2LB5A

Refined structural basis for the photoconversion of a phytochrome to the activated far-red light-absorbing form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor histidine kinase
publication title Structural basis for the photoconversion of a phytochrome to the activated Pfr form.
pubmed doi rcsb
source organism Synechococcus sp. ja-2-3b'a(2-13)
molecule tags Transferase
total genus 32
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2lb5A00
4Q0JA 5LBRA 3EEAA 1YSPA 2O0YA 1ZTUA 3S7PA 3KSIA 2W1TB 5HSQA 2VEAA 4G3VA 3CI6A 4GLQA 4MDZA 5HL6A 3S7QA 2VZWA 4G3WA 4R6LA 4YNRA 1TF1A 3KSHA 2K2NA 2OOLA 3E0YA 4E04A 2Y8HA 4Y5FA 2M7UA 4R70A 3O5YA 5L8MA 3NOUC 3S7NA 3IBRA 2ZMFA 2M7VA 3RFBA 3BJNA 2QYBA 3KSFA 5TJJA 4G3KA 4Q0HA 2W1RA 2KOIA 3S7OA 1F5MA 3LFVA 3OBFA 2K31A 3W2ZA 4Y3IA 4GW9A 4Y2FA 2O9CA 3K2NA 3IBJA 3NOPC 3MQ0A 4FOFA 2GX5A 5I5LA 3CITA 4Z1WA 5DFXA 2W3DA 4EUVA 3MF0A 3HCYA 2O9AA 3C2WA 4BWIA 4ETZA 1VHMA 3VV4A 3TRCA 2Y79A 2LB5A 1MKMA 4DN0A 5K5BA 3NOTC 2VKSA 2XRNA 4O8GA 1STZA 4IUHA 4IUKA 4LRYC 2W1TA 1TD5A 3MMHA 1MC0A 4YOFA 3KO6A 3NHQA 5AJGA 4O0PA 2XROA 2W3GA 4DMZA 2B18A 2LB9A 4LRZE 4MMNA 5HPFA 2VJWA 4ETXA 4LRXC 5DFYA 4RQ9A 4CQHA 3DBAA 4Q0IA 2W3HA 2XSSA 2IA2A 5HPIA 2KLIA 2W3EA 4ME4A 4EU0A 4MCWA 5C5KA 4PAUA 3R4KA 1YSQA 2O9BA 2G7UA 4MN7A 4QPRA 2W3FA 3KSGA 3ZQ5A 3G6OA 1YKDA 2O99A 4IJGA 4ZRRA 3D3OA 4O01A 2HGVA 3E98A 3OOVA
chains in the Genus database with same CATH superfamily
4R38A 3PHYA 5FA7A 2A2LA 4GLQA 4EBPA 4OQIA 1PIOA 1SKFA 3C4OA 3GVBA 1SDEA 4UHUA 4ARZA 2OLUA 5DJTA 2PD7A 1OT6A 2ZQ8A 3W8KA 2QYBA 3KSFA 3KYZA 3ZVTA 2W1RA 2KOIA 1MZUA 3LFVA 3B47A 2Y2HA 3F1PB 2FFYA 4Y3IA 1IYOA 2OWHA 3OLOA 3FKVA 1LSWA 3L7HA 4UQIS 4DJ2A 4Z1WA 4LENA 4MBHA 4WBGA 4EETB 1AWIA 2VV6A 3SH9A 3NBLA 3IF5A 4LCMA 4HQAA 3FC7A 4KQOA 3LEQA 5HDDA 2D02A 4P85A 1SZVA 2YKFA 5HZHA 4II7A 3NHQA 3IHAA 3JVUA 4BBTA 3VOYA 3SW1A 1TVFA 1W63Q 3LR5A 3PAGA 3W4QA 4EEUA 1JTGA 4DJ3A 4MCWA 4JGRA 4QY5A 1N4OA 4QPRA 1DRMA 1NRFA 3A0RA 1XPBA 3BWLA 3G6OA 2EXBA 1T19A 3A0SA 4UA7A 4EUZA 5AQBA 1RGYA 3MZDA 3UB7A 3LIEA 1MXOA 4H8RA 2J9OA 3C5AA 3E4OA 3A0VA 1CI9A 1W79A 5A91A 1TS7A 5CGXA 3CG5A 2ZQCA 2J80A 4E04A 4WEJA 3CJMA 4Y0TA 3QHYA 2H0YA 2EX8A 4EERA 3PTEA 1P0ZA 3VMAA 4Y7PA 3G34A 4ESPA 1DP8A 4PPRA 4R3JA 4CLCE 3G30A 3LIDA 1MWUA 1P9RA 4PKYA 3HLCA 4HOIA 1G68A 2VV8A 4KZAA 4UA9A 1IYPA 1IKIA 2JN7A 3VSLA 5KSHA 2WGVA 3NC8A 3MR0A 2OV5A 4ARZB 1LLBA 1FOFA 1GSVA 1TS0A 4ETZA 3IXBA 3S4XA 1MKMA 5K5BA 4UA6A 4E6WA 4WM9A 4BLMA 2Y91A 5F5YA 3MMHA 4BD1A 1WA9A 3WS0A 1E3UD 3UY6A 1CEFA 3UO9A 3BM6A 5EM0A 4LV3A 4KZ8A 2FH5A 3LR0A 2QZ6A 3VFHA 3IWQA 4HH3A 1C3BA 1FSYA 4ZJ2A 4PM8A 5AVEA 1G28A 1PI5A 3Q81A 4ZJ1A 4AFIA 4U3TA 4GKUA 3T1QB 1W63M 4R4SA 2BASA 2JKRI 2Y2NA 2OAP1 1CQAA 3GDIA 3MXRA 3HLEA 2INWA 4L9FA 1U60A 3MSHA 3UB9A 1LT0A 2VX8A 3R7WA 3S7NA 1S4SA 1NXYA 2ZMFA 1T18A 2EXAA 1XP4A 3UB5P 3IXHA 5EPHA 5J3WA 5HFOA 1TDGA 5CHJA 2PD8A 2WAEA 1Y54A 1DY6A 4S2OA 3BFFA 4GOGA 2ZC4B 4OONA 5I5LA 2DCFA 3E2LA 1M40A 3NIAA 1W8QA 1NLYA 4P87A 4E3OA 2ZQAA 2W3DA 5CHMA 2JC7A 3IF6A 3MF0A 4LCLA 2EX6A 4WYYA 3ZG7B 3D72A 4MEZA 4IVKA 3C7VA 1OTBA 2Y2IA 3QP4A 3TRCA 4WUJA 2LB5A 2HP6A 3LIFA 1OT9A 4UQIM 1YMXA 1J3WA 4Z9QA 1MBLA 1SDNA 1OTIA 2WUQA 2WZXA 3FPWA 2OLVA 2QKPA 2V2FF 4HY8A 2VJWA 2R9XA 4I3AA 3IXGA 4PMAA 2V8CA 2W3EA 4ME4A 4EU0A 4U0TA 5FAQA 4GZBA 1ESUA 5HW3A 4R23A 4WL9A 3IF6C 1XGJA 1XA1A 4Q8IA 3MQOA 2A24B 4KZ3A 3G35A 3EGXC 5J8XA 1PYYA 3CI6A 1CK3A 5G18A 3O3VA 4YFMA 3KSHA 4QHCA 3CUEA 3LEZA 4DRTA 2M7UA 5FL3A 4JF6A 2Y55A 4PM5A 4OLDA 2M7VA 4EV4A 5HD5A 3MZFA 4Q0HA 2ZC3B 1K6RA 1UWNX 2G2WA 3LR4A 5DF7A 2WKPA 2PR5A 3ITBA 5TBMA 1XX2A 5HWWA 4DE2A 3MZEA 4I3IA 3WRTA 4JBFA 1O07A 4NEED 3ZHHA 4I3JA 3K3DA 5CEBA 1PNEA 5CERA 1OJ5A 3DTMA 4KQRA 4S2IA 5EM1A 3R7WB 3OCLA 4HESA 5E2FA 3CUEC 5TR7A 3UDXA 5EOOA 2ZD8A 2B02A 2FFFB 5EVIC 4KG5A 3EOIA 3VFFA 1TS8A 1K55A 2GZAA 4OQGA 4OPYA 2GNXA 4RYEA 4HI4A 2B95A 2XD1A 1L0EA 1IEMA 1N9BA 1OPXA 2GDNA 3IF6B 5L10A 5F1FA 1RP5A 3N4IA 2Z2MB 4KG2A 3RJUA 1EWZA 1W8YA 1KE0A 3IS2A 3CHWP 3EEHA 1BLPA 5A90A 4OP8A 4QB8A 4WZ5C 1X0OA 1KGFA 3A3DA 3KSIA 4P6ZS 5HL6A 1GA9A 2VZWA 1MY8A 3G4PA 4MBKA 2L4RA 3KX0X 5L8MA 5F82A 3E2KA 2IWBA 3WRZA 3U2AA 1PZOA 2QJ5A 3BLMA 1NLZA 1HLUP 4PKYG 5FSRA 1D06A 1K38A 3D4FA 4KENB 4M3KA 3V5MA 4I38A 3OCNA 1NY0A 4L9GA 3N7WA 4R4RA 1IELA 2BG1A 2HZ5A 1F9IA 2O9AA 4GDBA 3LY4A 3T12B 3VV4A 3JPUA 1YLTA 5EVIB 5CXWA 4O8GA 2MJ6A 4FSFA 5EVID 3IX3A 3IX8A 2Y2KA 2W3GA 3TW8A 5DKKA 2HDSA 3ZCZA 4DDSA 4IEDA 4RX2A 5TBMB 4ETXA 4LRXC 2B5RA 4K0XA 1J9MA 4BMWA 1K0KA 4N1XA 2ZMAA 2R9WA 3TE8A 3B33A 3Q1FA 3B3XA 3NDEA 3ZG9B 4JF5A 3UNWA 2P74A 1F98A 3DWKA 3E4PA 2O0YA 1XFQA 2NUTC 4WF0A 4KZ5A 4FTXA 4MN6A 5KMWA 1S4RA 1UWPX 3LIBA 1KGEA 5HAPA 3UE1A 2PT7A 4Y5FA 1W5DA 4R0QA 1HD8A 1BLSA 2VGLS 5TJJA 5EE8A 1ZG6A 5GHYA 1MWSA 3OBFA 2D01A 3BFGA 1PWGA 3IS2B 4Y2FA 3A3IA 4X68A 3UPNA 1WYBA 4P0MA 5GHXA 2ZC7A 1IYQA 3T4JA 4RA7A 3I7JA 1NWZA 1YLWA 1M6KA 1DJAA 1E3UA 1K57C 1VHMA 3NOTC 2ZM8A 3T1RA 1V9ZA 2GJ3A 4GDNA 3BW6A 3GRJA 5FDHA 2OWJA 1MC0A 1OTAA 5KSCA 3O87A 1OTEA 3FWLA 1YAXA 3FKWA 4LFUA 3SOIA 4WELA 5M1AA 1S67L 2V1BA 3DBAA 3GR2A 3AGEA 1GHIA 1G6AA 4GN2A 2KLIA 2RCXA 1NZOA 3HLGA 5FI2A 5G4ZA 3WWXA 1AXBA 5CTNA 2W3FA 1MWRA 2WKRA 3CPTA 1FQGA 5GL9A 3V50A 1FCNA 3GSGA 2Q9MA 1GSWA 4E3IA 3G31A 2NUPC 5EOEA 1D1JA 2PHYA 3M6BA 4KQDA 4E3KA 1QMEA 1CI8A 1I5QA 1DJCA 5AQ9A 4B9OA 3ZG0A 1FR6A 4LPZA 2WYXA 3UB6A 1ACFA 3C38A 4B88A 4M4XA 5J4EA 3S7OA 4P6ZM 3MXQA 1ES2A 5EV0A 3NOPC 3LIAA 3LI8A 4KUKA 5E2EA 5E2HA 5JYPA 4NKPA 5L09A 3E4QA 3HCYA 1PWCA 4EW7A 1H0MA 3MJQA 1GHMA 3QP1A 4DN0A 2XRNA 4Y0OA 3VOZA 5DTSA 4EEPA 5KIZA 5FI6A 3QNBA 1YLPA 2Y2GA 1ERQA 5F6AA 1LI0A 1MKIA 3C30A 2XR0A 5CEDA 1XJ3A 4WEKA 2EFXA 5GLDA 2A24A 2EFUA 4OP5A 2JCHA 2IWCA 4OQHA 3BYDA 3CZDA 2Y2MA 3PBSA 3M2KA 2HGVA 3UPOA 1ZTUA 3N6IA 1H3QA 1Y4OA 3EQVA 1PW1A 4C3QA 4JXSA 2QMIA 4MDZA 3MFDA 2CC1A 4QU3A 2PYPA 3GQZA 1VETB 2PAVP 3ZNTA 1JVJA 1V9YA 1FILA 3KYQA 1EI5A 2K31A 2X02A 1H5XA 3CPTB 3G2ZA 3L9KA 4JKTA 1BSGA 5HAIA 4JXWA 2E8IA 3ZG5A 2VGLM 5HWVA 3S1YA 3T1XA 2ZOHA 3KYEA 4HIAA 4JF4A 3WS5A 1PW8A 5BOHA 2ZQ9A 2E8JA 2WGWB 4OVDA 3BFEA 3ZGAB 3LGOA 3DTIA 3TOIA 2Y2LA 3WS1A 1YM1A 4S2NC 4O0PA 4NXFA 3F1OB 3DAVA 2LB9A 4PM6A 3A3EA 5F1GA 4PM7A 5HPIA 4X55A 3PXPA 3PR6A 2VV7A 4HH2A 3CAXA 1K4EA 4PAUA 1ONHA 2G7UA 4BL3A 4XT2B 3SZTA 3P01A 3QP5A 3FPVA 4ZRRA 1YT4A 5FQIA 1GCEA 1HTZA 3EEAA 4MBFA 3S7PA 2XA7S 3OPPA 3WS2A 2XFSA 1JWVA 1KDSA 4S2MA 1CF0A 3NDGA 1S66L 4IHQA 3LY3A 1PWDA 4NXEA 3VE4A 2W0NA 2ZC5B 4LGWA 1Q2PA 2Z6CA 1Z09A 3HUMA 4EXOA 4Y15A 1KE4A 3BRMA 3V3RA 5F69A 4GW9A 3UDIA 4HJ3A 3IWOA 2V9AA 3VE3A 5A8BA 3TSGA 4FOFA 1CJFA 3D9YA 3VOLA 4R3AA 3ZVWA 5EVIA 1ODVA 4K91A 1P97A 4KZ4A 1S0WA 2WGIA 2XLNA 5FAPA 4X53A 3IH8A 1ES3A 4OQ0A 5EVLA 3NCKA 1S1ZA 3LR3A 3F1NA 3IT9A 3QP6A 2Z6DA 3GMWA 5F83A 4KQQA 3UB8A 1D7EA 1TEMA 2PR6A 3B42A 4LV2A 2B18A 4MMNA 3QP2A 2H28A 3FV7A 4N1HA 2PRFA 2W3HA 4WZ5A 1KDWA 4JGOA 1N9LA 4RVAA 5C5KA 1MPLA 1N9NA 5E2GA 4BENA 3CLOA 1L0GA 1S1YA 5FATA 2A3UA 3LO7A 4HJ4A 4MN5A 4BQMA 2QJ7A 3IXDA 1YMSA 3D3OA 3VP4A 2J3TC 1KOUA 4O01A 2PDRA 2C5WB 3BQ8A 3W4OA 1BUEA 4N92A 5HWTA 4E3LA 3HLBA 2XEPA 4H6JA 4R3BA 2BTFP 4S2KA 5FQJA 2BLSA 3E0YA 5TFQA 3V3SA 5HD3A 1DJBA 3IX4A 1WE4A 1YLZA 3O5YA 5DKLA 3OPRA 4GJ4A 2L1MA 5CTMA 3VP3A 3BFDA 4U0XA 1JNUA 4DE3A 3Q7VB 3MKFA 4WLAA 2PBDP 2KX6A 1HVBA 4C75A 3V67A 5FEGA 3BY9A 3MQ0A 4DKIA 5HAQA 4LV1A 4WMCD 2ZMVA 5EUAA 2VA0A 4CLCC 2HF6A 1I2SA 1H8YA 3GTCA 2EWWA 3RXWA 4KZ9A 3H7WA 1NJ4A 3TG9A 4F94A 3GECA 3BECA 3M6HA 1SKOB 3ZFZA 4ZJ3A 2HP5A 2V8FA 2WKQA 3IQAA 1BTLA 4FH4A 1KVLA 3UMDA 4DXBA 1KE3A 3P98A 3HLWA 4OOMA 2ZOIA 2YKHA 4LRZE 4UEYA 4X69A 1GHPA 2XSSA 3DW0A 1K54A 1IOUA 2EX9A 5G4YA 5HARA 3R4KA 4UAAA 1PFLA 4BL2A 2JBFA 2J3TD 3HL9A 2VLGA 2C6WB 2Z2LB 3F1NB 4Y17A 4OPRA 2ZL1A 4IVIA 3LYXA 1XFNA 1VEUA 2XFTA 1T1BA 4R6LA 4DXCA 4FUWA 4R70A 2I9VA 1T1AA 2XA7M 4KZBA 1XXMA 3MQQA 3ULFA 1L0DA 2HJ9C 1K54C 1F5MA 3QP8A 5M19A 2OSUA 4B93A 1JWZA 1OMEA 3W2ZA 2ZC6B 4MNRA 5JYOA 1K57A 3K2NA 4QD4A 3IBJA 1OTDA 1FSWA 4QY6A 4JXGA 2G2UA 4Y0UA 5TGFA 1NZUA 4H6JB 4CLCD 2WKIA 5DVAA 1SCWA 4C6YA 4X6TA 1ERMA 2ZLYA 4ZBEA 2ACGA 4KZ6A 5DJUA 1FCOA 5I94A 1K4FA 3Q82A 4LRYC 2V20A 3H82A 3W4PA 5U47A 5AJGA 3QNCA 1VQQA 2UWXA 2QWSA 3G32A 4IBXA 5HPFA 5HDCA 4MLLA 1LHYA 1ZHHB 1EROA 5HDSA 4ZAMA 2KDKA 1Z6FA 4IBRA 5GLAA 2HV1A 1P9WA 4KUOA 1YLYA 3KSGA 3H7WB 4EBLA 3PYPA 4X25A 3ZDJA 5EVEA 5GHZA 3LI9A 1SHVA 2ZBBA 1N9OA 4LLOB 5GLCA 2HDUA 2PBYA 3UDFA 1VETA 2ZQDA 3ZNYA 3S7QA 3M2JA 4OPZA 2Y4AA 4N9LA 4HEFA 2K2NA 5DTTA 3VP2A 3RTYA 2Y8HA 3ZYTA 1BLHA 5DF9A 4EQIA 4DDYA 3IBRA 2JKTM 3S22A 4S2JA 4GS9B 4Y13A 1BULA 3PBTA 4YWZA 1YLJA 2Y2PA 3BEBA 3Q7ZA 1LSVA 3OPHA 3UE6A 5IS1A 5IHVA 1NYYA 4HNBA 5EECA 2O9CA 4JGPA 4ZDXA 4B4ZA 4E3JA 2ZL1B 2WGWA 2GX5A 4FCFA 2P04A 1K6SA 3T4OA 1VEUB 3A3FA 4F3LA 1BLCA 2I72A 1E4DA 2Y59A 5MC7A 1F2KA 3MXSA 4X1MA 3NECA 5F68A 1GA0A 3EGDC 3F1OA 2DRWA 5FQ9A 5A92A 4GB7A 3N8SA 3T4SA 2W1TA 3MS6A 3OPLA 3LCEA 4GNUA 4EWFA 1HZOA 2XROA 1Y28A 3UN7A 2V1ZA 4ID4A 5CECA 4HHDA 3N8RA 3T4QA 3DTEA 2WADA 4HP4A 1GSXA 2DMWA 4XT2A 5DTKA 4YINA 3SH8A 4FH2A 4JLFA 5KZHA 2P9VB 4BJPA 4I5SA 2J3WA 5HX9A 1ONGA 2J9PA 3BFCA 3ZQ5A 1YKDA 5M18A 5IT5A 2HDQA 1YPRA 4Q0JA 4X1LA 5CHUA 5FDSA 5HSQA 3H82B 2VEAA 2CMNA 5IU1A 4NXGA 1DP9A 4K08A 5L07A 2EA9A 1LSXA 4NETA 2PYRA 3O86A 3C8CA 3IH9A 1IKGA 2X71A 1E25A 2OAQ1 4KG6A 2JKFA 4B4XA 4QJGA 1Q2QA 4S2LA 3DWZA 3SS5A 4R1GA 3CITA 4S2NA 3IWIA 2H0TA 1IFQA 4PHTA 5AVFA 1S6RA 2Y79A 3OZHA 2VKSA 3BLSA 4HP9A 4HBUA 2UV0E 4XXRA 5E43A 4CJNA 2ZM2A 3MKEA 5CGSA 3HUNA 2ZQ7A 5FAOA 3HUOA 1ALQA 1RGZA 4RQ9A 4L0LA 3VP1A 3Q07A 3BQAA 5CX7A 1LL8A 2V1AA 4RX3A 2J7VA 4F3LB 2HPBA 1YSQA 2O9BA 4EBNA 2K7SA 4MN7A 5FQKA 1UGUA 1XJ6A 3HJKA 1ESIA 3PBOA 2IWDA 1NYMA 5LBRA 1YSPA 5FQQA 2W1TB 3ZG8B 1VB6A 3LICA 3BY8A 1G6OA 4G3WA 4YNRA 1TF1A 4WN5A 3HLFA 3Q7VA 3G2YA 4KZ7A 2HJEA 3PAEA 2PU4A 2XGNA 3SH7A 2H5SA 3RH8B 4WMCA 3BJNA 2WK0A 5D3OA 5DF8A 4NXBA 4QWOA 1XA7A 1ZG4A 1XJ2A 3LUQA 2VGKA 4S2PA 1K56A 1G5UA 4NG2A 4JPMA 2A49A 2XH9A 3N8LA 1MWTA 1PZPA 2XDMA 3C4PA 1ES5A 1ZC2A 2JHEA 1L0FA 4P6BA 5FI7A 5FEFA 3HVFA 4GHIA 4JGQA 4OOYA 1SKOA 3VP0A 2WKHA 1H8ZA 2ZJ9A 2VGJA 3EQUA 2EX2A 1O7EA 2X01A 3MBZA 2WAFA 5CRFA 4K0WA 3TJZC 1BT5A 3HLDA 3H9WA 3NULA 3ICYA 5DFYA 4CQHA 1H8MA 3MFXA 1CEGA 1ES4A 1TS6A 3ISGA 1KGGA 2W27A 4GD8A 1FCMA 3OC2A 5EFWA 3VSKA 4D60A 4OLGA 1BYWA 1IYSA 2J8YA 3DTKA 4I39A 2AVXA 1DP6A 1JWPA 3UPPA 4PM9A 1I2WA 1QMFA 1BZAA 3NOUC 4EESA 3NI9A 3RFBA 3FZCA 4FD8A 1WYCA 2P7JA 3FG8A 4OKPA 4CLCA 1LL9A 5GLBA 1OJGA 4XUZA 3C7UA 4BD0A 1ZKJA 2V0UA 2DNSA 1T1CA 1VM1A 2XF3A 3UE3A 4LV0A 2XQZA 1EW0A 1LI9A 5L2FA 2JE5A 2QPNA 2FZ0A 5DFXA 4DF6A 3O88A 1NRJA 2Y2QA 3GV9A 3WS4A 1A0KA 2RL3A 1FIKA 3HBRA 2HDRA 2M1CA 4N9KA 3C2WA 1L2SA 4GCZA 2Y2OA 2JKRM 4EQ1A 3T4LA 2JKTI 3KO6A 3AGDA 4DMZA 1FR1A 1KVMA 3SS3A 2QHKA 3V39A 5HL1A 2Y2JA 4Q0IA 1K56D 4OOLA 4E3MA 4HJ6A 4E3NA 3CMZA 3HREA 3PBNA 5A93A 4GHIB 1K55C 5FASA 3F1PA 3T4KA 3FYZA 3SS4A 3CWFA 4L9EA 4G3VA 2V0WA 4GS9A 2OOLA 3NY4A 4DE1A 4HBTA 1PRQA 4X56A 3A3JA 4CPKA 1K25A 1XJ4A 3T50A 5AQ7A 4G3KA 2Q0OA 2VK3A 3U4LP 2P08A 1W7FA 4D2OA 1XKZA 3RXXA 3P09A 3PBRA 4DE0A 3HJIA 2H10A 3EWKA 3NJAA 4BBUA 5J7EA 3JYIA 1PI4A 4GD6A 3T1SA 4EUVA 2XK1A 1LL5A 3PBQA 2JKGA 4BWIA 1RCJA 4JXVA 3ITAA 1TDLA 1STZA 2ZM0A 4IUHA 2HP9A 2XD5A 4IUKA 3K3CA 4CLCB 1TD5A 4YOFA 1YQSA 1XGIA 2P9VA 4OPQA 4E6XA 3P7NA 2Q9NA 4XUXA 5CGWA 2R78A 3T4TA 4ZTKA 3UE0A 2IA2A 4A5RA 4BBVA 1L3LA 2WKEA 2WZZA 4NK3A 5AQAA 2EWVA 1JTDA 4OH0A 3AGFA 2PU2A 4O7DA 3UMEA 2L0WA 3IHBA 2O99A 4IJGA 3JVVA 5FQMA 4WZ4A 3E98A 3OOVA
chains in the Genus database with same CATH topology
4Q0JA 3EEAA 3S7PA 4R38A 2XA7S 1X0OA 3KSIA 5HSQA 3H82B 2VEAA 3PHYA 2CMNA 5IU1A 2A2LA 4GLQA 4P6ZS 4NXGA 5HL6A 1DP9A 2VZWA 4K08A 1S66L 2EA9A 4ARZA 4IHQA 2L4RA 1LSXA 5DJTA 2PD7A 3KX0X 1OT6A 5L8MA 4NXEA 3VE4A 2PYRA 2W0NA 2QYBA 3C8CA 3KSFA 3KYZA 2Z6CA 2W1RA 3U2AA 2KOIA 1MZUA 3LFVA 4EXOA 2QJ5A 3B47A 2OAQ1 1NLZA 3F1PB 5F69A 4Y3IA 4PKYG 1D06A 4GW9A 4HJ3A 2V9AA 3VE3A 2OWHA 5A8BA 3OLOA 1LSWA 4FOFA 4I38A 3OCNA 3CITA 4UQIS 4DJ2A 4Z1WA 3VOLA 4R3AA 4EETB 4L9GA 2VV6A 1IFQA 1ODVA 4PHTA 1P97A 1F9IA 2O9AA 4HQAA 3FC7A 4KQOA 5AVFA 3VV4A 2Y79A 5HDDA 2D02A 2VKSA 4O8GA 1S1ZA 3LR3A 4HP9A 2MJ6A 3F1NA 2Z6DA 4FSFA 2YKFA 5HZHA 4II7A 3UB8A 3NHQA 1D7EA 2PR6A 2W3GA 3B42A 3TW8A 2B18A 5DKKA 3JVUA 4MMNA 4BBTA 2H28A 5TBMB 4ETXA 4LRXC 3SW1A 4RQ9A 1W63Q 3LR5A 4BMWA 4L0LA 2W3HA 3BQAA 4EEUA 4JGOA 5CX7A 4DJ3A 4MCWA 1N9LA 5C5KA 1LL8A 1N9NA 2V1AA 4JGRA 3TE8A 4F3LB 3B33A 1YSQA 2O9BA 3CLOA 2K7SA 4MN7A 1S1YA 4QPRA 1DRMA 1UGUA 3A0RA 3G6OA 3BWLA 4HJ4A 4MN5A 1T19A 1XJ6A 3HJKA 2QJ7A 3A0SA 3D3OA 2J3TC 1KOUA 4O01A 1F98A 2PDRA 3PBOA 3UB7A 3LIEA 3E4PA 3BQ8A 5LBRA 1YSPA 2O0YA 1XFQA 2W1TB 2NUTC 4WF0A 5HWTA 3E4OA 1VB6A 4H6JA 3A0VA 4MN6A 3LICA 3BY8A 1S4RA 1TS7A 1G6OA 4G3WA 4YNRA 1TF1A 1UWPX 2J80A 3E0YA 3LIBA 4E04A 4WN5A 5HD3A 4WEJA 2PT7A 4Y5FA 3O5YA 2HJEA 5DKLA 4EERA 4GJ4A 2L1MA 3RH8B 3BJNA 2VGLS 1P0ZA 5TJJA 1DP8A 1JNUA 4CLCE 3OBFA 4NXBA 2D01A 4WLAA 3LIDA 1XJ2A 3LUQA 2KX6A 3IS2B 1P9RA 4Y2FA 4PKYA 3V67A 3BY9A 3MQ0A 4HOIA 2VV8A 2ZMVA 2JHEA 2VA0A 4CLCC 3T4JA 2HF6A 2JN7A 5KSHA 1NWZA 4GHIA 4JGQA 2EWWA 3MR0A 4ARZB 3H7WA 1GSVA 1TS0A 4ETZA 1VHMA 3EQUA 3GECA 1MKMA 5K5BA 3NOTC 1V9ZA 2GJ3A 3BW6A 5F5YA 2WKQA 2OWJA 3MMHA 1MC0A 1OTAA 1WA9A 3UMDA 3TJZC 4OOMA 2ZOIA 2YKHA 1OTEA 1YAXA 4LRZE 3H9WA 4UEYA 3ICYA 4WELA 5DFYA 1S67L 2V1BA 3DBAA 4CQHA 2XSSA 1H8MA 2KLIA 1IOUA 3MFXA 2FH5A 5G4YA 3LR0A 3R4KA 5G4ZA 4HH3A 1TS6A 2W3FA 5AVEA 2WKRA 2W27A 2J3TD 1G28A 2VLGA 3OC2A 5EFWA 4AFIA 1GSWA 3F1NB 1W63M 2NUPC 2BASA 2JKRI 2OAP1 2PHYA 3GDIA 3LYXA 1XFNA 4KQDA 1BYWA 1T1BA 4R6LA 2INWA 4I39A 1DP6A 4L9FA 4B9OA 4R70A 3UB9A 4LPZA 1LT0A 3UB6A 2VX8A 3R7WA 3NOUC 3S7NA 1S4SA 2I9VA 1T1AA 2ZMFA 2XA7M 4EESA 3C38A 3RFBA 1T18A 3MQQA 4M4XA 2P7JA 3FG8A 3ULFA 4CLCA 2HJ9C 5J4EA 3S7OA 1F5MA 1OJGA 4P6ZM 4B93A 5J3WA 3MXQA 2V0UA 3W2ZA 1T1CA 2PD8A 3K2NA 3UE3A 3IBJA 3NOPC 1OTDA 3LIAA 3LI8A 1EW0A 5I5LA 4KUKA 4H6JB 2FZ0A 4CLCD 5DFXA 1NLYA 2W3DA 4NKPA 1NRJA 3MF0A 3E4QA 3HCYA 3D72A 2M1CA 4EW7A 3C2WA 1OTBA 3MJQA 4GCZA 3TRCA 4WUJA 5DJUA 2LB5A 4DN0A 2JKRM 2XRNA 4EQ1A 3LIFA 1OT9A 3T4LA 4UQIM 4EEPA 4LRYC 3H82A 2JKTI 5KIZA 3KO6A 5AJGA 1OTIA 4DMZA 2QWSA 3FPWA 5HPFA 5HDCA 2QKPA 4HY8A 2VJWA 2QHKA 5F6AA 1ZHHB 4I3AA 5HDSA 2KDKA 4Q0IA 3C30A 4OOLA 1XJ3A 4WEKA 2W3EA 4HJ6A 4ME4A 4EU0A 2HV1A 2A24A 3PBNA 4GHIB 1P9WA 4KUOA 3KSGA 3H7WB 3F1PA 3PYPA 4WL9A 3T4KA 3PBSA 3MQOA 2HGVA 2A24B 3LI9A 3CWFA 3EGXC 1ZTUA 2ZBBA 1N9OA 4L9EA 4LLOB 1H3QA 3EQVA 4G3VA 3CI6A 4MDZA 2V0WA 3S7QA 4GS9A 3KSHA 2K2NA 2OOLA 3CUEA 3RTYA 2PYPA 2Y8HA 3ZYTA 2M7UA 5FL3A 5DF9A 3IBRA 2JKTM 2M7VA 4GS9B 1XJ4A 3T50A 1V9YA 3PBTA 4YWZA 5HD5A 4G3KA 4Q0HA 3KYQA 1LSVA 2K31A 3UE6A 2P08A 5IS1A 1UWNX 4HNBA 3LR4A 3PBRA 2O9CA 2WKPA 4JGPA 2PR5A 5TBMA 3HJIA 5HWWA 3EWKA 3NJAA 4BBUA 2GX5A 2P04A 4I3IA 5J7EA 2VGLM 4NEED 5HWVA 3T4OA 2ZOHA 4I3JA 4EUVA 4F3LA 3K3DA 5MC7A 3PBQA 4HIAA 4BWIA 1OJ5A 5F68A 3R7WB 3EGDC 3F1OA 3OCLA 3CUEC 1STZA 3T4SA 4IUHA 4IUKA 3K3CA 4CLCB 2W1TA 2B02A 1TD5A 4YOFA 3EOIA 4O0PA 2XROA 1Y28A 4NXFA 1TS8A 2GZAA 3F1OB 2LB9A 3P7NA 4HHDA 2GNXA 3T4QA 4HI4A 4HP4A 1GSXA 2R78A 2DMWA 4XT2A 3T4TA 2IA2A 5HPIA 4BBVA 3PXPA 3PR6A 2VV7A 4HH2A 3CAXA 4PAUA 1OPXA 2EWVA 4BJPA 2G7UA 4I5SA 2J3WA 4XT2B 3P01A 2L0WA 3UMEA 3FPVA 3ZQ5A 1YKDA 2O99A 4IJGA 4ZRRA 3IS2A 3JVVA 3EEHA 5IT5A 3E98A 3OOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q0J A;  5LBR A;  3EEA A;  1YSP A;  2O0Y A;  1ZTU A;  3S7P A;  3KSI A;  2W1T B;  5HSQ A;  2VEA A;  4G3V A;  3CI6 A;  4GLQ A;  4MDZ A;  5HL6 A;  3S7Q A;  2VZW A;  4G3W A;  4R6L A;  4YNR A;  1TF1 A;  3KSH A;  2K2N A;  2OOL A;  3E0Y A;  4E04 A;  2Y8H A;  4Y5F A;  2M7U A;  4R70 A;  3O5Y A;  5L8M A;  3NOU C;  3S7N A;  3IBR A;  2ZMF A;  2M7V A;  3RFB A;  3BJN A;  2QYB A;  3KSF A;  5TJJ A;  4G3K A;  4Q0H A;  2W1R A;  2KOI A;  3S7O A;  1F5M A;  3LFV A;  3OBF A;  2K31 A;  3W2Z A;  4Y3I A;  4GW9 A;  4Y2F A;  2O9C A;  3K2N A;  3IBJ A;  3NOP C;  3MQ0 A;  4FOF A;  2GX5 A;  5I5L A;  3CIT A;  4Z1W A;  5DFX A;  2W3D A;  4EUV A;  3MF0 A;  3HCY A;  2O9A A;  3C2W A;  4BWI A;  4ETZ A;  1VHM A;  3VV4 A;  3TRC A;  2Y79 A;  2LB5 A;  1MKM A;  4DN0 A;  5K5B A;  3NOT C;  2VKS A;  2XRN A;  4O8G A;  1STZ A;  4IUH A;  4IUK A;  4LRY C;  2W1T A;  1TD5 A;  3MMH A;  1MC0 A;  4YOF A;  3KO6 A;  3NHQ A;  5AJG A;  4O0P A;  2XRO A;  2W3G A;  4DMZ A;  2B18 A;  2LB9 A;  4LRZ E;  4MMN A;  5HPF A;  2VJW A;  4ETX A;  4LRX C;  5DFY A;  4RQ9 A;  4CQH A;  3DBA A;  4Q0I A;  2W3H A;  2XSS A;  2IA2 A;  5HPI A;  2KLI A;  2W3E A;  4ME4 A;  4EU0 A;  4MCW A;  5C5K A;  4PAU A;  3R4K A;  1YSQ A;  2O9B A;  2G7U A;  4MN7 A;  4QPR A;  2W3F A;  3KSG A;  3ZQ5 A;  3G6O A;  1YKD A;  2O99 A;  4IJG A;  4ZRR A;  3D3O A;  4O01 A;  2HGV A;  3E98 A;  3OOV A; 
#chains in the Genus database with same CATH topology
 4R38 A;  3PHY A;  5FA7 A;  2A2L A;  4GLQ A;  4EBP A;  4OQI A;  1PIO A;  1SKF A;  3C4O A;  3GVB A;  1SDE A;  4UHU A;  4ARZ A;  2OLU A;  5DJT A;  2PD7 A;  1OT6 A;  2ZQ8 A;  3W8K A;  2QYB A;  3KSF A;  3KYZ A;  3ZVT A;  2W1R A;  2KOI A;  1MZU A;  3LFV A;  3B47 A;  2Y2H A;  3F1P B;  2FFY A;  4Y3I A;  1IYO A;  2OWH A;  3OLO A;  3FKV A;  1LSW A;  3L7H A;  4UQI S;  4DJ2 A;  4Z1W A;  4LEN A;  4MBH A;  4WBG A;  4EET B;  1AWI A;  2VV6 A;  3SH9 A;  3NBL A;  3IF5 A;  4LCM A;  4HQA A;  3FC7 A;  4KQO A;  3LEQ A;  5HDD A;  2D02 A;  4P85 A;  1SZV A;  2YKF A;  5HZH A;  4II7 A;  3NHQ A;  3IHA A;  3JVU A;  4BBT A;  3VOY A;  3SW1 A;  1TVF A;  1W63 Q;  3LR5 A;  3PAG A;  3W4Q A;  4EEU A;  1JTG A;  4DJ3 A;  4MCW A;  4JGR A;  4QY5 A;  1N4O A;  4QPR A;  1DRM A;  1NRF A;  3A0R A;  1XPB A;  3BWL A;  3G6O A;  2EXB A;  1T19 A;  3A0S A;  4UA7 A;  4EUZ A;  5AQB A;  1RGY A;  3MZD A;  3UB7 A;  3LIE A;  1MXO A;  4H8R A;  2J9O A;  3C5A A;  3E4O A;  3A0V A;  1CI9 A;  1W79 A;  5A91 A;  1TS7 A;  5CGX A;  3CG5 A;  2ZQC A;  2J80 A;  4E04 A;  4WEJ A;  3CJM A;  4Y0T A;  3QHY A;  2H0Y A;  2EX8 A;  4EER A;  3PTE A;  1P0Z A;  3VMA A;  4Y7P A;  3G34 A;  4ESP A;  1DP8 A;  4PPR A;  4R3J A;  4CLC E;  3G30 A;  3LID A;  1MWU A;  1P9R A;  4PKY A;  3HLC A;  4HOI A;  1G68 A;  2VV8 A;  4KZA A;  4UA9 A;  1IYP A;  1IKI A;  2JN7 A;  3VSL A;  5KSH A;  2WGV A;  3NC8 A;  3MR0 A;  2OV5 A;  4ARZ B;  1LLB A;  1FOF A;  1GSV A;  1TS0 A;  4ETZ A;  3IXB A;  3S4X A;  1MKM A;  5K5B A;  4UA6 A;  4E6W A;  4WM9 A;  4BLM A;  2Y91 A;  5F5Y A;  3MMH A;  4BD1 A;  1WA9 A;  3WS0 A;  1E3U D;  3UY6 A;  1CEF A;  3UO9 A;  3BM6 A;  5EM0 A;  4LV3 A;  4KZ8 A;  2FH5 A;  3LR0 A;  2QZ6 A;  3VFH A;  3IWQ A;  4HH3 A;  1C3B A;  1FSY A;  4ZJ2 A;  4PM8 A;  5AVE A;  1G28 A;  1PI5 A;  3Q81 A;  4ZJ1 A;  4AFI A;  4U3T A;  4GKU A;  3T1Q B;  1W63 M;  4R4S A;  2BAS A;  2JKR I;  2Y2N A;  2OAP 1;  1CQA A;  3GDI A;  3MXR A;  3HLE A;  2INW A;  4L9F A;  1U60 A;  3MSH A;  3UB9 A;  1LT0 A;  2VX8 A;  3R7W A;  3S7N A;  1S4S A;  1NXY A;  2ZMF A;  1T18 A;  2EXA A;  1XP4 A;  3UB5 P;  3IXH A;  5EPH A;  5J3W A;  5HFO A;  1TDG A;  5CHJ A;  2PD8 A;  2WAE A;  1Y54 A;  1DY6 A;  4S2O A;  3BFF A;  4GOG A;  2ZC4 B;  4OON A;  5I5L A;  2DCF A;  3E2L A;  1M40 A;  3NIA A;  1W8Q A;  1NLY A;  4P87 A;  4E3O A;  2ZQA A;  2W3D A;  5CHM A;  2JC7 A;  3IF6 A;  3MF0 A;  4LCL A;  2EX6 A;  4WYY A;  3ZG7 B;  3D72 A;  4MEZ A;  4IVK A;  3C7V A;  1OTB A;  2Y2I A;  3QP4 A;  3TRC A;  4WUJ A;  2LB5 A;  2HP6 A;  3LIF A;  1OT9 A;  4UQI M;  1YMX A;  1J3W A;  4Z9Q A;  1MBL A;  1SDN A;  1OTI A;  2WUQ A;  2WZX A;  3FPW A;  2OLV A;  2QKP A;  2V2F F;  4HY8 A;  2VJW A;  2R9X A;  4I3A A;  3IXG A;  4PMA A;  2V8C A;  2W3E A;  4ME4 A;  4EU0 A;  4U0T A;  5FAQ A;  4GZB A;  1ESU A;  5HW3 A;  4R23 A;  4WL9 A;  3IF6 C;  1XGJ A;  1XA1 A;  4Q8I A;  3MQO A;  2A24 B;  4KZ3 A;  3G35 A;  3EGX C;  5J8X A;  1PYY A;  3CI6 A;  1CK3 A;  5G18 A;  3O3V A;  4YFM A;  3KSH A;  4QHC A;  3CUE A;  3LEZ A;  4DRT A;  2M7U A;  5FL3 A;  4JF6 A;  2Y55 A;  4PM5 A;  4OLD A;  2M7V A;  4EV4 A;  5HD5 A;  3MZF A;  4Q0H A;  2ZC3 B;  1K6R A;  1UWN X;  2G2W A;  3LR4 A;  5DF7 A;  2WKP A;  2PR5 A;  3ITB A;  5TBM A;  1XX2 A;  5HWW A;  4DE2 A;  3MZE A;  4I3I A;  3WRT A;  4JBF A;  1O07 A;  4NEE D;  3ZHH A;  4I3J A;  3K3D A;  5CEB A;  1PNE A;  5CER A;  1OJ5 A;  3DTM A;  4KQR A;  4S2I A;  5EM1 A;  3R7W B;  3OCL A;  4HES A;  5E2F A;  3CUE C;  5TR7 A;  3UDX A;  5EOO A;  2ZD8 A;  2B02 A;  2FFF B;  5EVI C;  4KG5 A;  3EOI A;  3VFF A;  1TS8 A;  1K55 A;  2GZA A;  4OQG A;  4OPY A;  2GNX A;  4RYE A;  4HI4 A;  2B95 A;  2XD1 A;  1L0E A;  1IEM A;  1N9B A;  1OPX A;  2GDN A;  3IF6 B;  5L10 A;  5F1F A;  1RP5 A;  3N4I A;  2Z2M B;  4KG2 A;  3RJU A;  1EWZ A;  1W8Y A;  1KE0 A;  3IS2 A;  3CHW P;  3EEH A;  1BLP A;  5A90 A;  4OP8 A;  4QB8 A;  4WZ5 C;  1X0O A;  1KGF A;  3A3D A;  3KSI A;  4P6Z S;  5HL6 A;  1GA9 A;  2VZW A;  1MY8 A;  3G4P A;  4MBK A;  2L4R A;  3KX0 X;  5L8M A;  5F82 A;  3E2K A;  2IWB A;  3WRZ A;  3U2A A;  1PZO A;  2QJ5 A;  3BLM A;  1NLZ A;  1HLU P;  4PKY G;  5FSR A;  1D06 A;  1K38 A;  3D4F A;  4KEN B;  4M3K A;  3V5M A;  4I38 A;  3OCN A;  1NY0 A;  4L9G A;  3N7W A;  4R4R A;  1IEL A;  2BG1 A;  2HZ5 A;  1F9I A;  2O9A A;  4GDB A;  3LY4 A;  3T12 B;  3VV4 A;  3JPU A;  1YLT A;  5EVI B;  5CXW A;  4O8G A;  2MJ6 A;  4FSF A;  5EVI D;  3IX3 A;  3IX8 A;  2Y2K A;  2W3G A;  3TW8 A;  5DKK A;  2HDS A;  3ZCZ A;  4DDS A;  4IED A;  4RX2 A;  5TBM B;  4ETX A;  4LRX C;  2B5R A;  4K0X A;  1J9M A;  4BMW A;  1K0K A;  4N1X A;  2ZMA A;  2R9W A;  3TE8 A;  3B33 A;  3Q1F A;  3B3X A;  3NDE A;  3ZG9 B;  4JF5 A;  3UNW A;  2P74 A;  1F98 A;  3DWK A;  3E4P A;  2O0Y A;  1XFQ A;  2NUT C;  4WF0 A;  4KZ5 A;  4FTX A;  4MN6 A;  5KMW A;  1S4R A;  1UWP X;  3LIB A;  1KGE A;  5HAP A;  3UE1 A;  2PT7 A;  4Y5F A;  1W5D A;  4R0Q A;  1HD8 A;  1BLS A;  2VGL S;  5TJJ A;  5EE8 A;  1ZG6 A;  5GHY A;  1MWS A;  3OBF A;  2D01 A;  3BFG A;  1PWG A;  3IS2 B;  4Y2F A;  3A3I A;  4X68 A;  3UPN A;  1WYB A;  4P0M A;  5GHX A;  2ZC7 A;  1IYQ A;  3T4J A;  4RA7 A;  3I7J A;  1NWZ A;  1YLW A;  1M6K A;  1DJA A;  1E3U A;  1K57 C;  1VHM A;  3NOT C;  2ZM8 A;  3T1R A;  1V9Z A;  2GJ3 A;  4GDN A;  3BW6 A;  3GRJ A;  5FDH A;  2OWJ A;  1MC0 A;  1OTA A;  5KSC A;  3O87 A;  1OTE A;  3FWL A;  1YAX A;  3FKW A;  4LFU A;  3SOI A;  4WEL A;  5M1A A;  1S67 L;  2V1B A;  3DBA A;  3GR2 A;  3AGE A;  1GHI A;  1G6A A;  4GN2 A;  2KLI A;  2RCX A;  1NZO A;  3HLG A;  5FI2 A;  5G4Z A;  3WWX A;  1AXB A;  5CTN A;  2W3F A;  1MWR A;  2WKR A;  3CPT A;  1FQG A;  5GL9 A;  3V50 A;  1FCN A;  3GSG A;  2Q9M A;  1GSW A;  4E3I A;  3G31 A;  2NUP C;  5EOE A;  1D1J A;  2PHY A;  3M6B A;  4KQD A;  4E3K A;  1QME A;  1CI8 A;  1I5Q A;  1DJC A;  5AQ9 A;  4B9O A;  3ZG0 A;  1FR6 A;  4LPZ A;  2WYX A;  3UB6 A;  1ACF A;  3C38 A;  4B88 A;  4M4X A;  5J4E A;  3S7O A;  4P6Z M;  3MXQ A;  1ES2 A;  5EV0 A;  3NOP C;  3LIA A;  3LI8 A;  4KUK A;  5E2E A;  5E2H A;  5JYP A;  4NKP A;  5L09 A;  3E4Q A;  3HCY A;  1PWC A;  4EW7 A;  1H0M A;  3MJQ A;  1GHM A;  3QP1 A;  4DN0 A;  2XRN A;  4Y0O A;  3VOZ A;  5DTS A;  4EEP A;  5KIZ A;  5FI6 A;  3QNB A;  1YLP A;  2Y2G A;  1ERQ A;  5F6A A;  1LI0 A;  1MKI A;  3C30 A;  2XR0 A;  5CED A;  1XJ3 A;  4WEK A;  2EFX A;  5GLD A;  2A24 A;  2EFU A;  4OP5 A;  2JCH A;  2IWC A;  4OQH A;  3BYD A;  3CZD A;  2Y2M A;  3PBS A;  3M2K A;  2HGV A;  3UPO A;  1ZTU A;  3N6I A;  1H3Q A;  1Y4O A;  3EQV A;  1PW1 A;  4C3Q A;  4JXS A;  2QMI A;  4MDZ A;  3MFD A;  2CC1 A;  4QU3 A;  2PYP A;  3GQZ A;  1VET B;  2PAV P;  3ZNT A;  1JVJ A;  1V9Y A;  1FIL A;  3KYQ A;  1EI5 A;  2K31 A;  2X02 A;  1H5X A;  3CPT B;  3G2Z A;  3L9K A;  4JKT A;  1BSG A;  5HAI A;  4JXW A;  2E8I A;  3ZG5 A;  2VGL M;  5HWV A;  3S1Y A;  3T1X A;  2ZOH A;  3KYE A;  4HIA A;  4JF4 A;  3WS5 A;  1PW8 A;  5BOH A;  2ZQ9 A;  2E8J A;  2WGW B;  4OVD A;  3BFE A;  3ZGA B;  3LGO A;  3DTI A;  3TOI A;  2Y2L A;  3WS1 A;  1YM1 A;  4S2N C;  4O0P A;  4NXF A;  3F1O B;  3DAV A;  2LB9 A;  4PM6 A;  3A3E A;  5F1G A;  4PM7 A;  5HPI A;  4X55 A;  3PXP A;  3PR6 A;  2VV7 A;  4HH2 A;  3CAX A;  1K4E A;  4PAU A;  1ONH A;  2G7U A;  4BL3 A;  4XT2 B;  3SZT A;  3P01 A;  3QP5 A;  3FPV A;  4ZRR A;  1YT4 A;  5FQI A;  1GCE A;  1HTZ A;  3EEA A;  4MBF A;  3S7P A;  2XA7 S;  3OPP A;  3WS2 A;  2XFS A;  1JWV A;  1KDS A;  4S2M A;  1CF0 A;  3NDG A;  1S66 L;  4IHQ A;  3LY3 A;  1PWD A;  4NXE A;  3VE4 A;  2W0N A;  2ZC5 B;  4LGW A;  1Q2P A;  2Z6C A;  1Z09 A;  3HUM A;  4EXO A;  4Y15 A;  1KE4 A;  3BRM A;  3V3R A;  5F69 A;  4GW9 A;  3UDI A;  4HJ3 A;  3IWO A;  2V9A A;  3VE3 A;  5A8B A;  3TSG A;  4FOF A;  1CJF A;  3D9Y A;  3VOL A;  4R3A A;  3ZVW A;  5EVI A;  1ODV A;  4K91 A;  1P97 A;  4KZ4 A;  1S0W A;  2WGI A;  2XLN A;  5FAP A;  4X53 A;  3IH8 A;  1ES3 A;  4OQ0 A;  5EVL A;  3NCK A;  1S1Z A;  3LR3 A;  3F1N A;  3IT9 A;  3QP6 A;  2Z6D A;  3GMW A;  5F83 A;  4KQQ A;  3UB8 A;  1D7E A;  1TEM A;  2PR6 A;  3B42 A;  4LV2 A;  2B18 A;  4MMN A;  3QP2 A;  2H28 A;  3FV7 A;  4N1H A;  2PRF A;  2W3H A;  4WZ5 A;  1KDW A;  4JGO A;  1N9L A;  4RVA A;  5C5K A;  1MPL A;  1N9N A;  5E2G A;  4BEN A;  3CLO A;  1L0G A;  1S1Y A;  5FAT A;  2A3U A;  3LO7 A;  4HJ4 A;  4MN5 A;  4BQM A;  2QJ7 A;  3IXD A;  1YMS A;  3D3O A;  3VP4 A;  2J3T C;  1KOU A;  4O01 A;  2PDR A;  2C5W B;  3BQ8 A;  3W4O A;  1BUE A;  4N92 A;  5HWT A;  4E3L A;  3HLB A;  2XEP A;  4H6J A;  4R3B A;  2BTF P;  4S2K A;  5FQJ A;  2BLS A;  3E0Y A;  5TFQ A;  3V3S A;  5HD3 A;  1DJB A;  3IX4 A;  1WE4 A;  1YLZ A;  3O5Y A;  5DKL A;  3OPR A;  4GJ4 A;  2L1M A;  5CTM A;  3VP3 A;  3BFD A;  4U0X A;  1JNU A;  4DE3 A;  3Q7V B;  3MKF A;  4WLA A;  2PBD P;  2KX6 A;  1HVB A;  4C75 A;  3V67 A;  5FEG A;  3BY9 A;  3MQ0 A;  4DKI A;  5HAQ A;  4LV1 A;  4WMC D;  2ZMV A;  5EUA A;  2VA0 A;  4CLC C;  2HF6 A;  1I2S A;  1H8Y A;  3GTC A;  2EWW A;  3RXW A;  4KZ9 A;  3H7W A;  1NJ4 A;  3TG9 A;  4F94 A;  3GEC A;  3BEC A;  3M6H A;  1SKO B;  3ZFZ A;  4ZJ3 A;  2HP5 A;  2V8F A;  2WKQ A;  3IQA A;  1BTL A;  4FH4 A;  1KVL A;  3UMD A;  4DXB A;  1KE3 A;  3P98 A;  3HLW A;  4OOM A;  2ZOI A;  2YKH A;  4LRZ E;  4UEY A;  4X69 A;  1GHP A;  2XSS A;  3DW0 A;  1K54 A;  1IOU A;  2EX9 A;  5G4Y A;  5HAR A;  3R4K A;  4UAA A;  1PFL A;  4BL2 A;  2JBF A;  2J3T D;  3HL9 A;  2VLG A;  2C6W B;  2Z2L B;  3F1N B;  4Y17 A;  4OPR A;  2ZL1 A;  4IVI A;  3LYX A;  1XFN A;  1VEU A;  2XFT A;  1T1B A;  4R6L A;  4DXC A;  4FUW A;  4R70 A;  2I9V A;  1T1A A;  2XA7 M;  4KZB A;  1XXM A;  3MQQ A;  3ULF A;  1L0D A;  2HJ9 C;  1K54 C;  1F5M A;  3QP8 A;  5M19 A;  2OSU A;  4B93 A;  1JWZ A;  1OME A;  3W2Z A;  2ZC6 B;  4MNR A;  5JYO A;  1K57 A;  3K2N A;  4QD4 A;  3IBJ A;  1OTD A;  1FSW A;  4QY6 A;  4JXG A;  2G2U A;  4Y0U A;  5TGF A;  1NZU A;  4H6J B;  4CLC D;  2WKI A;  5DVA A;  1SCW A;  4C6Y A;  4X6T A;  1ERM A;  2ZLY A;  4ZBE A;  2ACG A;  4KZ6 A;  5DJU A;  1FCO A;  5I94 A;  1K4F A;  3Q82 A;  4LRY C;  2V20 A;  3H82 A;  3W4P A;  5U47 A;  5AJG A;  3QNC A;  1VQQ A;  2UWX A;  2QWS A;  3G32 A;  4IBX A;  5HPF A;  5HDC A;  4MLL A;  1LHY A;  1ZHH B;  1ERO A;  5HDS A;  4ZAM A;  2KDK A;  1Z6F A;  4IBR A;  5GLA A;  2HV1 A;  1P9W A;  4KUO A;  1YLY A;  3KSG A;  3H7W B;  4EBL A;  3PYP A;  4X25 A;  3ZDJ A;  5EVE A;  5GHZ A;  3LI9 A;  1SHV A;  2ZBB A;  1N9O A;  4LLO B;  5GLC A;  2HDU A;  2PBY A;  3UDF A;  1VET A;  2ZQD A;  3ZNY A;  3S7Q A;  3M2J A;  4OPZ A;  2Y4A A;  4N9L A;  4HEF A;  2K2N A;  5DTT A;  3VP2 A;  3RTY A;  2Y8H A;  3ZYT A;  1BLH A;  5DF9 A;  4EQI A;  4DDY A;  3IBR A;  2JKT M;  3S22 A;  4S2J A;  4GS9 B;  4Y13 A;  1BUL A;  3PBT A;  4YWZ A;  1YLJ A;  2Y2P A;  3BEB A;  3Q7Z A;  1LSV A;  3OPH A;  3UE6 A;  5IS1 A;  5IHV A;  1NYY A;  4HNB A;  5EEC A;  2O9C A;  4JGP A;  4ZDX A;  4B4Z A;  4E3J A;  2ZL1 B;  2WGW A;  2GX5 A;  4FCF A;  2P04 A;  1K6S A;  3T4O A;  1VEU B;  3A3F A;  4F3L A;  1BLC A;  2I72 A;  1E4D A;  2Y59 A;  5MC7 A;  1F2K A;  3MXS A;  4X1M A;  3NEC A;  5F68 A;  1GA0 A;  3EGD C;  3F1O A;  2DRW A;  5FQ9 A;  5A92 A;  4GB7 A;  3N8S A;  3T4S A;  2W1T A;  3MS6 A;  3OPL A;  3LCE A;  4GNU A;  4EWF A;  1HZO A;  2XRO A;  1Y28 A;  3UN7 A;  2V1Z A;  4ID4 A;  5CEC A;  4HHD A;  3N8R A;  3T4Q A;  3DTE A;  2WAD A;  4HP4 A;  1GSX A;  2DMW A;  4XT2 A;  5DTK A;  4YIN A;  3SH8 A;  4FH2 A;  4JLF A;  5KZH A;  2P9V B;  4BJP A;  4I5S A;  2J3W A;  5HX9 A;  1ONG A;  2J9P A;  3BFC A;  3ZQ5 A;  1YKD A;  5M18 A;  5IT5 A;  2HDQ A;  1YPR A;  4Q0J A;  4X1L A;  5CHU A;  5FDS A;  5HSQ A;  3H82 B;  2VEA A;  2CMN A;  5IU1 A;  4NXG A;  1DP9 A;  4K08 A;  5L07 A;  2EA9 A;  1LSX A;  4NET A;  2PYR A;  3O86 A;  3C8C A;  3IH9 A;  1IKG A;  2X71 A;  1E25 A;  2OAQ 1;  4KG6 A;  2JKF A;  4B4X A;  4QJG A;  1Q2Q A;  4S2L A;  3DWZ A;  3SS5 A;  4R1G A;  3CIT A;  4S2N A;  3IWI A;  2H0T A;  1IFQ A;  4PHT A;  5AVF A;  1S6R A;  2Y79 A;  3OZH A;  2VKS A;  3BLS A;  4HP9 A;  4HBU A;  2UV0 E;  4XXR A;  5E43 A;  4CJN A;  2ZM2 A;  3MKE A;  5CGS A;  3HUN A;  2ZQ7 A;  5FAO A;  3HUO A;  1ALQ A;  1RGZ A;  4RQ9 A;  4L0L A;  3VP1 A;  3Q07 A;  3BQA A;  5CX7 A;  1LL8 A;  2V1A A;  4RX3 A;  2J7V A;  4F3L B;  2HPB A;  1YSQ A;  2O9B A;  4EBN A;  2K7S A;  4MN7 A;  5FQK A;  1UGU A;  1XJ6 A;  3HJK A;  1ESI A;  3PBO A;  2IWD A;  1NYM A;  5LBR A;  1YSP A;  5FQQ A;  2W1T B;  3ZG8 B;  1VB6 A;  3LIC A;  3BY8 A;  1G6O A;  4G3W A;  4YNR A;  1TF1 A;  4WN5 A;  3HLF A;  3Q7V A;  3G2Y A;  4KZ7 A;  2HJE A;  3PAE A;  2PU4 A;  2XGN A;  3SH7 A;  2H5S A;  3RH8 B;  4WMC A;  3BJN A;  2WK0 A;  5D3O A;  5DF8 A;  4NXB A;  4QWO A;  1XA7 A;  1ZG4 A;  1XJ2 A;  3LUQ A;  2VGK A;  4S2P A;  1K56 A;  1G5U A;  4NG2 A;  4JPM A;  2A49 A;  2XH9 A;  3N8L A;  1MWT A;  1PZP A;  2XDM A;  3C4P A;  1ES5 A;  1ZC2 A;  2JHE A;  1L0F A;  4P6B A;  5FI7 A;  5FEF A;  3HVF A;  4GHI A;  4JGQ A;  4OOY A;  1SKO A;  3VP0 A;  2WKH A;  1H8Z A;  2ZJ9 A;  2VGJ A;  3EQU A;  2EX2 A;  1O7E A;  2X01 A;  3MBZ A;  2WAF A;  5CRF A;  4K0W A;  3TJZ C;  1BT5 A;  3HLD A;  3H9W A;  3NUL A;  3ICY A;  5DFY A;  4CQH A;  1H8M A;  3MFX A;  1CEG A;  1ES4 A;  1TS6 A;  3ISG A;  1KGG A;  2W27 A;  4GD8 A;  1FCM A;  3OC2 A;  5EFW A;  3VSK A;  4D60 A;  4OLG A;  1BYW A;  1IYS A;  2J8Y A;  3DTK A;  4I39 A;  2AVX A;  1DP6 A;  1JWP A;  3UPP A;  4PM9 A;  1I2W A;  1QMF A;  1BZA A;  3NOU C;  4EES A;  3NI9 A;  3RFB A;  3FZC A;  4FD8 A;  1WYC A;  2P7J A;  3FG8 A;  4OKP A;  4CLC A;  1LL9 A;  5GLB A;  1OJG A;  4XUZ A;  3C7U A;  4BD0 A;  1ZKJ A;  2V0U A;  2DNS A;  1T1C A;  1VM1 A;  2XF3 A;  3UE3 A;  4LV0 A;  2XQZ A;  1EW0 A;  1LI9 A;  5L2F A;  2JE5 A;  2QPN A;  2FZ0 A;  5DFX A;  4DF6 A;  3O88 A;  1NRJ A;  2Y2Q A;  3GV9 A;  3WS4 A;  1A0K A;  2RL3 A;  1FIK A;  3HBR A;  2HDR A;  2M1C A;  4N9K A;  3C2W A;  1L2S A;  4GCZ A;  2Y2O A;  2JKR M;  4EQ1 A;  3T4L A;  2JKT I;  3KO6 A;  3AGD A;  4DMZ A;  1FR1 A;  1KVM A;  3SS3 A;  2QHK A;  3V39 A;  5HL1 A;  2Y2J A;  4Q0I A;  1K56 D;  4OOL A;  4E3M A;  4HJ6 A;  4E3N A;  3CMZ A;  3HRE A;  3PBN A;  5A93 A;  4GHI B;  1K55 C;  5FAS A;  3F1P A;  3T4K A;  3FYZ A;  3SS4 A;  3CWF A;  4L9E A;  4G3V A;  2V0W A;  4GS9 A;  2OOL A;  3NY4 A;  4DE1 A;  4HBT A;  1PRQ A;  4X56 A;  3A3J A;  4CPK A;  1K25 A;  1XJ4 A;  3T50 A;  5AQ7 A;  4G3K A;  2Q0O A;  2VK3 A;  3U4L P;  2P08 A;  1W7F A;  4D2O A;  1XKZ A;  3RXX A;  3P09 A;  3PBR A;  4DE0 A;  3HJI A;  2H10 A;  3EWK A;  3NJA A;  4BBU A;  5J7E A;  3JYI A;  1PI4 A;  4GD6 A;  3T1S A;  4EUV A;  2XK1 A;  1LL5 A;  3PBQ A;  2JKG A;  4BWI A;  1RCJ A;  4JXV A;  3ITA A;  1TDL A;  1STZ A;  2ZM0 A;  4IUH A;  2HP9 A;  2XD5 A;  4IUK A;  3K3C A;  4CLC B;  1TD5 A;  4YOF A;  1YQS A;  1XGI A;  2P9V A;  4OPQ A;  4E6X A;  3P7N A;  2Q9N A;  4XUX A;  5CGW A;  2R78 A;  3T4T A;  4ZTK A;  3UE0 A;  2IA2 A;  4A5R A;  4BBV A;  1L3L A;  2WKE A;  2WZZ A;  4NK3 A;  5AQA A;  2EWV A;  1JTD A;  4OH0 A;  3AGF A;  2PU2 A;  4O7D A;  3UME A;  2L0W A;  3IHB A;  2O99 A;  4IJG A;  3JVV A;  5FQM A;  4WZ4 A;  3E98 A;  3OOV A; 
#chains in the Genus database with same CATH homology
 4Q0J A;  3EEA A;  3S7P A;  4R38 A;  2XA7 S;  1X0O A;  3KSI A;  5HSQ A;  3H82 B;  2VEA A;  3PHY A;  2CMN A;  5IU1 A;  2A2L A;  4GLQ A;  4P6Z S;  4NXG A;  5HL6 A;  1DP9 A;  2VZW A;  4K08 A;  1S66 L;  2EA9 A;  4ARZ A;  4IHQ A;  2L4R A;  1LSX A;  5DJT A;  2PD7 A;  3KX0 X;  1OT6 A;  5L8M A;  4NXE A;  3VE4 A;  2PYR A;  2W0N A;  2QYB A;  3C8C A;  3KSF A;  3KYZ A;  2Z6C A;  2W1R A;  3U2A A;  2KOI A;  1MZU A;  3LFV A;  4EXO A;  2QJ5 A;  3B47 A;  2OAQ 1;  1NLZ A;  3F1P B;  5F69 A;  4Y3I A;  4PKY G;  1D06 A;  4GW9 A;  4HJ3 A;  2V9A A;  3VE3 A;  2OWH A;  5A8B A;  3OLO A;  1LSW A;  4FOF A;  4I38 A;  3OCN A;  3CIT A;  4UQI S;  4DJ2 A;  4Z1W A;  3VOL A;  4R3A A;  4EET B;  4L9G A;  2VV6 A;  1IFQ A;  1ODV A;  4PHT A;  1P97 A;  1F9I A;  2O9A A;  4HQA A;  3FC7 A;  4KQO A;  5AVF A;  3VV4 A;  2Y79 A;  5HDD A;  2D02 A;  2VKS A;  4O8G A;  1S1Z A;  3LR3 A;  4HP9 A;  2MJ6 A;  3F1N A;  2Z6D A;  4FSF A;  2YKF A;  5HZH A;  4II7 A;  3UB8 A;  3NHQ A;  1D7E A;  2PR6 A;  2W3G A;  3B42 A;  3TW8 A;  2B18 A;  5DKK A;  3JVU A;  4MMN A;  4BBT A;  2H28 A;  5TBM B;  4ETX A;  4LRX C;  3SW1 A;  4RQ9 A;  1W63 Q;  3LR5 A;  4BMW A;  4L0L A;  2W3H A;  3BQA A;  4EEU A;  4JGO A;  5CX7 A;  4DJ3 A;  4MCW A;  1N9L A;  5C5K A;  1LL8 A;  1N9N A;  2V1A A;  4JGR A;  3TE8 A;  4F3L B;  3B33 A;  1YSQ A;  2O9B A;  3CLO A;  2K7S A;  4MN7 A;  1S1Y A;  4QPR A;  1DRM A;  1UGU A;  3A0R A;  3G6O A;  3BWL A;  4HJ4 A;  4MN5 A;  1T19 A;  1XJ6 A;  3HJK A;  2QJ7 A;  3A0S A;  3D3O A;  2J3T C;  1KOU A;  4O01 A;  1F98 A;  2PDR A;  3PBO A;  3UB7 A;  3LIE A;  3E4P A;  3BQ8 A;  5LBR A;  1YSP A;  2O0Y A;  1XFQ A;  2W1T B;  2NUT C;  4WF0 A;  5HWT A;  3E4O A;  1VB6 A;  4H6J A;  3A0V A;  4MN6 A;  3LIC A;  3BY8 A;  1S4R A;  1TS7 A;  1G6O A;  4G3W A;  4YNR A;  1TF1 A;  1UWP X;  2J80 A;  3E0Y A;  3LIB A;  4E04 A;  4WN5 A;  5HD3 A;  4WEJ A;  2PT7 A;  4Y5F A;  3O5Y A;  2HJE A;  5DKL A;  4EER A;  4GJ4 A;  2L1M A;  3RH8 B;  3BJN A;  2VGL S;  1P0Z A;  5TJJ A;  1DP8 A;  1JNU A;  4CLC E;  3OBF A;  4NXB A;  2D01 A;  4WLA A;  3LID A;  1XJ2 A;  3LUQ A;  2KX6 A;  3IS2 B;  1P9R A;  4Y2F A;  4PKY A;  3V67 A;  3BY9 A;  3MQ0 A;  4HOI A;  2VV8 A;  2ZMV A;  2JHE A;  2VA0 A;  4CLC C;  3T4J A;  2HF6 A;  2JN7 A;  5KSH A;  1NWZ A;  4GHI A;  4JGQ A;  2EWW A;  3MR0 A;  4ARZ B;  3H7W A;  1GSV A;  1TS0 A;  4ETZ A;  1VHM A;  3EQU A;  3GEC A;  1MKM A;  5K5B A;  3NOT C;  1V9Z A;  2GJ3 A;  3BW6 A;  5F5Y A;  2WKQ A;  2OWJ A;  3MMH A;  1MC0 A;  1OTA A;  1WA9 A;  3UMD A;  3TJZ C;  4OOM A;  2ZOI A;  2YKH A;  1OTE A;  1YAX A;  4LRZ E;  3H9W A;  4UEY A;  3ICY A;  4WEL A;  5DFY A;  1S67 L;  2V1B A;  3DBA A;  4CQH A;  2XSS A;  1H8M A;  2KLI A;  1IOU A;  3MFX A;  2FH5 A;  5G4Y A;  3LR0 A;  3R4K A;  5G4Z A;  4HH3 A;  1TS6 A;  2W3F A;  5AVE A;  2WKR A;  2W27 A;  2J3T D;  1G28 A;  2VLG A;  3OC2 A;  5EFW A;  4AFI A;  1GSW A;  3F1N B;  1W63 M;  2NUP C;  2BAS A;  2JKR I;  2OAP 1;  2PHY A;  3GDI A;  3LYX A;  1XFN A;  4KQD A;  1BYW A;  1T1B A;  4R6L A;  2INW A;  4I39 A;  1DP6 A;  4L9F A;  4B9O A;  4R70 A;  3UB9 A;  4LPZ A;  1LT0 A;  3UB6 A;  2VX8 A;  3R7W A;  3NOU C;  3S7N A;  1S4S A;  2I9V A;  1T1A A;  2ZMF A;  2XA7 M;  4EES A;  3C38 A;  3RFB A;  1T18 A;  3MQQ A;  4M4X A;  2P7J A;  3FG8 A;  3ULF A;  4CLC A;  2HJ9 C;  5J4E A;  3S7O A;  1F5M A;  1OJG A;  4P6Z M;  4B93 A;  5J3W A;  3MXQ A;  2V0U A;  3W2Z A;  1T1C A;  2PD8 A;  3K2N A;  3UE3 A;  3IBJ A;  3NOP C;  1OTD A;  3LIA A;  3LI8 A;  1EW0 A;  5I5L A;  4KUK A;  4H6J B;  2FZ0 A;  4CLC D;  5DFX A;  1NLY A;  2W3D A;  4NKP A;  1NRJ A;  3MF0 A;  3E4Q A;  3HCY A;  3D72 A;  2M1C A;  4EW7 A;  3C2W A;  1OTB A;  3MJQ A;  4GCZ A;  3TRC A;  4WUJ A;  5DJU A;  2LB5 A;  4DN0 A;  2JKR M;  2XRN A;  4EQ1 A;  3LIF A;  1OT9 A;  3T4L A;  4UQI M;  4EEP A;  4LRY C;  3H82 A;  2JKT I;  5KIZ A;  3KO6 A;  5AJG A;  1OTI A;  4DMZ A;  2QWS A;  3FPW A;  5HPF A;  5HDC A;  2QKP A;  4HY8 A;  2VJW A;  2QHK A;  5F6A A;  1ZHH B;  4I3A A;  5HDS A;  2KDK A;  4Q0I A;  3C30 A;  4OOL A;  1XJ3 A;  4WEK A;  2W3E A;  4HJ6 A;  4ME4 A;  4EU0 A;  2HV1 A;  2A24 A;  3PBN A;  4GHI B;  1P9W A;  4KUO A;  3KSG A;  3H7W B;  3F1P A;  3PYP A;  4WL9 A;  3T4K A;  3PBS A;  3MQO A;  2HGV A;  2A24 B;  3LI9 A;  3CWF A;  3EGX C;  1ZTU A;  2ZBB A;  1N9O A;  4L9E A;  4LLO B;  1H3Q A;  3EQV A;  4G3V A;  3CI6 A;  4MDZ A;  2V0W A;  3S7Q A;  4GS9 A;  3KSH A;  2K2N A;  2OOL A;  3CUE A;  3RTY A;  2PYP A;  2Y8H A;  3ZYT A;  2M7U A;  5FL3 A;  5DF9 A;  3IBR A;  2JKT M;  2M7V A;  4GS9 B;  1XJ4 A;  3T50 A;  1V9Y A;  3PBT A;  4YWZ A;  5HD5 A;  4G3K A;  4Q0H A;  3KYQ A;  1LSV A;  2K31 A;  3UE6 A;  2P08 A;  5IS1 A;  1UWN X;  4HNB A;  3LR4 A;  3PBR A;  2O9C A;  2WKP A;  4JGP A;  2PR5 A;  5TBM A;  3HJI A;  5HWW A;  3EWK A;  3NJA A;  4BBU A;  2GX5 A;  2P04 A;  4I3I A;  5J7E A;  2VGL M;  4NEE D;  5HWV A;  3T4O A;  2ZOH A;  4I3J A;  4EUV A;  4F3L A;  3K3D A;  5MC7 A;  3PBQ A;  4HIA A;  4BWI A;  1OJ5 A;  5F68 A;  3R7W B;  3EGD C;  3F1O A;  3OCL A;  3CUE C;  1STZ A;  3T4S A;  4IUH A;  4IUK A;  3K3C A;  4CLC B;  2W1T A;  2B02 A;  1TD5 A;  4YOF A;  3EOI A;  4O0P A;  2XRO A;  1Y28 A;  4NXF A;  1TS8 A;  2GZA A;  3F1O B;  2LB9 A;  3P7N A;  4HHD A;  2GNX A;  3T4Q A;  4HI4 A;  4HP4 A;  1GSX A;  2R78 A;  2DMW A;  4XT2 A;  3T4T A;  2IA2 A;  5HPI A;  4BBV A;  3PXP A;  3PR6 A;  2VV7 A;  4HH2 A;  3CAX A;  4PAU A;  1OPX A;  2EWV A;  4BJP A;  2G7U A;  4I5S A;  2J3W A;  4XT2 B;  3P01 A;  2L0W A;  3UME A;  3FPV A;  3ZQ5 A;  1YKD A;  2O99 A;  4IJG A;  4ZRR A;  3IS2 A;  3JVV A;  3EEH A;  5IT5 A;  3E98 A;  3OOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...