1FCMA

Crystal structure of the e.coli ampc beta-lactamase mutant q120l/y150e covalently acylated with the inhibitory beta-lactam, cloxacillin
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLLVPDEVKSSSDLLRFYQNWQPAWAPGTQRLEANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Crystal Structures of Substrate and Inhibitor Complexes with AmpC -Lactamase: Possible Implications for Substrate-Assisted Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
total genus 107
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fcmA00
4OQ0A 4DE0A 1MY8A 1BT5A 1L2SA 2IWBA 2ZC4B 3BFCA 3LO7A 4GDNA 2J9OA 1O7EA 1VQQA 2XEPA 4FD8A 5F83A 3UNWA 1MWSA 3O87A 3OPRA 5HFOA 3WRTA 4OOLA 4OLDA 4EBLA 3HBRA 3LEZA 2E8IA 4X53A 5E43A 2Y4AA 4UA7A 3LY4A 4S2NC 5AQ9A 2Y59A 4DXCA 3IWOA 3E2KA 3VSKA 2Q9NA 4K91A 4HBUA 3S1YA 2OSUA 3CJMA 4KQRA 1RGZA 1W8QA 3HLCA 1VM1A 5M19A 4WMCD 4QB8A 4EBNA 1E25A 3Q82A 1BTLA 2A49A 1IYSA 4NETA 4S2LA 1GHPA 5FI7A 3D4FA 2RCXA 1WYBA 4BLMA 1GHIA 1W5DA 3V3SA 3HLGA 5FI6A 1L0FA 1KE0A 5A93A 3IH9A 1FCMA 1ES2A 3N4IA 4BD1A 4BD0A 1NZOA 3FKVA 4RX3A 4OPQA 2QZ6A 3C4OA 3UPPA 4A5RA 3ISGA 2WUQA 2QMIA 4LCMA 2WAEA 3ZCZA 3OCNA 1ONHA 4JXSA 4KZ8A 1K4EA 2EXAA 1L0DA 4JKTA 1L0EA 1ESUA 4IVKA 4OQGA 5HL1A 2XR0A 2I72A 3PBOA 4PM5A 1DJAA 2A3UA 2VGJA 2HP9A 2WYXA 1S6RA 4FCFA 2J7VA 5L2FA 5EOEA 3DTMA 4FH4A 5AQBA 2ZJ9A 5EVID 2Y2NA 5CERA 3SH7A 2XF3A 1W8YA 4HEFA 5EVIA 3WS0A 1C3BA 1RP5A 3UDIA 4BL3A 3NBLA 3UPOA 2XLNA 4OQHA 4DF6A 4QJGA 3ZG0A 3RJUA 4XUZA 1PI4A 4N1HA 2ZMAA 1BULA 3G35A 5CEDA 2CC1A 4KZ7A 4GD6A 4WEJA 2H0TA 4OH0A 1EWZA 4HESA 1J9MA 3G4PA 1YQSA 3M2KA 1ALQA 3UE1A 2Y2PA 3FWLA 2V1ZA 2J8YA 5FQJA 5HAPA 5GHZA 4DDSA 2ZM0A 4C3QA 5U47A 3RXWA 3HUNA 1BZAA 4FH2A 1Y54A 4Z9QA 1PZPA 3DWKA 2XD5A 3VP1A 2C5WB 4LV0A 4Y0TA 4WZ4A 3HVFA 3IXBA 3UE0A 4E6WA 3S4XA 2XD1A 1K6SA 1GHMA 5DF7A 5CEBA 3WWXA 1IKIA 1TDGA 4YINA 2EX9A 3UPNA 1YT4A 5FI2A 4B4ZA 3OPLA 3V50A 3CG5A 5TR7A 3W4QA 1NRFA 1SCWA 1BLSA 1I5QA 2EFUA 4KENB 4X69A 2ZQ7A 4OVDA 2RL3A 4KZ3A 1JWZA 3ITBA 4OP8A 3ZVTA 4GZBA 1FCOA 1TEMA 3N8SA 1YLWA 4L0LA 5AQAA 5FSRA 3EQVA 3SH8A 2ZQ8A 2ZC7A 1DY6A 4X56A 3PTEA 2BLSA 3FYZA 4QY5A 3A3EA 2X02A 4JPMA 4QD4A 1KDSA 4ZBEA 2B5RA 4OKPA 2R9WA 5EVIC 2ZQCA 5JYPA 2ZLYA 5CGXA 2JCHA 4ZJ3A 4DE3A 1K56D 1LL5A 2WKEA 3G34A 4MBHA 1Q2PA 1YLJA 1K56A 3IWQA 4R4SA 1CEFA 1ZC2A 1KVLA 3PAGA 5FAQA 5KZHA 1I2WA 4P6BA 2JE5A 4O7DA 4S2KA 3S22A 1K38A 1K57C 3VMAA 2XFTA 4M3KA 1IYOA 3LY3A 1BLCA 4JF5A 3ZDJA 2FFYA 3IHAA 3N8LA 1DJCA 2Y2MA 3MZFA 4F94A 2JBFA 2PU2A 4PM6A 5E2HA 1PWGA 3IH8A 1XA1A 1PIOA 1YMXA 3MKFA 2H0YA 3ZG9B 3DW0A 1FR1A 5FASA 2X01A 2G2WA 3ITAA 1ES5A 2IWDA 5AQ7A 4LV1A 4OP5A 5A90A 1LHYA 1PW8A 1JWPA 1XGJA 3Q7ZA 4JF4A 1K54C 2ZQDA 4BL2A 5FDHA 3NCKA 4KZ4A 3QNBA 3WS5A 4Y0OA 1H8ZA 2EX8A 4S2JA 5CHMA 1L0GA 3SH9A 2Z2LB 3C5AA 4KZ5A 2R9XA 4S2OA 3IF5A 3M6BA 2HP5A 4KQOA 3M2JA 3UE3A 5GLBA 3I7JA 1XXMA 2XFSA 4CJNA 4K0XA 3BYDA 5JYOA 1K4FA 1PI5A 4PM9A 4B88A 2Y2IA 1NXYA 3OPHA 4QY6A 3G32A 3UY6A 4E3LA 1FQGA 1U60A 3HUMA 2XQZA 4OLGA 3N6IA 4EQIA 1ERMA 3A3FA 1G6AA 5GLCA 2WGVA 3HLDA 3LCEA 5EPHA 2WGWB 3BRMA 2ZM2A 2WKHA 3ZNYA 4JLFA 4R3BA 1GA0A 2H5SA 3AGEA 2ZQ9A 1XPBA 2UWXA 3IQAA 3O88A 4ZDXA 4UHUA 1LL9A 4BQMA 1AXBA 5E2EA 2WZXA 3ZHHA 3OPPA 2WADA 3WS1A 5FA7A 4ZTKA 5CHUA 3G31A 3GTCA 3PBSA 3C7UA 1HTZA 1M6KA 1JVJA 3NDGA 4RA7A 1N4OA 5CTMA 1K57A 1BLPA 1KVMA 1IEMA 3ZNTA 4EV4A 2H10A 2JC7A 4KZ6A 3NY4A 4GNUA 1YLTA 3OCLA 1YLZA 3Q7VB 4WZ5A 3ZVWA 3VOYA 3IF6B 3V3RA 1XA7A 1JTGA 1MWTA 2Y55A 3BM6A 1PWCA 3UDXA 2HDRA 4X68A 2Y2OA 1MWRA 4YFMA 2P74A 1FR6A 4XUXA 4OPRA 1SHVA 1GCEA 2HDSA 1MBLA 3HLWA 1K54A 1NYYA 4FSFA 4JF6A 1E3UD 2P9VB 3Q07A 4MEZA 5EVLA 5EE8A 1E3UA 3WRZA 1IYPA 3FZCA 3G30A 2Y2GA 3C4PA 1ES4A 4P87A 4OQIA 1CK3A 1M40A 4P0MA 1ZG4A 5E2GA 1ES3A 2DCFA 4OOYA 1IELA 4E6XA 1QMFA 5G18A 2HDQA 1NYMA 1LLBA 3NI9A 3V39A 2HPBA 4GN2A 4K0WA 4GKUA 3RXXA 1FSWA 2PBYA 1ZG6A 4E3IA 3PBRA 5DF8A 5I94A 3GV9A 3MBZA 4DXBA 3A3DA 1PWDA 5FQQA 3P09A 5DTKA 2Q9MA 3W8KA 3BFGA 2XGNA 3PBNA 5F1FA 1K25A 1WYCA 3JYIA 3SS4A 4R1GA 1KE4A 4U0TA 1IKGA 3BLMA 5EECA 5FQIA 4KG6A 5GHXA 5KSCA 1XP4A 5HW3A 4PM8A 1BSGA 2HDUA 5CGWA 1LI9A 5D3OA 5J8XA 5GHYA 3HUOA 3IXHA 4KZ9A 5EUAA 4GOGA 3MZDA 4RVAA 3SS5A 1NJ4A 4E3KA 1IYQA 4S2PA 1FCNA 3FKWA 3HLBA 4WZ5C 4RX2A 4RYEA 1HD8A 4KG2A 1CI8A 3IHBA 4XXRA 4DE1A 4N9LA 4JXVA 3AGFA 3WS4A 4U3TA 5M18A 4R23A 4X55A 5F82A 4WEKA 3QNCA 4DRTA 4WM9A 3MZEA 1RCJA 2ZC6B 1YLPA 4KQQA 4R4RA 4PM7A 4ZJ2A 3GRJA 1TVFA 1OMEA 3VFFA 2OV5A 3BFEA 1NY0A 4WELA 1ZKJA 1K6RA 1BLHA 2WKIA 3HLFA 1XKZA 5IHVA 3CMZA 3CZDA 3VOZA 1K55C 3VP4A 3AGDA 3EQUA 3VP0A 3B3XA 2DRWA 5FQKA 3IXDA 4E3OA 2ZM8A 2Y2JA 1XGIA 1S0WA 5F1GA 4OPYA 1ESIA 5KMWA 1SDEA 2Y2QA 4KG5A 2WK0A 2C6WB 3G2YA 3G2ZA 4GDBA 4ZJ1A 4CPKA 4BJPA 4EWFA 4WMCA 3HLEA 5A92A 4IEDA 5HAQA 1YMSA 3N7WA 1XX2A 3GSGA 2ZD8A 3IXGA 4N9KA 4UA6A 2IWCA 3V5MA 2VGKA 4WYYA 2WGWA 3BFDA 4E3MA 1FOFA 2Y2HA 2ZQAA 2WAFA 3IWIA 4OONA 3NIAA 4QU3A 4DKIA 2WGIA 4EBPA 1KGEA 3GR2A 1RGYA 1SDNA 5TFQA 1ERQA 2XDMA 1DJBA 3VSLA 5DF9A 1I2SA 4R0QA 3A3JA 2BG1A 4D2OA 4LCLA 2G2UA 1EROA 5A91A 4WBGA 1PW1A 1GA9A 2FFFB 3HL9A 5M1AA 4BENA 2Y2KA 3N8RA 5BOHA 2J9PA 3M6HA 3PAEA 3C7VA 4DDYA 1TDLA 3Q1FA 1W79A 1SKFA 2V20A 1HVBA 1Q2QA 3BECA 4B4XA 4GD8A 1KE3A 4X6TA 5EOOA 5HARA 4MNRA 2PU4A 5EVIB 3MXRA 1O07A 1CI9A 4NK3A 1ONGA 3IT9A 4MLLA 5FAPA 3W4OA 3P98A 3UDFA 3GQZA 5HX9A 3W4PA 4U0XA 1W7FA 3Q7VA 4PMAA 5CRFA 3TSGA 4MBFA 3ZG8B 3IF6A 5GLDA 4N92A 3DWZA 3UO9A 2Z2MB 2OLUA 2OLVA 2Y2LA 4Y7PA 1YLYA 2GDNA 4JBFA 1JWVA 1FSYA 3PBQA 4JXWA 5HAIA 4H8RA 4ID4A 5CECA 4C75A 2ZC5B 3SOIA 5DVAA 4UAAA 4S2MA 2P9VA 5FQMA 1MWUA 2XH9A 1K55A 5CTNA 2QPNA 5GLAA 3MFDA 4LENA 1EI5A 1LI0A 3TG9A 5CGSA 4LV3A 1HZOA 3HREA 2ZC3B 3BEBA 3OC2A 1MPLA 4S2NA 4LV2A 4E3NA 1BUEA 1KGGA 1PYYA 3GVBA 4C6YA 1YM1A 2EXBA 3O86A 2Y91A 3O3VA 4GB7A 4Y0UA 5TGFA 1JTDA 1KDWA 4Q8IA 1H8YA 4IBXA 2EFXA 3NDEA 5GL9A 3ZGAB 4ZAMA 1QMEA 1WE4A 3VFHA 4IVIA 2V2FF 3MXSA 2WZZA 2DNSA 1E4DA 3WS2A 2EX6A 3E2LA 3SS3A 4P85A 2HP6A 3NC8A 4UA9A 5E2FA 3VP2A 4E3JA 2EX2A 3QHYA 4HBTA 3ZFZA 3A3IA 1MXOA 5FAOA 4KZAA 4N1XA 3FV7A 4DE2A 4JXGA 2XK1A 4OOMA 4KZBA 4QHCA 5FATA 3GMWA 4OPZA 1H5XA 2X71A 3BFFA 1PZOA 3BLSA 5DTSA 4EUZA 3ZG7B 1MKIA 3Q81A 1NZUA 3UN7A 1N9BA 1Z6FA 4PPRA 4R3JA 1CEGA 1KGFA 3IF6C 5CXWA 3VP3A 3PBTA 4IBRA 3TOIA 3ZG5A 3MKEA 5FQ9A 5DTTA 3OZHA 1G68A 4MBKA 5KSHA 4S2IA 5CHJA
chains in the Genus database with same CATH superfamily
4OQ0A 4DE0A 1L2SA 4R38A 2ZC4B 1FIKA 3BY9A 2J9OA 4CLCD 1VQQA 5HD5A 3UNWA 1MWSA 4OOLA 4WL9A 4NXFA 5E43A 4Y13A 2Y4AA 5AQ9A 2B18A 2Q9NA 4UQIM 2JKGA 3LIFA 3S1YA 3DAVA 1W8QA 4HP4A 2A49A 1TS8A 4S2LA 1GHPA 2GX5A 1W5DA 3V3SA 3IX4A 5FI6A 1KE0A 2O9AA 3N4IA 3A0VA 2QZ6A 3C4OA 2PBDP 4A5RA 5FL3A 1VETA 4JXSA 1K0KA 4X25A 2ZL1A 2XR0A 3PBOA 4PM5A 1DJAA 2PD7A 2WYXA 1S6RA 4FCFA 2J7VA 4I3JA 5CERA 1W8YA 3B33A 4HEFA 3UDIA 5HPIA 4FTXA 4E04A 3NBLA 4DF6A 2PR5A 3MS6A 1F9IA 3G35A 2CC1A 2YKHA 4GD6A 4WEJA 1EWZA 1N9LA 4O01A 3MJQA 1ALQA 5EFWA 5L8MA 5HAPA 4YOFA 5GHZA 2M7UA 5U47A 2VX8A 4GCZA 1P9RA 3DWKA 3S7NA 2C5WB 3C8CA 2XD1A 5DF7A 1TDGA 3OPLA 3V50A 1SCWA 1I5QA 4HH3A 1FCOA 4L0LA 2ZC7A 1DY6A 3FYZA 2X02A 4JPMA 1KDSA 4ZBEA 5EVIC 2R9WA 3TE8A 2ZQCA 2ZLYA 5CGXA 4ETZA 3QP5A 1K56D 4MBHA 4R4SA 1CEFA 5FAQA 1S4SA 5KZHA 4EEUA 2HZ5A 3S22A 4II7A 2XFTA 3RFBA 2FFYA 3IHAA 4F94A 1PWGA 3ZG5A 3ZG9B 5FASA 3ITAA 2IWDA 4LV1A 4EUVA 1LHYA 3Q7ZA 3W2ZA 1K54C 4BL2A 5HDCA 2PYRA 3UB6A 2K7SA 1AWIA 4Y15A 5GLBA 3I7JA 2Y2IA 1NXYA 3G32A 3UY6A 3HUMA 1D7EA 2XQZA 4L9FA 1ERMA 1G6AA 5GLCA 3LIEA 3LCEA 5F68A 4FUWA 4JGOA 3BRMA 2W0NA 4YNRA 2WKHA 4R3BA 2H5SA 4PKYG 3FG8A 4UHUA 3T4OA 5E2EA 3JVVA 5FA7A 3G31A 3GTCA 1FILA 3C7UA 5DFYA 3ZNTA 1IEMA 2H10A 4KZ6A 3NY4A 1YLZA 3ZVWA 3IF6B 3V3RA 1XA7A 1JTGA 3UDXA 4X68A 4NXEA 4GS9B 2Y2OA 1MWRA 2B02A 1N9OA 3D9YA 4MEZA 4HI4A 4IHQA 3FZCA 3OLOA 2DMWA 2GNXA 1ODVA 2DCFA 1S1ZA 1LLBA 2V8CA 4Y2FA 1FSWA 2O0YA 3GV9A 5FQQA 2Q9MA 3W8KA 3PBNA 1K25A 2QHKA 4R1GA 5FQIA 3MQQA 5HW3A 5D3OA 5EUAA 5HWWA 4RVAA 3T1SA 1NJ4A 4E3KA 3ULFA 1IYQA 4S2PA 3KSGA 3UMEA 4XXRA 2GJ3A 3IHBA 4JXVA 3NOPC 3L7HA 1MC0A 4WM9A 2ZC6B 4KQQA 4ZJ2A 2L4RA 4PM7A 1OMEA 2OV5A 4WELA 1K6RA 3CHWP 1XKZA 3KYQA 4CQHA 3B3XA 3IXDA 4E3OA 2Y2JA 1ESIA 1P97A 2Y79A 4ZJ1A 4WMCA 1G5UA 2IWCA 1L3LA 4E3MA 2Y2HA 2ZQAA 3IWIA 2WAFA 4OONA 4DKIA 3NIAA 1KGEA 1SDNA 2VZWA 3GDIA 5DF9A 3EGDC 3A3JA 1H3QA 1EROA 1V9ZA 4WBGA 5A91A 5M1AA 4Y17A 3K2NA 1T1AA 2J9PA 4K08A 4DDYA 1W79A 1HVBA 3T4QA 1Q2QA 4B4XA 3F1PB 2HJEA 1O07A 4NK3A 2PDRA 1ONGA 4MLLA 2J3TD 5CRFA 4JGPA 4N92A 2OLUA 3F1NB 2OLVA 2Y2LA 4CLCC 2GDNA 4JBFA 2EA9A 4JXWA 3IX3A 1Z09A 3MQ0A 2ZC5B 1F2KA 2YKFA 3NHQA 4S2MA 1ZTUA 1MWUA 2XH9A 1K55A 3MFDA 2MJ6A 1HZOA 1X0OA 2ZC3B 3BEBA 4LV2A 1BUEA 1KGGA 4NXBA 1HLUP 4IBXA 2EFXA 3NDEA 1T1CA 1H0MA 3E4QA 3VV4A 5TJJA 3VFHA 4IVIA 5L09A 2DNSA 3NC8A 3D72A 2EX2A 1OJGA 3ZFZA 4MDZA 3BY8A 1H5XA 5DTSA 2VKSA 3UN7A 1NRJA 1CEGA 4DMZA 5DTTA 1G68A 2IWBA 3LO7A 5C5KA 2IA2A 2XEPA 4FD8A 4LRYC 4HH2A 3OPRA 4GHIA 4OLDA 1OTAA 5A8BA 3LY4A 4ARZA 4DXCA 2HGVA 3IS2A 1TD5A 1P0ZA 4HBUA 3HLCA 4QB8A 1EW0A 3S7OA 1YKDA 4NETA 5HZHA 5F69A 3D4FA 2D02A 1GHIA 4BBVA 1ES2A 4BD1A 1NZOA 3R7WA 3FKVA 3SZTA 3ISGA 2QMIA 3OCNA 4KZ8A 1P9WA 2EXAA 1L0DA 4JKTA 5HL1A 4OQGA 3EOIA 2V8FA 2W3GA 2A3UA 1T19A 3E4PA 3ICYA 5AVFA 2HP9A 3KO6A 4FH4A 5K5BA 2ZJ9A 2FZ0A 3PHYA 2Y2NA 2XF3A 5EVIA 1C3BA 4I3IA 2O9BA 2LB9A 4BL3A 2VJWA 4XUZA 3SW1A 3CAXA 1BULA 2PD8A 2WKRA 4KZ7A 2H0TA 2JN7A 3G4PA 3UE1A 2Y2PA 2J8YA 4X1MA 3JVUA 2GZAA 4ETXA 3L9KA 4LV0A 3HVFA 1VEUB 1IOUA 3WWXA 3KSFA 5FI2A 3CG5A 5TR7A 3W4QA 2EFUA 4KENB 4X69A 4KZ3A 3UE6A 1TEMA 3T1XA 3LICA 5FSRA 2ZQ8A 4X56A 3PTEA 2BLSA 2AVXA 1GSVA 4ZJ3A 1GSWA 3G34A 4HHDA 1STZA 4O7DA 1K38A 1K57C 4M3KA 1IYOA 3LY3A 1BLCA 1XJ2A 3ZDJA 3QP8A 3N8LA 3MZFA 2Y2MA 3IH8A 1FR1A 1GSXA 2HF6A 5AQ7A 1Y28A 2WKQA 4OP5A 2PYPA 1NWZA 5FDHA 5HD3A 3QNBA 3D3OA 4I39A 2EX8A 2NUTC 1L0GA 4GHIB 3C5AA 2ZOHA 3IF5A 4KQOA 1PFLA 1T1BA 5EVEA 2XFSA 1SZVA 3BYDA 2W1TA 5JYOA 5F6AA 4PM9A 1LSXA 1FQGA 4EQIA 3A3FA 3DBAA 2VV6A 2ZM2A 4JLFA 1CQAA 3KSIA 2XA7S 3RTYA 1LL9A 3O5YA 1AXBA 3ZHHA 4ZTKA 5CHUA 3PBSA 1JVJA 3T50A 1UGUA 1XJ3A 1PRQA 1VB6A 1MWTA 2P08A 4YFMA 1FR6A 5J3WA 1SHVA 1MBLA 5HPFA 5G4ZA 5FEGA 2W3EA 2QYBA 5EE8A 1IFQA 2Y2GA 3MSHA 3K3CA 1ES3A 4E6XA 3H7WA 2HDQA 3KSHA 1SKOA 2HPBA 2EWWA 4GKUA 1ZG6A 4E3IA 3PBRA 5DF8A 5I94A 1PWDA 3P09A 5DTKA 3HCYA 5F1FA 1WYCA 2QJ7A 3JYIA 5IU1A 4EU0A 2I9VA 4U0TA 3BLMA 5GHXA 5KSCA 1BSGA 5J8XA 1LI9A 2BASA 5GHYA 3NOTC 1A0KA 4GOGA 3MZDA 3SS5A 2VGLS 3HLBA 4WZ5C 1ACFA 3WS4A 1YPRA 5M18A 2PAVP 4R23A 5F82A 3QNCA 1NLYA 1YLPA 1LSVA 3S7PA 3FC7A 3BFEA 1NY0A 1ZKJA 1LSWA 2OAQ1 3HLFA 2K2NA 3CZDA 3EQUA 2BTFP 3VP0A 3IX8A 2DRWA 5FQKA 4LRXC 1S0WA 4OPYA 1SDEA 2Y2QA 2C6WB 1LL8A 5A92A 4BJPA 4IEDA 5HDSA 3A0SA 1YMSA 3N7WA 4EESA 1OJ5A 3V5MA 4WYYA 2WGWA 3JPUA 4QU3A 2WGIA 1MKMA 3GR2A 5TFQA 2OOLA 2XDMA 3CPTA 1VETB 2VGLM 1I2SA 4NG2A 4D2OA 4LCLA 4PHTA 2ZL1B 1PW1A 1GA9A 2FFFB 4PAUA 4HJ4A 3PYPA 3M6HA 1TDLA 1SKFA 3BECA 4GD8A 1KE3A 5HARA 1CI9A 5FAPA 3W4OA 3P98A 3UDFA 3NJAA 5HX9A 3Q7VA 4PMAA 3ZG8B 5GLDA 3UO9A 4GW9A 2PRFA 2VV7A 2W3HA 4Y7PA 1JWVA 5DJUA 5HAIA 3PXPA 4H8RA 4Y5FA 5CECA 3EWKA 4HOIA 4UAAA 2P9VA 5FQMA 5CTNA 5GLAA 2QPNA 5IS1A 4LENA 1LI0A 4LV3A 3HREA 2JKRI 3QP1A 1YM1A 2Y91A 3O3VA 4Y0UA 2M7VA 1JTDA 1H8YA 4Q0HA 4ZAMA 1QMEA 1CF0A 2WZZA 3E2LA 3SS3A 2HP6A 4UA9A 1J3WA 4HBTA 3MR0A 1MXOA 5FAOA 4KZAA 4JXGA 4OPZA 4HY8A 3ZG7B 3CLOA 3Q81A 4PPRA 1N9BA 1Z6FA 3C2WA 1KGFA 3KYZA 3IF6C 3TOIA 1XJ4A 3OZHA 4MBKA 5CHJA 3MFXA 4DN0A 1MY8A 3BFCA 4GDNA 2J3WA 1O7EA 5HFOA 3WRTA 3BW6A 4EBLA 3LEZA 5CX7A 4S2NC 4HQAA 2V1AA 2JKFA 4L9EA 5LBRA 3VSKA 4K91A 2A24A 2OSUA 4EBNA 1E25A 1BTLA 1IYSA 1D1JA 1WYBA 4BLMA 4AFIA 3HLGA 1L0FA 2KDKA 3IH9A 4RX3A 2WUQA 1H8MA 2WAEA 3ZCZA 1ONHA 2Z6CA 1L0EA 1ESUA 3H82A 3TRCA 2VGJA 4WF0A 3MF0A 5L2FA 3LUQA 4Q0JA 5AQBA 5EVID 3FPVA 3SH7A 1OTEA 3UPOA 4OQHA 4BBUA 4QJGA 3T1RA 3ZG0A 3RJUA 1PI4A 3LIDA 2ZMAA 4HESA 1J9MA 4QWOA 1YQSA 3M2KA 4EXOA 4HIAA 3FWLA 2V1ZA 5FQJA 4DDSA 3LR0A 2ZM0A 3CUEC 3HUNA 1BZAA 3LI9A 4Z9QA 1PZPA 1DP9A 2XD5A 5EM1A 4Y0TA 5CEBA 2VV8A 4E6WA 1K6SA 1GHMA 2EX9A 4B4ZA 2QWSA 2H28A 1NRFA 2ZQ7A 4OVDA 3BJNA 1UWNX 1JWZA 4OP8A 3N8SA 4QY5A 1ZHHB 5L10A 4QD4A 3LR3A 5MC7A 4O8GA 4P6ZS 5TBMA 3RH8B 1OTIA 1YAXA 1F5MA 4BMWA 1LL5A 4XT2A 3IWQA 1ZC2A 1KVLA 3PAGA 3DTEA 4JF5A 1YSPA 2JBFA 2PU2A 1XA1A 3MKFA 2H0YA 5J4EA 2P7JA 2X01A 3LYXA 5A90A 4KZ4A 3WS5A 4Y0OA 2XRNA 1G28A 2R9XA 4LPZA 4MN6A 4MMNA 3M6BA 2HP5A 1W63Q 2KOIA 1XXMA 4G3KA 1PI5A 4B88A 4QY6A 1JNUA 4E3LA 1VHMA 4OLGA 4P6ZM 2WGVA 3E0YA 1GA0A 2ZQ9A 2UWXA 3O88A 2WZXA 3OPPA 3WS1A 2CMNA 4DJ2A 1HTZA 1M6KA 3U4LP 3T4SA 2ZMVA 4WZ5A 3OBFA 4D60A 2HDRA 2P74A 4OPRA 3KX0X 3CWFA 1K54A 4JF6A 4FSFA 4CLCE 1E3UA 3WRZA 3G30A 3C4PA 1ES4A 4OQIA 1CK3A 4P0MA 4OOYA 1IELA 1NYMA 3NI9A 3V39A 1D06A 4K0WA 4WLAA 3RXXA 3NECA 3ZYTA 3GECA 5DJTA 4DXBA 3A3DA 3NOUC 3BFGA 5AVEA 2XGNA 3B47A 4MN7A 1KE4A 2W3FA 1IKGA 4KG6A 1V9YA 4B93A 4LFUA 4PM8A 2HDUA 3QP4A 5EM0A 3IXHA 4UEYA 3IBRA 3MXQA 3NULA 4RX2A 1HD8A 4KG2A 1S67L 2LB5A 3LFVA 3DTIA 4G3VA 1DP6A 1RCJA 4R4RA 3GRJA 1TVFA 3LIBA 3VFFA 2V0WA 4Q0IA 2PT7A 5IHVA 3CMZA 3VOZA 1K55C 1YSQA 3AGDA 2ZBBA 5F5YA 3E98A 4ARZB 5L07A 4ZRRA 3VOLA 3IS2B 3UB8A 4EERA 3R4KA 1G6OA 1NLZA 5KMWA 2WK0A 3G2YA 4GDBA 5HAQA 3HLEA 2WKPA 3LR5A 3P7NA 3GSGA 3IXGA 4N9KA 1OT6A 4UA6A 2VGKA 3R7WB 2VLGA 4BWIA 1ERQA 3VSLA 3PR6A 2BG1A 4R3AA 3F1OA 4BENA 1TS0A 2Y2KA 3N8RA 5BOHA 3PAEA 3C7VA 2V20A 3BWLA 5EVIB 3GQZA 4U0XA 3TSGA 1PNEA 3IF6A 3DTKA 5HSQA 2Z2MB 3QP2A 1Y4OA 5AJGA 4GS9A 1YLYA 1FSYA 4C75A 3UB5P 2R78A 2JKTM 1T18A 1EI5A 2JHEA 3P01A 3OC2A 3UB9A 1MPLA 4S2NA 4E3NA 2OAP1 1PYYA 3GVBA 1XFNA 2EXBA 3O86A 4Q8IA 2XA7M 3ZGAB 3BQAA 1WE4A 3V67A 2V2FF 2O99A 4EEPA 3S7QA 2EX6A 4P85A 3VP2A 3QHYA 1XJ6A 4Y3IA 3MQOA 4DE2A 4OOMA 2XK1A 5FATA 4O0PA 2OWHA 5DKLA 3BFFA 3BLSA 4H6JA 4X1LA 4R3JA 2J3TC 3VP3A 3PBTA 4IBRA 5FQ9A 1DP8A 4S2IA 1BT5A 4IUKA 5F83A 4NEED 1TS7A 4CLCA 3O87A 4EQ1A 3HBRA 2E8IA 4X53A 4HJ3A 4LGWA 4UA7A 2Y59A 4LRZE 3IWOA 2V0UA 3E2KA 2EWVA 4HP9A 3OOVA 3CJMA 4KQRA 1RGZA 3CUEA 1VM1A 5M19A 4I5SA 1OTDA 4WMCD 3Q82A 5HWVA 5FI7A 2RCXA 4F3LA 4G3WA 1DRMA 5A93A 5J7EA 2E8JA 2XSSA 1FCMA 2W3DA 4BD0A 3B42A 2W1TB 4OPQA 3UPPA 3LGOA 4LCMA 3UMDA 1K4EA 2ACGA 4IVKA 2I72A 1BYWA 5EOEA 3DTMA 3F1PA 2INWA 3WS0A 1S66L 1RP5A 2ZMFA 1S1YA 2KLIA 2XLNA 3F1OB 4JGQA 3F1NA 4N1HA 3EEAA 5CEDA 4OH0A 4DJ3A 3TJZC 4C3QA 4QPRA 3RXWA 4FH2A 1Y54A 3EEHA 5HWTA 3VP1A 2L0WA 4WZ4A 3IXBA 3UE0A 3S4XA 4BBTA 2W27A 1IKIA 4YINA 3UPNA 1YT4A 4NXGA 2QKPA 1BLSA 2PR6A 3H7WB 3TW8A 2RL3A 1SKOB 4JGRA 3ITBA 3ZVTA 4GZBA 3SH8A 1YLWA 5AQAA 2V9AA 3EQVA 2XROA 4KQDA 3A3EA 2QJ5A 1S4RA 3IBJA 4WN5A 2B5RA 4OKPA 2O9CA 5JYPA 1F98A 2JCHA 4DE3A 2VA0A 2WKEA 1Q2PA 1YLJA 1K56A 1I2WA 4P6BA 1N9NA 2JE5A 4S2KA 3VMAA 2L1MA 4H6JB 1DJCA 3E4OA 2K31A 4PM6A 5E2HA 1PIOA 1YMXA 3QP6A 3DW0A 1TF1A 2G2WA 3C38A 4WUJA 2VK3A 1ES5A 1WA9A 1PW8A 1JWPA 1XGJA 4JF4A 2ZQDA 2HJ9C 3NCKA 3C30A 1H8ZA 4CLCB 3LIAA 4S2JA 5CHMA 3SH9A 2Z2LB 4KZ5A 4S2OA 3T4LA 1W63M 3M2JA 3UE3A 3LR4A 4CJNA 3T4KA 4K0XA 1K4FA 2ZOIA 3OPHA 1U60A 3N6IA 2B95A 4F3LB 3HLDA 5EPHA 2WGWB 4I38A 3ZNYA 4EETB 3AGEA 4RQ9A 1XPBA 3IQAA 3CPTB 4ZDXA 4BQMA 4EW7A 2WADA 2Y8HA 4IJGA 5I5LA 4RA7A 3NDGA 5HDDA 2W1RA 2PHYA 1N4OA 5CTMA 1K57A 2FH5A 1BLPA 1KVMA 1CJFA 2HV1A 2J80A 4EV4A 2JC7A 4GNUA 3MMHA 1YLTA 3OCLA 4KUKA 3VE3A 4ESPA 3K3DA 3Q7VB 3VOYA 2Y55A 3BM6A 1PWCA 3ZQ5A 4B9OA 4XUXA 1GCEA 2HDSA 3T4JA 2D01A 3HLWA 1NYYA 1E3UD 2P9VB 3Q07A 5EVLA 3U2AA 1VEUA 1IYPA 3T1QB 2OWJA 4P87A 3T12B 1M40A 1ZG4A 5E2GA 4R70A 1QMFA 5G18A 5DFXA 5FDSA 4GN2A 4HNBA 2PBYA 3A0RA 4IUHA 2JKTI 3MBZA 2UV0E 4HJ6A 1MZUA 4Z1WA 3SS4A 5EECA 4GLQA 1XP4A 3KYEA 5CGWA 1OPXA 3HUOA 2M1CA 4KZ9A 2Z6DA 4YWZA 1FCNA 3FKWA 3CI6A 4RYEA 4DE1A 1CI8A 4GJ4A 4N9LA 3AGFA 4U3TA 3EGXC 1LT0A 4X55A 4WEKA 4DRTA 3MZEA 1OT9A 2V1BA 1BLHA 2WKIA 2NUPC 4KUOA 3BQ8A 3VP4A 4L9GA 5HL6A 4M4XA 2ZM8A 5IT5A 1XGIA 2A24B 5F1GA 4LLOB 5FEFA 4MCWA 4KG5A 4EWFA 3G2ZA 4CPKA 1XX2A 2ZD8A 3BFDA 1OTBA 1FOFA 3CITA 4EBPA 1RGYA 1DJBA 4NKPA 4R0QA 2G2UA 3H82B 5EV0A 3HL9A 3Q1FA 1TS6A 4PKYA 4X6TA 1KOUA 2Q0OA 5EOOA 4MNRA 2PU4A 3HJIA 3MXRA 4MN5A 1XFQA 3IT9A 3W4PA 1W7FA 3VE4A 4MBFA 3DWZA 2P04A 3LEQA 2JKRM 3PBQA 4ID4A 4ME4A 4FOFA 3SOIA 3FPWA 5DVAA 4R6LA 3H9WA 5G4YA 4I3AA 3TG9A 5CGSA 3T4TA 4C6YA 1UWPX 4GB7A 5TGFA 4UQIS 1KDWA 2KX6A 5KIZA 5GL9A 3MXSA 1E4DA 3WS2A 4E3JA 5DKKA 5E2FA 2G7UA 3HJKA 3A3IA 3LI8A 4N1XA 3FV7A 4QHCA 4KZBA 3GMWA 3UB7A 2X71A 1PZOA 4EUZA 3G6OA 5TBMB 1MKIA 2A2LA 1NZUA 5CXWA 3MKEA 4XT2B 5KSHA 2VEAA
chains in the Genus database with same CATH topology
4OQ0A 4DE0A 1MY8A 1BT5A 1L2SA 2IWBA 2ZC4B 3BFCA 3LO7A 4GDNA 2J9OA 1O7EA 1VQQA 2XEPA 4FD8A 5F83A 3UNWA 1MWSA 3O87A 3OPRA 5HFOA 3WRTA 4OOLA 4OLDA 4EBLA 3HBRA 3LEZA 2E8IA 4X53A 5E43A 2Y4AA 4UA7A 3LY4A 4S2NC 5AQ9A 2Y59A 4DXCA 3IWOA 3E2KA 3VSKA 2Q9NA 4K91A 4HBUA 3S1YA 2OSUA 3CJMA 4KQRA 1RGZA 1W8QA 3HLCA 1VM1A 5M19A 4WMCD 4QB8A 4EBNA 1E25A 3Q82A 1BTLA 2A49A 1IYSA 4NETA 4S2LA 1GHPA 5FI7A 3D4FA 2RCXA 1WYBA 4BLMA 1GHIA 1W5DA 3V3SA 3HLGA 5FI6A 1L0FA 1KE0A 5A93A 3IH9A 1FCMA 1ES2A 3N4IA 4BD1A 4BD0A 1NZOA 3FKVA 4RX3A 4OPQA 2QZ6A 3C4OA 3UPPA 4A5RA 3ISGA 2WUQA 2QMIA 4LCMA 2WAEA 3ZCZA 3OCNA 1ONHA 4JXSA 4KZ8A 1K4EA 2EXAA 1L0DA 4JKTA 1L0EA 1ESUA 4IVKA 4OQGA 5HL1A 2XR0A 2I72A 3PBOA 4PM5A 1DJAA 2A3UA 2VGJA 2HP9A 2WYXA 1S6RA 4FCFA 2J7VA 5L2FA 5EOEA 3DTMA 4FH4A 5AQBA 2ZJ9A 5EVID 2Y2NA 5CERA 3SH7A 2XF3A 1W8YA 4HEFA 5EVIA 3WS0A 1C3BA 1RP5A 3UDIA 4BL3A 3NBLA 3UPOA 2XLNA 4OQHA 4DF6A 4QJGA 3ZG0A 3RJUA 4XUZA 1PI4A 4N1HA 2ZMAA 1BULA 3G35A 5CEDA 2CC1A 4KZ7A 4GD6A 4WEJA 2H0TA 4OH0A 1EWZA 4HESA 1J9MA 3G4PA 1YQSA 3M2KA 1ALQA 3UE1A 2Y2PA 3FWLA 2V1ZA 2J8YA 5FQJA 5HAPA 5GHZA 4DDSA 2ZM0A 4C3QA 5U47A 3RXWA 3HUNA 1BZAA 4FH2A 1Y54A 4Z9QA 1PZPA 3DWKA 2XD5A 3VP1A 2C5WB 4LV0A 4Y0TA 4WZ4A 3HVFA 3IXBA 3UE0A 4E6WA 3S4XA 2XD1A 1K6SA 1GHMA 5DF7A 5CEBA 3WWXA 1IKIA 1TDGA 4YINA 2EX9A 3UPNA 1YT4A 5FI2A 4B4ZA 3OPLA 3V50A 3CG5A 5TR7A 3W4QA 1NRFA 1SCWA 1BLSA 1I5QA 2EFUA 4KENB 4X69A 2ZQ7A 4OVDA 2RL3A 4KZ3A 1JWZA 3ITBA 4OP8A 3ZVTA 4GZBA 1FCOA 1TEMA 3N8SA 1YLWA 4L0LA 5AQAA 5FSRA 3EQVA 3SH8A 2ZQ8A 2ZC7A 1DY6A 4X56A 3PTEA 2BLSA 3FYZA 4QY5A 3A3EA 2X02A 4JPMA 4QD4A 1KDSA 4ZBEA 2B5RA 4OKPA 2R9WA 5EVIC 2ZQCA 5JYPA 2ZLYA 5CGXA 2JCHA 4ZJ3A 4DE3A 1K56D 1LL5A 2WKEA 3G34A 4MBHA 1Q2PA 1YLJA 1K56A 3IWQA 4R4SA 1CEFA 1ZC2A 1KVLA 3PAGA 5FAQA 5KZHA 1I2WA 4P6BA 2JE5A 4O7DA 4S2KA 3S22A 1K38A 1K57C 3VMAA 2XFTA 4M3KA 1IYOA 3LY3A 1BLCA 4JF5A 3ZDJA 2FFYA 3IHAA 3N8LA 1DJCA 2Y2MA 3MZFA 4F94A 2JBFA 2PU2A 4PM6A 5E2HA 1PWGA 3IH8A 1XA1A 1PIOA 1YMXA 3MKFA 2H0YA 3ZG9B 3DW0A 1FR1A 5FASA 2X01A 2G2WA 3ITAA 1ES5A 2IWDA 5AQ7A 4LV1A 4OP5A 5A90A 1LHYA 1PW8A 1JWPA 1XGJA 3Q7ZA 4JF4A 1K54C 2ZQDA 4BL2A 5FDHA 3NCKA 4KZ4A 3QNBA 3WS5A 4Y0OA 1H8ZA 2EX8A 4S2JA 5CHMA 1L0GA 3SH9A 2Z2LB 3C5AA 4KZ5A 2R9XA 4S2OA 3IF5A 3M6BA 2HP5A 4KQOA 3M2JA 3UE3A 5GLBA 3I7JA 1XXMA 2XFSA 4CJNA 4K0XA 3BYDA 5JYOA 1K4FA 1PI5A 4PM9A 4B88A 2Y2IA 1NXYA 3OPHA 4QY6A 3G32A 3UY6A 4E3LA 1FQGA 1U60A 3HUMA 2XQZA 4OLGA 3N6IA 4EQIA 1ERMA 3A3FA 1G6AA 5GLCA 2WGVA 3HLDA 3LCEA 5EPHA 2WGWB 3BRMA 2ZM2A 2WKHA 3ZNYA 4JLFA 4R3BA 1GA0A 2H5SA 3AGEA 2ZQ9A 1XPBA 2UWXA 3IQAA 3O88A 4ZDXA 4UHUA 1LL9A 4BQMA 1AXBA 5E2EA 2WZXA 3ZHHA 3OPPA 2WADA 3WS1A 5FA7A 4ZTKA 5CHUA 3G31A 3GTCA 3PBSA 3C7UA 1HTZA 1M6KA 1JVJA 3NDGA 4RA7A 1N4OA 5CTMA 1K57A 1BLPA 1KVMA 1IEMA 3ZNTA 4EV4A 2H10A 2JC7A 4KZ6A 3NY4A 4GNUA 1YLTA 3OCLA 1YLZA 3Q7VB 4WZ5A 3ZVWA 3VOYA 3IF6B 3V3RA 1XA7A 1JTGA 1MWTA 2Y55A 3BM6A 1PWCA 3UDXA 2HDRA 4X68A 2Y2OA 1MWRA 4YFMA 2P74A 1FR6A 4XUXA 4OPRA 1SHVA 1GCEA 2HDSA 1MBLA 3HLWA 1K54A 1NYYA 4FSFA 4JF6A 1E3UD 2P9VB 3Q07A 4MEZA 5EVLA 5EE8A 1E3UA 3WRZA 1IYPA 3FZCA 3G30A 2Y2GA 3C4PA 1ES4A 4P87A 4OQIA 1CK3A 1M40A 4P0MA 1ZG4A 5E2GA 1ES3A 2DCFA 4OOYA 1IELA 4E6XA 1QMFA 5G18A 2HDQA 1NYMA 1LLBA 3NI9A 3V39A 2HPBA 4GN2A 4K0WA 4GKUA 3RXXA 1FSWA 2PBYA 1ZG6A 4E3IA 3PBRA 5DF8A 5I94A 3GV9A 3MBZA 4DXBA 3A3DA 1PWDA 5FQQA 3P09A 5DTKA 2Q9MA 3W8KA 3BFGA 2XGNA 3PBNA 5F1FA 1K25A 1WYCA 3JYIA 3SS4A 4R1GA 1KE4A 4U0TA 1IKGA 3BLMA 5EECA 5FQIA 4KG6A 5GHXA 5KSCA 1XP4A 5HW3A 4PM8A 1BSGA 2HDUA 5CGWA 1LI9A 5D3OA 5J8XA 5GHYA 3HUOA 3IXHA 4KZ9A 5EUAA 4GOGA 3MZDA 4RVAA 3SS5A 1NJ4A 4E3KA 1IYQA 4S2PA 1FCNA 3FKWA 3HLBA 4WZ5C 4RX2A 4RYEA 1HD8A 4KG2A 1CI8A 3IHBA 4XXRA 4DE1A 4N9LA 4JXVA 3AGFA 3WS4A 4U3TA 5M18A 4R23A 4X55A 5F82A 4WEKA 3QNCA 4DRTA 4WM9A 3MZEA 1RCJA 2ZC6B 1YLPA 4KQQA 4R4RA 4PM7A 4ZJ2A 3GRJA 1TVFA 1OMEA 3VFFA 2OV5A 3BFEA 1NY0A 4WELA 1ZKJA 1K6RA 1BLHA 2WKIA 3HLFA 1XKZA 5IHVA 3CMZA 3CZDA 3VOZA 1K55C 3VP4A 3AGDA 3EQUA 3VP0A 3B3XA 2DRWA 5FQKA 3IXDA 4E3OA 2ZM8A 2Y2JA 1XGIA 1S0WA 5F1GA 4OPYA 1ESIA 5KMWA 1SDEA 2Y2QA 4KG5A 2WK0A 2C6WB 3G2YA 3G2ZA 4GDBA 4ZJ1A 4CPKA 4BJPA 4EWFA 4WMCA 3HLEA 5A92A 4IEDA 5HAQA 1YMSA 3N7WA 1XX2A 3GSGA 2ZD8A 3IXGA 4N9KA 4UA6A 2IWCA 3V5MA 2VGKA 4WYYA 2WGWA 3BFDA 4E3MA 1FOFA 2Y2HA 2ZQAA 2WAFA 3IWIA 4OONA 3NIAA 4QU3A 4DKIA 2WGIA 4EBPA 1KGEA 3GR2A 1RGYA 1SDNA 5TFQA 1ERQA 2XDMA 1DJBA 3VSLA 5DF9A 1I2SA 4R0QA 3A3JA 2BG1A 4D2OA 4LCLA 2G2UA 1EROA 5A91A 4WBGA 1PW1A 1GA9A 2FFFB 3HL9A 5M1AA 4BENA 2Y2KA 3N8RA 5BOHA 2J9PA 3M6HA 3PAEA 3C7VA 4DDYA 1TDLA 3Q1FA 1W79A 1SKFA 2V20A 1HVBA 1Q2QA 3BECA 4B4XA 4GD8A 1KE3A 4X6TA 5EOOA 5HARA 4MNRA 2PU4A 5EVIB 3MXRA 1O07A 1CI9A 4NK3A 1ONGA 3IT9A 4MLLA 5FAPA 3W4OA 3P98A 3UDFA 3GQZA 5HX9A 3W4PA 4U0XA 1W7FA 3Q7VA 4PMAA 5CRFA 3TSGA 4MBFA 3ZG8B 3IF6A 5GLDA 4N92A 3DWZA 3UO9A 2Z2MB 2OLUA 2OLVA 2Y2LA 4Y7PA 1YLYA 2GDNA 4JBFA 1JWVA 1FSYA 3PBQA 4JXWA 5HAIA 4H8RA 4ID4A 5CECA 4C75A 2ZC5B 3SOIA 5DVAA 4UAAA 4S2MA 2P9VA 5FQMA 1MWUA 2XH9A 1K55A 5CTNA 2QPNA 5GLAA 3MFDA 4LENA 1EI5A 1LI0A 3TG9A 5CGSA 4LV3A 1HZOA 3HREA 2ZC3B 3BEBA 3OC2A 1MPLA 4S2NA 4LV2A 4E3NA 1BUEA 1KGGA 1PYYA 3GVBA 4C6YA 1YM1A 2EXBA 3O86A 2Y91A 3O3VA 4GB7A 4Y0UA 5TGFA 1JTDA 1KDWA 4Q8IA 1H8YA 4IBXA 2EFXA 3NDEA 5GL9A 3ZGAB 4ZAMA 1QMEA 1WE4A 3VFHA 4IVIA 2V2FF 3MXSA 2WZZA 2DNSA 1E4DA 3WS2A 2EX6A 3E2LA 3SS3A 4P85A 2HP6A 3NC8A 4UA9A 5E2FA 3VP2A 4E3JA 2EX2A 3QHYA 4HBTA 3ZFZA 3A3IA 1MXOA 5FAOA 4KZAA 4N1XA 3FV7A 4DE2A 4JXGA 2XK1A 4OOMA 4KZBA 4QHCA 5FATA 3GMWA 4OPZA 1H5XA 2X71A 3BFFA 1PZOA 3BLSA 5DTSA 4EUZA 3ZG7B 1MKIA 3Q81A 1NZUA 3UN7A 1N9BA 1Z6FA 4PPRA 4R3JA 1CEGA 1KGFA 3IF6C 5CXWA 3VP3A 3PBTA 4IBRA 3TOIA 3ZG5A 3MKEA 5FQ9A 5DTTA 3OZHA 1G68A 4MBKA 5KSHA 4S2IA 5CHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OQ0 A;  4DE0 A;  1MY8 A;  1BT5 A;  1L2S A;  2IWB A;  2ZC4 B;  3BFC A;  3LO7 A;  4GDN A;  2J9O A;  1O7E A;  1VQQ A;  2XEP A;  4FD8 A;  5F83 A;  3UNW A;  1MWS A;  3O87 A;  3OPR A;  5HFO A;  3WRT A;  4OOL A;  4OLD A;  4EBL A;  3HBR A;  3LEZ A;  2E8I A;  4X53 A;  5E43 A;  2Y4A A;  4UA7 A;  3LY4 A;  4S2N C;  5AQ9 A;  2Y59 A;  4DXC A;  3IWO A;  3E2K A;  3VSK A;  2Q9N A;  4K91 A;  4HBU A;  3S1Y A;  2OSU A;  3CJM A;  4KQR A;  1RGZ A;  1W8Q A;  3HLC A;  1VM1 A;  5M19 A;  4WMC D;  4QB8 A;  4EBN A;  1E25 A;  3Q82 A;  1BTL A;  2A49 A;  1IYS A;  4NET A;  4S2L A;  1GHP A;  5FI7 A;  3D4F A;  2RCX A;  1WYB A;  4BLM A;  1GHI A;  1W5D A;  3V3S A;  3HLG A;  5FI6 A;  1L0F A;  1KE0 A;  5A93 A;  3IH9 A;  1FCM A;  1ES2 A;  3N4I A;  4BD1 A;  4BD0 A;  1NZO A;  3FKV A;  4RX3 A;  4OPQ A;  2QZ6 A;  3C4O A;  3UPP A;  4A5R A;  3ISG A;  2WUQ A;  2QMI A;  4LCM A;  2WAE A;  3ZCZ A;  3OCN A;  1ONH A;  4JXS A;  4KZ8 A;  1K4E A;  2EXA A;  1L0D A;  4JKT A;  1L0E A;  1ESU A;  4IVK A;  4OQG A;  5HL1 A;  2XR0 A;  2I72 A;  3PBO A;  4PM5 A;  1DJA A;  2A3U A;  2VGJ A;  2HP9 A;  2WYX A;  1S6R A;  4FCF A;  2J7V A;  5L2F A;  5EOE A;  3DTM A;  4FH4 A;  5AQB A;  2ZJ9 A;  5EVI D;  2Y2N A;  5CER A;  3SH7 A;  2XF3 A;  1W8Y A;  4HEF A;  5EVI A;  3WS0 A;  1C3B A;  1RP5 A;  3UDI A;  4BL3 A;  3NBL A;  3UPO A;  2XLN A;  4OQH A;  4DF6 A;  4QJG A;  3ZG0 A;  3RJU A;  4XUZ A;  1PI4 A;  4N1H A;  2ZMA A;  1BUL A;  3G35 A;  5CED A;  2CC1 A;  4KZ7 A;  4GD6 A;  4WEJ A;  2H0T A;  4OH0 A;  1EWZ A;  4HES A;  1J9M A;  3G4P A;  1YQS A;  3M2K A;  1ALQ A;  3UE1 A;  2Y2P A;  3FWL A;  2V1Z A;  2J8Y A;  5FQJ A;  5HAP A;  5GHZ A;  4DDS A;  2ZM0 A;  4C3Q A;  5U47 A;  3RXW A;  3HUN A;  1BZA A;  4FH2 A;  1Y54 A;  4Z9Q A;  1PZP A;  3DWK A;  2XD5 A;  3VP1 A;  2C5W B;  4LV0 A;  4Y0T A;  4WZ4 A;  3HVF A;  3IXB A;  3UE0 A;  4E6W A;  3S4X A;  2XD1 A;  1K6S A;  1GHM A;  5DF7 A;  5CEB A;  3WWX A;  1IKI A;  1TDG A;  4YIN A;  2EX9 A;  3UPN A;  1YT4 A;  5FI2 A;  4B4Z A;  3OPL A;  3V50 A;  3CG5 A;  5TR7 A;  3W4Q A;  1NRF A;  1SCW A;  1BLS A;  1I5Q A;  2EFU A;  4KEN B;  4X69 A;  2ZQ7 A;  4OVD A;  2RL3 A;  4KZ3 A;  1JWZ A;  3ITB A;  4OP8 A;  3ZVT A;  4GZB A;  1FCO A;  1TEM A;  3N8S A;  1YLW A;  4L0L A;  5AQA A;  5FSR A;  3EQV A;  3SH8 A;  2ZQ8 A;  2ZC7 A;  1DY6 A;  4X56 A;  3PTE A;  2BLS A;  3FYZ A;  4QY5 A;  3A3E A;  2X02 A;  4JPM A;  4QD4 A;  1KDS A;  4ZBE A;  2B5R A;  4OKP A;  2R9W A;  5EVI C;  2ZQC A;  5JYP A;  2ZLY A;  5CGX A;  2JCH A;  4ZJ3 A;  4DE3 A;  1K56 D;  1LL5 A;  2WKE A;  3G34 A;  4MBH A;  1Q2P A;  1YLJ A;  1K56 A;  3IWQ A;  4R4S A;  1CEF A;  1ZC2 A;  1KVL A;  3PAG A;  5FAQ A;  5KZH A;  1I2W A;  4P6B A;  2JE5 A;  4O7D A;  4S2K A;  3S22 A;  1K38 A;  1K57 C;  3VMA A;  2XFT A;  4M3K A;  1IYO A;  3LY3 A;  1BLC A;  4JF5 A;  3ZDJ A;  2FFY A;  3IHA A;  3N8L A;  1DJC A;  2Y2M A;  3MZF A;  4F94 A;  2JBF A;  2PU2 A;  4PM6 A;  5E2H A;  1PWG A;  3IH8 A;  1XA1 A;  1PIO A;  1YMX A;  3MKF A;  2H0Y A;  3ZG9 B;  3DW0 A;  1FR1 A;  5FAS A;  2X01 A;  2G2W A;  3ITA A;  1ES5 A;  2IWD A;  5AQ7 A;  4LV1 A;  4OP5 A;  5A90 A;  1LHY A;  1PW8 A;  1JWP A;  1XGJ A;  3Q7Z A;  4JF4 A;  1K54 C;  2ZQD A;  4BL2 A;  5FDH A;  3NCK A;  4KZ4 A;  3QNB A;  3WS5 A;  4Y0O A;  1H8Z A;  2EX8 A;  4S2J A;  5CHM A;  1L0G A;  3SH9 A;  2Z2L B;  3C5A A;  4KZ5 A;  2R9X A;  4S2O A;  3IF5 A;  3M6B A;  2HP5 A;  4KQO A;  3M2J A;  3UE3 A;  5GLB A;  3I7J A;  1XXM A;  2XFS A;  4CJN A;  4K0X A;  3BYD A;  5JYO A;  1K4F A;  1PI5 A;  4PM9 A;  4B88 A;  2Y2I A;  1NXY A;  3OPH A;  4QY6 A;  3G32 A;  3UY6 A;  4E3L A;  1FQG A;  1U60 A;  3HUM A;  2XQZ A;  4OLG A;  3N6I A;  4EQI A;  1ERM A;  3A3F A;  1G6A A;  5GLC A;  2WGV A;  3HLD A;  3LCE A;  5EPH A;  2WGW B;  3BRM A;  2ZM2 A;  2WKH A;  3ZNY A;  4JLF A;  4R3B A;  1GA0 A;  2H5S A;  3AGE A;  2ZQ9 A;  1XPB A;  2UWX A;  3IQA A;  3O88 A;  4ZDX A;  4UHU A;  1LL9 A;  4BQM A;  1AXB A;  5E2E A;  2WZX A;  3ZHH A;  3OPP A;  2WAD A;  3WS1 A;  5FA7 A;  4ZTK A;  5CHU A;  3G31 A;  3GTC A;  3PBS A;  3C7U A;  1HTZ A;  1M6K A;  1JVJ A;  3NDG A;  4RA7 A;  1N4O A;  5CTM A;  1K57 A;  1BLP A;  1KVM A;  1IEM A;  3ZNT A;  4EV4 A;  2H10 A;  2JC7 A;  4KZ6 A;  3NY4 A;  4GNU A;  1YLT A;  3OCL A;  1YLZ A;  3Q7V B;  4WZ5 A;  3ZVW A;  3VOY A;  3IF6 B;  3V3R A;  1XA7 A;  1JTG A;  1MWT A;  2Y55 A;  3BM6 A;  1PWC A;  3UDX A;  2HDR A;  4X68 A;  2Y2O A;  1MWR A;  4YFM A;  2P74 A;  1FR6 A;  4XUX A;  4OPR A;  1SHV A;  1GCE A;  2HDS A;  1MBL A;  3HLW A;  1K54 A;  1NYY A;  4FSF A;  4JF6 A;  1E3U D;  2P9V B;  3Q07 A;  4MEZ A;  5EVL A;  5EE8 A;  1E3U A;  3WRZ A;  1IYP A;  3FZC A;  3G30 A;  2Y2G A;  3C4P A;  1ES4 A;  4P87 A;  4OQI A;  1CK3 A;  1M40 A;  4P0M A;  1ZG4 A;  5E2G A;  1ES3 A;  2DCF A;  4OOY A;  1IEL A;  4E6X A;  1QMF A;  5G18 A;  2HDQ A;  1NYM A;  1LLB A;  3NI9 A;  3V39 A;  2HPB A;  4GN2 A;  4K0W A;  4GKU A;  3RXX A;  1FSW A;  2PBY A;  1ZG6 A;  4E3I A;  3PBR A;  5DF8 A;  5I94 A;  3GV9 A;  3MBZ A;  4DXB A;  3A3D A;  1PWD A;  5FQQ A;  3P09 A;  5DTK A;  2Q9M A;  3W8K A;  3BFG A;  2XGN A;  3PBN A;  5F1F A;  1K25 A;  1WYC A;  3JYI A;  3SS4 A;  4R1G A;  1KE4 A;  4U0T A;  1IKG A;  3BLM A;  5EEC A;  5FQI A;  4KG6 A;  5GHX A;  5KSC A;  1XP4 A;  5HW3 A;  4PM8 A;  1BSG A;  2HDU A;  5CGW A;  1LI9 A;  5D3O A;  5J8X A;  5GHY A;  3HUO A;  3IXH A;  4KZ9 A;  5EUA A;  4GOG A;  3MZD A;  4RVA A;  3SS5 A;  1NJ4 A;  4E3K A;  1IYQ A;  4S2P A;  1FCN A;  3FKW A;  3HLB A;  4WZ5 C;  4RX2 A;  4RYE A;  1HD8 A;  4KG2 A;  1CI8 A;  3IHB A;  4XXR A;  4DE1 A;  4N9L A;  4JXV A;  3AGF A;  3WS4 A;  4U3T A;  5M18 A;  4R23 A;  4X55 A;  5F82 A;  4WEK A;  3QNC A;  4DRT A;  4WM9 A;  3MZE A;  1RCJ A;  2ZC6 B;  1YLP A;  4KQQ A;  4R4R A;  4PM7 A;  4ZJ2 A;  3GRJ A;  1TVF A;  1OME A;  3VFF A;  2OV5 A;  3BFE A;  1NY0 A;  4WEL A;  1ZKJ A;  1K6R A;  1BLH A;  2WKI A;  3HLF A;  1XKZ A;  5IHV A;  3CMZ A;  3CZD A;  3VOZ A;  1K55 C;  3VP4 A;  3AGD A;  3EQU A;  3VP0 A;  3B3X A;  2DRW A;  5FQK A;  3IXD A;  4E3O A;  2ZM8 A;  2Y2J A;  1XGI A;  1S0W A;  5F1G A;  4OPY A;  1ESI A;  5KMW A;  1SDE A;  2Y2Q A;  4KG5 A;  2WK0 A;  2C6W B;  3G2Y A;  3G2Z A;  4GDB A;  4ZJ1 A;  4CPK A;  4BJP A;  4EWF A;  4WMC A;  3HLE A;  5A92 A;  4IED A;  5HAQ A;  1YMS A;  3N7W A;  1XX2 A;  3GSG A;  2ZD8 A;  3IXG A;  4N9K A;  4UA6 A;  2IWC A;  3V5M A;  2VGK A;  4WYY A;  2WGW A;  3BFD A;  4E3M A;  1FOF A;  2Y2H A;  2ZQA A;  2WAF A;  3IWI A;  4OON A;  3NIA A;  4QU3 A;  4DKI A;  2WGI A;  4EBP A;  1KGE A;  3GR2 A;  1RGY A;  1SDN A;  5TFQ A;  1ERQ A;  2XDM A;  1DJB A;  3VSL A;  5DF9 A;  1I2S A;  4R0Q A;  3A3J A;  2BG1 A;  4D2O A;  4LCL A;  2G2U A;  1ERO A;  5A91 A;  4WBG A;  1PW1 A;  1GA9 A;  2FFF B;  3HL9 A;  5M1A A;  4BEN A;  2Y2K A;  3N8R A;  5BOH A;  2J9P A;  3M6H A;  3PAE A;  3C7V A;  4DDY A;  1TDL A;  3Q1F A;  1W79 A;  1SKF A;  2V20 A;  1HVB A;  1Q2Q A;  3BEC A;  4B4X A;  4GD8 A;  1KE3 A;  4X6T A;  5EOO A;  5HAR A;  4MNR A;  2PU4 A;  5EVI B;  3MXR A;  1O07 A;  1CI9 A;  4NK3 A;  1ONG A;  3IT9 A;  4MLL A;  5FAP A;  3W4O A;  3P98 A;  3UDF A;  3GQZ A;  5HX9 A;  3W4P A;  4U0X A;  1W7F A;  3Q7V A;  4PMA A;  5CRF A;  3TSG A;  4MBF A;  3ZG8 B;  3IF6 A;  5GLD A;  4N92 A;  3DWZ A;  3UO9 A;  2Z2M B;  2OLU A;  2OLV A;  2Y2L A;  4Y7P A;  1YLY A;  2GDN A;  4JBF A;  1JWV A;  1FSY A;  3PBQ A;  4JXW A;  5HAI A;  4H8R A;  4ID4 A;  5CEC A;  4C75 A;  2ZC5 B;  3SOI A;  5DVA A;  4UAA A;  4S2M A;  2P9V A;  5FQM A;  1MWU A;  2XH9 A;  1K55 A;  5CTN A;  2QPN A;  5GLA A;  3MFD A;  4LEN A;  1EI5 A;  1LI0 A;  3TG9 A;  5CGS A;  4LV3 A;  1HZO A;  3HRE A;  2ZC3 B;  3BEB A;  3OC2 A;  1MPL A;  4S2N A;  4LV2 A;  4E3N A;  1BUE A;  1KGG A;  1PYY A;  3GVB A;  4C6Y A;  1YM1 A;  2EXB A;  3O86 A;  2Y91 A;  3O3V A;  4GB7 A;  4Y0U A;  5TGF A;  1JTD A;  1KDW A;  4Q8I A;  1H8Y A;  4IBX A;  2EFX A;  3NDE A;  5GL9 A;  3ZGA B;  4ZAM A;  1QME A;  1WE4 A;  3VFH A;  4IVI A;  2V2F F;  3MXS A;  2WZZ A;  2DNS A;  1E4D A;  3WS2 A;  2EX6 A;  3E2L A;  3SS3 A;  4P85 A;  2HP6 A;  3NC8 A;  4UA9 A;  5E2F A;  3VP2 A;  4E3J A;  2EX2 A;  3QHY A;  4HBT A;  3ZFZ A;  3A3I A;  1MXO A;  5FAO A;  4KZA A;  4N1X A;  3FV7 A;  4DE2 A;  4JXG A;  2XK1 A;  4OOM A;  4KZB A;  4QHC A;  5FAT A;  3GMW A;  4OPZ A;  1H5X A;  2X71 A;  3BFF A;  1PZO A;  3BLS A;  5DTS A;  4EUZ A;  3ZG7 B;  1MKI A;  3Q81 A;  1NZU A;  3UN7 A;  1N9B A;  1Z6F A;  4PPR A;  4R3J A;  1CEG A;  1KGF A;  3IF6 C;  5CXW A;  3VP3 A;  3PBT A;  4IBR A;  3TOI A;  3ZG5 A;  3MKE A;  5FQ9 A;  5DTT A;  3OZH A;  1G68 A;  4MBK A;  5KSH A;  4S2I A;  5CHJ A; 
#chains in the Genus database with same CATH topology
 4OQ0 A;  4DE0 A;  1L2S A;  4R38 A;  2ZC4 B;  1FIK A;  3BY9 A;  2J9O A;  4CLC D;  1VQQ A;  5HD5 A;  3UNW A;  1MWS A;  4OOL A;  4WL9 A;  4NXF A;  5E43 A;  4Y13 A;  2Y4A A;  5AQ9 A;  2B18 A;  2Q9N A;  4UQI M;  2JKG A;  3LIF A;  3S1Y A;  3DAV A;  1W8Q A;  4HP4 A;  2A49 A;  1TS8 A;  4S2L A;  1GHP A;  2GX5 A;  1W5D A;  3V3S A;  3IX4 A;  5FI6 A;  1KE0 A;  2O9A A;  3N4I A;  3A0V A;  2QZ6 A;  3C4O A;  2PBD P;  4A5R A;  5FL3 A;  1VET A;  4JXS A;  1K0K A;  4X25 A;  2ZL1 A;  2XR0 A;  3PBO A;  4PM5 A;  1DJA A;  2PD7 A;  2WYX A;  1S6R A;  4FCF A;  2J7V A;  4I3J A;  5CER A;  1W8Y A;  3B33 A;  4HEF A;  3UDI A;  5HPI A;  4FTX A;  4E04 A;  3NBL A;  4DF6 A;  2PR5 A;  3MS6 A;  1F9I A;  3G35 A;  2CC1 A;  2YKH A;  4GD6 A;  4WEJ A;  1EWZ A;  1N9L A;  4O01 A;  3MJQ A;  1ALQ A;  5EFW A;  5L8M A;  5HAP A;  4YOF A;  5GHZ A;  2M7U A;  5U47 A;  2VX8 A;  4GCZ A;  1P9R A;  3DWK A;  3S7N A;  2C5W B;  3C8C A;  2XD1 A;  5DF7 A;  1TDG A;  3OPL A;  3V50 A;  1SCW A;  1I5Q A;  4HH3 A;  1FCO A;  4L0L A;  2ZC7 A;  1DY6 A;  3FYZ A;  2X02 A;  4JPM A;  1KDS A;  4ZBE A;  5EVI C;  2R9W A;  3TE8 A;  2ZQC A;  2ZLY A;  5CGX A;  4ETZ A;  3QP5 A;  1K56 D;  4MBH A;  4R4S A;  1CEF A;  5FAQ A;  1S4S A;  5KZH A;  4EEU A;  2HZ5 A;  3S22 A;  4II7 A;  2XFT A;  3RFB A;  2FFY A;  3IHA A;  4F94 A;  1PWG A;  3ZG5 A;  3ZG9 B;  5FAS A;  3ITA A;  2IWD A;  4LV1 A;  4EUV A;  1LHY A;  3Q7Z A;  3W2Z A;  1K54 C;  4BL2 A;  5HDC A;  2PYR A;  3UB6 A;  2K7S A;  1AWI A;  4Y15 A;  5GLB A;  3I7J A;  2Y2I A;  1NXY A;  3G32 A;  3UY6 A;  3HUM A;  1D7E A;  2XQZ A;  4L9F A;  1ERM A;  1G6A A;  5GLC A;  3LIE A;  3LCE A;  5F68 A;  4FUW A;  4JGO A;  3BRM A;  2W0N A;  4YNR A;  2WKH A;  4R3B A;  2H5S A;  4PKY G;  3FG8 A;  4UHU A;  3T4O A;  5E2E A;  3JVV A;  5FA7 A;  3G31 A;  3GTC A;  1FIL A;  3C7U A;  5DFY A;  3ZNT A;  1IEM A;  2H10 A;  4KZ6 A;  3NY4 A;  1YLZ A;  3ZVW A;  3IF6 B;  3V3R A;  1XA7 A;  1JTG A;  3UDX A;  4X68 A;  4NXE A;  4GS9 B;  2Y2O A;  1MWR A;  2B02 A;  1N9O A;  3D9Y A;  4MEZ A;  4HI4 A;  4IHQ A;  3FZC A;  3OLO A;  2DMW A;  2GNX A;  1ODV A;  2DCF A;  1S1Z A;  1LLB A;  2V8C A;  4Y2F A;  1FSW A;  2O0Y A;  3GV9 A;  5FQQ A;  2Q9M A;  3W8K A;  3PBN A;  1K25 A;  2QHK A;  4R1G A;  5FQI A;  3MQQ A;  5HW3 A;  5D3O A;  5EUA A;  5HWW A;  4RVA A;  3T1S A;  1NJ4 A;  4E3K A;  3ULF A;  1IYQ A;  4S2P A;  3KSG A;  3UME A;  4XXR A;  2GJ3 A;  3IHB A;  4JXV A;  3NOP C;  3L7H A;  1MC0 A;  4WM9 A;  2ZC6 B;  4KQQ A;  4ZJ2 A;  2L4R A;  4PM7 A;  1OME A;  2OV5 A;  4WEL A;  1K6R A;  3CHW P;  1XKZ A;  3KYQ A;  4CQH A;  3B3X A;  3IXD A;  4E3O A;  2Y2J A;  1ESI A;  1P97 A;  2Y79 A;  4ZJ1 A;  4WMC A;  1G5U A;  2IWC A;  1L3L A;  4E3M A;  2Y2H A;  2ZQA A;  3IWI A;  2WAF A;  4OON A;  4DKI A;  3NIA A;  1KGE A;  1SDN A;  2VZW A;  3GDI A;  5DF9 A;  3EGD C;  3A3J A;  1H3Q A;  1ERO A;  1V9Z A;  4WBG A;  5A91 A;  5M1A A;  4Y17 A;  3K2N A;  1T1A A;  2J9P A;  4K08 A;  4DDY A;  1W79 A;  1HVB A;  3T4Q A;  1Q2Q A;  4B4X A;  3F1P B;  2HJE A;  1O07 A;  4NK3 A;  2PDR A;  1ONG A;  4MLL A;  2J3T D;  5CRF A;  4JGP A;  4N92 A;  2OLU A;  3F1N B;  2OLV A;  2Y2L A;  4CLC C;  2GDN A;  4JBF A;  2EA9 A;  4JXW A;  3IX3 A;  1Z09 A;  3MQ0 A;  2ZC5 B;  1F2K A;  2YKF A;  3NHQ A;  4S2M A;  1ZTU A;  1MWU A;  2XH9 A;  1K55 A;  3MFD A;  2MJ6 A;  1HZO A;  1X0O A;  2ZC3 B;  3BEB A;  4LV2 A;  1BUE A;  1KGG A;  4NXB A;  1HLU P;  4IBX A;  2EFX A;  3NDE A;  1T1C A;  1H0M A;  3E4Q A;  3VV4 A;  5TJJ A;  3VFH A;  4IVI A;  5L09 A;  2DNS A;  3NC8 A;  3D72 A;  2EX2 A;  1OJG A;  3ZFZ A;  4MDZ A;  3BY8 A;  1H5X A;  5DTS A;  2VKS A;  3UN7 A;  1NRJ A;  1CEG A;  4DMZ A;  5DTT A;  1G68 A;  2IWB A;  3LO7 A;  5C5K A;  2IA2 A;  2XEP A;  4FD8 A;  4LRY C;  4HH2 A;  3OPR A;  4GHI A;  4OLD A;  1OTA A;  5A8B A;  3LY4 A;  4ARZ A;  4DXC A;  2HGV A;  3IS2 A;  1TD5 A;  1P0Z A;  4HBU A;  3HLC A;  4QB8 A;  1EW0 A;  3S7O A;  1YKD A;  4NET A;  5HZH A;  5F69 A;  3D4F A;  2D02 A;  1GHI A;  4BBV A;  1ES2 A;  4BD1 A;  1NZO A;  3R7W A;  3FKV A;  3SZT A;  3ISG A;  2QMI A;  3OCN A;  4KZ8 A;  1P9W A;  2EXA A;  1L0D A;  4JKT A;  5HL1 A;  4OQG A;  3EOI A;  2V8F A;  2W3G A;  2A3U A;  1T19 A;  3E4P A;  3ICY A;  5AVF A;  2HP9 A;  3KO6 A;  4FH4 A;  5K5B A;  2ZJ9 A;  2FZ0 A;  3PHY A;  2Y2N A;  2XF3 A;  5EVI A;  1C3B A;  4I3I A;  2O9B A;  2LB9 A;  4BL3 A;  2VJW A;  4XUZ A;  3SW1 A;  3CAX A;  1BUL A;  2PD8 A;  2WKR A;  4KZ7 A;  2H0T A;  2JN7 A;  3G4P A;  3UE1 A;  2Y2P A;  2J8Y A;  4X1M A;  3JVU A;  2GZA A;  4ETX A;  3L9K A;  4LV0 A;  3HVF A;  1VEU B;  1IOU A;  3WWX A;  3KSF A;  5FI2 A;  3CG5 A;  5TR7 A;  3W4Q A;  2EFU A;  4KEN B;  4X69 A;  4KZ3 A;  3UE6 A;  1TEM A;  3T1X A;  3LIC A;  5FSR A;  2ZQ8 A;  4X56 A;  3PTE A;  2BLS A;  2AVX A;  1GSV A;  4ZJ3 A;  1GSW A;  3G34 A;  4HHD A;  1STZ A;  4O7D A;  1K38 A;  1K57 C;  4M3K A;  1IYO A;  3LY3 A;  1BLC A;  1XJ2 A;  3ZDJ A;  3QP8 A;  3N8L A;  3MZF A;  2Y2M A;  3IH8 A;  1FR1 A;  1GSX A;  2HF6 A;  5AQ7 A;  1Y28 A;  2WKQ A;  4OP5 A;  2PYP A;  1NWZ A;  5FDH A;  5HD3 A;  3QNB A;  3D3O A;  4I39 A;  2EX8 A;  2NUT C;  1L0G A;  4GHI B;  3C5A A;  2ZOH A;  3IF5 A;  4KQO A;  1PFL A;  1T1B A;  5EVE A;  2XFS A;  1SZV A;  3BYD A;  2W1T A;  5JYO A;  5F6A A;  4PM9 A;  1LSX A;  1FQG A;  4EQI A;  3A3F A;  3DBA A;  2VV6 A;  2ZM2 A;  4JLF A;  1CQA A;  3KSI A;  2XA7 S;  3RTY A;  1LL9 A;  3O5Y A;  1AXB A;  3ZHH A;  4ZTK A;  5CHU A;  3PBS A;  1JVJ A;  3T50 A;  1UGU A;  1XJ3 A;  1PRQ A;  1VB6 A;  1MWT A;  2P08 A;  4YFM A;  1FR6 A;  5J3W A;  1SHV A;  1MBL A;  5HPF A;  5G4Z A;  5FEG A;  2W3E A;  2QYB A;  5EE8 A;  1IFQ A;  2Y2G A;  3MSH A;  3K3C A;  1ES3 A;  4E6X A;  3H7W A;  2HDQ A;  3KSH A;  1SKO A;  2HPB A;  2EWW A;  4GKU A;  1ZG6 A;  4E3I A;  3PBR A;  5DF8 A;  5I94 A;  1PWD A;  3P09 A;  5DTK A;  3HCY A;  5F1F A;  1WYC A;  2QJ7 A;  3JYI A;  5IU1 A;  4EU0 A;  2I9V A;  4U0T A;  3BLM A;  5GHX A;  5KSC A;  1BSG A;  5J8X A;  1LI9 A;  2BAS A;  5GHY A;  3NOT C;  1A0K A;  4GOG A;  3MZD A;  3SS5 A;  2VGL S;  3HLB A;  4WZ5 C;  1ACF A;  3WS4 A;  1YPR A;  5M18 A;  2PAV P;  4R23 A;  5F82 A;  3QNC A;  1NLY A;  1YLP A;  1LSV A;  3S7P A;  3FC7 A;  3BFE A;  1NY0 A;  1ZKJ A;  1LSW A;  2OAQ 1;  3HLF A;  2K2N A;  3CZD A;  3EQU A;  2BTF P;  3VP0 A;  3IX8 A;  2DRW A;  5FQK A;  4LRX C;  1S0W A;  4OPY A;  1SDE A;  2Y2Q A;  2C6W B;  1LL8 A;  5A92 A;  4BJP A;  4IED A;  5HDS A;  3A0S A;  1YMS A;  3N7W A;  4EES A;  1OJ5 A;  3V5M A;  4WYY A;  2WGW A;  3JPU A;  4QU3 A;  2WGI A;  1MKM A;  3GR2 A;  5TFQ A;  2OOL A;  2XDM A;  3CPT A;  1VET B;  2VGL M;  1I2S A;  4NG2 A;  4D2O A;  4LCL A;  4PHT A;  2ZL1 B;  1PW1 A;  1GA9 A;  2FFF B;  4PAU A;  4HJ4 A;  3PYP A;  3M6H A;  1TDL A;  1SKF A;  3BEC A;  4GD8 A;  1KE3 A;  5HAR A;  1CI9 A;  5FAP A;  3W4O A;  3P98 A;  3UDF A;  3NJA A;  5HX9 A;  3Q7V A;  4PMA A;  3ZG8 B;  5GLD A;  3UO9 A;  4GW9 A;  2PRF A;  2VV7 A;  2W3H A;  4Y7P A;  1JWV A;  5DJU A;  5HAI A;  3PXP A;  4H8R A;  4Y5F A;  5CEC A;  3EWK A;  4HOI A;  4UAA A;  2P9V A;  5FQM A;  5CTN A;  5GLA A;  2QPN A;  5IS1 A;  4LEN A;  1LI0 A;  4LV3 A;  3HRE A;  2JKR I;  3QP1 A;  1YM1 A;  2Y91 A;  3O3V A;  4Y0U A;  2M7V A;  1JTD A;  1H8Y A;  4Q0H A;  4ZAM A;  1QME A;  1CF0 A;  2WZZ A;  3E2L A;  3SS3 A;  2HP6 A;  4UA9 A;  1J3W A;  4HBT A;  3MR0 A;  1MXO A;  5FAO A;  4KZA A;  4JXG A;  4OPZ A;  4HY8 A;  3ZG7 B;  3CLO A;  3Q81 A;  4PPR A;  1N9B A;  1Z6F A;  3C2W A;  1KGF A;  3KYZ A;  3IF6 C;  3TOI A;  1XJ4 A;  3OZH A;  4MBK A;  5CHJ A;  3MFX A;  4DN0 A;  1MY8 A;  3BFC A;  4GDN A;  2J3W A;  1O7E A;  5HFO A;  3WRT A;  3BW6 A;  4EBL A;  3LEZ A;  5CX7 A;  4S2N C;  4HQA A;  2V1A A;  2JKF A;  4L9E A;  5LBR A;  3VSK A;  4K91 A;  2A24 A;  2OSU A;  4EBN A;  1E25 A;  1BTL A;  1IYS A;  1D1J A;  1WYB A;  4BLM A;  4AFI A;  3HLG A;  1L0F A;  2KDK A;  3IH9 A;  4RX3 A;  2WUQ A;  1H8M A;  2WAE A;  3ZCZ A;  1ONH A;  2Z6C A;  1L0E A;  1ESU A;  3H82 A;  3TRC A;  2VGJ A;  4WF0 A;  3MF0 A;  5L2F A;  3LUQ A;  4Q0J A;  5AQB A;  5EVI D;  3FPV A;  3SH7 A;  1OTE A;  3UPO A;  4OQH A;  4BBU A;  4QJG A;  3T1R A;  3ZG0 A;  3RJU A;  1PI4 A;  3LID A;  2ZMA A;  4HES A;  1J9M A;  4QWO A;  1YQS A;  3M2K A;  4EXO A;  4HIA A;  3FWL A;  2V1Z A;  5FQJ A;  4DDS A;  3LR0 A;  2ZM0 A;  3CUE C;  3HUN A;  1BZA A;  3LI9 A;  4Z9Q A;  1PZP A;  1DP9 A;  2XD5 A;  5EM1 A;  4Y0T A;  5CEB A;  2VV8 A;  4E6W A;  1K6S A;  1GHM A;  2EX9 A;  4B4Z A;  2QWS A;  2H28 A;  1NRF A;  2ZQ7 A;  4OVD A;  3BJN A;  1UWN X;  1JWZ A;  4OP8 A;  3N8S A;  4QY5 A;  1ZHH B;  5L10 A;  4QD4 A;  3LR3 A;  5MC7 A;  4O8G A;  4P6Z S;  5TBM A;  3RH8 B;  1OTI A;  1YAX A;  1F5M A;  4BMW A;  1LL5 A;  4XT2 A;  3IWQ A;  1ZC2 A;  1KVL A;  3PAG A;  3DTE A;  4JF5 A;  1YSP A;  2JBF A;  2PU2 A;  1XA1 A;  3MKF A;  2H0Y A;  5J4E A;  2P7J A;  2X01 A;  3LYX A;  5A90 A;  4KZ4 A;  3WS5 A;  4Y0O A;  2XRN A;  1G28 A;  2R9X A;  4LPZ A;  4MN6 A;  4MMN A;  3M6B A;  2HP5 A;  1W63 Q;  2KOI A;  1XXM A;  4G3K A;  1PI5 A;  4B88 A;  4QY6 A;  1JNU A;  4E3L A;  1VHM A;  4OLG A;  4P6Z M;  2WGV A;  3E0Y A;  1GA0 A;  2ZQ9 A;  2UWX A;  3O88 A;  2WZX A;  3OPP A;  3WS1 A;  2CMN A;  4DJ2 A;  1HTZ A;  1M6K A;  3U4L P;  3T4S A;  2ZMV A;  4WZ5 A;  3OBF A;  4D60 A;  2HDR A;  2P74 A;  4OPR A;  3KX0 X;  3CWF A;  1K54 A;  4JF6 A;  4FSF A;  4CLC E;  1E3U A;  3WRZ A;  3G30 A;  3C4P A;  1ES4 A;  4OQI A;  1CK3 A;  4P0M A;  4OOY A;  1IEL A;  1NYM A;  3NI9 A;  3V39 A;  1D06 A;  4K0W A;  4WLA A;  3RXX A;  3NEC A;  3ZYT A;  3GEC A;  5DJT A;  4DXB A;  3A3D A;  3NOU C;  3BFG A;  5AVE A;  2XGN A;  3B47 A;  4MN7 A;  1KE4 A;  2W3F A;  1IKG A;  4KG6 A;  1V9Y A;  4B93 A;  4LFU A;  4PM8 A;  2HDU A;  3QP4 A;  5EM0 A;  3IXH A;  4UEY A;  3IBR A;  3MXQ A;  3NUL A;  4RX2 A;  1HD8 A;  4KG2 A;  1S67 L;  2LB5 A;  3LFV A;  3DTI A;  4G3V A;  1DP6 A;  1RCJ A;  4R4R A;  3GRJ A;  1TVF A;  3LIB A;  3VFF A;  2V0W A;  4Q0I A;  2PT7 A;  5IHV A;  3CMZ A;  3VOZ A;  1K55 C;  1YSQ A;  3AGD A;  2ZBB A;  5F5Y A;  3E98 A;  4ARZ B;  5L07 A;  4ZRR A;  3VOL A;  3IS2 B;  3UB8 A;  4EER A;  3R4K A;  1G6O A;  1NLZ A;  5KMW A;  2WK0 A;  3G2Y A;  4GDB A;  5HAQ A;  3HLE A;  2WKP A;  3LR5 A;  3P7N A;  3GSG A;  3IXG A;  4N9K A;  1OT6 A;  4UA6 A;  2VGK A;  3R7W B;  2VLG A;  4BWI A;  1ERQ A;  3VSL A;  3PR6 A;  2BG1 A;  4R3A A;  3F1O A;  4BEN A;  1TS0 A;  2Y2K A;  3N8R A;  5BOH A;  3PAE A;  3C7V A;  2V20 A;  3BWL A;  5EVI B;  3GQZ A;  4U0X A;  3TSG A;  1PNE A;  3IF6 A;  3DTK A;  5HSQ A;  2Z2M B;  3QP2 A;  1Y4O A;  5AJG A;  4GS9 A;  1YLY A;  1FSY A;  4C75 A;  3UB5 P;  2R78 A;  2JKT M;  1T18 A;  1EI5 A;  2JHE A;  3P01 A;  3OC2 A;  3UB9 A;  1MPL A;  4S2N A;  4E3N A;  2OAP 1;  1PYY A;  3GVB A;  1XFN A;  2EXB A;  3O86 A;  4Q8I A;  2XA7 M;  3ZGA B;  3BQA A;  1WE4 A;  3V67 A;  2V2F F;  2O99 A;  4EEP A;  3S7Q A;  2EX6 A;  4P85 A;  3VP2 A;  3QHY A;  1XJ6 A;  4Y3I A;  3MQO A;  4DE2 A;  4OOM A;  2XK1 A;  5FAT A;  4O0P A;  2OWH A;  5DKL A;  3BFF A;  3BLS A;  4H6J A;  4X1L A;  4R3J A;  2J3T C;  3VP3 A;  3PBT A;  4IBR A;  5FQ9 A;  1DP8 A;  4S2I A;  1BT5 A;  4IUK A;  5F83 A;  4NEE D;  1TS7 A;  4CLC A;  3O87 A;  4EQ1 A;  3HBR A;  2E8I A;  4X53 A;  4HJ3 A;  4LGW A;  4UA7 A;  2Y59 A;  4LRZ E;  3IWO A;  2V0U A;  3E2K A;  2EWV A;  4HP9 A;  3OOV A;  3CJM A;  4KQR A;  1RGZ A;  3CUE A;  1VM1 A;  5M19 A;  4I5S A;  1OTD A;  4WMC D;  3Q82 A;  5HWV A;  5FI7 A;  2RCX A;  4F3L A;  4G3W A;  1DRM A;  5A93 A;  5J7E A;  2E8J A;  2XSS A;  1FCM A;  2W3D A;  4BD0 A;  3B42 A;  2W1T B;  4OPQ A;  3UPP A;  3LGO A;  4LCM A;  3UMD A;  1K4E A;  2ACG A;  4IVK A;  2I72 A;  1BYW A;  5EOE A;  3DTM A;  3F1P A;  2INW A;  3WS0 A;  1S66 L;  1RP5 A;  2ZMF A;  1S1Y A;  2KLI A;  2XLN A;  3F1O B;  4JGQ A;  3F1N A;  4N1H A;  3EEA A;  5CED A;  4OH0 A;  4DJ3 A;  3TJZ C;  4C3Q A;  4QPR A;  3RXW A;  4FH2 A;  1Y54 A;  3EEH A;  5HWT A;  3VP1 A;  2L0W A;  4WZ4 A;  3IXB A;  3UE0 A;  3S4X A;  4BBT A;  2W27 A;  1IKI A;  4YIN A;  3UPN A;  1YT4 A;  4NXG A;  2QKP A;  1BLS A;  2PR6 A;  3H7W B;  3TW8 A;  2RL3 A;  1SKO B;  4JGR A;  3ITB A;  3ZVT A;  4GZB A;  3SH8 A;  1YLW A;  5AQA A;  2V9A A;  3EQV A;  2XRO A;  4KQD A;  3A3E A;  2QJ5 A;  1S4R A;  3IBJ A;  4WN5 A;  2B5R A;  4OKP A;  2O9C A;  5JYP A;  1F98 A;  2JCH A;  4DE3 A;  2VA0 A;  2WKE A;  1Q2P A;  1YLJ A;  1K56 A;  1I2W A;  4P6B A;  1N9N A;  2JE5 A;  4S2K A;  3VMA A;  2L1M A;  4H6J B;  1DJC A;  3E4O A;  2K31 A;  4PM6 A;  5E2H A;  1PIO A;  1YMX A;  3QP6 A;  3DW0 A;  1TF1 A;  2G2W A;  3C38 A;  4WUJ A;  2VK3 A;  1ES5 A;  1WA9 A;  1PW8 A;  1JWP A;  1XGJ A;  4JF4 A;  2ZQD A;  2HJ9 C;  3NCK A;  3C30 A;  1H8Z A;  4CLC B;  3LIA A;  4S2J A;  5CHM A;  3SH9 A;  2Z2L B;  4KZ5 A;  4S2O A;  3T4L A;  1W63 M;  3M2J A;  3UE3 A;  3LR4 A;  4CJN A;  3T4K A;  4K0X A;  1K4F A;  2ZOI A;  3OPH A;  1U60 A;  3N6I A;  2B95 A;  4F3L B;  3HLD A;  5EPH A;  2WGW B;  4I38 A;  3ZNY A;  4EET B;  3AGE A;  4RQ9 A;  1XPB A;  3IQA A;  3CPT B;  4ZDX A;  4BQM A;  4EW7 A;  2WAD A;  2Y8H A;  4IJG A;  5I5L A;  4RA7 A;  3NDG A;  5HDD A;  2W1R A;  2PHY A;  1N4O A;  5CTM A;  1K57 A;  2FH5 A;  1BLP A;  1KVM A;  1CJF A;  2HV1 A;  2J80 A;  4EV4 A;  2JC7 A;  4GNU A;  3MMH A;  1YLT A;  3OCL A;  4KUK A;  3VE3 A;  4ESP A;  3K3D A;  3Q7V B;  3VOY A;  2Y55 A;  3BM6 A;  1PWC A;  3ZQ5 A;  4B9O A;  4XUX A;  1GCE A;  2HDS A;  3T4J A;  2D01 A;  3HLW A;  1NYY A;  1E3U D;  2P9V B;  3Q07 A;  5EVL A;  3U2A A;  1VEU A;  1IYP A;  3T1Q B;  2OWJ A;  4P87 A;  3T12 B;  1M40 A;  1ZG4 A;  5E2G A;  4R70 A;  1QMF A;  5G18 A;  5DFX A;  5FDS A;  4GN2 A;  4HNB A;  2PBY A;  3A0R A;  4IUH A;  2JKT I;  3MBZ A;  2UV0 E;  4HJ6 A;  1MZU A;  4Z1W A;  3SS4 A;  5EEC A;  4GLQ A;  1XP4 A;  3KYE A;  5CGW A;  1OPX A;  3HUO A;  2M1C A;  4KZ9 A;  2Z6D A;  4YWZ A;  1FCN A;  3FKW A;  3CI6 A;  4RYE A;  4DE1 A;  1CI8 A;  4GJ4 A;  4N9L A;  3AGF A;  4U3T A;  3EGX C;  1LT0 A;  4X55 A;  4WEK A;  4DRT A;  3MZE A;  1OT9 A;  2V1B A;  1BLH A;  2WKI A;  2NUP C;  4KUO A;  3BQ8 A;  3VP4 A;  4L9G A;  5HL6 A;  4M4X A;  2ZM8 A;  5IT5 A;  1XGI A;  2A24 B;  5F1G A;  4LLO B;  5FEF A;  4MCW A;  4KG5 A;  4EWF A;  3G2Z A;  4CPK A;  1XX2 A;  2ZD8 A;  3BFD A;  1OTB A;  1FOF A;  3CIT A;  4EBP A;  1RGY A;  1DJB A;  4NKP A;  4R0Q A;  2G2U A;  3H82 B;  5EV0 A;  3HL9 A;  3Q1F A;  1TS6 A;  4PKY A;  4X6T A;  1KOU A;  2Q0O A;  5EOO A;  4MNR A;  2PU4 A;  3HJI A;  3MXR A;  4MN5 A;  1XFQ A;  3IT9 A;  3W4P A;  1W7F A;  3VE4 A;  4MBF A;  3DWZ A;  2P04 A;  3LEQ A;  2JKR M;  3PBQ A;  4ID4 A;  4ME4 A;  4FOF A;  3SOI A;  3FPW A;  5DVA A;  4R6L A;  3H9W A;  5G4Y A;  4I3A A;  3TG9 A;  5CGS A;  3T4T A;  4C6Y A;  1UWP X;  4GB7 A;  5TGF A;  4UQI S;  1KDW A;  2KX6 A;  5KIZ A;  5GL9 A;  3MXS A;  1E4D A;  3WS2 A;  4E3J A;  5DKK A;  5E2F A;  2G7U A;  3HJK A;  3A3I A;  3LI8 A;  4N1X A;  3FV7 A;  4QHC A;  4KZB A;  3GMW A;  3UB7 A;  2X71 A;  1PZO A;  4EUZ A;  3G6O A;  5TBM B;  1MKI A;  2A2L A;  1NZU A;  5CXW A;  3MKE A;  4XT2 B;  5KSH A;  2VEA A; 
#chains in the Genus database with same CATH homology
 4OQ0 A;  4DE0 A;  1MY8 A;  1BT5 A;  1L2S A;  2IWB A;  2ZC4 B;  3BFC A;  3LO7 A;  4GDN A;  2J9O A;  1O7E A;  1VQQ A;  2XEP A;  4FD8 A;  5F83 A;  3UNW A;  1MWS A;  3O87 A;  3OPR A;  5HFO A;  3WRT A;  4OOL A;  4OLD A;  4EBL A;  3HBR A;  3LEZ A;  2E8I A;  4X53 A;  5E43 A;  2Y4A A;  4UA7 A;  3LY4 A;  4S2N C;  5AQ9 A;  2Y59 A;  4DXC A;  3IWO A;  3E2K A;  3VSK A;  2Q9N A;  4K91 A;  4HBU A;  3S1Y A;  2OSU A;  3CJM A;  4KQR A;  1RGZ A;  1W8Q A;  3HLC A;  1VM1 A;  5M19 A;  4WMC D;  4QB8 A;  4EBN A;  1E25 A;  3Q82 A;  1BTL A;  2A49 A;  1IYS A;  4NET A;  4S2L A;  1GHP A;  5FI7 A;  3D4F A;  2RCX A;  1WYB A;  4BLM A;  1GHI A;  1W5D A;  3V3S A;  3HLG A;  5FI6 A;  1L0F A;  1KE0 A;  5A93 A;  3IH9 A;  1FCM A;  1ES2 A;  3N4I A;  4BD1 A;  4BD0 A;  1NZO A;  3FKV A;  4RX3 A;  4OPQ A;  2QZ6 A;  3C4O A;  3UPP A;  4A5R A;  3ISG A;  2WUQ A;  2QMI A;  4LCM A;  2WAE A;  3ZCZ A;  3OCN A;  1ONH A;  4JXS A;  4KZ8 A;  1K4E A;  2EXA A;  1L0D A;  4JKT A;  1L0E A;  1ESU A;  4IVK A;  4OQG A;  5HL1 A;  2XR0 A;  2I72 A;  3PBO A;  4PM5 A;  1DJA A;  2A3U A;  2VGJ A;  2HP9 A;  2WYX A;  1S6R A;  4FCF A;  2J7V A;  5L2F A;  5EOE A;  3DTM A;  4FH4 A;  5AQB A;  2ZJ9 A;  5EVI D;  2Y2N A;  5CER A;  3SH7 A;  2XF3 A;  1W8Y A;  4HEF A;  5EVI A;  3WS0 A;  1C3B A;  1RP5 A;  3UDI A;  4BL3 A;  3NBL A;  3UPO A;  2XLN A;  4OQH A;  4DF6 A;  4QJG A;  3ZG0 A;  3RJU A;  4XUZ A;  1PI4 A;  4N1H A;  2ZMA A;  1BUL A;  3G35 A;  5CED A;  2CC1 A;  4KZ7 A;  4GD6 A;  4WEJ A;  2H0T A;  4OH0 A;  1EWZ A;  4HES A;  1J9M A;  3G4P A;  1YQS A;  3M2K A;  1ALQ A;  3UE1 A;  2Y2P A;  3FWL A;  2V1Z A;  2J8Y A;  5FQJ A;  5HAP A;  5GHZ A;  4DDS A;  2ZM0 A;  4C3Q A;  5U47 A;  3RXW A;  3HUN A;  1BZA A;  4FH2 A;  1Y54 A;  4Z9Q A;  1PZP A;  3DWK A;  2XD5 A;  3VP1 A;  2C5W B;  4LV0 A;  4Y0T A;  4WZ4 A;  3HVF A;  3IXB A;  3UE0 A;  4E6W A;  3S4X A;  2XD1 A;  1K6S A;  1GHM A;  5DF7 A;  5CEB A;  3WWX A;  1IKI A;  1TDG A;  4YIN A;  2EX9 A;  3UPN A;  1YT4 A;  5FI2 A;  4B4Z A;  3OPL A;  3V50 A;  3CG5 A;  5TR7 A;  3W4Q A;  1NRF A;  1SCW A;  1BLS A;  1I5Q A;  2EFU A;  4KEN B;  4X69 A;  2ZQ7 A;  4OVD A;  2RL3 A;  4KZ3 A;  1JWZ A;  3ITB A;  4OP8 A;  3ZVT A;  4GZB A;  1FCO A;  1TEM A;  3N8S A;  1YLW A;  4L0L A;  5AQA A;  5FSR A;  3EQV A;  3SH8 A;  2ZQ8 A;  2ZC7 A;  1DY6 A;  4X56 A;  3PTE A;  2BLS A;  3FYZ A;  4QY5 A;  3A3E A;  2X02 A;  4JPM A;  4QD4 A;  1KDS A;  4ZBE A;  2B5R A;  4OKP A;  2R9W A;  5EVI C;  2ZQC A;  5JYP A;  2ZLY A;  5CGX A;  2JCH A;  4ZJ3 A;  4DE3 A;  1K56 D;  1LL5 A;  2WKE A;  3G34 A;  4MBH A;  1Q2P A;  1YLJ A;  1K56 A;  3IWQ A;  4R4S A;  1CEF A;  1ZC2 A;  1KVL A;  3PAG A;  5FAQ A;  5KZH A;  1I2W A;  4P6B A;  2JE5 A;  4O7D A;  4S2K A;  3S22 A;  1K38 A;  1K57 C;  3VMA A;  2XFT A;  4M3K A;  1IYO A;  3LY3 A;  1BLC A;  4JF5 A;  3ZDJ A;  2FFY A;  3IHA A;  3N8L A;  1DJC A;  2Y2M A;  3MZF A;  4F94 A;  2JBF A;  2PU2 A;  4PM6 A;  5E2H A;  1PWG A;  3IH8 A;  1XA1 A;  1PIO A;  1YMX A;  3MKF A;  2H0Y A;  3ZG9 B;  3DW0 A;  1FR1 A;  5FAS A;  2X01 A;  2G2W A;  3ITA A;  1ES5 A;  2IWD A;  5AQ7 A;  4LV1 A;  4OP5 A;  5A90 A;  1LHY A;  1PW8 A;  1JWP A;  1XGJ A;  3Q7Z A;  4JF4 A;  1K54 C;  2ZQD A;  4BL2 A;  5FDH A;  3NCK A;  4KZ4 A;  3QNB A;  3WS5 A;  4Y0O A;  1H8Z A;  2EX8 A;  4S2J A;  5CHM A;  1L0G A;  3SH9 A;  2Z2L B;  3C5A A;  4KZ5 A;  2R9X A;  4S2O A;  3IF5 A;  3M6B A;  2HP5 A;  4KQO A;  3M2J A;  3UE3 A;  5GLB A;  3I7J A;  1XXM A;  2XFS A;  4CJN A;  4K0X A;  3BYD A;  5JYO A;  1K4F A;  1PI5 A;  4PM9 A;  4B88 A;  2Y2I A;  1NXY A;  3OPH A;  4QY6 A;  3G32 A;  3UY6 A;  4E3L A;  1FQG A;  1U60 A;  3HUM A;  2XQZ A;  4OLG A;  3N6I A;  4EQI A;  1ERM A;  3A3F A;  1G6A A;  5GLC A;  2WGV A;  3HLD A;  3LCE A;  5EPH A;  2WGW B;  3BRM A;  2ZM2 A;  2WKH A;  3ZNY A;  4JLF A;  4R3B A;  1GA0 A;  2H5S A;  3AGE A;  2ZQ9 A;  1XPB A;  2UWX A;  3IQA A;  3O88 A;  4ZDX A;  4UHU A;  1LL9 A;  4BQM A;  1AXB A;  5E2E A;  2WZX A;  3ZHH A;  3OPP A;  2WAD A;  3WS1 A;  5FA7 A;  4ZTK A;  5CHU A;  3G31 A;  3GTC A;  3PBS A;  3C7U A;  1HTZ A;  1M6K A;  1JVJ A;  3NDG A;  4RA7 A;  1N4O A;  5CTM A;  1K57 A;  1BLP A;  1KVM A;  1IEM A;  3ZNT A;  4EV4 A;  2H10 A;  2JC7 A;  4KZ6 A;  3NY4 A;  4GNU A;  1YLT A;  3OCL A;  1YLZ A;  3Q7V B;  4WZ5 A;  3ZVW A;  3VOY A;  3IF6 B;  3V3R A;  1XA7 A;  1JTG A;  1MWT A;  2Y55 A;  3BM6 A;  1PWC A;  3UDX A;  2HDR A;  4X68 A;  2Y2O A;  1MWR A;  4YFM A;  2P74 A;  1FR6 A;  4XUX A;  4OPR A;  1SHV A;  1GCE A;  2HDS A;  1MBL A;  3HLW A;  1K54 A;  1NYY A;  4FSF A;  4JF6 A;  1E3U D;  2P9V B;  3Q07 A;  4MEZ A;  5EVL A;  5EE8 A;  1E3U A;  3WRZ A;  1IYP A;  3FZC A;  3G30 A;  2Y2G A;  3C4P A;  1ES4 A;  4P87 A;  4OQI A;  1CK3 A;  1M40 A;  4P0M A;  1ZG4 A;  5E2G A;  1ES3 A;  2DCF A;  4OOY A;  1IEL A;  4E6X A;  1QMF A;  5G18 A;  2HDQ A;  1NYM A;  1LLB A;  3NI9 A;  3V39 A;  2HPB A;  4GN2 A;  4K0W A;  4GKU A;  3RXX A;  1FSW A;  2PBY A;  1ZG6 A;  4E3I A;  3PBR A;  5DF8 A;  5I94 A;  3GV9 A;  3MBZ A;  4DXB A;  3A3D A;  1PWD A;  5FQQ A;  3P09 A;  5DTK A;  2Q9M A;  3W8K A;  3BFG A;  2XGN A;  3PBN A;  5F1F A;  1K25 A;  1WYC A;  3JYI A;  3SS4 A;  4R1G A;  1KE4 A;  4U0T A;  1IKG A;  3BLM A;  5EEC A;  5FQI A;  4KG6 A;  5GHX A;  5KSC A;  1XP4 A;  5HW3 A;  4PM8 A;  1BSG A;  2HDU A;  5CGW A;  1LI9 A;  5D3O A;  5J8X A;  5GHY A;  3HUO A;  3IXH A;  4KZ9 A;  5EUA A;  4GOG A;  3MZD A;  4RVA A;  3SS5 A;  1NJ4 A;  4E3K A;  1IYQ A;  4S2P A;  1FCN A;  3FKW A;  3HLB A;  4WZ5 C;  4RX2 A;  4RYE A;  1HD8 A;  4KG2 A;  1CI8 A;  3IHB A;  4XXR A;  4DE1 A;  4N9L A;  4JXV A;  3AGF A;  3WS4 A;  4U3T A;  5M18 A;  4R23 A;  4X55 A;  5F82 A;  4WEK A;  3QNC A;  4DRT A;  4WM9 A;  3MZE A;  1RCJ A;  2ZC6 B;  1YLP A;  4KQQ A;  4R4R A;  4PM7 A;  4ZJ2 A;  3GRJ A;  1TVF A;  1OME A;  3VFF A;  2OV5 A;  3BFE A;  1NY0 A;  4WEL A;  1ZKJ A;  1K6R A;  1BLH A;  2WKI A;  3HLF A;  1XKZ A;  5IHV A;  3CMZ A;  3CZD A;  3VOZ A;  1K55 C;  3VP4 A;  3AGD A;  3EQU A;  3VP0 A;  3B3X A;  2DRW A;  5FQK A;  3IXD A;  4E3O A;  2ZM8 A;  2Y2J A;  1XGI A;  1S0W A;  5F1G A;  4OPY A;  1ESI A;  5KMW A;  1SDE A;  2Y2Q A;  4KG5 A;  2WK0 A;  2C6W B;  3G2Y A;  3G2Z A;  4GDB A;  4ZJ1 A;  4CPK A;  4BJP A;  4EWF A;  4WMC A;  3HLE A;  5A92 A;  4IED A;  5HAQ A;  1YMS A;  3N7W A;  1XX2 A;  3GSG A;  2ZD8 A;  3IXG A;  4N9K A;  4UA6 A;  2IWC A;  3V5M A;  2VGK A;  4WYY A;  2WGW A;  3BFD A;  4E3M A;  1FOF A;  2Y2H A;  2ZQA A;  2WAF A;  3IWI A;  4OON A;  3NIA A;  4QU3 A;  4DKI A;  2WGI A;  4EBP A;  1KGE A;  3GR2 A;  1RGY A;  1SDN A;  5TFQ A;  1ERQ A;  2XDM A;  1DJB A;  3VSL A;  5DF9 A;  1I2S A;  4R0Q A;  3A3J A;  2BG1 A;  4D2O A;  4LCL A;  2G2U A;  1ERO A;  5A91 A;  4WBG A;  1PW1 A;  1GA9 A;  2FFF B;  3HL9 A;  5M1A A;  4BEN A;  2Y2K A;  3N8R A;  5BOH A;  2J9P A;  3M6H A;  3PAE A;  3C7V A;  4DDY A;  1TDL A;  3Q1F A;  1W79 A;  1SKF A;  2V20 A;  1HVB A;  1Q2Q A;  3BEC A;  4B4X A;  4GD8 A;  1KE3 A;  4X6T A;  5EOO A;  5HAR A;  4MNR A;  2PU4 A;  5EVI B;  3MXR A;  1O07 A;  1CI9 A;  4NK3 A;  1ONG A;  3IT9 A;  4MLL A;  5FAP A;  3W4O A;  3P98 A;  3UDF A;  3GQZ A;  5HX9 A;  3W4P A;  4U0X A;  1W7F A;  3Q7V A;  4PMA A;  5CRF A;  3TSG A;  4MBF A;  3ZG8 B;  3IF6 A;  5GLD A;  4N92 A;  3DWZ A;  3UO9 A;  2Z2M B;  2OLU A;  2OLV A;  2Y2L A;  4Y7P A;  1YLY A;  2GDN A;  4JBF A;  1JWV A;  1FSY A;  3PBQ A;  4JXW A;  5HAI A;  4H8R A;  4ID4 A;  5CEC A;  4C75 A;  2ZC5 B;  3SOI A;  5DVA A;  4UAA A;  4S2M A;  2P9V A;  5FQM A;  1MWU A;  2XH9 A;  1K55 A;  5CTN A;  2QPN A;  5GLA A;  3MFD A;  4LEN A;  1EI5 A;  1LI0 A;  3TG9 A;  5CGS A;  4LV3 A;  1HZO A;  3HRE A;  2ZC3 B;  3BEB A;  3OC2 A;  1MPL A;  4S2N A;  4LV2 A;  4E3N A;  1BUE A;  1KGG A;  1PYY A;  3GVB A;  4C6Y A;  1YM1 A;  2EXB A;  3O86 A;  2Y91 A;  3O3V A;  4GB7 A;  4Y0U A;  5TGF A;  1JTD A;  1KDW A;  4Q8I A;  1H8Y A;  4IBX A;  2EFX A;  3NDE A;  5GL9 A;  3ZGA B;  4ZAM A;  1QME A;  1WE4 A;  3VFH A;  4IVI A;  2V2F F;  3MXS A;  2WZZ A;  2DNS A;  1E4D A;  3WS2 A;  2EX6 A;  3E2L A;  3SS3 A;  4P85 A;  2HP6 A;  3NC8 A;  4UA9 A;  5E2F A;  3VP2 A;  4E3J A;  2EX2 A;  3QHY A;  4HBT A;  3ZFZ A;  3A3I A;  1MXO A;  5FAO A;  4KZA A;  4N1X A;  3FV7 A;  4DE2 A;  4JXG A;  2XK1 A;  4OOM A;  4KZB A;  4QHC A;  5FAT A;  3GMW A;  4OPZ A;  1H5X A;  2X71 A;  3BFF A;  1PZO A;  3BLS A;  5DTS A;  4EUZ A;  3ZG7 B;  1MKI A;  3Q81 A;  1NZU A;  3UN7 A;  1N9B A;  1Z6F A;  4PPR A;  4R3J A;  1CEG A;  1KGF A;  3IF6 C;  5CXW A;  3VP3 A;  3PBT A;  4IBR A;  3TOI A;  3ZG5 A;  3MKE A;  5FQ9 A;  5DTT A;  3OZH A;  1G68 A;  4MBK A;  5KSH A;  4S2I A;  5CHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...