4LPZA

Arnt transcription factor/coactivator complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
104
structure length
96
Chain Sequence
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFEYIICTNTNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title ARNT transcription factor/coactivator complex
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Aryl hydrocarbon receptor nuclear translocator
total genus 23
structure length 96
sequence length 104
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14598 PAS_11 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4lpzA00
2PD7A 1UWNX 3OLOA 4DJ3A 3F1PA 3A0VA 4H6JA 4HI4A 4WL9A 2ZBBA 1KOUA 3HJKA 3NOPC 1F9IA 5IU1A 5G4ZA 1ODVA 1OTIA 2PHYA 1XJ3A 2GJ3A 2VEAA 4KQDA 1LT0A 4KUOA 4NXEA 3UB8A 4I39A 3ULFA 3F1OB 5HD5A 4HHDA 3C8CA 2PR5A 3CAXA 1OTBA 2A24A 3H82B 3LIBA 3NHQA 4LRZE 3VOLA 5A8BA 1P97A 5HD3A 3ICYA 4GHIB 3MJQA 4JGRA 1UGUA 4HIAA 2PYPA 3MR0A 5F6AA 3VE3A 4BBVA 3BWLA 2VV7A 4NXFA 2V1AA 2HV1A 1XJ2A 1BYWA 1XJ4A 1GSXA 5TBMB 4F3LB 2L1MA 4XT2B 2INWA 4B9OA 1D06A 3F1PB 4H6JB 4XT2A 1T1BA 3CLOA 4I3JA 1N9OA 3P7NA 4EXOA 1Y28A 4RQ9A 3D72A 4DJ2A 1DRMA 2QHKA 4EQ1A 3K3DA 3SW1A 3UB6A 1OTEA 2V0WA 3H7WB 1N9LA 3HJIA 1LL8A 3RH8B 4BBTA 3KX0X 5HDCA 1OJ5A 4HP4A 1DP8A 2EA9A 1V9ZA 1TS8A 2OWHA 2R78A 3F1NA 1D7EA 1NWZA 3BY9A 4L9FA 4PKYA 3ZQ5A 2WKPA 4E04A 1XJ6A 4GS9B 3UB7A 2QKPA 3UMDA 2K7SA 2J80A 1LSWA 5AVEA 4R6LA 4HQAA 5F69A 1S66L 4F3LA 4GCZA 4HH2A 1T18A 2I9VA 1S1ZA 1S67L 2P7JA 3BY8A 3GDIA 3MQQA 3IS2A 3LICA 3NJAA 4LRXC 4JGPA 5J3WA 2JN7A 3FG8A 4JGQA 1GSVA 5DKKA 1VB6A 1OT9A 2CMNA 2L4RA 5F68A 1JNUA 4WUJA 1S1YA 4M4XA 4I38A 5HDSA 1GSWA 1G28A 4EERA 3E4QA 1F98A 3LIDA 5KIZA 3A0RA 3EEHA 2QWSA 1T1AA 1TS0A 3CWFA 3PYPA 1UWPX 4HJ4A 3NOTC 1P0ZA 4HH3A 3LYXA 1S4SA 3MFXA 4WN5A 3H82A 4L9EA 1S4RA 2V9AA 3A0SA 3K3CA 4LPZA 1DP9A 1TS6A 2M1CA 4YWZA 1LSVA 3MQOA 3B33A 3LIEA 1T1CA 5J7EA 2V0UA 2D02A 2B02A 3H9WA 3LI8A 4NXGA 5DJUA 4EW7A 5I5LA 4WF0A 5TBMA 1MZUA 2ZOIA 3IS2B 4HJ6A 5J4EA 2KDKA 2VLGA 1DP6A 4PKYG 4EESA 3IBRA 2L0WA 3UE6A 5HWTA 4BBUA 2V1BA 2OOLA 2OWJA 2WKRA 3LI9A 5DKLA 4KUKA 3LUQA 2PDRA 3F1OA 4JGOA 4NXBA 4EETB 2YKFA 2H28A 3E4OA 4LLOB 2WKQA 1T19A 3EWKA 2JHEA 1OJGA 2Z6DA 4GHIA 5HWVA 3LIFA 1XFNA 4K08A 3T50A 1TS7A 2QJ5A 5HWWA 1X0OA 3F1NB 1XFQA 5EFWA 4GW9A 4R38A 1EW0A 4HJ3A 4HNBA 4GS9A 3C2WA 2W0NA 4LRYC 4MN5A 2W27A 2VV6A 4R3AA 5IS1A 1N9NA 1OTAA 2PR6A 3GECA 3LIAA 2YKHA 2PD8A 3FC7A 4HOIA 4I3AA 4WLAA 3UB9A 4R70A 4I3IA 3NOUC 5AVFA 3E4PA 1V9YA 3MXQA 3UMEA 4EEUA 5DJTA 3VE4A 3H7WA 5HDDA 1OT6A 4MN6A 4I5SA 3G6OA 5G4YA 2PYRA 4EEPA 4HP9A 3PHYA 5HSQA 2A24B 1LSXA 2KX6A 1WA9A 2Z6CA 3RTYA 4HY8A 2QJ7A 1OTDA 2VV8A 2ZOHA 4L9GA 5F5YA 5HZHA 2D01A 2BASA
chains in the Genus database with same CATH superfamily
2JC7A 1E4DA 2J7VA 2V20A 3PAEA 5G4ZA 5FL3A 2MJ6A 4JXGA 2EXBA 4OH0A 3ISGA 3E0YA 5CTMA 3T1QB 2HDSA 2PYPA 3MR0A 3MMHA 3KSGA 4MBKA 5FI2A 5EM0A 1JWPA 4S2LA 4FTXA 1ZC2A 1ESUA 5GLAA 1K55C 4RQ9A 4YFMA 1VEUB 3S7QA 1N9LA 2R9XA 2VZWA 2Y2OA 3IX8A 3TRCA 4GDBA 2QKPA 2K7SA 1TVFA 1YLJA 2XH9A 3AGFA 4KZAA 2C6WB 3NDEA 4E3NA 4WUJA 2ZC7A 3S7OA 3NC8A 3LIDA 3V67A 1YPRA 4CJNA 3V39A 4D2OA 2EWVA 2XR0A 1G5UA 5CRFA 1KGEA 1JTGA 2XGNA 4KG6A 5J4EA 2V1BA 3IWQA 4EWFA 2GZAA 4ETZA 3LUQA 4JF5A 2M7UA 5KZHA 1IKIA 3MQ0A 1FILA 1DJAA 5IS1A 4GS9A 3AGEA 2VV6A 4Y0TA 3L9KA 4QPRA 1YSPA 4I5SA 4UQIM 4JKTA 4NG2A 1MXOA 1SKFA 2D01A 5EVLA 5CHJA 4PM6A 5DF8A 2UV0E 4PHTA 2W1RA 3ULFA 2J3TD 3C7UA 1TF1A 2A24A 5CTNA 3S4XA 3G2ZA 5A90A 4CLCA 2VGLS 1W79A 3WWXA 3C4OA 4IJGA 2NUPC 4MMNA 3IHAA 3UB6A 3VFHA 4DXCA 2ZL1B 1FCMA 1ZKJA 3EQVA 3SH7A 2JKRI 5G18A 2UWXA 2Y2JA 2ZQ7A 4FCFA 1S66L 4UA7A 3GDIA 3NJAA 3IXBA 1DJBA 5DKKA 4XXRA 3FYZA 4X68A 1NZUA 2V8CA 4HH3A 1MKIA 2V9AA 4OLDA 4FOFA 4JLFA 3OOVA 4RX3A 2B02A 4IHQA 1M6KA 5TBMA 4DDYA 3IS2B 3NULA 5CEDA 2AVXA 4BBUA 5EVIC 2Y2QA 3EQUA 3F1OA 5FI6A 5FASA 4K08A 1ES2A 5EFWA 4GW9A 4O01A 3C2WA 3KO6A 4OLGA 5FATA 4I3AA 3D9YA 2WKHA 3G32A 4O0PA 5KSHA 4DE0A 1CEGA 3PHYA 2J3TC 3A3EA 3ZNTA 3KYQA 4HY8A 2WAFA 3RXXA 4II7A 4UEYA 3OCLA 2ZBBA 3LFVA 1F9IA 2FZ0A 3VSKA 4AFIA 2PHYA 1XJ3A 4R1GA 1IYQA 3D4FA 1PWDA 4HIAA 4FD8A 5D3OA 1D06A 4XT2A 2DRWA 5K5BA 4Y0OA 4UHUA 3T4QA 4ARZB 5DTSA 4PM9A 1N9BA 1CK3A 2G2UA 4Q0HA 1W8QA 1D7EA 4MCWA 3U2AA 3V5MA 3NIAA 1LSWA 5EVIA 2Y8HA 3BY8A 1I2WA 2W3HA 4P85A 4OQGA 4K91A 1NJ4A 1VB6A 2XROA 3FKVA 5HDSA 1G28A 2OSUA 5EM1A 1F98A 4X1MA 4PAUA 4OKPA 4EQIA 1OPXA 2M1CA 3IX4A 3DW0A 4P87A 3HBRA 1YAXA 3VOZA 1DJCA 1I5QA 3QP4A 3QNCA 1PW1A 1QMEA 3ZCZA 5HWTA 3BM6A 2PU4A 5U47A 3IXGA 4YINA 2HJEA 3R7WB 3HLDA 4MN5A 2WGWB 4UAAA 1IELA 4KZ8A 4X56A 5HL6A 1CI9A 3G6OA 2HP9A 3BW6A 3IF6A 1EROA 3W4PA 1NLZA 2FFYA 2LB9A 1XKZA 3WS5A 1BSGA 3HLEA 3TW8A 1XP4A 3RXWA 1GA0A 4FSFA 4GNUA 1ONHA 4U0XA 5KMWA 1SDNA 1MWRA 1VM1A 3UE0A 5HAIA 4G3KA 4WZ5C 4HESA 2GX5A 4P6ZM 2EX6A 4S2NC 2XD5A 1W5DA 1MKMA 4KG5A 3SH9A 4KZBA 1FR1A 3BJNA 3OC2A 5L07A 2G7UA 1N9OA 3CPTA 2HGVA 3MSHA 4NEED 4EQ1A 1KGGA 2HZ5A 2Z2LB 4EBLA 4ME4A 2OWHA 1NWZA 3SS3A 2J80A 3Q7VB 4LRXC 4E3MA 5BOHA 3VOYA 4OP5A 1SHVA 3O88A 3T4OA 3LEQA 5TR7A 3BECA 3NOTC 1ERQA 3TG9A 1F5MA 4R0QA 1XGIA 3LEZA 1DY6A 5AJGA 5FQ9A 5FAPA 4KENB 3MQOA 2XK1A 3CJMA 4IBRA 3S7NA 4PPRA 1YMSA 2OOLA 2QYBA 1E3UD 4NXBA 2I72A 3BEBA 4LV2A 2J9OA 2ZC6B 3NBLA 1L2SA 4E3JA 5EOEA 4R23A 5CHMA 1PYYA 4WZ5A 1VEUA 3ZG8B 5CHUA 5F1FA 4QY6A 1L0EA 4Q0IA 1Y54A 2KX6A 1RGYA 4WEJA 5CXWA 3WRTA 5C5KA 2PRFA 4P6BA 2HDRA 1NY0A 1MBLA 2HDQA 3BFGA 3FPWA 4ETXA 2WZZA 1L0FA 2ZJ9A 1G68A 4LRZE 3H82B 2PBDP 2V2FF 2ZC5B 2E8IA 1GHPA 4PM5A 3D72A 1FOFA 4PM8A 3N8SA 4IVIA 1HTZA 4KZ9A 1V9ZA 3VMAA 3C4PA 3OBFA 4GS9B 1PWGA 1S1ZA 4DRTA 4X6TA 4Y15A 1FQGA 2L4RA 3IBJA 5HPFA 3MXSA 4Y13A 1W8YA 2QWSA 5DFYA 3LYXA 3MFXA 3K3CA 3A3FA 1EI5A 3IWOA 4YWZA 4G3VA 3TOIA 3A3IA 3LY3A 3WS2A 3T4LA 4WF0A 5EE8A 5DFXA 3IBRA 2HP6A 3FV7A 2H28A 4MBHA 4D60A 2FFFB 1G6AA 2QJ5A 4HBTA 2KLIA 4HNBA 5E2FA 2PD8A 3ZYTA 2JKRM 3UMEA 3VE4A 3CG5A 3PBOA 5G4YA 3PBQA 2BTFP 1KGFA 3MZEA 3DAVA 4IVKA 2Z6CA 5TFQA 3TE8A 1K4EA 5FA7A 4L9GA 4UQIS 3IQAA 4P6ZS 3RFBA 5HX9A 4U0TA 4MN7A 4I39A 4M3KA 4BWIA 4DN0A 3O3VA 5HD5A 4LCMA 1BYWA 3D3OA 3BLMA 3IXHA 4DJ2A 1P9WA 4E3OA 3SOIA 2Y79A 2EWWA 3M6HA 3T1XA 4IUKA 4PM7A 3O5YA 4GB7A 3N7WA 1IYPA 4X1LA 4XT2B 5FI7A 4JGQA 4GN2A 4QY5A 2ZMFA 1L3LA 5F82A 5A91A 5DF7A 3G30A 5EVID 4XUXA 2H0YA 2Y2KA 4P0MA 1TDLA 3BLSA 2ZQDA 4H8RA 2ZLYA 1E25A 1H8MA 4JF4A 4DMZA 1XA1A 1T19A 3LCEA 5E2GA 3T50A 2DMWA 3HUOA 1PI4A 5CGXA 1EW0A 2HPBA 4LV0A 3UPNA 4S2IA 3E4PA 1V9YA 2X02A 4JXWA 4N92A 3MBZA 3FZCA 4BLMA 1SZVA 3CI6A 5M1AA 1RP5A 3B42A 4S2OA 3ZG5A 3G2YA 4DJ3A 3MZFA 4ZBEA 3UB8A 2VEAA 3F1OB 5A8BA 2M7VA 3VFFA 5HD3A 4B93A 4BBVA 4WMCD 2W1TB 3HLGA 3T4JA 2W3EA 3MKFA 4FH4A 1K0KA 1MC0A 1Q2QA 2Y55A 3HJIA 3RH8B 4RYEA 4S2JA 2NUTC 2XDMA 3BY9A 3ZQ5A 3KSIA 4YNRA 2P7JA 3IS2A 2GNXA 1HVBA 3CUEC 4KQRA 5F68A 4GZBA 3SS5A 2BG1A 4HJ4A 1LI0A 1TS0A 2OLVA 3PBRA 4KG2A 3S22A 3E2KA 4KQQA 1S0WA 2ZOIA 1CQAA 1K54A 5M19A 3W8KA 3MKEA 2OWJA 2CC1A 3LI9A 2PDRA 5AQ9A 3PR6A 4JGOA 4N1HA 3T4KA 2JCHA 3EWKA 4JBFA 3PBSA 4K0WA 2Y2NA 3G4PA 1H0MA 1N9NA 1W63Q 2KOIA 1ZG6A 3LGOA 4DKIA 4ID4A 3BFEA 1H5XA 1BLPA 4Q0JA 1LSXA 1XX2A 2QJ7A 4JGRA 5DTKA 2XRNA 3OLOA 3NOPC 3HJKA 4EBNA 2ZQCA 3KSHA 5AQAA 2EX2A 3DTIA 4KQDA 3C8CA 3FWLA 3VOLA 5CGSA 4BMWA 2ZQAA 1LHYA 2VX8A 4ZJ3A 3CLOA 1CI8A 1K25A 3EGXC 4LCLA 3ZG0A 3TJZC 5EV0A 3G35A 2VGLM 2EA9A 3ZVTA 3VSLA 1GA9A 4BL3A 2QPNA 4E04A 3UB7A 2PAVP 4HBUA 2ZQ8A 1YSQA 2IWBA 3FG8A 3AGDA 1BUEA 2EX8A 2P9VA 4EU0A 1JNUA 2WKIA 4I38A 3DWZA 1MY8A 1MWSA 3ZNYA 1RGZA 4FH2A 1ONGA 3HLWA 1TS6A 3KYEA 5FSRA 3OPRA 3B33A 1K56D 1ZG4A 5J7EA 2V0UA 2WGWA 2W1TA 2A2LA 4HJ6A 3GMWA 5CERA 4PKYG 2Z2MB 4O8GA 5LBRA 1Y4OA 2ZM8A 1ES4A 2WKQA 3OPHA 1VHMA 3F1NB 1XFQA 3JPUA 2ZM2A 5HFOA 2W0NA 3GV9A 4DE2A 4B4XA 1P9RA 3H7WA 1XGJA 2FH5A 3W4QA 4EEPA 1HLUP 1PZOA 1PNEA 5DTTA 4GKUA 4IUHA 1OTDA 3NY4A 4LGWA 1PIOA 4BENA 5MC7A 3F1PA 1WYBA 3VP2A 4U3TA 1VETB 4OPZA 2IWCA 4HHDA 4G3WA 3ICYA 3VE3A 3Q7VA 4NXFA 5IHVA 1BLHA 3F1PB 4JXVA 1Y28A 3IWIA 1DRMA 4QD4A 2OAP1 5HAQA 2VGKA 1YLYA 1YLWA 1LL8A 2XEPA 3T4SA 2VA0A 4NKPA 1DP8A 3JVUA 5GHXA 2W3DA 3EGDC 3UN7A 5GHYA 4KZ4A 4JXSA 5F69A 4BJPA 3HUNA 4QWOA 1ESIA 1T18A 1AXBA 3LICA 4Y7PA 4EUVA 1OT9A 3IHBA 2B5RA 2VGJA 5A93A 5EECA 2JE5A 3B47A 3PYPA 3SW1A 4GDNA 4OP8A 3H82A 5FQKA 3ZVWA 4Q8IA 1FCOA 2OLUA 1WYCA 2EFXA 5E43A 5KSCA 4RX2A 1K57A 4CLCE 5DKLA 5F1GA 2ZD8A 4Y3IA 2YKFA 2ZM0A 4LLOB 4BL2A 3ZG9B 4EUZA 3BRMA 3B3XA 3LR4A 3VP3A 1LLBA 4Y5FA 1RCJA 2RL3A 4R3AA 2XQZA 4XUZA 3GECA 1L0DA 2WZXA 4S2KA 4R70A 3MXQA 2K2NA 1CF0A 4FUWA 3GSGA 4HEFA 2ZC4B 4KZ6A 2A24B 1K54C 3SH8A 3R4KA 4BQMA 3UE3A 2VV8A 4CLCB 4RA7A 4OONA 2QMIA 2PBYA 3A0VA 2GDNA 3P98A 3FKWA 4KUOA 1LT0A 4NXEA 2XA7M 3UDFA 2EFUA 3SZTA 2JKTM 1JTDA 3MJQA 4C6YA 3WRZA 4C75A 4LENA 4IEDA 1XJ4A 4DE3A 2JBFA 2Y2LA 4Y0UA 3KSFA 3H7WB 1G6OA 2Q0OA 5GHZA 3LR3A 2Y59A 4UA6A 3KYZA 3C38A 3LR5A 3GR2A 3TSGA 4R4SA 4E3KA 2H5SA 4OPRA 3EEHA 4MDZA 1UWPX 4A5RA 5HAPA 1MPLA 2VK3A 4WYYA 1LL5A 2O9CA 3N4IA 1DP6A 4EETB 2ZMVA 2W3FA 3O87A 1O07A 2Z6DA 1XFNA 5HWWA 4GJ4A 3Q7ZA 4R38A 3CITA 2YKHA 4RVAA 5AVFA 3NOUC 3BFDA 1GHIA 5HL1A 1OT6A 2E8JA 4KZ5A 2HP5A 1WA9A 4ZAMA 1ZHHB 3S1YA 4DXBA 2ZC3B 3UPPA 1YKDA 4Z9QA 1SDEA 2C5WB 4HI4A 1H8YA 4OQIA 3WS4A 1ODVA 4MBFA 5J8XA 3VV4A 4ARZA 3ZGAB 2P08A 5DF9A 5F6AA 4LV3A 2RCXA 3ZDJA 2V1AA 1PZPA 1XJ2A 4F3LB 3PAGA 4I3JA 2OAQ1 1STZA 1BULA 3HLFA 4ZJ1A 3PXPA 5HDCA 3E98A 4X53A 3UMDA 5GLDA 4HQAA 3Q1FA 1S67L 4QU3A 2OV5A 3O86A 3T1SA 4Y2FA 1YMXA 4GOGA 1GSWA 2Q9MA 3A0RA 4CPKA 1YLTA 3A0SA 3QHYA 3I7JA 4OOMA 2D02A 1KDWA 1LI9A 1L0GA 2JKTI 3BFCA 5AQ7A 1JWZA 4E6WA 3IT9A 4KUKA 3SS4A 3Q07A 4N1XA 1K56A 5FQMA 1OJGA 4GHIA 5HWVA 4MNRA 3UE1A 1MWUA 1TS7A 2EX9A 1PI5A 3QP1A 4BD1A 3FC7A 4HOIA 1I2SA 4N9KA 1PFLA 2O0YA 1W7FA 2XD1A 3NDGA 1K57C 3PBTA 1NYMA 3VP0A 1YQSA 3L7HA 4CLCD 4DF6A 4Z1WA 3VP1A 4IBXA 2P9VB 1VQQA 1EWZA 2WK0A 4X69A 2A49A 4QB8A 1LL9A 3CAXA 4BD0A 3V3SA 4NETA 3GTCA 1NZOA 2JKGA 3UDIA 5HARA 3BWLA 2VV7A 3CHWP 3WS1A 3EEAA 2L1MA 2XFSA 4EXOA 1T1BA 4OVDA 3BFFA 1C3BA 5GL9A 3C7VA 4DDSA 2XLNA 4LFUA 1QMFA 1KVMA 3KX0X 2X71A 2R78A 1O7EA 1WE4A 3IH8A 5E2HA 3QP2A 5L2FA 4R6LA 1KE3A 3A3JA 3DBAA 2JN7A 1FCNA 3HLBA 3QP5A 2PU2A 3HL9A 2HDUA 4M4XA 4EERA 2WGVA 1U60A 4WN5A 5EVEA 2Y2GA 3GVBA 3P09A 3H9WA 4EW7A 5DJUA 1ES3A 3HUMA 1MZUA 3V3RA 4ZTKA 3UE6A 3EOIA 2WKRA 5E2EA 2R9WA 1TD5A 3QP6A 3UY6A 2V1ZA 4NK3A 2QZ6A 3JVVA 3DTMA 4HJ3A 5HW3A 5CECA 5FEFA 4I3IA 5DJTA 3N8RA 4LV1A 4OOYA 1NRFA 3K2NA 4EV4A 2DCFA 3S7PA 5F5YA 4OPYA 3IF6C 1K4FA 1MWTA 4KQOA 1IYSA 2PT7A 5FAOA 5FDHA 2GJ3A 4JF6A 1NLYA 1YT4A 3W2ZA 4ESPA 4GHIB 1AWIA 3R7WA 1IOUA 3UO9A 2HV1A 2G2WA 1F2KA 2H0TA 2INWA 2DNSA 2W3GA 3P7NA 2H10A 2Y2IA 4EBPA 1YM1A 2Y4AA 1SKOA 4HP4A 1TS8A 1HZOA 4L9FA 4MLLA 3HVFA 2WKPA 1S6RA 1XJ6A 5AVEA 2I9VA 2WAEA 4CQHA 1J9MA 3N8LA 1GSVA 4OQHA 2CMNA 4B88A 1S1YA 2ACGA 1SKOB 1M40A 4GD6A 5FEGA 3IX3A 4L9EA 4LPZA 2O9AA 2Y2PA 5IT5A 4QJGA 3DWKA 2EXAA 3M6BA 2VLGA 3CPTB 4KZ3A 2IWDA 1PRQA 3IH9A 2V8FA 3NI9A 1ALQA 1X0OA 3Q81A 1OTAA 3LIAA 5L8MA 3QNBA 5FQIA 4OQ0A 1VETA 2ZL1A 3LO7A 1E3UA 3CZDA 5EOOA 3A3DA 5CEBA 5JYPA 4L0LA 2HF6A 1FSYA 4WL9A 1Z6FA 3OPLA 1KE0A 1K38A 2WKEA 2PR5A 1OTBA 3NHQA 1IKGA 3T4TA 2XA7S 1FR6A 5TBMB 1GSXA 4OPQA 4B9OA 2VKSA 3W4OA 3ITAA 3K3DA 4CLCC 2V0WA 4BBTA 4PMAA 1OJ5A 2Y91A 1D1JA 3CUEA 2P74A 1H3QA 3BYDA 1KVLA 4F3LA 3HREA 4E6XA 3ZHHA 4S2PA 1YLPA 3JYIA 2B18A 4JGPA 4WEKA 2WADA 1S4SA 3UPOA 1S4RA 3GQZA 1FIKA 3ZFZA 3GRJA 4NXGA 4ZDXA 5I5LA 4WMCA 2JKFA 1IYOA 1TDGA 4R3JA 4WBGA 1FSWA 4WZ4A 1J3WA 3NCKA 3UDXA 1BZAA 1BTLA 2XF3A 5FQJA 3UB5P 3MXRA 4S2MA 3BQ8A 2ZMAA 2A3UA 4WLAA 3IXDA 5CGWA 5HSQA 1PW8A 5EVIB 3RJUA 1KE4A 3G34A 5HDDA 3MFDA 4WM9A 4H6JA 1OMEA 4WELA 2X01A 5L09A 5FQQA 1P97A 1XA7A 4X55A 3NECA 1UGUA 1TEMA 5HPIA 1KDSA 1JWVA 3UNWA 1JVJA 4H6JB 4GLQA 1Z09A 3M2KA 2Q9NA 1ES5A 1N4OA 3P01A 3F1NA 2O9BA 3C5AA 3PTEA 4N9LA 2P04A 4GCZA 4HH2A 3MQQA 2IA2A 2Y2HA 2WYXA 3C30A 5J3WA 3Q82A 3WS0A 4ZJ2A 4F94A 1BLCA 2B95A 3OPPA 3IF6B 5KIZA 2J8YA 4Y17A 3DTEA 5GLCA 1P0ZA 3OZHA 5DVAA 5TJJA 3LIEA 2BLSA 3LI8A 1K6RA 3T12B 1CJFA 4R3BA 2KDKA 3MZDA 3M2JA 5TGFA 4KZ7A 3E4OA 3E2LA 3MF0A 2JHEA 1SCWA 1ACFA 1XPBA 1IFQA 3LR0A 3LY4A 2W27A 2PR6A 2ZQ9A 3UB9A 4ZRRA 2Y2MA 3QP8A 4HP9A 4QHCA 1Q2PA 2XFTA 5GLBA 3OCNA 4C3QA 5JYOA 1ZTUA 5HZHA 3VP4A 4O7DA 2BASA 2PD7A 1UWNX 4UA9A 5M18A 1KOUA 5FAQA 5IU1A 1W63M 1OTIA 5AQBA 5F83A 5A92A 3LIBA 5EUAA 1IEMA 5CX7A 4R4RA 4E3LA 4S2NA 4YOFA 2QHKA 1OTEA 3T1RA 4PKYA 1NYYA 2HJ9C 1NRJA 1XXMA 5L10A 3G31A 3MS6A 2J9PA 1PWCA 2O99A 2VJWA 3E4QA 2WUQA 1T1AA 3CWFA 1CEFA 3N6IA 1K55A 4DE1A 1DP9A 1HD8A 1LSVA 1A0KA 1T1CA 1BT5A 1NXYA 4X25A 3V50A 1BLSA 4EESA 2WGIA 2L0WA 3CMZA 3IF5A 3BQAA 4OOLA 4E3IA 1GCEA 4B4ZA 3DTKA 3LIFA 1H8ZA 3HCYA 4LRYC 2XSSA 3FPVA 3PBNA 1ERMA 4JPMA 5EPHA 2J3WA 4EEUA 3ITBA 4MN6A 2LB5A 3U4LP 1GHMA 1K6SA 2PYRA 4GD8A 5I94A 2K31A 1YLZA 3HLCA 4MEZA 3RTYA 2ZOHA 4K0XA 3ZG7B 5FDSA
chains in the Genus database with same CATH topology
5MC7A 3F1PA 4KQOA 2PT7A 5G4ZA 5FL3A 3FPWA 2MJ6A 2GJ3A 4ETXA 3E0YA 1NLYA 4HHDA 4G3WA 3H82B 4LRZE 3W2ZA 3ICYA 4GHIB 3R7WA 2PYPA 3MR0A 3VE3A 3MMHA 3KSGA 1IOUA 4NXFA 2HV1A 2INWA 3F1PB 2W3GA 3P7NA 1Y28A 4RQ9A 3D72A 1DRMA 2OAP1 3S7QA 1N9LA 1LL8A 4HP4A 2VA0A 2VZWA 1DP8A 3JVUA 1V9ZA 4NKPA 3T4SA 1TS8A 2W3DA 4L9FA 3EGDC 3OBFA 2WKPA 3TRCA 1XJ6A 4GS9B 2QKPA 2K7SA 5AVEA 5F69A 4BJPA 1T18A 2I9VA 1S1ZA 3LICA 4CQHA 4EUVA 1GSVA 2CMNA 1OT9A 2L4RA 4WUJA 3IBJA 1S1YA 5HPFA 3S7OA 3LIDA 3V67A 3B47A 3PYPA 2QWSA 3SW1A 5DFYA 3LYXA 3MFXA 3H82A 4L9EA 3K3CA 4LPZA 2O9AA 2EWVA 4YWZA 4G3VA 5IT5A 3T4LA 4WF0A 5J4EA 2VLGA 5DFXA 3IBRA 4CLCE 2V1BA 2GZAA 5DKLA 4ETZA 3LUQA 4Y3IA 2YKFA 2H28A 4LLOB 2M7UA 3MQ0A 2QJ5A 1X0OA 3LR4A 4Y5FA 2KLIA 4HNBA 4GS9A 5IS1A 2VV6A 4R3AA 1OTAA 3GECA 3LIAA 4QPRA 2PD8A 3ZYTA 5L8MA 4R70A 2JKRM 1YSPA 3MXQA 3UMEA 2K2NA 3VE4A 4I5SA 3PBOA 5G4YA 4UQIM 3PBQA 2A24B 2Z6CA 3R4KA 3TE8A 3UE3A 2VV8A 4L9GA 4CLCB 2D01A 4UQIS 4L0LA 3A0VA 4P6ZS 2HF6A 4WL9A 3RFBA 4PHTA 2W1RA 3ULFA 4KUOA 1LT0A 2J3TD 2XA7M 4MN7A 4I39A 4NXEA 4BWIA 4DN0A 1TF1A 5HD5A 2PR5A 1OTBA 2A24A 3NHQA 2JKTM 3MJQA 3T4TA 2XA7S 4CLCA 5TBMB 1BYWA 1XJ4A 1GSXA 3D3OA 4B9OA 2VGLS 2VKSA 4DJ2A 4IJGA 1P9WA 2NUPC 4MMNA 3K3DA 3UB6A 4CLCC 2V0WA 3KSFA 3H7WB 4BBTA 2Y79A 1G6OA 1OJ5A 2EWWA 3LR3A 3EQVA 3CUEA 1H3QA 4IUKA 2JKRI 3O5YA 1S66L 3KYZA 4F3LA 3GDIA 3NJAA 4XT2B 3C38A 4JGQA 2ZMFA 5DKKA 3LR5A 2B18A 3EEHA 4JGPA 4MDZA 4WEKA 1UWPX 4HH3A 1S4SA 1S4RA 2V9AA 4FOFA 3OOVA 4NXGA 2B02A 4IHQA 2O9CA 5I5LA 5TBMA 3IS2B 1DP6A 4BBUA 4EETB 3EQUA 1H8MA 3F1OA 2ZMVA 2W3FA 4DMZA 1T19A 2Z6DA 1XFNA 4K08A 3T50A 5HWWA 4GJ4A 2DMWA 5EFWA 3BQ8A 4GW9A 4R38A 4O01A 1EW0A 3C2WA 3KO6A 3CITA 2YKHA 4I3AA 4WLAA 3NOUC 5AVFA 3E4PA 1V9YA 4O0PA 5KSHA 1OT6A 3PHYA 2J3TC 3CI6A 5HSQA 1WA9A 1ZHHB 3KYQA 4HY8A 3B42A 5HDDA 1YKDA 4II7A 4DJ3A 4H6JA 4HI4A 4UEYA 3OCLA 2ZBBA 3LFVA 1F9IA 2FZ0A 4AFIA 1ODVA 2PHYA 1XJ3A 4WELA 2VEAA 3UB8A 3VV4A 4ARZA 3F1OB 5A8BA 2M7VA 1P97A 5HD3A 2P08A 1UGUA 4HIAA 5DF9A 4B93A 5F6AA 4BBVA 5HPIA 2W1TB 2V1AA 1XJ2A 4F3LB 3T4JA 1D06A 2W3EA 4H6JB 4XT2A 4I3JA 2OAQ1 1STZA 4GLQA 5K5BA 3T4QA 1MC0A 3PXPA 3HJIA 4ARZB 3RH8B 5HDCA 3E98A 4Q0HA 3P01A 2NUTC 3F1NA 2O9BA 1D7EA 3BY9A 4MCWA 3U2AA 3ZQ5A 3UMDA 1LSWA 2P04A 4HQAA 4GCZA 2Y8HA 4HH2A 3KSIA 2P7JA 3BY8A 3MQQA 1S67L 4YNRA 2W3HA 2IA2A 3C30A 3IS2A 5J3WA 2GNXA 3CUEC 1VB6A 4Y2FA 5F68A 2XROA 5HDSA 1GSWA 1G28A 1F98A 5KIZA 3A0RA 4HJ4A 1TS0A 4PAUA 1P0ZA 3A0SA 1OPXA 3PBRA 2M1CA 5TJJA 4OOMA 1YAXA 3LIEA 2D02A 3LI8A 2ZOIA 2JKTI 2KDKA 5HWTA 2OWJA 3LI9A 4KUKA 2PDRA 3PR6A 4JGOA 3T4KA 3E4OA 3EWKA 3MF0A 2JHEA 3PBSA 1OJGA 4GHIA 5HWVA 2HJEA 1IFQA 3R7WB 1TS7A 3LR0A 4MN5A 2W27A 1N9NA 2PR6A 1W63Q 3FC7A 4HOIA 3UB9A 2KOIA 4ZRRA 5HL6A 3G6OA 2O0YA 3BW6A 4HP9A 4Q0JA 1LSXA 3PBTA 1NLZA 3OCNA 2QJ7A 4CLCD 2LB9A 4Z1WA 1ZTUA 5HZHA 3TW8A 4JGRA 2BASA 2XRNA 2PD7A 1UWNX 3OLOA 1KOUA 3HJKA 3NOPC 5IU1A 4FSFA 1W63M 3KSHA 1OTIA 4KQDA 4G3KA 3C8CA 3CAXA 3LIBA 3VOLA 2GX5A 4P6ZM 4BMWA 2VX8A 1MKMA 5CX7A 3BWLA 2VV7A 3EEAA 3BJNA 2L1MA 3OC2A 4EXOA 1T1BA 2G7UA 3CLOA 1N9OA 2HGVA 3EGXC 2QHKA 4NEED 4YOFA 4EQ1A 3TJZC 1OTEA 3KX0X 2VGLM 4ME4A 2EA9A 2OWHA 2R78A 4PKYA 1NWZA 4E04A 2HJ9C 3UB7A 1NRJA 2J80A 4R6LA 3DBAA 1YSQA 4LRXC 2JN7A 3FG8A 4EU0A 1JNUA 3T4OA 4M4XA 4I38A 4EERA 2O99A 2VJWA 3E4QA 1T1AA 3CWFA 4WN5A 3NOTC 1F5MA 1DP9A 1TS6A 1LSVA 5AJGA 3MQOA 3B33A 1T1CA 5J7EA 2V0UA 3H9WA 4EW7A 2W1TA 5DJUA 2A2LA 1MZUA 4HJ6A 4PKYG 4EESA 3S7NA 4O8GA 2L0WA 5LBRA 3UE6A 3EOIA 2OOLA 2WKRA 2QYBA 1TD5A 4NXBA 3BQAA 4OOLA 2WKQA 1VHMA 3LIFA 3F1NB 1XFQA 3HCYA 4LRYC 2XSSA 3JVVA 4HJ3A 2W0NA 3FPVA 3PBNA 4I3IA 2J3WA 4EEUA 5DJTA 1P9RA 3H7WA 4MN6A 2LB5A 3K2NA 2FH5A 2PYRA 2K31A 4EEPA 4Q0IA 2KX6A 4WEJA 3RTYA 3S7PA 4IUHA 5C5KA 1OTDA 2ZOHA 5F5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PD7 A;  1UWN X;  3OLO A;  4DJ3 A;  3F1P A;  3A0V A;  4H6J A;  4HI4 A;  4WL9 A;  2ZBB A;  1KOU A;  3HJK A;  3NOP C;  1F9I A;  5IU1 A;  5G4Z A;  1ODV A;  1OTI A;  2PHY A;  1XJ3 A;  2GJ3 A;  2VEA A;  4KQD A;  1LT0 A;  4KUO A;  4NXE A;  3UB8 A;  4I39 A;  3ULF A;  3F1O B;  5HD5 A;  4HHD A;  3C8C A;  2PR5 A;  3CAX A;  1OTB A;  2A24 A;  3H82 B;  3LIB A;  3NHQ A;  4LRZ E;  3VOL A;  5A8B A;  1P97 A;  5HD3 A;  3ICY A;  4GHI B;  3MJQ A;  4JGR A;  1UGU A;  4HIA A;  2PYP A;  3MR0 A;  5F6A A;  3VE3 A;  4BBV A;  3BWL A;  2VV7 A;  4NXF A;  2V1A A;  2HV1 A;  1XJ2 A;  1BYW A;  1XJ4 A;  1GSX A;  5TBM B;  4F3L B;  2L1M A;  4XT2 B;  2INW A;  4B9O A;  1D06 A;  3F1P B;  4H6J B;  4XT2 A;  1T1B A;  3CLO A;  4I3J A;  1N9O A;  3P7N A;  4EXO A;  1Y28 A;  4RQ9 A;  3D72 A;  4DJ2 A;  1DRM A;  2QHK A;  4EQ1 A;  3K3D A;  3SW1 A;  3UB6 A;  1OTE A;  2V0W A;  3H7W B;  1N9L A;  3HJI A;  1LL8 A;  3RH8 B;  4BBT A;  3KX0 X;  5HDC A;  1OJ5 A;  4HP4 A;  1DP8 A;  2EA9 A;  1V9Z A;  1TS8 A;  2OWH A;  2R78 A;  3F1N A;  1D7E A;  1NWZ A;  3BY9 A;  4L9F A;  4PKY A;  3ZQ5 A;  2WKP A;  4E04 A;  1XJ6 A;  4GS9 B;  3UB7 A;  2QKP A;  3UMD A;  2K7S A;  2J80 A;  1LSW A;  5AVE A;  4R6L A;  4HQA A;  5F69 A;  1S66 L;  4F3L A;  4GCZ A;  4HH2 A;  1T18 A;  2I9V A;  1S1Z A;  1S67 L;  2P7J A;  3BY8 A;  3GDI A;  3MQQ A;  3IS2 A;  3LIC A;  3NJA A;  4LRX C;  4JGP A;  5J3W A;  2JN7 A;  3FG8 A;  4JGQ A;  1GSV A;  5DKK A;  1VB6 A;  1OT9 A;  2CMN A;  2L4R A;  5F68 A;  1JNU A;  4WUJ A;  1S1Y A;  4M4X A;  4I38 A;  5HDS A;  1GSW A;  1G28 A;  4EER A;  3E4Q A;  1F98 A;  3LID A;  5KIZ A;  3A0R A;  3EEH A;  2QWS A;  1T1A A;  1TS0 A;  3CWF A;  3PYP A;  1UWP X;  4HJ4 A;  3NOT C;  1P0Z A;  4HH3 A;  3LYX A;  1S4S A;  3MFX A;  4WN5 A;  3H82 A;  4L9E A;  1S4R A;  2V9A A;  3A0S A;  3K3C A;  4LPZ A;  1DP9 A;  1TS6 A;  2M1C A;  4YWZ A;  1LSV A;  3MQO A;  3B33 A;  3LIE A;  1T1C A;  5J7E A;  2V0U A;  2D02 A;  2B02 A;  3H9W A;  3LI8 A;  4NXG A;  5DJU A;  4EW7 A;  5I5L A;  4WF0 A;  5TBM A;  1MZU A;  2ZOI A;  3IS2 B;  4HJ6 A;  5J4E A;  2KDK A;  2VLG A;  1DP6 A;  4PKY G;  4EES A;  3IBR A;  2L0W A;  3UE6 A;  5HWT A;  4BBU A;  2V1B A;  2OOL A;  2OWJ A;  2WKR A;  3LI9 A;  5DKL A;  4KUK A;  3LUQ A;  2PDR A;  3F1O A;  4JGO A;  4NXB A;  4EET B;  2YKF A;  2H28 A;  3E4O A;  4LLO B;  2WKQ A;  1T19 A;  3EWK A;  2JHE A;  1OJG A;  2Z6D A;  4GHI A;  5HWV A;  3LIF A;  1XFN A;  4K08 A;  3T50 A;  1TS7 A;  2QJ5 A;  5HWW A;  1X0O A;  3F1N B;  1XFQ A;  5EFW A;  4GW9 A;  4R38 A;  1EW0 A;  4HJ3 A;  4HNB A;  4GS9 A;  3C2W A;  2W0N A;  4LRY C;  4MN5 A;  2W27 A;  2VV6 A;  4R3A A;  5IS1 A;  1N9N A;  1OTA A;  2PR6 A;  3GEC A;  3LIA A;  2YKH A;  2PD8 A;  3FC7 A;  4HOI A;  4I3A A;  4WLA A;  3UB9 A;  4R70 A;  4I3I A;  3NOU C;  5AVF A;  3E4P A;  1V9Y A;  3MXQ A;  3UME A;  4EEU A;  5DJT A;  3VE4 A;  3H7W A;  5HDD A;  1OT6 A;  4MN6 A;  4I5S A;  3G6O A;  5G4Y A;  2PYR A;  4EEP A;  4HP9 A;  3PHY A;  5HSQ A;  2A24 B;  1LSX A;  2KX6 A;  1WA9 A;  2Z6C A;  3RTY A;  4HY8 A;  2QJ7 A;  1OTD A;  2VV8 A;  2ZOH A;  4L9G A;  5F5Y A;  5HZH A;  2D01 A;  2BAS A; 
#chains in the Genus database with same CATH topology
 2JC7 A;  1E4D A;  2J7V A;  2V20 A;  3PAE A;  5G4Z A;  5FL3 A;  2MJ6 A;  4JXG A;  2EXB A;  4OH0 A;  3ISG A;  3E0Y A;  5CTM A;  3T1Q B;  2HDS A;  2PYP A;  3MR0 A;  3MMH A;  3KSG A;  4MBK A;  5FI2 A;  5EM0 A;  1JWP A;  4S2L A;  4FTX A;  1ZC2 A;  1ESU A;  5GLA A;  1K55 C;  4RQ9 A;  4YFM A;  1VEU B;  3S7Q A;  1N9L A;  2R9X A;  2VZW A;  2Y2O A;  3IX8 A;  3TRC A;  4GDB A;  2QKP A;  2K7S A;  1TVF A;  1YLJ A;  2XH9 A;  3AGF A;  4KZA A;  2C6W B;  3NDE A;  4E3N A;  4WUJ A;  2ZC7 A;  3S7O A;  3NC8 A;  3LID A;  3V67 A;  1YPR A;  4CJN A;  3V39 A;  4D2O A;  2EWV A;  2XR0 A;  1G5U A;  5CRF A;  1KGE A;  1JTG A;  2XGN A;  4KG6 A;  5J4E A;  2V1B A;  3IWQ A;  4EWF A;  2GZA A;  4ETZ A;  3LUQ A;  4JF5 A;  2M7U A;  5KZH A;  1IKI A;  3MQ0 A;  1FIL A;  1DJA A;  5IS1 A;  4GS9 A;  3AGE A;  2VV6 A;  4Y0T A;  3L9K A;  4QPR A;  1YSP A;  4I5S A;  4UQI M;  4JKT A;  4NG2 A;  1MXO A;  1SKF A;  2D01 A;  5EVL A;  5CHJ A;  4PM6 A;  5DF8 A;  2UV0 E;  4PHT A;  2W1R A;  3ULF A;  2J3T D;  3C7U A;  1TF1 A;  2A24 A;  5CTN A;  3S4X A;  3G2Z A;  5A90 A;  4CLC A;  2VGL S;  1W79 A;  3WWX A;  3C4O A;  4IJG A;  2NUP C;  4MMN A;  3IHA A;  3UB6 A;  3VFH A;  4DXC A;  2ZL1 B;  1FCM A;  1ZKJ A;  3EQV A;  3SH7 A;  2JKR I;  5G18 A;  2UWX A;  2Y2J A;  2ZQ7 A;  4FCF A;  1S66 L;  4UA7 A;  3GDI A;  3NJA A;  3IXB A;  1DJB A;  5DKK A;  4XXR A;  3FYZ A;  4X68 A;  1NZU A;  2V8C A;  4HH3 A;  1MKI A;  2V9A A;  4OLD A;  4FOF A;  4JLF A;  3OOV A;  4RX3 A;  2B02 A;  4IHQ A;  1M6K A;  5TBM A;  4DDY A;  3IS2 B;  3NUL A;  5CED A;  2AVX A;  4BBU A;  5EVI C;  2Y2Q A;  3EQU A;  3F1O A;  5FI6 A;  5FAS A;  4K08 A;  1ES2 A;  5EFW A;  4GW9 A;  4O01 A;  3C2W A;  3KO6 A;  4OLG A;  5FAT A;  4I3A A;  3D9Y A;  2WKH A;  3G32 A;  4O0P A;  5KSH A;  4DE0 A;  1CEG A;  3PHY A;  2J3T C;  3A3E A;  3ZNT A;  3KYQ A;  4HY8 A;  2WAF A;  3RXX A;  4II7 A;  4UEY A;  3OCL A;  2ZBB A;  3LFV A;  1F9I A;  2FZ0 A;  3VSK A;  4AFI A;  2PHY A;  1XJ3 A;  4R1G A;  1IYQ A;  3D4F A;  1PWD A;  4HIA A;  4FD8 A;  5D3O A;  1D06 A;  4XT2 A;  2DRW A;  5K5B A;  4Y0O A;  4UHU A;  3T4Q A;  4ARZ B;  5DTS A;  4PM9 A;  1N9B A;  1CK3 A;  2G2U A;  4Q0H A;  1W8Q A;  1D7E A;  4MCW A;  3U2A A;  3V5M A;  3NIA A;  1LSW A;  5EVI A;  2Y8H A;  3BY8 A;  1I2W A;  2W3H A;  4P85 A;  4OQG A;  4K91 A;  1NJ4 A;  1VB6 A;  2XRO A;  3FKV A;  5HDS A;  1G28 A;  2OSU A;  5EM1 A;  1F98 A;  4X1M A;  4PAU A;  4OKP A;  4EQI A;  1OPX A;  2M1C A;  3IX4 A;  3DW0 A;  4P87 A;  3HBR A;  1YAX A;  3VOZ A;  1DJC A;  1I5Q A;  3QP4 A;  3QNC A;  1PW1 A;  1QME A;  3ZCZ A;  5HWT A;  3BM6 A;  2PU4 A;  5U47 A;  3IXG A;  4YIN A;  2HJE A;  3R7W B;  3HLD A;  4MN5 A;  2WGW B;  4UAA A;  1IEL A;  4KZ8 A;  4X56 A;  5HL6 A;  1CI9 A;  3G6O A;  2HP9 A;  3BW6 A;  3IF6 A;  1ERO A;  3W4P A;  1NLZ A;  2FFY A;  2LB9 A;  1XKZ A;  3WS5 A;  1BSG A;  3HLE A;  3TW8 A;  1XP4 A;  3RXW A;  1GA0 A;  4FSF A;  4GNU A;  1ONH A;  4U0X A;  5KMW A;  1SDN A;  1MWR A;  1VM1 A;  3UE0 A;  5HAI A;  4G3K A;  4WZ5 C;  4HES A;  2GX5 A;  4P6Z M;  2EX6 A;  4S2N C;  2XD5 A;  1W5D A;  1MKM A;  4KG5 A;  3SH9 A;  4KZB A;  1FR1 A;  3BJN A;  3OC2 A;  5L07 A;  2G7U A;  1N9O A;  3CPT A;  2HGV A;  3MSH A;  4NEE D;  4EQ1 A;  1KGG A;  2HZ5 A;  2Z2L B;  4EBL A;  4ME4 A;  2OWH A;  1NWZ A;  3SS3 A;  2J80 A;  3Q7V B;  4LRX C;  4E3M A;  5BOH A;  3VOY A;  4OP5 A;  1SHV A;  3O88 A;  3T4O A;  3LEQ A;  5TR7 A;  3BEC A;  3NOT C;  1ERQ A;  3TG9 A;  1F5M A;  4R0Q A;  1XGI A;  3LEZ A;  1DY6 A;  5AJG A;  5FQ9 A;  5FAP A;  4KEN B;  3MQO A;  2XK1 A;  3CJM A;  4IBR A;  3S7N A;  4PPR A;  1YMS A;  2OOL A;  2QYB A;  1E3U D;  4NXB A;  2I72 A;  3BEB A;  4LV2 A;  2J9O A;  2ZC6 B;  3NBL A;  1L2S A;  4E3J A;  5EOE A;  4R23 A;  5CHM A;  1PYY A;  4WZ5 A;  1VEU A;  3ZG8 B;  5CHU A;  5F1F A;  4QY6 A;  1L0E A;  4Q0I A;  1Y54 A;  2KX6 A;  1RGY A;  4WEJ A;  5CXW A;  3WRT A;  5C5K A;  2PRF A;  4P6B A;  2HDR A;  1NY0 A;  1MBL A;  2HDQ A;  3BFG A;  3FPW A;  4ETX A;  2WZZ A;  1L0F A;  2ZJ9 A;  1G68 A;  4LRZ E;  3H82 B;  2PBD P;  2V2F F;  2ZC5 B;  2E8I A;  1GHP A;  4PM5 A;  3D72 A;  1FOF A;  4PM8 A;  3N8S A;  4IVI A;  1HTZ A;  4KZ9 A;  1V9Z A;  3VMA A;  3C4P A;  3OBF A;  4GS9 B;  1PWG A;  1S1Z A;  4DRT A;  4X6T A;  4Y15 A;  1FQG A;  2L4R A;  3IBJ A;  5HPF A;  3MXS A;  4Y13 A;  1W8Y A;  2QWS A;  5DFY A;  3LYX A;  3MFX A;  3K3C A;  3A3F A;  1EI5 A;  3IWO A;  4YWZ A;  4G3V A;  3TOI A;  3A3I A;  3LY3 A;  3WS2 A;  3T4L A;  4WF0 A;  5EE8 A;  5DFX A;  3IBR A;  2HP6 A;  3FV7 A;  2H28 A;  4MBH A;  4D60 A;  2FFF B;  1G6A A;  2QJ5 A;  4HBT A;  2KLI A;  4HNB A;  5E2F A;  2PD8 A;  3ZYT A;  2JKR M;  3UME A;  3VE4 A;  3CG5 A;  3PBO A;  5G4Y A;  3PBQ A;  2BTF P;  1KGF A;  3MZE A;  3DAV A;  4IVK A;  2Z6C A;  5TFQ A;  3TE8 A;  1K4E A;  5FA7 A;  4L9G A;  4UQI S;  3IQA A;  4P6Z S;  3RFB A;  5HX9 A;  4U0T A;  4MN7 A;  4I39 A;  4M3K A;  4BWI A;  4DN0 A;  3O3V A;  5HD5 A;  4LCM A;  1BYW A;  3D3O A;  3BLM A;  3IXH A;  4DJ2 A;  1P9W A;  4E3O A;  3SOI A;  2Y79 A;  2EWW A;  3M6H A;  3T1X A;  4IUK A;  4PM7 A;  3O5Y A;  4GB7 A;  3N7W A;  1IYP A;  4X1L A;  4XT2 B;  5FI7 A;  4JGQ A;  4GN2 A;  4QY5 A;  2ZMF A;  1L3L A;  5F82 A;  5A91 A;  5DF7 A;  3G30 A;  5EVI D;  4XUX A;  2H0Y A;  2Y2K A;  4P0M A;  1TDL A;  3BLS A;  2ZQD A;  4H8R A;  2ZLY A;  1E25 A;  1H8M A;  4JF4 A;  4DMZ A;  1XA1 A;  1T19 A;  3LCE A;  5E2G A;  3T50 A;  2DMW A;  3HUO A;  1PI4 A;  5CGX A;  1EW0 A;  2HPB A;  4LV0 A;  3UPN A;  4S2I A;  3E4P A;  1V9Y A;  2X02 A;  4JXW A;  4N92 A;  3MBZ A;  3FZC A;  4BLM A;  1SZV A;  3CI6 A;  5M1A A;  1RP5 A;  3B42 A;  4S2O A;  3ZG5 A;  3G2Y A;  4DJ3 A;  3MZF A;  4ZBE A;  3UB8 A;  2VEA A;  3F1O B;  5A8B A;  2M7V A;  3VFF A;  5HD3 A;  4B93 A;  4BBV A;  4WMC D;  2W1T B;  3HLG A;  3T4J A;  2W3E A;  3MKF A;  4FH4 A;  1K0K A;  1MC0 A;  1Q2Q A;  2Y55 A;  3HJI A;  3RH8 B;  4RYE A;  4S2J A;  2NUT C;  2XDM A;  3BY9 A;  3ZQ5 A;  3KSI A;  4YNR A;  2P7J A;  3IS2 A;  2GNX A;  1HVB A;  3CUE C;  4KQR A;  5F68 A;  4GZB A;  3SS5 A;  2BG1 A;  4HJ4 A;  1LI0 A;  1TS0 A;  2OLV A;  3PBR A;  4KG2 A;  3S22 A;  3E2K A;  4KQQ A;  1S0W A;  2ZOI A;  1CQA A;  1K54 A;  5M19 A;  3W8K A;  3MKE A;  2OWJ A;  2CC1 A;  3LI9 A;  2PDR A;  5AQ9 A;  3PR6 A;  4JGO A;  4N1H A;  3T4K A;  2JCH A;  3EWK A;  4JBF A;  3PBS A;  4K0W A;  2Y2N A;  3G4P A;  1H0M A;  1N9N A;  1W63 Q;  2KOI A;  1ZG6 A;  3LGO A;  4DKI A;  4ID4 A;  3BFE A;  1H5X A;  1BLP A;  4Q0J A;  1LSX A;  1XX2 A;  2QJ7 A;  4JGR A;  5DTK A;  2XRN A;  3OLO A;  3NOP C;  3HJK A;  4EBN A;  2ZQC A;  3KSH A;  5AQA A;  2EX2 A;  3DTI A;  4KQD A;  3C8C A;  3FWL A;  3VOL A;  5CGS A;  4BMW A;  2ZQA A;  1LHY A;  2VX8 A;  4ZJ3 A;  3CLO A;  1CI8 A;  1K25 A;  3EGX C;  4LCL A;  3ZG0 A;  3TJZ C;  5EV0 A;  3G35 A;  2VGL M;  2EA9 A;  3ZVT A;  3VSL A;  1GA9 A;  4BL3 A;  2QPN A;  4E04 A;  3UB7 A;  2PAV P;  4HBU A;  2ZQ8 A;  1YSQ A;  2IWB A;  3FG8 A;  3AGD A;  1BUE A;  2EX8 A;  2P9V A;  4EU0 A;  1JNU A;  2WKI A;  4I38 A;  3DWZ A;  1MY8 A;  1MWS A;  3ZNY A;  1RGZ A;  4FH2 A;  1ONG A;  3HLW A;  1TS6 A;  3KYE A;  5FSR A;  3OPR A;  3B33 A;  1K56 D;  1ZG4 A;  5J7E A;  2V0U A;  2WGW A;  2W1T A;  2A2L A;  4HJ6 A;  3GMW A;  5CER A;  4PKY G;  2Z2M B;  4O8G A;  5LBR A;  1Y4O A;  2ZM8 A;  1ES4 A;  2WKQ A;  3OPH A;  1VHM A;  3F1N B;  1XFQ A;  3JPU A;  2ZM2 A;  5HFO A;  2W0N A;  3GV9 A;  4DE2 A;  4B4X A;  1P9R A;  3H7W A;  1XGJ A;  2FH5 A;  3W4Q A;  4EEP A;  1HLU P;  1PZO A;  1PNE A;  5DTT A;  4GKU A;  4IUH A;  1OTD A;  3NY4 A;  4LGW A;  1PIO A;  4BEN A;  5MC7 A;  3F1P A;  1WYB A;  3VP2 A;  4U3T A;  1VET B;  4OPZ A;  2IWC A;  4HHD A;  4G3W A;  3ICY A;  3VE3 A;  3Q7V A;  4NXF A;  5IHV A;  1BLH A;  3F1P B;  4JXV A;  1Y28 A;  3IWI A;  1DRM A;  4QD4 A;  2OAP 1;  5HAQ A;  2VGK A;  1YLY A;  1YLW A;  1LL8 A;  2XEP A;  3T4S A;  2VA0 A;  4NKP A;  1DP8 A;  3JVU A;  5GHX A;  2W3D A;  3EGD C;  3UN7 A;  5GHY A;  4KZ4 A;  4JXS A;  5F69 A;  4BJP A;  3HUN A;  4QWO A;  1ESI A;  1T18 A;  1AXB A;  3LIC A;  4Y7P A;  4EUV A;  1OT9 A;  3IHB A;  2B5R A;  2VGJ A;  5A93 A;  5EEC A;  2JE5 A;  3B47 A;  3PYP A;  3SW1 A;  4GDN A;  4OP8 A;  3H82 A;  5FQK A;  3ZVW A;  4Q8I A;  1FCO A;  2OLU A;  1WYC A;  2EFX A;  5E43 A;  5KSC A;  4RX2 A;  1K57 A;  4CLC E;  5DKL A;  5F1G A;  2ZD8 A;  4Y3I A;  2YKF A;  2ZM0 A;  4LLO B;  4BL2 A;  3ZG9 B;  4EUZ A;  3BRM A;  3B3X A;  3LR4 A;  3VP3 A;  1LLB A;  4Y5F A;  1RCJ A;  2RL3 A;  4R3A A;  2XQZ A;  4XUZ A;  3GEC A;  1L0D A;  2WZX A;  4S2K A;  4R70 A;  3MXQ A;  2K2N A;  1CF0 A;  4FUW A;  3GSG A;  4HEF A;  2ZC4 B;  4KZ6 A;  2A24 B;  1K54 C;  3SH8 A;  3R4K A;  4BQM A;  3UE3 A;  2VV8 A;  4CLC B;  4RA7 A;  4OON A;  2QMI A;  2PBY A;  3A0V A;  2GDN A;  3P98 A;  3FKW A;  4KUO A;  1LT0 A;  4NXE A;  2XA7 M;  3UDF A;  2EFU A;  3SZT A;  2JKT M;  1JTD A;  3MJQ A;  4C6Y A;  3WRZ A;  4C75 A;  4LEN A;  4IED A;  1XJ4 A;  4DE3 A;  2JBF A;  2Y2L A;  4Y0U A;  3KSF A;  3H7W B;  1G6O A;  2Q0O A;  5GHZ A;  3LR3 A;  2Y59 A;  4UA6 A;  3KYZ A;  3C38 A;  3LR5 A;  3GR2 A;  3TSG A;  4R4S A;  4E3K A;  2H5S A;  4OPR A;  3EEH A;  4MDZ A;  1UWP X;  4A5R A;  5HAP A;  1MPL A;  2VK3 A;  4WYY A;  1LL5 A;  2O9C A;  3N4I A;  1DP6 A;  4EET B;  2ZMV A;  2W3F A;  3O87 A;  1O07 A;  2Z6D A;  1XFN A;  5HWW A;  4GJ4 A;  3Q7Z A;  4R38 A;  3CIT A;  2YKH A;  4RVA A;  5AVF A;  3NOU C;  3BFD A;  1GHI A;  5HL1 A;  1OT6 A;  2E8J A;  4KZ5 A;  2HP5 A;  1WA9 A;  4ZAM A;  1ZHH B;  3S1Y A;  4DXB A;  2ZC3 B;  3UPP A;  1YKD A;  4Z9Q A;  1SDE A;  2C5W B;  4HI4 A;  1H8Y A;  4OQI A;  3WS4 A;  1ODV A;  4MBF A;  5J8X A;  3VV4 A;  4ARZ A;  3ZGA B;  2P08 A;  5DF9 A;  5F6A A;  4LV3 A;  2RCX A;  3ZDJ A;  2V1A A;  1PZP A;  1XJ2 A;  4F3L B;  3PAG A;  4I3J A;  2OAQ 1;  1STZ A;  1BUL A;  3HLF A;  4ZJ1 A;  3PXP A;  5HDC A;  3E98 A;  4X53 A;  3UMD A;  5GLD A;  4HQA A;  3Q1F A;  1S67 L;  4QU3 A;  2OV5 A;  3O86 A;  3T1S A;  4Y2F A;  1YMX A;  4GOG A;  1GSW A;  2Q9M A;  3A0R A;  4CPK A;  1YLT A;  3A0S A;  3QHY A;  3I7J A;  4OOM A;  2D02 A;  1KDW A;  1LI9 A;  1L0G A;  2JKT I;  3BFC A;  5AQ7 A;  1JWZ A;  4E6W A;  3IT9 A;  4KUK A;  3SS4 A;  3Q07 A;  4N1X A;  1K56 A;  5FQM A;  1OJG A;  4GHI A;  5HWV A;  4MNR A;  3UE1 A;  1MWU A;  1TS7 A;  2EX9 A;  1PI5 A;  3QP1 A;  4BD1 A;  3FC7 A;  4HOI A;  1I2S A;  4N9K A;  1PFL A;  2O0Y A;  1W7F A;  2XD1 A;  3NDG A;  1K57 C;  3PBT A;  1NYM A;  3VP0 A;  1YQS A;  3L7H A;  4CLC D;  4DF6 A;  4Z1W A;  3VP1 A;  4IBX A;  2P9V B;  1VQQ A;  1EWZ A;  2WK0 A;  4X69 A;  2A49 A;  4QB8 A;  1LL9 A;  3CAX A;  4BD0 A;  3V3S A;  4NET A;  3GTC A;  1NZO A;  2JKG A;  3UDI A;  5HAR A;  3BWL A;  2VV7 A;  3CHW P;  3WS1 A;  3EEA A;  2L1M A;  2XFS A;  4EXO A;  1T1B A;  4OVD A;  3BFF A;  1C3B A;  5GL9 A;  3C7V A;  4DDS A;  2XLN A;  4LFU A;  1QMF A;  1KVM A;  3KX0 X;  2X71 A;  2R78 A;  1O7E A;  1WE4 A;  3IH8 A;  5E2H A;  3QP2 A;  5L2F A;  4R6L A;  1KE3 A;  3A3J A;  3DBA A;  2JN7 A;  1FCN A;  3HLB A;  3QP5 A;  2PU2 A;  3HL9 A;  2HDU A;  4M4X A;  4EER A;  2WGV A;  1U60 A;  4WN5 A;  5EVE A;  2Y2G A;  3GVB A;  3P09 A;  3H9W A;  4EW7 A;  5DJU A;  1ES3 A;  3HUM A;  1MZU A;  3V3R A;  4ZTK A;  3UE6 A;  3EOI A;  2WKR A;  5E2E A;  2R9W A;  1TD5 A;  3QP6 A;  3UY6 A;  2V1Z A;  4NK3 A;  2QZ6 A;  3JVV A;  3DTM A;  4HJ3 A;  5HW3 A;  5CEC A;  5FEF A;  4I3I A;  5DJT A;  3N8R A;  4LV1 A;  4OOY A;  1NRF A;  3K2N A;  4EV4 A;  2DCF A;  3S7P A;  5F5Y A;  4OPY A;  3IF6 C;  1K4F A;  1MWT A;  4KQO A;  1IYS A;  2PT7 A;  5FAO A;  5FDH A;  2GJ3 A;  4JF6 A;  1NLY A;  1YT4 A;  3W2Z A;  4ESP A;  4GHI B;  1AWI A;  3R7W A;  1IOU A;  3UO9 A;  2HV1 A;  2G2W A;  1F2K A;  2H0T A;  2INW A;  2DNS A;  2W3G A;  3P7N A;  2H10 A;  2Y2I A;  4EBP A;  1YM1 A;  2Y4A A;  1SKO A;  4HP4 A;  1TS8 A;  1HZO A;  4L9F A;  4MLL A;  3HVF A;  2WKP A;  1S6R A;  1XJ6 A;  5AVE A;  2I9V A;  2WAE A;  4CQH A;  1J9M A;  3N8L A;  1GSV A;  4OQH A;  2CMN A;  4B88 A;  1S1Y A;  2ACG A;  1SKO B;  1M40 A;  4GD6 A;  5FEG A;  3IX3 A;  4L9E A;  4LPZ A;  2O9A A;  2Y2P A;  5IT5 A;  4QJG A;  3DWK A;  2EXA A;  3M6B A;  2VLG A;  3CPT B;  4KZ3 A;  2IWD A;  1PRQ A;  3IH9 A;  2V8F A;  3NI9 A;  1ALQ A;  1X0O A;  3Q81 A;  1OTA A;  3LIA A;  5L8M A;  3QNB A;  5FQI A;  4OQ0 A;  1VET A;  2ZL1 A;  3LO7 A;  1E3U A;  3CZD A;  5EOO A;  3A3D A;  5CEB A;  5JYP A;  4L0L A;  2HF6 A;  1FSY A;  4WL9 A;  1Z6F A;  3OPL A;  1KE0 A;  1K38 A;  2WKE A;  2PR5 A;  1OTB A;  3NHQ A;  1IKG A;  3T4T A;  2XA7 S;  1FR6 A;  5TBM B;  1GSX A;  4OPQ A;  4B9O A;  2VKS A;  3W4O A;  3ITA A;  3K3D A;  4CLC C;  2V0W A;  4BBT A;  4PMA A;  1OJ5 A;  2Y91 A;  1D1J A;  3CUE A;  2P74 A;  1H3Q A;  3BYD A;  1KVL A;  4F3L A;  3HRE A;  4E6X A;  3ZHH A;  4S2P A;  1YLP A;  3JYI A;  2B18 A;  4JGP A;  4WEK A;  2WAD A;  1S4S A;  3UPO A;  1S4R A;  3GQZ A;  1FIK A;  3ZFZ A;  3GRJ A;  4NXG A;  4ZDX A;  5I5L A;  4WMC A;  2JKF A;  1IYO A;  1TDG A;  4R3J A;  4WBG A;  1FSW A;  4WZ4 A;  1J3W A;  3NCK A;  3UDX A;  1BZA A;  1BTL A;  2XF3 A;  5FQJ A;  3UB5 P;  3MXR A;  4S2M A;  3BQ8 A;  2ZMA A;  2A3U A;  4WLA A;  3IXD A;  5CGW A;  5HSQ A;  1PW8 A;  5EVI B;  3RJU A;  1KE4 A;  3G34 A;  5HDD A;  3MFD A;  4WM9 A;  4H6J A;  1OME A;  4WEL A;  2X01 A;  5L09 A;  5FQQ A;  1P97 A;  1XA7 A;  4X55 A;  3NEC A;  1UGU A;  1TEM A;  5HPI A;  1KDS A;  1JWV A;  3UNW A;  1JVJ A;  4H6J B;  4GLQ A;  1Z09 A;  3M2K A;  2Q9N A;  1ES5 A;  1N4O A;  3P01 A;  3F1N A;  2O9B A;  3C5A A;  3PTE A;  4N9L A;  2P04 A;  4GCZ A;  4HH2 A;  3MQQ A;  2IA2 A;  2Y2H A;  2WYX A;  3C30 A;  5J3W A;  3Q82 A;  3WS0 A;  4ZJ2 A;  4F94 A;  1BLC A;  2B95 A;  3OPP A;  3IF6 B;  5KIZ A;  2J8Y A;  4Y17 A;  3DTE A;  5GLC A;  1P0Z A;  3OZH A;  5DVA A;  5TJJ A;  3LIE A;  2BLS A;  3LI8 A;  1K6R A;  3T12 B;  1CJF A;  4R3B A;  2KDK A;  3MZD A;  3M2J A;  5TGF A;  4KZ7 A;  3E4O A;  3E2L A;  3MF0 A;  2JHE A;  1SCW A;  1ACF A;  1XPB A;  1IFQ A;  3LR0 A;  3LY4 A;  2W27 A;  2PR6 A;  2ZQ9 A;  3UB9 A;  4ZRR A;  2Y2M A;  3QP8 A;  4HP9 A;  4QHC A;  1Q2P A;  2XFT A;  5GLB A;  3OCN A;  4C3Q A;  5JYO A;  1ZTU A;  5HZH A;  3VP4 A;  4O7D A;  2BAS A;  2PD7 A;  1UWN X;  4UA9 A;  5M18 A;  1KOU A;  5FAQ A;  5IU1 A;  1W63 M;  1OTI A;  5AQB A;  5F83 A;  5A92 A;  3LIB A;  5EUA A;  1IEM A;  5CX7 A;  4R4R A;  4E3L A;  4S2N A;  4YOF A;  2QHK A;  1OTE A;  3T1R A;  4PKY A;  1NYY A;  2HJ9 C;  1NRJ A;  1XXM A;  5L10 A;  3G31 A;  3MS6 A;  2J9P A;  1PWC A;  2O99 A;  2VJW A;  3E4Q A;  2WUQ A;  1T1A A;  3CWF A;  1CEF A;  3N6I A;  1K55 A;  4DE1 A;  1DP9 A;  1HD8 A;  1LSV A;  1A0K A;  1T1C A;  1BT5 A;  1NXY A;  4X25 A;  3V50 A;  1BLS A;  4EES A;  2WGI A;  2L0W A;  3CMZ A;  3IF5 A;  3BQA A;  4OOL A;  4E3I A;  1GCE A;  4B4Z A;  3DTK A;  3LIF A;  1H8Z A;  3HCY A;  4LRY C;  2XSS A;  3FPV A;  3PBN A;  1ERM A;  4JPM A;  5EPH A;  2J3W A;  4EEU A;  3ITB A;  4MN6 A;  2LB5 A;  3U4L P;  1GHM A;  1K6S A;  2PYR A;  4GD8 A;  5I94 A;  2K31 A;  1YLZ A;  3HLC A;  4MEZ A;  3RTY A;  2ZOH A;  4K0X A;  3ZG7 B;  5FDS A; 
#chains in the Genus database with same CATH homology
 5MC7 A;  3F1P A;  4KQO A;  2PT7 A;  5G4Z A;  5FL3 A;  3FPW A;  2MJ6 A;  2GJ3 A;  4ETX A;  3E0Y A;  1NLY A;  4HHD A;  4G3W A;  3H82 B;  4LRZ E;  3W2Z A;  3ICY A;  4GHI B;  3R7W A;  2PYP A;  3MR0 A;  3VE3 A;  3MMH A;  3KSG A;  1IOU A;  4NXF A;  2HV1 A;  2INW A;  3F1P B;  2W3G A;  3P7N A;  1Y28 A;  4RQ9 A;  3D72 A;  1DRM A;  2OAP 1;  3S7Q A;  1N9L A;  1LL8 A;  4HP4 A;  2VA0 A;  2VZW A;  1DP8 A;  3JVU A;  1V9Z A;  4NKP A;  3T4S A;  1TS8 A;  2W3D A;  4L9F A;  3EGD C;  3OBF A;  2WKP A;  3TRC A;  1XJ6 A;  4GS9 B;  2QKP A;  2K7S A;  5AVE A;  5F69 A;  4BJP A;  1T18 A;  2I9V A;  1S1Z A;  3LIC A;  4CQH A;  4EUV A;  1GSV A;  2CMN A;  1OT9 A;  2L4R A;  4WUJ A;  3IBJ A;  1S1Y A;  5HPF A;  3S7O A;  3LID A;  3V67 A;  3B47 A;  3PYP A;  2QWS A;  3SW1 A;  5DFY A;  3LYX A;  3MFX A;  3H82 A;  4L9E A;  3K3C A;  4LPZ A;  2O9A A;  2EWV A;  4YWZ A;  4G3V A;  5IT5 A;  3T4L A;  4WF0 A;  5J4E A;  2VLG A;  5DFX A;  3IBR A;  4CLC E;  2V1B A;  2GZA A;  5DKL A;  4ETZ A;  3LUQ A;  4Y3I A;  2YKF A;  2H28 A;  4LLO B;  2M7U A;  3MQ0 A;  2QJ5 A;  1X0O A;  3LR4 A;  4Y5F A;  2KLI A;  4HNB A;  4GS9 A;  5IS1 A;  2VV6 A;  4R3A A;  1OTA A;  3GEC A;  3LIA A;  4QPR A;  2PD8 A;  3ZYT A;  5L8M A;  4R70 A;  2JKR M;  1YSP A;  3MXQ A;  3UME A;  2K2N A;  3VE4 A;  4I5S A;  3PBO A;  5G4Y A;  4UQI M;  3PBQ A;  2A24 B;  2Z6C A;  3R4K A;  3TE8 A;  3UE3 A;  2VV8 A;  4L9G A;  4CLC B;  2D01 A;  4UQI S;  4L0L A;  3A0V A;  4P6Z S;  2HF6 A;  4WL9 A;  3RFB A;  4PHT A;  2W1R A;  3ULF A;  4KUO A;  1LT0 A;  2J3T D;  2XA7 M;  4MN7 A;  4I39 A;  4NXE A;  4BWI A;  4DN0 A;  1TF1 A;  5HD5 A;  2PR5 A;  1OTB A;  2A24 A;  3NHQ A;  2JKT M;  3MJQ A;  3T4T A;  2XA7 S;  4CLC A;  5TBM B;  1BYW A;  1XJ4 A;  1GSX A;  3D3O A;  4B9O A;  2VGL S;  2VKS A;  4DJ2 A;  4IJG A;  1P9W A;  2NUP C;  4MMN A;  3K3D A;  3UB6 A;  4CLC C;  2V0W A;  3KSF A;  3H7W B;  4BBT A;  2Y79 A;  1G6O A;  1OJ5 A;  2EWW A;  3LR3 A;  3EQV A;  3CUE A;  1H3Q A;  4IUK A;  2JKR I;  3O5Y A;  1S66 L;  3KYZ A;  4F3L A;  3GDI A;  3NJA A;  4XT2 B;  3C38 A;  4JGQ A;  2ZMF A;  5DKK A;  3LR5 A;  2B18 A;  3EEH A;  4JGP A;  4MDZ A;  4WEK A;  1UWP X;  4HH3 A;  1S4S A;  1S4R A;  2V9A A;  4FOF A;  3OOV A;  4NXG A;  2B02 A;  4IHQ A;  2O9C A;  5I5L A;  5TBM A;  3IS2 B;  1DP6 A;  4BBU A;  4EET B;  3EQU A;  1H8M A;  3F1O A;  2ZMV A;  2W3F A;  4DMZ A;  1T19 A;  2Z6D A;  1XFN A;  4K08 A;  3T50 A;  5HWW A;  4GJ4 A;  2DMW A;  5EFW A;  3BQ8 A;  4GW9 A;  4R38 A;  4O01 A;  1EW0 A;  3C2W A;  3KO6 A;  3CIT A;  2YKH A;  4I3A A;  4WLA A;  3NOU C;  5AVF A;  3E4P A;  1V9Y A;  4O0P A;  5KSH A;  1OT6 A;  3PHY A;  2J3T C;  3CI6 A;  5HSQ A;  1WA9 A;  1ZHH B;  3KYQ A;  4HY8 A;  3B42 A;  5HDD A;  1YKD A;  4II7 A;  4DJ3 A;  4H6J A;  4HI4 A;  4UEY A;  3OCL A;  2ZBB A;  3LFV A;  1F9I A;  2FZ0 A;  4AFI A;  1ODV A;  2PHY A;  1XJ3 A;  4WEL A;  2VEA A;  3UB8 A;  3VV4 A;  4ARZ A;  3F1O B;  5A8B A;  2M7V A;  1P97 A;  5HD3 A;  2P08 A;  1UGU A;  4HIA A;  5DF9 A;  4B93 A;  5F6A A;  4BBV A;  5HPI A;  2W1T B;  2V1A A;  1XJ2 A;  4F3L B;  3T4J A;  1D06 A;  2W3E A;  4H6J B;  4XT2 A;  4I3J A;  2OAQ 1;  1STZ A;  4GLQ A;  5K5B A;  3T4Q A;  1MC0 A;  3PXP A;  3HJI A;  4ARZ B;  3RH8 B;  5HDC A;  3E98 A;  4Q0H A;  3P01 A;  2NUT C;  3F1N A;  2O9B A;  1D7E A;  3BY9 A;  4MCW A;  3U2A A;  3ZQ5 A;  3UMD A;  1LSW A;  2P04 A;  4HQA A;  4GCZ A;  2Y8H A;  4HH2 A;  3KSI A;  2P7J A;  3BY8 A;  3MQQ A;  1S67 L;  4YNR A;  2W3H A;  2IA2 A;  3C30 A;  3IS2 A;  5J3W A;  2GNX A;  3CUE C;  1VB6 A;  4Y2F A;  5F68 A;  2XRO A;  5HDS A;  1GSW A;  1G28 A;  1F98 A;  5KIZ A;  3A0R A;  4HJ4 A;  1TS0 A;  4PAU A;  1P0Z A;  3A0S A;  1OPX A;  3PBR A;  2M1C A;  5TJJ A;  4OOM A;  1YAX A;  3LIE A;  2D02 A;  3LI8 A;  2ZOI A;  2JKT I;  2KDK A;  5HWT A;  2OWJ A;  3LI9 A;  4KUK A;  2PDR A;  3PR6 A;  4JGO A;  3T4K A;  3E4O A;  3EWK A;  3MF0 A;  2JHE A;  3PBS A;  1OJG A;  4GHI A;  5HWV A;  2HJE A;  1IFQ A;  3R7W B;  1TS7 A;  3LR0 A;  4MN5 A;  2W27 A;  1N9N A;  2PR6 A;  1W63 Q;  3FC7 A;  4HOI A;  3UB9 A;  2KOI A;  4ZRR A;  5HL6 A;  3G6O A;  2O0Y A;  3BW6 A;  4HP9 A;  4Q0J A;  1LSX A;  3PBT A;  1NLZ A;  3OCN A;  2QJ7 A;  4CLC D;  2LB9 A;  4Z1W A;  1ZTU A;  5HZH A;  3TW8 A;  4JGR A;  2BAS A;  2XRN A;  2PD7 A;  1UWN X;  3OLO A;  1KOU A;  3HJK A;  3NOP C;  5IU1 A;  4FSF A;  1W63 M;  3KSH A;  1OTI A;  4KQD A;  4G3K A;  3C8C A;  3CAX A;  3LIB A;  3VOL A;  2GX5 A;  4P6Z M;  4BMW A;  2VX8 A;  1MKM A;  5CX7 A;  3BWL A;  2VV7 A;  3EEA A;  3BJN A;  2L1M A;  3OC2 A;  4EXO A;  1T1B A;  2G7U A;  3CLO A;  1N9O A;  2HGV A;  3EGX C;  2QHK A;  4NEE D;  4YOF A;  4EQ1 A;  3TJZ C;  1OTE A;  3KX0 X;  2VGL M;  4ME4 A;  2EA9 A;  2OWH A;  2R78 A;  4PKY A;  1NWZ A;  4E04 A;  2HJ9 C;  3UB7 A;  1NRJ A;  2J80 A;  4R6L A;  3DBA A;  1YSQ A;  4LRX C;  2JN7 A;  3FG8 A;  4EU0 A;  1JNU A;  3T4O A;  4M4X A;  4I38 A;  4EER A;  2O99 A;  2VJW A;  3E4Q A;  1T1A A;  3CWF A;  4WN5 A;  3NOT C;  1F5M A;  1DP9 A;  1TS6 A;  1LSV A;  5AJG A;  3MQO A;  3B33 A;  1T1C A;  5J7E A;  2V0U A;  3H9W A;  4EW7 A;  2W1T A;  5DJU A;  2A2L A;  1MZU A;  4HJ6 A;  4PKY G;  4EES A;  3S7N A;  4O8G A;  2L0W A;  5LBR A;  3UE6 A;  3EOI A;  2OOL A;  2WKR A;  2QYB A;  1TD5 A;  4NXB A;  3BQA A;  4OOL A;  2WKQ A;  1VHM A;  3LIF A;  3F1N B;  1XFQ A;  3HCY A;  4LRY C;  2XSS A;  3JVV A;  4HJ3 A;  2W0N A;  3FPV A;  3PBN A;  4I3I A;  2J3W A;  4EEU A;  5DJT A;  1P9R A;  3H7W A;  4MN6 A;  2LB5 A;  3K2N A;  2FH5 A;  2PYR A;  2K31 A;  4EEP A;  4Q0I A;  2KX6 A;  4WEJ A;  3RTY A;  3S7P A;  4IUH A;  5C5K A;  1OTD A;  2ZOH A;  5F5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...