFQA 4S2JA 3BFDA 1V9ZA 3SW1A 3DTEA 1WE4A 2R78A 3DTKA 4GN2A 3W4QA 3ZQ5A 2Y79A 3ITAA 4JPMA 1FOFA 2P7JA 4KQQA 4N9LA 3BY9A 4WBGA 3HLFA 1L0FA 4I38A 3HLWA 4U3TA 2Y2LA 5FI6A 4KUKA 4Z1WA 2WUQA 4P85A 3LFVA 3G4PA 2I9VA 1OJ5A 2ZD8A 3R7WB 2UV0E 4WMCA 3LIDA 2VGLS 4K08A 5A90A 2O9CA 3ZFZA 1TF1A 3PTEA 1KDWA 3CPTB 2ZL1A 2R9WA 4YNRA 4O7DA 4DE1A 4C3QA 3BFEA 1DP9A 3T1SA 3F1OA 1GHIA 3JYIA 1W79A 5DVAA 1TS0A 4FH2A 3G35A 1LSWA 3OOVA 5G18A 3ZG9B 5KIZA 3MQOA 4K91A 4K0XA 3PBTA 1JTDA 1PZOA 4BD1A 3IWOA 3SH8A 5IHVA 1GHMA 4ARZA 5CECA 2Y2QA 3OPPA 1IYQA 3DTIA 2Y2JA 2HP6A 3T4OA 3GVBA 2PDRA 4Y7PA 4QD4A 3I7JA 5CGWA 5J4EA 1GSXA 5I94A 1WA9A 3LEZA 3MMHA 5HAPA 4HNBA 2JKTI 3A0SA 5EVIA 5HW3A 2O99A 3LICA 4I3AA 3F1PA 2XD5A 4I39A 2VJWA 2Y2NA 2VX8A 5F6AA 1K57A 5HPIA 1KE4A 3E4QA 1MKIA 1IOUA 3G2YA 4LCLA 1F9IA 5U47A 2WZXA 3IS2B 4BBVA 3MFXA 3WRZA 1L0GA 4GOGA 3MXSA 3MZEA 4DXCA 2QMIA 3A3JA 4OQGA 2BTFP 4KZ5A 4KZ3A 1LI9A 3ZVWA 3NECA 1LL5A 4HJ3A 5CGXA 3T1QB 5AQBA 3V50A 4R70A 4ETXA 3Q7VB 1G28A 3IX4A 4KZBA 4OH0A 2JKRI 3D9YA 5K5BA 3O87A 2GJ3A 1YM1A 2EFUA 2PHYA 3FYZA 4BJPA 4CLCC 4E3MA 4NXGA 3VV4A 3A3DA 4DXBA 4Q0HA 3F1NA 3RH8B 4JXWA 1BUEA 1SZVA 2GX5A 3A0VA 1P9RA 4JGPA 2FFYA 1BLSA 3NC8A 5DJTA 2V0UA 5HAIA 4KQRA 1FILA 1DRMA 4EU0A 3ZVTA 3U4LP 4KZ8A 4KENB 4P6ZS 3UB7A 1OTAA 3IHBA 2P04A 2VA0A 2JBFA 3CAXA 2XA7S 4WLAA 5IU1A 3ZG7B 4F94A 2WKEA 4QB8A 1BLCA 2GNXA 4KQOA 1NYYA 1S67L 3AGDA 4GDBA 4BENA 2QKPA 1VHMA 5HD3A 4E3IA 3VP4A 3IF6A 4I3IA 5EVIB 3T4TA 4BD0A 5HWVA 2XFTA 1PI4A 4EUVA 4GLQA 2J3WA 1T19A 1DJBA 4EEUA 4HEFA 1KE3A 1H0MA 4X68A 3HLCA 1K0KA 1EROA 4E3JA 3UE6A 2L4RA 2XGNA 2DCFA 1XPBA 3C4PA 4WZ4A 1K54C 3LI9A 2ZLYA 1YMXA 3HJKA 1QMEA 5EOEA 3UMEA 3KSGA 4MEZA 4Q0IA 1K55A 3MKFA 4DJ3A 1T1CA 2WADA 3EWKA 1KVMA 2EX6A 2VZWA 3MJQA 1OT6A 3MQQA 3CHWP 3ICYA 3DW0A 1N4OA 2QPNA 1JVJA 4OONA 3Q81A 2IWCA 2XFSA 1E3UA 2Z2MB 2ZC3B 1HZOA 4ID4A 5FA7A 4C75A 5FDSA 2VGKA 4OLGA 2L1MA 3MSHA 1Y4OA 2ZC4B 1BULA 1XFNA 1BSGA 2V8CA 3AGEA 4XT2A 3WS5A 1YLJA 3IS2A 5G4YA 2XH9A 1IKGA 1CEFA 1J3WA 3V67A 3UPOA 2HGVA 5TR7A 2ZM8A 3M2KA 3PBOA 4GNUA 5J7EA 4R4SA 4PM9A 1K6RA 4QY5A 5HDSA 3BLMA 4JBFA 3GR2A 4YWZA 3M6HA 4HJ4A 4H8RA 4MMNA 1VM1A 4GZBA 3LO7A 2W1TA 5FAQA 1MWTA 3VE4A 2R9XA 3UDFA 4OP8A 3PBRA 1ACFA 3D3OA 2WGVA 4E6XA 2XEPA 1NY0A 3K3CA 2ZMAA 1LLBA 4E3OA 2VK3A 3H82A 5HFOA 4E6WA 1ZKJA 2KOIA 1XXMA 2WYXA 1K56D 4OPYA 2PBDP 4NXBA 5A93A 3G34A 2XLNA 2G7UA 1PYYA 2Y55A 1W63Q 2Y2IA 3JVVA 3MFDA 5AVEA 5FQ9A 3TW8A 3PAEA 1ES5A 3Q07A 4HP9A 2M1CA 2K31A 1CK3A 1O7EA 2C6WB 1HLUP 1MPLA 4NG2A 2RL3A 3QP1A 3SH7A 1KVLA 5EM1A 3PHYA 3W8KA 4LENA 4PM7A 3UMDA 3EOIA 2IA2A 3JPUA 1P0ZA 1RGZA 1NXYA 4QU3A 2CC1A 4CLCE 3WWXA 4GCZA 3WRTA 2DMWA 4FUWA 2D01A 3PXPA 5E43A 3BFGA 2OSUA 2JC7A 3HCYA 4RYEA 2OLVA 5HDCA 4RA7A 4CLCB 1LL9A 4QJGA 1NLZA 1XJ3A 1ODVA 4JF4A 3TOIA 3PBSA 2H0YA 1FIKA 2A24B 5A8BA 3LR0A 3Q7ZA 4UA6A 3NJAA 1XGJA 2W3FA 3NI9A 4IUKA 2NUTC 1GSWA 2PYRA 2Q9NA 3FC7A 4NKPA 2PU2A 3ZG8B 2VEAA 5JYPA 4JLFA 3H9WA 1G68A 2ZBBA 1GCEA 4OLDA 5FSRA 2J80A 2JE5A 4OQIA 4BBUA 3P01A 3MKEA 3GDIA 4DE2A 4NK3A 5GLDA 5FI2A 4JGRA 4KG6A 1ESUA 1PWCA 3FWLA 1YPRA 3BFFA 5LBRA 3LY3A 2ZM0A 5DF8A 3VP0A 5GLAA 2DNSA 1IYOA 2V8FA 3IXGA 4N9KA 4XXRA 4S2KA 2VKSA 3GTCA 3H82B 2Y59A 1K4FA 2L0WA 4S2NC 3TRCA 2V1ZA 2WKIA 2MJ6A 5G4ZA 4E3NA 5IS1A 4HH2A 1Z09A 5DTKA 1Y54A 2XA7M 3BYDA 4EESA 2W1RA 5A91A 5D3OA 4EBLA 3G6OA 2JCHA 2VV6A 4IEDA 1K55C 1BLPA 4IVKA 2PRFA 4O01A 1PZPA 5CXWA 1NLYA 4HIAA 4N1HA 3QP4A 4P87A 1WYCA 3NHQA 4S2OA 4F3LA 3S1YA 4PMAA 2ZQ8A 3LUQA 2P9VA 5EVID 3IF6B 2HDRA 2EFXA 2VLGA 3LIEA 4DMZA 1ZHHB 3KSIA 4HESA 4E3LA 3KYQA 3CITA 4R3AA 1BLHA 4OOYA 3IH8A 3F1PB 1IYPA 4HHDA 5HPFA 2P9VB 4G3WA 4G3KA 5FI7A 4CPKA 1XJ4A 3NOUC 4IHQA 4MCWA 2O0YA 1N9BA 5FEFA 4X69A 1IKIA 4Y5FA 1LSXA 5FL3A 4G3VA 1LSVA 4X25A 3N8SA 2E8IA 5EOOA 3E4OA 1P9WA 3IBRA 1K57C 5F69A 1ES4A 1MKMA 1NJ4A 4FSFA 1LL8A 1OTDA 4GHIA 1W7FA 4OPRA 2W3EA 5DF9A 3LYXA 3FG8A 5AVFA 3C2WA 3KSHA 3BJNA 5CHUA 1XX2A 2B5RA 3KYEA 4CJNA 5GLBA 5EVLA 1YLZA 4LV3A 2E8JA 3UB9A 1MY8A 1G6OA 1WYBA 5F82A 3C38A 2O9AA 3NULA 3IX8A 1GSVA 3HJIA 3E2LA 5HZHA 3N8RA 4O0PA 1YLPA 2B95A 4UA9A 5TBMB 2OLUA 2JKGA 3HLEA 1NWZA 2Y8HA
chains in the Genus database with same CATH topology
4Z9QA 4E3KA 1ZC2A 4S2IA 5AQ9A 3C4OA 4MEZA 5FATA 5GHYA 3G31A 1YLYA 1ZG6A 4GDNA 5J8XA 5A92A 1K55A 4QY6A 2Y2PA 2ZQCA 3MKFA 1IYSA 4S2MA 2EX8A 2WADA 4PM6A 3CG5A 5DF7A 1KVMA 1LHYA 4RVAA 2EX6A 4DE0A 1E25A 2Y2OA 4R23A 1ONHA 5F83A 3DW0A 4WEKA 4ZTKA 1N4OA 3NDEA 2QPNA 3DWZA 1JVJA 1Q2PA 3P98A 4OONA 4KZ7A 3IF5A 2A3UA 3Q81A 2IWCA 3FKVA 5M18A 2XFSA 2HDSA 1K25A 5TFQA 1E4DA 1IEMA 1E3UA 2PBYA 2Z2MB 1JTGA 1E3UD 2Y4AA 2ZC3B 1I2SA 3QNBA 3M6BA 1HZOA 3IQAA 2H10A 1SDNA 1SCWA 4ID4A 4PM5A 3BRMA 4S2LA 3A3IA 3ZGAB 1GA9A 1ONGA 5FA7A 1XGIA 4C75A 2J7VA 2X71A 3OPRA 4HBUA 2VGKA 4HBTA 4JF5A 4MBKA 4S2PA 4RX3A 4EBPA 1SKFA 1L0EA 3A3FA 4OLGA 3SS5A 4LV1A 1W8QA 4ZJ2A 3V5MA 1GA0A 1OMEA 3N8LA 5EVIC 4ZBEA 3QHYA 1ERMA 2ZC4B 1CEGA 2C5WB 3PBQA 1RCJA 1BULA 3IXBA 1K54A 3UE3A 5BOHA 1BSGA 1L2SA 3AGEA 4BL2A 3WS5A 1YLJA 5EE8A 2EXBA 3V39A 5FDHA 3UE0A 4EUZA 4N92A 3VOZA 2XH9A 3CZDA 4WM9A 4DRTA 1TDLA 5FASA 1XA1A 3BM6A 4KZ6A 1IKGA 1CEFA 3C5AA 5CHJA 5EPHA 2OV5A 4KZ9A 5GL9A 4K0WA 5HL1A 2H5SA 3UPOA 5TR7A 5GLCA 4KZ4A 2ZM8A 1Z6FA 3M2KA 2DRWA 1ALQA 2P74A 2Y2KA 2ZQDA 4RX2A 1W5DA 3VMAA 3W4PA 5CEBA 5HAQA 3Q1FA 4GKUA 3PBOA 3O3VA 1I5QA 4FH4A 4R3BA 1QMFA 4ZJ3A 3RJUA 3NY4A 2ZQ7A 3GQZA 4GNUA 5FQJA 3OZHA 3BEBA 4R4SA 5TGFA 4PM9A 1IELA 4OOLA 1K6RA 4QY5A 3HVFA 3BLMA 4JBFA 1NZOA 3OCLA 2A49A 3CMZA 3GR2A 1YQSA 5FQIA 1H5XA 1H8ZA 2I72A 3GSGA 3M6HA 3LCEA 4H8RA 4EWFA 5E2FA 3HBRA 4KZAA 4YINA 4D2OA 3IXHA 2X02A 5FAPA 1VM1A 3Q7VA 2XQZA 5M1AA 1PI5A 3G32A 3S4XA 1ESIA 1M6KA 4GZBA 3LO7A 5FAQA 3VP2A 5KMWA 3IT9A 4GD8A 1MWTA 2Z2LB 5FQMA 3O86A 2HDUA 2R9XA 3QNCA 2BLSA 3IWQA 4Y0TA 4LV2A 3P09A 1VQQA 3UDFA 1BZAA 4OP8A 4MBFA 3SOIA 3PBRA 5HARA 5CTNA 2WKHA 3TSGA 2WGVA 3ISGA 1K38A 3IXDA 1XP4A 3HUMA 2V20A 1FSYA 4WZ5A 4E6XA 2ZC5B 5EUAA 2XEPA 5HX9A 1S0WA 2RCXA 1MBLA 4LV0A 1EWZA 1NY0A 3V3SA 3ZG0A 4S2NA 4B4ZA 3ZHHA 2ZMAA 1LLBA 1AXBA 4E3OA 3HLGA 2XR0A 1CI8A 4DDYA 5HFOA 2XF3A 4E6WA 1ZKJA 3NIAA 3EQUA 3GRJA 4R4RA 1XXMA 1C3BA 2WYXA 1U60A 1K56D 2IWBA 4OPYA 4M3KA 1W8YA 1K56A 2ZC6B 3SS3A 5A93A 4S2JA 3BFDA 3G34A 2XLNA 1H8YA 4OPZA 1K4EA 1PYYA 4EV4A 2Y55A 3HUNA 4FD8A 4GD6A 4OOMA 5GHZA 3RXWA 1WE4A 4Y0UA 2Y2IA 4OP5A 4B88A 3MFDA 3O88A 4GN2A 3W4QA 4IVIA 5FQ9A 3ITAA 1BT5A 4JPMA 3GMWA 3PAEA 1FOFA 4KQQA 2EX9A 1ES5A 3Q07A 4N9LA 4WBGA 3OC2A 3HLFA 1L0FA 1CK3A 1O7EA 2C6WB 1NZUA 3HLWA 1MPLA 4C6YA 4U3TA 4WEJA 4KG2A 1JWPA 3VFFA 2RL3A 3AGFA 2Y2LA 5FI6A 3SH7A 1KVLA 1DY6A 1YMSA 3W8KA 1KGGA 4LENA 4OQ0A 4PM7A 2WUQA 4P85A 3S22A 3OPLA 3IWIA 1RGZA 1NXYA 3HREA 3G4PA 4QU3A 2CC1A 3WWXA 3WRTA 4DF6A 2GDNA 2WK0A 2ZD8A 3C7UA 5M19A 3BFCA 5E43A 4WMCA 2H0TA 3UPPA 1PW8A 3BFGA 2OSUA 1FCMA 2JC7A 2ZQAA 4RYEA 3WS1A 2OLVA 3D4FA 5A90A 1DJCA 4XUXA 3ZFZA 3PTEA 1K6SA 4PPRA 4R0QA 1KDWA 4BLMA 4DKIA 5KZHA 2J9PA 5EECA 4KG5A 4RA7A 2R9WA 5FAOA 1PW1A 1LL9A 4O7DA 1LI0A 4DE1A 4QJGA 4OQHA 3NBLA 3MZDA 4C3QA 3BFEA 1GHIA 3JYIA 1W79A 4JF4A 5DVAA 3VSKA 1MWUA 3TOIA 3PBSA 2H0YA 1NYMA 2WZZA 5L2FA 1S6RA 4FH2A 2EXAA 3ZG5A 4P0MA 2WAEA 3UN7A 3B3XA 5F1GA 5E2GA 3G35A 2HPBA 5G18A 3ZG9B 4ZAMA 3Q7ZA 4UA6A 5CERA 1FSWA 1XGJA 2EX2A 3NI9A 4K91A 2Q9NA 4ZDXA 4K0XA 5E2EA 3PBTA 2PU2A 1JTDA 1PZOA 3VSLA 3UDIA 1GHPA 3ZG8B 3HL9A 3WS2A 3SH9A 4BD1A 3IWOA 5JYPA 3SH8A 5IHVA 1GHMA 1YLTA 4JLFA 2G2WA 5CECA 2Y2QA 1HTZA 4BL3A 1G68A 4JKTA 3TG9A 3OPPA 1PWGA 1IYQA 4PM8A 2Y2JA 2HP6A 3GVBA 3PBNA 4Y7PA 1GCEA 4OLDA 5CRFA 4BQMA 5FQQA 5FSRA 2ZC7A 4DDSA 2JE5A 3HUOA 3N7WA 4OQIA 4QD4A 3I7JA 2V2FF 5CGWA 5I94A 3MKEA 4DE2A 3LEZA 3M2JA 1CI9A 4NK3A 1FR1A 2J8YA 5HAPA 5GLDA 4R3JA 5FI2A 5CHMA 2IWDA 4KG6A 5EVIA 5HW3A 4UA7A 1ESUA 1PWCA 3FWLA 3BFFA 3LY3A 2ZM0A 5DF8A 3VOYA 2X01A 2XD5A 4QHCA 2Y2NA 3VP0A 5GLAA 2DNSA 2WGIA 1Q2QA 2VGJA 3E2KA 4IBRA 5FQKA 1FCNA 4NETA 4U0XA 1IYOA 1K57A 1FQGA 3ITBA 1KE4A 3IXGA 4N9KA 4XXRA 4S2KA 2XD1A 2ZM2A 3OCNA 2WAFA 1MKIA 3GTCA 5F1FA 2Y59A 1K4FA 2XDMA 4OKPA 3G2YA 3HLBA 3LY4A 4LCLA 1KDSA 4S2NC 5U47A 1XA7A 2WGWB 2WZXA 3RXXA 3GV9A 4Q8IA 2V1ZA 3WRZA 2WKIA 1L0GA 4GOGA 4E3NA 2XK1A 1YT4A 4WMCD 2J9OA 1SDEA 1TVFA 3MXSA 3MZEA 4DXCA 2QMIA 2HP9A 3A3JA 3IHAA 5DTKA 1Y54A 4OQGA 3A3EA 4JXVA 3BYDA 4KZ5A 4KZ3A 5A91A 4MLLA 2Y91A 1LI9A 3UE1A 5D3OA 4FCFA 3ZVWA 1LL5A 4EBLA 1DJAA 2JCHA 5CGXA 3VP3A 3W4OA 4DE3A 4IEDA 5AQBA 1K55C 3V50A 1BLPA 1M40A 4IVKA 5AQAA 5CTMA 3ZNYA 3BLSA 3Q7VB 1G6AA 4GB7A 1PZPA 3UPNA 4B4XA 5CXWA 4KZBA 4OH0A 4WZ5C 5E2HA 4N1HA 4P87A 3C7VA 3O87A 1WYCA 3VP1A 3ZDJA 3IH9A 4S2OA 3UY6A 5DTTA 3S1YA 1JWZA 4PMAA 2ZQ8A 3Q82A 1KGEA 1YM1A 2EFUA 3FYZA 4JF6A 3BECA 2P9VA 4Y0OA 2ZQ9A 4BJPA 5EVID 4E3MA 3IF6B 2HDRA 2EFXA 3EQVA 4LCMA 3IF6C 4E3LA 3N4IA 1RP5A 3A3DA 4HESA 2PU4A 3ZNTA 1L0DA 4N1XA 4YFMA 4DXBA 4JXSA 1TEMA 1PWDA 3ZCZA 1BTLA 4JXWA 1BUEA 4EQIA 1BLHA 2ZJ9A 4X55A 3UDXA 2FFFB 4OOYA 3IH8A 3SS4A 1IYPA 4R1GA 4X6TA 1NRFA 1BLSA 2FFYA 3NC8A 2P9VB 4IBXA 4OVDA 5FI7A 5HAIA 4KQRA 4CPKA 3ZVTA 2BG1A 4KZ8A 5AQ7A 4KENB 4U0TA 3WS0A 4UAAA 3OPHA 3NDGA 3FZCA 1N9BA 2Q9MA 3HLDA 3IHBA 1KGFA 1IKIA 3G30A 4X69A 4XUZA 2JBFA 1EI5A 3ZG7B 3WS4A 4OPQA 4F94A 2WGWA 2WKEA 4QB8A 1I2WA 5KSCA 1BLCA 1SHVA 1ES3A 2UWXA 3N8SA 5GHXA 2E8IA 5EOOA 1YLWA 4JXGA 4KQOA 1NYYA 1KE0A 4X56A 1K57C 3AGDA 1ERQA 3N6IA 4P6BA 4GDBA 1ES4A 4BENA 4EBNA 1MWSA 1NJ4A 4FSFA 5DTSA 3G2ZA 3MBZA 1MWRA 1FR6A 4A5RA 2Y2MA 4E3IA 1W7FA 3VP4A 4OPRA 1FCOA 4ZJ1A 3IF6A 2G2UA 5EVIB 3V3RA 5JYOA 4MNRA 1JWVA 4BD0A 3DWKA 1MXOA 5DF9A 5CGSA 2XFTA 4X53A 1PI4A 3UO9A 3MZFA 5CHUA 3PAGA 4L0LA 1O07A 2QZ6A 1XX2A 2B5RA 1HVBA 1DJBA 4HEFA 1KE3A 3NCKA 4X68A 4CJNA 5GLBA 2Y2HA 3HLCA 2HP5A 5EVLA 3FKWA 1YLZA 4LV3A 5KSHA 1MY8A 4MBHA 3FV7A 1EROA 4WYYA 1J9MA 4UHUA 4E3JA 1PIOA 5CEDA 2XGNA 2DCFA 4WELA 1RGYA 2Y2GA 1WYBA 3VFHA 1XPBA 5F82A 1ES2A 3C4PA 1TDGA 4WZ4A 2HDQA 1K54C 3UNWA 1XKZA 2ZLYA 3E2LA 3DTMA 3N8RA 1YMXA 1YLPA 1QMEA 3CJMA 4UA9A 1ZG4A 2OLUA 1HD8A 3HLEA 3MXRA 5EOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z9Q A;  4E3K A;  1ZC2 A;  4S2I A;  5AQ9 A;  3C4O A;  4MEZ A;  5FAT A;  5GHY A;  3G31 A;  1YLY A;  1ZG6 A;  4GDN A;  5J8X A;  5A92 A;  1K55 A;  4QY6 A;  2Y2P A;  2ZQC A;  3MKF A;  1IYS A;  4S2M A;  2EX8 A;  2WAD A;  4PM6 A;  3CG5 A;  5DF7 A;  1KVM A;  1LHY A;  4RVA A;  2EX6 A;  4DE0 A;  1E25 A;  2Y2O A;  4R23 A;  1ONH A;  5F83 A;  3DW0 A;  4WEK A;  4ZTK A;  1N4O A;  3NDE A;  2QPN A;  3DWZ A;  1JVJ A;  1Q2P A;  3P98 A;  4OON A;  4KZ7 A;  3IF5 A;  2A3U A;  3Q81 A;  2IWC A;  3FKV A;  5M18 A;  2XFS A;  2HDS A;  1K25 A;  5TFQ A;  1E4D A;  1IEM A;  1E3U A;  2PBY A;  2Z2M B;  1JTG A;  1E3U D;  2Y4A A;  2ZC3 B;  1I2S A;  3QNB A;  3M6B A;  1HZO A;  3IQA A;  2H10 A;  1SDN A;  1SCW A;  4ID4 A;  4PM5 A;  3BRM A;  4S2L A;  3A3I A;  3ZGA B;  1GA9 A;  1ONG A;  5FA7 A;  1XGI A;  4C75 A;  2J7V A;  2X71 A;  3OPR A;  4HBU A;  2VGK A;  4HBT A;  4JF5 A;  4MBK A;  4S2P A;  4RX3 A;  4EBP A;  1SKF A;  1L0E A;  3A3F A;  4OLG A;  3SS5 A;  4LV1 A;  1W8Q A;  4ZJ2 A;  3V5M A;  1GA0 A;  1OME A;  3N8L A;  5EVI C;  4ZBE A;  3QHY A;  1ERM A;  2ZC4 B;  1CEG A;  2C5W B;  3PBQ A;  1RCJ A;  1BUL A;  3IXB A;  1K54 A;  3UE3 A;  5BOH A;  1BSG A;  1L2S A;  3AGE A;  4BL2 A;  3WS5 A;  1YLJ A;  5EE8 A;  2EXB A;  3V39 A;  5FDH A;  3UE0 A;  4EUZ A;  4N92 A;  3VOZ A;  2XH9 A;  3CZD A;  4WM9 A;  4DRT A;  1TDL A;  5FAS A;  1XA1 A;  3BM6 A;  4KZ6 A;  1IKG A;  1CEF A;  3C5A A;  5CHJ A;  5EPH A;  2OV5 A;  4KZ9 A;  5GL9 A;  4K0W A;  5HL1 A;  2H5S A;  3UPO A;  5TR7 A;  5GLC A;  4KZ4 A;  2ZM8 A;  1Z6F A;  3M2K A;  2DRW A;  1ALQ A;  2P74 A;  2Y2K A;  2ZQD A;  4RX2 A;  1W5D A;  3VMA A;  3W4P A;  5CEB A;  5HAQ A;  3Q1F A;  4GKU A;  3PBO A;  3O3V A;  1I5Q A;  4FH4 A;  4R3B A;  1QMF A;  4ZJ3 A;  3RJU A;  3NY4 A;  2ZQ7 A;  3GQZ A;  4GNU A;  5FQJ A;  3OZH A;  3BEB A;  4R4S A;  5TGF A;  4PM9 A;  1IEL A;  4OOL A;  1K6R A;  4QY5 A;  3HVF A;  3BLM A;  4JBF A;  1NZO A;  3OCL A;  2A49 A;  3CMZ A;  3GR2 A;  1YQS A;  5FQI A;  1H5X A;  1H8Z A;  2I72 A;  3GSG A;  3M6H A;  3LCE A;  4H8R A;  4EWF A;  5E2F A;  3HBR A;  4KZA A;  4YIN A;  4D2O A;  3IXH A;  2X02 A;  5FAP A;  1VM1 A;  3Q7V A;  2XQZ A;  5M1A A;  1PI5 A;  3G32 A;  3S4X A;  1ESI A;  1M6K A;  4GZB A;  3LO7 A;  5FAQ A;  3VP2 A;  5KMW A;  3IT9 A;  4GD8 A;  1MWT A;  2Z2L B;  5FQM A;  3O86 A;  2HDU A;  2R9X A;  3QNC A;  2BLS A;  3IWQ A;  4Y0T A;  4LV2 A;  3P09 A;  1VQQ A;  3UDF A;  1BZA A;  4OP8 A;  4MBF A;  3SOI A;  3PBR A;  5HAR A;  5CTN A;  2WKH A;  3TSG A;  2WGV A;  3ISG A;  1K38 A;  3IXD A;  1XP4 A;  3HUM A;  2V20 A;  1FSY A;  4WZ5 A;  4E6X A;  2ZC5 B;  5EUA A;  2XEP A;  5HX9 A;  1S0W A;  2RCX A;  1MBL A;  4LV0 A;  1EWZ A;  1NY0 A;  3V3S A;  3ZG0 A;  4S2N A;  4B4Z A;  3ZHH A;  2ZMA A;  1LLB A;  1AXB A;  4E3O A;  3HLG A;  2XR0 A;  1CI8 A;  4DDY A;  5HFO A;  2XF3 A;  4E6W A;  1ZKJ A;  3NIA A;  3EQU A;  3GRJ A;  4R4R A;  1XXM A;  1C3B A;  2WYX A;  1U60 A;  1K56 D;  2IWB A;  4OPY A;  4M3K A;  1W8Y A;  1K56 A;  2ZC6 B;  3SS3 A;  5A93 A;  4S2J A;  3BFD A;  3G34 A;  2XLN A;  1H8Y A;  4OPZ A;  1K4E A;  1PYY A;  4EV4 A;  2Y55 A;  3HUN A;  4FD8 A;  4GD6 A;  4OOM A;  5GHZ A;  3RXW A;  1WE4 A;  4Y0U A;  2Y2I A;  4OP5 A;  4B88 A;  3MFD A;  3O88 A;  4GN2 A;  3W4Q A;  4IVI A;  5FQ9 A;  3ITA A;  1BT5 A;  4JPM A;  3GMW A;  3PAE A;  1FOF A;  4KQQ A;  2EX9 A;  1ES5 A;  3Q07 A;  4N9L A;  4WBG A;  3OC2 A;  3HLF A;  1L0F A;  1CK3 A;  1O7E A;  2C6W B;  1NZU A;  3HLW A;  1MPL A;  4C6Y A;  4U3T A;  4WEJ A;  4KG2 A;  1JWP A;  3VFF A;  2RL3 A;  3AGF A;  2Y2L A;  5FI6 A;  3SH7 A;  1KVL A;  1DY6 A;  1YMS A;  3W8K A;  1KGG A;  4LEN A;  4OQ0 A;  4PM7 A;  2WUQ A;  4P85 A;  3S22 A;  3OPL A;  3IWI A;  1RGZ A;  1NXY A;  3HRE A;  3G4P A;  4QU3 A;  2CC1 A;  3WWX A;  3WRT A;  4DF6 A;  2GDN A;  2WK0 A;  2ZD8 A;  3C7U A;  5M19 A;  3BFC A;  5E43 A;  4WMC A;  2H0T A;  3UPP A;  1PW8 A;  3BFG A;  2OSU A;  1FCM A;  2JC7 A;  2ZQA A;  4RYE A;  3WS1 A;  2OLV A;  3D4F A;  5A90 A;  1DJC A;  4XUX A;  3ZFZ A;  3PTE A;  1K6S A;  4PPR A;  4R0Q A;  1KDW A;  4BLM A;  4DKI A;  5KZH A;  2J9P A;  5EEC A;  4KG5 A;  4RA7 A;  2R9W A;  5FAO A;  1PW1 A;  1LL9 A;  4O7D A;  1LI0 A;  4DE1 A;  4QJG A;  4OQH A;  3NBL A;  3MZD A;  4C3Q A;  3BFE A;  1GHI A;  3JYI A;  1W79 A;  4JF4 A;  5DVA A;  3VSK A;  1MWU A;  3TOI A;  3PBS A;  2H0Y A;  1NYM A;  2WZZ A;  5L2F A;  1S6R A;  4FH2 A;  2EXA A;  3ZG5 A;  4P0M A;  2WAE A;  3UN7 A;  3B3X A;  5F1G A;  5E2G A;  3G35 A;  2HPB A;  5G18 A;  3ZG9 B;  4ZAM A;  3Q7Z A;  4UA6 A;  5CER A;  1FSW A;  1XGJ A;  2EX2 A;  3NI9 A;  4K91 A;  2Q9N A;  4ZDX A;  4K0X A;  5E2E A;  3PBT A;  2PU2 A;  1JTD A;  1PZO A;  3VSL A;  3UDI A;  1GHP A;  3ZG8 B;  3HL9 A;  3WS2 A;  3SH9 A;  4BD1 A;  3IWO A;  5JYP A;  3SH8 A;  5IHV A;  1GHM A;  1YLT A;  4JLF A;  2G2W A;  5CEC A;  2Y2Q A;  1HTZ A;  4BL3 A;  1G68 A;  4JKT A;  3TG9 A;  3OPP A;  1PWG A;  1IYQ A;  4PM8 A;  2Y2J A;  2HP6 A;  3GVB A;  3PBN A;  4Y7P A;  1GCE A;  4OLD A;  5CRF A;  4BQM A;  5FQQ A;  5FSR A;  2ZC7 A;  4DDS A;  2JE5 A;  3HUO A;  3N7W A;  4OQI A;  4QD4 A;  3I7J A;  2V2F F;  5CGW A;  5I94 A;  3MKE A;  4DE2 A;  3LEZ A;  3M2J A;  1CI9 A;  4NK3 A;  1FR1 A;  2J8Y A;  5HAP A;  5GLD A;  4R3J A;  5FI2 A;  5CHM A;  2IWD A;  4KG6 A;  5EVI A;  5HW3 A;  4UA7 A;  1ESU A;  1PWC A;  3FWL A;  3BFF A;  3LY3 A;  2ZM0 A;  5DF8 A;  3VOY A;  2X01 A;  2XD5 A;  4QHC A;  2Y2N A;  3VP0 A;  5GLA A;  2DNS A;  2WGI A;  1Q2Q A;  2VGJ A;  3E2K A;  4IBR A;  5FQK A;  1FCN A;  4NET A;  4U0X A;  1IYO A;  1K57 A;  1FQG A;  3ITB A;  1KE4 A;  3IXG A;  4N9K A;  4XXR A;  4S2K A;  2XD1 A;  2ZM2 A;  3OCN A;  2WAF A;  1MKI A;  3GTC A;  5F1F A;  2Y59 A;  1K4F A;  2XDM A;  4OKP A;  3G2Y A;  3HLB A;  3LY4 A;  4LCL A;  1KDS A;  4S2N C;  5U47 A;  1XA7 A;  2WGW B;  2WZX A;  3RXX A;  3GV9 A;  4Q8I A;  2V1Z A;  3WRZ A;  2WKI A;  1L0G A;  4GOG A;  4E3N A;  2XK1 A;  1YT4 A;  4WMC D;  2J9O A;  1SDE A;  1TVF A;  3MXS A;  3MZE A;  4DXC A;  2QMI A;  2HP9 A;  3A3J A;  3IHA A;  5DTK A;  1Y54 A;  4OQG A;  3A3E A;  4JXV A;  3BYD A;  4KZ5 A;  4KZ3 A;  5A91 A;  4MLL A;  2Y91 A;  1LI9 A;  3UE1 A;  5D3O A;  4FCF A;  3ZVW A;  1LL5 A;  4EBL A;  1DJA A;  2JCH A;  5CGX A;  3VP3 A;  3W4O A;  4DE3 A;  4IED A;  5AQB A;  1K55 C;  3V50 A;  1BLP A;  1M40 A;  4IVK A;  5AQA A;  5CTM A;  3ZNY A;  3BLS A;  3Q7V B;  1G6A A;  4GB7 A;  1PZP A;  3UPN A;  4B4X A;  5CXW A;  4KZB A;  4OH0 A;  4WZ5 C;  5E2H A;  4N1H A;  4P87 A;  3C7V A;  3O87 A;  1WYC A;  3VP1 A;  3ZDJ A;  3IH9 A;  4S2O A;  3UY6 A;  5DTT A;  3S1Y A;  1JWZ A;  4PMA A;  2ZQ8 A;  3Q82 A;  1KGE A;  1YM1 A;  2EFU A;  3FYZ A;  4JF6 A;  3BEC A;  2P9V A;  4Y0O A;  2ZQ9 A;  4BJP A;  5EVI D;  4E3M A;  3IF6 B;  2HDR A;  2EFX A;  3EQV A;  4LCM A;  3IF6 C;  4E3L A;  3N4I A;  1RP5 A;  3A3D A;  4HES A;  2PU4 A;  3ZNT A;  1L0D A;  4N1X A;  4YFM A;  4DXB A;  4JXS A;  1TEM A;  1PWD A;  3ZCZ A;  1BTL A;  4JXW A;  1BUE A;  4EQI A;  1BLH A;  2ZJ9 A;  4X55 A;  3UDX A;  2FFF B;  4OOY A;  3IH8 A;  3SS4 A;  1IYP A;  4R1G A;  4X6T A;  1NRF A;  1BLS A;  2FFY A;  3NC8 A;  2P9V B;  4IBX A;  4OVD A;  5FI7 A;  5HAI A;  4KQR A;  4CPK A;  3ZVT A;  2BG1 A;  4KZ8 A;  5AQ7 A;  4KEN B;  4U0T A;  3WS0 A;  4UAA A;  3OPH A;  3NDG A;  3FZC A;  1N9B A;  2Q9M A;  3HLD A;  3IHB A;  1KGF A;  1IKI A;  3G30 A;  4X69 A;  4XUZ A;  2JBF A;  1EI5 A;  3ZG7 B;  3WS4 A;  4OPQ A;  4F94 A;  2WGW A;  2WKE A;  4QB8 A;  1I2W A;  5KSC A;  1BLC A;  1SHV A;  1ES3 A;  2UWX A;  3N8S A;  5GHX A;  2E8I A;  5EOO A;  1YLW A;  4JXG A;  4KQO A;  1NYY A;  1KE0 A;  4X56 A;  1K57 C;  3AGD A;  1ERQ A;  3N6I A;  4P6B A;  4GDB A;  1ES4 A;  4BEN A;  4EBN A;  1MWS A;  1NJ4 A;  4FSF A;  5DTS A;  3G2Z A;  3MBZ A;  1MWR A;  1FR6 A;  4A5R A;  2Y2M A;  4E3I A;  1W7F A;  3VP4 A;  4OPR A;  1FCO A;  4ZJ1 A;  3IF6 A;  2G2U A;  5EVI B;  3V3R A;  5JYO A;  4MNR A;  1JWV A;  4BD0 A;  3DWK A;  1MXO A;  5DF9 A;  5CGS A;  2XFT A;  4X53 A;  1PI4 A;  3UO9 A;  3MZF A;  5CHU A;  3PAG A;  4L0L A;  1O07 A;  2QZ6 A;  1XX2 A;  2B5R A;  1HVB A;  1DJB A;  4HEF A;  1KE3 A;  3NCK A;  4X68 A;  4CJN A;  5GLB A;  2Y2H A;  3HLC A;  2HP5 A;  5EVL A;  3FKW A;  1YLZ A;  4LV3 A;  5KSH A;  1MY8 A;  4MBH A;  3FV7 A;  1ERO A;  4WYY A;  1J9M A;  4UHU A;  4E3J A;  1PIO A;  5CED A;  2XGN A;  2DCF A;  4WEL A;  1RGY A;  2Y2G A;  1WYB A;  3VFH A;  1XPB A;  5F82 A;  1ES2 A;  3C4P A;  1TDG A;  4WZ4 A;  2HDQ A;  1K54 C;  3UNW A;  1XKZ A;  2ZLY A;  3E2L A;  3DTM A;  3N8R A;  1YMX A;  1YLP A;  1QME A;  3CJM A;  4UA9 A;  1ZG4 A;  2OLU A;  1HD8 A;  3HLE A;  3MXR A;  5EOE A; 
#chains in the Genus database with same CATH topology
 5FAT A;  3T4L A;  1ZG6 A;  4GDN A;  4QY6 A;  4Q0J A;  1IYS A;  2EX8 A;  5DF7 A;  1LHY A;  2VV7 A;  4RVA A;  1E25 A;  3B42 A;  4R23 A;  3MXQ A;  5F83 A;  2W27 A;  1Y28 A;  1Q2P A;  5IT5 A;  1YKD A;  4KZ7 A;  2HF6 A;  1H3Q A;  2QYB A;  1VEU B;  5TFQ A;  1JTG A;  2Y4A A;  3M6B A;  3IQA A;  1MZU A;  4S2L A;  3A3I A;  1GA9 A;  1ZTU A;  4HBU A;  4RX3 A;  3PBQ A;  3D72 A;  3UE3 A;  5C5K A;  1OTE A;  4BL2 A;  5EE8 A;  2EXB A;  3V39 A;  1G5U A;  1UGU A;  4R38 A;  4EUZ A;  3VOZ A;  3CZD A;  1JNU A;  5CHJ A;  4R6L A;  1D06 A;  5HL1 A;  2H5S A;  3OLO A;  5GLC A;  1Z6F A;  5CEB A;  2PYP A;  3VMA A;  3W4P A;  1I5Q A;  4FH4 A;  4ZJ3 A;  1QMF A;  3GQZ A;  3BEB A;  5TGF A;  4BWI A;  1NZO A;  3OCL A;  1STZ A;  2A49 A;  1YQS A;  4EWF A;  4HOI A;  4KZA A;  4D2O A;  2X02 A;  3Q7V A;  4LPZ A;  1PI5 A;  3S4X A;  3VP2 A;  2ZL1 B;  3IX3 A;  3IT9 A;  3P09 A;  4MBF A;  3SOI A;  5HAR A;  5CTN A;  1TD5 A;  1K38 A;  1XP4 A;  5DFY A;  4LV0 A;  3V3S A;  2W1T B;  2AVX A;  1T1B A;  2XR0 A;  4ESP A;  1SKO A;  2VGL M;  3EQU A;  3GRJ A;  4R4R A;  1W63 M;  1W8Y A;  2ZC6 B;  1UWN X;  3A0R A;  4OPZ A;  1K4E A;  2D02 A;  2OWH A;  4EV4 A;  3EGD C;  3RXW A;  5GHZ A;  4Y0U A;  4B88 A;  2QJ7 A;  2INW A;  4I3J A;  1BT5 A;  4II7 A;  2EX9 A;  2OOL A;  3OC2 A;  2EWV A;  3QP2 A;  4C6Y A;  2KLI A;  4WEJ A;  4KG2 A;  1JWP A;  2J3T D;  2YKF A;  3AGF A;  4Y2F A;  3LR4 A;  1DY6 A;  2ZMF A;  4OQ0 A;  1L3L A;  3S22 A;  3IWI A;  3HRE A;  4LFU A;  3U2A A;  2WK0 A;  2H0T A;  1FCM A;  2ZQA A;  3WS1 A;  3D4F A;  4XUX A;  4L9F A;  4BLM A;  1K6S A;  4PPR A;  4DKI A;  2J9P A;  5EEC A;  2ACG A;  5FAO A;  1PW1 A;  2JN7 A;  1LI0 A;  3KO6 A;  3NBL A;  1S66 L;  3MZD A;  4P6Z M;  2J3T C;  4GJ4 A;  3VSK A;  3EGX C;  2WZZ A;  1NYM A;  1S6R A;  3ZG5 A;  4P0M A;  2WAE A;  3B3X A;  5F1G A;  1OTB A;  3FPW A;  5E2G A;  2Z6D A;  2H28 A;  4I5S A;  1S1Y A;  1FSW A;  1PNE A;  4X1M A;  2LB9 A;  4KQD A;  5E2E A;  3UDI A;  2WKQ A;  3HL9 A;  3SH9 A;  4FOF A;  1YLT A;  2HZ5 A;  1KOU A;  3PBN A;  4GW9 A;  5CRF A;  4BQM A;  5FQQ A;  2ZC7 A;  3HUO A;  2V2F F;  1T18 A;  1CI9 A;  1FR1 A;  2J8Y A;  4R3J A;  3C8C A;  3T4J A;  1TS7 A;  3KSF A;  2W3H A;  3QP8 A;  2WGI A;  1Q2Q A;  2VGJ A;  5FQK A;  1F2K A;  1FCN A;  5EVE A;  1FQG A;  4LRY C;  2WAF A;  4KUO A;  5HD5 A;  5F1F A;  1SKO B;  2XDM A;  3HLB A;  3LY4 A;  1KDS A;  3GV9 A;  3CUE C;  4MN5 A;  4WMC D;  1SDE A;  3PYP A;  4UQI S;  2PD7 A;  5EFW A;  2Y91 A;  2PD8 A;  3UE1 A;  3BQA A;  1DJA A;  3SZT A;  3W4O A;  3LIB A;  4DE3 A;  1UWP X;  1M40 A;  5AQA A;  5CTM A;  4HH3 A;  3FPV A;  3UPN A;  4B4X A;  5E2H A;  1OJG A;  3C7V A;  3VP1 A;  3ZDJ A;  3IH9 A;  3UY6 A;  2BAS A;  1JWZ A;  3UB6 A;  3BEC A;  2ZQ9 A;  3KX0 X;  3E98 A;  3EQV A;  2OAQ 1;  4LCM A;  1RP5 A;  4N1X A;  4JXS A;  1TEM A;  1PWD A;  1BTL A;  2KDK A;  4ETZ A;  2Z6C A;  2ZJ9 A;  3MS6 A;  4X55 A;  2FFF B;  5EV0 A;  4R1G A;  4MN6 A;  2B18 A;  4PAU A;  4OVD A;  3H7W B;  5HWW A;  4PKY A;  2BG1 A;  3T1X A;  4U0T A;  4UAA A;  3QP5 A;  3NDG A;  4GHI B;  3T4Q A;  2Q9M A;  1KGF A;  3G30 A;  3T4K A;  3LIF A;  3LR5 A;  5L8M A;  4EQ1 A;  3WS4 A;  1I2W A;  5KSC A;  1SHV A;  4H6J B;  1ES3 A;  3BW6 A;  1KE0 A;  4CQH A;  3N6I A;  2V0W A;  4P6B A;  4EBN A;  1VET B;  1VEU A;  2OAP 1;  1MWR A;  1FR6 A;  5L07 A;  3L9K A;  1FCO A;  3V3R A;  3R4K A;  1JWV A;  3DWK A;  1MXO A;  1A0K A;  5CGS A;  4NXF A;  3UO9 A;  2ZOH A;  4LRX C;  4NEE D;  3PAG A;  4L0L A;  1O07 A;  1VET A;  1HVB A;  3NCK A;  2Y2H A;  2M7U A;  2HP5 A;  4ME4 A;  5KSH A;  3MR0 A;  3FV7 A;  4WYY A;  1J9M A;  4UHU A;  3S7P A;  1PIO A;  3DAV A;  5CED A;  4WEL A;  2Y2G A;  4X1L A;  4WUJ A;  4PHT A;  1EW0 A;  3UNW A;  1XKZ A;  3DTM A;  1S4R A;  2VV8 A;  3RTY A;  5DKL A;  4Z9Q A;  3C4O A;  4AFI A;  5GHY A;  3G31 A;  4HQA A;  1YLY A;  2FH5 A;  5J8X A;  4B93 A;  3F1N B;  2Y2P A;  4Y13 A;  5TJJ A;  4S2M A;  5FEG A;  2ZMV A;  1ONH A;  3LR3 A;  4JGO A;  4ZTK A;  3H7W A;  2K7S A;  3NDE A;  3DWZ A;  4L9G A;  3P98 A;  3IF5 A;  2A3U A;  3T50 A;  4DN0 A;  3FKV A;  1BYW A;  4WN5 A;  1K25 A;  1IEM A;  1S4S A;  2PBY A;  1E3U D;  2QHK A;  2LB5 A;  2H10 A;  1SDN A;  1SCW A;  2WKP A;  1ONG A;  2PR5 A;  1PRQ A;  1VB6 A;  3CPT A;  2X71 A;  3OPR A;  4EBP A;  4JF5 A;  3A3F A;  3SS5 A;  4FTX A;  4LV1 A;  1W8Q A;  5EVI C;  4ZBE A;  1V9Y A;  3QHY A;  1ERM A;  2XRO A;  2C5W B;  3IXB A;  1K54 A;  2A24 A;  4GS9 A;  3S7N A;  4WM9 A;  5FAS A;  1XA1 A;  4KZ6 A;  4KZ9 A;  5GL9 A;  4K0W A;  3LEQ A;  4HY8 A;  2P74 A;  1ALQ A;  5HAQ A;  2W3G A;  4GKU A;  3O3V A;  4BMW A;  3RJU A;  4R3B A;  2ZQ7 A;  1IFQ A;  3UB8 A;  3NOT C;  5FQI A;  1H5X A;  1H8Z A;  4DJ2 A;  3GSG A;  3CUE A;  2O9B A;  4YIN A;  5MC7 A;  2B02 A;  3IXH A;  2OWJ A;  4GS9 B;  1ESI A;  5KMW A;  4XT2 B;  3NOP C;  2BLS A;  3IWQ A;  4Y0T A;  4LV2 A;  1BZA A;  1CF0 A;  2WKH A;  3IXD A;  2QWS A;  3HUM A;  1FSY A;  1XJ6 A;  2ZC5 B;  4YOF A;  5HX9 A;  1S0W A;  1MBL A;  1EWZ A;  3ZG0 A;  3ZHH A;  1AXB A;  1T1A A;  3HLG A;  3CWF A;  1CI8 A;  4DDY A;  3NIA A;  2YKH A;  1C3B A;  1U60 A;  2IWB A;  1K56 A;  3RFB A;  3SS3 A;  1H8Y A;  4OOM A;  3HUN A;  4FD8 A;  4GD6 A;  4NXE A;  4QPR A;  4OP5 A;  5HDD A;  3O88 A;  3ULF A;  4IVI A;  4IJG A;  5HSQ A;  4HI4 A;  3OBF A;  4EER A;  3GMW A;  4UQI M;  4WF0 A;  1NZU A;  2FZ0 A;  4Y3I A;  3VFF A;  5HL6 A;  3TJZ C;  1YMS A;  3B47 A;  1KGG A;  4LRZ E;  3PR6 A;  3OPL A;  3CI6 A;  2QJ5 A;  4DF6 A;  2GDN A;  3C7U A;  5M19 A;  3BFC A;  3UPP A;  3EEH A;  1PW8 A;  1DJC A;  4HP4 A;  1MC0 A;  4R0Q A;  5KZH A;  4KG5 A;  4LLO B;  4OQH A;  3B33 A;  5AJG A;  3VE3 A;  1N9L A;  4L9E A;  1MWU A;  5L2F A;  5DJU A;  4CLC A;  2EXA A;  3S7Q A;  3UN7 A;  2HPB A;  4ZAM A;  4UEY A;  3QP6 A;  3LI8 A;  5CER A;  3LIA A;  2EX2 A;  3ZYT A;  4ZDX A;  2W0N A;  3VSL A;  1GHP A;  3W2Z A;  3WS2 A;  2V1A A;  2G2W A;  1HTZ A;  4BL3 A;  4JKT A;  3TG9 A;  2XSS A;  1PWG A;  4PM8 A;  5L10 A;  4DDS A;  3O5Y A;  3JVU A;  3N7W A;  2XRN A;  3BQ8 A;  3M2J A;  4JGQ A;  5CHM A;  1YAX A;  2IWD A;  4UA7 A;  3VOY A;  2X01 A;  2ZOI A;  4QHC A;  3E2K A;  4IBR A;  4NET A;  4U0X A;  1F5M A;  2V9A A;  3ITB A;  4QWO A;  3DBA A;  2XD1 A;  5L09 A;  2ZM2 A;  3OCN A;  4MN7 A;  3K2N A;  4OKP A;  1XA7 A;  2WGW B;  3RXX A;  4Q8I A;  5DFX A;  1DP6 A;  3EEA A;  2XK1 A;  1YT4 A;  2J9O A;  1TVF A;  2HP9 A;  3IHA A;  3A3E A;  4JXV A;  1S1Z A;  4MLL A;  1PFL A;  3T4S A;  4FCF A;  3VP3 A;  4EET B;  4D60 A;  3ZNY A;  3BLS A;  1G6A A;  4GB7 A;  3T1R A;  1YSP A;  4CLC D;  4WZ5 C;  1YSQ A;  2V1B A;  5CX7 A;  4RQ9 A;  5DTT A;  4Y0O A;  3Q82 A;  1KGE A;  4JF6 A;  4F3L B;  1F98 A;  3IF6 C;  3N4I A;  2PU4 A;  5J3W A;  1L0D A;  3ZNT A;  4YFM A;  1DP8 A;  2NUP C;  3ZCZ A;  4EQI A;  5EM0 A;  3UDX A;  3SS4 A;  4X6T A;  1NRF A;  4IBX A;  1H8M A;  3BY8 A;  5AQ7 A;  3WS0 A;  2PT7 A;  3OPH A;  3FZC A;  3KYZ A;  3HLD A;  5F5Y A;  1OTI A;  4XUZ A;  2A2L A;  1EI5 A;  4OPQ A;  2WGW A;  4IUH A;  3VOL A;  2UWX A;  5GHX A;  1YLW A;  4JXG A;  4PKY G;  5TBM A;  4X56 A;  1ERQ A;  2JHE A;  2HV1 A;  1MWS A;  5DTS A;  3G2Z A;  3T12 B;  3MBZ A;  2WKR A;  4A5R A;  2Y2M A;  4ZJ1 A;  3K3D A;  2G2U A;  5JYO A;  4ZRR A;  4MNR A;  2HJE A;  4X53 A;  3MZF A;  2QZ6 A;  2Q0O A;  3MQ0 A;  1XJ2 A;  3L7H A;  3FKW A;  4MBH A;  1TS6 A;  2PR6 A;  1RGY A;  3VFH A;  2EA9 A;  1P97 A;  1ES2 A;  1TDG A;  2HDQ A;  2EWW A;  4EEP A;  4WL9 A;  3CJM A;  1ZG4 A;  1HD8 A;  3MXR A;  2PAV P;  1D1J A;  1ZC2 A;  2P08 A;  4S2I A;  5AQ9 A;  4E3K A;  1N9O A;  5A92 A;  4E04 A;  3LGO A;  2ZQC A;  4PM6 A;  3CG5 A;  1OT9 A;  3UB5 P;  4Y15 A;  4DE0 A;  2Y2O A;  3E4P A;  4WEK A;  3TE8 A;  3E0Y A;  3MF0 A;  4HJ6 A;  4M4X A;  4BBT A;  5M18 A;  2HDS A;  1E4D A;  4MDZ A;  1LT0 A;  3QNB A;  1I2S A;  4LGW A;  5HWT A;  4EXO A;  4PM5 A;  2JKT M;  3BRM A;  3ZGA B;  1XGI A;  4H6J A;  2GZA A;  2J7V A;  4HBT A;  4MBK A;  4S2P A;  1SKF A;  1L0E A;  3S7O A;  4ZJ2 A;  3V5M A;  1GA0 A;  1CQA A;  1OME A;  3N8L A;  5I5L A;  2M7V A;  1CEG A;  1RCJ A;  5BOH A;  1L2S A;  2W3D A;  5FDH A;  3UE0 A;  4B9O A;  1TS8 A;  4N92 A;  4ARZ B;  4DRT A;  1TDL A;  4O8G A;  3BM6 A;  2OV5 A;  3C5A A;  5EPH A;  1OPX A;  3F1O B;  4KZ4 A;  2DRW A;  2Y2K A;  2ZQD A;  4RX2 A;  1W5D A;  3Q1F A;  3IBJ A;  3NY4 A;  5FQJ A;  3OZH A;  3P7N A;  1IEL A;  4OOL A;  3BWL A;  3C30 A;  3HVF A;  3CMZ A;  2I72 A;  1X0O A;  4Y17 A;  4EW7 A;  3LCE A;  3GEC A;  5E2F A;  3HBR A;  2K2N A;  5FAP A;  2XQZ A;  5M1A A;  3G32 A;  3CLO A;  1M6K A;  5F68 A;  4GD8 A;  2Z2L B;  5FQM A;  2JKR M;  3O86 A;  2HDU A;  3QNC A;  2KX6 A;  3R7W A;  1VQQ A;  2JKF A;  3TSG A;  3ISG A;  1AWI A;  1N9N A;  2V20 A;  4WZ5 A;  5EUA A;  2RCX A;  4B4Z A;  4S2N A;  5DKK A;  2XF3 A;  1NRJ A;  2CMN A;  2HJ9 C;  1D7E A;  4M3K A;  1CJF A;  1XFQ A;  4S2J A;  3BFD A;  1V9Z A;  3SW1 A;  3DTE A;  1WE4 A;  2R78 A;  3DTK A;  4GN2 A;  3W4Q A;  3ZQ5 A;  2Y79 A;  3ITA A;  4JPM A;  1FOF A;  2P7J A;  4KQQ A;  4N9L A;  3BY9 A;  4WBG A;  3HLF A;  1L0F A;  4I38 A;  3HLW A;  4U3T A;  2Y2L A;  5FI6 A;  4KUK A;  4Z1W A;  2WUQ A;  4P85 A;  3LFV A;  3G4P A;  2I9V A;  1OJ5 A;  2ZD8 A;  3R7W B;  2UV0 E;  4WMC A;  3LID A;  2VGL S;  4K08 A;  5A90 A;  2O9C A;  3ZFZ A;  1TF1 A;  3PTE A;  1KDW A;  3CPT B;  2ZL1 A;  2R9W A;  4YNR A;  4O7D A;  4DE1 A;  4C3Q A;  3BFE A;  1DP9 A;  3T1S A;  3F1O A;  1GHI A;  3JYI A;  1W79 A;  5DVA A;  1TS0 A;  4FH2 A;  3G35 A;  1LSW A;  3OOV A;  5G18 A;  3ZG9 B;  5KIZ A;  3MQO A;  4K91 A;  4K0X A;  3PBT A;  1JTD A;  1PZO A;  4BD1 A;  3IWO A;  3SH8 A;  5IHV A;  1GHM A;  4ARZ A;  5CEC A;  2Y2Q A;  3OPP A;  1IYQ A;  3DTI A;  2Y2J A;  2HP6 A;  3T4O A;  3GVB A;  2PDR A;  4Y7P A;  4QD4 A;  3I7J A;  5CGW A;  5J4E A;  1GSX A;  5I94 A;  1WA9 A;  3LEZ A;  3MMH A;  5HAP A;  4HNB A;  2JKT I;  3A0S A;  5EVI A;  5HW3 A;  2O99 A;  3LIC A;  4I3A A;  3F1P A;  2XD5 A;  4I39 A;  2VJW A;  2Y2N A;  2VX8 A;  5F6A A;  1K57 A;  5HPI A;  1KE4 A;  3E4Q A;  1MKI A;  1IOU A;  3G2Y A;  4LCL A;  1F9I A;  5U47 A;  2WZX A;  3IS2 B;  4BBV A;  3MFX A;  3WRZ A;  1L0G A;  4GOG A;  3MXS A;  3MZE A;  4DXC A;  2QMI A;  3A3J A;  4OQG A;  2BTF P;  4KZ5 A;  4KZ3 A;  1LI9 A;  3ZVW A;  3NEC A;  1LL5 A;  4HJ3 A;  5CGX A;  3T1Q B;  5AQB A;  3V50 A;  4R70 A;  4ETX A;  3Q7V B;  1G28 A;  3IX4 A;  4KZB A;  4OH0 A;  2JKR I;  3D9Y A;  5K5B A;  3O87 A;  2GJ3 A;  1YM1 A;  2EFU A;  2PHY A;  3FYZ A;  4BJP A;  4CLC C;  4E3M A;  4NXG A;  3VV4 A;  3A3D A;  4DXB A;  4Q0H A;  3F1N A;  3RH8 B;  4JXW A;  1BUE A;  1SZV A;  2GX5 A;  3A0V A;  1P9R A;  4JGP A;  2FFY A;  1BLS A;  3NC8 A;  5DJT A;  2V0U A;  5HAI A;  4KQR A;  1FIL A;  1DRM A;  4EU0 A;  3ZVT A;  3U4L P;  4KZ8 A;  4KEN B;  4P6Z S;  3UB7 A;  1OTA A;  3IHB A;  2P04 A;  2VA0 A;  2JBF A;  3CAX A;  2XA7 S;  4WLA A;  5IU1 A;  3ZG7 B;  4F94 A;  2WKE A;  4QB8 A;  1BLC A;  2GNX A;  4KQO A;  1NYY A;  1S67 L;  3AGD A;  4GDB A;  4BEN A;  2QKP A;  1VHM A;  5HD3 A;  4E3I A;  3VP4 A;  3IF6 A;  4I3I A;  5EVI B;  3T4T A;  4BD0 A;  5HWV A;  2XFT A;  1PI4 A;  4EUV A;  4GLQ A;  2J3W A;  1T19 A;  1DJB A;  4EEU A;  4HEF A;  1KE3 A;  1H0M A;  4X68 A;  3HLC A;  1K0K A;  1ERO A;  4E3J A;  3UE6 A;  2L4R A;  2XGN A;  2DCF A;  1XPB A;  3C4P A;  4WZ4 A;  1K54 C;  3LI9 A;  2ZLY A;  1YMX A;  3HJK A;  1QME A;  5EOE A;  3UME A;  3KSG A;  4MEZ A;  4Q0I A;  1K55 A;  3MKF A;  4DJ3 A;  1T1C A;  2WAD A;  3EWK A;  1KVM A;  2EX6 A;  2VZW A;  3MJQ A;  1OT6 A;  3MQQ A;  3CHW P;  3ICY A;  3DW0 A;  1N4O A;  2QPN A;  1JVJ A;  4OON A;  3Q81 A;  2IWC A;  2XFS A;  1E3U A;  2Z2M B;  2ZC3 B;  1HZO A;  4ID4 A;  5FA7 A;  4C75 A;  5FDS A;  2VGK A;  4OLG A;  2L1M A;  3MSH A;  1Y4O A;  2ZC4 B;  1BUL A;  1XFN A;  1BSG A;  2V8C A;  3AGE A;  4XT2 A;  3WS5 A;  1YLJ A;  3IS2 A;  5G4Y A;  2XH9 A;  1IKG A;  1CEF A;  1J3W A;  3V67 A;  3UPO A;  2HGV A;  5TR7 A;  2ZM8 A;  3M2K A;  3PBO A;  4GNU A;  5J7E A;  4R4S A;  4PM9 A;  1K6R A;  4QY5 A;  5HDS A;  3BLM A;  4JBF A;  3GR2 A;  4YWZ A;  3M6H A;  4HJ4 A;  4H8R A;  4MMN A;  1VM1 A;  4GZB A;  3LO7 A;  2W1T A;  5FAQ A;  1MWT A;  3VE4 A;  2R9X A;  3UDF A;  4OP8 A;  3PBR A;  1ACF A;  3D3O A;  2WGV A;  4E6X A;  2XEP A;  1NY0 A;  3K3C A;  2ZMA A;  1LLB A;  4E3O A;  2VK3 A;  3H82 A;  5HFO A;  4E6W A;  1ZKJ A;  2KOI A;  1XXM A;  2WYX A;  1K56 D;  4OPY A;  2PBD P;  4NXB A;  5A93 A;  3G34 A;  2XLN A;  2G7U A;  1PYY A;  2Y55 A;  1W63 Q;  2Y2I A;  3JVV A;  3MFD A;  5AVE A;  5FQ9 A;  3TW8 A;  3PAE A;  1ES5 A;  3Q07 A;  4HP9 A;  2M1C A;  2K31 A;  1CK3 A;  1O7E A;  2C6W B;  1HLU P;  1MPL A;  4NG2 A;  2RL3 A;  3QP1 A;  3SH7 A;  1KVL A;  5EM1 A;  3PHY A;  3W8K A;  4LEN A;  4PM7 A;  3UMD A;  3EOI A;  2IA2 A;  3JPU A;  1P0Z A;  1RGZ A;  1NXY A;  4QU3 A;  2CC1 A;  4CLC E;  3WWX A;  4GCZ A;  3WRT A;  2DMW A;  4FUW A;  2D01 A;  3PXP A;  5E43 A;  3BFG A;  2OSU A;  2JC7 A;  3HCY A;  4RYE A;  2OLV A;  5HDC A;  4RA7 A;  4CLC B;  1LL9 A;  4QJG A;  1NLZ A;  1XJ3 A;  1ODV A;  4JF4 A;  3TOI A;  3PBS A;  2H0Y A;  1FIK A;  2A24 B;  5A8B A;  3LR0 A;  3Q7Z A;  4UA6 A;  3NJA A;  1XGJ A;  2W3F A;  3NI9 A;  4IUK A;  2NUT C;  1GSW A;  2PYR A;  2Q9N A;  3FC7 A;  4NKP A;  2PU2 A;  3ZG8 B;  2VEA A;  5JYP A;  4JLF A;  3H9W A;  1G68 A;  2ZBB A;  1GCE A;  4OLD A;  5FSR A;  2J80 A;  2JE5 A;  4OQI A;  4BBU A;  3P01 A;  3MKE A;  3GDI A;  4DE2 A;  4NK3 A;  5GLD A;  5FI2 A;  4JGR A;  4KG6 A;  1ESU A;  1PWC A;  3FWL A;  1YPR A;  3BFF A;  5LBR A;  3LY3 A;  2ZM0 A;  5DF8 A;  3VP0 A;  5GLA A;  2DNS A;  1IYO A;  2V8F A;  3IXG A;  4N9K A;  4XXR A;  4S2K A;  2VKS A;  3GTC A;  3H82 B;  2Y59 A;  1K4F A;  2L0W A;  4S2N C;  3TRC A;  2V1Z A;  2WKI A;  2MJ6 A;  5G4Z A;  4E3N A;  5IS1 A;  4HH2 A;  1Z09 A;  5DTK A;  1Y54 A;  2XA7 M;  3BYD A;  4EES A;  2W1R A;  5A91 A;  5D3O A;  4EBL A;  3G6O A;  2JCH A;  2VV6 A;  4IED A;  1K55 C;  1BLP A;  4IVK A;  2PRF A;  4O01 A;  1PZP A;  5CXW A;  1NLY A;  4HIA A;  4N1H A;  3QP4 A;  4P87 A;  1WYC A;  3NHQ A;  4S2O A;  4F3L A;  3S1Y A;  4PMA A;  2ZQ8 A;  3LUQ A;  2P9V A;  5EVI D;  3IF6 B;  2HDR A;  2EFX A;  2VLG A;  3LIE A;  4DMZ A;  1ZHH B;  3KSI A;  4HES A;  4E3L A;  3KYQ A;  3CIT A;  4R3A A;  1BLH A;  4OOY A;  3IH8 A;  3F1P B;  1IYP A;  4HHD A;  5HPF A;  2P9V B;  4G3W A;  4G3K A;  5FI7 A;  4CPK A;  1XJ4 A;  3NOU C;  4IHQ A;  4MCW A;  2O0Y A;  1N9B A;  5FEF A;  4X69 A;  1IKI A;  4Y5F A;  1LSX A;  5FL3 A;  4G3V A;  1LSV A;  4X25 A;  3N8S A;  2E8I A;  5EOO A;  3E4O A;  1P9W A;  3IBR A;  1K57 C;  5F69 A;  1ES4 A;  1MKM A;  1NJ4 A;  4FSF A;  1LL8 A;  1OTD A;  4GHI A;  1W7F A;  4OPR A;  2W3E A;  5DF9 A;  3LYX A;  3FG8 A;  5AVF A;  3C2W A;  3KSH A;  3BJN A;  5CHU A;  1XX2 A;  2B5R A;  3KYE A;  4CJN A;  5GLB A;  5EVL A;  1YLZ A;  4LV3 A;  2E8J A;  3UB9 A;  1MY8 A;  1G6O A;  1WYB A;  5F82 A;  3C38 A;  2O9A A;  3NUL A;  3IX8 A;  1GSV A;  3HJI A;  3E2L A;  5HZH A;  3N8R A;  4O0P A;  1YLP A;  2B95 A;  4UA9 A;  5TBM B;  2OLU A;  2JKG A;  3HLE A;  1NWZ A;  2Y8H A; 
#chains in the Genus database with same CATH homology
 4Z9Q A;  4E3K A;  1ZC2 A;  4S2I A;  5AQ9 A;  3C4O A;  4MEZ A;  5FAT A;  5GHY A;  3G31 A;  1YLY A;  1ZG6 A;  4GDN A;  5J8X A;  5A92 A;  1K55 A;  4QY6 A;  2Y2P A;  2ZQC A;  3MKF A;  1IYS A;  4S2M A;  2EX8 A;  2WAD A;  4PM6 A;  3CG5 A;  5DF7 A;  1KVM A;  1LHY A;  4RVA A;  2EX6 A;  4DE0 A;  1E25 A;  2Y2O A;  4R23 A;  1ONH A;  5F83 A;  3DW0 A;  4WEK A;  4ZTK A;  1N4O A;  3NDE A;  2QPN A;  3DWZ A;  1JVJ A;  1Q2P A;  3P98 A;  4OON A;  4KZ7 A;  3IF5 A;  2A3U A;  3Q81 A;  2IWC A;  3FKV A;  5M18 A;  2XFS A;  2HDS A;  1K25 A;  5TFQ A;  1E4D A;  1IEM A;  1E3U A;  2PBY A;  2Z2M B;  1JTG A;  1E3U D;  2Y4A A;  2ZC3 B;  1I2S A;  3QNB A;  3M6B A;  1HZO A;  3IQA A;  2H10 A;  1SDN A;  1SCW A;  4ID4 A;  4PM5 A;  3BRM A;  4S2L A;  3A3I A;  3ZGA B;  1GA9 A;  1ONG A;  5FA7 A;  1XGI A;  4C75 A;  2J7V A;  2X71 A;  3OPR A;  4HBU A;  2VGK A;  4HBT A;  4JF5 A;  4MBK A;  4S2P A;  4RX3 A;  4EBP A;  1SKF A;  1L0E A;  3A3F A;  4OLG A;  3SS5 A;  4LV1 A;  1W8Q A;  4ZJ2 A;  3V5M A;  1GA0 A;  1OME A;  3N8L A;  5EVI C;  4ZBE A;  3QHY A;  1ERM A;  2ZC4 B;  1CEG A;  2C5W B;  3PBQ A;  1RCJ A;  1BUL A;  3IXB A;  1K54 A;  3UE3 A;  5BOH A;  1BSG A;  1L2S A;  3AGE A;  4BL2 A;  3WS5 A;  1YLJ A;  5EE8 A;  2EXB A;  3V39 A;  5FDH A;  3UE0 A;  4EUZ A;  4N92 A;  3VOZ A;  2XH9 A;  3CZD A;  4WM9 A;  4DRT A;  1TDL A;  5FAS A;  1XA1 A;  3BM6 A;  4KZ6 A;  1IKG A;  1CEF A;  3C5A A;  5CHJ A;  5EPH A;  2OV5 A;  4KZ9 A;  5GL9 A;  4K0W A;  5HL1 A;  2H5S A;  3UPO A;  5TR7 A;  5GLC A;  4KZ4 A;  2ZM8 A;  1Z6F A;  3M2K A;  2DRW A;  1ALQ A;  2P74 A;  2Y2K A;  2ZQD A;  4RX2 A;  1W5D A;  3VMA A;  3W4P A;  5CEB A;  5HAQ A;  3Q1F A;  4GKU A;  3PBO A;  3O3V A;  1I5Q A;  4FH4 A;  4R3B A;  1QMF A;  4ZJ3 A;  3RJU A;  3NY4 A;  2ZQ7 A;  3GQZ A;  4GNU A;  5FQJ A;  3OZH A;  3BEB A;  4R4S A;  5TGF A;  4PM9 A;  1IEL A;  4OOL A;  1K6R A;  4QY5 A;  3HVF A;  3BLM A;  4JBF A;  1NZO A;  3OCL A;  2A49 A;  3CMZ A;  3GR2 A;  1YQS A;  5FQI A;  1H5X A;  1H8Z A;  2I72 A;  3GSG A;  3M6H A;  3LCE A;  4H8R A;  4EWF A;  5E2F A;  3HBR A;  4KZA A;  4YIN A;  4D2O A;  3IXH A;  2X02 A;  5FAP A;  1VM1 A;  3Q7V A;  2XQZ A;  5M1A A;  1PI5 A;  3G32 A;  3S4X A;  1ESI A;  1M6K A;  4GZB A;  3LO7 A;  5FAQ A;  3VP2 A;  5KMW A;  3IT9 A;  4GD8 A;  1MWT A;  2Z2L B;  5FQM A;  3O86 A;  2HDU A;  2R9X A;  3QNC A;  2BLS A;  3IWQ A;  4Y0T A;  4LV2 A;  3P09 A;  1VQQ A;  3UDF A;  1BZA A;  4OP8 A;  4MBF A;  3SOI A;  3PBR A;  5HAR A;  5CTN A;  2WKH A;  3TSG A;  2WGV A;  3ISG A;  1K38 A;  3IXD A;  1XP4 A;  3HUM A;  2V20 A;  1FSY A;  4WZ5 A;  4E6X A;  2ZC5 B;  5EUA A;  2XEP A;  5HX9 A;  1S0W A;  2RCX A;  1MBL A;  4LV0 A;  1EWZ A;  1NY0 A;  3V3S A;  3ZG0 A;  4S2N A;  4B4Z A;  3ZHH A;  2ZMA A;  1LLB A;  1AXB A;  4E3O A;  3HLG A;  2XR0 A;  1CI8 A;  4DDY A;  5HFO A;  2XF3 A;  4E6W A;  1ZKJ A;  3NIA A;  3EQU A;  3GRJ A;  4R4R A;  1XXM A;  1C3B A;  2WYX A;  1U60 A;  1K56 D;  2IWB A;  4OPY A;  4M3K A;  1W8Y A;  1K56 A;  2ZC6 B;  3SS3 A;  5A93 A;  4S2J A;  3BFD A;  3G34 A;  2XLN A;  1H8Y A;  4OPZ A;  1K4E A;  1PYY A;  4EV4 A;  2Y55 A;  3HUN A;  4FD8 A;  4GD6 A;  4OOM A;  5GHZ A;  3RXW A;  1WE4 A;  4Y0U A;  2Y2I A;  4OP5 A;  4B88 A;  3MFD A;  3O88 A;  4GN2 A;  3W4Q A;  4IVI A;  5FQ9 A;  3ITA A;  1BT5 A;  4JPM A;  3GMW A;  3PAE A;  1FOF A;  4KQQ A;  2EX9 A;  1ES5 A;  3Q07 A;  4N9L A;  4WBG A;  3OC2 A;  3HLF A;  1L0F A;  1CK3 A;  1O7E A;  2C6W B;  1NZU A;  3HLW A;  1MPL A;  4C6Y A;  4U3T A;  4WEJ A;  4KG2 A;  1JWP A;  3VFF A;  2RL3 A;  3AGF A;  2Y2L A;  5FI6 A;  3SH7 A;  1KVL A;  1DY6 A;  1YMS A;  3W8K A;  1KGG A;  4LEN A;  4OQ0 A;  4PM7 A;  2WUQ A;  4P85 A;  3S22 A;  3OPL A;  3IWI A;  1RGZ A;  1NXY A;  3HRE A;  3G4P A;  4QU3 A;  2CC1 A;  3WWX A;  3WRT A;  4DF6 A;  2GDN A;  2WK0 A;  2ZD8 A;  3C7U A;  5M19 A;  3BFC A;  5E43 A;  4WMC A;  2H0T A;  3UPP A;  1PW8 A;  3BFG A;  2OSU A;  1FCM A;  2JC7 A;  2ZQA A;  4RYE A;  3WS1 A;  2OLV A;  3D4F A;  5A90 A;  1DJC A;  4XUX A;  3ZFZ A;  3PTE A;  1K6S A;  4PPR A;  4R0Q A;  1KDW A;  4BLM A;  4DKI A;  5KZH A;  2J9P A;  5EEC A;  4KG5 A;  4RA7 A;  2R9W A;  5FAO A;  1PW1 A;  1LL9 A;  4O7D A;  1LI0 A;  4DE1 A;  4QJG A;  4OQH A;  3NBL A;  3MZD A;  4C3Q A;  3BFE A;  1GHI A;  3JYI A;  1W79 A;  4JF4 A;  5DVA A;  3VSK A;  1MWU A;  3TOI A;  3PBS A;  2H0Y A;  1NYM A;  2WZZ A;  5L2F A;  1S6R A;  4FH2 A;  2EXA A;  3ZG5 A;  4P0M A;  2WAE A;  3UN7 A;  3B3X A;  5F1G A;  5E2G A;  3G35 A;  2HPB A;  5G18 A;  3ZG9 B;  4ZAM A;  3Q7Z A;  4UA6 A;  5CER A;  1FSW A;  1XGJ A;  2EX2 A;  3NI9 A;  4K91 A;  2Q9N A;  4ZDX A;  4K0X A;  5E2E A;  3PBT A;  2PU2 A;  1JTD A;  1PZO A;  3VSL A;  3UDI A;  1GHP A;  3ZG8 B;  3HL9 A;  3WS2 A;  3SH9 A;  4BD1 A;  3IWO A;  5JYP A;  3SH8 A;  5IHV A;  1GHM A;  1YLT A;  4JLF A;  2G2W A;  5CEC A;  2Y2Q A;  1HTZ A;  4BL3 A;  1G68 A;  4JKT A;  3TG9 A;  3OPP A;  1PWG A;  1IYQ A;  4PM8 A;  2Y2J A;  2HP6 A;  3GVB A;  3PBN A;  4Y7P A;  1GCE A;  4OLD A;  5CRF A;  4BQM A;  5FQQ A;  5FSR A;  2ZC7 A;  4DDS A;  2JE5 A;  3HUO A;  3N7W A;  4OQI A;  4QD4 A;  3I7J A;  2V2F F;  5CGW A;  5I94 A;  3MKE A;  4DE2 A;  3LEZ A;  3M2J A;  1CI9 A;  4NK3 A;  1FR1 A;  2J8Y A;  5HAP A;  5GLD A;  4R3J A;  5FI2 A;  5CHM A;  2IWD A;  4KG6 A;  5EVI A;  5HW3 A;  4UA7 A;  1ESU A;  1PWC A;  3FWL A;  3BFF A;  3LY3 A;  2ZM0 A;  5DF8 A;  3VOY A;  2X01 A;  2XD5 A;  4QHC A;  2Y2N A;  3VP0 A;  5GLA A;  2DNS A;  2WGI A;  1Q2Q A;  2VGJ A;  3E2K A;  4IBR A;  5FQK A;  1FCN A;  4NET A;  4U0X A;  1IYO A;  1K57 A;  1FQG A;  3ITB A;  1KE4 A;  3IXG A;  4N9K A;  4XXR A;  4S2K A;  2XD1 A;  2ZM2 A;  3OCN A;  2WAF A;  1MKI A;  3GTC A;  5F1F A;  2Y59 A;  1K4F A;  2XDM A;  4OKP A;  3G2Y A;  3HLB A;  3LY4 A;  4LCL A;  1KDS A;  4S2N C;  5U47 A;  1XA7 A;  2WGW B;  2WZX A;  3RXX A;  3GV9 A;  4Q8I A;  2V1Z A;  3WRZ A;  2WKI A;  1L0G A;  4GOG A;  4E3N A;  2XK1 A;  1YT4 A;  4WMC D;  2J9O A;  1SDE A;  1TVF A;  3MXS A;  3MZE A;  4DXC A;  2QMI A;  2HP9 A;  3A3J A;  3IHA A;  5DTK A;  1Y54 A;  4OQG A;  3A3E A;  4JXV A;  3BYD A;  4KZ5 A;  4KZ3 A;  5A91 A;  4MLL A;  2Y91 A;  1LI9 A;  3UE1 A;  5D3O A;  4FCF A;  3ZVW A;  1LL5 A;  4EBL A;  1DJA A;  2JCH A;  5CGX A;  3VP3 A;  3W4O A;  4DE3 A;  4IED A;  5AQB A;  1K55 C;  3V50 A;  1BLP A;  1M40 A;  4IVK A;  5AQA A;  5CTM A;  3ZNY A;  3BLS A;  3Q7V B;  1G6A A;  4GB7 A;  1PZP A;  3UPN A;  4B4X A;  5CXW A;  4KZB A;  4OH0 A;  4WZ5 C;  5E2H A;  4N1H A;  4P87 A;  3C7V A;  3O87 A;  1WYC A;  3VP1 A;  3ZDJ A;  3IH9 A;  4S2O A;  3UY6 A;  5DTT A;  3S1Y A;  1JWZ A;  4PMA A;  2ZQ8 A;  3Q82 A;  1KGE A;  1YM1 A;  2EFU A;  3FYZ A;  4JF6 A;  3BEC A;  2P9V A;  4Y0O A;  2ZQ9 A;  4BJP A;  5EVI D;  4E3M A;  3IF6 B;  2HDR A;  2EFX A;  3EQV A;  4LCM A;  3IF6 C;  4E3L A;  3N4I A;  1RP5 A;  3A3D A;  4HES A;  2PU4 A;  3ZNT A;  1L0D A;  4N1X A;  4YFM A;  4DXB A;  4JXS A;  1TEM A;  1PWD A;  3ZCZ A;  1BTL A;  4JXW A;  1BUE A;  4EQI A;  1BLH A;  2ZJ9 A;  4X55 A;  3UDX A;  2FFF B;  4OOY A;  3IH8 A;  3SS4 A;  1IYP A;  4R1G A;  4X6T A;  1NRF A;  1BLS A;  2FFY A;  3NC8 A;  2P9V B;  4IBX A;  4OVD A;  5FI7 A;  5HAI A;  4KQR A;  4CPK A;  3ZVT A;  2BG1 A;  4KZ8 A;  5AQ7 A;  4KEN B;  4U0T A;  3WS0 A;  4UAA A;  3OPH A;  3NDG A;  3FZC A;  1N9B A;  2Q9M A;  3HLD A;  3IHB A;  1KGF A;  1IKI A;  3G30 A;  4X69 A;  4XUZ A;  2JBF A;  1EI5 A;  3ZG7 B;  3WS4 A;  4OPQ A;  4F94 A;  2WGW A;  2WKE A;  4QB8 A;  1I2W A;  5KSC A;  1BLC A;  1SHV A;  1ES3 A;  2UWX A;  3N8S A;  5GHX A;  2E8I A;  5EOO A;  1YLW A;  4JXG A;  4KQO A;  1NYY A;  1KE0 A;  4X56 A;  1K57 C;  3AGD A;  1ERQ A;  3N6I A;  4P6B A;  4GDB A;  1ES4 A;  4BEN A;  4EBN A;  1MWS A;  1NJ4 A;  4FSF A;  5DTS A;  3G2Z A;  3MBZ A;  1MWR A;  1FR6 A;  4A5R A;  2Y2M A;  4E3I A;  1W7F A;  3VP4 A;  4OPR A;  1FCO A;  4ZJ1 A;  3IF6 A;  2G2U A;  5EVI B;  3V3R A;  5JYO A;  4MNR A;  1JWV A;  4BD0 A;  3DWK A;  1MXO A;  5DF9 A;  5CGS A;  2XFT A;  4X53 A;  1PI4 A;  3UO9 A;  3MZF A;  5CHU A;  3PAG A;  4L0L A;  1O07 A;  2QZ6 A;  1XX2 A;  2B5R A;  1HVB A;  1DJB A;  4HEF A;  1KE3 A;  3NCK A;  4X68 A;  4CJN A;  5GLB A;  2Y2H A;  3HLC A;  2HP5 A;  5EVL A;  3FKW A;  1YLZ A;  4LV3 A;  5KSH A;  1MY8 A;  4MBH A;  3FV7 A;  1ERO A;  4WYY A;  1J9M A;  4UHU A;  4E3J A;  1PIO A;  5CED A;  2XGN A;  2DCF A;  4WEL A;  1RGY A;  2Y2G A;  1WYB A;  3VFH A;  1XPB A;  5F82 A;  1ES2 A;  3C4P A;  1TDG A;  4WZ4 A;  2HDQ A;  1K54 C;  3UNW A;  1XKZ A;  2ZLY A;  3E2L A;  3DTM A;  3N8R A;  1YMX A;  1YLP A;  1QME A;  3CJM A;  4UA9 A;  1ZG4 A;  2OLU A;  1HD8 A;  3HLE A;  3MXR A;  5EOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...