1FCMA

Crystal structure of the e.coli ampc beta-lactamase mutant q120l/y150e covalently acylated with the inhibitory beta-lactam, cloxacillin
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLLVPDEVKSSSDLLRFYQNWQPAWAPGTQRLEANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Crystal Structures of Substrate and Inhibitor Complexes with AmpC -Lactamase: Possible Implications for Substrate-Assisted Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/antibiotic
total genus 107
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fcmA00
4ZDXA 1NZUA 4GZBA 3HLDA 3UDIA 3UE3A 5FAOA 3IWQA 1BTLA 1H8ZA 3Q7VB 3NIAA 4PM8A 4LV0A 1YLYA 4S2KA 1YLWA 3UY6A 1SKFA 4LCMA 4WEJA 1BLPA 1IYOA 5FQJA 4HBUA 4OPZA 1K55C 1ES4A 2Q9MA 5GLAA 4LV1A 3AGEA 4GKUA 3W4OA 2X02A 1I5QA 1BLSA 2QPNA 2WADA 1NJ4A 2JC7A 3N8RA 3PBQA 1PW1A 3OCLA 5I94A 4B88A 2ZC6B 1GA9A 4GN2A 1NRFA 4ID4A 3ZG9B 3BFDA 1ERMA 1JWPA 3P09A 1SDNA 5A93A 4OP8A 2ZD8A 1KGEA 4OPQA 3AGFA 1JTDA 2XLNA 3HLBA 3WS4A 3PBRA 2ZC7A 3IHAA 4PM6A 3N4IA 4RVAA 4FH4A 5DTSA 4JXVA 3RXWA 4QJGA 2ZQ9A 3WRTA 3EQVA 2EX8A 5AQBA 4E3OA 3A3DA 4WMCA 4WZ5A 3G4PA 4JLFA 4U0TA 5HX9A 3BM6A 3M6BA 2OLVA 4DXCA 1L0FA 1PZOA 4CJNA 1YMSA 1SHVA 3IF5A 4XUXA 1EROA 5FQMA 1K56A 1H8YA 2H10A 2ZMAA 1W8QA 4GD8A 4EQIA 5HFOA 2IWBA 1XGJA 3Q1FA 3ZG8B 1EWZA 1AXBA 1IKGA 4RA7A 3TOIA 3GR2A 2XD5A 1MWUA 1ES5A 2UWXA 4NETA 3W4QA 2Y2NA 4QY6A 4KQOA 2J9OA 1ONHA 5KZHA 1WE4A 5AQAA 4UAAA 1PI5A 3IWOA 2X01A 5DTTA 5FAPA 2XQZA 5AQ7A 3BYDA 2XGNA 5E43A 4FCFA 1MKIA 1PI4A 3BFEA 3CJMA 5M1AA 4EBPA 1K54A 1ALQA 1U60A 5CEBA 1IKIA 3HUMA 4S2NA 4WZ5C 3RXXA 2H5SA 1VM1A 3FV7A 3HL9A 5IHVA 5E2GA 4KZ4A 4N9LA 4HEFA 5CRFA 4WBGA 1G6AA 2EFUA 4Y0OA 4Y0UA 4ZBEA 2DRWA 3A3JA 3CMZA 1L0GA 4GD6A 3VP1A 2XK1A 4OQGA 1HTZA 5EE8A 1H5XA 1YT4A 3HLGA 4P6BA 1GCEA 2H0TA 1SDEA 2XF3A 2BG1A 5HAIA 2ZQCA 3BECA 3O3VA 3IF6C 1G68A 3O86A 3HUOA 3NDEA 4MBKA 4WYYA 5D3OA 2B5RA 3A3IA 4DXBA 1NY0A 1K25A 4S2JA 3QNCA 1CI8A 2Z2MB 4BJPA 3GSGA 3ZCZA 3PBTA 3ZG7B 4KG6A 3UPPA 1OMEA 3PAEA 3S22A 4E3MA 2PU2A 4K0WA 3S1YA 4ZJ2A 3Q82A 1K54C 4K0XA 3GTCA 3GVBA 4N1XA 3G2YA 4DDSA 1KGFA 4QB8A 4XXRA 2FFYA 3WS0A 1TVFA 5JYOA 2OSUA 2ZM2A 3UE1A 4KZ3A 2WZXA 1C3BA 5GHZA 2GDNA 5CXWA 3NCKA 4OQHA 4YINA 5DF7A 5FA7A 2Y2IA 1CEFA 2JCHA 4DRTA 3ISGA 4IVIA 4DE0A 3IWIA 1QMFA 1IYPA 4DDYA 2ZC3B 2I72A 1ES2A 1FSWA 4R4RA 5E2HA 3OPHA 2QZ6A 4C6YA 1M6KA 4FSFA 3IHBA 4X55A 1DY6A 3GRJA 1MY8A 5TGFA 5DF9A 2Y2PA 1ZC2A 2XD1A 4S2LA 4BLMA 4DE1A 3I7JA 3PAGA 4EWFA 3UO9A 4LENA 4PMAA 1BZAA 5HL1A 3ZDJA 1J9MA 1Q2PA 4X6TA 1PWDA 2EX2A 3SS3A 4E3JA 3V3SA 1GHMA 1YLPA 1EI5A 4DE2A 3WS2A 1IEMA 2ZQAA 3HLFA 5A90A 4GDBA 2VGKA 1CEGA 2ZC5B 3G30A 4KZBA 4JXGA 4S2IA 1KGGA 3N8SA 4OOLA 2WZZA 4EV4A 5JYPA 2C5WB 4RYEA 1YLJA 1LL5A 4LV2A 4U0XA 1DJBA 1W79A 2Y55A 5L2FA 3NI9A 4OKPA 5GLCA 4EUZA 1ESUA 4UHUA 5KSHA 1GHIA 2Y2GA 1GHPA 4JKTA 1JVJA 2WGWA 5GL9A 4X68A 1L0EA 5EVLA 3GQZA 4EBLA 1YQSA 5HAQA 3FKVA 5DF8A 5F1FA 1DJCA 2Q9NA 3O88A 3SS4A 1NZOA 1YLTA 3VP0A 3UDXA 1ERQA 3BFFA 4S2PA 1BT5A 1PWGA 2ZLYA 3E2LA 3ZGAB 4Y0TA 1FOFA 2HP5A 2Y2JA 5CHMA 3OC2A 3IF6A 1K57C 5U47A 3VP3A 4R1GA 4RX3A 2PBYA 3TG9A 3C7VA 5CTNA 1K6RA 4QD4A 1PWCA 5FAQA 4ZTKA 2XFTA 3DTMA 3VOYA 3B3XA 1KE3A 4KG5A 1KVMA 5M18A 3SH7A 2OV5A 4DE3A 1CI9A 1O7EA 5FQIA 3HBRA 1KDWA 1XKZA 1ES3A 3WRZA 1O07A 4KZ8A 3SH8A 2IWDA 4C3QA 4IEDA 1XA1A 2ZQ8A 4JF4A 4MBHA 3SH9A 1VQQA 5FSRA 4Z9QA 4DF6A 4E3IA 3OPPA 4BD1A 2ZM0A 4NK3A 5EOOA 1L0DA 3MZDA 5M19A 3NY4A 2WAFA 1I2WA 1K4EA 2WGWB 3O87A 3PBSA 4P87A 3ZNTA 3WS1A 3HLCA 4ZAMA 4OPYA 5FI2A 4D2OA 4KZ9A 2A3UA 1BULA 4BL2A 1LL9A 3ITAA 3VFHA 1ONGA 3IH9A 4EBNA 1FQGA 1IYQA 4K91A 5CEDA 4R3BA 3DWZA 5CHJA 2R9WA 2ZQ7A 1KVLA 3ITBA 4HBTA 4JXWA 3ZFZA 1PYYA 4PM7A 3V3RA 1E3UA 1HZOA 3NDGA 1XGIA 3ZNYA 3FKWA 4PM9A 1FR6A 3IF6B 3NBLA 1E4DA 5EUAA 2WGVA 3FWLA 3G2ZA 5GHYA 4WELA 4MBFA 3HLWA 4LV3A 4KZ7A 3G32A 4JXSA 3JYIA 2IWCA 3PTEA 4BD0A 3IQAA 4UA9A 1RGYA 5FASA 3IXHA 3MFDA 4PM5A 4HESA 4KZ5A 4IBRA 5EPHA 5HW3A 1NYYA 1DJAA 1PZPA 4CPKA 2R9XA 5FQKA 4GDNA 1FCNA 3LEZA 5CTMA 3NC8A 3UDFA 2J9PA 5EOEA 1PW8A 1W8YA 4S2MA 5E2FA 4OQIA 3UPNA 1ESIA 4E6WA 4ZJ3A 2HDRA 3CZDA 4R3JA 4GNUA 3MXSA 1ZG4A 2RCXA 4JPMA 5CECA 2ZQDA 1JWZA 3PBOA 3MBZA 4WEKA 5F83A 3Q07A 4OPRA 3DW0A 5TFQA 4YFMA 3GV9A 3HLEA 2Y91A 1IELA 3IH8A 1MWTA 3S4XA 1XX2A 4N1HA 1WYBA 3CG5A 3LO7A 1LI9A 1HVBA 4OLDA 5DVAA 3HUNA 5FATA 1QMEA 3MXRA 4OVDA 4B4XA 3C5AA 2J8YA 3E2KA 1JTGA 1E3UD 2H0YA 2C6WB 1PIOA 2EX9A 4WZ4A 1K57A 3GMWA 1MPLA 2BLSA 4H8RA 4E3NA 4DKIA 2G2UA 3MZEA 3VSLA 1S6RA 5F1GA 1LLBA 1ZKJA 3OZHA 2WKIA 4OOMA 4OONA 3A3FA 2V20A 2CC1A 2Y2KA 4FH2A 3WS5A 2XR0A 2Y2QA 4OH0A 2HP9A 3UN7A 3N8LA 5E2EA 3LY4A 1TDLA 3UNWA 3M6HA 2J7VA 4QU3A 5HAPA 3VP4A 3ZG0A 2DNSA 3UE0A 1W7FA 2EFXA 2XFSA 5CGSA 2WUQA 2ZC4B 3MZFA 3OPRA 4JF5A 3V50A 1L2SA 3Q7ZA 4MLLA 1KE4A 3P98A 1FCOA 4IVKA 3G35A 4S2OA 5FDHA 4PPRA 4WM9A 4ZJ1A 3UPOA 3HVFA 2G2WA 2V1ZA 2JE5A 4BENA 3IT9A 3VFFA 4KZ6A 3IXDA 1LI0A 2XEPA 4OP5A 5FQ9A 3OCNA 3ZVWA 3VSKA 3IXBA 2HDUA 3MKEA 3M2JA 3LY3A 3LCEA 4KENB 3N7WA 4MEZA 3W8KA 3VMAA 1RGZA 4RX2A 2Y2MA 1FR1A 4QHCA 2RL3A 4N92A 3BFGA 2A49A 4C75A 4GB7A 1S0WA 3VP2A 3V39A 2WYXA 3QNBA 4A5RA 2EX6A 2EXAA 4BL3A 3G34A 3BLSA 1XP4A 2Y2OA 4XUZA 3C7UA 2PU4A 2E8IA 3PBNA 4UA6A 5GHXA 1IYSA 2ZJ9A 3OPLA 4F94A 4E6XA 1Z6FA 1RCJA 2WKHA 5EVIA 2HDQA 2XDMA 4X69A 4N9KA 3TSGA 2P74A 1HD8A 4GOGA 4IBXA 2P9VA 4UA7A 5BOHA 1W5DA 2QMIA 4P85A 4FD8A 2EXBA 5CERA 3BEBA 3DWKA 4KZAA 5CGWA 1FCMA 4B4ZA 5CGXA 2Y2HA 1CK3A 1XXMA 4L0LA 1BUEA 2Y4AA 4Y7PA 5CHUA 1XA7A 4R4SA 3ZVTA 1MBLA 2HDSA 1KE0A 5HARA 1GA0A 3W4PA 1YMXA 3Q7VA 2X71A 3FZCA 4OQ0A 4Q8IA 2DCFA 5FI6A 5G18A 1K4FA 2Z2LB 3HREA 4U3TA 4WMCD 2HPBA 3A3EA 1TDGA 1MWSA 4KQQA 3FYZA 1TEMA 3WWXA 3ZHHA 3C4OA 4E3LA 2WK0A 3VOZA 1WYCA 3ZG5A 5KMWA 1K38A 3BRMA 4OLGA 4OOYA 1JWVA 4LCLA 1I2SA 3G31A 4R23A 5KSCA 1K56D 1LHYA 5TR7A 3N6IA 1BLCA 1K6SA 5DTKA 4M3KA 5EVIC 5A92A 5GLDA 4JF6A 4R0QA 1MXOA 4P0MA 4X53A 3V5MA 1K55A 1RP5A 4KQRA 4O7DA 2WKEA 4QY5A 1BSGA 1N4OA 5EVID 5GLBA 1NYMA 5EECA 2ZM8A 1SCWA 5FQQA 1XPBA 1E25A 3M2KA 3C4PA 3IXGA 5AQ9A 5EVIB 1MWRA 2JBFA 2XH9A 4S2NC 5F82A 4KG2A 3BLMA 4BQMA 4E3KA 1ZG6A 2V2FF 2VGJA 5FI7A 2P9VB 3D4FA 2Y2LA 3Q81A 3RJUA 3EQUA 1YLZA 5A91A 4JBFA 1NXYA 3SS5A 1Y54A 2HP6A 3AGDA 2OLUA 3SOIA 5J8XA 3QHYA 3BFCA 1N9BA 2Y59A 1KDSA 1Q2QA 2FFFB 1M40A 4X56A 2WAEA 4MNRA 1FSYA 2WGIA 3MKFA 1BLHA 1YM1A
chains in the Genus database with same CATH superfamily
3MF0A 1S4RA 3UE3A 4BBUA 5FAOA 3IWQA 1H8ZA 1V9ZA 4WEJA 5FQJA 1F98A 1K0KA 1T1AA 5GLAA 3F1PA 1BLSA 2QPNA 2WADA 3DAVA 2JC7A 3N8RA 3OCLA 5I94A 3BQ8A 1JWPA 1TD5A 5EM0A 5J4EA 3P09A 4OP8A 2MJ6A 4B9OA 4P6ZS 4QJGA 1NWZA 2ZQ9A 3EQVA 5AQBA 3ZQ5A 4WZ5A 4GHIA 1SHVA 3LIFA 2ZMAA 1W8QA 4WL9A 1XGJA 4LRXC 4L9GA 3G6OA 5AVFA 3ZG8B 4DMZA 2P7JA 4RA7A 4EXOA 1T1BA 4KQOA 2J9OA 1ONHA 2BTFP 5FAPA 4EEPA 5AQ7A 1S67L 1K54A 1YKDA 3HUMA 4S2NA 4PHTA 2H5SA 2Z6CA 4KZ4A 1GSVA 2FH5A 1G6AA 4WBGA 5EE8A 4B93A 1GCEA 2XF3A 2ZQCA 3JPUA 3CITA 1G68A 3K2NA 4WYYA 5D3OA 4M4XA 3LUQA 4S2JA 1XJ6A 1DP9A 4BJPA 3ZCZA 3PBTA 4KG6A 1BYWA 4N1XA 4QB8A 4XXRA 5JYOA 2WZXA 1C3BA 3UB6A 2LB5A 2HJEA 3B42A 1QMFA 2M1CA 1ES2A 4BMWA 2QZ6A 2ZL1B 1MY8A 4CQHA 3MQQA 1ZC2A 2XA7M 4EWFA 2PYPA 1Q2PA 4X6TA 2J3TC 4P6ZM 4E04A 1IEMA 3HLFA 1OPXA 3G30A 3ULFA 2J3TD 4Q0IA 2A2LA 2C5WB 1LL5A 3TW8A 2Y55A 5L2FA 3CHWP 3PR6A 4JKTA 5CX7A 1L0EA 3MJQA 5HAQA 5DF8A 5F1FA 3O88A 3SS4A 1NZOA 3VP0A 3FG8A 4IJGA 4Y0TA 2Y2JA 3C2WA 1L3LA 3OC2A 3VP3A 3VE4A 4QD4A 4HP4A 1KE3A 2GX5A 3OLOA 5IT5A 1KDWA 3D9YA 3LYXA 2O0YA 3BY9A 4DF6A 3OPPA 2NUPC 1L0DA 4BBTA 2WGWB 3HLCA 5FI2A 4D2OA 3IX4A 3VV4A 1BULA 3ITAA 2Y79A 4K91A 1IYQA 3DWZA 3ITBA 2ZOIA 5EM1A 2V0UA 2VGLS 3NDGA 1XGIA 3IF6B 3NBLA 2WGVA 3FWLA 2W3EA 3T12B 5FEFA 4WELA 4MBFA 3HJKA 3PTEA 4X1LA 3S7NA 1VEUA 4UA9A 3MFDA 1P9RA 3H82A 5EPHA 4KZ5A 1NYYA 2G7UA 3MMHA 3NHQA 1YPRA 4HJ3A 4GDNA 2K31A 4NEED 3F1NB 3MQ0A 5F83A 3Q07A 4YFMA 3IH8A 1IELA 3S4XA 1XX2A 4N1HA 1WYBA 3LO7A 1LI9A 5FATA 3MXRA 4OVDA 4HH2A 4B4XA 2J8YA 2H0YA 2C6WB 1PIOA 1K57A 2BLSA 4H8RA 4DKIA 2W3DA 4JGOA 1ZKJA 4OOMA 3NJAA 4ARZB 4FH2A 2CC1A 2Y2KA 3N8LA 1TDLA 4PAUA 3VP4A 3ZG0A 2DNSA 3UE0A 3V50A 4JF5A 3Q7ZA 4MLLA 4F3LB 4HJ6A 4S2OA 3IS2A 2JE5A 3IT9A 2QYBA 4QWOA 3VFFA 1LI0A 4KUOA 2WKQA 4CLCA 3PYPA 2AVXA 3CPTB 3LY3A 3W8KA 3N7WA 1FR1A 3V39A 4A5RA 2EXAA 2ZOHA 4BL3A 4HIAA 3BLSA 1T1CA 4XUZA 2PU4A 5GHXA 4F94A 4E6XA 1RCJA 4IHQA 2XDMA 2OAP1 1HD8A 4L9EA 4UA7A 4H6JA 2QMIA 2Y8HA 4FD8A 4MN5A 4B4ZA 1FCMA 4FTXA 5CGXA 4L0LA 4Y7PA 3T4KA 3QP2A 4R4SA 2PBDP 5HARA 2X71A 4GS9A 4OQ0A 4YWZA 5FI6A 1K4FA 3C38A 2HPBA 4KQQA 3IX8A 1WYCA 3G31A 1BLCA 1CJFA 4R0QA 1YAXA 1BSGA 3IBJA 5GLBA 1XPBA 4NG2A 4S2NC 4E3KA 4BQMA 1ZG6A 3D4FA 3BW6A 3RJUA 2Z6DA 4JBFA 1Z09A 1NXYA 3SS5A 3AGDA 2OLUA 3QHYA 2B95A 2Y59A 1FSYA 3MKFA 1BLHA 4ZDXA 1NZUA 4GZBA 1BTLA 1VETB 3UY6A 1CF0A 3E4QA 4OPZA 1OTEA 1K55C 4LV1A 4GKUA 3RFBA 1I5QA 5FL3A 3QP6A 1NJ4A 3PBQA 1S1ZA 2ZMVA 3PXPA 2XROA 3T4SA 1GA9A 3ZG9B 4ME4A 4EETB 2O9AA 4Y15A 2ZD8A 4OPQA 4Y5FA 3PBRA 3DTEA 5HDSA 5DTSA 3RXWA 2KLIA 2XRNA 4E3OA 4EERA 3A0SA 1S1YA 3G4PA 3T4TA 2OLVA 4CJNA 1H8MA 5FQMA 1EROA 1FIKA 1K56A 2YKHA 4LPZA 4EQIA 1KOUA 5HFOA 2IWBA 3Q1FA 3CLOA 1MWUA 3W4QA 1F5MA 5KZHA 2JKRM 2R78A 3LR4A 1XFNA 3IWOA 4UAAA 2XQZA 5HWTA 3P7NA 4FCFA 3BFEA 4EBPA 5CEBA 5L8MA 4R3AA 3KYEA 2HZ5A 5J7EA 3HL9A 2PD8A 5IHVA 2ZL1A 5E2GA 4HEFA 5CRFA 2VK3A 2EFUA 3E98A 4Y0UA 5HD3A 4I3AA 2D01A 3A3JA 3VP1A 4GLQA 2XK1A 3EOIA 1YT4A 5EVEA 1SDEA 1TF1A 5HAIA 3S7OA 3BECA 5L10A 1Y28A 3O3VA 3E0YA 3O86A 3HUOA 1K25A 3VE3A 4AFIA 3FPWA 1WA9A 2PU2A 2V9AA 4ZJ2A 3GVBA 3G2YA 1J3WA 2FFYA 1TVFA 3LEQA 2ZM2A 3UE1A 5GHZA 2GDNA 4YINA 5DF7A 2Y2IA 4MN7A 3UB7A 2PDRA 4DRTA 4NXFA 3L7HA 4HNBA 1M6KA 4X55A 4GS9B 3GRJA 5DF9A 4EQ1A 4I3IA 2XD1A 1VB6A 4BLMA 2I9VA 3I7JA 3PAGA 3TE8A 4LENA 4PMAA 2GZAA 2BASA 1PWDA 2EX2A 3SS3A 3V3SA 1GHMA 1FILA 1YLPA 3GDIA 1EI5A 4DE2A 3WS2A 3T4OA 4II7A 2JN7A 4S2IA 4RQ9A 2WZZA 5JYPA 1LSXA 1YLJA 3BY8A 3P01A 3NI9A 5GLCA 4UHUA 1GHIA 4UQIM 2WGWA 3LIBA 3L9KA 5F68A 4X68A 4EBLA 3T1QB 4HOIA 3FKVA 1Y4OA 4ETXA 1DJCA 4MCWA 1PWGA 2ZLYA 3E2LA 3ZGAB 2J80A 1FOFA 5EV0A 3IF6A 1K57C 2CMNA 5L07A 4UEYA 4Y2FA 1IFQA 1PWCA 4ZTKA 2XSSA 3DTMA 3B3XA 2OOLA 1O7EA 5FQIA 3HBRA 1XKZA 1ES3A 3WRZA 4C3QA 1XA1A 3EWKA 4PKYA 5FSRA 4Z9QA 3F1NA 3HJIA 4LRZE 3VOLA 4NK3A 3NY4A 1I2WA 4P87A 3ZNTA 1V9YA 4OPYA 2A3UA 4BL2A 3VFHA 3IH9A 4CLCC 5CEDA 3SW1A 1KVLA 4JXWA 3ZFZA 1UWPX 4PM7A 4CLCD 4PM9A 1FR6A 3NECA 1E4DA 3D3OA 3H7WB 2KX6A 4ARZA 1IOUA 2JKTM 3UB9A 4LV3A 4KZ7A 1N9NA 2IWCA 4BD0A 1N9LA 4O01A 1RGYA 3IXHA 4PM5A 4HESA 5HW3A 2EWWA 1DJAA 1PZPA 4F3LA 5FQKA 3LEZA 3UDFA 1W8YA 5E2FA 3UPNA 1ESIA 1OJGA 2EA9A 4FUWA 3MSHA 4DJ3A 3MXSA 2RCXA 2PR5A 3GV9A 3CPTA 2Y91A 2B18A 1MWTA 5DVAA 3HUNA 2OAQ1 2QJ7A 1E3UD 5MC7A 3GMWA 3CUEA 2PRFA 3OZHA 4R6LA 2XR0A 2HP9A 1D06A 3M6HA 3T4QA 1JNUA 1W7FA 5CGSA 2W0NA 3MZFA 3OPRA 1L2SA 1DP8A 3G35A 5FDHA 4PPRA 4HHDA 4G3VA 4BENA 4IUKA 3IXDA 5LBRA 3ZVWA 3VSKA 3K3CA 4MEZA 4RX2A 2Y2MA 4QHCA 3BFGA 3O5YA 1XJ2A 4GB7A 3VP2A 2WYXA 3QNBA 2EX6A 4R38A 1OTIA 4NXEA 2E8IA 2PD7A 2ZJ9A 4X1MA 2W3GA 2HDQA 4Q0JA 2P74A 3LR0A 3FPVA 3T1RA 4IBXA 3RH8B 4P85A 2ZMFA 1XXMA 3LI8A 2Y4AA 1PNEA 1F2KA 1XA7A 3ZVTA 4I39A 1KE0A 3W4PA 4XT2B 1VETA 3S7QA 4KUKA 3FYZA 1TEMA 3WWXA 4E3LA 2WK0A 3VOZA 5KMWA 1K38A 3BRMA 5KSCA 4R23A 2FZ0A 1K56D 1PRQA 4M3KA 5EVIC 2A24B 2L0WA 5IS1A 4JF6A 1MXOA 1XJ3A 5HPIA 3V5MA 4KQRA 1GSWA 3UB5P 5EVID 1NYMA 1SCWA 2O9CA 3KYZA 1MWRA 2OWHA 2VGJA 5HPFA 2P9VB 3Q81A 1Y54A 2HP6A 3CAXA 1D7EA 3SOIA 2ACGA 1Q2QA 3F1OB 1YM1A 3UDIA 5TJJA 4LV0A 1YLYA 1SKFA 2VLGA 4LCMA 1IYOA 1ES4A 5C5KA 4LFUA 3W4OA 5HWVA 3T4LA 1PW1A 1LL8A 4GN2A 1NRFA 3BFDA 3T1SA 1SZVA 1ERMA 3LIAA 2YKFA 5A93A 1W63M 4DJ2A 3AGFA 1JTDA 2XLNA 4YNRA 4EUVA 3MS6A 4PM6A 3UMDA 2DMWA 3BJNA 2EX8A 3A3DA 4WMCA 4JLFA 3BM6A 3M6BA 1NLYA 4DXCA 1L0FA 2KDKA 2QKPA 2H10A 4GD8A 2WKRA 3IBRA 5TBMB 1AXBA 3GR2A 2XD5A 2IA2A 1YSQA 2JHEA 1NRJA 3PHYA 1PI5A 2VGLM 2PAVP 4HI4A 2PT7A 1LSWA 5E43A 1MKIA 1PI4A 3T1XA 1U60A 3RXXA 4WZ5C 4N9LA 2H28A 1G5UA 4ZBEA 1L0GA 3CMZA 4Y17A 1HTZA 1H5XA 1UGUA 2P08A 3HLGA 2H0TA 2BG1A 5HL6A 3IF6C 4MBKA 1STZA 2B5RA 3TRCA 3T4JA 3QNCA 1TS8A 3TJZC 3GSGA 2PHYA 3C8CA 2L4RA 1DP6A 1MZUA 1OMEA 3PAEA 3S22A 4K0WA 3S1YA 4HQAA 4JGQA 1K54C 4NKPA 3GTCA 4DDSA 3WS0A 5CXWA 3NCKA 4OQHA 5FA7A 2JCHA 2V0WA 3E4OA 4DE0A 4DDYA 3KSIA 2ZC3B 4R4RA 3OPHA 4FSFA 4I38A 5TGFA 2W1RA 4Y3IA 4DE1A 1P0ZA 3UO9A 1BZAA 2JKGA 2VX8A 3ZDJA 1J9MA 1F9IA 4E3JA 2UV0E 1SKOB 5A90A 4GDBA 1TS7A 4KZBA 4O0PA 4KQDA 3U2AA 3MQOA 4U0XA 4LV2A 3K3DA 1DJBA 1W79A 4PKYG 4OKPA 2QJ5A 1ESUA 1JVJA 2L1MA 1YSPA 1G28A 1YQSA 2Q9NA 5G4ZA 4S2PA 2NUTC 1BT5A 1XJ4A 4LRYC 1OTBA 5U47A 1MKMA 3SZTA 3H7WA 3UMEA 3EEAA 4I3JA 5DJUA 2W1TB 3C7VA 1K6RA 5FAQA 2XFTA 5AVEA 3SH7A 4GCZA 4DE3A 1CI9A 3SH8A 4KZ8A 4IEDA 3LI9A 2HJ9C 2ZQ8A 4BD1A 4ESPA 5EOOA 3MZDA 3R7WB 3WS1A 4ZAMA 4KZ9A 1LL9A 1ONGA 4EBNA 1FQGA 5F6AA 3E4PA 5CHJA 2R9WA 4HBTA 5FEGA 1PYYA 1HZOA 3QP5A 4WLAA 2JKFA 3RTYA 5EUAA 1ZHHB 5J3WA 3G2ZA 5GHYA 3HLWA 4JXSA 3JYIA 3IQAA 1H3QA 3BWLA 4IBRA 4CPKA 1FCNA 3NC8A 4MN6A 2J9PA 3LR3A 4S2MA 4OQIA 4E6WA 1AWIA 2HDRA 3CZDA 3NOPC 4GNUA 4JPMA 5CECA 2ZQDA 3PBOA 3MBZA 4WEKA 5TFQA 3HLEA 4OLDA 1QMEA 3E2KA 2VJWA 1W63Q 4G3WA 3VSLA 1S6RA 5F1GA 4OONA 2V20A 3LY4A 3UNWA 2J7VA 4QU3A 3ZYTA 5HAPA 3LFVA 2XA7S 1EW0A 1P9WA 3P98A 4IVKA 2Q0OA 2K7SA 4NXBA 4WM9A 3BQAA 4ZJ1A 3HVFA 4X25A 4XT2A 2INWA 4Z1WA 5HDDA 2E8JA 2V8CA 2XEPA 4OP5A 5FQ9A 3IXBA 3MKEA 3S7PA 2WKPA 4ETZA 4GW9A 3JVVA 4HH3A 2A24A 2RL3A 2A49A 3DBAA 1S0WA 3G34A 3LIDA 2Y2OA 3C7UA 4UA6A 4GJ4A 1IYSA 3OPLA 3EGXC 1Z6FA 4N9KA 4FOFA 3TSGA 5F69A 4GOGA 4G3KA 2P9VA 5BOHA 2W27A 5CERA 2EXBA 3V67A 3BEBA 3KX0X 4KZAA 5CGWA 3NOTC 1CK3A 3F1OA 4HJ4A 5K5BA 4Q8IA 2Z2LB 4U3TA 4WMCD 2V1AA 4LGWA 1MWSA 4O8GA 1OTAA 3ZG5A 4OLGA 4OOYA 1JWVA 5DJTA 4LCLA 1I2SA 5TR7A 5DTKA 5A92A 1ZTUA 4QPRA 1ACFA 1GSXA 4X53A 4ZRRA 1K55A 4O7DA 2WKEA 5A8BA 1N4OA 5EECA 5FQQA 2ZM8A 1E25A 3C4PA 5EVIB 1DRMA 2P04A 5F82A 4KG2A 3BLMA 5FI7A 3EQUA 1VHMA 5DKKA 5AJGA 3QP1A 5J8XA 1N9BA 2FFFB 1M40A 3KSFA 2WGIA 2JKRI 3HLDA 4PM8A 3Q7VB 3NIAA 5TBMA 3T50A 4S2KA 1YLWA 1BLPA 2O9BA 3LR5A 4HBUA 2Q9MA 2W3FA 3AGEA 2X02A 3CI6A 2GJ3A 3ICYA 4B88A 4EU0A 2ZC6B 4ID4A 1SDNA 1KGEA 1LT0A 3HLBA 3WS4A 2ZC7A 3IHAA 3NULA 3N4IA 4RVAA 4FH4A 4JXVA 3WRTA 1S66L 5L09A 4U0TA 5HX9A 1P97A 1PZOA 1YMSA 3IF5A 4XUXA 1H8YA 1EWZA 1IKGA 3UB8A 3TOIA 2UWXA 1ES5A 1UWNX 4NETA 2Y2NA 4QY6A 1CQAA 2J3WA 3DTKA 5DFYA 5IU1A 2W3HA 3F1PB 1PFLA 1WE4A 5AQAA 2ZBBA 2X01A 5DTTA 4CLCE 3BYDA 2PYRA 2XGNA 4EW7A 3CJMA 2KOIA 5M1AA 1ALQA 2VKSA 1IKIA 1VM1A 4LLOB 3FV7A 2HV1A 2VZWA 4Y0OA 2DRWA 4JGPA 4GD6A 4OQGA 5KIZA 4P6BA 3W2ZA 2M7UA 4GHIB 1SKOA 3NDEA 3A3IA 4DXBA 1NY0A 1S4SA 1CI8A 2Z2MB 1XFQA 3ZG7B 3UPPA 4E3MA 5HZHA 3QP8A 2VV7A 3Q82A 1MC0A 2K2NA 4YOFA 4K0XA 2PR6A 1KGFA 5HDCA 2OSUA 4KZ3A 4D60A 5EFWA 1CEFA 2B02A 3ISGA 4IVIA 3IWIA 1IYPA 2I72A 4MDZA 1FSWA 1OT6A 3MFXA 3LIEA 5E2HA 4C6YA 1X0OA 3IHBA 1DY6A 4NXGA 1HLUP 3B33A 2Y2PA 1N9OA 4S2LA 4WN5A 2QHKA 2QWSA 1OTDA 4HY8A 5HL1A 2W1TA 3KSGA 5DKLA 2ZQAA 4DN0A 2VGKA 1CEGA 2ZC5B 4JXGA 1KGGA 3N8SA 4OOLA 4EV4A 4RYEA 4BBVA 1H0MA 1TS0A 4EUZA 3R7WA 5KSHA 2Y2GA 1GHPA 3U4LP 5GL9A 5EVLA 3GQZA 3OOVA 1YLTA 3UDXA 1ERQA 5HSQA 2JKTI 3BFFA 5FDSA 2HP5A 5CHMA 3GECA 4R1GA 4RX3A 2PBYA 3TG9A 2O99A 1G6OA 5CTNA 3VOYA 4KG5A 1KVMA 5M18A 2VA0A 2OV5A 3KYQA 4R70A 4HP9A 1O07A 2IWDA 3SH9A 4JF4A 4MBHA 4E3IA 1VQQA 1T18A 2ZM0A 3NOUC 5M19A 2WAFA 1K4EA 4K08A 2VV6A 3O87A 3PBSA 3C30A 4R3BA 2ZQ7A 3OBFA 4L9FA 3V3RA 1E3UA 3ZNYA 3FKWA 4Q0HA 3LGOA 2HF6A 5HWWA 3G32A 3KO6A 5FASA 3EGDC 3A0VA 1TS6A 2R9XA 2VV8A 5DFXA 5G4YA 2V1BA 3MXQA 5CTMA 5EOEA 4IUHA 1PW8A 3JVUA 1D1JA 4ZJ3A 4R3JA 1ZG4A 4JGRA 3UE6A 1JWZA 4OPRA 2EWVA 3DW0A 3CG5A 1HVBA 3C5AA 1JTGA 4WZ4A 2EX9A 4MMNA 1MPLA 4E3NA 2G2UA 1A0KA 3MZEA 1LLBA 3H9WA 2LB9A 2WKIA 2V8FA 3A3FA 3WS5A 2Y2QA 4OH0A 3UN7A 5E2EA 3FC7A 2EFXA 2XFSA 1VEUB 3A0RA 3B47A 3LICA 2WUQA 3H82B 2HGVA 4WUJA 2ZC4B 1KE4A 1FCOA 1OJ5A 3UPOA 2G2WA 2V1ZA 1LSVA 5HD5A 2OWJA 4KZ6A 3CUEC 3OCNA 2HDUA 3M2JA 4KENB 3LCEA 3VMAA 1RGZA 2GNXA 3R4KA 3IX3A 1ODVA 3HCYA 4N92A 2M7VA 4C75A 1XP4A 3DTIA 4UQIS 3PBNA 3QP4A 2WKHA 3CWFA 5EVIA 4X69A 1W5DA 3DWKA 2Y2HA 1BUEA 4WF0A 1MBLA 2HDSA 3IS2B 3MR0A 1GA0A 1YMXA 3Q7VA 3FZCA 3KSHA 3D72A 2DCFA 5G18A 3HREA 4I5SA 3A3EA 1TDGA 3ZHHA 3C4OA 4CLCB 1OT9A 2VEAA 1LHYA 3N6IA 1K6SA 5GLDA 5F5YA 2D02A 4P0MA 1T19A 1RP5A 4QY5A 4EEUA 3EEHA 3M2KA 3IXGA 5AQ9A 4BWIA 2JBFA 2XH9A 5I5LA 2V2FF 1NLZA 2Y2LA 4H6JB 1YLZA 5A91A 4Y13A 4EESA 3BFCA 1KDSA 4X56A 2WAEA 4MNRA 5CHUA
chains in the Genus database with same CATH topology
4ZDXA 1NZUA 4GZBA 3HLDA 3UDIA 3UE3A 5FAOA 3IWQA 1BTLA 1H8ZA 3Q7VB 3NIAA 4PM8A 4LV0A 1YLYA 4S2KA 1YLWA 3UY6A 1SKFA 4LCMA 4WEJA 1BLPA 1IYOA 5FQJA 4HBUA 4OPZA 1K55C 1ES4A 2Q9MA 5GLAA 4LV1A 3AGEA 4GKUA 3W4OA 2X02A 1I5QA 1BLSA 2QPNA 2WADA 1NJ4A 2JC7A 3N8RA 3PBQA 1PW1A 3OCLA 5I94A 4B88A 2ZC6B 1GA9A 4GN2A 1NRFA 4ID4A 3ZG9B 3BFDA 1ERMA 1JWPA 3P09A 1SDNA 5A93A 4OP8A 2ZD8A 1KGEA 4OPQA 3AGFA 1JTDA 2XLNA 3HLBA 3WS4A 3PBRA 2ZC7A 3IHAA 4PM6A 3N4IA 4RVAA 4FH4A 5DTSA 4JXVA 3RXWA 4QJGA 2ZQ9A 3WRTA 3EQVA 2EX8A 5AQBA 4E3OA 3A3DA 4WMCA 4WZ5A 3G4PA 4JLFA 4U0TA 5HX9A 3BM6A 3M6BA 2OLVA 4DXCA 1L0FA 1PZOA 4CJNA 1YMSA 1SHVA 3IF5A 4XUXA 1EROA 5FQMA 1K56A 1H8YA 2H10A 2ZMAA 1W8QA 4GD8A 4EQIA 5HFOA 2IWBA 1XGJA 3Q1FA 3ZG8B 1EWZA 1AXBA 1IKGA 4RA7A 3TOIA 3GR2A 2XD5A 1MWUA 1ES5A 2UWXA 4NETA 3W4QA 2Y2NA 4QY6A 4KQOA 2J9OA 1ONHA 5KZHA 1WE4A 5AQAA 4UAAA 1PI5A 3IWOA 2X01A 5DTTA 5FAPA 2XQZA 5AQ7A 3BYDA 2XGNA 5E43A 4FCFA 1MKIA 1PI4A 3BFEA 3CJMA 5M1AA 4EBPA 1K54A 1ALQA 1U60A 5CEBA 1IKIA 3HUMA 4S2NA 4WZ5C 3RXXA 2H5SA 1VM1A 3FV7A 3HL9A 5IHVA 5E2GA 4KZ4A 4N9LA 4HEFA 5CRFA 4WBGA 1G6AA 2EFUA 4Y0OA 4Y0UA 4ZBEA 2DRWA 3A3JA 3CMZA 1L0GA 4GD6A 3VP1A 2XK1A 4OQGA 1HTZA 5EE8A 1H5XA 1YT4A 3HLGA 4P6BA 1GCEA 2H0TA 1SDEA 2XF3A 2BG1A 5HAIA 2ZQCA 3BECA 3O3VA 3IF6C 1G68A 3O86A 3HUOA 3NDEA 4MBKA 4WYYA 5D3OA 2B5RA 3A3IA 4DXBA 1NY0A 1K25A 4S2JA 3QNCA 1CI8A 2Z2MB 4BJPA 3GSGA 3ZCZA 3PBTA 3ZG7B 4KG6A 3UPPA 1OMEA 3PAEA 3S22A 4E3MA 2PU2A 4K0WA 3S1YA 4ZJ2A 3Q82A 1K54C 4K0XA 3GTCA 3GVBA 4N1XA 3G2YA 4DDSA 1KGFA 4QB8A 4XXRA 2FFYA 3WS0A 1TVFA 5JYOA 2OSUA 2ZM2A 3UE1A 4KZ3A 2WZXA 1C3BA 5GHZA 2GDNA 5CXWA 3NCKA 4OQHA 4YINA 5DF7A 5FA7A 2Y2IA 1CEFA 2JCHA 4DRTA 3ISGA 4IVIA 4DE0A 3IWIA 1QMFA 1IYPA 4DDYA 2ZC3B 2I72A 1ES2A 1FSWA 4R4RA 5E2HA 3OPHA 2QZ6A 4C6YA 1M6KA 4FSFA 3IHBA 4X55A 1DY6A 3GRJA 1MY8A 5TGFA 5DF9A 2Y2PA 1ZC2A 2XD1A 4S2LA 4BLMA 4DE1A 3I7JA 3PAGA 4EWFA 3UO9A 4LENA 4PMAA 1BZAA 5HL1A 3ZDJA 1J9MA 1Q2PA 4X6TA 1PWDA 2EX2A 3SS3A 4E3JA 3V3SA 1GHMA 1YLPA 1EI5A 4DE2A 3WS2A 1IEMA 2ZQAA 3HLFA 5A90A 4GDBA 2VGKA 1CEGA 2ZC5B 3G30A 4KZBA 4JXGA 4S2IA 1KGGA 3N8SA 4OOLA 2WZZA 4EV4A 5JYPA 2C5WB 4RYEA 1YLJA 1LL5A 4LV2A 4U0XA 1DJBA 1W79A 2Y55A 5L2FA 3NI9A 4OKPA 5GLCA 4EUZA 1ESUA 4UHUA 5KSHA 1GHIA 2Y2GA 1GHPA 4JKTA 1JVJA 2WGWA 5GL9A 4X68A 1L0EA 5EVLA 3GQZA 4EBLA 1YQSA 5HAQA 3FKVA 5DF8A 5F1FA 1DJCA 2Q9NA 3O88A 3SS4A 1NZOA 1YLTA 3VP0A 3UDXA 1ERQA 3BFFA 4S2PA 1BT5A 1PWGA 2ZLYA 3E2LA 3ZGAB 4Y0TA 1FOFA 2HP5A 2Y2JA 5CHMA 3OC2A 3IF6A 1K57C 5U47A 3VP3A 4R1GA 4RX3A 2PBYA 3TG9A 3C7VA 5CTNA 1K6RA 4QD4A 1PWCA 5FAQA 4ZTKA 2XFTA 3DTMA 3VOYA 3B3XA 1KE3A 4KG5A 1KVMA 5M18A 3SH7A 2OV5A 4DE3A 1CI9A 1O7EA 5FQIA 3HBRA 1KDWA 1XKZA 1ES3A 3WRZA 1O07A 4KZ8A 3SH8A 2IWDA 4C3QA 4IEDA 1XA1A 2ZQ8A 4JF4A 4MBHA 3SH9A 1VQQA 5FSRA 4Z9QA 4DF6A 4E3IA 3OPPA 4BD1A 2ZM0A 4NK3A 5EOOA 1L0DA 3MZDA 5M19A 3NY4A 2WAFA 1I2WA 1K4EA 2WGWB 3O87A 3PBSA 4P87A 3ZNTA 3WS1A 3HLCA 4ZAMA 4OPYA 5FI2A 4D2OA 4KZ9A 2A3UA 1BULA 4BL2A 1LL9A 3ITAA 3VFHA 1ONGA 3IH9A 4EBNA 1FQGA 1IYQA 4K91A 5CEDA 4R3BA 3DWZA 5CHJA 2R9WA 2ZQ7A 1KVLA 3ITBA 4HBTA 4JXWA 3ZFZA 1PYYA 4PM7A 3V3RA 1E3UA 1HZOA 3NDGA 1XGIA 3ZNYA 3FKWA 4PM9A 1FR6A 3IF6B 3NBLA 1E4DA 5EUAA 2WGVA 3FWLA 3G2ZA 5GHYA 4WELA 4MBFA 3HLWA 4LV3A 4KZ7A 3G32A 4JXSA 3JYIA 2IWCA 3PTEA 4BD0A 3IQAA 4UA9A 1RGYA 5FASA 3IXHA 3MFDA 4PM5A 4HESA 4KZ5A 4IBRA 5EPHA 5HW3A 1NYYA 1DJAA 1PZPA 4CPKA 2R9XA 5FQKA 4GDNA 1FCNA 3LEZA 5CTMA 3NC8A 3UDFA 2J9PA 5EOEA 1PW8A 1W8YA 4S2MA 5E2FA 4OQIA 3UPNA 1ESIA 4E6WA 4ZJ3A 2HDRA 3CZDA 4R3JA 4GNUA 3MXSA 1ZG4A 2RCXA 4JPMA 5CECA 2ZQDA 1JWZA 3PBOA 3MBZA 4WEKA 5F83A 3Q07A 4OPRA 3DW0A 5TFQA 4YFMA 3GV9A 3HLEA 2Y91A 1IELA 3IH8A 1MWTA 3S4XA 1XX2A 4N1HA 1WYBA 3CG5A 3LO7A 1LI9A 1HVBA 4OLDA 5DVAA 3HUNA 5FATA 1QMEA 3MXRA 4OVDA 4B4XA 3C5AA 2J8YA 3E2KA 1JTGA 1E3UD 2H0YA 2C6WB 1PIOA 2EX9A 4WZ4A 1K57A 3GMWA 1MPLA 2BLSA 4H8RA 4E3NA 4DKIA 2G2UA 3MZEA 3VSLA 1S6RA 5F1GA 1LLBA 1ZKJA 3OZHA 2WKIA 4OOMA 4OONA 3A3FA 2V20A 2CC1A 2Y2KA 4FH2A 3WS5A 2XR0A 2Y2QA 4OH0A 2HP9A 3UN7A 3N8LA 5E2EA 3LY4A 1TDLA 3UNWA 3M6HA 2J7VA 4QU3A 5HAPA 3VP4A 3ZG0A 2DNSA 3UE0A 1W7FA 2EFXA 2XFSA 5CGSA 2WUQA 2ZC4B 3MZFA 3OPRA 4JF5A 3V50A 1L2SA 3Q7ZA 4MLLA 1KE4A 3P98A 1FCOA 4IVKA 3G35A 4S2OA 5FDHA 4PPRA 4WM9A 4ZJ1A 3UPOA 3HVFA 2G2WA 2V1ZA 2JE5A 4BENA 3IT9A 3VFFA 4KZ6A 3IXDA 1LI0A 2XEPA 4OP5A 5FQ9A 3OCNA 3ZVWA 3VSKA 3IXBA 2HDUA 3MKEA 3M2JA 3LY3A 3LCEA 4KENB 3N7WA 4MEZA 3W8KA 3VMAA 1RGZA 4RX2A 2Y2MA 1FR1A 4QHCA 2RL3A 4N92A 3BFGA 2A49A 4C75A 4GB7A 1S0WA 3VP2A 3V39A 2WYXA 3QNBA 4A5RA 2EX6A 2EXAA 4BL3A 3G34A 3BLSA 1XP4A 2Y2OA 4XUZA 3C7UA 2PU4A 2E8IA 3PBNA 4UA6A 5GHXA 1IYSA 2ZJ9A 3OPLA 4F94A 4E6XA 1Z6FA 1RCJA 2WKHA 5EVIA 2HDQA 2XDMA 4X69A 4N9KA 3TSGA 2P74A 1HD8A 4GOGA 4IBXA 2P9VA 4UA7A 5BOHA 1W5DA 2QMIA 4P85A 4FD8A 2EXBA 5CERA 3BEBA 3DWKA 4KZAA 5CGWA 1FCMA 4B4ZA 5CGXA 2Y2HA 1CK3A 1XXMA 4L0LA 1BUEA 2Y4AA 4Y7PA 5CHUA 1XA7A 4R4SA 3ZVTA 1MBLA 2HDSA 1KE0A 5HARA 1GA0A 3W4PA 1YMXA 3Q7VA 2X71A 3FZCA 4OQ0A 4Q8IA 2DCFA 5FI6A 5G18A 1K4FA 2Z2LB 3HREA 4U3TA 4WMCD 2HPBA 3A3EA 1TDGA 1MWSA 4KQQA 3FYZA 1TEMA 3WWXA 3ZHHA 3C4OA 4E3LA 2WK0A 3VOZA 1WYCA 3ZG5A 5KMWA 1K38A 3BRMA 4OLGA 4OOYA 1JWVA 4LCLA 1I2SA 3G31A 4R23A 5KSCA 1K56D 1LHYA 5TR7A 3N6IA 1BLCA 1K6SA 5DTKA 4M3KA 5EVIC 5A92A 5GLDA 4JF6A 4R0QA 1MXOA 4P0MA 4X53A 3V5MA 1K55A 1RP5A 4KQRA 4O7DA 2WKEA 4QY5A 1BSGA 1N4OA 5EVID 5GLBA 1NYMA 5EECA 2ZM8A 1SCWA 5FQQA 1XPBA 1E25A 3M2KA 3C4PA 3IXGA 5AQ9A 5EVIB 1MWRA 2JBFA 2XH9A 4S2NC 5F82A 4KG2A 3BLMA 4BQMA 4E3KA 1ZG6A 2V2FF 2VGJA 5FI7A 2P9VB 3D4FA 2Y2LA 3Q81A 3RJUA 3EQUA 1YLZA 5A91A 4JBFA 1NXYA 3SS5A 1Y54A 2HP6A 3AGDA 2OLUA 3SOIA 5J8XA 3QHYA 3BFCA 1N9BA 2Y59A 1KDSA 1Q2QA 2FFFB 1M40A 4X56A 2WAEA 4MNRA 1FSYA 2WGIA 3MKFA 1BLHA 1YM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZDX A;  1NZU A;  4GZB A;  3HLD A;  3UDI A;  3UE3 A;  5FAO A;  3IWQ A;  1BTL A;  1H8Z A;  3Q7V B;  3NIA A;  4PM8 A;  4LV0 A;  1YLY A;  4S2K A;  1YLW A;  3UY6 A;  1SKF A;  4LCM A;  4WEJ A;  1BLP A;  1IYO A;  5FQJ A;  4HBU A;  4OPZ A;  1K55 C;  1ES4 A;  2Q9M A;  5GLA A;  4LV1 A;  3AGE A;  4GKU A;  3W4O A;  2X02 A;  1I5Q A;  1BLS A;  2QPN A;  2WAD A;  1NJ4 A;  2JC7 A;  3N8R A;  3PBQ A;  1PW1 A;  3OCL A;  5I94 A;  4B88 A;  2ZC6 B;  1GA9 A;  4GN2 A;  1NRF A;  4ID4 A;  3ZG9 B;  3BFD A;  1ERM A;  1JWP A;  3P09 A;  1SDN A;  5A93 A;  4OP8 A;  2ZD8 A;  1KGE A;  4OPQ A;  3AGF A;  1JTD A;  2XLN A;  3HLB A;  3WS4 A;  3PBR A;  2ZC7 A;  3IHA A;  4PM6 A;  3N4I A;  4RVA A;  4FH4 A;  5DTS A;  4JXV A;  3RXW A;  4QJG A;  2ZQ9 A;  3WRT A;  3EQV A;  2EX8 A;  5AQB A;  4E3O A;  3A3D A;  4WMC A;  4WZ5 A;  3G4P A;  4JLF A;  4U0T A;  5HX9 A;  3BM6 A;  3M6B A;  2OLV A;  4DXC A;  1L0F A;  1PZO A;  4CJN A;  1YMS A;  1SHV A;  3IF5 A;  4XUX A;  1ERO A;  5FQM A;  1K56 A;  1H8Y A;  2H10 A;  2ZMA A;  1W8Q A;  4GD8 A;  4EQI A;  5HFO A;  2IWB A;  1XGJ A;  3Q1F A;  3ZG8 B;  1EWZ A;  1AXB A;  1IKG A;  4RA7 A;  3TOI A;  3GR2 A;  2XD5 A;  1MWU A;  1ES5 A;  2UWX A;  4NET A;  3W4Q A;  2Y2N A;  4QY6 A;  4KQO A;  2J9O A;  1ONH A;  5KZH A;  1WE4 A;  5AQA A;  4UAA A;  1PI5 A;  3IWO A;  2X01 A;  5DTT A;  5FAP A;  2XQZ A;  5AQ7 A;  3BYD A;  2XGN A;  5E43 A;  4FCF A;  1MKI A;  1PI4 A;  3BFE A;  3CJM A;  5M1A A;  4EBP A;  1K54 A;  1ALQ A;  1U60 A;  5CEB A;  1IKI A;  3HUM A;  4S2N A;  4WZ5 C;  3RXX A;  2H5S A;  1VM1 A;  3FV7 A;  3HL9 A;  5IHV A;  5E2G A;  4KZ4 A;  4N9L A;  4HEF A;  5CRF A;  4WBG A;  1G6A A;  2EFU A;  4Y0O A;  4Y0U A;  4ZBE A;  2DRW A;  3A3J A;  3CMZ A;  1L0G A;  4GD6 A;  3VP1 A;  2XK1 A;  4OQG A;  1HTZ A;  5EE8 A;  1H5X A;  1YT4 A;  3HLG A;  4P6B A;  1GCE A;  2H0T A;  1SDE A;  2XF3 A;  2BG1 A;  5HAI A;  2ZQC A;  3BEC A;  3O3V A;  3IF6 C;  1G68 A;  3O86 A;  3HUO A;  3NDE A;  4MBK A;  4WYY A;  5D3O A;  2B5R A;  3A3I A;  4DXB A;  1NY0 A;  1K25 A;  4S2J A;  3QNC A;  1CI8 A;  2Z2M B;  4BJP A;  3GSG A;  3ZCZ A;  3PBT A;  3ZG7 B;  4KG6 A;  3UPP A;  1OME A;  3PAE A;  3S22 A;  4E3M A;  2PU2 A;  4K0W A;  3S1Y A;  4ZJ2 A;  3Q82 A;  1K54 C;  4K0X A;  3GTC A;  3GVB A;  4N1X A;  3G2Y A;  4DDS A;  1KGF A;  4QB8 A;  4XXR A;  2FFY A;  3WS0 A;  1TVF A;  5JYO A;  2OSU A;  2ZM2 A;  3UE1 A;  4KZ3 A;  2WZX A;  1C3B A;  5GHZ A;  2GDN A;  5CXW A;  3NCK A;  4OQH A;  4YIN A;  5DF7 A;  5FA7 A;  2Y2I A;  1CEF A;  2JCH A;  4DRT A;  3ISG A;  4IVI A;  4DE0 A;  3IWI A;  1QMF A;  1IYP A;  4DDY A;  2ZC3 B;  2I72 A;  1ES2 A;  1FSW A;  4R4R A;  5E2H A;  3OPH A;  2QZ6 A;  4C6Y A;  1M6K A;  4FSF A;  3IHB A;  4X55 A;  1DY6 A;  3GRJ A;  1MY8 A;  5TGF A;  5DF9 A;  2Y2P A;  1ZC2 A;  2XD1 A;  4S2L A;  4BLM A;  4DE1 A;  3I7J A;  3PAG A;  4EWF A;  3UO9 A;  4LEN A;  4PMA A;  1BZA A;  5HL1 A;  3ZDJ A;  1J9M A;  1Q2P A;  4X6T A;  1PWD A;  2EX2 A;  3SS3 A;  4E3J A;  3V3S A;  1GHM A;  1YLP A;  1EI5 A;  4DE2 A;  3WS2 A;  1IEM A;  2ZQA A;  3HLF A;  5A90 A;  4GDB A;  2VGK A;  1CEG A;  2ZC5 B;  3G30 A;  4KZB A;  4JXG A;  4S2I A;  1KGG A;  3N8S A;  4OOL A;  2WZZ A;  4EV4 A;  5JYP A;  2C5W B;  4RYE A;  1YLJ A;  1LL5 A;  4LV2 A;  4U0X A;  1DJB A;  1W79 A;  2Y55 A;  5L2F A;  3NI9 A;  4OKP A;  5GLC A;  4EUZ A;  1ESU A;  4UHU A;  5KSH A;  1GHI A;  2Y2G A;  1GHP A;  4JKT A;  1JVJ A;  2WGW A;  5GL9 A;  4X68 A;  1L0E A;  5EVL A;  3GQZ A;  4EBL A;  1YQS A;  5HAQ A;  3FKV A;  5DF8 A;  5F1F A;  1DJC A;  2Q9N A;  3O88 A;  3SS4 A;  1NZO A;  1YLT A;  3VP0 A;  3UDX A;  1ERQ A;  3BFF A;  4S2P A;  1BT5 A;  1PWG A;  2ZLY A;  3E2L A;  3ZGA B;  4Y0T A;  1FOF A;  2HP5 A;  2Y2J A;  5CHM A;  3OC2 A;  3IF6 A;  1K57 C;  5U47 A;  3VP3 A;  4R1G A;  4RX3 A;  2PBY A;  3TG9 A;  3C7V A;  5CTN A;  1K6R A;  4QD4 A;  1PWC A;  5FAQ A;  4ZTK A;  2XFT A;  3DTM A;  3VOY A;  3B3X A;  1KE3 A;  4KG5 A;  1KVM A;  5M18 A;  3SH7 A;  2OV5 A;  4DE3 A;  1CI9 A;  1O7E A;  5FQI A;  3HBR A;  1KDW A;  1XKZ A;  1ES3 A;  3WRZ A;  1O07 A;  4KZ8 A;  3SH8 A;  2IWD A;  4C3Q A;  4IED A;  1XA1 A;  2ZQ8 A;  4JF4 A;  4MBH A;  3SH9 A;  1VQQ A;  5FSR A;  4Z9Q A;  4DF6 A;  4E3I A;  3OPP A;  4BD1 A;  2ZM0 A;  4NK3 A;  5EOO A;  1L0D A;  3MZD A;  5M19 A;  3NY4 A;  2WAF A;  1I2W A;  1K4E A;  2WGW B;  3O87 A;  3PBS A;  4P87 A;  3ZNT A;  3WS1 A;  3HLC A;  4ZAM A;  4OPY A;  5FI2 A;  4D2O A;  4KZ9 A;  2A3U A;  1BUL A;  4BL2 A;  1LL9 A;  3ITA A;  3VFH A;  1ONG A;  3IH9 A;  4EBN A;  1FQG A;  1IYQ A;  4K91 A;  5CED A;  4R3B A;  3DWZ A;  5CHJ A;  2R9W A;  2ZQ7 A;  1KVL A;  3ITB A;  4HBT A;  4JXW A;  3ZFZ A;  1PYY A;  4PM7 A;  3V3R A;  1E3U A;  1HZO A;  3NDG A;  1XGI A;  3ZNY A;  3FKW A;  4PM9 A;  1FR6 A;  3IF6 B;  3NBL A;  1E4D A;  5EUA A;  2WGV A;  3FWL A;  3G2Z A;  5GHY A;  4WEL A;  4MBF A;  3HLW A;  4LV3 A;  4KZ7 A;  3G32 A;  4JXS A;  3JYI A;  2IWC A;  3PTE A;  4BD0 A;  3IQA A;  4UA9 A;  1RGY A;  5FAS A;  3IXH A;  3MFD A;  4PM5 A;  4HES A;  4KZ5 A;  4IBR A;  5EPH A;  5HW3 A;  1NYY A;  1DJA A;  1PZP A;  4CPK A;  2R9X A;  5FQK A;  4GDN A;  1FCN A;  3LEZ A;  5CTM A;  3NC8 A;  3UDF A;  2J9P A;  5EOE A;  1PW8 A;  1W8Y A;  4S2M A;  5E2F A;  4OQI A;  3UPN A;  1ESI A;  4E6W A;  4ZJ3 A;  2HDR A;  3CZD A;  4R3J A;  4GNU A;  3MXS A;  1ZG4 A;  2RCX A;  4JPM A;  5CEC A;  2ZQD A;  1JWZ A;  3PBO A;  3MBZ A;  4WEK A;  5F83 A;  3Q07 A;  4OPR A;  3DW0 A;  5TFQ A;  4YFM A;  3GV9 A;  3HLE A;  2Y91 A;  1IEL A;  3IH8 A;  1MWT A;  3S4X A;  1XX2 A;  4N1H A;  1WYB A;  3CG5 A;  3LO7 A;  1LI9 A;  1HVB A;  4OLD A;  5DVA A;  3HUN A;  5FAT A;  1QME A;  3MXR A;  4OVD A;  4B4X A;  3C5A A;  2J8Y A;  3E2K A;  1JTG A;  1E3U D;  2H0Y A;  2C6W B;  1PIO A;  2EX9 A;  4WZ4 A;  1K57 A;  3GMW A;  1MPL A;  2BLS A;  4H8R A;  4E3N A;  4DKI A;  2G2U A;  3MZE A;  3VSL A;  1S6R A;  5F1G A;  1LLB A;  1ZKJ A;  3OZH A;  2WKI A;  4OOM A;  4OON A;  3A3F A;  2V20 A;  2CC1 A;  2Y2K A;  4FH2 A;  3WS5 A;  2XR0 A;  2Y2Q A;  4OH0 A;  2HP9 A;  3UN7 A;  3N8L A;  5E2E A;  3LY4 A;  1TDL A;  3UNW A;  3M6H A;  2J7V A;  4QU3 A;  5HAP A;  3VP4 A;  3ZG0 A;  2DNS A;  3UE0 A;  1W7F A;  2EFX A;  2XFS A;  5CGS A;  2WUQ A;  2ZC4 B;  3MZF A;  3OPR A;  4JF5 A;  3V50 A;  1L2S A;  3Q7Z A;  4MLL A;  1KE4 A;  3P98 A;  1FCO A;  4IVK A;  3G35 A;  4S2O A;  5FDH A;  4PPR A;  4WM9 A;  4ZJ1 A;  3UPO A;  3HVF A;  2G2W A;  2V1Z A;  2JE5 A;  4BEN A;  3IT9 A;  3VFF A;  4KZ6 A;  3IXD A;  1LI0 A;  2XEP A;  4OP5 A;  5FQ9 A;  3OCN A;  3ZVW A;  3VSK A;  3IXB A;  2HDU A;  3MKE A;  3M2J A;  3LY3 A;  3LCE A;  4KEN B;  3N7W A;  4MEZ A;  3W8K A;  3VMA A;  1RGZ A;  4RX2 A;  2Y2M A;  1FR1 A;  4QHC A;  2RL3 A;  4N92 A;  3BFG A;  2A49 A;  4C75 A;  4GB7 A;  1S0W A;  3VP2 A;  3V39 A;  2WYX A;  3QNB A;  4A5R A;  2EX6 A;  2EXA A;  4BL3 A;  3G34 A;  3BLS A;  1XP4 A;  2Y2O A;  4XUZ A;  3C7U A;  2PU4 A;  2E8I A;  3PBN A;  4UA6 A;  5GHX A;  1IYS A;  2ZJ9 A;  3OPL A;  4F94 A;  4E6X A;  1Z6F A;  1RCJ A;  2WKH A;  5EVI A;  2HDQ A;  2XDM A;  4X69 A;  4N9K A;  3TSG A;  2P74 A;  1HD8 A;  4GOG A;  4IBX A;  2P9V A;  4UA7 A;  5BOH A;  1W5D A;  2QMI A;  4P85 A;  4FD8 A;  2EXB A;  5CER A;  3BEB A;  3DWK A;  4KZA A;  5CGW A;  1FCM A;  4B4Z A;  5CGX A;  2Y2H A;  1CK3 A;  1XXM A;  4L0L A;  1BUE A;  2Y4A A;  4Y7P A;  5CHU A;  1XA7 A;  4R4S A;  3ZVT A;  1MBL A;  2HDS A;  1KE0 A;  5HAR A;  1GA0 A;  3W4P A;  1YMX A;  3Q7V A;  2X71 A;  3FZC A;  4OQ0 A;  4Q8I A;  2DCF A;  5FI6 A;  5G18 A;  1K4F A;  2Z2L B;  3HRE A;  4U3T A;  4WMC D;  2HPB A;  3A3E A;  1TDG A;  1MWS A;  4KQQ A;  3FYZ A;  1TEM A;  3WWX A;  3ZHH A;  3C4O A;  4E3L A;  2WK0 A;  3VOZ A;  1WYC A;  3ZG5 A;  5KMW A;  1K38 A;  3BRM A;  4OLG A;  4OOY A;  1JWV A;  4LCL A;  1I2S A;  3G31 A;  4R23 A;  5KSC A;  1K56 D;  1LHY A;  5TR7 A;  3N6I A;  1BLC A;  1K6S A;  5DTK A;  4M3K A;  5EVI C;  5A92 A;  5GLD A;  4JF6 A;  4R0Q A;  1MXO A;  4P0M A;  4X53 A;  3V5M A;  1K55 A;  1RP5 A;  4KQR A;  4O7D A;  2WKE A;  4QY5 A;  1BSG A;  1N4O A;  5EVI D;  5GLB A;  1NYM A;  5EEC A;  2ZM8 A;  1SCW A;  5FQQ A;  1XPB A;  1E25 A;  3M2K A;  3C4P A;  3IXG A;  5AQ9 A;  5EVI B;  1MWR A;  2JBF A;  2XH9 A;  4S2N C;  5F82 A;  4KG2 A;  3BLM A;  4BQM A;  4E3K A;  1ZG6 A;  2V2F F;  2VGJ A;  5FI7 A;  2P9V B;  3D4F A;  2Y2L A;  3Q81 A;  3RJU A;  3EQU A;  1YLZ A;  5A91 A;  4JBF A;  1NXY A;  3SS5 A;  1Y54 A;  2HP6 A;  3AGD A;  2OLU A;  3SOI A;  5J8X A;  3QHY A;  3BFC A;  1N9B A;  2Y59 A;  1KDS A;  1Q2Q A;  2FFF B;  1M40 A;  4X56 A;  2WAE A;  4MNR A;  1FSY A;  2WGI A;  3MKF A;  1BLH A;  1YM1 A; 
#chains in the Genus database with same CATH topology
 3MF0 A;  1S4R A;  3UE3 A;  4BBU A;  5FAO A;  3IWQ A;  1H8Z A;  1V9Z A;  4WEJ A;  5FQJ A;  1F98 A;  1K0K A;  1T1A A;  5GLA A;  3F1P A;  1BLS A;  2QPN A;  2WAD A;  3DAV A;  2JC7 A;  3N8R A;  3OCL A;  5I94 A;  3BQ8 A;  1JWP A;  1TD5 A;  5EM0 A;  5J4E A;  3P09 A;  4OP8 A;  2MJ6 A;  4B9O A;  4P6Z S;  4QJG A;  1NWZ A;  2ZQ9 A;  3EQV A;  5AQB A;  3ZQ5 A;  4WZ5 A;  4GHI A;  1SHV A;  3LIF A;  2ZMA A;  1W8Q A;  4WL9 A;  1XGJ A;  4LRX C;  4L9G A;  3G6O A;  5AVF A;  3ZG8 B;  4DMZ A;  2P7J A;  4RA7 A;  4EXO A;  1T1B A;  4KQO A;  2J9O A;  1ONH A;  2BTF P;  5FAP A;  4EEP A;  5AQ7 A;  1S67 L;  1K54 A;  1YKD A;  3HUM A;  4S2N A;  4PHT A;  2H5S A;  2Z6C A;  4KZ4 A;  1GSV A;  2FH5 A;  1G6A A;  4WBG A;  5EE8 A;  4B93 A;  1GCE A;  2XF3 A;  2ZQC A;  3JPU A;  3CIT A;  1G68 A;  3K2N A;  4WYY A;  5D3O A;  4M4X A;  3LUQ A;  4S2J A;  1XJ6 A;  1DP9 A;  4BJP A;  3ZCZ A;  3PBT A;  4KG6 A;  1BYW A;  4N1X A;  4QB8 A;  4XXR A;  5JYO A;  2WZX A;  1C3B A;  3UB6 A;  2LB5 A;  2HJE A;  3B42 A;  1QMF A;  2M1C A;  1ES2 A;  4BMW A;  2QZ6 A;  2ZL1 B;  1MY8 A;  4CQH A;  3MQQ A;  1ZC2 A;  2XA7 M;  4EWF A;  2PYP A;  1Q2P A;  4X6T A;  2J3T C;  4P6Z M;  4E04 A;  1IEM A;  3HLF A;  1OPX A;  3G30 A;  3ULF A;  2J3T D;  4Q0I A;  2A2L A;  2C5W B;  1LL5 A;  3TW8 A;  2Y55 A;  5L2F A;  3CHW P;  3PR6 A;  4JKT A;  5CX7 A;  1L0E A;  3MJQ A;  5HAQ A;  5DF8 A;  5F1F A;  3O88 A;  3SS4 A;  1NZO A;  3VP0 A;  3FG8 A;  4IJG A;  4Y0T A;  2Y2J A;  3C2W A;  1L3L A;  3OC2 A;  3VP3 A;  3VE4 A;  4QD4 A;  4HP4 A;  1KE3 A;  2GX5 A;  3OLO A;  5IT5 A;  1KDW A;  3D9Y A;  3LYX A;  2O0Y A;  3BY9 A;  4DF6 A;  3OPP A;  2NUP C;  1L0D A;  4BBT A;  2WGW B;  3HLC A;  5FI2 A;  4D2O A;  3IX4 A;  3VV4 A;  1BUL A;  3ITA A;  2Y79 A;  4K91 A;  1IYQ A;  3DWZ A;  3ITB A;  2ZOI A;  5EM1 A;  2V0U A;  2VGL S;  3NDG A;  1XGI A;  3IF6 B;  3NBL A;  2WGV A;  3FWL A;  2W3E A;  3T12 B;  5FEF A;  4WEL A;  4MBF A;  3HJK A;  3PTE A;  4X1L A;  3S7N A;  1VEU A;  4UA9 A;  3MFD A;  1P9R A;  3H82 A;  5EPH A;  4KZ5 A;  1NYY A;  2G7U A;  3MMH A;  3NHQ A;  1YPR A;  4HJ3 A;  4GDN A;  2K31 A;  4NEE D;  3F1N B;  3MQ0 A;  5F83 A;  3Q07 A;  4YFM A;  3IH8 A;  1IEL A;  3S4X A;  1XX2 A;  4N1H A;  1WYB A;  3LO7 A;  1LI9 A;  5FAT A;  3MXR A;  4OVD A;  4HH2 A;  4B4X A;  2J8Y A;  2H0Y A;  2C6W B;  1PIO A;  1K57 A;  2BLS A;  4H8R A;  4DKI A;  2W3D A;  4JGO A;  1ZKJ A;  4OOM A;  3NJA A;  4ARZ B;  4FH2 A;  2CC1 A;  2Y2K A;  3N8L A;  1TDL A;  4PAU A;  3VP4 A;  3ZG0 A;  2DNS A;  3UE0 A;  3V50 A;  4JF5 A;  3Q7Z A;  4MLL A;  4F3L B;  4HJ6 A;  4S2O A;  3IS2 A;  2JE5 A;  3IT9 A;  2QYB A;  4QWO A;  3VFF A;  1LI0 A;  4KUO A;  2WKQ A;  4CLC A;  3PYP A;  2AVX A;  3CPT B;  3LY3 A;  3W8K A;  3N7W A;  1FR1 A;  3V39 A;  4A5R A;  2EXA A;  2ZOH A;  4BL3 A;  4HIA A;  3BLS A;  1T1C A;  4XUZ A;  2PU4 A;  5GHX A;  4F94 A;  4E6X A;  1RCJ A;  4IHQ A;  2XDM A;  2OAP 1;  1HD8 A;  4L9E A;  4UA7 A;  4H6J A;  2QMI A;  2Y8H A;  4FD8 A;  4MN5 A;  4B4Z A;  1FCM A;  4FTX A;  5CGX A;  4L0L A;  4Y7P A;  3T4K A;  3QP2 A;  4R4S A;  2PBD P;  5HAR A;  2X71 A;  4GS9 A;  4OQ0 A;  4YWZ A;  5FI6 A;  1K4F A;  3C38 A;  2HPB A;  4KQQ A;  3IX8 A;  1WYC A;  3G31 A;  1BLC A;  1CJF A;  4R0Q A;  1YAX A;  1BSG A;  3IBJ A;  5GLB A;  1XPB A;  4NG2 A;  4S2N C;  4E3K A;  4BQM A;  1ZG6 A;  3D4F A;  3BW6 A;  3RJU A;  2Z6D A;  4JBF A;  1Z09 A;  1NXY A;  3SS5 A;  3AGD A;  2OLU A;  3QHY A;  2B95 A;  2Y59 A;  1FSY A;  3MKF A;  1BLH A;  4ZDX A;  1NZU A;  4GZB A;  1BTL A;  1VET B;  3UY6 A;  1CF0 A;  3E4Q A;  4OPZ A;  1OTE A;  1K55 C;  4LV1 A;  4GKU A;  3RFB A;  1I5Q A;  5FL3 A;  3QP6 A;  1NJ4 A;  3PBQ A;  1S1Z A;  2ZMV A;  3PXP A;  2XRO A;  3T4S A;  1GA9 A;  3ZG9 B;  4ME4 A;  4EET B;  2O9A A;  4Y15 A;  2ZD8 A;  4OPQ A;  4Y5F A;  3PBR A;  3DTE A;  5HDS A;  5DTS A;  3RXW A;  2KLI A;  2XRN A;  4E3O A;  4EER A;  3A0S A;  1S1Y A;  3G4P A;  3T4T A;  2OLV A;  4CJN A;  1H8M A;  5FQM A;  1ERO A;  1FIK A;  1K56 A;  2YKH A;  4LPZ A;  4EQI A;  1KOU A;  5HFO A;  2IWB A;  3Q1F A;  3CLO A;  1MWU A;  3W4Q A;  1F5M A;  5KZH A;  2JKR M;  2R78 A;  3LR4 A;  1XFN A;  3IWO A;  4UAA A;  2XQZ A;  5HWT A;  3P7N A;  4FCF A;  3BFE A;  4EBP A;  5CEB A;  5L8M A;  4R3A A;  3KYE A;  2HZ5 A;  5J7E A;  3HL9 A;  2PD8 A;  5IHV A;  2ZL1 A;  5E2G A;  4HEF A;  5CRF A;  2VK3 A;  2EFU A;  3E98 A;  4Y0U A;  5HD3 A;  4I3A A;  2D01 A;  3A3J A;  3VP1 A;  4GLQ A;  2XK1 A;  3EOI A;  1YT4 A;  5EVE A;  1SDE A;  1TF1 A;  5HAI A;  3S7O A;  3BEC A;  5L10 A;  1Y28 A;  3O3V A;  3E0Y A;  3O86 A;  3HUO A;  1K25 A;  3VE3 A;  4AFI A;  3FPW A;  1WA9 A;  2PU2 A;  2V9A A;  4ZJ2 A;  3GVB A;  3G2Y A;  1J3W A;  2FFY A;  1TVF A;  3LEQ A;  2ZM2 A;  3UE1 A;  5GHZ A;  2GDN A;  4YIN A;  5DF7 A;  2Y2I A;  4MN7 A;  3UB7 A;  2PDR A;  4DRT A;  4NXF A;  3L7H A;  4HNB A;  1M6K A;  4X55 A;  4GS9 B;  3GRJ A;  5DF9 A;  4EQ1 A;  4I3I A;  2XD1 A;  1VB6 A;  4BLM A;  2I9V A;  3I7J A;  3PAG A;  3TE8 A;  4LEN A;  4PMA A;  2GZA A;  2BAS A;  1PWD A;  2EX2 A;  3SS3 A;  3V3S A;  1GHM A;  1FIL A;  1YLP A;  3GDI A;  1EI5 A;  4DE2 A;  3WS2 A;  3T4O A;  4II7 A;  2JN7 A;  4S2I A;  4RQ9 A;  2WZZ A;  5JYP A;  1LSX A;  1YLJ A;  3BY8 A;  3P01 A;  3NI9 A;  5GLC A;  4UHU A;  1GHI A;  4UQI M;  2WGW A;  3LIB A;  3L9K A;  5F68 A;  4X68 A;  4EBL A;  3T1Q B;  4HOI A;  3FKV A;  1Y4O A;  4ETX A;  1DJC A;  4MCW A;  1PWG A;  2ZLY A;  3E2L A;  3ZGA B;  2J80 A;  1FOF A;  5EV0 A;  3IF6 A;  1K57 C;  2CMN A;  5L07 A;  4UEY A;  4Y2F A;  1IFQ A;  1PWC A;  4ZTK A;  2XSS A;  3DTM A;  3B3X A;  2OOL A;  1O7E A;  5FQI A;  3HBR A;  1XKZ A;  1ES3 A;  3WRZ A;  4C3Q A;  1XA1 A;  3EWK A;  4PKY A;  5FSR A;  4Z9Q A;  3F1N A;  3HJI A;  4LRZ E;  3VOL A;  4NK3 A;  3NY4 A;  1I2W A;  4P87 A;  3ZNT A;  1V9Y A;  4OPY A;  2A3U A;  4BL2 A;  3VFH A;  3IH9 A;  4CLC C;  5CED A;  3SW1 A;  1KVL A;  4JXW A;  3ZFZ A;  1UWP X;  4PM7 A;  4CLC D;  4PM9 A;  1FR6 A;  3NEC A;  1E4D A;  3D3O A;  3H7W B;  2KX6 A;  4ARZ A;  1IOU A;  2JKT M;  3UB9 A;  4LV3 A;  4KZ7 A;  1N9N A;  2IWC A;  4BD0 A;  1N9L A;  4O01 A;  1RGY A;  3IXH A;  4PM5 A;  4HES A;  5HW3 A;  2EWW A;  1DJA A;  1PZP A;  4F3L A;  5FQK A;  3LEZ A;  3UDF A;  1W8Y A;  5E2F A;  3UPN A;  1ESI A;  1OJG A;  2EA9 A;  4FUW A;  3MSH A;  4DJ3 A;  3MXS A;  2RCX A;  2PR5 A;  3GV9 A;  3CPT A;  2Y91 A;  2B18 A;  1MWT A;  5DVA A;  3HUN A;  2OAQ 1;  2QJ7 A;  1E3U D;  5MC7 A;  3GMW A;  3CUE A;  2PRF A;  3OZH A;  4R6L A;  2XR0 A;  2HP9 A;  1D06 A;  3M6H A;  3T4Q A;  1JNU A;  1W7F A;  5CGS A;  2W0N A;  3MZF A;  3OPR A;  1L2S A;  1DP8 A;  3G35 A;  5FDH A;  4PPR A;  4HHD A;  4G3V A;  4BEN A;  4IUK A;  3IXD A;  5LBR A;  3ZVW A;  3VSK A;  3K3C A;  4MEZ A;  4RX2 A;  2Y2M A;  4QHC A;  3BFG A;  3O5Y A;  1XJ2 A;  4GB7 A;  3VP2 A;  2WYX A;  3QNB A;  2EX6 A;  4R38 A;  1OTI A;  4NXE A;  2E8I A;  2PD7 A;  2ZJ9 A;  4X1M A;  2W3G A;  2HDQ A;  4Q0J A;  2P74 A;  3LR0 A;  3FPV A;  3T1R A;  4IBX A;  3RH8 B;  4P85 A;  2ZMF A;  1XXM A;  3LI8 A;  2Y4A A;  1PNE A;  1F2K A;  1XA7 A;  3ZVT A;  4I39 A;  1KE0 A;  3W4P A;  4XT2 B;  1VET A;  3S7Q A;  4KUK A;  3FYZ A;  1TEM A;  3WWX A;  4E3L A;  2WK0 A;  3VOZ A;  5KMW A;  1K38 A;  3BRM A;  5KSC A;  4R23 A;  2FZ0 A;  1K56 D;  1PRQ A;  4M3K A;  5EVI C;  2A24 B;  2L0W A;  5IS1 A;  4JF6 A;  1MXO A;  1XJ3 A;  5HPI A;  3V5M A;  4KQR A;  1GSW A;  3UB5 P;  5EVI D;  1NYM A;  1SCW A;  2O9C A;  3KYZ A;  1MWR A;  2OWH A;  2VGJ A;  5HPF A;  2P9V B;  3Q81 A;  1Y54 A;  2HP6 A;  3CAX A;  1D7E A;  3SOI A;  2ACG A;  1Q2Q A;  3F1O B;  1YM1 A;  3UDI A;  5TJJ A;  4LV0 A;  1YLY A;  1SKF A;  2VLG A;  4LCM A;  1IYO A;  1ES4 A;  5C5K A;  4LFU A;  3W4O A;  5HWV A;  3T4L A;  1PW1 A;  1LL8 A;  4GN2 A;  1NRF A;  3BFD A;  3T1S A;  1SZV A;  1ERM A;  3LIA A;  2YKF A;  5A93 A;  1W63 M;  4DJ2 A;  3AGF A;  1JTD A;  2XLN A;  4YNR A;  4EUV A;  3MS6 A;  4PM6 A;  3UMD A;  2DMW A;  3BJN A;  2EX8 A;  3A3D A;  4WMC A;  4JLF A;  3BM6 A;  3M6B A;  1NLY A;  4DXC A;  1L0F A;  2KDK A;  2QKP A;  2H10 A;  4GD8 A;  2WKR A;  3IBR A;  5TBM B;  1AXB A;  3GR2 A;  2XD5 A;  2IA2 A;  1YSQ A;  2JHE A;  1NRJ A;  3PHY A;  1PI5 A;  2VGL M;  2PAV P;  4HI4 A;  2PT7 A;  1LSW A;  5E43 A;  1MKI A;  1PI4 A;  3T1X A;  1U60 A;  3RXX A;  4WZ5 C;  4N9L A;  2H28 A;  1G5U A;  4ZBE A;  1L0G A;  3CMZ A;  4Y17 A;  1HTZ A;  1H5X A;  1UGU A;  2P08 A;  3HLG A;  2H0T A;  2BG1 A;  5HL6 A;  3IF6 C;  4MBK A;  1STZ A;  2B5R A;  3TRC A;  3T4J A;  3QNC A;  1TS8 A;  3TJZ C;  3GSG A;  2PHY A;  3C8C A;  2L4R A;  1DP6 A;  1MZU A;  1OME A;  3PAE A;  3S22 A;  4K0W A;  3S1Y A;  4HQA A;  4JGQ A;  1K54 C;  4NKP A;  3GTC A;  4DDS A;  3WS0 A;  5CXW A;  3NCK A;  4OQH A;  5FA7 A;  2JCH A;  2V0W A;  3E4O A;  4DE0 A;  4DDY A;  3KSI A;  2ZC3 B;  4R4R A;  3OPH A;  4FSF A;  4I38 A;  5TGF A;  2W1R A;  4Y3I A;  4DE1 A;  1P0Z A;  3UO9 A;  1BZA A;  2JKG A;  2VX8 A;  3ZDJ A;  1J9M A;  1F9I A;  4E3J A;  2UV0 E;  1SKO B;  5A90 A;  4GDB A;  1TS7 A;  4KZB A;  4O0P A;  4KQD A;  3U2A A;  3MQO A;  4U0X A;  4LV2 A;  3K3D A;  1DJB A;  1W79 A;  4PKY G;  4OKP A;  2QJ5 A;  1ESU A;  1JVJ A;  2L1M A;  1YSP A;  1G28 A;  1YQS A;  2Q9N A;  5G4Z A;  4S2P A;  2NUT C;  1BT5 A;  1XJ4 A;  4LRY C;  1OTB A;  5U47 A;  1MKM A;  3SZT A;  3H7W A;  3UME A;  3EEA A;  4I3J A;  5DJU A;  2W1T B;  3C7V A;  1K6R A;  5FAQ A;  2XFT A;  5AVE A;  3SH7 A;  4GCZ A;  4DE3 A;  1CI9 A;  3SH8 A;  4KZ8 A;  4IED A;  3LI9 A;  2HJ9 C;  2ZQ8 A;  4BD1 A;  4ESP A;  5EOO A;  3MZD A;  3R7W B;  3WS1 A;  4ZAM A;  4KZ9 A;  1LL9 A;  1ONG A;  4EBN A;  1FQG A;  5F6A A;  3E4P A;  5CHJ A;  2R9W A;  4HBT A;  5FEG A;  1PYY A;  1HZO A;  3QP5 A;  4WLA A;  2JKF A;  3RTY A;  5EUA A;  1ZHH B;  5J3W A;  3G2Z A;  5GHY A;  3HLW A;  4JXS A;  3JYI A;  3IQA A;  1H3Q A;  3BWL A;  4IBR A;  4CPK A;  1FCN A;  3NC8 A;  4MN6 A;  2J9P A;  3LR3 A;  4S2M A;  4OQI A;  4E6W A;  1AWI A;  2HDR A;  3CZD A;  3NOP C;  4GNU A;  4JPM A;  5CEC A;  2ZQD A;  3PBO A;  3MBZ A;  4WEK A;  5TFQ A;  3HLE A;  4OLD A;  1QME A;  3E2K A;  2VJW A;  1W63 Q;  4G3W A;  3VSL A;  1S6R A;  5F1G A;  4OON A;  2V20 A;  3LY4 A;  3UNW A;  2J7V A;  4QU3 A;  3ZYT A;  5HAP A;  3LFV A;  2XA7 S;  1EW0 A;  1P9W A;  3P98 A;  4IVK A;  2Q0O A;  2K7S A;  4NXB A;  4WM9 A;  3BQA A;  4ZJ1 A;  3HVF A;  4X25 A;  4XT2 A;  2INW A;  4Z1W A;  5HDD A;  2E8J A;  2V8C A;  2XEP A;  4OP5 A;  5FQ9 A;  3IXB A;  3MKE A;  3S7P A;  2WKP A;  4ETZ A;  4GW9 A;  3JVV A;  4HH3 A;  2A24 A;  2RL3 A;  2A49 A;  3DBA A;  1S0W A;  3G34 A;  3LID A;  2Y2O A;  3C7U A;  4UA6 A;  4GJ4 A;  1IYS A;  3OPL A;  3EGX C;  1Z6F A;  4N9K A;  4FOF A;  3TSG A;  5F69 A;  4GOG A;  4G3K A;  2P9V A;  5BOH A;  2W27 A;  5CER A;  2EXB A;  3V67 A;  3BEB A;  3KX0 X;  4KZA A;  5CGW A;  3NOT C;  1CK3 A;  3F1O A;  4HJ4 A;  5K5B A;  4Q8I A;  2Z2L B;  4U3T A;  4WMC D;  2V1A A;  4LGW A;  1MWS A;  4O8G A;  1OTA A;  3ZG5 A;  4OLG A;  4OOY A;  1JWV A;  5DJT A;  4LCL A;  1I2S A;  5TR7 A;  5DTK A;  5A92 A;  1ZTU A;  4QPR A;  1ACF A;  1GSX A;  4X53 A;  4ZRR A;  1K55 A;  4O7D A;  2WKE A;  5A8B A;  1N4O A;  5EEC A;  5FQQ A;  2ZM8 A;  1E25 A;  3C4P A;  5EVI B;  1DRM A;  2P04 A;  5F82 A;  4KG2 A;  3BLM A;  5FI7 A;  3EQU A;  1VHM A;  5DKK A;  5AJG A;  3QP1 A;  5J8X A;  1N9B A;  2FFF B;  1M40 A;  3KSF A;  2WGI A;  2JKR I;  3HLD A;  4PM8 A;  3Q7V B;  3NIA A;  5TBM A;  3T50 A;  4S2K A;  1YLW A;  1BLP A;  2O9B A;  3LR5 A;  4HBU A;  2Q9M A;  2W3F A;  3AGE A;  2X02 A;  3CI6 A;  2GJ3 A;  3ICY A;  4B88 A;  4EU0 A;  2ZC6 B;  4ID4 A;  1SDN A;  1KGE A;  1LT0 A;  3HLB A;  3WS4 A;  2ZC7 A;  3IHA A;  3NUL A;  3N4I A;  4RVA A;  4FH4 A;  4JXV A;  3WRT A;  1S66 L;  5L09 A;  4U0T A;  5HX9 A;  1P97 A;  1PZO A;  1YMS A;  3IF5 A;  4XUX A;  1H8Y A;  1EWZ A;  1IKG A;  3UB8 A;  3TOI A;  2UWX A;  1ES5 A;  1UWN X;  4NET A;  2Y2N A;  4QY6 A;  1CQA A;  2J3W A;  3DTK A;  5DFY A;  5IU1 A;  2W3H A;  3F1P B;  1PFL A;  1WE4 A;  5AQA A;  2ZBB A;  2X01 A;  5DTT A;  4CLC E;  3BYD A;  2PYR A;  2XGN A;  4EW7 A;  3CJM A;  2KOI A;  5M1A A;  1ALQ A;  2VKS A;  1IKI A;  1VM1 A;  4LLO B;  3FV7 A;  2HV1 A;  2VZW A;  4Y0O A;  2DRW A;  4JGP A;  4GD6 A;  4OQG A;  5KIZ A;  4P6B A;  3W2Z A;  2M7U A;  4GHI B;  1SKO A;  3NDE A;  3A3I A;  4DXB A;  1NY0 A;  1S4S A;  1CI8 A;  2Z2M B;  1XFQ A;  3ZG7 B;  3UPP A;  4E3M A;  5HZH A;  3QP8 A;  2VV7 A;  3Q82 A;  1MC0 A;  2K2N A;  4YOF A;  4K0X A;  2PR6 A;  1KGF A;  5HDC A;  2OSU A;  4KZ3 A;  4D60 A;  5EFW A;  1CEF A;  2B02 A;  3ISG A;  4IVI A;  3IWI A;  1IYP A;  2I72 A;  4MDZ A;  1FSW A;  1OT6 A;  3MFX A;  3LIE A;  5E2H A;  4C6Y A;  1X0O A;  3IHB A;  1DY6 A;  4NXG A;  1HLU P;  3B33 A;  2Y2P A;  1N9O A;  4S2L A;  4WN5 A;  2QHK A;  2QWS A;  1OTD A;  4HY8 A;  5HL1 A;  2W1T A;  3KSG A;  5DKL A;  2ZQA A;  4DN0 A;  2VGK A;  1CEG A;  2ZC5 B;  4JXG A;  1KGG A;  3N8S A;  4OOL A;  4EV4 A;  4RYE A;  4BBV A;  1H0M A;  1TS0 A;  4EUZ A;  3R7W A;  5KSH A;  2Y2G A;  1GHP A;  3U4L P;  5GL9 A;  5EVL A;  3GQZ A;  3OOV A;  1YLT A;  3UDX A;  1ERQ A;  5HSQ A;  2JKT I;  3BFF A;  5FDS A;  2HP5 A;  5CHM A;  3GEC A;  4R1G A;  4RX3 A;  2PBY A;  3TG9 A;  2O99 A;  1G6O A;  5CTN A;  3VOY A;  4KG5 A;  1KVM A;  5M18 A;  2VA0 A;  2OV5 A;  3KYQ A;  4R70 A;  4HP9 A;  1O07 A;  2IWD A;  3SH9 A;  4JF4 A;  4MBH A;  4E3I A;  1VQQ A;  1T18 A;  2ZM0 A;  3NOU C;  5M19 A;  2WAF A;  1K4E A;  4K08 A;  2VV6 A;  3O87 A;  3PBS A;  3C30 A;  4R3B A;  2ZQ7 A;  3OBF A;  4L9F A;  3V3R A;  1E3U A;  3ZNY A;  3FKW A;  4Q0H A;  3LGO A;  2HF6 A;  5HWW A;  3G32 A;  3KO6 A;  5FAS A;  3EGD C;  3A0V A;  1TS6 A;  2R9X A;  2VV8 A;  5DFX A;  5G4Y A;  2V1B A;  3MXQ A;  5CTM A;  5EOE A;  4IUH A;  1PW8 A;  3JVU A;  1D1J A;  4ZJ3 A;  4R3J A;  1ZG4 A;  4JGR A;  3UE6 A;  1JWZ A;  4OPR A;  2EWV A;  3DW0 A;  3CG5 A;  1HVB A;  3C5A A;  1JTG A;  4WZ4 A;  2EX9 A;  4MMN A;  1MPL A;  4E3N A;  2G2U A;  1A0K A;  3MZE A;  1LLB A;  3H9W A;  2LB9 A;  2WKI A;  2V8F A;  3A3F A;  3WS5 A;  2Y2Q A;  4OH0 A;  3UN7 A;  5E2E A;  3FC7 A;  2EFX A;  2XFS A;  1VEU B;  3A0R A;  3B47 A;  3LIC A;  2WUQ A;  3H82 B;  2HGV A;  4WUJ A;  2ZC4 B;  1KE4 A;  1FCO A;  1OJ5 A;  3UPO A;  2G2W A;  2V1Z A;  1LSV A;  5HD5 A;  2OWJ A;  4KZ6 A;  3CUE C;  3OCN A;  2HDU A;  3M2J A;  4KEN B;  3LCE A;  3VMA A;  1RGZ A;  2GNX A;  3R4K A;  3IX3 A;  1ODV A;  3HCY A;  4N92 A;  2M7V A;  4C75 A;  1XP4 A;  3DTI A;  4UQI S;  3PBN A;  3QP4 A;  2WKH A;  3CWF A;  5EVI A;  4X69 A;  1W5D A;  3DWK A;  2Y2H A;  1BUE A;  4WF0 A;  1MBL A;  2HDS A;  3IS2 B;  3MR0 A;  1GA0 A;  1YMX A;  3Q7V A;  3FZC A;  3KSH A;  3D72 A;  2DCF A;  5G18 A;  3HRE A;  4I5S A;  3A3E A;  1TDG A;  3ZHH A;  3C4O A;  4CLC B;  1OT9 A;  2VEA A;  1LHY A;  3N6I A;  1K6S A;  5GLD A;  5F5Y A;  2D02 A;  4P0M A;  1T19 A;  1RP5 A;  4QY5 A;  4EEU A;  3EEH A;  3M2K A;  3IXG A;  5AQ9 A;  4BWI A;  2JBF A;  2XH9 A;  5I5L A;  2V2F F;  1NLZ A;  2Y2L A;  4H6J B;  1YLZ A;  5A91 A;  4Y13 A;  4EES A;  3BFC A;  1KDS A;  4X56 A;  2WAE A;  4MNR A;  5CHU A; 
#chains in the Genus database with same CATH homology
 4ZDX A;  1NZU A;  4GZB A;  3HLD A;  3UDI A;  3UE3 A;  5FAO A;  3IWQ A;  1BTL A;  1H8Z A;  3Q7V B;  3NIA A;  4PM8 A;  4LV0 A;  1YLY A;  4S2K A;  1YLW A;  3UY6 A;  1SKF A;  4LCM A;  4WEJ A;  1BLP A;  1IYO A;  5FQJ A;  4HBU A;  4OPZ A;  1K55 C;  1ES4 A;  2Q9M A;  5GLA A;  4LV1 A;  3AGE A;  4GKU A;  3W4O A;  2X02 A;  1I5Q A;  1BLS A;  2QPN A;  2WAD A;  1NJ4 A;  2JC7 A;  3N8R A;  3PBQ A;  1PW1 A;  3OCL A;  5I94 A;  4B88 A;  2ZC6 B;  1GA9 A;  4GN2 A;  1NRF A;  4ID4 A;  3ZG9 B;  3BFD A;  1ERM A;  1JWP A;  3P09 A;  1SDN A;  5A93 A;  4OP8 A;  2ZD8 A;  1KGE A;  4OPQ A;  3AGF A;  1JTD A;  2XLN A;  3HLB A;  3WS4 A;  3PBR A;  2ZC7 A;  3IHA A;  4PM6 A;  3N4I A;  4RVA A;  4FH4 A;  5DTS A;  4JXV A;  3RXW A;  4QJG A;  2ZQ9 A;  3WRT A;  3EQV A;  2EX8 A;  5AQB A;  4E3O A;  3A3D A;  4WMC A;  4WZ5 A;  3G4P A;  4JLF A;  4U0T A;  5HX9 A;  3BM6 A;  3M6B A;  2OLV A;  4DXC A;  1L0F A;  1PZO A;  4CJN A;  1YMS A;  1SHV A;  3IF5 A;  4XUX A;  1ERO A;  5FQM A;  1K56 A;  1H8Y A;  2H10 A;  2ZMA A;  1W8Q A;  4GD8 A;  4EQI A;  5HFO A;  2IWB A;  1XGJ A;  3Q1F A;  3ZG8 B;  1EWZ A;  1AXB A;  1IKG A;  4RA7 A;  3TOI A;  3GR2 A;  2XD5 A;  1MWU A;  1ES5 A;  2UWX A;  4NET A;  3W4Q A;  2Y2N A;  4QY6 A;  4KQO A;  2J9O A;  1ONH A;  5KZH A;  1WE4 A;  5AQA A;  4UAA A;  1PI5 A;  3IWO A;  2X01 A;  5DTT A;  5FAP A;  2XQZ A;  5AQ7 A;  3BYD A;  2XGN A;  5E43 A;  4FCF A;  1MKI A;  1PI4 A;  3BFE A;  3CJM A;  5M1A A;  4EBP A;  1K54 A;  1ALQ A;  1U60 A;  5CEB A;  1IKI A;  3HUM A;  4S2N A;  4WZ5 C;  3RXX A;  2H5S A;  1VM1 A;  3FV7 A;  3HL9 A;  5IHV A;  5E2G A;  4KZ4 A;  4N9L A;  4HEF A;  5CRF A;  4WBG A;  1G6A A;  2EFU A;  4Y0O A;  4Y0U A;  4ZBE A;  2DRW A;  3A3J A;  3CMZ A;  1L0G A;  4GD6 A;  3VP1 A;  2XK1 A;  4OQG A;  1HTZ A;  5EE8 A;  1H5X A;  1YT4 A;  3HLG A;  4P6B A;  1GCE A;  2H0T A;  1SDE A;  2XF3 A;  2BG1 A;  5HAI A;  2ZQC A;  3BEC A;  3O3V A;  3IF6 C;  1G68 A;  3O86 A;  3HUO A;  3NDE A;  4MBK A;  4WYY A;  5D3O A;  2B5R A;  3A3I A;  4DXB A;  1NY0 A;  1K25 A;  4S2J A;  3QNC A;  1CI8 A;  2Z2M B;  4BJP A;  3GSG A;  3ZCZ A;  3PBT A;  3ZG7 B;  4KG6 A;  3UPP A;  1OME A;  3PAE A;  3S22 A;  4E3M A;  2PU2 A;  4K0W A;  3S1Y A;  4ZJ2 A;  3Q82 A;  1K54 C;  4K0X A;  3GTC A;  3GVB A;  4N1X A;  3G2Y A;  4DDS A;  1KGF A;  4QB8 A;  4XXR A;  2FFY A;  3WS0 A;  1TVF A;  5JYO A;  2OSU A;  2ZM2 A;  3UE1 A;  4KZ3 A;  2WZX A;  1C3B A;  5GHZ A;  2GDN A;  5CXW A;  3NCK A;  4OQH A;  4YIN A;  5DF7 A;  5FA7 A;  2Y2I A;  1CEF A;  2JCH A;  4DRT A;  3ISG A;  4IVI A;  4DE0 A;  3IWI A;  1QMF A;  1IYP A;  4DDY A;  2ZC3 B;  2I72 A;  1ES2 A;  1FSW A;  4R4R A;  5E2H A;  3OPH A;  2QZ6 A;  4C6Y A;  1M6K A;  4FSF A;  3IHB A;  4X55 A;  1DY6 A;  3GRJ A;  1MY8 A;  5TGF A;  5DF9 A;  2Y2P A;  1ZC2 A;  2XD1 A;  4S2L A;  4BLM A;  4DE1 A;  3I7J A;  3PAG A;  4EWF A;  3UO9 A;  4LEN A;  4PMA A;  1BZA A;  5HL1 A;  3ZDJ A;  1J9M A;  1Q2P A;  4X6T A;  1PWD A;  2EX2 A;  3SS3 A;  4E3J A;  3V3S A;  1GHM A;  1YLP A;  1EI5 A;  4DE2 A;  3WS2 A;  1IEM A;  2ZQA A;  3HLF A;  5A90 A;  4GDB A;  2VGK A;  1CEG A;  2ZC5 B;  3G30 A;  4KZB A;  4JXG A;  4S2I A;  1KGG A;  3N8S A;  4OOL A;  2WZZ A;  4EV4 A;  5JYP A;  2C5W B;  4RYE A;  1YLJ A;  1LL5 A;  4LV2 A;  4U0X A;  1DJB A;  1W79 A;  2Y55 A;  5L2F A;  3NI9 A;  4OKP A;  5GLC A;  4EUZ A;  1ESU A;  4UHU A;  5KSH A;  1GHI A;  2Y2G A;  1GHP A;  4JKT A;  1JVJ A;  2WGW A;  5GL9 A;  4X68 A;  1L0E A;  5EVL A;  3GQZ A;  4EBL A;  1YQS A;  5HAQ A;  3FKV A;  5DF8 A;  5F1F A;  1DJC A;  2Q9N A;  3O88 A;  3SS4 A;  1NZO A;  1YLT A;  3VP0 A;  3UDX A;  1ERQ A;  3BFF A;  4S2P A;  1BT5 A;  1PWG A;  2ZLY A;  3E2L A;  3ZGA B;  4Y0T A;  1FOF A;  2HP5 A;  2Y2J A;  5CHM A;  3OC2 A;  3IF6 A;  1K57 C;  5U47 A;  3VP3 A;  4R1G A;  4RX3 A;  2PBY A;  3TG9 A;  3C7V A;  5CTN A;  1K6R A;  4QD4 A;  1PWC A;  5FAQ A;  4ZTK A;  2XFT A;  3DTM A;  3VOY A;  3B3X A;  1KE3 A;  4KG5 A;  1KVM A;  5M18 A;  3SH7 A;  2OV5 A;  4DE3 A;  1CI9 A;  1O7E A;  5FQI A;  3HBR A;  1KDW A;  1XKZ A;  1ES3 A;  3WRZ A;  1O07 A;  4KZ8 A;  3SH8 A;  2IWD A;  4C3Q A;  4IED A;  1XA1 A;  2ZQ8 A;  4JF4 A;  4MBH A;  3SH9 A;  1VQQ A;  5FSR A;  4Z9Q A;  4DF6 A;  4E3I A;  3OPP A;  4BD1 A;  2ZM0 A;  4NK3 A;  5EOO A;  1L0D A;  3MZD A;  5M19 A;  3NY4 A;  2WAF A;  1I2W A;  1K4E A;  2WGW B;  3O87 A;  3PBS A;  4P87 A;  3ZNT A;  3WS1 A;  3HLC A;  4ZAM A;  4OPY A;  5FI2 A;  4D2O A;  4KZ9 A;  2A3U A;  1BUL A;  4BL2 A;  1LL9 A;  3ITA A;  3VFH A;  1ONG A;  3IH9 A;  4EBN A;  1FQG A;  1IYQ A;  4K91 A;  5CED A;  4R3B A;  3DWZ A;  5CHJ A;  2R9W A;  2ZQ7 A;  1KVL A;  3ITB A;  4HBT A;  4JXW A;  3ZFZ A;  1PYY A;  4PM7 A;  3V3R A;  1E3U A;  1HZO A;  3NDG A;  1XGI A;  3ZNY A;  3FKW A;  4PM9 A;  1FR6 A;  3IF6 B;  3NBL A;  1E4D A;  5EUA A;  2WGV A;  3FWL A;  3G2Z A;  5GHY A;  4WEL A;  4MBF A;  3HLW A;  4LV3 A;  4KZ7 A;  3G32 A;  4JXS A;  3JYI A;  2IWC A;  3PTE A;  4BD0 A;  3IQA A;  4UA9 A;  1RGY A;  5FAS A;  3IXH A;  3MFD A;  4PM5 A;  4HES A;  4KZ5 A;  4IBR A;  5EPH A;  5HW3 A;  1NYY A;  1DJA A;  1PZP A;  4CPK A;  2R9X A;  5FQK A;  4GDN A;  1FCN A;  3LEZ A;  5CTM A;  3NC8 A;  3UDF A;  2J9P A;  5EOE A;  1PW8 A;  1W8Y A;  4S2M A;  5E2F A;  4OQI A;  3UPN A;  1ESI A;  4E6W A;  4ZJ3 A;  2HDR A;  3CZD A;  4R3J A;  4GNU A;  3MXS A;  1ZG4 A;  2RCX A;  4JPM A;  5CEC A;  2ZQD A;  1JWZ A;  3PBO A;  3MBZ A;  4WEK A;  5F83 A;  3Q07 A;  4OPR A;  3DW0 A;  5TFQ A;  4YFM A;  3GV9 A;  3HLE A;  2Y91 A;  1IEL A;  3IH8 A;  1MWT A;  3S4X A;  1XX2 A;  4N1H A;  1WYB A;  3CG5 A;  3LO7 A;  1LI9 A;  1HVB A;  4OLD A;  5DVA A;  3HUN A;  5FAT A;  1QME A;  3MXR A;  4OVD A;  4B4X A;  3C5A A;  2J8Y A;  3E2K A;  1JTG A;  1E3U D;  2H0Y A;  2C6W B;  1PIO A;  2EX9 A;  4WZ4 A;  1K57 A;  3GMW A;  1MPL A;  2BLS A;  4H8R A;  4E3N A;  4DKI A;  2G2U A;  3MZE A;  3VSL A;  1S6R A;  5F1G A;  1LLB A;  1ZKJ A;  3OZH A;  2WKI A;  4OOM A;  4OON A;  3A3F A;  2V20 A;  2CC1 A;  2Y2K A;  4FH2 A;  3WS5 A;  2XR0 A;  2Y2Q A;  4OH0 A;  2HP9 A;  3UN7 A;  3N8L A;  5E2E A;  3LY4 A;  1TDL A;  3UNW A;  3M6H A;  2J7V A;  4QU3 A;  5HAP A;  3VP4 A;  3ZG0 A;  2DNS A;  3UE0 A;  1W7F A;  2EFX A;  2XFS A;  5CGS A;  2WUQ A;  2ZC4 B;  3MZF A;  3OPR A;  4JF5 A;  3V50 A;  1L2S A;  3Q7Z A;  4MLL A;  1KE4 A;  3P98 A;  1FCO A;  4IVK A;  3G35 A;  4S2O A;  5FDH A;  4PPR A;  4WM9 A;  4ZJ1 A;  3UPO A;  3HVF A;  2G2W A;  2V1Z A;  2JE5 A;  4BEN A;  3IT9 A;  3VFF A;  4KZ6 A;  3IXD A;  1LI0 A;  2XEP A;  4OP5 A;  5FQ9 A;  3OCN A;  3ZVW A;  3VSK A;  3IXB A;  2HDU A;  3MKE A;  3M2J A;  3LY3 A;  3LCE A;  4KEN B;  3N7W A;  4MEZ A;  3W8K A;  3VMA A;  1RGZ A;  4RX2 A;  2Y2M A;  1FR1 A;  4QHC A;  2RL3 A;  4N92 A;  3BFG A;  2A49 A;  4C75 A;  4GB7 A;  1S0W A;  3VP2 A;  3V39 A;  2WYX A;  3QNB A;  4A5R A;  2EX6 A;  2EXA A;  4BL3 A;  3G34 A;  3BLS A;  1XP4 A;  2Y2O A;  4XUZ A;  3C7U A;  2PU4 A;  2E8I A;  3PBN A;  4UA6 A;  5GHX A;  1IYS A;  2ZJ9 A;  3OPL A;  4F94 A;  4E6X A;  1Z6F A;  1RCJ A;  2WKH A;  5EVI A;  2HDQ A;  2XDM A;  4X69 A;  4N9K A;  3TSG A;  2P74 A;  1HD8 A;  4GOG A;  4IBX A;  2P9V A;  4UA7 A;  5BOH A;  1W5D A;  2QMI A;  4P85 A;  4FD8 A;  2EXB A;  5CER A;  3BEB A;  3DWK A;  4KZA A;  5CGW A;  1FCM A;  4B4Z A;  5CGX A;  2Y2H A;  1CK3 A;  1XXM A;  4L0L A;  1BUE A;  2Y4A A;  4Y7P A;  5CHU A;  1XA7 A;  4R4S A;  3ZVT A;  1MBL A;  2HDS A;  1KE0 A;  5HAR A;  1GA0 A;  3W4P A;  1YMX A;  3Q7V A;  2X71 A;  3FZC A;  4OQ0 A;  4Q8I A;  2DCF A;  5FI6 A;  5G18 A;  1K4F A;  2Z2L B;  3HRE A;  4U3T A;  4WMC D;  2HPB A;  3A3E A;  1TDG A;  1MWS A;  4KQQ A;  3FYZ A;  1TEM A;  3WWX A;  3ZHH A;  3C4O A;  4E3L A;  2WK0 A;  3VOZ A;  1WYC A;  3ZG5 A;  5KMW A;  1K38 A;  3BRM A;  4OLG A;  4OOY A;  1JWV A;  4LCL A;  1I2S A;  3G31 A;  4R23 A;  5KSC A;  1K56 D;  1LHY A;  5TR7 A;  3N6I A;  1BLC A;  1K6S A;  5DTK A;  4M3K A;  5EVI C;  5A92 A;  5GLD A;  4JF6 A;  4R0Q A;  1MXO A;  4P0M A;  4X53 A;  3V5M A;  1K55 A;  1RP5 A;  4KQR A;  4O7D A;  2WKE A;  4QY5 A;  1BSG A;  1N4O A;  5EVI D;  5GLB A;  1NYM A;  5EEC A;  2ZM8 A;  1SCW A;  5FQQ A;  1XPB A;  1E25 A;  3M2K A;  3C4P A;  3IXG A;  5AQ9 A;  5EVI B;  1MWR A;  2JBF A;  2XH9 A;  4S2N C;  5F82 A;  4KG2 A;  3BLM A;  4BQM A;  4E3K A;  1ZG6 A;  2V2F F;  2VGJ A;  5FI7 A;  2P9V B;  3D4F A;  2Y2L A;  3Q81 A;  3RJU A;  3EQU A;  1YLZ A;  5A91 A;  4JBF A;  1NXY A;  3SS5 A;  1Y54 A;  2HP6 A;  3AGD A;  2OLU A;  3SOI A;  5J8X A;  3QHY A;  3BFC A;  1N9B A;  2Y59 A;  1KDS A;  1Q2Q A;  2FFF B;  1M40 A;  4X56 A;  2WAE A;  4MNR A;  1FSY A;  2WGI A;  3MKF A;  1BLH A;  1YM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...