2LB5A

Refined structural basis for the photoconversion of a phytochrome to the activated far-red light-absorbing form
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
172
structure length
172
Chain Sequence
LDQILRATVEEVRAFLGTDRVKVYRFDPEGHGTVVAEARGGERLPSLLGLTFPAGDIPEEARRLFRLAQVRVIVDVEAQSRSISQPESWGLSARVPLGEPLQRPVDPCHVHYLKSMGVASSLVVPLMHHQELWGLLVSHHAEPRPYSQEELQVVQLLADQVSIAIAQAELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Sensor histidine kinase
publication title Structural basis for the photoconversion of a phytochrome to the activated Pfr form.
pubmed doi rcsb
source organism Synechococcus sp. ja-2-3b'a(2-13)
total genus 32
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2011-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2lb5A00
4IUHA 4O0PA 5TJJA 2XSSA 4O8GA 2G7UA 3C2WA 5DFXA 5L8MA 3RFBA 3HCYA 4BWIA 5LBRA 5HPFA 4QPRA 4FOFA 2K31A 1TF1A 3VV4A 1F5MA 3ZQ5A 3LFVA 3E0YA 4GW9A 4PAUA 4Y5FA 1STZA 4MMNA 4CQHA 4G3WA 2GX5A 3S7OA 2KLIA 2Y8HA 3S7QA 3CI6A 2O99A 2LB9A 3NOTC 3KO6A 5K5BA 3MQ0A 5HPIA 2OOLA 3R4KA 2O9AA 2B18A 4E04A 1TD5A 2K2NA 2HGVA 2W1RA 2W3FA 2VEAA 2W3EA 2XROA 4IJGA 3NOPC 3BJNA 3KSFA 3S7PA 3KSGA 4DMZA 2VJWA 4DN0A 2W3DA 4ETXA 2ZMFA 4IUKA 3O5YA 2LB5A 4ZRRA 1MC0A 4O01A 3DBAA 2M7UA 2VKSA 4Q0IA 2KOIA 2M7VA 4EUVA 2O0YA 3TRCA 4R70A 3OBFA 4MDZA 4YNRA 4MCWA 3W2ZA 3G6OA 4Z1WA 3MMHA 3KSIA 1YKDA 2O9CA 5DFYA 4Q0JA 1YSQA 3NHQA 4LRYC 3KSHA 4R6LA 3IBRA 5HSQA 4G3KA 4EU0A 3S7NA 1ZTUA 4RQ9A 5I5LA 2O9BA 3CITA 4Y3IA 5C5KA 2XRNA 3IBJA 2W3GA 1YSPA 2QYBA 3MF0A 3OOVA 4YOFA 4LRZE 3NOUC 4GLQA 4ME4A 4LRXC 4MN7A 4Q0HA 3K2NA 4G3VA 4ETZA 2W1TB 3D3OA 4Y2FA 5HL6A 2Y79A 1MKMA 1VHMA 3E98A 2W1TA 2VZWA 2W3HA 2IA2A 5AJGA 3EEAA
chains in the Genus database with same CATH superfamily
1D1JA 1BUEA 2XSSA 3SS3A 2G7UA 3OCNA 3GDIA 4N92A 2IWDA 3RTYA 1W63Q 1T18A 2JHEA 2VK3A 4NXBA 4MBKA 3ZNYA 1YT4A 1RP5A 1VETA 4F94A 2E8JA 3UB5P 1XKZA 3H82B 2JKTI 3MQ0A 2Y2IA 1SDEA 1BLHA 3O87A 1EW0A 4NG2A 1FQGA 1U60A 3UE6A 4GD6A 4N1HA 3BFDA 4XUXA 1YAXA 5D3OA 4GD8A 3IXHA 5U47A 3GMWA 1YLJA 3FC7A 3AGFA 3HL9A 3LGOA 1M40A 5TGFA 4BD0A 3T1XA 1G68A 2DMWA 2EFUA 3IBRA 1CK3A 4WEKA 3GECA 3T4LA 2O9BA 1MWSA 5CGSA 5CEBA 3WS5A 1SHVA 5C5KA 3FPWA 3MZDA 3VSLA 3LICA 5HL6A 4HJ4A 2OWHA 3HLGA 4R3AA 5FEGA 1KE0A 2Y79A 1ZKJA 3B47A 3KYEA 3WS1A 2XEPA 4EWFA 4C6YA 3A3EA 3WS2A 1XJ4A 2R9XA 5IHVA 2VLGA 4U0TA 3BQAA 4YINA 4WM9A 1TF1A 3DTEA 5FAQA 1S6RA 3AGEA 4KUKA 4JF4A 4CQHA 3ZG0A 2QHKA 2VV8A 1CEGA 1OJ5A 4O7DA 5HPIA 3T4TA 3MQQA 3V67A 3V3RA 1YLZA 4JKTA 4OQIA 1CJFA 3BFCA 3TG9A 4E3NA 2DRWA 4ZBEA 2VEAA 3W4OA 4IJGA 1NZUA 4KG6A 3S7PA 4DMZA 5JYPA 2H5SA 1BZAA 2HJEA 2ZD8A 1HLUP 4RX2A 4JGPA 3TSGA 3T4QA 4NXGA 2W3DA 4OKPA 4FUWA 2VX8A 3O5YA 5A93A 5HFOA 3WRTA 1GSVA 3E2KA 2FH5A 2XFTA 4R70A 1Q2PA 5HWWA 1M6KA 2WGWA 1O07A 3MXQA 1OTDA 4S2NA 1CEFA 1E25A 3QP5A 2H0TA 3FKVA 2WKEA 3UDIA 1Y54A 2P7JA 2J9PA 3F1PA 5F69A 1DY6A 3T1QB 2J3TC 5AQBA 2IWBA 4MN7A 1GCEA 2WKIA 4ETZA 5HAIA 4HH3A 1BSGA 1H8YA 1NJ4A 1ACFA 3IH9A 5EVIB 3QP8A 1W63M 4E6XA 3LIBA 1LL9A 2JBFA 4OQHA 1KVLA 3LIDA 3PBNA 4QPRA 5A90A 1RGYA 1XFNA 1RGZA 1XFQA 2JE5A 3FKWA 3C7VA 4ZDXA 2AVXA 2I72A 3NI9A 3W4PA 3C7UA 4Y0TA 3G30A 3JVUA 3KO6A 3G34A 2Q0OA 1T1BA 4KZ9A 1XJ2A 2W3FA 5FATA 2V8CA 5CTMA 3H82A 1DP8A 4UA9A 1EI5A 2QJ7A 4IEDA 5CHUA 2PYPA 5EE8A 1T1AA 3P09A 3RJUA 2KOIA 3ZG7B 2EX9A 5EVLA 2NUPC 3CPTB 3KSIA 4EV4A 1GHIA 3RH8B 2ZQCA 3ZCZA 5KSCA 4WZ5A 2WGVA 4ARZB 1TVFA 2GJ3A 2JKRI 2V2FF 4P0MA 4PMAA 2HV1A 3WRZA 2OWJA 2Y2KA 5E43A 4XT2B 3D3OA 1IKGA 3MSHA 3IS2B 4FTXA 4B4ZA 1VHMA 3R7WB 4DE3A 3OPLA 1PFLA 1GA9A 1JWVA 3WS0A 2H10A 3KYZA 4KZ3A 4DJ3A 3IWIA 4EUZA 4CPKA 2Z6CA 3HLFA 4MN6A 1LL5A 4ZTKA 5DFXA 3ZFZA 3HCYA 1L0GA 5M19A 1H0MA 4EBLA 1H3QA 1DRMA 3M6BA 5EECA 1ERQA 2Z2LB 2WGIA 3IWOA 1JWPA 1LSVA 2ZC3B 2ZC7A 3S7QA 2QKPA 2HGVA 5MC7A 1MY8A 2Q9MA 2Y2PA 3F1NB 3NOPC 2OLUA 4MBFA 1K54A 2VGJA 5FDSA 3BW6A 4JLFA 4WELA 1MZUA 3U4LP 4LENA 1LLBA 4UAAA 2XD1A 5L07A 2A24A 3RXWA 4EUVA 4LGWA 2INWA 1NYYA 3MZEA 4QHCA 3A0RA 4P6BA 4MEZA 1YKDA 2O9CA 4LFUA 4K0XA 5FQQA 1ESIA 2NUTC 1G6OA 3CG5A 5EPHA 2PBYA 2V1ZA 1NRJA 3VFFA 5M18A 4HESA 2YKFA 3MF0A 4OP8A 4LRZE 2Y91A 1PYYA 3ZHHA 4WL9A 4EEUA 2J80A 3IF6B 3UB6A 2K7SA 3OPRA 5A8BA 5KSHA 4XXRA 4QD4A 1V9YA 2PYRA 2WK0A 4JXWA 3N8RA 1MBLA 1YMSA 2Y2LA 1JWZA 3V39A 5EVIA 4R23A 3O3VA 3SOIA 4R4RA 3ZQ5A 4IBXA 5F82A 3NBLA 4UA6A 5G18A 4E3OA 3HLDA 4JXGA 3Q1FA 3UMEA 3UNWA 1GHMA 1OJGA 2CC1A 4Y13A 5HWTA 4FH2A 1J9MA 1MXOA 4DXCA 3NC8A 3H7WA 4KZ7A 3BFGA 5E2EA 3UDFA 1JTGA 4E3IA 3KSGA 2R9WA 4AFIA 5AVFA 4KUOA 3QP6A 4CLCA 5GHZA 5KMWA 4K08A 3DBAA 1QMFA 3O88A 3CHWP 3HREA 3UMDA 4BBUA 4HQAA 3M6HA 3G6OA 2Y2QA 4Y17A 4EESA 1S0WA 5EVID 3QP2A 4R0QA 4XUZA 3HLBA 3PHYA 4G3KA 3CPTA 2OSUA 2WZZA 4WEJA 3HBRA 5FQ9A 4GCZA 4Q0HA 5IU1A 2ZQAA 3QNBA 4GNUA 5DTKA 4ARZA 4EW7A 2EA9A 3SH9A 1MKMA 2L0WA 4MN5A 1I5QA 2HDQA 2HP5A 4XT2A 3VP4A 3UE3A 3NCKA 3Q81A 3EEAA 3TE8A 3JVVA 3MFXA 3BYDA 3GTCA 4HNBA 3R7WA 5A92A 3VP0A 5LBRA 4CLCD 1PW1A 4I3AA 3E0YA 5FI7A 2XQZA 3LY4A 4R38A 1CF0A 2Y8HA 4CLCE 2LB9A 1FSYA 3NOTC 4GS9B 1AWIA 4GB7A 4OONA 1XX2A 4KG2A 3IHBA 3LUQA 4HP9A 3ZDJA 3P01A 5IS1A 3DWZA 3UE1A 5HW3A 5FI6A 4DN0A 2PU2A 1I2WA 3JYIA 1BLPA 3F1NA 3S1YA 1F2KA 2WZXA 1GA0A 4DJ2A 1IYSA 3C38A 3BRMA 3UB9A 4MLLA 3FG8A 1MWUA 2M7UA 4Q0IA 3W4QA 4Z9QA 1NYMA 1XP4A 3C4PA 3NDGA 2Y2HA 2C5WB 3ICYA 5HL1A 1LHYA 3BLMA 4OPZA 4HJ3A 1QMEA 3E4QA 1NLYA 3NHQA 5HARA 1YMXA 1DJBA 5M1AA 2XH9A 5HDSA 1K55A 4S2NC 5GHYA 5HD3A 3CITA 3OZHA 4X69A 1FCOA 4B93A 4DKIA 3K2NA 3BECA 1XJ3A 4HHDA 4GKUA 4QB8A 5CRFA 5G4YA 4MBHA 1YLPA 2DNSA 3IF6A 4EETB 2QPNA 1FIKA 1L0FA 2ZMVA 3N6IA 5HPFA 3T12B 2K31A 5JYOA 4GOGA 2A3UA 3ISGA 2BLSA 4PM5A 5F1FA 1STZA 3ZG8B 2FFYA 4IBRA 5CEDA 4IHQA 3A0SA 4D2OA 4DXBA 4EBPA 3Q07A 5FASA 1L0EA 1PWGA 2B18A 3FZCA 1HD8A 3SH7A 4WBGA 3LY3A 4YFMA 3FPVA 3QNCA 5J4EA 1UWPX 3BJNA 2VJWA 4L9EA 1OTAA 2ACGA 5AQ7A 4ETXA 3Q82A 1WYCA 5E2FA 4HBUA 2M7VA 5TFQA 4Z1WA 3MMHA 3MKFA 3BEBA 2J8YA 2GNXA 2A24B 4RYEA 1Y28A 1H5XA 3P7NA 1HVBA 2XA7S 4D60A 4LV0A 3PYPA 1TS0A 2JKGA 3S7NA 3JPUA 1S1ZA 4BENA 2HDRA 4I3IA 5GLCA 4X1MA 3NOUC 4PM6A 2EWVA 4UQIM 4WZ5C 1XJ6A 1VQQA 3W8KA 1BYWA 1SDNA 3MBZA 2PD7A 4X25A 4X68A 3E2LA 4LCLA 1XGJA 4OPQA 3OCLA 1V9ZA 2PBDP 1K6RA 2W3HA 4RX3A 5CTNA 3LEZA 3TW8A 1SZVA 3S22A 2EWWA 1K4EA 3CUEA 4KENB 2A49A 2KX6A 3HLWA 5HZHA 1GHPA 2PDRA 3LFVA 4MNRA 3VE3A 4Y5FA 3T4JA 4MMNA 3ZGAB 1TS8A 3B33A 4PKYG 1W7FA 2JKFA 2R78A 4RA7A 3VOLA 1S1YA 3BM6A 3LCEA 4P85A 4L9FA 4GS9A 1OMEA 3D4FA 2ZQ9A 4X53A 4I39A 3QP4A 2WKRA 3GR2A 5L2FA 3H7WB 1BLSA 1G5UA 3BLSA 5F5YA 4DDSA 1KE4A 2VKSA 4QY5A 2UWXA 5DKLA 5L10A 4BMWA 4GDNA 4OP5A 4OOYA 3RXXA 1LT0A 4CLCB 4BD1A 2XGNA 3N8SA 1L3LA 3M2KA 2HZ5A 4OVDA 4Y3IA 3IH8A 1MPLA 5E2GA 2Y2NA 4FD8A 1SKFA 3FYZA 1MWTA 2Y4AA 4FSFA 4P6ZM 2WYXA 3ITBA 2PAVP 3SZTA 4BBTA 1AXBA 4KZBA 2UV0E 1W79A 5AJGA 3NECA 1H8MA 5TJJA 1ES4A 4EERA 4L0LA 3LI9A 5L8MA 3A3IA 3A3FA 2VGLM 2ZBBA 4FOFA 3L9KA 3C8CA 5EVIC 1GSWA 2EX6A 5GLDA 2V0UA 2ZC4B 2BASA 1YLTA 5DF8A 3Q7ZA 4R3JA 3ZG9B 5EUAA 3SS4A 3S4XA 1LSWA 1XPBA 5K5BA 5TR7A 2O9AA 3OC2A 4ZJ2A 5BOHA 4OPYA 3PBRA 1YM1A 3GV9A 3PBOA 2FZ0A 3UPNA 5HAQA 4N1XA 5A91A 1C3BA 3E4OA 3MFDA 2ZMFA 4C3QA 2PR6A 3EOIA 1ERMA 2GZAA 2L4RA 3K3CA 1IYOA 2WKQA 3FV7A 5EOOA 2V0WA 4DE0A 5EM0A 1BT5A 3LR3A 1FR6A 1KDSA 4EU0A 4KQOA 4B4XA 1ZTUA 4S2LA 2E8IA 5DF7A 3OOVA 1PWCA 3IHAA 2H0YA 5HAPA 4FH4A 2J9OA 2W0NA 3EGDC 3PBSA 1A0KA 3ZYTA 3UDXA 1HZOA 1NY0A 3HLCA 5GL9A 2ZMAA 2V9AA 3BFFA 4UEYA 1RCJA 5EV0A 1LL8A 3DTKA 4O8GA 4NK3A 2Y2GA 3L7HA 1OPXA 3VV4A 1FSWA 1K56A 3LR4A 5F1GA 4BQMA 2IWCA 4PKYA 3A0VA 4LLOB 3CI6A 4KZ4A 1OTBA 3PR6A 4S2PA 1ZHHB 3NIAA 5J7EA 5CX7A 1K25A 2M1CA 4HEFA 4CJNA 1D06A 1OTEA 2V20A 3E4PA 1P9WA 1UWNX 2V8FA 2OLVA 3PAEA 5CHMA 2ZLYA 1PWDA 2Y59A 5HDCA 5G4ZA 3B42A 1ZG4A 2LB5A 5E2HA 4BJPA 1Z09A 4A5RA 1KGGA 1E3UA 2O0YA 3G32A 4GZBA 5EVEA 3HJKA 4OLDA 4ESPA 1ZC2A 3IF5A 3ZNTA 1K56D 5DVAA 5I5LA 1K38A 1K57A 5L09A 2X71A 3OLOA 1NXYA 2D01A 4YOFA 1NLZA 1FOFA 2L1MA 2OAP1 5AQ9A 4JXVA 1D7EA 2H28A 3T1RA 4BBVA 3BY8A 2Y2OA 4Y7PA 4HBTA 3C2WA 4KG5A 2HP9A 3IF6C 3HUOA 4NEED 5CGXA 2JKTM 2XR0A 1E3UD 4PAUA 3VE4A 1W5DA 4G3WA 3ZVWA 3S7OA 2VA0A 4DDYA 1VEUB 2B02A 1P9RA 4NXEA 3VOZA 2WAEA 3QHYA 2W1RA 1XA7A 1KVMA 3WWXA 1NZOA 2P9VB 5FAOA 3KSFA 4GN2A 4HJ6A 1KGFA 4I5SA 4WN5A 4M4XA 1TS6A 5HWVA 3C4OA 2JC7A 2WKPA 1E4DA 3LIFA 5FQKA 1MC0A 2ZQDA 2XK1A 2KDKA 3N7WA 4EQ1A 1K4FA 1N4OA 3BQ8A 1L0DA 5FL3A 3AGDA 3F1OB 3CJMA 2DCFA 1ODVA 1IELA 2G2WA 4R6LA 4PM7A 4JPMA 1Q2QA 2P08A 2Z6DA 4QWOA 4U0XA 4QY6A 1Y4OA 3UY6A 4LV2A 4KQQA 4R4SA 3A3JA 4X55A 5FSRA 4S2OA 2W1TB 3UB7A 5KZHA 2OAQ1 2J3WA 1SCWA 3UB8A 2ZM8A 3MZFA 1YPRA 1FILA 4JBFA 3VP1A 2EX2A 3LIAA 3KYQA 3D72A 1LI9A 4PHTA 5HD5A 3DTMA 4N9KA 4S2MA 1XGIA 3PBTA 4WMCA 1H8ZA 3CUEC 4EEPA 4Q8IA 1XXMA 1O7EA 3MQOA 5TBMB 3MJQA 2VV6A 3A3DA 2O99A 3IXGA 1I2SA 5FDHA 3UE0A 4WLAA 2HP6A 3TJZC 2ZQ7A 5DTTA 3SW1A 2ZOIA 3NULA 2ZC5B 4I38A 2XD5A 2XLNA 4JF6A 2Y55A 1UGUA 4YWZA 3CMZA 1G28A 1ONGA 1L2SA 1FR1A 3NDEA 1NWZA 3T50A 1YLYA 3IXDA 1W8QA 4EBNA 1IKIA 2GDNA 3CZDA 3VMAA 1TS7A 5HX9A 3MXSA 2V1AA 3CWFA 4HY8A 4LRYC 3HUNA 3BY9A 4R1GA 1NRFA 4WMCD 4KQRA 2MJ6A 1KDWA 2HDSA 1S4SA 2PT7A 1YSPA 4HP4A 1MKIA 3LO7A 1N9OA 1S67L 5EM1A 2ZL1B 4OPRA 1KOUA 4DE1A 2QWSA 1PNEA 1PI5A 3KX0X 5FEFA 4KZAA 3GVBA 4O0PA 5EOEA 4E6WA 2YKHA 3RFBA 4N9LA 1ZG6A 4P87A 4L9GA 2RCXA 1FCMA 3FWLA 3D9YA 5KIZA 3B3XA 3BWLA 2G2UA 5DKKA 2CMNA 5FAPA 4C75A 2OOLA 4I3JA 4E3KA 5J3WA 1ES5A 1VEUA 4PM8A 4BL2A 4DRTA 4KZ5A 4OOMA 1IFQA 4JGQA 3HJIA 1SKOA 2P9VA 4JGOA 4JXSA 5I94A 4HI4A 4B9OA 3K3DA 3TRCA 1CI9A 3IX8A 4MCWA 3EEHA 2JKRM 3IT9A 3NJAA 4Q0JA 1DP6A 4OQGA 3KSHA 1W8YA 5CECA 3DW0A 5CGWA 2PU4A 4ID4A 1IOUA 5HSQA 1WE4A 2ZOHA 1K54C 1OT6A 2HDUA 3F1OA 2QMIA 1GSXA 1P0ZA 5EFWA 4HOIA 1TDLA 3DWKA 2W3GA 5FA7A 1WYBA 4LRXC 3MXRA 4G3VA 1K0KA 5FQMA 5DTSA 2WADA 1DJCA 4WF0A 4RVAA 1ES2A 1G6AA 3HUMA 4ZAMA 5GHXA 3EGXC 3O86A 2W1TA 4NKPA 3H9WA 2FFFB 1FCNA 1T19A 5CHJA 1N9LA 3MR0A 4IVIA 2BTFP 3OPPA 3WS4A 3PXPA 1YLWA 4WYYA 1HTZA 3IWQA 3BFEA 3LIEA 2KLIA 2PD8A 4E3JA 2B5RA 1K6SA 3R4KA 4HH2A 4R3BA 3EWKA 1S4RA 4GHIB 2K2NA 4KQDA 2WAFA 3HVFA 5TBMA 1IYQA 1PZOA 1N9BA 2W3EA 3UN7A 3Q7VB 2PHYA 4QJGA 3IXBA 2EXBA 4WUJA 4OLGA 4WZ4A 4NETA 2HF6A 4O01A 4H6JB 2P74A 3PTEA 3OBFA 4BLMA 3OPHA 4OOLA 1EROA 3LI8A 2ZM0A 4H8RA 5DFYA 3IX3A 2VGKA 3PBQA 4X6TA 4F3LB 2X01A 3M2JA 4K0WA 4Y15A 5J8XA 1VM1A 2Y2MA 4LV3A 1YQSA 3DTIA 3MS6A 2X02A 4DE2A 1DP9A 3G4PA 3V50A 2A2LA 3IBJA 1JTDA 4CLCC 1X0OA 4GLQA 3VFHA 2V1BA 2EFXA 1K57C 2W27A 4X56A 3LYXA 4Y0UA 5DJUA 3ITAA 4II7A 4UQIS 3G31A 1T1CA 3UO9A 2ZL1A 1PW8A 1CQAA 3NY4A 4IUHA 3T4SA 4FCFA 4UA7A 3LEQA 1VB6A 3GSGA 1BTLA 3QP1A 4BWIA 1KE3A 3VSKA 2JN7A 1F5MA 1VETB 5F68A 4LCMA 4LPZA 4GW9A 1OT9A 2GX5A 2XDMA 1DJAA 1J3WA 4OQ0A 5F6AA 4QU3A 3PAGA 4S2KA 5CERA 3UPOA 1TD5A 5FI2A 2Q9NA 3DAVA 4EQIA 2J3TD 3ZVTA 3SS5A 3GQZA 2VV7A 2ZM2A 3V3SA 2XFSA 1MWRA 1IYPA 5AVEA 3EQUA 3UPPA 2P04A 1Z6FA 4X1LA 4KZ6A 3N8LA 4KZ8A 2Z2MB 3IX4A 4IVKA 4JGRA 4IUKA 3HLEA 4ZRRA 1ESUA 3G2YA 2I9VA 3ULFA 1F9IA 1XA1A 4YNRA 1BLCA 4OH0A 5FQJA 4JF5A 3T4KA 3TOIA 1TDGA 3EQVA 3T1SA 1ALQA 2ZJ9A 3N4IA 3CAXA 3V5MA 1ES3A 2XRNA 4E3MA 2QYBA 1IEMA 2B95A 4ME4A 1BULA 5DF9A 2D02A 4Y2FA 3C5AA 4PPRA 2HPBA 3ZG5A 4M3KA 1JVJA 5FQIA 3G35A 2PR5A 4PM9A 4P6ZS 3GRJA 3P98A 1K55C 5GLBA 2ZQ8A 4B88A 1F98A 5HDDA 3VOYA 2HJ9C 1KGEA 3LR0A 2VGLS 4BL3A 3LR5A 3T4OA 2Y2JA 1ONHA 2WKHA 4E04A 3SH8A 5DJTA 2PRFA 3U2AA 3VP2A 2ZC6B 1EWZA 4ZJ1A 2XROA 4DF6A 1LSXA 2OV5A 5AQAA 4GHIA 3IQAA 4GJ4A 4K91A 1PI4A 4LV1A 1PRQA 4S2JA 1OTIA 2WGWB 5F83A 1TEMA 3Q7VA 4GDBA 1WA9A 1N9NA 2XA7M 4MDZA 3I7JA 2XF3A 3W2ZA 3C30A 4S2IA 4HIAA 4UHUA 1SKOB 2EX8A 1YSQA 4U3TA 4H6JA 2C6WB 3F1PB 4EXOA 1PIOA 4ZJ3A 2RL3A 3IS2A 4RQ9A 5IT5A 2QJ5A 4F3LA 1CI8A 1P97A 3G2ZA 1LI0A 4NXFA 2JCHA 1JNUA 2WUQA 2J7VA 4E3LA 5CXWA 1S66L 2EXAA 2BG1A 5GLAA 3MKEA 3E98A 2QZ6A 3CLOA 1PZPA 2VZWA 3VP3A 2IA2A 4Y0OA
chains in the Genus database with same CATH topology
1H8MA 4O0PA 5TJJA 2YKHA 4EERA 2XSSA 4L0LA 3LI9A 2G7UA 5L8MA 3RFBA 3OCNA 3GDIA 2VGLM 2ZBBA 4FOFA 3C8CA 1GSWA 3RTYA 3ZQ5A 2V0UA 1W63Q 1T18A 2BASA 4L9GA 2JHEA 4NXBA 3UMEA 5KIZA 1OJGA 3BWLA 1LSWA 5K5BA 5DKKA 5HWTA 3H82B 2CMNA 2JKTI 3MQ0A 2OOLA 2O9AA 4I3JA 5J3WA 3OC2A 3H7WA 1EW0A 3PBRA 3UE6A 3PBOA 2FZ0A 3KSGA 4AFIA 5AVFA 4OOMA 1IFQA 1YAXA 4KUOA 4JGQA 4CLCA 3E4OA 3HJIA 2ZMFA 4K08A 4JGOA 3DBAA 2PR6A 4HI4A 3FC7A 3EOIA 4B9OA 2GZAA 3K3DA 3TRCA 2L4RA 3K3CA 4MCWA 3UMDA 4BBUA 4HQAA 3EEHA 3G6OA 4EESA 2WKQA 2JKRM 3NJAA 2V0WA 4Q0JA 1DP6A 3KSHA 2DMWA 3PHYA 3IBRA 1IOUA 5HSQA 4G3KA 3LR3A 2ZOHA 4WEKA 1OT6A 4KQOA 4EU0A 3GECA 3F1OA 1ZTUA 3T4LA 1P0ZA 1GSXA 2O9BA 5EFWA 4HOIA 4WEJA 5C5KA 3FPWA 2W3GA 3OOVA 4LRXC 4GCZA 4Q0HA 5IU1A 4G3VA 3LICA 5HL6A 4HJ4A 4ARZA 4EW7A 2EA9A 2OWHA 4R3AA 2Y79A 4WF0A 1MKMA 3B47A 2L0WA 4MN5A 2W0NA 3EGXC 3EGDC 3PBSA 3ZYTA 4XT2A 2W1TA 3UE3A 1XJ4A 2V9AA 4NKPA 3EEAA 4UEYA 3H9WA 3TE8A 3JVVA 3MFXA 1LL8A 4HNBA 3R7WA 4O8GA 2VLGA 3BQAA 1T19A 5LBRA 1OPXA 4CLCD 1N9LA 3VV4A 1TF1A 3MR0A 3LR4A 4I3AA 3PXPA 4KUKA 3E0YA 4PKYA 4CQHA 2QHKA 2VV8A 3LIEA 4R38A 2KLIA 3A0VA 2Y8HA 1OJ5A 4LLOB 2PD8A 3CI6A 1OTBA 4CLCE 2LB9A 3NOTC 3PR6A 4GS9B 1ZHHB 5HPIA 3T4TA 5J7EA 3MQQA 5CX7A 4HH2A 3R4KA 2M1CA 3V67A 3EWKA 1S4RA 4GHIB 1D06A 1OTEA 2K2NA 4KQDA 3E4PA 1P9WA 5TBMA 1UWNX 2VEAA 2W3EA 4IJGA 3LUQA 4HP9A 3P01A 5IS1A 3S7PA 4DMZA 4DN0A 2HJEA 2PHYA 4WUJA 4JGPA 5HDCA 3T4QA 5G4ZA 3F1NA 4NXGA 2W3DA 4DJ2A 2VX8A 3B42A 3O5YA 2LB5A 4BJPA 3C38A 2HF6A 3UB9A 4O01A 1GSVA 3FG8A 2M7UA 4Q0IA 4H6JB 2FH5A 2O0YA 4R70A 3OBFA 5HWWA 3ICYA 4OOLA 3LI8A 4HJ3A 3MXQA 3E4QA 1NLYA 5DFYA 1OTDA 3NHQA 3PBQA 4F3LB 3HJKA 5HDSA 5I5LA 2P7JA 5HD3A 3CITA 1DP9A 3OLOA 2A2LA 2D01A 3IBJA 1NLZA 3F1PA 4YOFA 5F69A 4B93A 4CLCC 1X0OA 2J3TC 2L1MA 4GLQA 2V1BA 4MN7A 2W27A 2OAP1 3K2NA 4ETZA 1XJ3A 3LYXA 4HH3A 4HHDA 1D7EA 5DJUA 2H28A 5G4YA 4BBVA 4II7A 4UQIS 1T1CA 3BY8A 1W63M 3LIBA 4IUHA 3T4SA 1VB6A 3C2WA 4EETB 4BWIA 3LIDA 2ZMVA 3PBNA 5HPFA 4NEED 4QPRA 2K31A 2JN7A 1F5MA 1XFNA 2JKTM 1XFQA 5F68A 4LPZA 4GW9A 4PAUA 3VE4A 1STZA 1OT9A 4G3WA 2GX5A 3S7OA 2VA0A 2B02A 1P9RA 4IHQA 3A0SA 3JVUA 3KO6A 4NXEA 5F6AA 1T1BA 2B18A 1TD5A 1XJ2A 2W1RA 2W3FA 3FPVA 2J3TD 5J4EA 1UWPX 2VV7A 3H82A 3BJNA 3KSFA 1DP8A 4HJ6A 2VJWA 5AVEA 4L9EA 3EQUA 2QJ7A 2P04A 4WN5A 4I5SA 4M4XA 1OTAA 1TS6A 5HWVA 2PYPA 4ETXA 1T1AA 2WKPA 4JGRA 4IUKA 3LIFA 4ZRRA 1MC0A 2KDKA 2I9VA 2KOIA 2M7VA 4EQ1A 3ULFA 1F9IA 3BQ8A 5FL3A 4YNRA 2NUPC 4Z1WA 3F1OB 3MMHA 3KSIA 1ODVA 2GNXA 2A24B 3T4KA 1Y28A 4R6LA 3P7NA 2P08A 2Z6DA 2XA7S 3EQVA 3RH8B 3PYPA 1TS0A 3S7NA 1S1ZA 4ARZB 3CAXA 4I3IA 2XRNA 2GJ3A 2JKRI 2QYBA 2HV1A 3NOUC 2OWJA 4ME4A 2EWVA 4UQIM 5DF9A 1XJ6A 4XT2B 2D02A 2W1TB 3D3OA 4Y2FA 3UB7A 1BYWA 3IS2B 2OAQ1 2J3WA 2PD7A 3UB8A 1VHMA 3R7WB 3OCLA 2PR5A 1V9ZA 4P6ZS 3LIAA 2W3HA 3KYQA 3KYZA 4DJ3A 3TW8A 2Z6CA 4MN6A 2EWWA 3D72A 5DFXA 3HCYA 4PHTA 5HD5A 3CUEA 1F98A 2KX6A 5HDDA 3PBTA 1H3QA 1DRMA 5HZHA 2HJ9C 3LR0A 2PDRA 3CUEC 3LFVA 3VE3A 4EEPA 4Y5FA 1LSVA 3T4JA 4MMNA 2VGLS 1TS8A 3LR5A 3MQOA 3B33A 4PKYG 3S7QA 5TBMB 3T4OA 3MJQA 2QKPA 2VV6A 2O99A 2R78A 4WLAA 4E04A 3TJZC 3VOLA 1S1YA 2HGVA 5MC7A 5DJTA 3SW1A 3U2AA 4L9FA 3F1NB 2ZOIA 2XROA 3NOPC 4GS9A 1LSXA 4I38A 4GHIA 3BW6A 4GJ4A 4I39A 4WELA 1MZUA 1UGUA 4YWZA 2WKRA 3H7WB 1G28A 5F5YA 2A24A 1OTIA 1NWZA 2VKSA 1WA9A 3T50A 4EUVA 5DKLA 2INWA 1N9NA 4BMWA 2XA7M 4MDZA 3A0RA 1TS7A 3W2ZA 1LT0A 3C30A 4CLCB 4HIAA 1YKDA 2O9CA 2V1AA 3CWFA 1YSQA 4HY8A 4LRYC 4H6JA 3BY9A 3F1PB 4EXOA 2NUTC 1G6OA 3IS2A 4RQ9A 2MJ6A 5IT5A 4Y3IA 1NRJA 2QJ5A 4F3LA 1S4SA 2YKFA 2PT7A 1P97A 1YSPA 3MF0A 4LRZE 4HP4A 4NXFA 1JNUA 4WL9A 1N9OA 4FSFA 4EEUA 4P6ZM 1S67L 1S66L 2J80A 4BBTA 3UB6A 2K7SA 1KOUA 5A8BA 5KSHA 1V9YA 2PYRA 3CLOA 2QWSA 3E98A 3KX0X 2VZWA 2IA2A 5AJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUH A;  4O0P A;  5TJJ A;  2XSS A;  4O8G A;  2G7U A;  3C2W A;  5DFX A;  5L8M A;  3RFB A;  3HCY A;  4BWI A;  5LBR A;  5HPF A;  4QPR A;  4FOF A;  2K31 A;  1TF1 A;  3VV4 A;  1F5M A;  3ZQ5 A;  3LFV A;  3E0Y A;  4GW9 A;  4PAU A;  4Y5F A;  1STZ A;  4MMN A;  4CQH A;  4G3W A;  2GX5 A;  3S7O A;  2KLI A;  2Y8H A;  3S7Q A;  3CI6 A;  2O99 A;  2LB9 A;  3NOT C;  3KO6 A;  5K5B A;  3MQ0 A;  5HPI A;  2OOL A;  3R4K A;  2O9A A;  2B18 A;  4E04 A;  1TD5 A;  2K2N A;  2HGV A;  2W1R A;  2W3F A;  2VEA A;  2W3E A;  2XRO A;  4IJG A;  3NOP C;  3BJN A;  3KSF A;  3S7P A;  3KSG A;  4DMZ A;  2VJW A;  4DN0 A;  2W3D A;  4ETX A;  2ZMF A;  4IUK A;  3O5Y A;  2LB5 A;  4ZRR A;  1MC0 A;  4O01 A;  3DBA A;  2M7U A;  2VKS A;  4Q0I A;  2KOI A;  2M7V A;  4EUV A;  2O0Y A;  3TRC A;  4R70 A;  3OBF A;  4MDZ A;  4YNR A;  4MCW A;  3W2Z A;  3G6O A;  4Z1W A;  3MMH A;  3KSI A;  1YKD A;  2O9C A;  5DFY A;  4Q0J A;  1YSQ A;  3NHQ A;  4LRY C;  3KSH A;  4R6L A;  3IBR A;  5HSQ A;  4G3K A;  4EU0 A;  3S7N A;  1ZTU A;  4RQ9 A;  5I5L A;  2O9B A;  3CIT A;  4Y3I A;  5C5K A;  2XRN A;  3IBJ A;  2W3G A;  1YSP A;  2QYB A;  3MF0 A;  3OOV A;  4YOF A;  4LRZ E;  3NOU C;  4GLQ A;  4ME4 A;  4LRX C;  4MN7 A;  4Q0H A;  3K2N A;  4G3V A;  4ETZ A;  2W1T B;  3D3O A;  4Y2F A;  5HL6 A;  2Y79 A;  1MKM A;  1VHM A;  3E98 A;  2W1T A;  2VZW A;  2W3H A;  2IA2 A;  5AJG A;  3EEA A; 
#chains in the Genus database with same CATH topology
 1D1J A;  1BUE A;  2XSS A;  3SS3 A;  2G7U A;  3OCN A;  3GDI A;  4N92 A;  2IWD A;  3RTY A;  1W63 Q;  1T18 A;  2JHE A;  2VK3 A;  4NXB A;  4MBK A;  3ZNY A;  1YT4 A;  1RP5 A;  1VET A;  4F94 A;  2E8J A;  3UB5 P;  1XKZ A;  3H82 B;  2JKT I;  3MQ0 A;  2Y2I A;  1SDE A;  1BLH A;  3O87 A;  1EW0 A;  4NG2 A;  1FQG A;  1U60 A;  3UE6 A;  4GD6 A;  4N1H A;  3BFD A;  4XUX A;  1YAX A;  5D3O A;  4GD8 A;  3IXH A;  5U47 A;  3GMW A;  1YLJ A;  3FC7 A;  3AGF A;  3HL9 A;  3LGO A;  1M40 A;  5TGF A;  4BD0 A;  3T1X A;  1G68 A;  2DMW A;  2EFU A;  3IBR A;  1CK3 A;  4WEK A;  3GEC A;  3T4L A;  2O9B A;  1MWS A;  5CGS A;  5CEB A;  3WS5 A;  1SHV A;  5C5K A;  3FPW A;  3MZD A;  3VSL A;  3LIC A;  5HL6 A;  4HJ4 A;  2OWH A;  3HLG A;  4R3A A;  5FEG A;  1KE0 A;  2Y79 A;  1ZKJ A;  3B47 A;  3KYE A;  3WS1 A;  2XEP A;  4EWF A;  4C6Y A;  3A3E A;  3WS2 A;  1XJ4 A;  2R9X A;  5IHV A;  2VLG A;  4U0T A;  3BQA A;  4YIN A;  4WM9 A;  1TF1 A;  3DTE A;  5FAQ A;  1S6R A;  3AGE A;  4KUK A;  4JF4 A;  4CQH A;  3ZG0 A;  2QHK A;  2VV8 A;  1CEG A;  1OJ5 A;  4O7D A;  5HPI A;  3T4T A;  3MQQ A;  3V67 A;  3V3R A;  1YLZ A;  4JKT A;  4OQI A;  1CJF A;  3BFC A;  3TG9 A;  4E3N A;  2DRW A;  4ZBE A;  2VEA A;  3W4O A;  4IJG A;  1NZU A;  4KG6 A;  3S7P A;  4DMZ A;  5JYP A;  2H5S A;  1BZA A;  2HJE A;  2ZD8 A;  1HLU P;  4RX2 A;  4JGP A;  3TSG A;  3T4Q A;  4NXG A;  2W3D A;  4OKP A;  4FUW A;  2VX8 A;  3O5Y A;  5A93 A;  5HFO A;  3WRT A;  1GSV A;  3E2K A;  2FH5 A;  2XFT A;  4R70 A;  1Q2P A;  5HWW A;  1M6K A;  2WGW A;  1O07 A;  3MXQ A;  1OTD A;  4S2N A;  1CEF A;  1E25 A;  3QP5 A;  2H0T A;  3FKV A;  2WKE A;  3UDI A;  1Y54 A;  2P7J A;  2J9P A;  3F1P A;  5F69 A;  1DY6 A;  3T1Q B;  2J3T C;  5AQB A;  2IWB A;  4MN7 A;  1GCE A;  2WKI A;  4ETZ A;  5HAI A;  4HH3 A;  1BSG A;  1H8Y A;  1NJ4 A;  1ACF A;  3IH9 A;  5EVI B;  3QP8 A;  1W63 M;  4E6X A;  3LIB A;  1LL9 A;  2JBF A;  4OQH A;  1KVL A;  3LID A;  3PBN A;  4QPR A;  5A90 A;  1RGY A;  1XFN A;  1RGZ A;  1XFQ A;  2JE5 A;  3FKW A;  3C7V A;  4ZDX A;  2AVX A;  2I72 A;  3NI9 A;  3W4P A;  3C7U A;  4Y0T A;  3G30 A;  3JVU A;  3KO6 A;  3G34 A;  2Q0O A;  1T1B A;  4KZ9 A;  1XJ2 A;  2W3F A;  5FAT A;  2V8C A;  5CTM A;  3H82 A;  1DP8 A;  4UA9 A;  1EI5 A;  2QJ7 A;  4IED A;  5CHU A;  2PYP A;  5EE8 A;  1T1A A;  3P09 A;  3RJU A;  2KOI A;  3ZG7 B;  2EX9 A;  5EVL A;  2NUP C;  3CPT B;  3KSI A;  4EV4 A;  1GHI A;  3RH8 B;  2ZQC A;  3ZCZ A;  5KSC A;  4WZ5 A;  2WGV A;  4ARZ B;  1TVF A;  2GJ3 A;  2JKR I;  2V2F F;  4P0M A;  4PMA A;  2HV1 A;  3WRZ A;  2OWJ A;  2Y2K A;  5E43 A;  4XT2 B;  3D3O A;  1IKG A;  3MSH A;  3IS2 B;  4FTX A;  4B4Z A;  1VHM A;  3R7W B;  4DE3 A;  3OPL A;  1PFL A;  1GA9 A;  1JWV A;  3WS0 A;  2H10 A;  3KYZ A;  4KZ3 A;  4DJ3 A;  3IWI A;  4EUZ A;  4CPK A;  2Z6C A;  3HLF A;  4MN6 A;  1LL5 A;  4ZTK A;  5DFX A;  3ZFZ A;  3HCY A;  1L0G A;  5M19 A;  1H0M A;  4EBL A;  1H3Q A;  1DRM A;  3M6B A;  5EEC A;  1ERQ A;  2Z2L B;  2WGI A;  3IWO A;  1JWP A;  1LSV A;  2ZC3 B;  2ZC7 A;  3S7Q A;  2QKP A;  2HGV A;  5MC7 A;  1MY8 A;  2Q9M A;  2Y2P A;  3F1N B;  3NOP C;  2OLU A;  4MBF A;  1K54 A;  2VGJ A;  5FDS A;  3BW6 A;  4JLF A;  4WEL A;  1MZU A;  3U4L P;  4LEN A;  1LLB A;  4UAA A;  2XD1 A;  5L07 A;  2A24 A;  3RXW A;  4EUV A;  4LGW A;  2INW A;  1NYY A;  3MZE A;  4QHC A;  3A0R A;  4P6B A;  4MEZ A;  1YKD A;  2O9C A;  4LFU A;  4K0X A;  5FQQ A;  1ESI A;  2NUT C;  1G6O A;  3CG5 A;  5EPH A;  2PBY A;  2V1Z A;  1NRJ A;  3VFF A;  5M18 A;  4HES A;  2YKF A;  3MF0 A;  4OP8 A;  4LRZ E;  2Y91 A;  1PYY A;  3ZHH A;  4WL9 A;  4EEU A;  2J80 A;  3IF6 B;  3UB6 A;  2K7S A;  3OPR A;  5A8B A;  5KSH A;  4XXR A;  4QD4 A;  1V9Y A;  2PYR A;  2WK0 A;  4JXW A;  3N8R A;  1MBL A;  1YMS A;  2Y2L A;  1JWZ A;  3V39 A;  5EVI A;  4R23 A;  3O3V A;  3SOI A;  4R4R A;  3ZQ5 A;  4IBX A;  5F82 A;  3NBL A;  4UA6 A;  5G18 A;  4E3O A;  3HLD A;  4JXG A;  3Q1F A;  3UME A;  3UNW A;  1GHM A;  1OJG A;  2CC1 A;  4Y13 A;  5HWT A;  4FH2 A;  1J9M A;  1MXO A;  4DXC A;  3NC8 A;  3H7W A;  4KZ7 A;  3BFG A;  5E2E A;  3UDF A;  1JTG A;  4E3I A;  3KSG A;  2R9W A;  4AFI A;  5AVF A;  4KUO A;  3QP6 A;  4CLC A;  5GHZ A;  5KMW A;  4K08 A;  3DBA A;  1QMF A;  3O88 A;  3CHW P;  3HRE A;  3UMD A;  4BBU A;  4HQA A;  3M6H A;  3G6O A;  2Y2Q A;  4Y17 A;  4EES A;  1S0W A;  5EVI D;  3QP2 A;  4R0Q A;  4XUZ A;  3HLB A;  3PHY A;  4G3K A;  3CPT A;  2OSU A;  2WZZ A;  4WEJ A;  3HBR A;  5FQ9 A;  4GCZ A;  4Q0H A;  5IU1 A;  2ZQA A;  3QNB A;  4GNU A;  5DTK A;  4ARZ A;  4EW7 A;  2EA9 A;  3SH9 A;  1MKM A;  2L0W A;  4MN5 A;  1I5Q A;  2HDQ A;  2HP5 A;  4XT2 A;  3VP4 A;  3UE3 A;  3NCK A;  3Q81 A;  3EEA A;  3TE8 A;  3JVV A;  3MFX A;  3BYD A;  3GTC A;  4HNB A;  3R7W A;  5A92 A;  3VP0 A;  5LBR A;  4CLC D;  1PW1 A;  4I3A A;  3E0Y A;  5FI7 A;  2XQZ A;  3LY4 A;  4R38 A;  1CF0 A;  2Y8H A;  4CLC E;  2LB9 A;  1FSY A;  3NOT C;  4GS9 B;  1AWI A;  4GB7 A;  4OON A;  1XX2 A;  4KG2 A;  3IHB A;  3LUQ A;  4HP9 A;  3ZDJ A;  3P01 A;  5IS1 A;  3DWZ A;  3UE1 A;  5HW3 A;  5FI6 A;  4DN0 A;  2PU2 A;  1I2W A;  3JYI A;  1BLP A;  3F1N A;  3S1Y A;  1F2K A;  2WZX A;  1GA0 A;  4DJ2 A;  1IYS A;  3C38 A;  3BRM A;  3UB9 A;  4MLL A;  3FG8 A;  1MWU A;  2M7U A;  4Q0I A;  3W4Q A;  4Z9Q A;  1NYM A;  1XP4 A;  3C4P A;  3NDG A;  2Y2H A;  2C5W B;  3ICY A;  5HL1 A;  1LHY A;  3BLM A;  4OPZ A;  4HJ3 A;  1QME A;  3E4Q A;  1NLY A;  3NHQ A;  5HAR A;  1YMX A;  1DJB A;  5M1A A;  2XH9 A;  5HDS A;  1K55 A;  4S2N C;  5GHY A;  5HD3 A;  3CIT A;  3OZH A;  4X69 A;  1FCO A;  4B93 A;  4DKI A;  3K2N A;  3BEC A;  1XJ3 A;  4HHD A;  4GKU A;  4QB8 A;  5CRF A;  5G4Y A;  4MBH A;  1YLP A;  2DNS A;  3IF6 A;  4EET B;  2QPN A;  1FIK A;  1L0F A;  2ZMV A;  3N6I A;  5HPF A;  3T12 B;  2K31 A;  5JYO A;  4GOG A;  2A3U A;  3ISG A;  2BLS A;  4PM5 A;  5F1F A;  1STZ A;  3ZG8 B;  2FFY A;  4IBR A;  5CED A;  4IHQ A;  3A0S A;  4D2O A;  4DXB A;  4EBP A;  3Q07 A;  5FAS A;  1L0E A;  1PWG A;  2B18 A;  3FZC A;  1HD8 A;  3SH7 A;  4WBG A;  3LY3 A;  4YFM A;  3FPV A;  3QNC A;  5J4E A;  1UWP X;  3BJN A;  2VJW A;  4L9E A;  1OTA A;  2ACG A;  5AQ7 A;  4ETX A;  3Q82 A;  1WYC A;  5E2F A;  4HBU A;  2M7V A;  5TFQ A;  4Z1W A;  3MMH A;  3MKF A;  3BEB A;  2J8Y A;  2GNX A;  2A24 B;  4RYE A;  1Y28 A;  1H5X A;  3P7N A;  1HVB A;  2XA7 S;  4D60 A;  4LV0 A;  3PYP A;  1TS0 A;  2JKG A;  3S7N A;  3JPU A;  1S1Z A;  4BEN A;  2HDR A;  4I3I A;  5GLC A;  4X1M A;  3NOU C;  4PM6 A;  2EWV A;  4UQI M;  4WZ5 C;  1XJ6 A;  1VQQ A;  3W8K A;  1BYW A;  1SDN A;  3MBZ A;  2PD7 A;  4X25 A;  4X68 A;  3E2L A;  4LCL A;  1XGJ A;  4OPQ A;  3OCL A;  1V9Z A;  2PBD P;  1K6R A;  2W3H A;  4RX3 A;  5CTN A;  3LEZ A;  3TW8 A;  1SZV A;  3S22 A;  2EWW A;  1K4E A;  3CUE A;  4KEN B;  2A49 A;  2KX6 A;  3HLW A;  5HZH A;  1GHP A;  2PDR A;  3LFV A;  4MNR A;  3VE3 A;  4Y5F A;  3T4J A;  4MMN A;  3ZGA B;  1TS8 A;  3B33 A;  4PKY G;  1W7F A;  2JKF A;  2R78 A;  4RA7 A;  3VOL A;  1S1Y A;  3BM6 A;  3LCE A;  4P85 A;  4L9F A;  4GS9 A;  1OME A;  3D4F A;  2ZQ9 A;  4X53 A;  4I39 A;  3QP4 A;  2WKR A;  3GR2 A;  5L2F A;  3H7W B;  1BLS A;  1G5U A;  3BLS A;  5F5Y A;  4DDS A;  1KE4 A;  2VKS A;  4QY5 A;  2UWX A;  5DKL A;  5L10 A;  4BMW A;  4GDN A;  4OP5 A;  4OOY A;  3RXX A;  1LT0 A;  4CLC B;  4BD1 A;  2XGN A;  3N8S A;  1L3L A;  3M2K A;  2HZ5 A;  4OVD A;  4Y3I A;  3IH8 A;  1MPL A;  5E2G A;  2Y2N A;  4FD8 A;  1SKF A;  3FYZ A;  1MWT A;  2Y4A A;  4FSF A;  4P6Z M;  2WYX A;  3ITB A;  2PAV P;  3SZT A;  4BBT A;  1AXB A;  4KZB A;  2UV0 E;  1W79 A;  5AJG A;  3NEC A;  1H8M A;  5TJJ A;  1ES4 A;  4EER A;  4L0L A;  3LI9 A;  5L8M A;  3A3I A;  3A3F A;  2VGL M;  2ZBB A;  4FOF A;  3L9K A;  3C8C A;  5EVI C;  1GSW A;  2EX6 A;  5GLD A;  2V0U A;  2ZC4 B;  2BAS A;  1YLT A;  5DF8 A;  3Q7Z A;  4R3J A;  3ZG9 B;  5EUA A;  3SS4 A;  3S4X A;  1LSW A;  1XPB A;  5K5B A;  5TR7 A;  2O9A A;  3OC2 A;  4ZJ2 A;  5BOH A;  4OPY A;  3PBR A;  1YM1 A;  3GV9 A;  3PBO A;  2FZ0 A;  3UPN A;  5HAQ A;  4N1X A;  5A91 A;  1C3B A;  3E4O A;  3MFD A;  2ZMF A;  4C3Q A;  2PR6 A;  3EOI A;  1ERM A;  2GZA A;  2L4R A;  3K3C A;  1IYO A;  2WKQ A;  3FV7 A;  5EOO A;  2V0W A;  4DE0 A;  5EM0 A;  1BT5 A;  3LR3 A;  1FR6 A;  1KDS A;  4EU0 A;  4KQO A;  4B4X A;  1ZTU A;  4S2L A;  2E8I A;  5DF7 A;  3OOV A;  1PWC A;  3IHA A;  2H0Y A;  5HAP A;  4FH4 A;  2J9O A;  2W0N A;  3EGD C;  3PBS A;  1A0K A;  3ZYT A;  3UDX A;  1HZO A;  1NY0 A;  3HLC A;  5GL9 A;  2ZMA A;  2V9A A;  3BFF A;  4UEY A;  1RCJ A;  5EV0 A;  1LL8 A;  3DTK A;  4O8G A;  4NK3 A;  2Y2G A;  3L7H A;  1OPX A;  3VV4 A;  1FSW A;  1K56 A;  3LR4 A;  5F1G A;  4BQM A;  2IWC A;  4PKY A;  3A0V A;  4LLO B;  3CI6 A;  4KZ4 A;  1OTB A;  3PR6 A;  4S2P A;  1ZHH B;  3NIA A;  5J7E A;  5CX7 A;  1K25 A;  2M1C A;  4HEF A;  4CJN A;  1D06 A;  1OTE A;  2V20 A;  3E4P A;  1P9W A;  1UWN X;  2V8F A;  2OLV A;  3PAE A;  5CHM A;  2ZLY A;  1PWD A;  2Y59 A;  5HDC A;  5G4Z A;  3B42 A;  1ZG4 A;  2LB5 A;  5E2H A;  4BJP A;  1Z09 A;  4A5R A;  1KGG A;  1E3U A;  2O0Y A;  3G32 A;  4GZB A;  5EVE A;  3HJK A;  4OLD A;  4ESP A;  1ZC2 A;  3IF5 A;  3ZNT A;  1K56 D;  5DVA A;  5I5L A;  1K38 A;  1K57 A;  5L09 A;  2X71 A;  3OLO A;  1NXY A;  2D01 A;  4YOF A;  1NLZ A;  1FOF A;  2L1M A;  2OAP 1;  5AQ9 A;  4JXV A;  1D7E A;  2H28 A;  3T1R A;  4BBV A;  3BY8 A;  2Y2O A;  4Y7P A;  4HBT A;  3C2W A;  4KG5 A;  2HP9 A;  3IF6 C;  3HUO A;  4NEE D;  5CGX A;  2JKT M;  2XR0 A;  1E3U D;  4PAU A;  3VE4 A;  1W5D A;  4G3W A;  3ZVW A;  3S7O A;  2VA0 A;  4DDY A;  1VEU B;  2B02 A;  1P9R A;  4NXE A;  3VOZ A;  2WAE A;  3QHY A;  2W1R A;  1XA7 A;  1KVM A;  3WWX A;  1NZO A;  2P9V B;  5FAO A;  3KSF A;  4GN2 A;  4HJ6 A;  1KGF A;  4I5S A;  4WN5 A;  4M4X A;  1TS6 A;  5HWV A;  3C4O A;  2JC7 A;  2WKP A;  1E4D A;  3LIF A;  5FQK A;  1MC0 A;  2ZQD A;  2XK1 A;  2KDK A;  3N7W A;  4EQ1 A;  1K4F A;  1N4O A;  3BQ8 A;  1L0D A;  5FL3 A;  3AGD A;  3F1O B;  3CJM A;  2DCF A;  1ODV A;  1IEL A;  2G2W A;  4R6L A;  4PM7 A;  4JPM A;  1Q2Q A;  2P08 A;  2Z6D A;  4QWO A;  4U0X A;  4QY6 A;  1Y4O A;  3UY6 A;  4LV2 A;  4KQQ A;  4R4S A;  3A3J A;  4X55 A;  5FSR A;  4S2O A;  2W1T B;  3UB7 A;  5KZH A;  2OAQ 1;  2J3W A;  1SCW A;  3UB8 A;  2ZM8 A;  3MZF A;  1YPR A;  1FIL A;  4JBF A;  3VP1 A;  2EX2 A;  3LIA A;  3KYQ A;  3D72 A;  1LI9 A;  4PHT A;  5HD5 A;  3DTM A;  4N9K A;  4S2M A;  1XGI A;  3PBT A;  4WMC A;  1H8Z A;  3CUE C;  4EEP A;  4Q8I A;  1XXM A;  1O7E A;  3MQO A;  5TBM B;  3MJQ A;  2VV6 A;  3A3D A;  2O99 A;  3IXG A;  1I2S A;  5FDH A;  3UE0 A;  4WLA A;  2HP6 A;  3TJZ C;  2ZQ7 A;  5DTT A;  3SW1 A;  2ZOI A;  3NUL A;  2ZC5 B;  4I38 A;  2XD5 A;  2XLN A;  4JF6 A;  2Y55 A;  1UGU A;  4YWZ A;  3CMZ A;  1G28 A;  1ONG A;  1L2S A;  1FR1 A;  3NDE A;  1NWZ A;  3T50 A;  1YLY A;  3IXD A;  1W8Q A;  4EBN A;  1IKI A;  2GDN A;  3CZD A;  3VMA A;  1TS7 A;  5HX9 A;  3MXS A;  2V1A A;  3CWF A;  4HY8 A;  4LRY C;  3HUN A;  3BY9 A;  4R1G A;  1NRF A;  4WMC D;  4KQR A;  2MJ6 A;  1KDW A;  2HDS A;  1S4S A;  2PT7 A;  1YSP A;  4HP4 A;  1MKI A;  3LO7 A;  1N9O A;  1S67 L;  5EM1 A;  2ZL1 B;  4OPR A;  1KOU A;  4DE1 A;  2QWS A;  1PNE A;  1PI5 A;  3KX0 X;  5FEF A;  4KZA A;  3GVB A;  4O0P A;  5EOE A;  4E6W A;  2YKH A;  3RFB A;  4N9L A;  1ZG6 A;  4P87 A;  4L9G A;  2RCX A;  1FCM A;  3FWL A;  3D9Y A;  5KIZ A;  3B3X A;  3BWL A;  2G2U A;  5DKK A;  2CMN A;  5FAP A;  4C75 A;  2OOL A;  4I3J A;  4E3K A;  5J3W A;  1ES5 A;  1VEU A;  4PM8 A;  4BL2 A;  4DRT A;  4KZ5 A;  4OOM A;  1IFQ A;  4JGQ A;  3HJI A;  1SKO A;  2P9V A;  4JGO A;  4JXS A;  5I94 A;  4HI4 A;  4B9O A;  3K3D A;  3TRC A;  1CI9 A;  3IX8 A;  4MCW A;  3EEH A;  2JKR M;  3IT9 A;  3NJA A;  4Q0J A;  1DP6 A;  4OQG A;  3KSH A;  1W8Y A;  5CEC A;  3DW0 A;  5CGW A;  2PU4 A;  4ID4 A;  1IOU A;  5HSQ A;  1WE4 A;  2ZOH A;  1K54 C;  1OT6 A;  2HDU A;  3F1O A;  2QMI A;  1GSX A;  1P0Z A;  5EFW A;  4HOI A;  1TDL A;  3DWK A;  2W3G A;  5FA7 A;  1WYB A;  4LRX C;  3MXR A;  4G3V A;  1K0K A;  5FQM A;  5DTS A;  2WAD A;  1DJC A;  4WF0 A;  4RVA A;  1ES2 A;  1G6A A;  3HUM A;  4ZAM A;  5GHX A;  3EGX C;  3O86 A;  2W1T A;  4NKP A;  3H9W A;  2FFF B;  1FCN A;  1T19 A;  5CHJ A;  1N9L A;  3MR0 A;  4IVI A;  2BTF P;  3OPP A;  3WS4 A;  3PXP A;  1YLW A;  4WYY A;  1HTZ A;  3IWQ A;  3BFE A;  3LIE A;  2KLI A;  2PD8 A;  4E3J A;  2B5R A;  1K6S A;  3R4K A;  4HH2 A;  4R3B A;  3EWK A;  1S4R A;  4GHI B;  2K2N A;  4KQD A;  2WAF A;  3HVF A;  5TBM A;  1IYQ A;  1PZO A;  1N9B A;  2W3E A;  3UN7 A;  3Q7V B;  2PHY A;  4QJG A;  3IXB A;  2EXB A;  4WUJ A;  4OLG A;  4WZ4 A;  4NET A;  2HF6 A;  4O01 A;  4H6J B;  2P74 A;  3PTE A;  3OBF A;  4BLM A;  3OPH A;  4OOL A;  1ERO A;  3LI8 A;  2ZM0 A;  4H8R A;  5DFY A;  3IX3 A;  2VGK A;  3PBQ A;  4X6T A;  4F3L B;  2X01 A;  3M2J A;  4K0W A;  4Y15 A;  5J8X A;  1VM1 A;  2Y2M A;  4LV3 A;  1YQS A;  3DTI A;  3MS6 A;  2X02 A;  4DE2 A;  1DP9 A;  3G4P A;  3V50 A;  2A2L A;  3IBJ A;  1JTD A;  4CLC C;  1X0O A;  4GLQ A;  3VFH A;  2V1B A;  2EFX A;  1K57 C;  2W27 A;  4X56 A;  3LYX A;  4Y0U A;  5DJU A;  3ITA A;  4II7 A;  4UQI S;  3G31 A;  1T1C A;  3UO9 A;  2ZL1 A;  1PW8 A;  1CQA A;  3NY4 A;  4IUH A;  3T4S A;  4FCF A;  4UA7 A;  3LEQ A;  1VB6 A;  3GSG A;  1BTL A;  3QP1 A;  4BWI A;  1KE3 A;  3VSK A;  2JN7 A;  1F5M A;  1VET B;  5F68 A;  4LCM A;  4LPZ A;  4GW9 A;  1OT9 A;  2GX5 A;  2XDM A;  1DJA A;  1J3W A;  4OQ0 A;  5F6A A;  4QU3 A;  3PAG A;  4S2K A;  5CER A;  3UPO A;  1TD5 A;  5FI2 A;  2Q9N A;  3DAV A;  4EQI A;  2J3T D;  3ZVT A;  3SS5 A;  3GQZ A;  2VV7 A;  2ZM2 A;  3V3S A;  2XFS A;  1MWR A;  1IYP A;  5AVE A;  3EQU A;  3UPP A;  2P04 A;  1Z6F A;  4X1L A;  4KZ6 A;  3N8L A;  4KZ8 A;  2Z2M B;  3IX4 A;  4IVK A;  4JGR A;  4IUK A;  3HLE A;  4ZRR A;  1ESU A;  3G2Y A;  2I9V A;  3ULF A;  1F9I A;  1XA1 A;  4YNR A;  1BLC A;  4OH0 A;  5FQJ A;  4JF5 A;  3T4K A;  3TOI A;  1TDG A;  3EQV A;  3T1S A;  1ALQ A;  2ZJ9 A;  3N4I A;  3CAX A;  3V5M A;  1ES3 A;  2XRN A;  4E3M A;  2QYB A;  1IEM A;  2B95 A;  4ME4 A;  1BUL A;  5DF9 A;  2D02 A;  4Y2F A;  3C5A A;  4PPR A;  2HPB A;  3ZG5 A;  4M3K A;  1JVJ A;  5FQI A;  3G35 A;  2PR5 A;  4PM9 A;  4P6Z S;  3GRJ A;  3P98 A;  1K55 C;  5GLB A;  2ZQ8 A;  4B88 A;  1F98 A;  5HDD A;  3VOY A;  2HJ9 C;  1KGE A;  3LR0 A;  2VGL S;  4BL3 A;  3LR5 A;  3T4O A;  2Y2J A;  1ONH A;  2WKH A;  4E04 A;  3SH8 A;  5DJT A;  2PRF A;  3U2A A;  3VP2 A;  2ZC6 B;  1EWZ A;  4ZJ1 A;  2XRO A;  4DF6 A;  1LSX A;  2OV5 A;  5AQA A;  4GHI A;  3IQA A;  4GJ4 A;  4K91 A;  1PI4 A;  4LV1 A;  1PRQ A;  4S2J A;  1OTI A;  2WGW B;  5F83 A;  1TEM A;  3Q7V A;  4GDB A;  1WA9 A;  1N9N A;  2XA7 M;  4MDZ A;  3I7J A;  2XF3 A;  3W2Z A;  3C30 A;  4S2I A;  4HIA A;  4UHU A;  1SKO B;  2EX8 A;  1YSQ A;  4U3T A;  4H6J A;  2C6W B;  3F1P B;  4EXO A;  1PIO A;  4ZJ3 A;  2RL3 A;  3IS2 A;  4RQ9 A;  5IT5 A;  2QJ5 A;  4F3L A;  1CI8 A;  1P97 A;  3G2Z A;  1LI0 A;  4NXF A;  2JCH A;  1JNU A;  2WUQ A;  2J7V A;  4E3L A;  5CXW A;  1S66 L;  2EXA A;  2BG1 A;  5GLA A;  3MKE A;  3E98 A;  2QZ6 A;  3CLO A;  1PZP A;  2VZW A;  3VP3 A;  2IA2 A;  4Y0O A; 
#chains in the Genus database with same CATH homology
 1H8M A;  4O0P A;  5TJJ A;  2YKH A;  4EER A;  2XSS A;  4L0L A;  3LI9 A;  2G7U A;  5L8M A;  3RFB A;  3OCN A;  3GDI A;  2VGL M;  2ZBB A;  4FOF A;  3C8C A;  1GSW A;  3RTY A;  3ZQ5 A;  2V0U A;  1W63 Q;  1T18 A;  2BAS A;  4L9G A;  2JHE A;  4NXB A;  3UME A;  5KIZ A;  1OJG A;  3BWL A;  1LSW A;  5K5B A;  5DKK A;  5HWT A;  3H82 B;  2CMN A;  2JKT I;  3MQ0 A;  2OOL A;  2O9A A;  4I3J A;  5J3W A;  3OC2 A;  3H7W A;  1EW0 A;  3PBR A;  3UE6 A;  3PBO A;  2FZ0 A;  3KSG A;  4AFI A;  5AVF A;  4OOM A;  1IFQ A;  1YAX A;  4KUO A;  4JGQ A;  4CLC A;  3E4O A;  3HJI A;  2ZMF A;  4K08 A;  4JGO A;  3DBA A;  2PR6 A;  4HI4 A;  3FC7 A;  3EOI A;  4B9O A;  2GZA A;  3K3D A;  3TRC A;  2L4R A;  3K3C A;  4MCW A;  3UMD A;  4BBU A;  4HQA A;  3EEH A;  3G6O A;  4EES A;  2WKQ A;  2JKR M;  3NJA A;  2V0W A;  4Q0J A;  1DP6 A;  3KSH A;  2DMW A;  3PHY A;  3IBR A;  1IOU A;  5HSQ A;  4G3K A;  3LR3 A;  2ZOH A;  4WEK A;  1OT6 A;  4KQO A;  4EU0 A;  3GEC A;  3F1O A;  1ZTU A;  3T4L A;  1P0Z A;  1GSX A;  2O9B A;  5EFW A;  4HOI A;  4WEJ A;  5C5K A;  3FPW A;  2W3G A;  3OOV A;  4LRX C;  4GCZ A;  4Q0H A;  5IU1 A;  4G3V A;  3LIC A;  5HL6 A;  4HJ4 A;  4ARZ A;  4EW7 A;  2EA9 A;  2OWH A;  4R3A A;  2Y79 A;  4WF0 A;  1MKM A;  3B47 A;  2L0W A;  4MN5 A;  2W0N A;  3EGX C;  3EGD C;  3PBS A;  3ZYT A;  4XT2 A;  2W1T A;  3UE3 A;  1XJ4 A;  2V9A A;  4NKP A;  3EEA A;  4UEY A;  3H9W A;  3TE8 A;  3JVV A;  3MFX A;  1LL8 A;  4HNB A;  3R7W A;  4O8G A;  2VLG A;  3BQA A;  1T19 A;  5LBR A;  1OPX A;  4CLC D;  1N9L A;  3VV4 A;  1TF1 A;  3MR0 A;  3LR4 A;  4I3A A;  3PXP A;  4KUK A;  3E0Y A;  4PKY A;  4CQH A;  2QHK A;  2VV8 A;  3LIE A;  4R38 A;  2KLI A;  3A0V A;  2Y8H A;  1OJ5 A;  4LLO B;  2PD8 A;  3CI6 A;  1OTB A;  4CLC E;  2LB9 A;  3NOT C;  3PR6 A;  4GS9 B;  1ZHH B;  5HPI A;  3T4T A;  5J7E A;  3MQQ A;  5CX7 A;  4HH2 A;  3R4K A;  2M1C A;  3V67 A;  3EWK A;  1S4R A;  4GHI B;  1D06 A;  1OTE A;  2K2N A;  4KQD A;  3E4P A;  1P9W A;  5TBM A;  1UWN X;  2VEA A;  2W3E A;  4IJG A;  3LUQ A;  4HP9 A;  3P01 A;  5IS1 A;  3S7P A;  4DMZ A;  4DN0 A;  2HJE A;  2PHY A;  4WUJ A;  4JGP A;  5HDC A;  3T4Q A;  5G4Z A;  3F1N A;  4NXG A;  2W3D A;  4DJ2 A;  2VX8 A;  3B42 A;  3O5Y A;  2LB5 A;  4BJP A;  3C38 A;  2HF6 A;  3UB9 A;  4O01 A;  1GSV A;  3FG8 A;  2M7U A;  4Q0I A;  4H6J B;  2FH5 A;  2O0Y A;  4R70 A;  3OBF A;  5HWW A;  3ICY A;  4OOL A;  3LI8 A;  4HJ3 A;  3MXQ A;  3E4Q A;  1NLY A;  5DFY A;  1OTD A;  3NHQ A;  3PBQ A;  4F3L B;  3HJK A;  5HDS A;  5I5L A;  2P7J A;  5HD3 A;  3CIT A;  1DP9 A;  3OLO A;  2A2L A;  2D01 A;  3IBJ A;  1NLZ A;  3F1P A;  4YOF A;  5F69 A;  4B93 A;  4CLC C;  1X0O A;  2J3T C;  2L1M A;  4GLQ A;  2V1B A;  4MN7 A;  2W27 A;  2OAP 1;  3K2N A;  4ETZ A;  1XJ3 A;  3LYX A;  4HH3 A;  4HHD A;  1D7E A;  5DJU A;  2H28 A;  5G4Y A;  4BBV A;  4II7 A;  4UQI S;  1T1C A;  3BY8 A;  1W63 M;  3LIB A;  4IUH A;  3T4S A;  1VB6 A;  3C2W A;  4EET B;  4BWI A;  3LID A;  2ZMV A;  3PBN A;  5HPF A;  4NEE D;  4QPR A;  2K31 A;  2JN7 A;  1F5M A;  1XFN A;  2JKT M;  1XFQ A;  5F68 A;  4LPZ A;  4GW9 A;  4PAU A;  3VE4 A;  1STZ A;  1OT9 A;  4G3W A;  2GX5 A;  3S7O A;  2VA0 A;  2B02 A;  1P9R A;  4IHQ A;  3A0S A;  3JVU A;  3KO6 A;  4NXE A;  5F6A A;  1T1B A;  2B18 A;  1TD5 A;  1XJ2 A;  2W1R A;  2W3F A;  3FPV A;  2J3T D;  5J4E A;  1UWP X;  2VV7 A;  3H82 A;  3BJN A;  3KSF A;  1DP8 A;  4HJ6 A;  2VJW A;  5AVE A;  4L9E A;  3EQU A;  2QJ7 A;  2P04 A;  4WN5 A;  4I5S A;  4M4X A;  1OTA A;  1TS6 A;  5HWV A;  2PYP A;  4ETX A;  1T1A A;  2WKP A;  4JGR A;  4IUK A;  3LIF A;  4ZRR A;  1MC0 A;  2KDK A;  2I9V A;  2KOI A;  2M7V A;  4EQ1 A;  3ULF A;  1F9I A;  3BQ8 A;  5FL3 A;  4YNR A;  2NUP C;  4Z1W A;  3F1O B;  3MMH A;  3KSI A;  1ODV A;  2GNX A;  2A24 B;  3T4K A;  1Y28 A;  4R6L A;  3P7N A;  2P08 A;  2Z6D A;  2XA7 S;  3EQV A;  3RH8 B;  3PYP A;  1TS0 A;  3S7N A;  1S1Z A;  4ARZ B;  3CAX A;  4I3I A;  2XRN A;  2GJ3 A;  2JKR I;  2QYB A;  2HV1 A;  3NOU C;  2OWJ A;  4ME4 A;  2EWV A;  4UQI M;  5DF9 A;  1XJ6 A;  4XT2 B;  2D02 A;  2W1T B;  3D3O A;  4Y2F A;  3UB7 A;  1BYW A;  3IS2 B;  2OAQ 1;  2J3W A;  2PD7 A;  3UB8 A;  1VHM A;  3R7W B;  3OCL A;  2PR5 A;  1V9Z A;  4P6Z S;  3LIA A;  2W3H A;  3KYQ A;  3KYZ A;  4DJ3 A;  3TW8 A;  2Z6C A;  4MN6 A;  2EWW A;  3D72 A;  5DFX A;  3HCY A;  4PHT A;  5HD5 A;  3CUE A;  1F98 A;  2KX6 A;  5HDD A;  3PBT A;  1H3Q A;  1DRM A;  5HZH A;  2HJ9 C;  3LR0 A;  2PDR A;  3CUE C;  3LFV A;  3VE3 A;  4EEP A;  4Y5F A;  1LSV A;  3T4J A;  4MMN A;  2VGL S;  1TS8 A;  3LR5 A;  3MQO A;  3B33 A;  4PKY G;  3S7Q A;  5TBM B;  3T4O A;  3MJQ A;  2QKP A;  2VV6 A;  2O99 A;  2R78 A;  4WLA A;  4E04 A;  3TJZ C;  3VOL A;  1S1Y A;  2HGV A;  5MC7 A;  5DJT A;  3SW1 A;  3U2A A;  4L9F A;  3F1N B;  2ZOI A;  2XRO A;  3NOP C;  4GS9 A;  1LSX A;  4I38 A;  4GHI A;  3BW6 A;  4GJ4 A;  4I39 A;  4WEL A;  1MZU A;  1UGU A;  4YWZ A;  2WKR A;  3H7W B;  1G28 A;  5F5Y A;  2A24 A;  1OTI A;  1NWZ A;  2VKS A;  1WA9 A;  3T50 A;  4EUV A;  5DKL A;  2INW A;  1N9N A;  4BMW A;  2XA7 M;  4MDZ A;  3A0R A;  1TS7 A;  3W2Z A;  1LT0 A;  3C30 A;  4CLC B;  4HIA A;  1YKD A;  2O9C A;  2V1A A;  3CWF A;  1YSQ A;  4HY8 A;  4LRY C;  4H6J A;  3BY9 A;  3F1P B;  4EXO A;  2NUT C;  1G6O A;  3IS2 A;  4RQ9 A;  2MJ6 A;  5IT5 A;  4Y3I A;  1NRJ A;  2QJ5 A;  4F3L A;  1S4S A;  2YKF A;  2PT7 A;  1P97 A;  1YSP A;  3MF0 A;  4LRZ E;  4HP4 A;  4NXF A;  1JNU A;  4WL9 A;  1N9O A;  4FSF A;  4EEU A;  4P6Z M;  1S67 L;  1S66 L;  2J80 A;  4BBT A;  3UB6 A;  2K7S A;  1KOU A;  5A8B A;  5KSH A;  1V9Y A;  2PYR A;  3CLO A;  2QWS A;  3E98 A;  3KX0 X;  2VZW A;  2IA2 A;  5AJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...