2LB5A

Refined structural basis for the photoconversion of a phytochrome to the activated far-red light-absorbing form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase
publication title Structural basis for the photoconversion of a phytochrome to the activated Pfr form.
pubmed doi rcsb
source organism Synechococcus sp. ja-2-3b'a(2-13)
molecule tags Transferase
total genus 32
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2lb5A00
3ZQ5A 2W3GA 4G3KA 2W1TB 2XRNA 4ETXA 3D3OA 1MC0A 5K5BA 4DMZA 5HL6A 1TF1A 3HCYA 4G3WA 3DBAA 4Q0HA 5L8MA 1ZTUA 1VHMA 2OOLA 4G3VA 2O0YA 4Y5FA 4YOFA 5LBRA 2XSSA 4QPRA 3KSIA 2O9CA 3KSFA 3EEAA 3MQ0A 3S7PA 4DN0A 4GLQA 4O0PA 1YSPA 3KSGA 3NOUC 5DFXA 4BWIA 5HSQA 2W1RA 3NOPC 5TJJA 1MKMA 3IBJA 1YSQA 4CQHA 2KLIA 2W3DA 4Y2FA 3C2WA 4ME4A 2IA2A 2M7VA 3KO6A 2QYBA 3MMHA 4YNRA 2W3FA 3G6OA 2ZMFA 4MMNA 3NOTC 5AJGA 4EUVA 2K31A 3S7NA 3OBFA 3MF0A 2M7UA 5HPIA 3BJNA 3OOVA 4LRZE 2O9BA 3KSHA 2O9AA 3O5YA 4Q0IA 2VKSA 4MDZA 4LRXC 2Y8HA 2O99A 2VZWA 4E04A 3E0YA 4EU0A 2Y79A 2W1TA 3R4KA 4GW9A 2G7UA 5C5KA 4IUHA 2LB9A 2VJWA 4O01A 4Y3IA 2W3HA 5HPFA 1F5MA 3CI6A 2K2NA 3W2ZA 3VV4A 4IUKA 4Z1WA 1YKDA 4IJGA 2XROA 5I5LA 4MCWA 2GX5A 3CITA 1STZA 2W3EA 4LRYC 3LFVA 4R70A 3RFBA 2B18A 4RQ9A 3E98A 4Q0JA 3TRCA 4ETZA 3K2NA 4FOFA 4R6LA 2HGVA 4ZRRA 3NHQA 2VEAA 1TD5A 4O8GA 2LB5A 3IBRA 5DFYA 2KOIA 4PAUA 3S7QA 4MN7A 3S7OA
chains in the Genus database with same CATH superfamily
3EGDC 3D3OA 3F1NB 2Q9MA 1ZKJA 1MBLA 5DTSA 1N4OA 1K54A 3RXWA 4HESA 1FSYA 1S67L 3T1SA 1YM1A 1YQSA 4Y5FA 3H82A 4P6ZS 3E4OA 2CMNA 3FV7A 3HUNA 3V39A 2E8IA 3GV9A 1JWPA 4NEED 1BLHA 5J7EA 2L0WA 1HLUP 2W27A 1LLBA 4DJ2A 1YLPA 2Y2JA 3OPPA 2VV6A 4B88A 3SH9A 5HPIA 3OOVA 4OP8A 5EVID 1KGFA 4GZBA 4PM8A 3FKWA 3IS2B 3FKVA 3B47A 1V9YA 4WN5A 4E04A 2ZJ9A 5AQBA 1S0WA 5EVEA 1ONGA 2K7SA 3T4JA 4OONA 3UE3A 3CUEC 3T1QB 3WWXA 2HP6A 4I5SA 1XFNA 4Y0OA 4XUXA 4HP4A 4BL3A 1JNUA 5HAPA 2OWJA 5GHYA 5AVEA 1D7EA 3MJQA 2Z6CA 4BBTA 2WGWB 1NYMA 1PFLA 1LT0A 3HCYA 3GRJA 4O7DA 4S2NA 1DP6A 3C7UA 4OPZA 3KSFA 3EEAA 3A0VA 2XLNA 5DF7A 3IF6A 4HY8A 4E6XA 2P7JA 3NIAA 3NOUC 4KZ3A 2W1RA 1BT5A 1NZOA 2Y2QA 5TR7A 4ID4A 4S2MA 1N9OA 1LL8A 2M7VA 1MWUA 5A91A 2EWWA 2W3FA 2Y91A 1G5UA 3TE8A 4KZ7A 4I3IA 1TEMA 3C8CA 2O9BA 3ZG5A 1FOFA 1UGUA 4MDZA 4X1MA 4LRXC 3QP2A 3T50A 5KZHA 2G7UA 2ZC7A 3TSGA 1BLPA 3SH8A 4KENB 4CLCD 1XGJA 1KVLA 1RP5A 2XA7M 1JVJA 3BFDA 1NZUA 5F83A 1BUEA 2J7VA 3FZCA 4X55A 4RYEA 2RL3A 3BW6A 4JGPA 4N92A 4Z1WA 3V50A 2EX2A 3BEBA 2X71A 3MZEA 4BMWA 5EM0A 3OC2A 4JBFA 4R1GA 4WMCD 3KYZA 1CK3A 5IT5A 1CF0A 2OWHA 2PYPA 3M6BA 3PBQA 4JF6A 4WBGA 3BFCA 4S2KA 2XA7S 3ZGAB 3H9WA 5G18A 3DBAA 4DKIA 1RGYA 4S2NC 4R3AA 3OPLA 3KSIA 3SS4A 3BYDA 2JHEA 3R7WB 2A24A 4DN0A 1YSPA 1FQGA 3IF6C 5DVAA 4MN5A 1T1CA 1NWZA 1PI5A 1FCMA 5HDDA 4GHIA 3LR0A 4OVDA 1K4FA 1G6AA 5TFQA 5CECA 3LIFA 1X0OA 4PMAA 3LIBA 1RCJA 1SKOA 4C3QA 4WZ5A 5FSRA 1L0EA 4ZTKA 3NULA 5HW3A 3OBFA 2J3TC 2D01A 3FG8A 4MBKA 3F1PB 3LIAA 2WZXA 4JXVA 3G30A 1S66L 1ZG6A 3EEHA 2OAP1 3E2KA 3IH9A 3ZYTA 2VA0A 1H8ZA 3P09A 2PT7A 2A3UA 5JYPA 1F5MA 2K2NA 4E3LA 1H3QA 3ZG7B 1BTLA 2INWA 3P7NA 5CGWA 1K56D 3LCEA 3MXRA 2W3EA 4LRYC 5E43A 4HIAA 4DDSA 2H5SA 1FCNA 4Z9QA 1Z09A 1TS6A 4Q0JA 1ES4A 1S6RA 3CLOA 1S1ZA 1WA9A 1DP8A 4G3KA 2W1TB 4K0XA 4U0XA 4DMZA 4BQMA 4HNBA 4OQGA 1ACFA 2WGIA 3HLBA 2Z6DA 3KYQA 3U4LP 5CHJA 4X69A 1AXBA 2XGNA 2Y2PA 1LSXA 3NOPC 4JF4A 1L0GA 4UAAA 1O07A 4UA9A 4JGQA 4F3LA 2QPNA 3UE1A 4KQRA 4DXCA 2WKQA 4WZ5C 1EWZA 4JPMA 2M7UA 1Q2PA 3NY4A 1JWZA 2BLSA 3UY6A 5FEFA 2ZC4B 2WK0A 4KQDA 3ZNTA 3E0YA 3F1OA 1IFQA 3DAVA 1H8YA 5L2FA 4I38A 4JXGA 4LCMA 3VOZA 1FIKA 5CXWA 4KZ4A 4ESPA 1XPBA 2C6WB 3PYPA 1VETB 1P9RA 1IYPA 2J9OA 2Z2MB 3IXHA 4MBHA 2HP5A 4Q8IA 3GQZA 4UA6A 3DTEA 2HJEA 3WS2A 2QHKA 1WYCA 1H8MA 3EQVA 1SHVA 1VEUA 3A0RA 4R3BA 4P85A 4LPZA 1OJ5A 3MXQA 2J80A 1OT6A 4ETXA 3HJIA 5HL6A 3LI9A 4II7A 5IU1A 4JLFA 4I39A 3TW8A 5TGFA 5LBRA 1K6SA 4K0WA 4HQAA 2JKRI 4JXSA 5CEBA 4CLCB 2R9XA 2PBDP 4EQIA 2EX9A 3HLEA 3N6IA 5I94A 1MKMA 2J3TD 4L9EA 3EGXC 3T4TA 4WYYA 2P08A 5FA7A 3PBSA 5CHMA 1T19A 2ZM8A 1VB6A 2PAVP 2BG1A 4FUWA 3S7NA 4LV2A 3KSHA 3K3CA 3D72A 2O9AA 3BECA 3HUMA 2VKSA 3BLMA 1PWCA 1TVFA 4HJ3A 4KZ5A 4WF0A 5CHUA 3BFGA 1OT9A 5U47A 3MQOA 4O01A 1IYQA 5J8XA 3HJKA 1LHYA 5FI2A 1G6OA 2IWCA 3VV4A 4IUKA 4K08A 3M6HA 1PYYA 1WE4A 4U0TA 4OLGA 3ISGA 2ZM0A 1STZA 3OLOA 4OH0A 2HV1A 1OJGA 4KZ8A 3O87A 4IBXA 1GCEA 1H0MA 3A3JA 1LSWA 4EWFA 5GLAA 4WM9A 2XRNA 5EPHA 4X53A 1T1AA 3T12B 1ES3A 1FILA 4X25A 3BFEA 2V0UA 4YOFA 4QPRA 3ZNYA 4BBVA 2ZOIA 4E6WA 2FH5A 1I5QA 5FATA 5DJTA 3VOYA 4HJ4A 2Y2HA 1OTIA 3T1RA 3IHAA 4WZ4A 2WAEA 4IVKA 1Q2QA 3VP2A 2Q9NA 4RVAA 4HBTA 1W63M 5DF8A 4GOGA 5HWVA 2VK3A 2XDMA 2ZQ7A 5EE8A 1Y28A 3LYXA 2WKHA 2V20A 3SW1A 2V1AA 3K3DA 3IX3A 4LRZE 3O5YA 3LR5A 3QP4A 4BL2A 3H82B 4NG2A 4GS9A 1P0ZA 3V5MA 3IXGA 4FH4A 2V8CA 5EVLA 4LENA 4UQIM 2PHYA 4PM9A 1GHPA 1HTZA 2H10A 5I5LA 4ARZA 3MFXA 3CITA 4ZDXA 2VV8A 2ZL1A 4HBUA 2Y59A 4N9LA 1K55A 4P6BA 4ZRRA 3T1XA 3EOIA 1M6KA 4NXGA 3IS2A 4QY6A 3S7OA 5CTNA 4HJ6A 3QP8A 2GZAA 3NDEA 4QD4A 1J9MA 3T4SA 3DTMA 5D3OA 4L9GA 1GA0A 2EX8A 4N1HA 2ZMAA 4PKYA 2Y2KA 2WYXA 3S7PA 2JE5A 1HZOA 5TBMA 2Y2MA 5KSHA 2JN7A 3KSGA 1I2WA 2EXBA 4D2OA 4HOIA 4OPRA 2KLIA 3UB9A 3ZVWA 3MKFA 1KE0A 1ALQA 3CMZA 1YLYA 3N8RA 1K54C 1OTBA 2X01A 3KYEA 3KO6A 4C6YA 4E3OA 4P87A 4K91A 2ZMFA 3ICYA 4CPKA 4YWZA 4EUVA 2J9PA 3NBLA 3EQUA 4HI4A 2PRFA 4KZ6A 2JKTI 2DMWA 2L4RA 1M40A 3IF6B 3BLSA 4S2PA 2LB9A 1E3UD 1LL5A 4EERA 2A2LA 2VGKA 2W3HA 1K38A 1JTDA 3VOLA 4KG2A 4E3IA 3ITAA 1LI9A 3C7VA 4RX2A 1FR1A 4H8RA 1ES5A 1IOUA 3VSLA 3DTIA 5DJUA 1K55C 1MWRA 4OOYA 4PAUA 4MN7A 2H0TA 2ZD8A 1IYOA 2NUPC 3VFFA 3BRMA 4QY5A 4PM7A 4IHQA 4ZBEA 4FH2A 4PPRA 3QP6A 3RXXA 1NYYA 2FFFB 3C4PA 4WEJA 1S4RA 4G3VA 2UV0E 5E2HA 4L0LA 5FQQA 5HARA 4R4RA 5AQAA 5HWTA 3MQ0A 4EUZA 4FTXA 2J3WA 3VP4A 4GLQA 5DTTA 3QNBA 4CJNA 1I2SA 3GDIA 1OMEA 4GJ4A 3VMAA 1YLWA 2HDRA 3WRTA 4WL9A 1GSXA 2G2WA 2AVXA 5KMWA 3LUQA 4ZJ2A 3UB8A 1NRFA 2P9VB 1YLZA 4JXWA 1PZPA 2VGLM 1PWDA 4PKYG 3NOTC 5EFWA 3IQAA 3BJNA 1DJAA 3PBOA 4QU3A 2A24B 1FSWA 3HREA 5CEDA 2YKHA 2ACGA 5L09A 4DF6A 5FAQA 4GHIB 1VM1A 3V3RA 3W2ZA 3BQ8A 1IYSA 2PBYA 4D60A 4IJGA 4DXBA 2C5WB 4IVIA 1SKOB 4KZ9A 5J3WA 3H7WA 3K2NA 3NHQA 2LB5A 3S7QA 5A8BA 2UWXA 3JPUA 2HDSA 1T18A 4EW7A 2OV5A 2GDNA 3PBTA 4G3WA 3JVVA 1XGIA 2ZOHA 3IWQA 4Q0HA 3M2KA 4OP5A 3CPTA 3WS1A 4NXEA 2XSSA 4GNUA 4EXOA 3IXDA 4P0MA 2CC1A 2Y55A 1MPLA 5GLDA 5HL1A 3UPPA 2JKRM 2IWDA 4XUZA 4EBNA 3VFHA 3Q1FA 1W5DA 3BFFA 4X68A 3O88A 3I7JA 1IELA 5EECA 2XR0A 3B33A 3LICA 1TS8A 2H28A 3UNWA 1DRMA 3MZDA 4GDNA 4R38A 1XXMA 5EVIA 3LEZA 2K31A 2PYRA 1MZUA 2R9WA 3HLCA 2Y2NA 2QJ5A 3PAEA 3UPNA 3G4PA 4LV1A 1BSGA 3A3IA 2KX6A 1XJ4A 5AQ7A 4MN6A 2JC7A 2VLGA 3Q7VA 3ZCZA 2NUTC 2WKEA 3CI6A 2FFYA 2EXAA 3IT9A 3HLFA 1A0KA 3IF5A 3TOIA 4F3LB 4LV3A 4H6JB 4MCWA 2GX5A 4ZAMA 3LFVA 3VP3A 1SKFA 2XFSA 3OPRA 3W4QA 3EWKA 5GLBA 4E3NA 4ZJ3A 5G4YA 3F1OB 1MC0A 4WLAA 2ZBBA 1CJFA 1K4EA 2OLUA 5HD3A 3E2LA 4YINA 3UMDA 4OQHA 5FQMA 5L8MA 2OOLA 4PM6A 3S22A 1XJ3A 4S2IA 2ZC5B 1SCWA 3MKEA 3G2ZA 2OLVA 1OTEA 5CGXA 4BWIA 1YMSA 4BENA 2XFTA 3LY3A 5L10A 1TDGA 1MWTA 4BLMA 1VEUB 4GCZA 3DW0A 2RCXA 5FQ9A 3CZDA 1W79A 2ZQDA 2KDKA 5F69A 2QYBA 3MMHA 3UB7A 2Y2GA 3UB6A 1NLYA 5HAIA 5EVIC 4HH3A 2FZ0A 4BD1A 5JYOA 3LO7A 1EI5A 4Y7PA 1WYBA 4MNRA 3DWZA 1MY8A 3VP0A 5DKKA 5HAQA 4EETB 1K0KA 4RA7A 1G68A 1GA9A 2JKGA 2Y79A 3QP1A 4IUHA 1BULA 1N9LA 2HF6A 2Y2LA 2L1MA 5F5YA 5HX9A 4XT2A 5FAOA 2XH9A 1BYWA 3U2AA 1K6RA 1Z6FA 1EW0A 1D06A 5FI6A 2GNXA 3FPVA 4R70A 3ITBA 1IKGA 5M1AA 3AGEA 2I72A 4X1LA 5EV0A 4DJ3A 1F2KA 1TD5A 2HDQA 3CWFA 4KQOA 2OAQ1 3DWKA 3UDFA 5HD5A 3JYIA 2PD8A 4QB8A 4Y17A 1C3BA 4EV4A 5HWWA 1GSWA 2PU2A 2P74A 4OLDA 4JGRA 4M3KA 3AGDA 3UMEA 1PI4A 2VV7A 1JTGA 2QMIA 5DFXA 2XEPA 3WS5A 3UDIA 5AVFA 3CHWP 4OPQA 3T4OA 4B4ZA 5M19A 1NLZA 4YNRA 3NI9A 4B9OA 4FD8A 2XD1A 3ZG8B 4DRTA 4DE1A 4WELA 3LY4A 1NXYA 2XD5A 4UEYA 3PHYA 2Y8HA 3IX8A 4CLCE 5GLCA 2EFXA 2ZQCA 5C5KA 5A90A 1E4DA 3Q82A 3F1NA 1S4SA 5FDSA 2M1CA 3A0SA 5HPFA 3WRZA 1MXOA 1K56A 5J4EA 3P01A 2XROA 3A3DA 3G2YA 3E4PA 4JF5A 2ZLYA 2B18A 2ZM2A 4R4SA 5CX7A 1Y54A 1KE4A 3DTKA 4ETZA 4O8GA 4GS9B 4M4XA 4BBUA 3HLWA 2W3GA 4GD6A 1XKZA 3N8SA 1O7EA 3GSGA 5A92A 3B42A 1RGZA 1S1YA 1TF1A 3SZTA 1N9BA 1NRJA 3E4QA 2Q0OA 1VHMA 3PAGA 2ZQ9A 1D1JA 2V0WA 4EBLA 2WGVA 3Q7ZA 1L3LA 4ARZB 1MWSA 3CAXA 2ZL1B 3VP1A 3BY9A 5GHZA 3MS6A 3SS3A 4UQIS 4FSFA 1DP9A 3HUOA 4GDBA 4CQHA 2JKFA 3LGOA 2Y2IA 5FQKA 2IWBA 2V9AA 1XX2A 2IA2A 3GMWA 5KSCA 4E3MA 2J8YA 1W8QA 4OOMA 3FPWA 4QJGA 1KDSA 3HLGA 3SH7A 5AJGA 3T4LA 4WUJA 1U60A 3LIDA 2B5RA 1ODVA 5EOEA 4Q0IA 2ZMVA 4U3TA 4EQ1A 5TBMB 1SDEA 2QJ7A 2WGWA 5GHXA 4HH2A 2VJWA 1ONHA 3G31A 3GECA 5G4ZA 3MXSA 4OPYA 4LCLA 1E25A 5CGSA 2Z2LB 4Y13A 2PR5A 5HZHA 4R3JA 4EEPA 2X02A 4DE0A 1NY0A 3Q81A 3P98A 1PZOA 1VQQA 1OPXA 4KQQA 4RQ9A 3WS4A 1FCOA 4LV0A 3UO9A 2HGVA 1W8YA 1XJ6A 3IBRA 1XFQA 2KOIA 3HL9A 3VE3A 2HP9A 5HFOA 1JWVA 3NECA 3ZQ5A 3LIEA 3D9YA 2V1BA 1V9ZA 1CI8A 4KUKA 4S2OA 1ZTUA 3NCKA 5GL9A 1KOUA 5CRFA 1NJ4A 5FDHA 4UHUA 3N7WA 2BASA 4OQIA 4A5RA 5FASA 4NXFA 2ZC6B 1TS7A 2EA9A 1YLJA 3LR3A 2EWVA 3L7HA 4FCFA 1F98A 5HSQA 3LI8A 3IXBA 2W3DA 4NK3A 4B93A 4KUOA 1PNEA 1YAXA 2V8FA 5AQ9A 5IS1A 3PTEA 4EBPA 4L9FA 3VE4A 5F1GA 2XK1A 5FEGA 4AFIA 2QWSA 2XQZA 3UE6A 1TS0A 1ZHHB 2A49A 3MF0A 2XF3A 3OZHA 3L9KA 2V1ZA 1DJCA 4MEZA 5M18A 1KDWA 3IWIA 3OCLA 5BOHA 4DE3A 2EFUA 1KGEA 1TDLA 4HEFA 1ESIA 4XXRA 3BQAA 1FR6A 3IX4A 1CI9A 5E2GA 2JBFA 3GTCA 1OTDA 3D4FA 2P9VA 3NDGA 3OCNA 4Y15A 3NJAA 3O86A 4S2LA 2PR6A 4MLLA 4R0QA 4RX3A 2WADA 3R7WA 1GHIA 2V2FF 3BY8A 3TRCA 4E3JA 2HZ5A 3A3FA 2EX6A 3IH8A 1PW1A 4OOLA 2VGLS 3RJUA 3ZG9B 1XA7A 5F1FA 3QNCA 3ZG0A 5L07A 2D02A 2O0YA 3ZHHA 2WZZA 2VGJA 2PU4A 3N4IA 3F1PA 4NETA 4N9KA 4GKUA 3AGFA 4BJPA 1DY6A 3H7WB 4F94A 2B02A 1UWPX 5TJJA 1YSQA 1XP4A 3CJMA 2OSUA 3S4XA 2DNSA 5FAPA 2I9VA 1IKIA 1P9WA 1ES2A 4S2JA 1KE3A 4KG6A 5F68A 3C38A 3G6OA 2VX8A 1UWNX 4MMNA 1LL9A 4DDYA 3B3XA 3C30A 4JGOA 1DJBA 3CPTB 1SZVA 3M2JA 3SS5A 1GHMA 2O99A 2Y2OA 1CEGA 3R4KA 2W1TA 1K25A 3FWLA 4EEUA 4LGWA 3QP5A 2G2UA 3WS0A 3C5AA 5MC7A 5IHVA 3PR6A 4LFUA 1ERQA 1YMXA 5EVIB 2ZQAA 3G35A 3GR2A 3LR4A 3E98A 3UDXA 3N8LA 2VEAA 4LLOB 5DFYA 3KX0X 1L0DA 1SDNA 3RH8B 1T1BA 1MKIA 2QKPA 5K5BA 1K57A 3Q7VB 3T4QA 3BWLA 3MFDA 1BLSA 5DKLA 4BD0A 5F82A 3TJZC 4JKTA 3S1YA 3OPHA 1QMEA 4KG5A 4H6JA 4GN2A 4DE2A 3V3SA 4YFMA 1YLTA 5CTMA 3G34A 5FQJA 2DRWA 1W7FA 3C2WA 2ZQ8A 2WAFA 1YPRA 4OQ0A 3O3VA 2H0YA 3MBZA 3RTYA 5F6AA 1BLCA 3IHBA 4KZAA 1VETA 3ZFZA 4I3JA 1KGGA 2HJ9C 2WKPA 4NXBA 3W8KA 4R23A 1IEMA 3MQQA 2PDRA 2ZC3B 3PXPA 3QHYA 5HDCA 1KVMA 3HVFA 1E3UA 2VZWA 4KZBA 3ZDJA 4GW9A 5FL3A 1L2SA 2HDUA 1G28A 3BM6A 3IWOA 5E2EA 4E3KA 1PWGA 4QHCA 1YKDA 1Y4OA 3W4OA 3A3EA 3CG5A 3NC8A 1CEFA 3VSKA 3UB5P 2Y4AA 3JVUA 2DCFA 4GB7A 2WKIA 3RFBA 3V67A 4HP9A 4CLCA 4C75A 5EOOA 4FOFA 2WUQA 3G32A 5DTKA 3W4PA 3UN7A 2GJ3A 1OTAA 1YT4A 1BZAA 1J3WA 1CQAA 4GD8A 1K57C 1LSVA 4WMCA 3HLDA 5HDSA 5EUAA 4ZJ1A 3TG9A 4XT2B 1W63Q 2W0NA 1ZC2A 5EM1A 2O9CA 2B95A 1H5XA 2PD7A 1P97A 1F9IA 2HPBA 2QZ6A 4IEDA 2BTFP 4O0PA 2E8JA 1HVBA 1ESUA 3C4OA 3IBJA 1PRQA 4Y2FA 3UE0A 4Y0TA 1AWIA 2P04A 4ME4A 1XA1A 3FYZA 4Y0UA 5FQIA 4X6TA 1XJ2A 5FI7A 5E2FA 1PW8A 3MR0A 2WKRA 2R78A 3UPOA 4OKPA 1N9NA 2YKFA 1LI0A 4X56A 4B4XA 4QWOA 1GSVA 1EROA 1QMFA 4UA7A 4HHDA 3ULFA 1PIOA 4NKPA 1HD8A 5A93A 5KIZA 4I3AA 3MZFA 4EU0A 3CUEA 4Y3IA 5DF9A 3GVBA 3PBRA 3Q07A 1ERMA 4N1XA 3T4KA 4PM5A 3FC7A 3ZVTA 3SOIA 3HBRA 4MBFA 4WEKA 4P6ZM 4IBRA 5CERA 2MJ6A 4PHTA 4EESA 1L0FA 4CLCC 3MSHA 3LEQA 4R6LA 2JKTM 2JCHA 1ZG4A 3PBNA
chains in the Genus database with same CATH topology
3ZQ5A 4EW7A 4LPZA 1OJ5A 3EGDC 3MXQA 3LIEA 2J80A 1OT6A 4ETXA 3D3OA 3HJIA 3F1NB 2V1BA 5HL6A 3LI9A 1V9ZA 4KUKA 4II7A 3PBTA 4G3WA 3JVVA 5IU1A 2ZOHA 4Q0HA 1ZTUA 1S67L 4I39A 3TW8A 1KOUA 4Y5FA 4NXEA 5LBRA 2XSSA 3H82A 4EXOA 4P6ZS 3E4OA 2CMNA 2BASA 4HQAA 2JKRI 4NXFA 1TS7A 2EA9A 4CLCB 3LR3A 2EWVA 1F98A 5HSQA 2JKRM 3LI8A 4NEED 1MKMA 5J7EA 2J3TD 2L0WA 2W3DA 4L9EA 4B93A 3EGXC 2W27A 1YAXA 4KUOA 3T4TA 3B33A 2P08A 5IS1A 3PBSA 3LICA 1TS8A 2H28A 4L9FA 1DRMA 3VE4A 4DJ2A 1T19A 4AFIA 2QWSA 4R38A 2VV6A 3UE6A 1TS0A 1VB6A 1ZHHB 2K31A 3S7NA 3MF0A 5HPIA 2PYRA 3OOVA 1MZUA 3KSHA 3K3CA 3D72A 2O9AA 3OCLA 2QJ5A 3IS2B 2VKSA 4HJ3A 3B47A 1V9YA 4WN5A 4WF0A 4E04A 2KX6A 1XJ4A 1OT9A 2K7SA 3T4JA 3MQOA 4O01A 3BQAA 4MN6A 2VLGA 3UE3A 3CUEC 3HJKA 2NUTC 3CI6A 1OTDA 1G6OA 3OCNA 3VV4A 4IUKA 3NJAA 4K08A 4F3LB 4I5SA 2PR6A 1XFNA 4H6JB 4MCWA 2GX5A 1STZA 3LFVA 3OLOA 3R7WA 2HV1A 1OJGA 4HP4A 1JNUA 3BY8A 3TRCA 2OWJA 3EWKA 5AVEA 1D7EA 1LSWA 3MJQA 2Z6CA 5G4YA 4BBTA 3F1OB 2XRNA 1MC0A 4OOLA 2VGLS 4WLAA 1T1AA 2ZBBA 1LT0A 5HD3A 3HCYA 3UMDA 5L8MA 1DP6A 2D02A 2OOLA 2O0YA 1XJ3A 2V0UA 4YOFA 3F1PA 4QPRA 3KSFA 3EEAA 4BBVA 2ZOIA 3A0VA 2FH5A 4BJPA 4HY8A 1OTEA 3H7WB 5DJTA 2P7JA 3NOUC 4HJ4A 4BWIA 2W1RA 2B02A 1UWPX 1OTIA 5TJJA 1YSQA 4GCZA 1N9OA 1LL8A 1W63M 2M7VA 2I9VA 1P9WA 5HWVA 2KDKA 5F69A 2QYBA 2EWWA 3MMHA 1Y28A 2W3FA 3C38A 3G6OA 2VX8A 3LYXA 5F68A 3UB7A 3UB6A 1UWNX 1NLYA 4MMNA 3TE8A 3SW1A 2V1AA 4HH3A 2FZ0A 3K3DA 4I3IA 3C30A 3C8CA 4JGOA 4LRZE 2O9BA 3O5YA 3LR5A 3H82B 4GS9A 5DKKA 1UGUA 4MDZA 4LRXC 1P0ZA 4EETB 2O99A 3T50A 2Y79A 2W1TA 3R4KA 2G7UA 4IUHA 1N9LA 2HF6A 4UQIM 4CLCD 2PHYA 2XA7M 4EEUA 2L1MA 5F5YA 4XT2A 3BW6A 4JGPA 4Z1WA 5MC7A 1BYWA 3U2AA 3PR6A 1EW0A 1D06A 5I5LA 4ARZA 3MFXA 3CITA 2GNXA 3FPVA 4BMWA 4R70A 3OC2A 2VV8A 3LR4A 3E98A 3KYZA 5IT5A 4DJ3A 4ZRRA 3EOIA 2VEAA 1TD5A 2OWHA 4LLOB 4NXGA 2PYPA 3IS2A 3CWFA 5DFYA 4KQOA 3KX0X 3S7OA 4HJ6A 2GZAA 3RH8B 3PBQA 1T1BA 5HD5A 2QKPA 5K5BA 2PD8A 2XA7S 3T4QA 3BWLA 3T4SA 3H9WA 5DKLA 5HWWA 1GSWA 4L9GA 3DBAA 3TJZC 4PKYA 4R3AA 4JGRA 4H6JA 3KSIA 3S7PA 2JHEA 3R7WB 2A24A 4DN0A 3UMEA 5TBMA 1YSPA 2VV7A 5KSHA 2JN7A 3KSGA 4MN5A 5DFXA 1T1CA 1NWZA 4HOIA 5HDDA 4GHIA 2KLIA 3UB9A 3LR0A 3C2WA 5AVFA 3T4OA 1OTBA 3LIFA 1X0OA 3LIBA 3RTYA 3KO6A 5F6AA 1NLZA 4YNRA 4I3JA 2ZMFA 2HJ9C 3ICYA 2WKPA 4NXBA 3PBNA 4B9OA 4YWZA 4EUVA 3OBFA 3EQUA 3MQQA 2PDRA 4HI4A 2J3TC 3PXPA 4WELA 2D01A 5HDCA 3FG8A 3F1PB 3LIAA 4UEYA 1S66L 3PHYA 3EEHA 2Y8HA 4CLCE 2JKTI 2DMWA 2L4RA 2OAP1 2VZWA 5C5KA 4GW9A 2LB9A 3ZYTA 2VA0A 5FL3A 3F1NA 4EERA 1S4SA 2A2LA 2M1CA 2PT7A 2W3HA 1G28A 3A0SA 5HPFA 1F5MA 2K2NA 3VOLA 1H3QA 5J4EA 1YKDA 3P01A 2XROA 2INWA 3P7NA 1IOUA 3JVUA 2W3EA 3E4PA 4LRYC 3RFBA 3V67A 4HIAA 2B18A 4HP9A 5CX7A 4CLCA 1TS6A 4Q0JA 4ETZA 4FOFA 5DJUA 4O8GA 4PAUA 4GS9B 4M4XA 4MN7A 4BBUA 3CLOA 2GJ3A 1S1ZA 2NUPC 1OTAA 2W3GA 1WA9A 1DP8A 4G3KA 2W1TB 4IHQA 3B42A 4DMZA 4HNBA 1S1YA 1LSVA 1TF1A 1NRJA 5HDSA 4WEJA 3E4QA 4XT2B 1VHMA 1S4RA 1W63Q 2Z6DA 3KYQA 4G3VA 2W0NA 4L0LA 2V0WA 5HWTA 4ARZB 2O9CA 3MQ0A 2PD7A 1P97A 1F9IA 2J3WA 4GLQA 3CAXA 4O0PA 3BY9A 3GDIA 4UQIS 4GJ4A 1LSXA 3NOPC 4FSFA 1DP9A 3IBJA 4CQHA 4Y2FA 4WL9A 1GSXA 2P04A 4ME4A 2V9AA 3LUQA 3UB8A 2IA2A 4JGQA 4F3LA 1XJ2A 3MR0A 2WKRA 2R78A 2VGLM 4OOMA 3FPWA 2WKQA 4PKYG 1N9NA 3NOTC 2YKFA 5EFWA 5AJGA 3T4LA 1GSVA 4WUJA 2M7UA 3BJNA 3LIDA 4HHDA 3ULFA 1ODVA 3PBOA 4Q0IA 4NKPA 2ZMVA 4EQ1A 2A24B 5KIZA 4I3AA 5TBMB 4KQDA 2QJ7A 3E0YA 4EU0A 2YKHA 3F1OA 1IFQA 4HH2A 2VJWA 3GECA 5G4ZA 3CUEA 4GHIB 4Y3IA 5DF9A 4I38A 3PBRA 3W2ZA 2PR5A 5HZHA 3T4KA 4EEPA 3BQ8A 3FC7A 4IJGA 3PYPA 4WEKA 1P9RA 5J3WA 1OPXA 4P6ZM 4RQ9A 2MJ6A 4PHTA 4EESA 3H7WA 4CLCC 3K2NA 4R6LA 2HJEA 2HGVA 3NHQA 2QHKA 1XJ6A 2JKTM 2LB5A 3IBRA 1H8MA 1XFQA 2KOIA 3EQVA 3VE3A 3S7QA 5A8BA 3A0RA 1T18A 2OAQ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ5 A;  2W3G A;  4G3K A;  2W1T B;  2XRN A;  4ETX A;  3D3O A;  1MC0 A;  5K5B A;  4DMZ A;  5HL6 A;  1TF1 A;  3HCY A;  4G3W A;  3DBA A;  4Q0H A;  5L8M A;  1ZTU A;  1VHM A;  2OOL A;  4G3V A;  2O0Y A;  4Y5F A;  4YOF A;  5LBR A;  2XSS A;  4QPR A;  3KSI A;  2O9C A;  3KSF A;  3EEA A;  3MQ0 A;  3S7P A;  4DN0 A;  4GLQ A;  4O0P A;  1YSP A;  3KSG A;  3NOU C;  5DFX A;  4BWI A;  5HSQ A;  2W1R A;  3NOP C;  5TJJ A;  1MKM A;  3IBJ A;  1YSQ A;  4CQH A;  2KLI A;  2W3D A;  4Y2F A;  3C2W A;  4ME4 A;  2IA2 A;  2M7V A;  3KO6 A;  2QYB A;  3MMH A;  4YNR A;  2W3F A;  3G6O A;  2ZMF A;  4MMN A;  3NOT C;  5AJG A;  4EUV A;  2K31 A;  3S7N A;  3OBF A;  3MF0 A;  2M7U A;  5HPI A;  3BJN A;  3OOV A;  4LRZ E;  2O9B A;  3KSH A;  2O9A A;  3O5Y A;  4Q0I A;  2VKS A;  4MDZ A;  4LRX C;  2Y8H A;  2O99 A;  2VZW A;  4E04 A;  3E0Y A;  4EU0 A;  2Y79 A;  2W1T A;  3R4K A;  4GW9 A;  2G7U A;  5C5K A;  4IUH A;  2LB9 A;  2VJW A;  4O01 A;  4Y3I A;  2W3H A;  5HPF A;  1F5M A;  3CI6 A;  2K2N A;  3W2Z A;  3VV4 A;  4IUK A;  4Z1W A;  1YKD A;  4IJG A;  2XRO A;  5I5L A;  4MCW A;  2GX5 A;  3CIT A;  1STZ A;  2W3E A;  4LRY C;  3LFV A;  4R70 A;  3RFB A;  2B18 A;  4RQ9 A;  3E98 A;  4Q0J A;  3TRC A;  4ETZ A;  3K2N A;  4FOF A;  4R6L A;  2HGV A;  4ZRR A;  3NHQ A;  2VEA A;  1TD5 A;  4O8G A;  2LB5 A;  3IBR A;  5DFY A;  2KOI A;  4PAU A;  3S7Q A;  4MN7 A;  3S7O A; 
#chains in the Genus database with same CATH topology
 3EGD C;  3D3O A;  3F1N B;  2Q9M A;  1ZKJ A;  1MBL A;  5DTS A;  1N4O A;  1K54 A;  3RXW A;  4HES A;  1FSY A;  1S67 L;  3T1S A;  1YM1 A;  1YQS A;  4Y5F A;  3H82 A;  4P6Z S;  3E4O A;  2CMN A;  3FV7 A;  3HUN A;  3V39 A;  2E8I A;  3GV9 A;  1JWP A;  4NEE D;  1BLH A;  5J7E A;  2L0W A;  1HLU P;  2W27 A;  1LLB A;  4DJ2 A;  1YLP A;  2Y2J A;  3OPP A;  2VV6 A;  4B88 A;  3SH9 A;  5HPI A;  3OOV A;  4OP8 A;  5EVI D;  1KGF A;  4GZB A;  4PM8 A;  3FKW A;  3IS2 B;  3FKV A;  3B47 A;  1V9Y A;  4WN5 A;  4E04 A;  2ZJ9 A;  5AQB A;  1S0W A;  5EVE A;  1ONG A;  2K7S A;  3T4J A;  4OON A;  3UE3 A;  3CUE C;  3T1Q B;  3WWX A;  2HP6 A;  4I5S A;  1XFN A;  4Y0O A;  4XUX A;  4HP4 A;  4BL3 A;  1JNU A;  5HAP A;  2OWJ A;  5GHY A;  5AVE A;  1D7E A;  3MJQ A;  2Z6C A;  4BBT A;  2WGW B;  1NYM A;  1PFL A;  1LT0 A;  3HCY A;  3GRJ A;  4O7D A;  4S2N A;  1DP6 A;  3C7U A;  4OPZ A;  3KSF A;  3EEA A;  3A0V A;  2XLN A;  5DF7 A;  3IF6 A;  4HY8 A;  4E6X A;  2P7J A;  3NIA A;  3NOU C;  4KZ3 A;  2W1R A;  1BT5 A;  1NZO A;  2Y2Q A;  5TR7 A;  4ID4 A;  4S2M A;  1N9O A;  1LL8 A;  2M7V A;  1MWU A;  5A91 A;  2EWW A;  2W3F A;  2Y91 A;  1G5U A;  3TE8 A;  4KZ7 A;  4I3I A;  1TEM A;  3C8C A;  2O9B A;  3ZG5 A;  1FOF A;  1UGU A;  4MDZ A;  4X1M A;  4LRX C;  3QP2 A;  3T50 A;  5KZH A;  2G7U A;  2ZC7 A;  3TSG A;  1BLP A;  3SH8 A;  4KEN B;  4CLC D;  1XGJ A;  1KVL A;  1RP5 A;  2XA7 M;  1JVJ A;  3BFD A;  1NZU A;  5F83 A;  1BUE A;  2J7V A;  3FZC A;  4X55 A;  4RYE A;  2RL3 A;  3BW6 A;  4JGP A;  4N92 A;  4Z1W A;  3V50 A;  2EX2 A;  3BEB A;  2X71 A;  3MZE A;  4BMW A;  5EM0 A;  3OC2 A;  4JBF A;  4R1G A;  4WMC D;  3KYZ A;  1CK3 A;  5IT5 A;  1CF0 A;  2OWH A;  2PYP A;  3M6B A;  3PBQ A;  4JF6 A;  4WBG A;  3BFC A;  4S2K A;  2XA7 S;  3ZGA B;  3H9W A;  5G18 A;  3DBA A;  4DKI A;  1RGY A;  4S2N C;  4R3A A;  3OPL A;  3KSI A;  3SS4 A;  3BYD A;  2JHE A;  3R7W B;  2A24 A;  4DN0 A;  1YSP A;  1FQG A;  3IF6 C;  5DVA A;  4MN5 A;  1T1C A;  1NWZ A;  1PI5 A;  1FCM A;  5HDD A;  4GHI A;  3LR0 A;  4OVD A;  1K4F A;  1G6A A;  5TFQ A;  5CEC A;  3LIF A;  1X0O A;  4PMA A;  3LIB A;  1RCJ A;  1SKO A;  4C3Q A;  4WZ5 A;  5FSR A;  1L0E A;  4ZTK A;  3NUL A;  5HW3 A;  3OBF A;  2J3T C;  2D01 A;  3FG8 A;  4MBK A;  3F1P B;  3LIA A;  2WZX A;  4JXV A;  3G30 A;  1S66 L;  1ZG6 A;  3EEH A;  2OAP 1;  3E2K A;  3IH9 A;  3ZYT A;  2VA0 A;  1H8Z A;  3P09 A;  2PT7 A;  2A3U A;  5JYP A;  1F5M A;  2K2N A;  4E3L A;  1H3Q A;  3ZG7 B;  1BTL A;  2INW A;  3P7N A;  5CGW A;  1K56 D;  3LCE A;  3MXR A;  2W3E A;  4LRY C;  5E43 A;  4HIA A;  4DDS A;  2H5S A;  1FCN A;  4Z9Q A;  1Z09 A;  1TS6 A;  4Q0J A;  1ES4 A;  1S6R A;  3CLO A;  1S1Z A;  1WA9 A;  1DP8 A;  4G3K A;  2W1T B;  4K0X A;  4U0X A;  4DMZ A;  4BQM A;  4HNB A;  4OQG A;  1ACF A;  2WGI A;  3HLB A;  2Z6D A;  3KYQ A;  3U4L P;  5CHJ A;  4X69 A;  1AXB A;  2XGN A;  2Y2P A;  1LSX A;  3NOP C;  4JF4 A;  1L0G A;  4UAA A;  1O07 A;  4UA9 A;  4JGQ A;  4F3L A;  2QPN A;  3UE1 A;  4KQR A;  4DXC A;  2WKQ A;  4WZ5 C;  1EWZ A;  4JPM A;  2M7U A;  1Q2P A;  3NY4 A;  1JWZ A;  2BLS A;  3UY6 A;  5FEF A;  2ZC4 B;  2WK0 A;  4KQD A;  3ZNT A;  3E0Y A;  3F1O A;  1IFQ A;  3DAV A;  1H8Y A;  5L2F A;  4I38 A;  4JXG A;  4LCM A;  3VOZ A;  1FIK A;  5CXW A;  4KZ4 A;  4ESP A;  1XPB A;  2C6W B;  3PYP A;  1VET B;  1P9R A;  1IYP A;  2J9O A;  2Z2M B;  3IXH A;  4MBH A;  2HP5 A;  4Q8I A;  3GQZ A;  4UA6 A;  3DTE A;  2HJE A;  3WS2 A;  2QHK A;  1WYC A;  1H8M A;  3EQV A;  1SHV A;  1VEU A;  3A0R A;  4R3B A;  4P85 A;  4LPZ A;  1OJ5 A;  3MXQ A;  2J80 A;  1OT6 A;  4ETX A;  3HJI A;  5HL6 A;  3LI9 A;  4II7 A;  5IU1 A;  4JLF A;  4I39 A;  3TW8 A;  5TGF A;  5LBR A;  1K6S A;  4K0W A;  4HQA A;  2JKR I;  4JXS A;  5CEB A;  4CLC B;  2R9X A;  2PBD P;  4EQI A;  2EX9 A;  3HLE A;  3N6I A;  5I94 A;  1MKM A;  2J3T D;  4L9E A;  3EGX C;  3T4T A;  4WYY A;  2P08 A;  5FA7 A;  3PBS A;  5CHM A;  1T19 A;  2ZM8 A;  1VB6 A;  2PAV P;  2BG1 A;  4FUW A;  3S7N A;  4LV2 A;  3KSH A;  3K3C A;  3D72 A;  2O9A A;  3BEC A;  3HUM A;  2VKS A;  3BLM A;  1PWC A;  1TVF A;  4HJ3 A;  4KZ5 A;  4WF0 A;  5CHU A;  3BFG A;  1OT9 A;  5U47 A;  3MQO A;  4O01 A;  1IYQ A;  5J8X A;  3HJK A;  1LHY A;  5FI2 A;  1G6O A;  2IWC A;  3VV4 A;  4IUK A;  4K08 A;  3M6H A;  1PYY A;  1WE4 A;  4U0T A;  4OLG A;  3ISG A;  2ZM0 A;  1STZ A;  3OLO A;  4OH0 A;  2HV1 A;  1OJG A;  4KZ8 A;  3O87 A;  4IBX A;  1GCE A;  1H0M A;  3A3J A;  1LSW A;  4EWF A;  5GLA A;  4WM9 A;  2XRN A;  5EPH A;  4X53 A;  1T1A A;  3T12 B;  1ES3 A;  1FIL A;  4X25 A;  3BFE A;  2V0U A;  4YOF A;  4QPR A;  3ZNY A;  4BBV A;  2ZOI A;  4E6W A;  2FH5 A;  1I5Q A;  5FAT A;  5DJT A;  3VOY A;  4HJ4 A;  2Y2H A;  1OTI A;  3T1R A;  3IHA A;  4WZ4 A;  2WAE A;  4IVK A;  1Q2Q A;  3VP2 A;  2Q9N A;  4RVA A;  4HBT A;  1W63 M;  5DF8 A;  4GOG A;  5HWV A;  2VK3 A;  2XDM A;  2ZQ7 A;  5EE8 A;  1Y28 A;  3LYX A;  2WKH A;  2V20 A;  3SW1 A;  2V1A A;  3K3D A;  3IX3 A;  4LRZ E;  3O5Y A;  3LR5 A;  3QP4 A;  4BL2 A;  3H82 B;  4NG2 A;  4GS9 A;  1P0Z A;  3V5M A;  3IXG A;  4FH4 A;  2V8C A;  5EVL A;  4LEN A;  4UQI M;  2PHY A;  4PM9 A;  1GHP A;  1HTZ A;  2H10 A;  5I5L A;  4ARZ A;  3MFX A;  3CIT A;  4ZDX A;  2VV8 A;  2ZL1 A;  4HBU A;  2Y59 A;  4N9L A;  1K55 A;  4P6B A;  4ZRR A;  3T1X A;  3EOI A;  1M6K A;  4NXG A;  3IS2 A;  4QY6 A;  3S7O A;  5CTN A;  4HJ6 A;  3QP8 A;  2GZA A;  3NDE A;  4QD4 A;  1J9M A;  3T4S A;  3DTM A;  5D3O A;  4L9G A;  1GA0 A;  2EX8 A;  4N1H A;  2ZMA A;  4PKY A;  2Y2K A;  2WYX A;  3S7P A;  2JE5 A;  1HZO A;  5TBM A;  2Y2M A;  5KSH A;  2JN7 A;  3KSG A;  1I2W A;  2EXB A;  4D2O A;  4HOI A;  4OPR A;  2KLI A;  3UB9 A;  3ZVW A;  3MKF A;  1KE0 A;  1ALQ A;  3CMZ A;  1YLY A;  3N8R A;  1K54 C;  1OTB A;  2X01 A;  3KYE A;  3KO6 A;  4C6Y A;  4E3O A;  4P87 A;  4K91 A;  2ZMF A;  3ICY A;  4CPK A;  4YWZ A;  4EUV A;  2J9P A;  3NBL A;  3EQU A;  4HI4 A;  2PRF A;  4KZ6 A;  2JKT I;  2DMW A;  2L4R A;  1M40 A;  3IF6 B;  3BLS A;  4S2P A;  2LB9 A;  1E3U D;  1LL5 A;  4EER A;  2A2L A;  2VGK A;  2W3H A;  1K38 A;  1JTD A;  3VOL A;  4KG2 A;  4E3I A;  3ITA A;  1LI9 A;  3C7V A;  4RX2 A;  1FR1 A;  4H8R A;  1ES5 A;  1IOU A;  3VSL A;  3DTI A;  5DJU A;  1K55 C;  1MWR A;  4OOY A;  4PAU A;  4MN7 A;  2H0T A;  2ZD8 A;  1IYO A;  2NUP C;  3VFF A;  3BRM A;  4QY5 A;  4PM7 A;  4IHQ A;  4ZBE A;  4FH2 A;  4PPR A;  3QP6 A;  3RXX A;  1NYY A;  2FFF B;  3C4P A;  4WEJ A;  1S4R A;  4G3V A;  2UV0 E;  5E2H A;  4L0L A;  5FQQ A;  5HAR A;  4R4R A;  5AQA A;  5HWT A;  3MQ0 A;  4EUZ A;  4FTX A;  2J3W A;  3VP4 A;  4GLQ A;  5DTT A;  3QNB A;  4CJN A;  1I2S A;  3GDI A;  1OME A;  4GJ4 A;  3VMA A;  1YLW A;  2HDR A;  3WRT A;  4WL9 A;  1GSX A;  2G2W A;  2AVX A;  5KMW A;  3LUQ A;  4ZJ2 A;  3UB8 A;  1NRF A;  2P9V B;  1YLZ A;  4JXW A;  1PZP A;  2VGL M;  1PWD A;  4PKY G;  3NOT C;  5EFW A;  3IQA A;  3BJN A;  1DJA A;  3PBO A;  4QU3 A;  2A24 B;  1FSW A;  3HRE A;  5CED A;  2YKH A;  2ACG A;  5L09 A;  4DF6 A;  5FAQ A;  4GHI B;  1VM1 A;  3V3R A;  3W2Z A;  3BQ8 A;  1IYS A;  2PBY A;  4D60 A;  4IJG A;  4DXB A;  2C5W B;  4IVI A;  1SKO B;  4KZ9 A;  5J3W A;  3H7W A;  3K2N A;  3NHQ A;  2LB5 A;  3S7Q A;  5A8B A;  2UWX A;  3JPU A;  2HDS A;  1T18 A;  4EW7 A;  2OV5 A;  2GDN A;  3PBT A;  4G3W A;  3JVV A;  1XGI A;  2ZOH A;  3IWQ A;  4Q0H A;  3M2K A;  4OP5 A;  3CPT A;  3WS1 A;  4NXE A;  2XSS A;  4GNU A;  4EXO A;  3IXD A;  4P0M A;  2CC1 A;  2Y55 A;  1MPL A;  5GLD A;  5HL1 A;  3UPP A;  2JKR M;  2IWD A;  4XUZ A;  4EBN A;  3VFH A;  3Q1F A;  1W5D A;  3BFF A;  4X68 A;  3O88 A;  3I7J A;  1IEL A;  5EEC A;  2XR0 A;  3B33 A;  3LIC A;  1TS8 A;  2H28 A;  3UNW A;  1DRM A;  3MZD A;  4GDN A;  4R38 A;  1XXM A;  5EVI A;  3LEZ A;  2K31 A;  2PYR A;  1MZU A;  2R9W A;  3HLC A;  2Y2N A;  2QJ5 A;  3PAE A;  3UPN A;  3G4P A;  4LV1 A;  1BSG A;  3A3I A;  2KX6 A;  1XJ4 A;  5AQ7 A;  4MN6 A;  2JC7 A;  2VLG A;  3Q7V A;  3ZCZ A;  2NUT C;  2WKE A;  3CI6 A;  2FFY A;  2EXA A;  3IT9 A;  3HLF A;  1A0K A;  3IF5 A;  3TOI A;  4F3L B;  4LV3 A;  4H6J B;  4MCW A;  2GX5 A;  4ZAM A;  3LFV A;  3VP3 A;  1SKF A;  2XFS A;  3OPR A;  3W4Q A;  3EWK A;  5GLB A;  4E3N A;  4ZJ3 A;  5G4Y A;  3F1O B;  1MC0 A;  4WLA A;  2ZBB A;  1CJF A;  1K4E A;  2OLU A;  5HD3 A;  3E2L A;  4YIN A;  3UMD A;  4OQH A;  5FQM A;  5L8M A;  2OOL A;  4PM6 A;  3S22 A;  1XJ3 A;  4S2I A;  2ZC5 B;  1SCW A;  3MKE A;  3G2Z A;  2OLV A;  1OTE A;  5CGX A;  4BWI A;  1YMS A;  4BEN A;  2XFT A;  3LY3 A;  5L10 A;  1TDG A;  1MWT A;  4BLM A;  1VEU B;  4GCZ A;  3DW0 A;  2RCX A;  5FQ9 A;  3CZD A;  1W79 A;  2ZQD A;  2KDK A;  5F69 A;  2QYB A;  3MMH A;  3UB7 A;  2Y2G A;  3UB6 A;  1NLY A;  5HAI A;  5EVI C;  4HH3 A;  2FZ0 A;  4BD1 A;  5JYO A;  3LO7 A;  1EI5 A;  4Y7P A;  1WYB A;  4MNR A;  3DWZ A;  1MY8 A;  3VP0 A;  5DKK A;  5HAQ A;  4EET B;  1K0K A;  4RA7 A;  1G68 A;  1GA9 A;  2JKG A;  2Y79 A;  3QP1 A;  4IUH A;  1BUL A;  1N9L A;  2HF6 A;  2Y2L A;  2L1M A;  5F5Y A;  5HX9 A;  4XT2 A;  5FAO A;  2XH9 A;  1BYW A;  3U2A A;  1K6R A;  1Z6F A;  1EW0 A;  1D06 A;  5FI6 A;  2GNX A;  3FPV A;  4R70 A;  3ITB A;  1IKG A;  5M1A A;  3AGE A;  2I72 A;  4X1L A;  5EV0 A;  4DJ3 A;  1F2K A;  1TD5 A;  2HDQ A;  3CWF A;  4KQO A;  2OAQ 1;  3DWK A;  3UDF A;  5HD5 A;  3JYI A;  2PD8 A;  4QB8 A;  4Y17 A;  1C3B A;  4EV4 A;  5HWW A;  1GSW A;  2PU2 A;  2P74 A;  4OLD A;  4JGR A;  4M3K A;  3AGD A;  3UME A;  1PI4 A;  2VV7 A;  1JTG A;  2QMI A;  5DFX A;  2XEP A;  3WS5 A;  3UDI A;  5AVF A;  3CHW P;  4OPQ A;  3T4O A;  4B4Z A;  5M19 A;  1NLZ A;  4YNR A;  3NI9 A;  4B9O A;  4FD8 A;  2XD1 A;  3ZG8 B;  4DRT A;  4DE1 A;  4WEL A;  3LY4 A;  1NXY A;  2XD5 A;  4UEY A;  3PHY A;  2Y8H A;  3IX8 A;  4CLC E;  5GLC A;  2EFX A;  2ZQC A;  5C5K A;  5A90 A;  1E4D A;  3Q82 A;  3F1N A;  1S4S A;  5FDS A;  2M1C A;  3A0S A;  5HPF A;  3WRZ A;  1MXO A;  1K56 A;  5J4E A;  3P01 A;  2XRO A;  3A3D A;  3G2Y A;  3E4P A;  4JF5 A;  2ZLY A;  2B18 A;  2ZM2 A;  4R4S A;  5CX7 A;  1Y54 A;  1KE4 A;  3DTK A;  4ETZ A;  4O8G A;  4GS9 B;  4M4X A;  4BBU A;  3HLW A;  2W3G A;  4GD6 A;  1XKZ A;  3N8S A;  1O7E A;  3GSG A;  5A92 A;  3B42 A;  1RGZ A;  1S1Y A;  1TF1 A;  3SZT A;  1N9B A;  1NRJ A;  3E4Q A;  2Q0O A;  1VHM A;  3PAG A;  2ZQ9 A;  1D1J A;  2V0W A;  4EBL A;  2WGV A;  3Q7Z A;  1L3L A;  4ARZ B;  1MWS A;  3CAX A;  2ZL1 B;  3VP1 A;  3BY9 A;  5GHZ A;  3MS6 A;  3SS3 A;  4UQI S;  4FSF A;  1DP9 A;  3HUO A;  4GDB A;  4CQH A;  2JKF A;  3LGO A;  2Y2I A;  5FQK A;  2IWB A;  2V9A A;  1XX2 A;  2IA2 A;  3GMW A;  5KSC A;  4E3M A;  2J8Y A;  1W8Q A;  4OOM A;  3FPW A;  4QJG A;  1KDS A;  3HLG A;  3SH7 A;  5AJG A;  3T4L A;  4WUJ A;  1U60 A;  3LID A;  2B5R A;  1ODV A;  5EOE A;  4Q0I A;  2ZMV A;  4U3T A;  4EQ1 A;  5TBM B;  1SDE A;  2QJ7 A;  2WGW A;  5GHX A;  4HH2 A;  2VJW A;  1ONH A;  3G31 A;  3GEC A;  5G4Z A;  3MXS A;  4OPY A;  4LCL A;  1E25 A;  5CGS A;  2Z2L B;  4Y13 A;  2PR5 A;  5HZH A;  4R3J A;  4EEP A;  2X02 A;  4DE0 A;  1NY0 A;  3Q81 A;  3P98 A;  1PZO A;  1VQQ A;  1OPX A;  4KQQ A;  4RQ9 A;  3WS4 A;  1FCO A;  4LV0 A;  3UO9 A;  2HGV A;  1W8Y A;  1XJ6 A;  3IBR A;  1XFQ A;  2KOI A;  3HL9 A;  3VE3 A;  2HP9 A;  5HFO A;  1JWV A;  3NEC A;  3ZQ5 A;  3LIE A;  3D9Y A;  2V1B A;  1V9Z A;  1CI8 A;  4KUK A;  4S2O A;  1ZTU A;  3NCK A;  5GL9 A;  1KOU A;  5CRF A;  1NJ4 A;  5FDH A;  4UHU A;  3N7W A;  2BAS A;  4OQI A;  4A5R A;  5FAS A;  4NXF A;  2ZC6 B;  1TS7 A;  2EA9 A;  1YLJ A;  3LR3 A;  2EWV A;  3L7H A;  4FCF A;  1F98 A;  5HSQ A;  3LI8 A;  3IXB A;  2W3D A;  4NK3 A;  4B93 A;  4KUO A;  1PNE A;  1YAX A;  2V8F A;  5AQ9 A;  5IS1 A;  3PTE A;  4EBP A;  4L9F A;  3VE4 A;  5F1G A;  2XK1 A;  5FEG A;  4AFI A;  2QWS A;  2XQZ A;  3UE6 A;  1TS0 A;  1ZHH B;  2A49 A;  3MF0 A;  2XF3 A;  3OZH A;  3L9K A;  2V1Z A;  1DJC A;  4MEZ A;  5M18 A;  1KDW A;  3IWI A;  3OCL A;  5BOH A;  4DE3 A;  2EFU A;  1KGE A;  1TDL A;  4HEF A;  1ESI A;  4XXR A;  3BQA A;  1FR6 A;  3IX4 A;  1CI9 A;  5E2G A;  2JBF A;  3GTC A;  1OTD A;  3D4F A;  2P9V A;  3NDG A;  3OCN A;  4Y15 A;  3NJA A;  3O86 A;  4S2L A;  2PR6 A;  4MLL A;  4R0Q A;  4RX3 A;  2WAD A;  3R7W A;  1GHI A;  2V2F F;  3BY8 A;  3TRC A;  4E3J A;  2HZ5 A;  3A3F A;  2EX6 A;  3IH8 A;  1PW1 A;  4OOL A;  2VGL S;  3RJU A;  3ZG9 B;  1XA7 A;  5F1F A;  3QNC A;  3ZG0 A;  5L07 A;  2D02 A;  2O0Y A;  3ZHH A;  2WZZ A;  2VGJ A;  2PU4 A;  3N4I A;  3F1P A;  4NET A;  4N9K A;  4GKU A;  3AGF A;  4BJP A;  1DY6 A;  3H7W B;  4F94 A;  2B02 A;  1UWP X;  5TJJ A;  1YSQ A;  1XP4 A;  3CJM A;  2OSU A;  3S4X A;  2DNS A;  5FAP A;  2I9V A;  1IKI A;  1P9W A;  1ES2 A;  4S2J A;  1KE3 A;  4KG6 A;  5F68 A;  3C38 A;  3G6O A;  2VX8 A;  1UWN X;  4MMN A;  1LL9 A;  4DDY A;  3B3X A;  3C30 A;  4JGO A;  1DJB A;  3CPT B;  1SZV A;  3M2J A;  3SS5 A;  1GHM A;  2O99 A;  2Y2O A;  1CEG A;  3R4K A;  2W1T A;  1K25 A;  3FWL A;  4EEU A;  4LGW A;  3QP5 A;  2G2U A;  3WS0 A;  3C5A A;  5MC7 A;  5IHV A;  3PR6 A;  4LFU A;  1ERQ A;  1YMX A;  5EVI B;  2ZQA A;  3G35 A;  3GR2 A;  3LR4 A;  3E98 A;  3UDX A;  3N8L A;  2VEA A;  4LLO B;  5DFY A;  3KX0 X;  1L0D A;  1SDN A;  3RH8 B;  1T1B A;  1MKI A;  2QKP A;  5K5B A;  1K57 A;  3Q7V B;  3T4Q A;  3BWL A;  3MFD A;  1BLS A;  5DKL A;  4BD0 A;  5F82 A;  3TJZ C;  4JKT A;  3S1Y A;  3OPH A;  1QME A;  4KG5 A;  4H6J A;  4GN2 A;  4DE2 A;  3V3S A;  4YFM A;  1YLT A;  5CTM A;  3G34 A;  5FQJ A;  2DRW A;  1W7F A;  3C2W A;  2ZQ8 A;  2WAF A;  1YPR A;  4OQ0 A;  3O3V A;  2H0Y A;  3MBZ A;  3RTY A;  5F6A A;  1BLC A;  3IHB A;  4KZA A;  1VET A;  3ZFZ A;  4I3J A;  1KGG A;  2HJ9 C;  2WKP A;  4NXB A;  3W8K A;  4R23 A;  1IEM A;  3MQQ A;  2PDR A;  2ZC3 B;  3PXP A;  3QHY A;  5HDC A;  1KVM A;  3HVF A;  1E3U A;  2VZW A;  4KZB A;  3ZDJ A;  4GW9 A;  5FL3 A;  1L2S A;  2HDU A;  1G28 A;  3BM6 A;  3IWO A;  5E2E A;  4E3K A;  1PWG A;  4QHC A;  1YKD A;  1Y4O A;  3W4O A;  3A3E A;  3CG5 A;  3NC8 A;  1CEF A;  3VSK A;  3UB5 P;  2Y4A A;  3JVU A;  2DCF A;  4GB7 A;  2WKI A;  3RFB A;  3V67 A;  4HP9 A;  4CLC A;  4C75 A;  5EOO A;  4FOF A;  2WUQ A;  3G32 A;  5DTK A;  3W4P A;  3UN7 A;  2GJ3 A;  1OTA A;  1YT4 A;  1BZA A;  1J3W A;  1CQA A;  4GD8 A;  1K57 C;  1LSV A;  4WMC A;  3HLD A;  5HDS A;  5EUA A;  4ZJ1 A;  3TG9 A;  4XT2 B;  1W63 Q;  2W0N A;  1ZC2 A;  5EM1 A;  2O9C A;  2B95 A;  1H5X A;  2PD7 A;  1P97 A;  1F9I A;  2HPB A;  2QZ6 A;  4IED A;  2BTF P;  4O0P A;  2E8J A;  1HVB A;  1ESU A;  3C4O A;  3IBJ A;  1PRQ A;  4Y2F A;  3UE0 A;  4Y0T A;  1AWI A;  2P04 A;  4ME4 A;  1XA1 A;  3FYZ A;  4Y0U A;  5FQI A;  4X6T A;  1XJ2 A;  5FI7 A;  5E2F A;  1PW8 A;  3MR0 A;  2WKR A;  2R78 A;  3UPO A;  4OKP A;  1N9N A;  2YKF A;  1LI0 A;  4X56 A;  4B4X A;  4QWO A;  1GSV A;  1ERO A;  1QMF A;  4UA7 A;  4HHD A;  3ULF A;  1PIO A;  4NKP A;  1HD8 A;  5A93 A;  5KIZ A;  4I3A A;  3MZF A;  4EU0 A;  3CUE A;  4Y3I A;  5DF9 A;  3GVB A;  3PBR A;  3Q07 A;  1ERM A;  4N1X A;  3T4K A;  4PM5 A;  3FC7 A;  3ZVT A;  3SOI A;  3HBR A;  4MBF A;  4WEK A;  4P6Z M;  4IBR A;  5CER A;  2MJ6 A;  4PHT A;  4EES A;  1L0F A;  4CLC C;  3MSH A;  3LEQ A;  4R6L A;  2JKT M;  2JCH A;  1ZG4 A;  3PBN A; 
#chains in the Genus database with same CATH homology
 3ZQ5 A;  4EW7 A;  4LPZ A;  1OJ5 A;  3EGD C;  3MXQ A;  3LIE A;  2J80 A;  1OT6 A;  4ETX A;  3D3O A;  3HJI A;  3F1N B;  2V1B A;  5HL6 A;  3LI9 A;  1V9Z A;  4KUK A;  4II7 A;  3PBT A;  4G3W A;  3JVV A;  5IU1 A;  2ZOH A;  4Q0H A;  1ZTU A;  1S67 L;  4I39 A;  3TW8 A;  1KOU A;  4Y5F A;  4NXE A;  5LBR A;  2XSS A;  3H82 A;  4EXO A;  4P6Z S;  3E4O A;  2CMN A;  2BAS A;  4HQA A;  2JKR I;  4NXF A;  1TS7 A;  2EA9 A;  4CLC B;  3LR3 A;  2EWV A;  1F98 A;  5HSQ A;  2JKR M;  3LI8 A;  4NEE D;  1MKM A;  5J7E A;  2J3T D;  2L0W A;  2W3D A;  4L9E A;  4B93 A;  3EGX C;  2W27 A;  1YAX A;  4KUO A;  3T4T A;  3B33 A;  2P08 A;  5IS1 A;  3PBS A;  3LIC A;  1TS8 A;  2H28 A;  4L9F A;  1DRM A;  3VE4 A;  4DJ2 A;  1T19 A;  4AFI A;  2QWS A;  4R38 A;  2VV6 A;  3UE6 A;  1TS0 A;  1VB6 A;  1ZHH B;  2K31 A;  3S7N A;  3MF0 A;  5HPI A;  2PYR A;  3OOV A;  1MZU A;  3KSH A;  3K3C A;  3D72 A;  2O9A A;  3OCL A;  2QJ5 A;  3IS2 B;  2VKS A;  4HJ3 A;  3B47 A;  1V9Y A;  4WN5 A;  4WF0 A;  4E04 A;  2KX6 A;  1XJ4 A;  1OT9 A;  2K7S A;  3T4J A;  3MQO A;  4O01 A;  3BQA A;  4MN6 A;  2VLG A;  3UE3 A;  3CUE C;  3HJK A;  2NUT C;  3CI6 A;  1OTD A;  1G6O A;  3OCN A;  3VV4 A;  4IUK A;  3NJA A;  4K08 A;  4F3L B;  4I5S A;  2PR6 A;  1XFN A;  4H6J B;  4MCW A;  2GX5 A;  1STZ A;  3LFV A;  3OLO A;  3R7W A;  2HV1 A;  1OJG A;  4HP4 A;  1JNU A;  3BY8 A;  3TRC A;  2OWJ A;  3EWK A;  5AVE A;  1D7E A;  1LSW A;  3MJQ A;  2Z6C A;  5G4Y A;  4BBT A;  3F1O B;  2XRN A;  1MC0 A;  4OOL A;  2VGL S;  4WLA A;  1T1A A;  2ZBB A;  1LT0 A;  5HD3 A;  3HCY A;  3UMD A;  5L8M A;  1DP6 A;  2D02 A;  2OOL A;  2O0Y A;  1XJ3 A;  2V0U A;  4YOF A;  3F1P A;  4QPR A;  3KSF A;  3EEA A;  4BBV A;  2ZOI A;  3A0V A;  2FH5 A;  4BJP A;  4HY8 A;  1OTE A;  3H7W B;  5DJT A;  2P7J A;  3NOU C;  4HJ4 A;  4BWI A;  2W1R A;  2B02 A;  1UWP X;  1OTI A;  5TJJ A;  1YSQ A;  4GCZ A;  1N9O A;  1LL8 A;  1W63 M;  2M7V A;  2I9V A;  1P9W A;  5HWV A;  2KDK A;  5F69 A;  2QYB A;  2EWW A;  3MMH A;  1Y28 A;  2W3F A;  3C38 A;  3G6O A;  2VX8 A;  3LYX A;  5F68 A;  3UB7 A;  3UB6 A;  1UWN X;  1NLY A;  4MMN A;  3TE8 A;  3SW1 A;  2V1A A;  4HH3 A;  2FZ0 A;  3K3D A;  4I3I A;  3C30 A;  3C8C A;  4JGO A;  4LRZ E;  2O9B A;  3O5Y A;  3LR5 A;  3H82 B;  4GS9 A;  5DKK A;  1UGU A;  4MDZ A;  4LRX C;  1P0Z A;  4EET B;  2O99 A;  3T50 A;  2Y79 A;  2W1T A;  3R4K A;  2G7U A;  4IUH A;  1N9L A;  2HF6 A;  4UQI M;  4CLC D;  2PHY A;  2XA7 M;  4EEU A;  2L1M A;  5F5Y A;  4XT2 A;  3BW6 A;  4JGP A;  4Z1W A;  5MC7 A;  1BYW A;  3U2A A;  3PR6 A;  1EW0 A;  1D06 A;  5I5L A;  4ARZ A;  3MFX A;  3CIT A;  2GNX A;  3FPV A;  4BMW A;  4R70 A;  3OC2 A;  2VV8 A;  3LR4 A;  3E98 A;  3KYZ A;  5IT5 A;  4DJ3 A;  4ZRR A;  3EOI A;  2VEA A;  1TD5 A;  2OWH A;  4LLO B;  4NXG A;  2PYP A;  3IS2 A;  3CWF A;  5DFY A;  4KQO A;  3KX0 X;  3S7O A;  4HJ6 A;  2GZA A;  3RH8 B;  3PBQ A;  1T1B A;  5HD5 A;  2QKP A;  5K5B A;  2PD8 A;  2XA7 S;  3T4Q A;  3BWL A;  3T4S A;  3H9W A;  5DKL A;  5HWW A;  1GSW A;  4L9G A;  3DBA A;  3TJZ C;  4PKY A;  4R3A A;  4JGR A;  4H6J A;  3KSI A;  3S7P A;  2JHE A;  3R7W B;  2A24 A;  4DN0 A;  3UME A;  5TBM A;  1YSP A;  2VV7 A;  5KSH A;  2JN7 A;  3KSG A;  4MN5 A;  5DFX A;  1T1C A;  1NWZ A;  4HOI A;  5HDD A;  4GHI A;  2KLI A;  3UB9 A;  3LR0 A;  3C2W A;  5AVF A;  3T4O A;  1OTB A;  3LIF A;  1X0O A;  3LIB A;  3RTY A;  3KO6 A;  5F6A A;  1NLZ A;  4YNR A;  4I3J A;  2ZMF A;  2HJ9 C;  3ICY A;  2WKP A;  4NXB A;  3PBN A;  4B9O A;  4YWZ A;  4EUV A;  3OBF A;  3EQU A;  3MQQ A;  2PDR A;  4HI4 A;  2J3T C;  3PXP A;  4WEL A;  2D01 A;  5HDC A;  3FG8 A;  3F1P B;  3LIA A;  4UEY A;  1S66 L;  3PHY A;  3EEH A;  2Y8H A;  4CLC E;  2JKT I;  2DMW A;  2L4R A;  2OAP 1;  2VZW A;  5C5K A;  4GW9 A;  2LB9 A;  3ZYT A;  2VA0 A;  5FL3 A;  3F1N A;  4EER A;  1S4S A;  2A2L A;  2M1C A;  2PT7 A;  2W3H A;  1G28 A;  3A0S A;  5HPF A;  1F5M A;  2K2N A;  3VOL A;  1H3Q A;  5J4E A;  1YKD A;  3P01 A;  2XRO A;  2INW A;  3P7N A;  1IOU A;  3JVU A;  2W3E A;  3E4P A;  4LRY C;  3RFB A;  3V67 A;  4HIA A;  2B18 A;  4HP9 A;  5CX7 A;  4CLC A;  1TS6 A;  4Q0J A;  4ETZ A;  4FOF A;  5DJU A;  4O8G A;  4PAU A;  4GS9 B;  4M4X A;  4MN7 A;  4BBU A;  3CLO A;  2GJ3 A;  1S1Z A;  2NUP C;  1OTA A;  2W3G A;  1WA9 A;  1DP8 A;  4G3K A;  2W1T B;  4IHQ A;  3B42 A;  4DMZ A;  4HNB A;  1S1Y A;  1LSV A;  1TF1 A;  1NRJ A;  5HDS A;  4WEJ A;  3E4Q A;  4XT2 B;  1VHM A;  1S4R A;  1W63 Q;  2Z6D A;  3KYQ A;  4G3V A;  2W0N A;  4L0L A;  2V0W A;  5HWT A;  4ARZ B;  2O9C A;  3MQ0 A;  2PD7 A;  1P97 A;  1F9I A;  2J3W A;  4GLQ A;  3CAX A;  4O0P A;  3BY9 A;  3GDI A;  4UQI S;  4GJ4 A;  1LSX A;  3NOP C;  4FSF A;  1DP9 A;  3IBJ A;  4CQH A;  4Y2F A;  4WL9 A;  1GSX A;  2P04 A;  4ME4 A;  2V9A A;  3LUQ A;  3UB8 A;  2IA2 A;  4JGQ A;  4F3L A;  1XJ2 A;  3MR0 A;  2WKR A;  2R78 A;  2VGL M;  4OOM A;  3FPW A;  2WKQ A;  4PKY G;  1N9N A;  3NOT C;  2YKF A;  5EFW A;  5AJG A;  3T4L A;  1GSV A;  4WUJ A;  2M7U A;  3BJN A;  3LID A;  4HHD A;  3ULF A;  1ODV A;  3PBO A;  4Q0I A;  4NKP A;  2ZMV A;  4EQ1 A;  2A24 B;  5KIZ A;  4I3A A;  5TBM B;  4KQD A;  2QJ7 A;  3E0Y A;  4EU0 A;  2YKH A;  3F1O A;  1IFQ A;  4HH2 A;  2VJW A;  3GEC A;  5G4Z A;  3CUE A;  4GHI B;  4Y3I A;  5DF9 A;  4I38 A;  3PBR A;  3W2Z A;  2PR5 A;  5HZH A;  3T4K A;  4EEP A;  3BQ8 A;  3FC7 A;  4IJG A;  3PYP A;  4WEK A;  1P9R A;  5J3W A;  1OPX A;  4P6Z M;  4RQ9 A;  2MJ6 A;  4PHT A;  4EES A;  3H7W A;  4CLC C;  3K2N A;  4R6L A;  2HJE A;  2HGV A;  3NHQ A;  2QHK A;  1XJ6 A;  2JKT M;  2LB5 A;  3IBR A;  1H8M A;  1XFQ A;  2KOI A;  3EQV A;  3VE3 A;  3S7Q A;  5A8B A;  3A0R A;  1T18 A;  2OAQ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...