1FCMA

Crystal structure of the e.coli ampc beta-lactamase mutant q120l/y150e covalently acylated with the inhibitory beta-lactam, cloxacillin
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLLVPDEVKSSSDLLRFYQNWQPAWAPGTQRLEANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Substrate and Inhibitor Complexes with AmpC -Lactamase: Possible Implications for Substrate-Assisted Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
molecule keywords BETA-LACTAMASE
total genus 107
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fcmA00
3PAGA 2WYXA 4PM5A 4OPYA 3W4PA 4OQGA 4WZ5C 4OP5A 4QY6A 2P74A 4U0XA 4WZ5A 5GHXA 1C3BA 4WEKA 3ZDJA 2JBFA 5DVAA 2WGWA 5A90A 3WWXA 4IBXA 1K57C 4U3TA 4B4XA 5CECA 3ZFZA 3UPNA 3ZG9B 1YLYA 1CI9A 3ISGA 4QY5A 3C4PA 3HLDA 3JYIA 1NJ4A 4S2JA 5F1GA 3HUNA 1IYQA 5FI6A 4X6TA 4ZTKA 1ESUA 1MWUA 5FAOA 1N9BA 3QHYA 1IELA 2G2WA 3NCKA 4ZDXA 3HLFA 1M6KA 3QNBA 4R1GA 4WYYA 1E25A 3S1YA 4JF4A 4QD4A 5M1AA 2HPBA 1CEFA 4M3KA 3G4PA 1KGEA 2WUQA 1ZG6A 3O86A 5GLCA 3Q07A 4MBKA 1YMSA 1VQQA 4NETA 3NI9A 1ES2A 1EROA 3CZDA 3IWQA 2XLNA 1NYYA 3VSKA 1G6AA 2OLUA 1M40A 3MBZA 1WYCA 4OKPA 3MKEA 4MLLA 3TSGA 5A92A 2XEPA 3DWZA 4OONA 3WS5A 3MXSA 1MWTA 1FQGA 4KZ8A 3MZFA 2ZC7A 3B3XA 1ZKJA 4KZBA 5FASA 4DRTA 1XA7A 3FV7A 2WKIA 5EOOA 1FCOA 2ZD8A 4OVDA 2QMIA 2Y2NA 1XA1A 4E3KA 1PYYA 1GHPA 1SCWA 3VOYA 1TEMA 4JF5A 2ZQ7A 1WYBA 4QB8A 4KZ7A 2Y4AA 4DE1A 1YLPA 3A3DA 3GTCA 4WELA 5FQJA 4JXVA 4N1XA 1K56A 3IH8A 3IT9A 2Y2LA 3P98A 4CPKA 3MKFA 5FAQA 3M6BA 3FWLA 4KG2A 3RXWA 4GN2A 4JKTA 5F82A 4FH2A 3G2YA 4ID4A 2Y55A 4RVAA 3S4XA 3BECA 3BYDA 3PBRA 4EV4A 1K54C 3HVFA 3ZG8B 4BL2A 3DTMA 1FR1A 1K54A 1K56D 4PMAA 1W79A 1KGGA 2RCXA 4MBFA 4OLDA 3V3RA 1N4OA 1L0GA 3IWIA 1CI8A 1ES5A 1IKIA 1XP4A 5E2EA 1JWVA 3IF5A 4GD8A 1K57A 2H10A 2C6WB 5FQ9A 1O07A 2WAEA 4R3JA 3UNWA 2EFXA 4R23A 4KG5A 4KZ4A 4R4SA 4MEZA 4EWFA 3WS1A 1PW1A 3HREA 4X55A 2Z2MB 1L0DA 3G34A 2BG1A 2XR0A 3HLCA 1LI9A 5DTSA 1TDLA 3MFDA 3UY6A 3BM6A 3VP4A 1HD8A 3HLBA 4PM9A 5AQ7A 2XFTA 5FQIA 2WAFA 3PBOA 5U47A 2FFYA 2DNSA 4P85A 4WBGA 4IVKA 4OP8A 1EI5A 4OQ0A 5CRFA 4R4RA 3NBLA 4YINA 4DXBA 5FI7A 4B4ZA 5CXWA 4L0LA 5HAIA 3SH7A 1NRFA 2EX8A 1GA9A 3V39A 1MWSA 3UE1A 5M18A 2OLVA 3A3JA 5EVIB 5E2FA 3WS0A 2WGIA 1KE0A 2IWCA 1YQSA 4IEDA 1ZC2A 2G2UA 1WE4A 1NZOA 4WMCA 2Q9MA 5CGSA 3IH9A 1FR6A 3M6HA 4Z9QA 1KGFA 1MPLA 2JCHA 2WGVA 3NDGA 2HP9A 3RJUA 2DRWA 5FQMA 2Y91A 3IXBA 2ZM8A 4GDNA 4MNRA 4Q8IA 1BTLA 1FCNA 4F94A 4N1HA 2ZC5B 4GKUA 3MXRA 2X01A 3VP1A 4HESA 4S2MA 3SS4A 2GDNA 3G30A 4DXCA 4S2NC 3CG5A 4OOMA 3AGDA 5CTMA 4ZJ3A 4X68A 3D4FA 3SS5A 1RGYA 5I94A 4K91A 3RXXA 4XUXA 3GSGA 5GLAA 1H8ZA 1LLBA 4JBFA 1PWDA 5CEDA 3V50A 1K55A 1IYOA 3C5AA 1W8YA 3Q82A 1IKGA 2ZM0A 3Q7VB 4NK3A 5FAPA 1BLHA 3S22A 4HBUA 4BJPA 5KZHA 1PW8A 3NC8A 3UE3A 1YLZA 1KE4A 3VOZA 3OZHA 1U60A 4ZJ1A 1HTZA 5D3OA 5EECA 4PPRA 4JF6A 4KZAA 3N8SA 1Y54A 4C3QA 3VFHA 2DCFA 3IHAA 1YLTA 4MBHA 4EQIA 5EVIA 1MBLA 1EWZA 3OPLA 4BQMA 2J8YA 1KVLA 3ITBA 1E3UD 2P9VA 2ZC4B 2HDRA 3ZG5A 1SKFA 3BFFA 5DF7A 4JPMA 3HUOA 5M19A 5CGXA 4E3MA 4X69A 5HAPA 2EFUA 4FH4A 1SDNA 5HW3A 3A3IA 3DWKA 2WZXA 5AQAA 3I7JA 3G31A 3GMWA 1NY0A 4LENA 3E2KA 3SS3A 3DW0A 4E3LA 1OMEA 1NZUA 2H0YA 5KSCA 3E2LA 2IWDA 3OC2A 2X02A 5IHVA 3N6IA 3VMAA 3GRJA 3M2JA 3O87A 4FSFA 3HLEA 5F1FA 1XXMA 5E2GA 3UDIA 3ZG7B 3BFDA 4UHUA 1L2SA 4KQQA 4E3NA 3NIAA 2R9XA 4P6BA 1LHYA 2ZC3B 3G2ZA 2PU4A 1W7FA 1CEGA 5GHYA 5GLDA 1JWZA 3OCNA 2EX9A 3VP3A 2R9WA 3PBSA 4GZBA 1FOFA 4QJGA 5GL9A 2Y2HA 1JWPA 3WS4A 1Q2PA 3A3FA 3TG9A 4K0WA 1TDGA 3UDFA 3VP2A 4E6XA 1S6RA 3G32A 1GA0A 2XD5A 1ES4A 4IVIA 1BSGA 3P09A 1ALQA 3BLSA 5A91A 3ZVTA 2H5SA 1PI5A 3FKVA 3LY4A 1DJCA 3HBRA 4BL3A 1NYMA 4EUZA 1J9MA 2I72A 2XF3A 4N9KA 5L2FA 3SH8A 1KVMA 5CTNA 5GLBA 3UN7A 2ZM2A 4JXGA 1QMFA 2EX2A 4RA7A 3ITAA 4GNUA 3EQUA 2A49A 1W5DA 2EXAA 2ZQ8A 4KQRA 1VM1A 3Q7VA 1YM1A 4DDSA 2A3UA 4GD6A 2ZQAA 3AGEA 2IWBA 5HFOA 5EVID 1Q2QA 3PTEA 3V3SA 1TVFA 3IF6A 2Q9NA 1K25A 3C7VA 3HLGA 2XD1A 2XGNA 4FD8A 4PM8A 4WEJA 4OPZA 4E6WA 1I5QA 1PZOA 3N4IA 5AQBA 3W4QA 4C75A 1PWCA 5CEBA 5HL1A 3VP0A 2ZQ9A 4JLFA 2PU2A 1FCMA 1SDEA 2JC7A 2P9VB 4WZ4A 4KZ5A 4N9LA 2Y2OA 4LV1A 1GHIA 4JXSA 4QHCA 1G68A 5G18A 4U0TA 1MY8A 1W8QA 1I2SA 3LCEA 1K4FA 3M2KA 4LV2A 4PM7A 3C7UA 4BLMA 5J8XA 5FI2A 4GDBA 3LEZA 4R3BA 3FKWA 4HEFA 5CHJA 4XUZA 4IBRA 4OH0A 4EBPA 3BEBA 1H8YA 3UO9A 1FSYA 1K55C 1JTDA 4P87A 2J7VA 2XQZA 1ESIA 3VSLA 5FSRA 2QPNA 3LY3A 4LCLA 3GR2A 4H8RA 4HBTA 3ZCZA 4WMCD 1RGZA 1FSWA 2Y2IA 2Z2LB 5FQQA 2C5WB 3PBNA 4OLGA 2HDUA 1E4DA 2XFSA 2E8IA 2J9OA 4Y7PA 1PI4A 1ZG4A 2ZQCA 1I2WA 3OPRA 1BLCA 4UAAA 5CHUA 1K6RA 3N8LA 1BZAA 1QMEA 5DF9A 4OQHA 5E2HA 1PZPA 3VFFA 3N7WA 5EOEA 4EBLA 4JXWA 4WM9A 5TR7A 1RCJA 2ZQDA 3SH9A 3O3VA 3BLMA 4DF6A 1L0EA 1XX2A 1YMXA 3NDEA 3UE0A 3IQAA 5KMWA 2QZ6A 4OOYA 1S0WA 4ZAMA 4RX3A 3GQZA 1MWRA 3HUMA 4S2IA 3CMZA 4FCFA 2V2FF 4RYEA 1PWGA 3C4OA 3Q7ZA 1BUEA 1MKIA 3IXHA 2ZC6B 4GB7A 5JYPA 2OV5A 2WGWB 1KDWA 2WADA 3G35A 1XPBA 4ZJ2A 5JYOA 5F83A 5DTTA 5A93A 1XGJA 2X71A 4KZ6A 1KDSA 2Y2GA 3PBQA 2JE5A 2XK1A 3IXDA 3QNCA 4UA6A 1AXBA 4UA9A 4DDYA 3WS2A 2WK0A 4CJNA 4UA7A 3UDXA 2WKHA 2ZLYA 3UPPA 4X56A 1Z6FA 1O7EA 3UPOA 3WRZA 1XGIA 4BENA 2CC1A 2FFFB 3V5MA 1HVBA 4DE2A 2Y59A 2Y2JA 3OPHA 2OSUA 5GHZA 3OPPA 5EPHA 1BLSA 5EVLA 5FDHA 2VGJA 1ERQA 2XH9A 2EXBA 4E3IA 2Y2PA 2B5RA 5E43A 1K4EA 3O88A 1L0FA 3N8RA 1JTGA 3FYZA 4O7DA 1YT4A 4S2OA 1BULA 4C6YA 5TFQA 5DF8A 5HX9A 1MXOA 4OPQA 5HAQA 1GCEA 3TOIA 3BFGA 4LV3A 2HP5A 1IEMA 3LO7A 4OPRA 1KE3A 3IF6B 3WRTA 3W4OA 5BOHA 1GHMA 4OOLA 4Y0TA 3Q81A 5EE8A 1DY6A 2WKEA 4BD1A 4YFMA 3Q1FA 4S2PA 4S2NA 1K38A 2V1ZA 2XDMA 1XKZA 4S2KA 2V20A 3MZDA 1BT5A 2UWXA 5FQKA 4P0MA 2BLSA 1ES3A 4D2OA 1LI0A 4A5RA 2Y2QA 1H5XA 3IF6C 5FATA 1LL5A 4KENB 2ZMAA 4X53A 4DE3A 2Y2KA 3CJMA 2Y2MA 5TGFA 4QU3A 4KZ9A 3ZGAB 2WZZA 3BFEA 4OQIA 3PBTA 1ONGA 1LL9A 5KSHA 3ZVWA 4S2LA 5CERA 3GVBA 4Y0OA 3OCLA 1DJAA 1ONHA 5CHMA 3IXGA 3HL9A 4E3JA 4Y0UA 3HLWA 2HDSA 3GV9A 3IHBA 1DJBA 4DKIA 1ERMA 1BLPA 1NXYA 4KZ3A 3IWOA 5HARA 4KG6A 5EVIC 4BD0A 4N92A 4E3OA 4EBNA 4B88A 2HDQA 3EQVA 5EUAA 4ZBEA 2RL3A 1IYPA 3ZNTA 4PM6A 1HZOA 5CGWA 3PAEA 3FZCA 1IYSA 1YLWA 2PBYA 3NY4A 2ZJ9A 5FA7A 1E3UA 2H0TA 4K0XA 3ZHHA 1CK3A 3AGFA 4XXRA 1SHVA 3ZNYA 3BRMA 4LCMA 3SOIA 5AQ9A 1PIOA 4LV0A 1JVJA 1YLJA 3W8KA 4RX2A 3MZEA 3A3EA 4GOGA 4DE0A 2J9PA 2HP6A 2EX6A 5DTKA 3ZG0A 3BFCA 1K6SA 2VGKA 4KQOA 1RP5A 4R0QA
chains in the Genus database with same CATH superfamily
2WYXA 4OPYA 1FILA 4WZ5C 3CUEA 5DVAA 2K7SA 1X0OA 4IBXA 2JKFA 4QY5A 1GSVA 3JYIA 1L3LA 1UWPX 4X6TA 1ESUA 4I39A 1STZA 2E8JA 4I5SA 4P6ZM 1M6KA 3S1YA 1E25A 3MS6A 4NXBA 4B93A 5EV0A 1GSXA 4UEYA 2WUQA 4Q0HA 2H28A 2OAQ1 2XLNA 5HDDA 4WL9A 1WYCA 2V8CA 3TSGA 1LL8A 2JKTI 3DWZA 3MXSA 3A0VA 4HH2A 3MZFA 3A0RA 2ZC7A 3R7WB 3FV7A 5HWTA 1P0ZA 1VETB 4P6ZS 1OTEA 3VOYA 1TEMA 2ZQ7A 1MC0A 3A3DA 5FQJA 3R7WA 1TS8A 4CPKA 1GSWA 3LEQA 4JKTA 4K08A 3G2YA 4LLOB 3BYDA 3PBRA 4JGRA 2QJ7A 4BL2A 3DTMA 1K54A 1K56D 3T1SA 4OLDA 3IX8A 1L0GA 2HJ9C 1CI8A 1JWVA 3IF5A 2C6WB 3FPVA 3QP8A 4R23A 4DN0A 4R4SA 3MQ0A 3WS1A 4Y15A 4X55A 2KX6A 1TDLA 3MFDA 1HD8A 2WKRA 2PR6A 4CLCA 3PBOA 2DNSA 4WBGA 1EI5A 4OQ0A 4R4RA 5TJJA 5CXWA 1T1CA 5HAIA 3SH7A 1NRFA 3PYPA 3A3JA 5EVIB 2WGIA 3C2WA 4IEDA 2B02A 3NJAA 5CGSA 1FR6A 5HPIA 2JCHA 1N9LA 4GDNA 1BTLA 1SZVA 3G30A 3S7NA 3MQQA 4OOMA 5I94A 4Y17A 4JBFA 4F3LB 4HJ4A 4CQHA 2QKPA 3Q7VB 5EM1A 1UGUA 5FEGA 2ZOHA 4HJ6A 3VOZA 1HTZA 4JF6A 2DCFA 4EQIA 1OPXA 3MXQA 1MBLA 1EWZA 3OPLA 4BQMA 2VGLS 2P9VA 1SKFA 4EERA 4E3MA 1OT9A 5HW3A 3I7JA 4LENA 3E2KA 2G7UA 4E3LA 1NZUA 5KSCA 3E2LA 2J3TD 3OC2A 3P7NA 1F9IA 4EEPA 5TBMB 4UHUA 1L2SA 2PDRA 1W7FA 5HDSA 3OCNA 2R9WA 3BQAA 5GL9A 1Q2PA 4K0WA 4G3WA 2Y8HA 1S6RA 4O8GA 4UQIS 3H7WB 4X1LA 3LY4A 3HBRA 3S7QA 4EUZA 2XF3A 4N9KA 3UN7A 4AFIA 2VGLM 4JXGA 3ULFA 3EQUA 2XA7M 1W5DA 1F2KA 2K2NA 3H7WA 4DDSA 4GD6A 5HFOA 5EVID 2W3EA 2K31A 4FD8A 4PM8A 4LRZE 3W4QA 5HL1A 2ZQ9A 4JLFA 5CX7A 4WZ4A 2P9VB 1MY8A 1I2SA 4LV2A 4BLMA 5FI2A 4GDBA 3FKWA 3CLOA 1H8YA 4L9EA 3UO9A 3GECA 3VE4A 1V9ZA 4BBUA 1P9WA 3ZCZA 4WMCD 1FSWA 2Y2IA 2YKHA 2HDUA 3UB9A 3OPRA 4UAAA 4R38A 5E2HA 1PZPA 5EOEA 4EBLA 4WM9A 2ZQDA 3O3VA 1NLZA 1L0EA 2EWWA 5KMWA 2QWSA 1VEUB 4X1MA 3U2AA 3HUMA 4S2IA 5IT5A 1N9NA 1BUEA 1MKIA 5HZHA 3T4QA 2ZC6B 1KDWA 1XGJA 3BY8A 1KDSA 3IXDA 4UA9A 3WS2A 4UA7A 4X56A 3UPOA 1XGIA 3V5MA 4DE2A 2Y59A 1S67L 3MQOA 2Y2PA 2B5RA 5E43A 1L0FA 3N8RA 1JTGA 4D60A 4QPRA 4LV3A 4IUHA 4HHDA 2VV6A 3WRTA 4NEED 1GHMA 4Y0TA 1DY6A 3CUEC 5DJUA 4S2NA 2V1ZA 2A24A 5F6AA 1VETA 2V20A 5FQKA 1OTIA 4YOFA 3T4SA 2BLSA 4A5RA 5G4ZA 2Y2QA 3IF6C 4PHTA 1LSVA 4NKPA 1S1YA 5TGFA 2WZZA 4OQIA 5KSHA 4S2LA 4MN5A 5CHMA 1HLUP 3IHBA 1DJBA 3RFBA 5EVIC 2JKRM 3LIFA 1IYPA 1HZOA 4JGOA 5CGWA 3G6OA 2PBYA 3EOIA 2ZJ9A 3FG8A 3T4KA 1SHVA 1FIKA 4O01A 1IFQA 1JVJA 3W8KA 4RX2A 1LSWA 4UQIM 4DE0A 4NG2A 2EX6A 1K6SA 2HJEA 3PAGA 3KX0X 1S66L 3W4PA 4YNRA 4U0XA 2WGWA 3WWXA 1D7EA 2V9AA 2W3GA 1NJ4A 4S2JA 3ZYTA 1IYQA 5FI6A 2W3FA 2VA0A 2W0NA 5I5LA 5FAOA 1XJ2A 1N9BA 1IELA 2G2WA 3FPWA 2A2LA 4WYYA 4ARZB 4YWZA 1G6OA 4QD4A 1ACFA 4M3KA 1KGEA 3F1NA 1ZG6A 5GLCA 3Q07A 2Y79A 4IUKA 1YMSA 2OWJA 5AJGA 1VQQA 3IWQA 2OLUA 1M40A 3MR0A 3D72A 4MLLA 4HIAA 3WS5A 4BBTA 1FQGA 2J80A 3TW8A 3B3XA 1ZKJA 4KZBA 4DRTA 3DTKA 5HD5A 1FCOA 3LICA 1UWNX 1PYYA 1GHPA 3GDIA 3FC7A 1WYBA 4X25A 4Y2FA 4GHIB 3GTCA 4JXVA 4ID4A 3S4XA 3BECA 3ZG8B 3HVFA 1T1AA 4LRXC 4PMAA 1FR1A 4B9OA 3EGXC 1KGGA 2RCXA 2W1TA 4MBFA 1N4OA 3IWIA 1XP4A 2H10A 4WF0A 1O07A 2VZWA 2WAEA 5C5KA 3UNWA 2O9BA 4KZ4A 1PW1A 2VJWA 3HJKA 2XR0A 3BM6A 1XFNA 3QP1A 3HLBA 5AQ7A 3SZTA 4OP8A 1OJGA 3KYQA 3NBLA 2EX8A 3UE1A 5M18A 2OLVA 5E2FA 3NOPC 1KE0A 1YQSA 1ZC2A 1XJ4A 1NZOA 1KGFA 3NDGA 2HP9A 1ODVA 2VKSA 3IXBA 2ZM8A 4F94A 2ZC5B 3VP1A 3T4LA 5L07A 2GDNA 4DXCA 4S2NC 4ZJ3A 3SS5A 3E0YA 2VX8A 3RXXA 1PWDA 3F1OA 1IYOA 3C5AA 3Q82A 1NLYA 4BJPA 3NC8A 2PYPA 3UE3A 3VV4A 1YLZA 4MN6A 3OZHA 3LI9A 1BYWA 5EECA 1DRMA 4KZAA 3VFHA 5EVIA 3ITBA 1E3UD 3F1NB 2JHEA 2PR5A 3BFFA 3NOUC 4DMZA 3HUOA 2QHKA 1TS6A 1Y28A 5CGXA 3EGDC 2W3DA 1SDNA 3DWKA 3IX4A 2ZBBA 3GMWA 3DW0A 3V67A 1OTDA 4IJGA 2JN7A 1S1ZA 4EEUA 5IHVA 3O87A 4GS9A 4H6JB 5F1FA 3UDIA 3BFDA 4E3NA 2R9XA 5GLDA 4QJGA 5K5BA 3KSHA 4GZBA 2Y2HA 3WS4A 2NUTC 1TDGA 3CHWP 3G32A 5DFXA 1ES4A 3BLSA 5A91A 3FKVA 4I38A 2I72A 5L2FA 3SH8A 2KDKA 5CTNA 3DTEA 2PD7A 2CMNA 4GNUA 3LGOA 2A49A 2ZQ8A 4CLCD 4KQRA 2V1AA 3U4LP 2ZQAA 2P04A 3S7PA 1TVFA 4RQ9A 2Q9NA 2KLIA 3HLGA 2XD1A 1PZOA 2L4RA 5F69A 1A0KA 4C75A 5CEBA 3VP0A 4G3VA 1FCMA 2JC7A 5HDCA 4KZ5A 1YAXA 1GHIA 4JXSA 1G68A 4Q0JA 4U0TA 3UMDA 2IA2A 5HPFA 4PM7A 5J8XA 3UB8A 3R4KA 1YPRA 2VV7A 4O0PA 4IBRA 4EBPA 1K55C 5A8BA 4P87A 2HF6A 2R78A 3NOTC 3LY3A 2LB5A 4NXFA 4HBTA 1T18A 2Z2LB 4HQAA 3CITA 2XFSA 1E4DA 1VEUA 1ZG4A 2ZQCA 1I2WA 1BLCA 5CHUA 3LI8A 1K6RA 3N7WA 3DTIA 1YMXA 3NDEA 5DFYA 5L10A 3IQAA 2FZ0A 3W2ZA 4LGWA 1OT6A 4ZAMA 4CLCB 3E4PA 4RYEA 3C4OA 2PBDP 2PD8A 2D01A 2WGWB 4NXGA 4ZJ2A 5JYOA 5F83A 3TE8A 3IS2A 4CLCC 1D06A 2Y2GA 3PBQA 2JE5A 1IOUA 3OOVA 2ZLYA 2GJ3A 1O7EA 3WRZA 4BENA 3C38A 2CC1A 4PKYA 1HVBA 2OSUA 3OPPA 1MKMA 2VGJA 4XT2B 2XH9A 2B95A 2V8FA 3BJNA 4S2OA 5TFQA 1MXOA 4OPQA 5L8MA 3TRCA 1T19A 3LO7A 3IF6B 3OBFA 4HJ3A 3Q81A 2HV1A 4BD1A 4GW9A 2XDMA 4S2KA 2O9CA 1BT5A 3LIBA 3UB5P 3KYEA 3A0SA 1LL5A 2ZMAA 3LIDA 2Y2KA 3QP4A 4QU3A 3ZGAB 4Y0OA 1DJAA 3HL9A 4Y0UA 3JVUA 2XA7S 4BD0A 4KG6A 2HDQA 3EQVA 4ZBEA 1IYSA 1V9YA 4EW7A 1E3UA 2H0TA 3ZHHA 3L9KA 4JGQA 3UB6A 3SOIA 1PIOA 5HWVA 1VHMA 3A3EA 4GOGA 3ZG0A 1EW0A 3BFCA 2VGKA 4KQOA 4OP5A 4XT2A 2P74A 4WZ5A 4WEKA 5A90A 1DP8A 5EVEA 3LR5A 5CECA 3IX3A 3UPNA 1YLYA 2NUPC 4HI4A 3HLDA 3HUNA 2L1MA 1MWUA 1W63Q 3NCKA 4ZDXA 3HLFA 3QNBA 4R1GA 4FTXA 2QJ5A 2V0WA 3G4PA 3LR4A 4ME4A 2QYBA 5EFWA 3B47A 1ZHHB 3NI9A 1ES2A 1EROA 3CZDA 5HSQA 1NYYA 3VSKA 1G6AA 3MBZA 4OKPA 3MKEA 2XEPA 3CWFA 4OONA 3RTYA 4KZ8A 3PHYA 5FASA 2WKIA 2HZ5A 4OVDA 2QMIA 2Y2NA 1SCWA 2J3WA 4MCWA 4JF5A 2W1TB 4KZ7A 2Y4AA 1YLPA 4WELA 2PYRA 5DKKA 2GZAA 1K56A 3EEHA 2OAP1 3IT9A 1CF0A 3MKFA 3RXWA 3FWLA 4GN2A 4RVAA 4EV4A 2BTFP 1W63M 2P7JA 1W79A 4H6JA 1ES5A 2YKFA 5E2EA 3LR3A 4EESA 2OWHA 1SKOB 4R3JA 2EFXA 5G4YA 4KG5A 4MEZA 5AVFA 2Z2MB 2WKQA 3MFXA 3KSIA 3T1QB 3UY6A 3HLCA 5HD3A 3VP4A 3PXPA 2WAFA 3IBJA 2FFYA 1SKOA 4P85A 4IVKA 2EWVA 4DXBA 5FI7A 4B4ZA 4L0LA 2ZL1A 1MWSA 1CJFA 3OLOA 3WS0A 2IWCA 3VOLA 4WMCA 2G2UA 5J3WA 2Q9MA 2JKRI 3M6HA 4Z9QA 1MPLA 3BQ8A 3RJUA 2DRWA 1FCNA 4N1HA 1D1JA 3MXRA 4S2MA 5CTMA 3QP2A 3AGDA 1TD5A 2PHYA 4XUXA 3GSGA 5GLAA 5CEDA 3V50A 2ZM0A 1BLHA 1H8MA 4HBUA 3SW1A 1PW8A 3NECA 1KE4A 1P9RA 4R70A 4ZJ1A 4PPRA 3N8SA 1Y54A 4MBHA 3K3DA 2HDRA 3ZG5A 5FDSA 4JPMA 2D02A 3MMHA 5M19A 5HAPA 4FH4A 3G31A 3EWKA 1NY0A 3VE3A 2XRNA 2O99A 4I3AA 2IWDA 1F5MA 2VLGA 3UMEA 3BWLA 3GRJA 3M2JA 4FSFA 3HLEA 3S7OA 1XXMA 2ACGA 5E2GA 3ZG7B 1G5UA 3H82B 4P6BA 1LHYA 3G2ZA 2PU4A 1CEGA 5GHYA 4IHQA 1JWZA 2EX9A 4HY8A 1JWPA 2GX5A 3A3FA 2W3HA 3BY9A 1F98A 4E6XA 1GA0A 2XD5A 2O9AA 3P09A 2H5SA 1PI5A 3O5YA 2I9VA 4EUVA 2ZOIA 1QMFA 4RA7A 3ITAA 1YSQA 1VM1A 3AGEA 3NULA 2M7UA 3PTEA 4Y13A 3IF6A 1K25A 1ZTUA 2XGNA 4OPZA 4E6WA 4HP9A 3N4IA 5AQBA 4EQ1A 3MSHA 3E4QA 4GJ4A 4E04A 3C7UA 3CAXA 4R3AA 4R3BA 4HEFA 5CHJA 4GHIA 1DP9A 4OH0A 4JGPA 4LRYC 2QPNA 3D3OA 4LCLA 3GR2A 1RGZA 4PAUA 3PBNA 1XFQA 3KSFA 3MJQA 2E8IA 2J9OA 4Y7PA 1PI4A 4HH3A 3ICYA 2MJ6A 4MN7A 3N8LA 1QMEA 5DF9A 3VFFA 5AVEA 1RCJA 2W1RA 3BLMA 3UE0A 4QWOA 1NRJA 2DMWA 4OOYA 1S0WA 5L09A 3GQZA 1MWRA 3E4OA 4FCFA 1H3QA 2V0UA 3IXHA 2WADA 3G35A 5DTTA 2A24B 2X71A 2O0YA 5IS1A 1AXBA 4DDYA 3UDXA 2WKHA 4KQDA 4Z1WA 3OPHA 3DBAA 1BLSA 5EVLA 2PT7A 1ERQA 2HGVA 3DAVA 4ETZA 4FUWA 2V1BA 4C6YA 3BFGA 5F68A 4OPRA 1KE3A 3W4OA 4OOLA 5EE8A 4YFMA 3D9YA 2M7VA 1S4RA 1XKZA 1H0MA 3K2NA 1XJ3A 2UWXA 4P0MA 4D2OA 1LI0A 1H5XA 4X53A 4DE3A 4KZ9A 3BFEA 3LUQA 1ONGA 2P08A 3ZVWA 3H9WA 2PRFA 4L9GA 3GVBA 1PNEA 4MDZA 4E3JA 4LFUA 4DKIA 1NXYA 4EBNA 5HARA 4N92A 5EUAA 3ZNTA 3FZCA 3NY4A 4K0XA 3B33A 2L0WA 1CK3A 1OJ5A 3AGFA 4XXRA 4LCMA 4I3JA 4LV0A 3MZEA 2J9PA 4F3LA 2HP6A 4I3IA 1AWIA 2Q0OA 4PM5A 3HCYA 4OQGA 4QY6A 3K3CA 5GHXA 1C3BA 5HL6A 3ZDJA 2JBFA 1K57C 4U3TA 4B4XA 3TJZC 3ZFZA 3ZG9B 1CI9A 3ISGA 3C4PA 4ESPA 5F1GA 4ZTKA 3PR6A 3QHYA 4KUKA 4JF4A 2J3TC 5M1AA 2HPBA 1CEFA 3NHQA 5FL3A 3LYXA 4HP4A 2ZMVA 1JNUA 3O86A 1VB6A 4MBKA 5J7EA 4NETA 1N9OA 5MC7A 1G28A 5A92A 1MWTA 3T1XA 4ZRRA 1XA7A 5EOOA 2ZD8A 3T4JA 1XA1A 4E3KA 1TS7A 4QB8A 4DE1A 4N1XA 3IH8A 4DJ3A 2Y2LA 3P98A 5FAQA 3M6BA 1OTAA 4KG2A 5F82A 4FH2A 2Y55A 1K54C 1YSPA 3UB7A 3T50A 3V3RA 3C8CA 1IKIA 4GD8A 1K57A 5FQ9A 4EWFA 3HREA 1L0DA 3G34A 2ZL1B 2BG1A 4GLQA 4WN5A 1LI9A 5DTSA 4PM9A 3KYZA 2XFTA 5FQIA 5U47A 4BMWA 5CRFA 2ZMFA 2M1CA 4YINA 4R6LA 4HNBA 3RH8B 1GA9A 3V39A 1P97A 2Z6DA 1WE4A 5FEFA 3IH9A 2WGVA 5FQMA 2Y91A 4MNRA 4Q8IA 5IU1A 4EXOA 4GKUA 2JKGA 2X01A 4HESA 3SS4A 2GNXA 3CG5A 4X68A 3D4FA 3LIAA 1RGYA 4K91A 1H8ZA 1LLBA 4LPZA 1K55A 3T4OA 1W8YA 4NK3A 1IKGA 5FAPA 3JVVA 3F1PB 3S22A 5KZHA 1S4SA 1U60A 2WKPA 5D3OA 4C3QA 3IHAA 3MF0A 1YLTA 2J8YA 1KVLA 2INWA 3F1PA 2ZC4B 4EETB 5DF7A 2AVXA 5F5YA 5LBRA 4X69A 3BW6A 2EFUA 3A3IA 2WZXA 5AQAA 3SS3A 4BWIA 1OMEA 2H0YA 2X02A 3N6IA 1NWZA 3VMAA 5DKLA 4KQQA 3NIAA 4WUJA 3JPUA 2ZC3B 3VP3A 3PBSA 1FOFA 2BASA 2LB9A 3TG9A 4Q0IA 3UDFA 3VP2A 2W27A 3T4TA 1Y4OA 4IVIA 1BSGA 1ALQA 3ZVTA 3ZQ5A 1DJCA 4BL3A 1NYMA 1DP6A 1J9MA 3LR0A 4ARZA 4Y3IA 1KVMA 5GLBA 2ZM2A 2EX2A 2FH5A 4HOIA 1YKDA 2EXAA 5EM0A 3P01A 3Q7VA 1YM1A 2A3UA 4KUOA 1LT0A 2IWBA 4GS9B 1Q2QA 3V3SA 1J3WA 1XJ6A 3C7VA 3CI6A 4WEJA 1I5QA 1PWCA 3T12B 2PU2A 1SDEA 1WA9A 4N9LA 2Y2OA 4LV1A 4QHCA 2B18A 4M4XA 5G18A 1W8QA 3LCEA 4Y5FA 1K4FA 3M2KA 2VV8A 3LEZA 3KO6A 4XUZA 3BEBA 4WLAA 1FSYA 1JTDA 4II7A 1TS0A 2J7VA 4G3KA 2XQZA 1ESIA 3VSLA 1OTBA 5FSRA 4H8RA 2PAVP 2UV0E 3IBRA 5FQQA 3E98A 2C5WB 5TBMA 1MZUA 4OLGA 3B42A 4L9FA 1PFLA 1PRQA 1BZAA 3L7HA 4OQHA 1KOUA 4JXWA 5TR7A 4MMNA 3SH9A 4DF6A 1XX2A 1LSXA 4CLCE 2QZ6A 5J4EA 1Z09A 4RX3A 3CMZA 3CPTB 1T1BA 2V2FF 1PWGA 3Q7ZA 3EEAA 1TF1A 4GB7A 5JYPA 2OV5A 1XPBA 5A93A 4KZ6A 3QNCA 4UA6A 2XK1A 2WK0A 3UE6A 4CJNA 3UPPA 1K0KA 1Z6FA 2FFFB 3CPTA 2KOIA 2Y2JA 2XSSA 3LIEA 3QP6A 5GHZA 5DJTA 5EPHA 5FDHA 2EXBA 4E3IA 1K4EA 3O88A 2OOLA 3FYZA 4O7DA 1YT4A 1BULA 5DF8A 3C30A 5HX9A 5HAQA 1GCEA 3TOIA 4DJ2A 1CQAA 2HP5A 1IEMA 2EA9A 5BOHA 4GCZA 2WKEA 4FOFA 3Q1FA 4S2PA 1K38A 3KSGA 3IS2B 3MZDA 4ETXA 1ES3A 5FATA 4KENB 3T1RA 3CJMA 2Y2MA 2JKTM 3LFVA 3PBTA 1LL9A 5KIZA 5CERA 3OCLA 1ONHA 4PKYG 3IXGA 4BBVA 5HWWA 3HLWA 2HDSA 3GV9A 1ERMA 1BLPA 4KZ3A 3IWOA 4E3OA 4B88A 4EU0A 2RL3A 4PM6A 2VK3A 3PAEA 1YLWA 5FA7A 2XROA 4NXEA 2Z6CA 3ZNYA 3QP5A 3BRMA 5AQ9A 1YLJA 2VEAA 3HJIA 3F1OB 5DTKA 3H82A 1RP5A 4R0QA
chains in the Genus database with same CATH topology
3PAGA 2WYXA 4PM5A 4OPYA 3W4PA 4OQGA 4WZ5C 4OP5A 4QY6A 2P74A 4U0XA 4WZ5A 5GHXA 1C3BA 4WEKA 3ZDJA 2JBFA 5DVAA 2WGWA 5A90A 3WWXA 4IBXA 1K57C 4U3TA 4B4XA 5CECA 3ZFZA 3UPNA 3ZG9B 1YLYA 1CI9A 3ISGA 4QY5A 3C4PA 3HLDA 3JYIA 1NJ4A 4S2JA 5F1GA 3HUNA 1IYQA 5FI6A 4X6TA 4ZTKA 1ESUA 1MWUA 5FAOA 1N9BA 3QHYA 1IELA 2G2WA 3NCKA 4ZDXA 3HLFA 1M6KA 3QNBA 4R1GA 4WYYA 1E25A 3S1YA 4JF4A 4QD4A 5M1AA 2HPBA 1CEFA 4M3KA 3G4PA 1KGEA 2WUQA 1ZG6A 3O86A 5GLCA 3Q07A 4MBKA 1YMSA 1VQQA 4NETA 3NI9A 1ES2A 1EROA 3CZDA 3IWQA 2XLNA 1NYYA 3VSKA 1G6AA 2OLUA 1M40A 3MBZA 1WYCA 4OKPA 3MKEA 4MLLA 3TSGA 5A92A 2XEPA 3DWZA 4OONA 3WS5A 3MXSA 1MWTA 1FQGA 4KZ8A 3MZFA 2ZC7A 3B3XA 1ZKJA 4KZBA 5FASA 4DRTA 1XA7A 3FV7A 2WKIA 5EOOA 1FCOA 2ZD8A 4OVDA 2QMIA 2Y2NA 1XA1A 4E3KA 1PYYA 1GHPA 1SCWA 3VOYA 1TEMA 4JF5A 2ZQ7A 1WYBA 4QB8A 4KZ7A 2Y4AA 4DE1A 1YLPA 3A3DA 3GTCA 4WELA 5FQJA 4JXVA 4N1XA 1K56A 3IH8A 3IT9A 2Y2LA 3P98A 4CPKA 3MKFA 5FAQA 3M6BA 3FWLA 4KG2A 3RXWA 4GN2A 4JKTA 5F82A 4FH2A 3G2YA 4ID4A 2Y55A 4RVAA 3S4XA 3BECA 3BYDA 3PBRA 4EV4A 1K54C 3HVFA 3ZG8B 4BL2A 3DTMA 1FR1A 1K54A 1K56D 4PMAA 1W79A 1KGGA 2RCXA 4MBFA 4OLDA 3V3RA 1N4OA 1L0GA 3IWIA 1CI8A 1ES5A 1IKIA 1XP4A 5E2EA 1JWVA 3IF5A 4GD8A 1K57A 2H10A 2C6WB 5FQ9A 1O07A 2WAEA 4R3JA 3UNWA 2EFXA 4R23A 4KG5A 4KZ4A 4R4SA 4MEZA 4EWFA 3WS1A 1PW1A 3HREA 4X55A 2Z2MB 1L0DA 3G34A 2BG1A 2XR0A 3HLCA 1LI9A 5DTSA 1TDLA 3MFDA 3UY6A 3BM6A 3VP4A 1HD8A 3HLBA 4PM9A 5AQ7A 2XFTA 5FQIA 2WAFA 3PBOA 5U47A 2FFYA 2DNSA 4P85A 4WBGA 4IVKA 4OP8A 1EI5A 4OQ0A 5CRFA 4R4RA 3NBLA 4YINA 4DXBA 5FI7A 4B4ZA 5CXWA 4L0LA 5HAIA 3SH7A 1NRFA 2EX8A 1GA9A 3V39A 1MWSA 3UE1A 5M18A 2OLVA 3A3JA 5EVIB 5E2FA 3WS0A 2WGIA 1KE0A 2IWCA 1YQSA 4IEDA 1ZC2A 2G2UA 1WE4A 1NZOA 4WMCA 2Q9MA 5CGSA 3IH9A 1FR6A 3M6HA 4Z9QA 1KGFA 1MPLA 2JCHA 2WGVA 3NDGA 2HP9A 3RJUA 2DRWA 5FQMA 2Y91A 3IXBA 2ZM8A 4GDNA 4MNRA 4Q8IA 1BTLA 1FCNA 4F94A 4N1HA 2ZC5B 4GKUA 3MXRA 2X01A 3VP1A 4HESA 4S2MA 3SS4A 2GDNA 3G30A 4DXCA 4S2NC 3CG5A 4OOMA 3AGDA 5CTMA 4ZJ3A 4X68A 3D4FA 3SS5A 1RGYA 5I94A 4K91A 3RXXA 4XUXA 3GSGA 5GLAA 1H8ZA 1LLBA 4JBFA 1PWDA 5CEDA 3V50A 1K55A 1IYOA 3C5AA 1W8YA 3Q82A 1IKGA 2ZM0A 3Q7VB 4NK3A 5FAPA 1BLHA 3S22A 4HBUA 4BJPA 5KZHA 1PW8A 3NC8A 3UE3A 1YLZA 1KE4A 3VOZA 3OZHA 1U60A 4ZJ1A 1HTZA 5D3OA 5EECA 4PPRA 4JF6A 4KZAA 3N8SA 1Y54A 4C3QA 3VFHA 2DCFA 3IHAA 1YLTA 4MBHA 4EQIA 5EVIA 1MBLA 1EWZA 3OPLA 4BQMA 2J8YA 1KVLA 3ITBA 1E3UD 2P9VA 2ZC4B 2HDRA 3ZG5A 1SKFA 3BFFA 5DF7A 4JPMA 3HUOA 5M19A 5CGXA 4E3MA 4X69A 5HAPA 2EFUA 4FH4A 1SDNA 5HW3A 3A3IA 3DWKA 2WZXA 5AQAA 3I7JA 3G31A 3GMWA 1NY0A 4LENA 3E2KA 3SS3A 3DW0A 4E3LA 1OMEA 1NZUA 2H0YA 5KSCA 3E2LA 2IWDA 3OC2A 2X02A 5IHVA 3N6IA 3VMAA 3GRJA 3M2JA 3O87A 4FSFA 3HLEA 5F1FA 1XXMA 5E2GA 3UDIA 3ZG7B 3BFDA 4UHUA 1L2SA 4KQQA 4E3NA 3NIAA 2R9XA 4P6BA 1LHYA 2ZC3B 3G2ZA 2PU4A 1W7FA 1CEGA 5GHYA 5GLDA 1JWZA 3OCNA 2EX9A 3VP3A 2R9WA 3PBSA 4GZBA 1FOFA 4QJGA 5GL9A 2Y2HA 1JWPA 3WS4A 1Q2PA 3A3FA 3TG9A 4K0WA 1TDGA 3UDFA 3VP2A 4E6XA 1S6RA 3G32A 1GA0A 2XD5A 1ES4A 4IVIA 1BSGA 3P09A 1ALQA 3BLSA 5A91A 3ZVTA 2H5SA 1PI5A 3FKVA 3LY4A 1DJCA 3HBRA 4BL3A 1NYMA 4EUZA 1J9MA 2I72A 2XF3A 4N9KA 5L2FA 3SH8A 1KVMA 5CTNA 5GLBA 3UN7A 2ZM2A 4JXGA 1QMFA 2EX2A 4RA7A 3ITAA 4GNUA 3EQUA 2A49A 1W5DA 2EXAA 2ZQ8A 4KQRA 1VM1A 3Q7VA 1YM1A 4DDSA 2A3UA 4GD6A 2ZQAA 3AGEA 2IWBA 5HFOA 5EVID 1Q2QA 3PTEA 3V3SA 1TVFA 3IF6A 2Q9NA 1K25A 3C7VA 3HLGA 2XD1A 2XGNA 4FD8A 4PM8A 4WEJA 4OPZA 4E6WA 1I5QA 1PZOA 3N4IA 5AQBA 3W4QA 4C75A 1PWCA 5CEBA 5HL1A 3VP0A 2ZQ9A 4JLFA 2PU2A 1FCMA 1SDEA 2JC7A 2P9VB 4WZ4A 4KZ5A 4N9LA 2Y2OA 4LV1A 1GHIA 4JXSA 4QHCA 1G68A 5G18A 4U0TA 1MY8A 1W8QA 1I2SA 3LCEA 1K4FA 3M2KA 4LV2A 4PM7A 3C7UA 4BLMA 5J8XA 5FI2A 4GDBA 3LEZA 4R3BA 3FKWA 4HEFA 5CHJA 4XUZA 4IBRA 4OH0A 4EBPA 3BEBA 1H8YA 3UO9A 1FSYA 1K55C 1JTDA 4P87A 2J7VA 2XQZA 1ESIA 3VSLA 5FSRA 2QPNA 3LY3A 4LCLA 3GR2A 4H8RA 4HBTA 3ZCZA 4WMCD 1RGZA 1FSWA 2Y2IA 2Z2LB 5FQQA 2C5WB 3PBNA 4OLGA 2HDUA 1E4DA 2XFSA 2E8IA 2J9OA 4Y7PA 1PI4A 1ZG4A 2ZQCA 1I2WA 3OPRA 1BLCA 4UAAA 5CHUA 1K6RA 3N8LA 1BZAA 1QMEA 5DF9A 4OQHA 5E2HA 1PZPA 3VFFA 3N7WA 5EOEA 4EBLA 4JXWA 4WM9A 5TR7A 1RCJA 2ZQDA 3SH9A 3O3VA 3BLMA 4DF6A 1L0EA 1XX2A 1YMXA 3NDEA 3UE0A 3IQAA 5KMWA 2QZ6A 4OOYA 1S0WA 4ZAMA 4RX3A 3GQZA 1MWRA 3HUMA 4S2IA 3CMZA 4FCFA 2V2FF 4RYEA 1PWGA 3C4OA 3Q7ZA 1BUEA 1MKIA 3IXHA 2ZC6B 4GB7A 5JYPA 2OV5A 2WGWB 1KDWA 2WADA 3G35A 1XPBA 4ZJ2A 5JYOA 5F83A 5DTTA 5A93A 1XGJA 2X71A 4KZ6A 1KDSA 2Y2GA 3PBQA 2JE5A 2XK1A 3IXDA 3QNCA 4UA6A 1AXBA 4UA9A 4DDYA 3WS2A 2WK0A 4CJNA 4UA7A 3UDXA 2WKHA 2ZLYA 3UPPA 4X56A 1Z6FA 1O7EA 3UPOA 3WRZA 1XGIA 4BENA 2CC1A 2FFFB 3V5MA 1HVBA 4DE2A 2Y59A 2Y2JA 3OPHA 2OSUA 5GHZA 3OPPA 5EPHA 1BLSA 5EVLA 5FDHA 2VGJA 1ERQA 2XH9A 2EXBA 4E3IA 2Y2PA 2B5RA 5E43A 1K4EA 3O88A 1L0FA 3N8RA 1JTGA 3FYZA 4O7DA 1YT4A 4S2OA 1BULA 4C6YA 5TFQA 5DF8A 5HX9A 1MXOA 4OPQA 5HAQA 1GCEA 3TOIA 3BFGA 4LV3A 2HP5A 1IEMA 3LO7A 4OPRA 1KE3A 3IF6B 3WRTA 3W4OA 5BOHA 1GHMA 4OOLA 4Y0TA 3Q81A 5EE8A 1DY6A 2WKEA 4BD1A 4YFMA 3Q1FA 4S2PA 4S2NA 1K38A 2V1ZA 2XDMA 1XKZA 4S2KA 2V20A 3MZDA 1BT5A 2UWXA 5FQKA 4P0MA 2BLSA 1ES3A 4D2OA 1LI0A 4A5RA 2Y2QA 1H5XA 3IF6C 5FATA 1LL5A 4KENB 2ZMAA 4X53A 4DE3A 2Y2KA 3CJMA 2Y2MA 5TGFA 4QU3A 4KZ9A 3ZGAB 2WZZA 3BFEA 4OQIA 3PBTA 1ONGA 1LL9A 5KSHA 3ZVWA 4S2LA 5CERA 3GVBA 4Y0OA 3OCLA 1DJAA 1ONHA 5CHMA 3IXGA 3HL9A 4E3JA 4Y0UA 3HLWA 2HDSA 3GV9A 3IHBA 1DJBA 4DKIA 1ERMA 1BLPA 1NXYA 4KZ3A 3IWOA 5HARA 4KG6A 5EVIC 4BD0A 4N92A 4E3OA 4EBNA 4B88A 2HDQA 3EQVA 5EUAA 4ZBEA 2RL3A 1IYPA 3ZNTA 4PM6A 1HZOA 5CGWA 3PAEA 3FZCA 1IYSA 1YLWA 2PBYA 3NY4A 2ZJ9A 5FA7A 1E3UA 2H0TA 4K0XA 3ZHHA 1CK3A 3AGFA 4XXRA 1SHVA 3ZNYA 3BRMA 4LCMA 3SOIA 5AQ9A 1PIOA 4LV0A 1JVJA 1YLJA 3W8KA 4RX2A 3MZEA 3A3EA 4GOGA 4DE0A 2J9PA 2HP6A 2EX6A 5DTKA 3ZG0A 3BFCA 1K6SA 2VGKA 4KQOA 1RP5A 4R0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PAG A;  2WYX A;  4PM5 A;  4OPY A;  3W4P A;  4OQG A;  4WZ5 C;  4OP5 A;  4QY6 A;  2P74 A;  4U0X A;  4WZ5 A;  5GHX A;  1C3B A;  4WEK A;  3ZDJ A;  2JBF A;  5DVA A;  2WGW A;  5A90 A;  3WWX A;  4IBX A;  1K57 C;  4U3T A;  4B4X A;  5CEC A;  3ZFZ A;  3UPN A;  3ZG9 B;  1YLY A;  1CI9 A;  3ISG A;  4QY5 A;  3C4P A;  3HLD A;  3JYI A;  1NJ4 A;  4S2J A;  5F1G A;  3HUN A;  1IYQ A;  5FI6 A;  4X6T A;  4ZTK A;  1ESU A;  1MWU A;  5FAO A;  1N9B A;  3QHY A;  1IEL A;  2G2W A;  3NCK A;  4ZDX A;  3HLF A;  1M6K A;  3QNB A;  4R1G A;  4WYY A;  1E25 A;  3S1Y A;  4JF4 A;  4QD4 A;  5M1A A;  2HPB A;  1CEF A;  4M3K A;  3G4P A;  1KGE A;  2WUQ A;  1ZG6 A;  3O86 A;  5GLC A;  3Q07 A;  4MBK A;  1YMS A;  1VQQ A;  4NET A;  3NI9 A;  1ES2 A;  1ERO A;  3CZD A;  3IWQ A;  2XLN A;  1NYY A;  3VSK A;  1G6A A;  2OLU A;  1M40 A;  3MBZ A;  1WYC A;  4OKP A;  3MKE A;  4MLL A;  3TSG A;  5A92 A;  2XEP A;  3DWZ A;  4OON A;  3WS5 A;  3MXS A;  1MWT A;  1FQG A;  4KZ8 A;  3MZF A;  2ZC7 A;  3B3X A;  1ZKJ A;  4KZB A;  5FAS A;  4DRT A;  1XA7 A;  3FV7 A;  2WKI A;  5EOO A;  1FCO A;  2ZD8 A;  4OVD A;  2QMI A;  2Y2N A;  1XA1 A;  4E3K A;  1PYY A;  1GHP A;  1SCW A;  3VOY A;  1TEM A;  4JF5 A;  2ZQ7 A;  1WYB A;  4QB8 A;  4KZ7 A;  2Y4A A;  4DE1 A;  1YLP A;  3A3D A;  3GTC A;  4WEL A;  5FQJ A;  4JXV A;  4N1X A;  1K56 A;  3IH8 A;  3IT9 A;  2Y2L A;  3P98 A;  4CPK A;  3MKF A;  5FAQ A;  3M6B A;  3FWL A;  4KG2 A;  3RXW A;  4GN2 A;  4JKT A;  5F82 A;  4FH2 A;  3G2Y A;  4ID4 A;  2Y55 A;  4RVA A;  3S4X A;  3BEC A;  3BYD A;  3PBR A;  4EV4 A;  1K54 C;  3HVF A;  3ZG8 B;  4BL2 A;  3DTM A;  1FR1 A;  1K54 A;  1K56 D;  4PMA A;  1W79 A;  1KGG A;  2RCX A;  4MBF A;  4OLD A;  3V3R A;  1N4O A;  1L0G A;  3IWI A;  1CI8 A;  1ES5 A;  1IKI A;  1XP4 A;  5E2E A;  1JWV A;  3IF5 A;  4GD8 A;  1K57 A;  2H10 A;  2C6W B;  5FQ9 A;  1O07 A;  2WAE A;  4R3J A;  3UNW A;  2EFX A;  4R23 A;  4KG5 A;  4KZ4 A;  4R4S A;  4MEZ A;  4EWF A;  3WS1 A;  1PW1 A;  3HRE A;  4X55 A;  2Z2M B;  1L0D A;  3G34 A;  2BG1 A;  2XR0 A;  3HLC A;  1LI9 A;  5DTS A;  1TDL A;  3MFD A;  3UY6 A;  3BM6 A;  3VP4 A;  1HD8 A;  3HLB A;  4PM9 A;  5AQ7 A;  2XFT A;  5FQI A;  2WAF A;  3PBO A;  5U47 A;  2FFY A;  2DNS A;  4P85 A;  4WBG A;  4IVK A;  4OP8 A;  1EI5 A;  4OQ0 A;  5CRF A;  4R4R A;  3NBL A;  4YIN A;  4DXB A;  5FI7 A;  4B4Z A;  5CXW A;  4L0L A;  5HAI A;  3SH7 A;  1NRF A;  2EX8 A;  1GA9 A;  3V39 A;  1MWS A;  3UE1 A;  5M18 A;  2OLV A;  3A3J A;  5EVI B;  5E2F A;  3WS0 A;  2WGI A;  1KE0 A;  2IWC A;  1YQS A;  4IED A;  1ZC2 A;  2G2U A;  1WE4 A;  1NZO A;  4WMC A;  2Q9M A;  5CGS A;  3IH9 A;  1FR6 A;  3M6H A;  4Z9Q A;  1KGF A;  1MPL A;  2JCH A;  2WGV A;  3NDG A;  2HP9 A;  3RJU A;  2DRW A;  5FQM A;  2Y91 A;  3IXB A;  2ZM8 A;  4GDN A;  4MNR A;  4Q8I A;  1BTL A;  1FCN A;  4F94 A;  4N1H A;  2ZC5 B;  4GKU A;  3MXR A;  2X01 A;  3VP1 A;  4HES A;  4S2M A;  3SS4 A;  2GDN A;  3G30 A;  4DXC A;  4S2N C;  3CG5 A;  4OOM A;  3AGD A;  5CTM A;  4ZJ3 A;  4X68 A;  3D4F A;  3SS5 A;  1RGY A;  5I94 A;  4K91 A;  3RXX A;  4XUX A;  3GSG A;  5GLA A;  1H8Z A;  1LLB A;  4JBF A;  1PWD A;  5CED A;  3V50 A;  1K55 A;  1IYO A;  3C5A A;  1W8Y A;  3Q82 A;  1IKG A;  2ZM0 A;  3Q7V B;  4NK3 A;  5FAP A;  1BLH A;  3S22 A;  4HBU A;  4BJP A;  5KZH A;  1PW8 A;  3NC8 A;  3UE3 A;  1YLZ A;  1KE4 A;  3VOZ A;  3OZH A;  1U60 A;  4ZJ1 A;  1HTZ A;  5D3O A;  5EEC A;  4PPR A;  4JF6 A;  4KZA A;  3N8S A;  1Y54 A;  4C3Q A;  3VFH A;  2DCF A;  3IHA A;  1YLT A;  4MBH A;  4EQI A;  5EVI A;  1MBL A;  1EWZ A;  3OPL A;  4BQM A;  2J8Y A;  1KVL A;  3ITB A;  1E3U D;  2P9V A;  2ZC4 B;  2HDR A;  3ZG5 A;  1SKF A;  3BFF A;  5DF7 A;  4JPM A;  3HUO A;  5M19 A;  5CGX A;  4E3M A;  4X69 A;  5HAP A;  2EFU A;  4FH4 A;  1SDN A;  5HW3 A;  3A3I A;  3DWK A;  2WZX A;  5AQA A;  3I7J A;  3G31 A;  3GMW A;  1NY0 A;  4LEN A;  3E2K A;  3SS3 A;  3DW0 A;  4E3L A;  1OME A;  1NZU A;  2H0Y A;  5KSC A;  3E2L A;  2IWD A;  3OC2 A;  2X02 A;  5IHV A;  3N6I A;  3VMA A;  3GRJ A;  3M2J A;  3O87 A;  4FSF A;  3HLE A;  5F1F A;  1XXM A;  5E2G A;  3UDI A;  3ZG7 B;  3BFD A;  4UHU A;  1L2S A;  4KQQ A;  4E3N A;  3NIA A;  2R9X A;  4P6B A;  1LHY A;  2ZC3 B;  3G2Z A;  2PU4 A;  1W7F A;  1CEG A;  5GHY A;  5GLD A;  1JWZ A;  3OCN A;  2EX9 A;  3VP3 A;  2R9W A;  3PBS A;  4GZB A;  1FOF A;  4QJG A;  5GL9 A;  2Y2H A;  1JWP A;  3WS4 A;  1Q2P A;  3A3F A;  3TG9 A;  4K0W A;  1TDG A;  3UDF A;  3VP2 A;  4E6X A;  1S6R A;  3G32 A;  1GA0 A;  2XD5 A;  1ES4 A;  4IVI A;  1BSG A;  3P09 A;  1ALQ A;  3BLS A;  5A91 A;  3ZVT A;  2H5S A;  1PI5 A;  3FKV A;  3LY4 A;  1DJC A;  3HBR A;  4BL3 A;  1NYM A;  4EUZ A;  1J9M A;  2I72 A;  2XF3 A;  4N9K A;  5L2F A;  3SH8 A;  1KVM A;  5CTN A;  5GLB A;  3UN7 A;  2ZM2 A;  4JXG A;  1QMF A;  2EX2 A;  4RA7 A;  3ITA A;  4GNU A;  3EQU A;  2A49 A;  1W5D A;  2EXA A;  2ZQ8 A;  4KQR A;  1VM1 A;  3Q7V A;  1YM1 A;  4DDS A;  2A3U A;  4GD6 A;  2ZQA A;  3AGE A;  2IWB A;  5HFO A;  5EVI D;  1Q2Q A;  3PTE A;  3V3S A;  1TVF A;  3IF6 A;  2Q9N A;  1K25 A;  3C7V A;  3HLG A;  2XD1 A;  2XGN A;  4FD8 A;  4PM8 A;  4WEJ A;  4OPZ A;  4E6W A;  1I5Q A;  1PZO A;  3N4I A;  5AQB A;  3W4Q A;  4C75 A;  1PWC A;  5CEB A;  5HL1 A;  3VP0 A;  2ZQ9 A;  4JLF A;  2PU2 A;  1FCM A;  1SDE A;  2JC7 A;  2P9V B;  4WZ4 A;  4KZ5 A;  4N9L A;  2Y2O A;  4LV1 A;  1GHI A;  4JXS A;  4QHC A;  1G68 A;  5G18 A;  4U0T A;  1MY8 A;  1W8Q A;  1I2S A;  3LCE A;  1K4F A;  3M2K A;  4LV2 A;  4PM7 A;  3C7U A;  4BLM A;  5J8X A;  5FI2 A;  4GDB A;  3LEZ A;  4R3B A;  3FKW A;  4HEF A;  5CHJ A;  4XUZ A;  4IBR A;  4OH0 A;  4EBP A;  3BEB A;  1H8Y A;  3UO9 A;  1FSY A;  1K55 C;  1JTD A;  4P87 A;  2J7V A;  2XQZ A;  1ESI A;  3VSL A;  5FSR A;  2QPN A;  3LY3 A;  4LCL A;  3GR2 A;  4H8R A;  4HBT A;  3ZCZ A;  4WMC D;  1RGZ A;  1FSW A;  2Y2I A;  2Z2L B;  5FQQ A;  2C5W B;  3PBN A;  4OLG A;  2HDU A;  1E4D A;  2XFS A;  2E8I A;  2J9O A;  4Y7P A;  1PI4 A;  1ZG4 A;  2ZQC A;  1I2W A;  3OPR A;  1BLC A;  4UAA A;  5CHU A;  1K6R A;  3N8L A;  1BZA A;  1QME A;  5DF9 A;  4OQH A;  5E2H A;  1PZP A;  3VFF A;  3N7W A;  5EOE A;  4EBL A;  4JXW A;  4WM9 A;  5TR7 A;  1RCJ A;  2ZQD A;  3SH9 A;  3O3V A;  3BLM A;  4DF6 A;  1L0E A;  1XX2 A;  1YMX A;  3NDE A;  3UE0 A;  3IQA A;  5KMW A;  2QZ6 A;  4OOY A;  1S0W A;  4ZAM A;  4RX3 A;  3GQZ A;  1MWR A;  3HUM A;  4S2I A;  3CMZ A;  4FCF A;  2V2F F;  4RYE A;  1PWG A;  3C4O A;  3Q7Z A;  1BUE A;  1MKI A;  3IXH A;  2ZC6 B;  4GB7 A;  5JYP A;  2OV5 A;  2WGW B;  1KDW A;  2WAD A;  3G35 A;  1XPB A;  4ZJ2 A;  5JYO A;  5F83 A;  5DTT A;  5A93 A;  1XGJ A;  2X71 A;  4KZ6 A;  1KDS A;  2Y2G A;  3PBQ A;  2JE5 A;  2XK1 A;  3IXD A;  3QNC A;  4UA6 A;  1AXB A;  4UA9 A;  4DDY A;  3WS2 A;  2WK0 A;  4CJN A;  4UA7 A;  3UDX A;  2WKH A;  2ZLY A;  3UPP A;  4X56 A;  1Z6F A;  1O7E A;  3UPO A;  3WRZ A;  1XGI A;  4BEN A;  2CC1 A;  2FFF B;  3V5M A;  1HVB A;  4DE2 A;  2Y59 A;  2Y2J A;  3OPH A;  2OSU A;  5GHZ A;  3OPP A;  5EPH A;  1BLS A;  5EVL A;  5FDH A;  2VGJ A;  1ERQ A;  2XH9 A;  2EXB A;  4E3I A;  2Y2P A;  2B5R A;  5E43 A;  1K4E A;  3O88 A;  1L0F A;  3N8R A;  1JTG A;  3FYZ A;  4O7D A;  1YT4 A;  4S2O A;  1BUL A;  4C6Y A;  5TFQ A;  5DF8 A;  5HX9 A;  1MXO A;  4OPQ A;  5HAQ A;  1GCE A;  3TOI A;  3BFG A;  4LV3 A;  2HP5 A;  1IEM A;  3LO7 A;  4OPR A;  1KE3 A;  3IF6 B;  3WRT A;  3W4O A;  5BOH A;  1GHM A;  4OOL A;  4Y0T A;  3Q81 A;  5EE8 A;  1DY6 A;  2WKE A;  4BD1 A;  4YFM A;  3Q1F A;  4S2P A;  4S2N A;  1K38 A;  2V1Z A;  2XDM A;  1XKZ A;  4S2K A;  2V20 A;  3MZD A;  1BT5 A;  2UWX A;  5FQK A;  4P0M A;  2BLS A;  1ES3 A;  4D2O A;  1LI0 A;  4A5R A;  2Y2Q A;  1H5X A;  3IF6 C;  5FAT A;  1LL5 A;  4KEN B;  2ZMA A;  4X53 A;  4DE3 A;  2Y2K A;  3CJM A;  2Y2M A;  5TGF A;  4QU3 A;  4KZ9 A;  3ZGA B;  2WZZ A;  3BFE A;  4OQI A;  3PBT A;  1ONG A;  1LL9 A;  5KSH A;  3ZVW A;  4S2L A;  5CER A;  3GVB A;  4Y0O A;  3OCL A;  1DJA A;  1ONH A;  5CHM A;  3IXG A;  3HL9 A;  4E3J A;  4Y0U A;  3HLW A;  2HDS A;  3GV9 A;  3IHB A;  1DJB A;  4DKI A;  1ERM A;  1BLP A;  1NXY A;  4KZ3 A;  3IWO A;  5HAR A;  4KG6 A;  5EVI C;  4BD0 A;  4N92 A;  4E3O A;  4EBN A;  4B88 A;  2HDQ A;  3EQV A;  5EUA A;  4ZBE A;  2RL3 A;  1IYP A;  3ZNT A;  4PM6 A;  1HZO A;  5CGW A;  3PAE A;  3FZC A;  1IYS A;  1YLW A;  2PBY A;  3NY4 A;  2ZJ9 A;  5FA7 A;  1E3U A;  2H0T A;  4K0X A;  3ZHH A;  1CK3 A;  3AGF A;  4XXR A;  1SHV A;  3ZNY A;  3BRM A;  4LCM A;  3SOI A;  5AQ9 A;  1PIO A;  4LV0 A;  1JVJ A;  1YLJ A;  3W8K A;  4RX2 A;  3MZE A;  3A3E A;  4GOG A;  4DE0 A;  2J9P A;  2HP6 A;  2EX6 A;  5DTK A;  3ZG0 A;  3BFC A;  1K6S A;  2VGK A;  4KQO A;  1RP5 A;  4R0Q A; 
#chains in the Genus database with same CATH topology
 2WYX A;  4OPY A;  1FIL A;  4WZ5 C;  3CUE A;  5DVA A;  2K7S A;  1X0O A;  4IBX A;  2JKF A;  4QY5 A;  1GSV A;  3JYI A;  1L3L A;  1UWP X;  4X6T A;  1ESU A;  4I39 A;  1STZ A;  2E8J A;  4I5S A;  4P6Z M;  1M6K A;  3S1Y A;  1E25 A;  3MS6 A;  4NXB A;  4B93 A;  5EV0 A;  1GSX A;  4UEY A;  2WUQ A;  4Q0H A;  2H28 A;  2OAQ 1;  2XLN A;  5HDD A;  4WL9 A;  1WYC A;  2V8C A;  3TSG A;  1LL8 A;  2JKT I;  3DWZ A;  3MXS A;  3A0V A;  4HH2 A;  3MZF A;  3A0R A;  2ZC7 A;  3R7W B;  3FV7 A;  5HWT A;  1P0Z A;  1VET B;  4P6Z S;  1OTE A;  3VOY A;  1TEM A;  2ZQ7 A;  1MC0 A;  3A3D A;  5FQJ A;  3R7W A;  1TS8 A;  4CPK A;  1GSW A;  3LEQ A;  4JKT A;  4K08 A;  3G2Y A;  4LLO B;  3BYD A;  3PBR A;  4JGR A;  2QJ7 A;  4BL2 A;  3DTM A;  1K54 A;  1K56 D;  3T1S A;  4OLD A;  3IX8 A;  1L0G A;  2HJ9 C;  1CI8 A;  1JWV A;  3IF5 A;  2C6W B;  3FPV A;  3QP8 A;  4R23 A;  4DN0 A;  4R4S A;  3MQ0 A;  3WS1 A;  4Y15 A;  4X55 A;  2KX6 A;  1TDL A;  3MFD A;  1HD8 A;  2WKR A;  2PR6 A;  4CLC A;  3PBO A;  2DNS A;  4WBG A;  1EI5 A;  4OQ0 A;  4R4R A;  5TJJ A;  5CXW A;  1T1C A;  5HAI A;  3SH7 A;  1NRF A;  3PYP A;  3A3J A;  5EVI B;  2WGI A;  3C2W A;  4IED A;  2B02 A;  3NJA A;  5CGS A;  1FR6 A;  5HPI A;  2JCH A;  1N9L A;  4GDN A;  1BTL A;  1SZV A;  3G30 A;  3S7N A;  3MQQ A;  4OOM A;  5I94 A;  4Y17 A;  4JBF A;  4F3L B;  4HJ4 A;  4CQH A;  2QKP A;  3Q7V B;  5EM1 A;  1UGU A;  5FEG A;  2ZOH A;  4HJ6 A;  3VOZ A;  1HTZ A;  4JF6 A;  2DCF A;  4EQI A;  1OPX A;  3MXQ A;  1MBL A;  1EWZ A;  3OPL A;  4BQM A;  2VGL S;  2P9V A;  1SKF A;  4EER A;  4E3M A;  1OT9 A;  5HW3 A;  3I7J A;  4LEN A;  3E2K A;  2G7U A;  4E3L A;  1NZU A;  5KSC A;  3E2L A;  2J3T D;  3OC2 A;  3P7N A;  1F9I A;  4EEP A;  5TBM B;  4UHU A;  1L2S A;  2PDR A;  1W7F A;  5HDS A;  3OCN A;  2R9W A;  3BQA A;  5GL9 A;  1Q2P A;  4K0W A;  4G3W A;  2Y8H A;  1S6R A;  4O8G A;  4UQI S;  3H7W B;  4X1L A;  3LY4 A;  3HBR A;  3S7Q A;  4EUZ A;  2XF3 A;  4N9K A;  3UN7 A;  4AFI A;  2VGL M;  4JXG A;  3ULF A;  3EQU A;  2XA7 M;  1W5D A;  1F2K A;  2K2N A;  3H7W A;  4DDS A;  4GD6 A;  5HFO A;  5EVI D;  2W3E A;  2K31 A;  4FD8 A;  4PM8 A;  4LRZ E;  3W4Q A;  5HL1 A;  2ZQ9 A;  4JLF A;  5CX7 A;  4WZ4 A;  2P9V B;  1MY8 A;  1I2S A;  4LV2 A;  4BLM A;  5FI2 A;  4GDB A;  3FKW A;  3CLO A;  1H8Y A;  4L9E A;  3UO9 A;  3GEC A;  3VE4 A;  1V9Z A;  4BBU A;  1P9W A;  3ZCZ A;  4WMC D;  1FSW A;  2Y2I A;  2YKH A;  2HDU A;  3UB9 A;  3OPR A;  4UAA A;  4R38 A;  5E2H A;  1PZP A;  5EOE A;  4EBL A;  4WM9 A;  2ZQD A;  3O3V A;  1NLZ A;  1L0E A;  2EWW A;  5KMW A;  2QWS A;  1VEU B;  4X1M A;  3U2A A;  3HUM A;  4S2I A;  5IT5 A;  1N9N A;  1BUE A;  1MKI A;  5HZH A;  3T4Q A;  2ZC6 B;  1KDW A;  1XGJ A;  3BY8 A;  1KDS A;  3IXD A;  4UA9 A;  3WS2 A;  4UA7 A;  4X56 A;  3UPO A;  1XGI A;  3V5M A;  4DE2 A;  2Y59 A;  1S67 L;  3MQO A;  2Y2P A;  2B5R A;  5E43 A;  1L0F A;  3N8R A;  1JTG A;  4D60 A;  4QPR A;  4LV3 A;  4IUH A;  4HHD A;  2VV6 A;  3WRT A;  4NEE D;  1GHM A;  4Y0T A;  1DY6 A;  3CUE C;  5DJU A;  4S2N A;  2V1Z A;  2A24 A;  5F6A A;  1VET A;  2V20 A;  5FQK A;  1OTI A;  4YOF A;  3T4S A;  2BLS A;  4A5R A;  5G4Z A;  2Y2Q A;  3IF6 C;  4PHT A;  1LSV A;  4NKP A;  1S1Y A;  5TGF A;  2WZZ A;  4OQI A;  5KSH A;  4S2L A;  4MN5 A;  5CHM A;  1HLU P;  3IHB A;  1DJB A;  3RFB A;  5EVI C;  2JKR M;  3LIF A;  1IYP A;  1HZO A;  4JGO A;  5CGW A;  3G6O A;  2PBY A;  3EOI A;  2ZJ9 A;  3FG8 A;  3T4K A;  1SHV A;  1FIK A;  4O01 A;  1IFQ A;  1JVJ A;  3W8K A;  4RX2 A;  1LSW A;  4UQI M;  4DE0 A;  4NG2 A;  2EX6 A;  1K6S A;  2HJE A;  3PAG A;  3KX0 X;  1S66 L;  3W4P A;  4YNR A;  4U0X A;  2WGW A;  3WWX A;  1D7E A;  2V9A A;  2W3G A;  1NJ4 A;  4S2J A;  3ZYT A;  1IYQ A;  5FI6 A;  2W3F A;  2VA0 A;  2W0N A;  5I5L A;  5FAO A;  1XJ2 A;  1N9B A;  1IEL A;  2G2W A;  3FPW A;  2A2L A;  4WYY A;  4ARZ B;  4YWZ A;  1G6O A;  4QD4 A;  1ACF A;  4M3K A;  1KGE A;  3F1N A;  1ZG6 A;  5GLC A;  3Q07 A;  2Y79 A;  4IUK A;  1YMS A;  2OWJ A;  5AJG A;  1VQQ A;  3IWQ A;  2OLU A;  1M40 A;  3MR0 A;  3D72 A;  4MLL A;  4HIA A;  3WS5 A;  4BBT A;  1FQG A;  2J80 A;  3TW8 A;  3B3X A;  1ZKJ A;  4KZB A;  4DRT A;  3DTK A;  5HD5 A;  1FCO A;  3LIC A;  1UWN X;  1PYY A;  1GHP A;  3GDI A;  3FC7 A;  1WYB A;  4X25 A;  4Y2F A;  4GHI B;  3GTC A;  4JXV A;  4ID4 A;  3S4X A;  3BEC A;  3ZG8 B;  3HVF A;  1T1A A;  4LRX C;  4PMA A;  1FR1 A;  4B9O A;  3EGX C;  1KGG A;  2RCX A;  2W1T A;  4MBF A;  1N4O A;  3IWI A;  1XP4 A;  2H10 A;  4WF0 A;  1O07 A;  2VZW A;  2WAE A;  5C5K A;  3UNW A;  2O9B A;  4KZ4 A;  1PW1 A;  2VJW A;  3HJK A;  2XR0 A;  3BM6 A;  1XFN A;  3QP1 A;  3HLB A;  5AQ7 A;  3SZT A;  4OP8 A;  1OJG A;  3KYQ A;  3NBL A;  2EX8 A;  3UE1 A;  5M18 A;  2OLV A;  5E2F A;  3NOP C;  1KE0 A;  1YQS A;  1ZC2 A;  1XJ4 A;  1NZO A;  1KGF A;  3NDG A;  2HP9 A;  1ODV A;  2VKS A;  3IXB A;  2ZM8 A;  4F94 A;  2ZC5 B;  3VP1 A;  3T4L A;  5L07 A;  2GDN A;  4DXC A;  4S2N C;  4ZJ3 A;  3SS5 A;  3E0Y A;  2VX8 A;  3RXX A;  1PWD A;  3F1O A;  1IYO A;  3C5A A;  3Q82 A;  1NLY A;  4BJP A;  3NC8 A;  2PYP A;  3UE3 A;  3VV4 A;  1YLZ A;  4MN6 A;  3OZH A;  3LI9 A;  1BYW A;  5EEC A;  1DRM A;  4KZA A;  3VFH A;  5EVI A;  3ITB A;  1E3U D;  3F1N B;  2JHE A;  2PR5 A;  3BFF A;  3NOU C;  4DMZ A;  3HUO A;  2QHK A;  1TS6 A;  1Y28 A;  5CGX A;  3EGD C;  2W3D A;  1SDN A;  3DWK A;  3IX4 A;  2ZBB A;  3GMW A;  3DW0 A;  3V67 A;  1OTD A;  4IJG A;  2JN7 A;  1S1Z A;  4EEU A;  5IHV A;  3O87 A;  4GS9 A;  4H6J B;  5F1F A;  3UDI A;  3BFD A;  4E3N A;  2R9X A;  5GLD A;  4QJG A;  5K5B A;  3KSH A;  4GZB A;  2Y2H A;  3WS4 A;  2NUT C;  1TDG A;  3CHW P;  3G32 A;  5DFX A;  1ES4 A;  3BLS A;  5A91 A;  3FKV A;  4I38 A;  2I72 A;  5L2F A;  3SH8 A;  2KDK A;  5CTN A;  3DTE A;  2PD7 A;  2CMN A;  4GNU A;  3LGO A;  2A49 A;  2ZQ8 A;  4CLC D;  4KQR A;  2V1A A;  3U4L P;  2ZQA A;  2P04 A;  3S7P A;  1TVF A;  4RQ9 A;  2Q9N A;  2KLI A;  3HLG A;  2XD1 A;  1PZO A;  2L4R A;  5F69 A;  1A0K A;  4C75 A;  5CEB A;  3VP0 A;  4G3V A;  1FCM A;  2JC7 A;  5HDC A;  4KZ5 A;  1YAX A;  1GHI A;  4JXS A;  1G68 A;  4Q0J A;  4U0T A;  3UMD A;  2IA2 A;  5HPF A;  4PM7 A;  5J8X A;  3UB8 A;  3R4K A;  1YPR A;  2VV7 A;  4O0P A;  4IBR A;  4EBP A;  1K55 C;  5A8B A;  4P87 A;  2HF6 A;  2R78 A;  3NOT C;  3LY3 A;  2LB5 A;  4NXF A;  4HBT A;  1T18 A;  2Z2L B;  4HQA A;  3CIT A;  2XFS A;  1E4D A;  1VEU A;  1ZG4 A;  2ZQC A;  1I2W A;  1BLC A;  5CHU A;  3LI8 A;  1K6R A;  3N7W A;  3DTI A;  1YMX A;  3NDE A;  5DFY A;  5L10 A;  3IQA A;  2FZ0 A;  3W2Z A;  4LGW A;  1OT6 A;  4ZAM A;  4CLC B;  3E4P A;  4RYE A;  3C4O A;  2PBD P;  2PD8 A;  2D01 A;  2WGW B;  4NXG A;  4ZJ2 A;  5JYO A;  5F83 A;  3TE8 A;  3IS2 A;  4CLC C;  1D06 A;  2Y2G A;  3PBQ A;  2JE5 A;  1IOU A;  3OOV A;  2ZLY A;  2GJ3 A;  1O7E A;  3WRZ A;  4BEN A;  3C38 A;  2CC1 A;  4PKY A;  1HVB A;  2OSU A;  3OPP A;  1MKM A;  2VGJ A;  4XT2 B;  2XH9 A;  2B95 A;  2V8F A;  3BJN A;  4S2O A;  5TFQ A;  1MXO A;  4OPQ A;  5L8M A;  3TRC A;  1T19 A;  3LO7 A;  3IF6 B;  3OBF A;  4HJ3 A;  3Q81 A;  2HV1 A;  4BD1 A;  4GW9 A;  2XDM A;  4S2K A;  2O9C A;  1BT5 A;  3LIB A;  3UB5 P;  3KYE A;  3A0S A;  1LL5 A;  2ZMA A;  3LID A;  2Y2K A;  3QP4 A;  4QU3 A;  3ZGA B;  4Y0O A;  1DJA A;  3HL9 A;  4Y0U A;  3JVU A;  2XA7 S;  4BD0 A;  4KG6 A;  2HDQ A;  3EQV A;  4ZBE A;  1IYS A;  1V9Y A;  4EW7 A;  1E3U A;  2H0T A;  3ZHH A;  3L9K A;  4JGQ A;  3UB6 A;  3SOI A;  1PIO A;  5HWV A;  1VHM A;  3A3E A;  4GOG A;  3ZG0 A;  1EW0 A;  3BFC A;  2VGK A;  4KQO A;  4OP5 A;  4XT2 A;  2P74 A;  4WZ5 A;  4WEK A;  5A90 A;  1DP8 A;  5EVE A;  3LR5 A;  5CEC A;  3IX3 A;  3UPN A;  1YLY A;  2NUP C;  4HI4 A;  3HLD A;  3HUN A;  2L1M A;  1MWU A;  1W63 Q;  3NCK A;  4ZDX A;  3HLF A;  3QNB A;  4R1G A;  4FTX A;  2QJ5 A;  2V0W A;  3G4P A;  3LR4 A;  4ME4 A;  2QYB A;  5EFW A;  3B47 A;  1ZHH B;  3NI9 A;  1ES2 A;  1ERO A;  3CZD A;  5HSQ A;  1NYY A;  3VSK A;  1G6A A;  3MBZ A;  4OKP A;  3MKE A;  2XEP A;  3CWF A;  4OON A;  3RTY A;  4KZ8 A;  3PHY A;  5FAS A;  2WKI A;  2HZ5 A;  4OVD A;  2QMI A;  2Y2N A;  1SCW A;  2J3W A;  4MCW A;  4JF5 A;  2W1T B;  4KZ7 A;  2Y4A A;  1YLP A;  4WEL A;  2PYR A;  5DKK A;  2GZA A;  1K56 A;  3EEH A;  2OAP 1;  3IT9 A;  1CF0 A;  3MKF A;  3RXW A;  3FWL A;  4GN2 A;  4RVA A;  4EV4 A;  2BTF P;  1W63 M;  2P7J A;  1W79 A;  4H6J A;  1ES5 A;  2YKF A;  5E2E A;  3LR3 A;  4EES A;  2OWH A;  1SKO B;  4R3J A;  2EFX A;  5G4Y A;  4KG5 A;  4MEZ A;  5AVF A;  2Z2M B;  2WKQ A;  3MFX A;  3KSI A;  3T1Q B;  3UY6 A;  3HLC A;  5HD3 A;  3VP4 A;  3PXP A;  2WAF A;  3IBJ A;  2FFY A;  1SKO A;  4P85 A;  4IVK A;  2EWV A;  4DXB A;  5FI7 A;  4B4Z A;  4L0L A;  2ZL1 A;  1MWS A;  1CJF A;  3OLO A;  3WS0 A;  2IWC A;  3VOL A;  4WMC A;  2G2U A;  5J3W A;  2Q9M A;  2JKR I;  3M6H A;  4Z9Q A;  1MPL A;  3BQ8 A;  3RJU A;  2DRW A;  1FCN A;  4N1H A;  1D1J A;  3MXR A;  4S2M A;  5CTM A;  3QP2 A;  3AGD A;  1TD5 A;  2PHY A;  4XUX A;  3GSG A;  5GLA A;  5CED A;  3V50 A;  2ZM0 A;  1BLH A;  1H8M A;  4HBU A;  3SW1 A;  1PW8 A;  3NEC A;  1KE4 A;  1P9R A;  4R70 A;  4ZJ1 A;  4PPR A;  3N8S A;  1Y54 A;  4MBH A;  3K3D A;  2HDR A;  3ZG5 A;  5FDS A;  4JPM A;  2D02 A;  3MMH A;  5M19 A;  5HAP A;  4FH4 A;  3G31 A;  3EWK A;  1NY0 A;  3VE3 A;  2XRN A;  2O99 A;  4I3A A;  2IWD A;  1F5M A;  2VLG A;  3UME A;  3BWL A;  3GRJ A;  3M2J A;  4FSF A;  3HLE A;  3S7O A;  1XXM A;  2ACG A;  5E2G A;  3ZG7 B;  1G5U A;  3H82 B;  4P6B A;  1LHY A;  3G2Z A;  2PU4 A;  1CEG A;  5GHY A;  4IHQ A;  1JWZ A;  2EX9 A;  4HY8 A;  1JWP A;  2GX5 A;  3A3F A;  2W3H A;  3BY9 A;  1F98 A;  4E6X A;  1GA0 A;  2XD5 A;  2O9A A;  3P09 A;  2H5S A;  1PI5 A;  3O5Y A;  2I9V A;  4EUV A;  2ZOI A;  1QMF A;  4RA7 A;  3ITA A;  1YSQ A;  1VM1 A;  3AGE A;  3NUL A;  2M7U A;  3PTE A;  4Y13 A;  3IF6 A;  1K25 A;  1ZTU A;  2XGN A;  4OPZ A;  4E6W A;  4HP9 A;  3N4I A;  5AQB A;  4EQ1 A;  3MSH A;  3E4Q A;  4GJ4 A;  4E04 A;  3C7U A;  3CAX A;  4R3A A;  4R3B A;  4HEF A;  5CHJ A;  4GHI A;  1DP9 A;  4OH0 A;  4JGP A;  4LRY C;  2QPN A;  3D3O A;  4LCL A;  3GR2 A;  1RGZ A;  4PAU A;  3PBN A;  1XFQ A;  3KSF A;  3MJQ A;  2E8I A;  2J9O A;  4Y7P A;  1PI4 A;  4HH3 A;  3ICY A;  2MJ6 A;  4MN7 A;  3N8L A;  1QME A;  5DF9 A;  3VFF A;  5AVE A;  1RCJ A;  2W1R A;  3BLM A;  3UE0 A;  4QWO A;  1NRJ A;  2DMW A;  4OOY A;  1S0W A;  5L09 A;  3GQZ A;  1MWR A;  3E4O A;  4FCF A;  1H3Q A;  2V0U A;  3IXH A;  2WAD A;  3G35 A;  5DTT A;  2A24 B;  2X71 A;  2O0Y A;  5IS1 A;  1AXB A;  4DDY A;  3UDX A;  2WKH A;  4KQD A;  4Z1W A;  3OPH A;  3DBA A;  1BLS A;  5EVL A;  2PT7 A;  1ERQ A;  2HGV A;  3DAV A;  4ETZ A;  4FUW A;  2V1B A;  4C6Y A;  3BFG A;  5F68 A;  4OPR A;  1KE3 A;  3W4O A;  4OOL A;  5EE8 A;  4YFM A;  3D9Y A;  2M7V A;  1S4R A;  1XKZ A;  1H0M A;  3K2N A;  1XJ3 A;  2UWX A;  4P0M A;  4D2O A;  1LI0 A;  1H5X A;  4X53 A;  4DE3 A;  4KZ9 A;  3BFE A;  3LUQ A;  1ONG A;  2P08 A;  3ZVW A;  3H9W A;  2PRF A;  4L9G A;  3GVB A;  1PNE A;  4MDZ A;  4E3J A;  4LFU A;  4DKI A;  1NXY A;  4EBN A;  5HAR A;  4N92 A;  5EUA A;  3ZNT A;  3FZC A;  3NY4 A;  4K0X A;  3B33 A;  2L0W A;  1CK3 A;  1OJ5 A;  3AGF A;  4XXR A;  4LCM A;  4I3J A;  4LV0 A;  3MZE A;  2J9P A;  4F3L A;  2HP6 A;  4I3I A;  1AWI A;  2Q0O A;  4PM5 A;  3HCY A;  4OQG A;  4QY6 A;  3K3C A;  5GHX A;  1C3B A;  5HL6 A;  3ZDJ A;  2JBF A;  1K57 C;  4U3T A;  4B4X A;  3TJZ C;  3ZFZ A;  3ZG9 B;  1CI9 A;  3ISG A;  3C4P A;  4ESP A;  5F1G A;  4ZTK A;  3PR6 A;  3QHY A;  4KUK A;  4JF4 A;  2J3T C;  5M1A A;  2HPB A;  1CEF A;  3NHQ A;  5FL3 A;  3LYX A;  4HP4 A;  2ZMV A;  1JNU A;  3O86 A;  1VB6 A;  4MBK A;  5J7E A;  4NET A;  1N9O A;  5MC7 A;  1G28 A;  5A92 A;  1MWT A;  3T1X A;  4ZRR A;  1XA7 A;  5EOO A;  2ZD8 A;  3T4J A;  1XA1 A;  4E3K A;  1TS7 A;  4QB8 A;  4DE1 A;  4N1X A;  3IH8 A;  4DJ3 A;  2Y2L A;  3P98 A;  5FAQ A;  3M6B A;  1OTA A;  4KG2 A;  5F82 A;  4FH2 A;  2Y55 A;  1K54 C;  1YSP A;  3UB7 A;  3T50 A;  3V3R A;  3C8C A;  1IKI A;  4GD8 A;  1K57 A;  5FQ9 A;  4EWF A;  3HRE A;  1L0D A;  3G34 A;  2ZL1 B;  2BG1 A;  4GLQ A;  4WN5 A;  1LI9 A;  5DTS A;  4PM9 A;  3KYZ A;  2XFT A;  5FQI A;  5U47 A;  4BMW A;  5CRF A;  2ZMF A;  2M1C A;  4YIN A;  4R6L A;  4HNB A;  3RH8 B;  1GA9 A;  3V39 A;  1P97 A;  2Z6D A;  1WE4 A;  5FEF A;  3IH9 A;  2WGV A;  5FQM A;  2Y91 A;  4MNR A;  4Q8I A;  5IU1 A;  4EXO A;  4GKU A;  2JKG A;  2X01 A;  4HES A;  3SS4 A;  2GNX A;  3CG5 A;  4X68 A;  3D4F A;  3LIA A;  1RGY A;  4K91 A;  1H8Z A;  1LLB A;  4LPZ A;  1K55 A;  3T4O A;  1W8Y A;  4NK3 A;  1IKG A;  5FAP A;  3JVV A;  3F1P B;  3S22 A;  5KZH A;  1S4S A;  1U60 A;  2WKP A;  5D3O A;  4C3Q A;  3IHA A;  3MF0 A;  1YLT A;  2J8Y A;  1KVL A;  2INW A;  3F1P A;  2ZC4 B;  4EET B;  5DF7 A;  2AVX A;  5F5Y A;  5LBR A;  4X69 A;  3BW6 A;  2EFU A;  3A3I A;  2WZX A;  5AQA A;  3SS3 A;  4BWI A;  1OME A;  2H0Y A;  2X02 A;  3N6I A;  1NWZ A;  3VMA A;  5DKL A;  4KQQ A;  3NIA A;  4WUJ A;  3JPU A;  2ZC3 B;  3VP3 A;  3PBS A;  1FOF A;  2BAS A;  2LB9 A;  3TG9 A;  4Q0I A;  3UDF A;  3VP2 A;  2W27 A;  3T4T A;  1Y4O A;  4IVI A;  1BSG A;  1ALQ A;  3ZVT A;  3ZQ5 A;  1DJC A;  4BL3 A;  1NYM A;  1DP6 A;  1J9M A;  3LR0 A;  4ARZ A;  4Y3I A;  1KVM A;  5GLB A;  2ZM2 A;  2EX2 A;  2FH5 A;  4HOI A;  1YKD A;  2EXA A;  5EM0 A;  3P01 A;  3Q7V A;  1YM1 A;  2A3U A;  4KUO A;  1LT0 A;  2IWB A;  4GS9 B;  1Q2Q A;  3V3S A;  1J3W A;  1XJ6 A;  3C7V A;  3CI6 A;  4WEJ A;  1I5Q A;  1PWC A;  3T12 B;  2PU2 A;  1SDE A;  1WA9 A;  4N9L A;  2Y2O A;  4LV1 A;  4QHC A;  2B18 A;  4M4X A;  5G18 A;  1W8Q A;  3LCE A;  4Y5F A;  1K4F A;  3M2K A;  2VV8 A;  3LEZ A;  3KO6 A;  4XUZ A;  3BEB A;  4WLA A;  1FSY A;  1JTD A;  4II7 A;  1TS0 A;  2J7V A;  4G3K A;  2XQZ A;  1ESI A;  3VSL A;  1OTB A;  5FSR A;  4H8R A;  2PAV P;  2UV0 E;  3IBR A;  5FQQ A;  3E98 A;  2C5W B;  5TBM A;  1MZU A;  4OLG A;  3B42 A;  4L9F A;  1PFL A;  1PRQ A;  1BZA A;  3L7H A;  4OQH A;  1KOU A;  4JXW A;  5TR7 A;  4MMN A;  3SH9 A;  4DF6 A;  1XX2 A;  1LSX A;  4CLC E;  2QZ6 A;  5J4E A;  1Z09 A;  4RX3 A;  3CMZ A;  3CPT B;  1T1B A;  2V2F F;  1PWG A;  3Q7Z A;  3EEA A;  1TF1 A;  4GB7 A;  5JYP A;  2OV5 A;  1XPB A;  5A93 A;  4KZ6 A;  3QNC A;  4UA6 A;  2XK1 A;  2WK0 A;  3UE6 A;  4CJN A;  3UPP A;  1K0K A;  1Z6F A;  2FFF B;  3CPT A;  2KOI A;  2Y2J A;  2XSS A;  3LIE A;  3QP6 A;  5GHZ A;  5DJT A;  5EPH A;  5FDH A;  2EXB A;  4E3I A;  1K4E A;  3O88 A;  2OOL A;  3FYZ A;  4O7D A;  1YT4 A;  1BUL A;  5DF8 A;  3C30 A;  5HX9 A;  5HAQ A;  1GCE A;  3TOI A;  4DJ2 A;  1CQA A;  2HP5 A;  1IEM A;  2EA9 A;  5BOH A;  4GCZ A;  2WKE A;  4FOF A;  3Q1F A;  4S2P A;  1K38 A;  3KSG A;  3IS2 B;  3MZD A;  4ETX A;  1ES3 A;  5FAT A;  4KEN B;  3T1R A;  3CJM A;  2Y2M A;  2JKT M;  3LFV A;  3PBT A;  1LL9 A;  5KIZ A;  5CER A;  3OCL A;  1ONH A;  4PKY G;  3IXG A;  4BBV A;  5HWW A;  3HLW A;  2HDS A;  3GV9 A;  1ERM A;  1BLP A;  4KZ3 A;  3IWO A;  4E3O A;  4B88 A;  4EU0 A;  2RL3 A;  4PM6 A;  2VK3 A;  3PAE A;  1YLW A;  5FA7 A;  2XRO A;  4NXE A;  2Z6C A;  3ZNY A;  3QP5 A;  3BRM A;  5AQ9 A;  1YLJ A;  2VEA A;  3HJI A;  3F1O B;  5DTK A;  3H82 A;  1RP5 A;  4R0Q A; 
#chains in the Genus database with same CATH homology
 3PAG A;  2WYX A;  4PM5 A;  4OPY A;  3W4P A;  4OQG A;  4WZ5 C;  4OP5 A;  4QY6 A;  2P74 A;  4U0X A;  4WZ5 A;  5GHX A;  1C3B A;  4WEK A;  3ZDJ A;  2JBF A;  5DVA A;  2WGW A;  5A90 A;  3WWX A;  4IBX A;  1K57 C;  4U3T A;  4B4X A;  5CEC A;  3ZFZ A;  3UPN A;  3ZG9 B;  1YLY A;  1CI9 A;  3ISG A;  4QY5 A;  3C4P A;  3HLD A;  3JYI A;  1NJ4 A;  4S2J A;  5F1G A;  3HUN A;  1IYQ A;  5FI6 A;  4X6T A;  4ZTK A;  1ESU A;  1MWU A;  5FAO A;  1N9B A;  3QHY A;  1IEL A;  2G2W A;  3NCK A;  4ZDX A;  3HLF A;  1M6K A;  3QNB A;  4R1G A;  4WYY A;  1E25 A;  3S1Y A;  4JF4 A;  4QD4 A;  5M1A A;  2HPB A;  1CEF A;  4M3K A;  3G4P A;  1KGE A;  2WUQ A;  1ZG6 A;  3O86 A;  5GLC A;  3Q07 A;  4MBK A;  1YMS A;  1VQQ A;  4NET A;  3NI9 A;  1ES2 A;  1ERO A;  3CZD A;  3IWQ A;  2XLN A;  1NYY A;  3VSK A;  1G6A A;  2OLU A;  1M40 A;  3MBZ A;  1WYC A;  4OKP A;  3MKE A;  4MLL A;  3TSG A;  5A92 A;  2XEP A;  3DWZ A;  4OON A;  3WS5 A;  3MXS A;  1MWT A;  1FQG A;  4KZ8 A;  3MZF A;  2ZC7 A;  3B3X A;  1ZKJ A;  4KZB A;  5FAS A;  4DRT A;  1XA7 A;  3FV7 A;  2WKI A;  5EOO A;  1FCO A;  2ZD8 A;  4OVD A;  2QMI A;  2Y2N A;  1XA1 A;  4E3K A;  1PYY A;  1GHP A;  1SCW A;  3VOY A;  1TEM A;  4JF5 A;  2ZQ7 A;  1WYB A;  4QB8 A;  4KZ7 A;  2Y4A A;  4DE1 A;  1YLP A;  3A3D A;  3GTC A;  4WEL A;  5FQJ A;  4JXV A;  4N1X A;  1K56 A;  3IH8 A;  3IT9 A;  2Y2L A;  3P98 A;  4CPK A;  3MKF A;  5FAQ A;  3M6B A;  3FWL A;  4KG2 A;  3RXW A;  4GN2 A;  4JKT A;  5F82 A;  4FH2 A;  3G2Y A;  4ID4 A;  2Y55 A;  4RVA A;  3S4X A;  3BEC A;  3BYD A;  3PBR A;  4EV4 A;  1K54 C;  3HVF A;  3ZG8 B;  4BL2 A;  3DTM A;  1FR1 A;  1K54 A;  1K56 D;  4PMA A;  1W79 A;  1KGG A;  2RCX A;  4MBF A;  4OLD A;  3V3R A;  1N4O A;  1L0G A;  3IWI A;  1CI8 A;  1ES5 A;  1IKI A;  1XP4 A;  5E2E A;  1JWV A;  3IF5 A;  4GD8 A;  1K57 A;  2H10 A;  2C6W B;  5FQ9 A;  1O07 A;  2WAE A;  4R3J A;  3UNW A;  2EFX A;  4R23 A;  4KG5 A;  4KZ4 A;  4R4S A;  4MEZ A;  4EWF A;  3WS1 A;  1PW1 A;  3HRE A;  4X55 A;  2Z2M B;  1L0D A;  3G34 A;  2BG1 A;  2XR0 A;  3HLC A;  1LI9 A;  5DTS A;  1TDL A;  3MFD A;  3UY6 A;  3BM6 A;  3VP4 A;  1HD8 A;  3HLB A;  4PM9 A;  5AQ7 A;  2XFT A;  5FQI A;  2WAF A;  3PBO A;  5U47 A;  2FFY A;  2DNS A;  4P85 A;  4WBG A;  4IVK A;  4OP8 A;  1EI5 A;  4OQ0 A;  5CRF A;  4R4R A;  3NBL A;  4YIN A;  4DXB A;  5FI7 A;  4B4Z A;  5CXW A;  4L0L A;  5HAI A;  3SH7 A;  1NRF A;  2EX8 A;  1GA9 A;  3V39 A;  1MWS A;  3UE1 A;  5M18 A;  2OLV A;  3A3J A;  5EVI B;  5E2F A;  3WS0 A;  2WGI A;  1KE0 A;  2IWC A;  1YQS A;  4IED A;  1ZC2 A;  2G2U A;  1WE4 A;  1NZO A;  4WMC A;  2Q9M A;  5CGS A;  3IH9 A;  1FR6 A;  3M6H A;  4Z9Q A;  1KGF A;  1MPL A;  2JCH A;  2WGV A;  3NDG A;  2HP9 A;  3RJU A;  2DRW A;  5FQM A;  2Y91 A;  3IXB A;  2ZM8 A;  4GDN A;  4MNR A;  4Q8I A;  1BTL A;  1FCN A;  4F94 A;  4N1H A;  2ZC5 B;  4GKU A;  3MXR A;  2X01 A;  3VP1 A;  4HES A;  4S2M A;  3SS4 A;  2GDN A;  3G30 A;  4DXC A;  4S2N C;  3CG5 A;  4OOM A;  3AGD A;  5CTM A;  4ZJ3 A;  4X68 A;  3D4F A;  3SS5 A;  1RGY A;  5I94 A;  4K91 A;  3RXX A;  4XUX A;  3GSG A;  5GLA A;  1H8Z A;  1LLB A;  4JBF A;  1PWD A;  5CED A;  3V50 A;  1K55 A;  1IYO A;  3C5A A;  1W8Y A;  3Q82 A;  1IKG A;  2ZM0 A;  3Q7V B;  4NK3 A;  5FAP A;  1BLH A;  3S22 A;  4HBU A;  4BJP A;  5KZH A;  1PW8 A;  3NC8 A;  3UE3 A;  1YLZ A;  1KE4 A;  3VOZ A;  3OZH A;  1U60 A;  4ZJ1 A;  1HTZ A;  5D3O A;  5EEC A;  4PPR A;  4JF6 A;  4KZA A;  3N8S A;  1Y54 A;  4C3Q A;  3VFH A;  2DCF A;  3IHA A;  1YLT A;  4MBH A;  4EQI A;  5EVI A;  1MBL A;  1EWZ A;  3OPL A;  4BQM A;  2J8Y A;  1KVL A;  3ITB A;  1E3U D;  2P9V A;  2ZC4 B;  2HDR A;  3ZG5 A;  1SKF A;  3BFF A;  5DF7 A;  4JPM A;  3HUO A;  5M19 A;  5CGX A;  4E3M A;  4X69 A;  5HAP A;  2EFU A;  4FH4 A;  1SDN A;  5HW3 A;  3A3I A;  3DWK A;  2WZX A;  5AQA A;  3I7J A;  3G31 A;  3GMW A;  1NY0 A;  4LEN A;  3E2K A;  3SS3 A;  3DW0 A;  4E3L A;  1OME A;  1NZU A;  2H0Y A;  5KSC A;  3E2L A;  2IWD A;  3OC2 A;  2X02 A;  5IHV A;  3N6I A;  3VMA A;  3GRJ A;  3M2J A;  3O87 A;  4FSF A;  3HLE A;  5F1F A;  1XXM A;  5E2G A;  3UDI A;  3ZG7 B;  3BFD A;  4UHU A;  1L2S A;  4KQQ A;  4E3N A;  3NIA A;  2R9X A;  4P6B A;  1LHY A;  2ZC3 B;  3G2Z A;  2PU4 A;  1W7F A;  1CEG A;  5GHY A;  5GLD A;  1JWZ A;  3OCN A;  2EX9 A;  3VP3 A;  2R9W A;  3PBS A;  4GZB A;  1FOF A;  4QJG A;  5GL9 A;  2Y2H A;  1JWP A;  3WS4 A;  1Q2P A;  3A3F A;  3TG9 A;  4K0W A;  1TDG A;  3UDF A;  3VP2 A;  4E6X A;  1S6R A;  3G32 A;  1GA0 A;  2XD5 A;  1ES4 A;  4IVI A;  1BSG A;  3P09 A;  1ALQ A;  3BLS A;  5A91 A;  3ZVT A;  2H5S A;  1PI5 A;  3FKV A;  3LY4 A;  1DJC A;  3HBR A;  4BL3 A;  1NYM A;  4EUZ A;  1J9M A;  2I72 A;  2XF3 A;  4N9K A;  5L2F A;  3SH8 A;  1KVM A;  5CTN A;  5GLB A;  3UN7 A;  2ZM2 A;  4JXG A;  1QMF A;  2EX2 A;  4RA7 A;  3ITA A;  4GNU A;  3EQU A;  2A49 A;  1W5D A;  2EXA A;  2ZQ8 A;  4KQR A;  1VM1 A;  3Q7V A;  1YM1 A;  4DDS A;  2A3U A;  4GD6 A;  2ZQA A;  3AGE A;  2IWB A;  5HFO A;  5EVI D;  1Q2Q A;  3PTE A;  3V3S A;  1TVF A;  3IF6 A;  2Q9N A;  1K25 A;  3C7V A;  3HLG A;  2XD1 A;  2XGN A;  4FD8 A;  4PM8 A;  4WEJ A;  4OPZ A;  4E6W A;  1I5Q A;  1PZO A;  3N4I A;  5AQB A;  3W4Q A;  4C75 A;  1PWC A;  5CEB A;  5HL1 A;  3VP0 A;  2ZQ9 A;  4JLF A;  2PU2 A;  1FCM A;  1SDE A;  2JC7 A;  2P9V B;  4WZ4 A;  4KZ5 A;  4N9L A;  2Y2O A;  4LV1 A;  1GHI A;  4JXS A;  4QHC A;  1G68 A;  5G18 A;  4U0T A;  1MY8 A;  1W8Q A;  1I2S A;  3LCE A;  1K4F A;  3M2K A;  4LV2 A;  4PM7 A;  3C7U A;  4BLM A;  5J8X A;  5FI2 A;  4GDB A;  3LEZ A;  4R3B A;  3FKW A;  4HEF A;  5CHJ A;  4XUZ A;  4IBR A;  4OH0 A;  4EBP A;  3BEB A;  1H8Y A;  3UO9 A;  1FSY A;  1K55 C;  1JTD A;  4P87 A;  2J7V A;  2XQZ A;  1ESI A;  3VSL A;  5FSR A;  2QPN A;  3LY3 A;  4LCL A;  3GR2 A;  4H8R A;  4HBT A;  3ZCZ A;  4WMC D;  1RGZ A;  1FSW A;  2Y2I A;  2Z2L B;  5FQQ A;  2C5W B;  3PBN A;  4OLG A;  2HDU A;  1E4D A;  2XFS A;  2E8I A;  2J9O A;  4Y7P A;  1PI4 A;  1ZG4 A;  2ZQC A;  1I2W A;  3OPR A;  1BLC A;  4UAA A;  5CHU A;  1K6R A;  3N8L A;  1BZA A;  1QME A;  5DF9 A;  4OQH A;  5E2H A;  1PZP A;  3VFF A;  3N7W A;  5EOE A;  4EBL A;  4JXW A;  4WM9 A;  5TR7 A;  1RCJ A;  2ZQD A;  3SH9 A;  3O3V A;  3BLM A;  4DF6 A;  1L0E A;  1XX2 A;  1YMX A;  3NDE A;  3UE0 A;  3IQA A;  5KMW A;  2QZ6 A;  4OOY A;  1S0W A;  4ZAM A;  4RX3 A;  3GQZ A;  1MWR A;  3HUM A;  4S2I A;  3CMZ A;  4FCF A;  2V2F F;  4RYE A;  1PWG A;  3C4O A;  3Q7Z A;  1BUE A;  1MKI A;  3IXH A;  2ZC6 B;  4GB7 A;  5JYP A;  2OV5 A;  2WGW B;  1KDW A;  2WAD A;  3G35 A;  1XPB A;  4ZJ2 A;  5JYO A;  5F83 A;  5DTT A;  5A93 A;  1XGJ A;  2X71 A;  4KZ6 A;  1KDS A;  2Y2G A;  3PBQ A;  2JE5 A;  2XK1 A;  3IXD A;  3QNC A;  4UA6 A;  1AXB A;  4UA9 A;  4DDY A;  3WS2 A;  2WK0 A;  4CJN A;  4UA7 A;  3UDX A;  2WKH A;  2ZLY A;  3UPP A;  4X56 A;  1Z6F A;  1O7E A;  3UPO A;  3WRZ A;  1XGI A;  4BEN A;  2CC1 A;  2FFF B;  3V5M A;  1HVB A;  4DE2 A;  2Y59 A;  2Y2J A;  3OPH A;  2OSU A;  5GHZ A;  3OPP A;  5EPH A;  1BLS A;  5EVL A;  5FDH A;  2VGJ A;  1ERQ A;  2XH9 A;  2EXB A;  4E3I A;  2Y2P A;  2B5R A;  5E43 A;  1K4E A;  3O88 A;  1L0F A;  3N8R A;  1JTG A;  3FYZ A;  4O7D A;  1YT4 A;  4S2O A;  1BUL A;  4C6Y A;  5TFQ A;  5DF8 A;  5HX9 A;  1MXO A;  4OPQ A;  5HAQ A;  1GCE A;  3TOI A;  3BFG A;  4LV3 A;  2HP5 A;  1IEM A;  3LO7 A;  4OPR A;  1KE3 A;  3IF6 B;  3WRT A;  3W4O A;  5BOH A;  1GHM A;  4OOL A;  4Y0T A;  3Q81 A;  5EE8 A;  1DY6 A;  2WKE A;  4BD1 A;  4YFM A;  3Q1F A;  4S2P A;  4S2N A;  1K38 A;  2V1Z A;  2XDM A;  1XKZ A;  4S2K A;  2V20 A;  3MZD A;  1BT5 A;  2UWX A;  5FQK A;  4P0M A;  2BLS A;  1ES3 A;  4D2O A;  1LI0 A;  4A5R A;  2Y2Q A;  1H5X A;  3IF6 C;  5FAT A;  1LL5 A;  4KEN B;  2ZMA A;  4X53 A;  4DE3 A;  2Y2K A;  3CJM A;  2Y2M A;  5TGF A;  4QU3 A;  4KZ9 A;  3ZGA B;  2WZZ A;  3BFE A;  4OQI A;  3PBT A;  1ONG A;  1LL9 A;  5KSH A;  3ZVW A;  4S2L A;  5CER A;  3GVB A;  4Y0O A;  3OCL A;  1DJA A;  1ONH A;  5CHM A;  3IXG A;  3HL9 A;  4E3J A;  4Y0U A;  3HLW A;  2HDS A;  3GV9 A;  3IHB A;  1DJB A;  4DKI A;  1ERM A;  1BLP A;  1NXY A;  4KZ3 A;  3IWO A;  5HAR A;  4KG6 A;  5EVI C;  4BD0 A;  4N92 A;  4E3O A;  4EBN A;  4B88 A;  2HDQ A;  3EQV A;  5EUA A;  4ZBE A;  2RL3 A;  1IYP A;  3ZNT A;  4PM6 A;  1HZO A;  5CGW A;  3PAE A;  3FZC A;  1IYS A;  1YLW A;  2PBY A;  3NY4 A;  2ZJ9 A;  5FA7 A;  1E3U A;  2H0T A;  4K0X A;  3ZHH A;  1CK3 A;  3AGF A;  4XXR A;  1SHV A;  3ZNY A;  3BRM A;  4LCM A;  3SOI A;  5AQ9 A;  1PIO A;  4LV0 A;  1JVJ A;  1YLJ A;  3W8K A;  4RX2 A;  3MZE A;  3A3E A;  4GOG A;  4DE0 A;  2J9P A;  2HP6 A;  2EX6 A;  5DTK A;  3ZG0 A;  3BFC A;  1K6S A;  2VGK A;  4KQO A;  1RP5 A;  4R0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...