1FCMA

Crystal structure of the e.coli ampc beta-lactamase mutant q120l/y150e covalently acylated with the inhibitory beta-lactam, cloxacillin
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
358
structure length
352
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLLVPDEVKSSSDLLRFYQNWQPAWAPGTQRLEANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords BETA-LACTAMASE
publication title Crystal Structures of Substrate and Inhibitor Complexes with AmpC -Lactamase: Possible Implications for Substrate-Assisted Catalysis
pubmed doi rcsb
source organism Escherichia coli
total genus 107
structure length 352
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1fcmA00
2RCXA 4PM5A 4E3JA 3Q07A 5FSRA 1ZG6A 1RGYA 4RVAA 4X53A 4LV3A 4EUZA 3BFEA 3BLSA 1XPBA 2XF3A 3MZFA 4WZ5C 4Y0UA 1JWPA 4XXRA 5DTKA 1K6RA 2QZ6A 2JE5A 4RX3A 5DF8A 3FV7A 5CECA 2HDQA 3V50A 1JVJA 3WS2A 4DF6A 1BSGA 3FWLA 3IXBA 4D2OA 3ZGAB 5EVLA 5IHVA 1W79A 3ZNYA 4JKTA 5TR7A 1YMSA 3HBRA 3GR2A 4JXGA 3UPOA 2WAEA 4DDSA 1BUEA 1K4EA 2DCFA 3UDXA 1K38A 1K56D 1RP5A 5A90A 1IEMA 1K25A 5EVIA 3VOZA 2FFFB 2HPBA 5GHXA 4L0LA 4B4ZA 4GKUA 2OSUA 2V20A 2HDSA 4KG2A 1KVLA 1GA0A 5FDHA 4GN2A 5EVIB 1Y54A 3OPPA 1XKZA 2Y2JA 2B5RA 1IYOA 4GD8A 5G18A 1K4FA 4DXBA 3IT9A 4HBUA 4BJPA 4S2NA 3BFDA 3VSKA 4X6TA 1QMEA 1TDLA 2ZQCA 5CTNA 3IXDA 1MY8A 2XFSA 3G35A 3MZEA 1PW8A 5L2FA 1NRFA 4GZBA 1IKIA 2WZXA 3EQVA 3N8SA 4JXVA 4E3IA 1DJBA 1DJCA 3V39A 5CRFA 1QMFA 5EVIC 4OOYA 2ZC6B 2ZQ7A 4ZTKA 5FA7A 1ONHA 4IVIA 4X56A 4IEDA 2P74A 2XD1A 5A91A 1C3BA 4FCFA 4LV2A 3SS4A 2IWBA 1KE4A 1K57C 2EFUA 4U0XA 1MXOA 2EX6A 4E3KA 4S2LA 4S2NC 4N9KA 3WS0A 2C5WB 4DE3A 4E3MA 5JYPA 3VSLA 4KZ9A 4YFMA 4KZ3A 5JYOA 4FH4A 2HP6A 3SS3A 3BFGA 3VFFA 4PM8A 3PTEA 4KQRA 3N8LA 3E2KA 3IWIA 1I2SA 4ZJ1A 4X55A 1E3UA 3OPRA 4IVKA 4HESA 4GDBA 1L0FA 5AQAA 3NC8A 1ES2A 3C4OA 4P87A 4C75A 1MWRA 1BULA 4RA7A 5HAPA 4EQIA 4WYYA 4Y7PA 4HBTA 2H0TA 1GHPA 3NBLA 3ZG7B 4OOLA 3HVFA 3TOIA 1ZKJA 5FI6A 1PW1A 4C6YA 4DRTA 2XFTA 2BG1A 3Q1FA 1FSWA 4Q8IA 2Y2LA 4WZ4A 1CEGA 2IWDA 1ESUA 2XEPA 4S2KA 3DW0A 3ZHHA 5GL9A 2IWCA 1IYQA 1GHIA 2Y2PA 1FQGA 3P09A 1KGGA 4BL3A 5E43A 4LV1A 3N4IA 1E25A 3N6IA 1BLCA 4F94A 1EI5A 3SH8A 3VP4A 1DJAA 4K0WA 3OCNA 1MWUA 4PM9A 2H0YA 2H5SA 4JF6A 1W8YA 2J7VA 5FQMA 1M6KA 2X71A 4HEFA 3VP3A 4E3LA 2J8YA 2PU2A 1GCEA 5E2FA 4N92A 5EECA 1MWTA 2UWXA 5FQQA 1HTZA 4LCLA 3M2JA 5TGFA 3NY4A 1LHYA 5GLBA 3G30A 1L0EA 2ZQ9A 2WGIA 3CMZA 3OPLA 4X68A 5CXWA 1H8YA 3LY3A 3PAGA 3S4XA 4OKPA 3WS4A 2Y2NA 3DWKA 4KQQA 2Y2HA 5FAQA 5J8XA 3HLDA 3NDEA 2VGKA 2PBYA 1MPLA 3W4PA 2A3UA 3A3JA 3G4PA 5CERA 4R4RA 3LEZA 1IYSA 2XQZA 4CJNA 2ZQ8A 1WYBA 5EUAA 1XGIA 3HL9A 4KQOA 5F1GA 1K6SA 2Y2QA 2P9VB 1YLJA 3ZG5A 1MBLA 1BT5A 3M6BA 4JBFA 5TFQA 3UDFA 3G2ZA 5FQIA 3S22A 2XDMA 4OQGA 3UY6A 4UAAA 3AGFA 1BLPA 3E2LA 3SH9A 1S0WA 1XP4A 3IF6A 1PWGA 5GHYA 3NCKA 2J9OA 4UA7A 3G34A 5HL1A 1VM1A 4NK3A 3UDIA 5D3OA 5AQBA 4P6BA 4QD4A 3CG5A 2WAFA 1CI8A 5FQJA 5CEBA 4GOGA 2DNSA 2HDUA 2OV5A 1LI9A 5HARA 2ZD8A 1TEMA 1YLPA 3C7UA 4N1XA 4OPQA 2OLUA 4KZ4A 3ZNTA 3GQZA 1YLWA 1YLTA 3UO9A 1FCNA 2P9VA 2Y59A 5FQ9A 3CJMA 3HLGA 3BEBA 3VP2A 4E6WA 3UN7A 4M3KA 4FSFA 1ZC2A 3IF6C 3Q7VB 1SDEA 3UE3A 1O7EA 3IH8A 1J9MA 5KSHA 3BM6A 4XUZA 2XR0A 3MXRA 4UA6A 5KZHA 4YINA 1SCWA 1K56A 2E8IA 1LL5A 1KDWA 2ZM8A 4KZ6A 4QY5A 1TVFA 4PM6A 4R23A 1JWVA 3UPNA 2WGWB 1ALQA 1IKGA 1JWZA 1K54A 2VGJA 4CPKA 2H10A 3BFCA 3ITBA 1PYYA 2EX9A 4PM7A 4X69A 3V5MA 4MBFA 4R3BA 4IBRA 1ERQA 3CZDA 4WMCD 3ZVTA 2A49A 3PBSA 2Q9NA 1G6AA 3IQAA 4FH2A 5DTTA 1HD8A 1PWDA 2XK1A 4EBNA 3QNCA 1H8ZA 3D4FA 5FI7A 1FSYA 1KE0A 3ITAA 1CI9A 1I2WA 4N1HA 4ZJ2A 2ZC3B 3MKFA 4JF5A 4OLGA 2WGWA 5KSCA 1L0GA 1K54C 3HLEA 4BENA 4XUXA 5A93A 1MKIA 3BLMA 4P85A 3IH9A 4BD1A 2WKIA 4KZAA 2Y2IA 3IXGA 3V3RA 5CHMA 5AQ9A 4EBPA 3FKVA 1G68A 1EROA 3IXHA 4WMCA 5M19A 5CTMA 2HDRA 2FFYA 1XX2A 2ZLYA 2EXAA 4H8RA 3MXSA 5CHJA 1NZOA 2CC1A 3FKWA 1PI5A 3HUMA 4MBHA 4P0MA 1HZOA 4MLLA 3Q82A 4JPMA 4ZAMA 1W8QA 3HUNA 5GLDA 4E3NA 1YT4A 3SH7A 3ZCZA 1M40A 4LENA 4OVDA 1W5DA 4QHCA 3ZVWA 1L2SA 3PBNA 2PU4A 2Y91A 3GMWA 5CEDA 3UE1A 3IWOA 3PBTA 4S2PA 3MKEA 3G31A 1EWZA 3IHBA 1BLHA 1KVMA 4GD6A 2G2WA 2Z2LB 1TDGA 3OPHA 4BQMA 2Z2MB 4Z9QA 4JF4A 2WKHA 5CHUA 1ONGA 1CK3A 4Y0TA 3A3FA 3OC2A 2WADA 2JC7A 4DE0A 1YMXA 1BTLA 3A3IA 3ZDJA 4KENB 1XA7A 3A3DA 3P98A 5EE8A 1MWSA 1NJ4A 3VMAA 4MEZA 2ZM0A 3A3EA 3LCEA 1IELA 4O7DA 1Q2PA 1NZUA 2WYXA 2WZZA 2X02A 3JYIA 4PPRA 4ZJ3A 3IHAA 4OPYA 1NYYA 4K0XA 1WE4A 3C5AA 4FD8A 1FOFA 4JXSA 5FAPA 4QU3A 1NY0A 1FR6A 3GV9A 1XGJA 2EX2A 3HLCA 3AGEA 2JCHA 3ZG8B 3I7JA 1RGZA 4IBXA 4A5RA 4DDYA 5CGSA 1W7FA 3BRMA 4RX2A 3TSGA 4DXCA 5M1AA 4S2OA 3PBQA 4WBGA 5EVID 5F83A 4BD0A 2C6WB 1PZPA 4UA9A 4WEKA 4EWFA 3QNBA 1GA9A 5GLCA 4OPRA 2J9PA 1DY6A 1GHMA 3C4PA 2DRWA 3G32A 3Q81A 4EBLA 3M2KA 3M6HA 2BLSA 2OLVA 1E4DA 2Y2OA 4R0QA 1LI0A 1CEFA 2ZC5B 2R9WA 2V1ZA 5HFOA 1ESIA 3QHYA 5FASA 1NXYA 3RXXA 4MNRA 5BOHA 4Y0OA 2G2UA 2ZQDA 4B88A 5F1FA 3GTCA 5EPHA 3UE0A 3VP1A 4OQIA 3VOYA 3ZG0A 2WKEA 3HUOA 3MZDA 1SHVA 4MBKA 1RCJA 1N4OA 1YM1A 3GSGA 1LLBA 3ZFZA 4EV4A 3MFDA 3W4QA 3AGDA 3WS5A 3EQUA 1BLSA 2ZMAA 4R4SA 2ZC4B 5DTSA 3IF5A 4C3QA 2XLNA 3TG9A 5FAOA 5FQKA 1XXMA 1K57A 5HAIA 2ZM2A 4OH0A 4OLDA 4DE2A 4LV0A 2R9XA 2GDNA 5HW3A 4WEJA 1U60A 4R3JA 2QMIA 4JXWA 1YLZA 4QB8A 1ERMA 5M18A 1L0DA 4ZDXA 1AXBA 5AQ7A 1Q2QA 3G2YA 3HLWA 3SS5A 3UPPA 1FR1A 5CGXA 3Q7VA 1PIOA 4BL2A 3WRTA 1KGEA 3GRJA 1E3UD 4K91A 4KZ8A 5DF9A 4DE1A 4OPZA 1O07A 3SOIA 1N9BA 1K55A 3ISGA 4KG6A 3VFHA 3MBZA 2EX8A 4R1GA 3O87A 4QJGA 4KG5A 5HX9A 3DWZA 1HVBA 3ZG9B 3HLBA 3Q7ZA 4JLFA 4ZBEA 5GLAA 3IWQA 4OONA 4RYEA 4E6XA 5A92A 1YLYA 3DTMA 1PI4A 4GNUA 2ZQAA 3O88A 4S2IA 3W4OA 2ZJ9A 3PBRA 4ID4A 4U3TA 4OOMA 4E3OA 4GDNA 2Y2KA 2XH9A 2ZC7A 3O3VA 1SKFA 3S1YA 4OQ0A 5I94A 5E2EA 1BZAA 4U0TA 2Y4AA 2HP5A 2XD5A 1ES4A 3NIAA 2QPNA 2Q9MA 3OCLA 5E2HA 3PAEA 1K55C 1PWCA 3C7VA 4S2JA 3BYDA 3GVBA 3WS1A 1Z6FA 2WK0A 3FZCA 3NI9A 4QY6A 5EOEA 1WYCA 3OZHA 2EXBA 4OQHA 4GB7A 5EOOA 1LL9A 5HAQA 4OP8A 1FCMA 1NYMA 1SDNA 3LY4A 5GHZA 4DKIA 1VQQA 3BECA 4KZ5A 4S2MA 3NDGA 5U47A 3RJUA 5F82A 1KE3A 5FATA 4NETA 5KMWA 3VP0A 4OP5A 1ZG4A 4BLMA 1ES5A 3B3XA 1IYPA 2X01A 2XGNA 2V2FF 4PMAA 1I5QA 1KGFA 3N8RA 2WGVA 3WRZA 1XA1A 3WWXA 4KZ7A 3V3SA 4B4XA 5CGWA 3HLFA 1YQSA 3HREA 3FYZA 4WZ5A 3RXWA 1FCOA 4WELA 1JTDA 4WM9A 3BFFA 4UHUA 1ES3A 3W8KA 2JBFA 1JTGA 2Y55A 3N7WA 3O86A 5DF7A 2RL3A 3IF6B 3LO7A 1KDSA 2EFXA 2WUQA 3PBOA 5DVAA 1S6RA 2Y2MA 4KZBA 2I72A 1PZOA 1H5XA 4LCMA 3UNWA 4N9LA 5FI2A 2Y2GA 5E2GA 1OMEA 2HP9A
chains in the Genus database with same CATH superfamily
4PM5A 3IX8A 1RGYA 4RVAA 3BFEA 2XF3A 5DTKA 3PYPA 2QZ6A 3MR0A 5DF8A 3LGOA 5CECA 3E4PA 3WS2A 3FWLA 3IXBA 4D2OA 5IHVA 5TR7A 3GR2A 2A24B 1K4EA 2DCFA 1IEMA 2PHYA 2OSUA 2V20A 5F6AA 1KVLA 3NJAA 4GN2A 3O5YA 5DKLA 3OPPA 2L0WA 4GD8A 3VE3A 1K4FA 4BJPA 3VSKA 2ZQCA 5TBMB 2JKFA 3IX4A 3EQVA 4XT2B 2FH5A 4IVIA 3C38A 3NHQA 4X56A 2P74A 4HP4A 5A91A 1C3BA 1NLZA 4ESPA 3H82B 1K57C 1MXOA 1LSXA 4N9KA 4E3MA 3VSLA 4M4XA 2VGLM 5JYOA 5EV0A 4GCZA 3E2KA 3IWIA 1I2SA 3NC8A 3CUEA 3E4QA 4X1LA 5HAPA 4Y7PA 4HBTA 5J7EA 4JGRA 4OOLA 1ZKJA 5FI6A 4C6YA 2Z6CA 4DRTA 2QHKA 3MFXA 2IWDA 2HJ9C 4ARZB 1TF1A 2Y2PA 4BL3A 5E43A 4LV1A 4MDZA 2AVXA 3CUEC 4F94A 4K0WA 3EWKA 3ZYTA 2W1TA 2XA7M 1W8YA 3QP8A 4HEFA 3VP3A 2PU2A 4N92A 2I9VA 1HTZA 2IA2A 2OAP1 3BWLA 3M2JA 3NY4A 1L0EA 4X68A 3GECA 5J8XA 4WUJA 3UE6A 1MPLA 3G4PA 4R4RA 1IYSA 2ZQ8A 4DMZA 5EUAA 1XGIA 2Y2QA 2P9VB 1BT5A 3UDFA 4CLCB 3G2ZA 5CX7A 5GHYA 2J9OA 4NK3A 2VV6A 3UDIA 5D3OA 3B33A 4P6BA 5DFYA 4QD4A 2EWVA 3PHYA 2WAFA 1CI8A 2J80A 4GOGA 2OV5A 2XROA 1LI9A 2ZD8A 4O0PA 4KZ4A 3RFBA 3UO9A 3RTYA 5FQ9A 4EUVA 3HLGA 2K7SA 4M3KA 1ZC2A 4D60A 3Q7VB 3UE3A 1J9MA 1MKMA 3S7OA 5KSHA 4XUZA 3MXRA 2WKQA 1K56A 2E8IA 2XRNA 5HD5A 1KDWA 4ETXA 2VK3A 1JWZA 4CPKA 4JGQA 3BY8A 3KX0X 2K2NA 2EX9A 4I3AA 3PBSA 1G6AA 3NOPC 4EBNA 3CPTA 1KE0A 4ZJ2A 2W3EA 2Y79A 2WGWA 4I3IA 4QWOA 4EBPA 4GJ4A 1G68A 4PKYA 3IXHA 3VV4A 1XX2A 2EXAA 3LI8A 1HZOA 4ZAMA 3Q82A 4JPMA 1W8QA 5GLDA 3ZVWA 1OJ5A 3GMWA 5CEDA 3IWOA 3PBTA 3MKEA 3IHBA 2Z2LB 3FG8A 1GSXA 4JF4A 2WKHA 4H6JB 2O9AA 3A3FA 2WADA 1BTLA 1Y28A 3ZDJA 4KENB 1XA7A 1NJ4A 1S66L 3LCEA 1VHMA 4O7DA 2X02A 3JYIA 1NYYA 2WKRA 4HJ4A 1NY0A 3AGEA 3ZG8B 1RGZA 1GSWA 1W7FA 2B95A 5F83A 3PBQA 1V9ZA 2W3GA 1PZPA 3QP4A 3C4PA 1G5UA 3Q81A 5HDCA 4R0QA 1LI0A 4EU0A 1ESIA 2GX5A 4MNRA 5F1FA 2G2UA 3GTCA 4Q0IA 5EPHA 4OQIA 3T1XA 2QWSA 3ZG0A 1SHVA 3TE8A 1YM1A 4LRXC 5EM1A 1ZTUA 1T19A 3MFDA 3WS5A 4PHTA 3MF0A 4R4SA 5LBRA 5DTSA 2Q0OA 4LV0A 4JXWA 5HSQA 1ERMA 5M18A 1AXBA 3HLWA 3UPPA 5HPFA 1WA9A 4DE1A 1K0KA 1O07A 3MQQA 1TD5A 3MBZA 1S4SA 4KG5A 5HX9A 3HLBA 3LR4A 2P08A 3Q7ZA 5GLAA 3IWQA 4E6XA 3DTMA 3E4OA 3ZFZA 4S2IA 3C30A 4OOMA 4GDNA 2Y2KA 5I94A 4OQ0A 1VEUB 4FUWA 3T4JA 1BZAA 3CHWP 3NIAA 2Q9MA 5E2HA 3PAEA 3S7PA 3C7VA 3LFVA 2OAQ1 3FZCA 3S7NA 3NI9A 4QY6A 1P9RA 4X25A 2EXBA 5EOOA 1SDNA 1VQQA 3BECA 4KZ5A 3NDGA 3T4TA 1KE3A 4MN6A 5FATA 4OP5A 4GHIB 5HDSA 3B3XA 2XGNA 3HJIA 3WWXA 3H7WA 1JNUA 2H28A 1FCOA 1JTDA 4WN5A 5AJGA 5L07A 2O0YA 5DF7A 2JBFA 2EFXA 2WUQA 4WL9A 1S6RA 4KZBA 4LCMA 4R70A 4KUKA 4LRZE 1FIKA 1GSVA 4E3JA 1P9WA 3Q07A 4Y2FA 5FSRA 4LGWA 4I38A 1XPBA 3A0VA 2HDQA 1JVJA 3ZGAB 2V0WA 5EVLA 3ZNYA 3S7QA 2GNXA 2PD7A 1BUEA 4HOIA 1K38A 1K56D 5EVIA 3VOZA 1YKDA 2FFFB 2HPBA 5GHXA 2OWHA 4KG2A 4HQAA 1XKZA 4B93A 4HBUA 4MMNA 3P01A 5DFXA 1QMEA 5CTNA 4ME4A 3IXDA 3A0SA 1W63Q 3IS2A 3MZEA 1PW8A 2VJWA 1NRFA 2VV8A 2W0NA 2WZXA 4JXVA 4E3IA 1DJCA 3V39A 1QMFA 5EVIC 5HDDA 2ZQ7A 4ZTKA 5FA7A 3GDIA 2XD1A 1KE4A 2P04A 4U0XA 2O9BA 3WS0A 2C5WB 5JYPA 2J3WA 4KZ3A 2M7VA 4FH4A 3EGXC 3VFFA 3BFGA 2ZOHA 4KQRA 4ZJ1A 1E3UA 4KUOA 4P87A 4EXOA 4RA7A 1NRJA 1XJ2A 1GHPA 3HVFA 2QJ5A 1FSWA 2Y2LA 4GS9A 1ESUA 5IS1A 5GL9A 3N6IA 1BLCA 3U2AA 3LYXA 3OCNA 4PM9A 3F1PA 3R7WA 5IU1A 4NG2A 3K2NA 5EECA 3UB5P 5TGFA 4LCLA 3FPVA 5GLBA 2ZQ9A 1H0MA 3CMZA 3OPLA 2XSSA 1H8YA 4DJ3A 3PAGA 2Y2HA 5FAQA 1N9NA 3W4PA 3LR0A 2XQZA 3BW6A 1WYBA 2A2LA 1K6SA 3CITA 4JBFA 3S22A 1XP4A 3IF6A 5J3WA 3NCKA 5HL1A 2O99A 3B47A 3QP2A 1SKOA 2OOLA 5CEBA 1TEMA 1OTDA 4N1XA 4OPQA 2Y59A 3CJMA 3MQ0A 4HHDA 1LL8A 3IF6C 4UA6A 1LL5A 1TVFA 3E98A 1JWVA 3UPNA 1ALQA 1IKGA 1K54A 4BBTA 3V5MA 1G6OA 4WMCD 1TS7A 5HZHA 3CAXA 1PWDA 2XK1A 4P6ZS 1FSYA 1I2WA 3MKFA 2NUPC 4OLGA 1K54C 1CJFA 2ZL1A 5A93A 1MKIA 2Y2IA 5AQ9A 1MZUA 5M19A 3D3OA 3F1NA 4H8RA 5CHJA 1HLUP 2W27A 1YSQA 4EW7A 3HUNA 3ZCZA 4OVDA 4QHCA 4EQ1A 1L2SA 1TS6A 3PBNA 2PU4A 3UE1A 4S2PA 1EWZA 4LFUA 1BLHA 4BQMA 2G2WA 3OPHA 4DE0A 2JC7A 1YMXA 5EE8A 3QP6A 1MWSA 3VMAA 3UMDA 4MEZA 2ZM0A 3LIBA 1PNEA 1L3LA 2EWWA 2WYXA 1XJ6A 3D72A 4K0XA 5HD3A 3TJZC 3DAVA 2EX2A 4NXFA 3DTKA 2JKRM 3G6OA 5FEGA 4HNBA 3BRMA 4RX2A 2PR5A 4S2OA 4WBGA 5EVID 4BD0A 2VLGA 4WEKA 1F98A 3U4LP 1Y4OA 4Z1WA 1GHMA 3JVUA 3P7NA 2DRWA 1J3WA 3G32A 3M6HA 1VETB 2BLSA 2OLVA 2Y2OA 3TW8A 1F5MA 3JVVA 2ZC5B 2R9WA 5L8MA 1NXYA 3RXXA 5BOHA 3IS2B 4B88A 4BBVA 2BTFP 3F1OB 3VP1A 3VOYA 4GW9A 4MBKA 3MZDA 4NXBA 1N4OA 3MQOA 3EQUA 1CF0A 1F2KA 1T1AA 2ZC4B 3K3CA 4C3QA 1G28A 5FAOA 5FQKA 3OOVA 2VZWA 2R9XA 5HW3A 4WEJA 1U60A 4R3JA 2QMIA 1T18A 5DJTA 4ZDXA 2KDKA 3WRTA 1E3UD 3MXQA 4KZ8A 4Y15A 3SOIA 1XFNA 4IJGA 4JGOA 2EX8A 2VX8A 1HVBA 3ZG9B 1DRMA 4JLFA 4I5SA 5A92A 3O88A 4E3OA 2ZJ9A 3PBRA 3R4KA 2XH9A 3O3VA 3T1RA 1SKFA 5E2EA 1S67L 3T4OA 2HP5A 2QPNA 1EW0A 4Q0JA 4EETB 1AWIA 3F1PB 3WS1A 1Z6FA 2WK0A 5HWVA 4HH2A 3OZHA 3LI9A 5L09A 4YWZA 4GB7A 5HAQA 1LL9A 4OP8A 1FCMA 2JN7A 2PBDP 3RJUA 5U47A 3T1SA 5MC7A 4NETA 1ES5A 3FC7A 4LRYC 4PMAA 2L1MA 1I5QA 1KGFA 3LIFA 4AFIA 4HY8A 2M1CA 4K08A 4WZ5A 2KLIA 3BFFA 4BWIA 3IF6B 5DVAA 2Y2MA 1PZOA 2I72A 1H5XA 5E2GA 2HP9A 5F5YA 1H3QA 2VGLS 4EUZA 3BLSA 3MZFA 4WZ5C 4XXRA 1K6RA 2JE5A 3LIAA 3SZTA 1BSGA 2VKSA 1W79A 1YMSA 3HBRA 1MC0A 4JXGA 2WAEA 4DDSA 3UDXA 5A90A 4B4ZA 4L0LA 4GKUA 2HDSA 3UB8A 1GA0A 3MJQA 1Y54A 1IYOA 3ULFA 4ETZA 2YKHA 2VA0A 3IT9A 2WKPA 4S2NA 4X6TA 3G35A 3UB9A 2XA7S 2M7UA 1IKIA 1DJBA 4OOYA 2ZC6B 2B18A 4IEDA 4HI4A 2ZBBA 2VEAA 4LV2A 2IWBA 2EFUA 2ZL1B 2EX6A 4E3KA 4S2NC 4II7A 5TBMA 3SS3A 4QPRA 3F1NB 4XT2A 4MN5A 1D1JA 4X55A 3OPRA 4IVKA 4HESA 4GDBA 1L0FA 4C75A 1MWRA 1BULA 2JHEA 4IHQA 1XJ3A 2W1TB 2XFTA 4Q8IA 2XEPA 3PXPA 3DW0A 3ZHHA 3NOTC 2IWCA 1GHIA 1FQGA 3QP5A 1KGGA 2JKRI 4O8GA 1OTIA 3SH8A 1DJAA 1MWUA 1UWPX 2V1BA 2H5SA 2W3HA 1W63M 2J7VA 2YKFA 3E0YA 1M6KA 5FQMA 2X71A 4E04A 4E3LA 3EEHA 1GCEA 5E2FA 1MWTA 2UWXA 5FQQA 3G30A 5CXWA 5HL6A 4ARZA 4OKPA 4JGPA 3WS4A 2Y2NA 4DJ2A 3HLDA 2O9CA 3NDEA 2JKTM 1UWNX 2A3UA 3A3JA 4GLQA 5AVFA 1D06A 4KQOA 5TFQA 5FQIA 2XDMA 1H8MA 3UY6A 4UAAA 3AGFA 1BLPA 2LB9A 1PWGA 4L9FA 1DP6A 1X0OA 4UA7A 3G34A 1P0ZA 3CG5A 2DNSA 2HDUA 5HARA 3KSIA 5EFWA 1YLPA 3GQZA 1YLTA 5F69A 1FCNA 2P9VA 4HP9A 4CLCA 3BEBA 4E6WA 3UN7A 3MS6A 2NUTC 3KYZA 1SDEA 1O7EA 2W3DA 4LLOB 3BM6A 3UMEA 2XR0A 4B9OA 4WF0A 5KZHA 5G4ZA 4YINA 3CPTB 3T4QA 3VE4A 4KZ6A 2WGWB 2J3TD 3LIDA 3BFCA 1ACFA 1PYYA 4CLCC 4PM7A 4MBFA 1OT9A 1ERQA 3CZDA 1DP9A 1D7EA 4PAUA 2A49A 1UGUA 3V67A 2Q9NA 3IQAA 1HD8A 4EERA 3LR3A 4N1HA 3W2ZA 2FZ0A 4JF5A 1L0GA 2D02A 3HLEA 2HV1A 3BLMA 4P85A 5IT5A 5J4EA 4KZAA 3C8CA 4F3LA 3IXGA 3V3RA 3FKVA 4I39A 2HDRA 2FFYA 2ZLYA 3MXSA 1NZOA 2GZAA 3FKWA 1LSVA 1PI5A 3HUMA 4Y17A 4P0MA 1YT4A 1XJ4A 3SH7A 1M40A 4LENA 5FL3A 2Y91A 4L9GA 3G31A 1KVMA 5DKKA 4RQ9A 2Z2MB 4Z9QA 5KIZA 1ONGA 4L9EA 1OT6A 3A3IA 3P98A 5L10A 2QJ7A 2PYPA 4HJ3A 3QP1A 2E8JA 1NZUA 4PPRA 3IHAA 4OPYA 5FAPA 4QU3A 1FR6A 3HLCA 4A5RA 4H6JA 1Z09A 5CGSA 2V0UA 4DXCA 3JPUA 1BYWA 5M1AA 2C6WB 1IOUA 4EEUA 4EWFA 1GA9A 4ZRRA 2P7JA 2GJ3A 2J9PA 1STZA 1CEFA 2V1ZA 5A8BA 3QHYA 1OTAA 4Y0OA 3HJKA 1LLBA 4EV4A 3W4QA 3AGDA 3CWFA 2ZMAA 3IF5A 2XLNA 3TG9A 1TS8A 1XXMA 1K57A 5HAIA 2ZM2A 4DE2A 2GDNA 1YLZA 2Z6DA 5AVEA 1Q2QA 3G2YA 3SS5A 2DMWA 4BL2A 3KSFA 4EESA 4K91A 5DF9A 4OPZA 4NKPA 1ODVA 4R1GA 4QJGA 3O87A 3DWZA 4ZBEA 4RYEA 4CLCE 3A0RA 1YLYA 1PI4A 4GNUA 2ZQAA 3W4OA 4ID4A 3C2WA 4U3TA 2W1RA 2ZC7A 2V8FA 3T4LA 2Y4AA 1ES4A 1PWCA 3EGDC 3H7WB 3D9YA 2LB5A 2JKTI 4NXEA 3T4KA 3B42A 5EOEA 5HWTA 1NYMA 3LY4A 3CLOA 4S2MA 1VEUA 1S1YA 3VOLA 1IYPA 2X01A 3IBRA 2V2FF 4YNRA 3NOUC 2WGVA 4R38A 3WRZA 3V3SA 4B4XA 2HGVA 3HLFA 1YQSA 3HREA 2ZMFA 3RXWA 4WELA 2G7UA 2ACGA 4WM9A 4UHUA 1ES3A 4UEYA 3W8KA 3N7WA 1JTGA 2PD8A 3O86A 3LIEA 4GHIA 3PBOA 2K31A 3UNWA 4N9LA 5EVIB 1T1CA 2RCXA 1ZG6A 4X53A 4LV3A 4Y0UA 1JWPA 2V8CA 1LSWA 4RX3A 3FV7A 3LUQA 4DN0A 3V50A 1P97A 4CLCD 4DF6A 4G3VA 4JKTA 3UPOA 3T1QB 1RP5A 1K25A 1VB6A 4UQIS 2KX6A 2HZ5A 5FDHA 1PRQA 2Y2JA 2B5RA 5G18A 3MSHA 4DXBA 3BFDA 5TJJA 1TDLA 3SW1A 3T50A 1MY8A 2XFSA 2D01A 5L2FA 4GZBA 3KSGA 3L9KA 3N8SA 3KSHA 5CRFA 3TRCA 1V9YA 1ONHA 5FEFA 1LT0A 4FCFA 3SS4A 4Q0HA 4HJ6A 4S2LA 5G4YA 4DE3A 4KZ9A 4F3LB 5K5BA 4IUKA 4YFMA 2HP6A 4GS9B 4PM8A 3PTEA 3N8LA 2BASA 2PDRA 2PR6A 3IX3A 3BJNA 4G3WA 1OTBA 2HJEA 5DJUA 1ES2A 3C4OA 5AQAA 2L4RA 4O01A 4EQIA 4WYYA 1OTEA 3H9WA 3R7WB 2H0TA 3ZG7B 3NBLA 2J3TC 3TOIA 1PW1A 3DTEA 2BG1A 3Q1FA 3ICYA 4WZ4A 1CEGA 4S2KA 4I3JA 3BY9A 1IYQA 3N4IA 1E25A 1EI5A 3VP4A 4HIAA 2H0YA 4Y5FA 4JF6A 1OPXA 2J8YA 1LHYA 1OJGA 5FDSA 2WGIA 3LY3A 3DTIA 1YPRA 3S4XA 5I5LA 3DWKA 4KQQA 2OWJA 2VGKA 2PBYA 4YOFA 5CERA 1NLYA 1SKOB 3LEZA 4CJNA 3BQAA 5EVEA 2UV0E 3HL9A 5F1GA 1YLJA 3ZG5A 1MBLA 3M6BA 2R78A 4OQGA 4PKYG 3E2LA 3SH9A 1S0WA 2PT7A 1VM1A 5AQBA 2QYBA 2HF6A 1SZVA 3K3DA 5FQJA 3C7UA 3OBFA 2OLUA 3ZNTA 1YLWA 4FTXA 3VP2A 4FSFA 1KOUA 2EA9A 3IH8A 2A24A 1A0KA 3EOIA 1SCWA 3BQ8A 3L7HA 2ZM8A 4QY5A 1ZHHB 4PM6A 4R23A 4G3KA 2VGJA 4IUHA 2H10A 3ITBA 3EEAA 4X69A 2V9AA 4R3BA 1TS0A 4IBRA 3ZVTA 2Y8HA 4FH2A 5DTTA 5EM0A 3QNCA 1H8ZA 4KQDA 3D4FA 5FI7A 3ITAA 1CI9A 2ZC3B 5KSCA 4BENA 3H82A 4XUXA 3IH9A 4BD1A 2WKIA 5CHMA 4MN7A 3OLOA 1EROA 1IFQA 1YAXA 4WMCA 5CTMA 3IBJA 2CC1A 3KO6A 3NECA 4MBHA 4MLLA 3MMHA 4E3NA 1W5DA 4GD6A 1TDGA 2CMNA 2QKPA 5CHUA 1CK3A 4Y0TA 4HH3A 3OC2A 1N9LA 3DBAA 3A3DA 3KYQA 4BMWA 3A3EA 3KYEA 1IELA 1Q2PA 2WZZA 4ZJ3A 4P6ZM 1WE4A 3C5AA 4FD8A 1FOFA 4JXSA 1N9OA 3GV9A 1XGJA 2JCHA 3NULA 3I7JA 4IBXA 4DDYA 2B02A 3TSGA 5HPIA 4EEPA 4UA9A 3QNBA 1S1ZA 3T4SA 5GLCA 4CQHA 4OPRA 1DY6A 4EBLA 3M2KA 3LR5A 1E4DA 5HFOA 4R6LA 5FASA 3PR6A 2ZQDA 3UE0A 2ZOIA 2WKEA 3HUOA 5C5KA 1RCJA 3GSGA 1BLSA 3RH8B 3UB6A 1VETA 4OLDA 4OH0A 3LEQA 2KOIA 1YSPA 4QB8A 1L0DA 1XFQA 5AQ7A 3F1OA 1FR1A 5CGXA 3Q7VA 1PIOA 2VV7A 1KGEA 3GRJA 1N9BA 1K55A 3ISGA 4KG6A 3VFHA 2PRFA 4OONA 1T1BA 2PYRA 4NXGA 2W3FA 4WLAA 3CI6A 3S1YA 1DP8A 3HCYA 4FOFA 4U0TA 5F68A 2XD5A 1OMEA 4NEED 5HWWA 3OCLA 1K55C 4S2JA 3BYDA 3GVBA 3LICA 3UB7A 3ZQ5A 4X1MA 1WYCA 1CQAA 4OQHA 5GHZA 4UQIM 4DKIA 5F82A 5KMWA 3VP0A 1ZG4A 4BLMA 1FILA 3N8RA 1NWZA 1XA1A 4KZ7A 4BBUA 5CGWA 4LPZA 1PFLA 3FYZA 4R3AA 3T12B 2PAVP 2MJ6A 2JKGA 2INWA 2Y55A 2ZMVA 4Y13A 2RL3A 1F9IA 1S4RA 4MCWA 3LO7A 1KDSA 4Y3IA 3FPWA 5FI2A 2V1AA 2Y2GA 3P09A
chains in the Genus database with same CATH topology
2RCXA 4PM5A 4E3JA 3Q07A 5FSRA 1ZG6A 1RGYA 4RVAA 4X53A 4LV3A 4EUZA 3BFEA 3BLSA 1XPBA 2XF3A 3MZFA 4WZ5C 4Y0UA 1JWPA 4XXRA 5DTKA 1K6RA 2QZ6A 2JE5A 4RX3A 5DF8A 3FV7A 5CECA 2HDQA 3V50A 1JVJA 3WS2A 4DF6A 1BSGA 3FWLA 3IXBA 4D2OA 3ZGAB 5EVLA 5IHVA 1W79A 3ZNYA 4JKTA 5TR7A 1YMSA 3HBRA 3GR2A 4JXGA 3UPOA 2WAEA 4DDSA 1BUEA 1K4EA 2DCFA 3UDXA 1K38A 1K56D 1RP5A 5A90A 1IEMA 1K25A 5EVIA 3VOZA 2FFFB 2HPBA 5GHXA 4L0LA 4B4ZA 4GKUA 2OSUA 2V20A 2HDSA 4KG2A 1KVLA 1GA0A 5FDHA 4GN2A 5EVIB 1Y54A 3OPPA 1XKZA 2Y2JA 2B5RA 1IYOA 4GD8A 5G18A 1K4FA 4DXBA 3IT9A 4HBUA 4BJPA 4S2NA 3BFDA 3VSKA 4X6TA 1QMEA 1TDLA 2ZQCA 5CTNA 3IXDA 1MY8A 2XFSA 3G35A 3MZEA 1PW8A 5L2FA 1NRFA 4GZBA 1IKIA 2WZXA 3EQVA 3N8SA 4JXVA 4E3IA 1DJBA 1DJCA 3V39A 5CRFA 1QMFA 5EVIC 4OOYA 2ZC6B 2ZQ7A 4ZTKA 5FA7A 1ONHA 4IVIA 4X56A 4IEDA 2P74A 2XD1A 5A91A 1C3BA 4FCFA 4LV2A 3SS4A 2IWBA 1KE4A 1K57C 2EFUA 4U0XA 1MXOA 2EX6A 4E3KA 4S2LA 4S2NC 4N9KA 3WS0A 2C5WB 4DE3A 4E3MA 5JYPA 3VSLA 4KZ9A 4YFMA 4KZ3A 5JYOA 4FH4A 2HP6A 3SS3A 3BFGA 3VFFA 4PM8A 3PTEA 4KQRA 3N8LA 3E2KA 3IWIA 1I2SA 4ZJ1A 4X55A 1E3UA 3OPRA 4IVKA 4HESA 4GDBA 1L0FA 5AQAA 3NC8A 1ES2A 3C4OA 4P87A 4C75A 1MWRA 1BULA 4RA7A 5HAPA 4EQIA 4WYYA 4Y7PA 4HBTA 2H0TA 1GHPA 3NBLA 3ZG7B 4OOLA 3HVFA 3TOIA 1ZKJA 5FI6A 1PW1A 4C6YA 4DRTA 2XFTA 2BG1A 3Q1FA 1FSWA 4Q8IA 2Y2LA 4WZ4A 1CEGA 2IWDA 1ESUA 2XEPA 4S2KA 3DW0A 3ZHHA 5GL9A 2IWCA 1IYQA 1GHIA 2Y2PA 1FQGA 3P09A 1KGGA 4BL3A 5E43A 4LV1A 3N4IA 1E25A 3N6IA 1BLCA 4F94A 1EI5A 3SH8A 3VP4A 1DJAA 4K0WA 3OCNA 1MWUA 4PM9A 2H0YA 2H5SA 4JF6A 1W8YA 2J7VA 5FQMA 1M6KA 2X71A 4HEFA 3VP3A 4E3LA 2J8YA 2PU2A 1GCEA 5E2FA 4N92A 5EECA 1MWTA 2UWXA 5FQQA 1HTZA 4LCLA 3M2JA 5TGFA 3NY4A 1LHYA 5GLBA 3G30A 1L0EA 2ZQ9A 2WGIA 3CMZA 3OPLA 4X68A 5CXWA 1H8YA 3LY3A 3PAGA 3S4XA 4OKPA 3WS4A 2Y2NA 3DWKA 4KQQA 2Y2HA 5FAQA 5J8XA 3HLDA 3NDEA 2VGKA 2PBYA 1MPLA 3W4PA 2A3UA 3A3JA 3G4PA 5CERA 4R4RA 3LEZA 1IYSA 2XQZA 4CJNA 2ZQ8A 1WYBA 5EUAA 1XGIA 3HL9A 4KQOA 5F1GA 1K6SA 2Y2QA 2P9VB 1YLJA 3ZG5A 1MBLA 1BT5A 3M6BA 4JBFA 5TFQA 3UDFA 3G2ZA 5FQIA 3S22A 2XDMA 4OQGA 3UY6A 4UAAA 3AGFA 1BLPA 3E2LA 3SH9A 1S0WA 1XP4A 3IF6A 1PWGA 5GHYA 3NCKA 2J9OA 4UA7A 3G34A 5HL1A 1VM1A 4NK3A 3UDIA 5D3OA 5AQBA 4P6BA 4QD4A 3CG5A 2WAFA 1CI8A 5FQJA 5CEBA 4GOGA 2DNSA 2HDUA 2OV5A 1LI9A 5HARA 2ZD8A 1TEMA 1YLPA 3C7UA 4N1XA 4OPQA 2OLUA 4KZ4A 3ZNTA 3GQZA 1YLWA 1YLTA 3UO9A 1FCNA 2P9VA 2Y59A 5FQ9A 3CJMA 3HLGA 3BEBA 3VP2A 4E6WA 3UN7A 4M3KA 4FSFA 1ZC2A 3IF6C 3Q7VB 1SDEA 3UE3A 1O7EA 3IH8A 1J9MA 5KSHA 3BM6A 4XUZA 2XR0A 3MXRA 4UA6A 5KZHA 4YINA 1SCWA 1K56A 2E8IA 1LL5A 1KDWA 2ZM8A 4KZ6A 4QY5A 1TVFA 4PM6A 4R23A 1JWVA 3UPNA 2WGWB 1ALQA 1IKGA 1JWZA 1K54A 2VGJA 4CPKA 2H10A 3BFCA 3ITBA 1PYYA 2EX9A 4PM7A 4X69A 3V5MA 4MBFA 4R3BA 4IBRA 1ERQA 3CZDA 4WMCD 3ZVTA 2A49A 3PBSA 2Q9NA 1G6AA 3IQAA 4FH2A 5DTTA 1HD8A 1PWDA 2XK1A 4EBNA 3QNCA 1H8ZA 3D4FA 5FI7A 1FSYA 1KE0A 3ITAA 1CI9A 1I2WA 4N1HA 4ZJ2A 2ZC3B 3MKFA 4JF5A 4OLGA 2WGWA 5KSCA 1L0GA 1K54C 3HLEA 4BENA 4XUXA 5A93A 1MKIA 3BLMA 4P85A 3IH9A 4BD1A 2WKIA 4KZAA 2Y2IA 3IXGA 3V3RA 5CHMA 5AQ9A 4EBPA 3FKVA 1G68A 1EROA 3IXHA 4WMCA 5M19A 5CTMA 2HDRA 2FFYA 1XX2A 2ZLYA 2EXAA 4H8RA 3MXSA 5CHJA 1NZOA 2CC1A 3FKWA 1PI5A 3HUMA 4MBHA 4P0MA 1HZOA 4MLLA 3Q82A 4JPMA 4ZAMA 1W8QA 3HUNA 5GLDA 4E3NA 1YT4A 3SH7A 3ZCZA 1M40A 4LENA 4OVDA 1W5DA 4QHCA 3ZVWA 1L2SA 3PBNA 2PU4A 2Y91A 3GMWA 5CEDA 3UE1A 3IWOA 3PBTA 4S2PA 3MKEA 3G31A 1EWZA 3IHBA 1BLHA 1KVMA 4GD6A 2G2WA 2Z2LB 1TDGA 3OPHA 4BQMA 2Z2MB 4Z9QA 4JF4A 2WKHA 5CHUA 1ONGA 1CK3A 4Y0TA 3A3FA 3OC2A 2WADA 2JC7A 4DE0A 1YMXA 1BTLA 3A3IA 3ZDJA 4KENB 1XA7A 3A3DA 3P98A 5EE8A 1MWSA 1NJ4A 3VMAA 4MEZA 2ZM0A 3A3EA 3LCEA 1IELA 4O7DA 1Q2PA 1NZUA 2WYXA 2WZZA 2X02A 3JYIA 4PPRA 4ZJ3A 3IHAA 4OPYA 1NYYA 4K0XA 1WE4A 3C5AA 4FD8A 1FOFA 4JXSA 5FAPA 4QU3A 1NY0A 1FR6A 3GV9A 1XGJA 2EX2A 3HLCA 3AGEA 2JCHA 3ZG8B 3I7JA 1RGZA 4IBXA 4A5RA 4DDYA 5CGSA 1W7FA 3BRMA 4RX2A 3TSGA 4DXCA 5M1AA 4S2OA 3PBQA 4WBGA 5EVID 5F83A 4BD0A 2C6WB 1PZPA 4UA9A 4WEKA 4EWFA 3QNBA 1GA9A 5GLCA 4OPRA 2J9PA 1DY6A 1GHMA 3C4PA 2DRWA 3G32A 3Q81A 4EBLA 3M2KA 3M6HA 2BLSA 2OLVA 1E4DA 2Y2OA 4R0QA 1LI0A 1CEFA 2ZC5B 2R9WA 2V1ZA 5HFOA 1ESIA 3QHYA 5FASA 1NXYA 3RXXA 4MNRA 5BOHA 4Y0OA 2G2UA 2ZQDA 4B88A 5F1FA 3GTCA 5EPHA 3UE0A 3VP1A 4OQIA 3VOYA 3ZG0A 2WKEA 3HUOA 3MZDA 1SHVA 4MBKA 1RCJA 1N4OA 1YM1A 3GSGA 1LLBA 3ZFZA 4EV4A 3MFDA 3W4QA 3AGDA 3WS5A 3EQUA 1BLSA 2ZMAA 4R4SA 2ZC4B 5DTSA 3IF5A 4C3QA 2XLNA 3TG9A 5FAOA 5FQKA 1XXMA 1K57A 5HAIA 2ZM2A 4OH0A 4OLDA 4DE2A 4LV0A 2R9XA 2GDNA 5HW3A 4WEJA 1U60A 4R3JA 2QMIA 4JXWA 1YLZA 4QB8A 1ERMA 5M18A 1L0DA 4ZDXA 1AXBA 5AQ7A 1Q2QA 3G2YA 3HLWA 3SS5A 3UPPA 1FR1A 5CGXA 3Q7VA 1PIOA 4BL2A 3WRTA 1KGEA 3GRJA 1E3UD 4K91A 4KZ8A 5DF9A 4DE1A 4OPZA 1O07A 3SOIA 1N9BA 1K55A 3ISGA 4KG6A 3VFHA 3MBZA 2EX8A 4R1GA 3O87A 4QJGA 4KG5A 5HX9A 3DWZA 1HVBA 3ZG9B 3HLBA 3Q7ZA 4JLFA 4ZBEA 5GLAA 3IWQA 4OONA 4RYEA 4E6XA 5A92A 1YLYA 3DTMA 1PI4A 4GNUA 2ZQAA 3O88A 4S2IA 3W4OA 2ZJ9A 3PBRA 4ID4A 4U3TA 4OOMA 4E3OA 4GDNA 2Y2KA 2XH9A 2ZC7A 3O3VA 1SKFA 3S1YA 4OQ0A 5I94A 5E2EA 1BZAA 4U0TA 2Y4AA 2HP5A 2XD5A 1ES4A 3NIAA 2QPNA 2Q9MA 3OCLA 5E2HA 3PAEA 1K55C 1PWCA 3C7VA 4S2JA 3BYDA 3GVBA 3WS1A 1Z6FA 2WK0A 3FZCA 3NI9A 4QY6A 5EOEA 1WYCA 3OZHA 2EXBA 4OQHA 4GB7A 5EOOA 1LL9A 5HAQA 4OP8A 1FCMA 1NYMA 1SDNA 3LY4A 5GHZA 4DKIA 1VQQA 3BECA 4KZ5A 4S2MA 3NDGA 5U47A 3RJUA 5F82A 1KE3A 5FATA 4NETA 5KMWA 3VP0A 4OP5A 1ZG4A 4BLMA 1ES5A 3B3XA 1IYPA 2X01A 2XGNA 2V2FF 4PMAA 1I5QA 1KGFA 3N8RA 2WGVA 3WRZA 1XA1A 3WWXA 4KZ7A 3V3SA 4B4XA 5CGWA 3HLFA 1YQSA 3HREA 3FYZA 4WZ5A 3RXWA 1FCOA 4WELA 1JTDA 4WM9A 3BFFA 4UHUA 1ES3A 3W8KA 2JBFA 1JTGA 2Y55A 3N7WA 3O86A 5DF7A 2RL3A 3IF6B 3LO7A 1KDSA 2EFXA 2WUQA 3PBOA 5DVAA 1S6RA 2Y2MA 4KZBA 2I72A 1PZOA 1H5XA 4LCMA 3UNWA 4N9LA 5FI2A 2Y2GA 5E2GA 1OMEA 2HP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RCX A;  4PM5 A;  4E3J A;  3Q07 A;  5FSR A;  1ZG6 A;  1RGY A;  4RVA A;  4X53 A;  4LV3 A;  4EUZ A;  3BFE A;  3BLS A;  1XPB A;  2XF3 A;  3MZF A;  4WZ5 C;  4Y0U A;  1JWP A;  4XXR A;  5DTK A;  1K6R A;  2QZ6 A;  2JE5 A;  4RX3 A;  5DF8 A;  3FV7 A;  5CEC A;  2HDQ A;  3V50 A;  1JVJ A;  3WS2 A;  4DF6 A;  1BSG A;  3FWL A;  3IXB A;  4D2O A;  3ZGA B;  5EVL A;  5IHV A;  1W79 A;  3ZNY A;  4JKT A;  5TR7 A;  1YMS A;  3HBR A;  3GR2 A;  4JXG A;  3UPO A;  2WAE A;  4DDS A;  1BUE A;  1K4E A;  2DCF A;  3UDX A;  1K38 A;  1K56 D;  1RP5 A;  5A90 A;  1IEM A;  1K25 A;  5EVI A;  3VOZ A;  2FFF B;  2HPB A;  5GHX A;  4L0L A;  4B4Z A;  4GKU A;  2OSU A;  2V20 A;  2HDS A;  4KG2 A;  1KVL A;  1GA0 A;  5FDH A;  4GN2 A;  5EVI B;  1Y54 A;  3OPP A;  1XKZ A;  2Y2J A;  2B5R A;  1IYO A;  4GD8 A;  5G18 A;  1K4F A;  4DXB A;  3IT9 A;  4HBU A;  4BJP A;  4S2N A;  3BFD A;  3VSK A;  4X6T A;  1QME A;  1TDL A;  2ZQC A;  5CTN A;  3IXD A;  1MY8 A;  2XFS A;  3G35 A;  3MZE A;  1PW8 A;  5L2F A;  1NRF A;  4GZB A;  1IKI A;  2WZX A;  3EQV A;  3N8S A;  4JXV A;  4E3I A;  1DJB A;  1DJC A;  3V39 A;  5CRF A;  1QMF A;  5EVI C;  4OOY A;  2ZC6 B;  2ZQ7 A;  4ZTK A;  5FA7 A;  1ONH A;  4IVI A;  4X56 A;  4IED A;  2P74 A;  2XD1 A;  5A91 A;  1C3B A;  4FCF A;  4LV2 A;  3SS4 A;  2IWB A;  1KE4 A;  1K57 C;  2EFU A;  4U0X A;  1MXO A;  2EX6 A;  4E3K A;  4S2L A;  4S2N C;  4N9K A;  3WS0 A;  2C5W B;  4DE3 A;  4E3M A;  5JYP A;  3VSL A;  4KZ9 A;  4YFM A;  4KZ3 A;  5JYO A;  4FH4 A;  2HP6 A;  3SS3 A;  3BFG A;  3VFF A;  4PM8 A;  3PTE A;  4KQR A;  3N8L A;  3E2K A;  3IWI A;  1I2S A;  4ZJ1 A;  4X55 A;  1E3U A;  3OPR A;  4IVK A;  4HES A;  4GDB A;  1L0F A;  5AQA A;  3NC8 A;  1ES2 A;  3C4O A;  4P87 A;  4C75 A;  1MWR A;  1BUL A;  4RA7 A;  5HAP A;  4EQI A;  4WYY A;  4Y7P A;  4HBT A;  2H0T A;  1GHP A;  3NBL A;  3ZG7 B;  4OOL A;  3HVF A;  3TOI A;  1ZKJ A;  5FI6 A;  1PW1 A;  4C6Y A;  4DRT A;  2XFT A;  2BG1 A;  3Q1F A;  1FSW A;  4Q8I A;  2Y2L A;  4WZ4 A;  1CEG A;  2IWD A;  1ESU A;  2XEP A;  4S2K A;  3DW0 A;  3ZHH A;  5GL9 A;  2IWC A;  1IYQ A;  1GHI A;  2Y2P A;  1FQG A;  3P09 A;  1KGG A;  4BL3 A;  5E43 A;  4LV1 A;  3N4I A;  1E25 A;  3N6I A;  1BLC A;  4F94 A;  1EI5 A;  3SH8 A;  3VP4 A;  1DJA A;  4K0W A;  3OCN A;  1MWU A;  4PM9 A;  2H0Y A;  2H5S A;  4JF6 A;  1W8Y A;  2J7V A;  5FQM A;  1M6K A;  2X71 A;  4HEF A;  3VP3 A;  4E3L A;  2J8Y A;  2PU2 A;  1GCE A;  5E2F A;  4N92 A;  5EEC A;  1MWT A;  2UWX A;  5FQQ A;  1HTZ A;  4LCL A;  3M2J A;  5TGF A;  3NY4 A;  1LHY A;  5GLB A;  3G30 A;  1L0E A;  2ZQ9 A;  2WGI A;  3CMZ A;  3OPL A;  4X68 A;  5CXW A;  1H8Y A;  3LY3 A;  3PAG A;  3S4X A;  4OKP A;  3WS4 A;  2Y2N A;  3DWK A;  4KQQ A;  2Y2H A;  5FAQ A;  5J8X A;  3HLD A;  3NDE A;  2VGK A;  2PBY A;  1MPL A;  3W4P A;  2A3U A;  3A3J A;  3G4P A;  5CER A;  4R4R A;  3LEZ A;  1IYS A;  2XQZ A;  4CJN A;  2ZQ8 A;  1WYB A;  5EUA A;  1XGI A;  3HL9 A;  4KQO A;  5F1G A;  1K6S A;  2Y2Q A;  2P9V B;  1YLJ A;  3ZG5 A;  1MBL A;  1BT5 A;  3M6B A;  4JBF A;  5TFQ A;  3UDF A;  3G2Z A;  5FQI A;  3S22 A;  2XDM A;  4OQG A;  3UY6 A;  4UAA A;  3AGF A;  1BLP A;  3E2L A;  3SH9 A;  1S0W A;  1XP4 A;  3IF6 A;  1PWG A;  5GHY A;  3NCK A;  2J9O A;  4UA7 A;  3G34 A;  5HL1 A;  1VM1 A;  4NK3 A;  3UDI A;  5D3O A;  5AQB A;  4P6B A;  4QD4 A;  3CG5 A;  2WAF A;  1CI8 A;  5FQJ A;  5CEB A;  4GOG A;  2DNS A;  2HDU A;  2OV5 A;  1LI9 A;  5HAR A;  2ZD8 A;  1TEM A;  1YLP A;  3C7U A;  4N1X A;  4OPQ A;  2OLU A;  4KZ4 A;  3ZNT A;  3GQZ A;  1YLW A;  1YLT A;  3UO9 A;  1FCN A;  2P9V A;  2Y59 A;  5FQ9 A;  3CJM A;  3HLG A;  3BEB A;  3VP2 A;  4E6W A;  3UN7 A;  4M3K A;  4FSF A;  1ZC2 A;  3IF6 C;  3Q7V B;  1SDE A;  3UE3 A;  1O7E A;  3IH8 A;  1J9M A;  5KSH A;  3BM6 A;  4XUZ A;  2XR0 A;  3MXR A;  4UA6 A;  5KZH A;  4YIN A;  1SCW A;  1K56 A;  2E8I A;  1LL5 A;  1KDW A;  2ZM8 A;  4KZ6 A;  4QY5 A;  1TVF A;  4PM6 A;  4R23 A;  1JWV A;  3UPN A;  2WGW B;  1ALQ A;  1IKG A;  1JWZ A;  1K54 A;  2VGJ A;  4CPK A;  2H10 A;  3BFC A;  3ITB A;  1PYY A;  2EX9 A;  4PM7 A;  4X69 A;  3V5M A;  4MBF A;  4R3B A;  4IBR A;  1ERQ A;  3CZD A;  4WMC D;  3ZVT A;  2A49 A;  3PBS A;  2Q9N A;  1G6A A;  3IQA A;  4FH2 A;  5DTT A;  1HD8 A;  1PWD A;  2XK1 A;  4EBN A;  3QNC A;  1H8Z A;  3D4F A;  5FI7 A;  1FSY A;  1KE0 A;  3ITA A;  1CI9 A;  1I2W A;  4N1H A;  4ZJ2 A;  2ZC3 B;  3MKF A;  4JF5 A;  4OLG A;  2WGW A;  5KSC A;  1L0G A;  1K54 C;  3HLE A;  4BEN A;  4XUX A;  5A93 A;  1MKI A;  3BLM A;  4P85 A;  3IH9 A;  4BD1 A;  2WKI A;  4KZA A;  2Y2I A;  3IXG A;  3V3R A;  5CHM A;  5AQ9 A;  4EBP A;  3FKV A;  1G68 A;  1ERO A;  3IXH A;  4WMC A;  5M19 A;  5CTM A;  2HDR A;  2FFY A;  1XX2 A;  2ZLY A;  2EXA A;  4H8R A;  3MXS A;  5CHJ A;  1NZO A;  2CC1 A;  3FKW A;  1PI5 A;  3HUM A;  4MBH A;  4P0M A;  1HZO A;  4MLL A;  3Q82 A;  4JPM A;  4ZAM A;  1W8Q A;  3HUN A;  5GLD A;  4E3N A;  1YT4 A;  3SH7 A;  3ZCZ A;  1M40 A;  4LEN A;  4OVD A;  1W5D A;  4QHC A;  3ZVW A;  1L2S A;  3PBN A;  2PU4 A;  2Y91 A;  3GMW A;  5CED A;  3UE1 A;  3IWO A;  3PBT A;  4S2P A;  3MKE A;  3G31 A;  1EWZ A;  3IHB A;  1BLH A;  1KVM A;  4GD6 A;  2G2W A;  2Z2L B;  1TDG A;  3OPH A;  4BQM A;  2Z2M B;  4Z9Q A;  4JF4 A;  2WKH A;  5CHU A;  1ONG A;  1CK3 A;  4Y0T A;  3A3F A;  3OC2 A;  2WAD A;  2JC7 A;  4DE0 A;  1YMX A;  1BTL A;  3A3I A;  3ZDJ A;  4KEN B;  1XA7 A;  3A3D A;  3P98 A;  5EE8 A;  1MWS A;  1NJ4 A;  3VMA A;  4MEZ A;  2ZM0 A;  3A3E A;  3LCE A;  1IEL A;  4O7D A;  1Q2P A;  1NZU A;  2WYX A;  2WZZ A;  2X02 A;  3JYI A;  4PPR A;  4ZJ3 A;  3IHA A;  4OPY A;  1NYY A;  4K0X A;  1WE4 A;  3C5A A;  4FD8 A;  1FOF A;  4JXS A;  5FAP A;  4QU3 A;  1NY0 A;  1FR6 A;  3GV9 A;  1XGJ A;  2EX2 A;  3HLC A;  3AGE A;  2JCH A;  3ZG8 B;  3I7J A;  1RGZ A;  4IBX A;  4A5R A;  4DDY A;  5CGS A;  1W7F A;  3BRM A;  4RX2 A;  3TSG A;  4DXC A;  5M1A A;  4S2O A;  3PBQ A;  4WBG A;  5EVI D;  5F83 A;  4BD0 A;  2C6W B;  1PZP A;  4UA9 A;  4WEK A;  4EWF A;  3QNB A;  1GA9 A;  5GLC A;  4OPR A;  2J9P A;  1DY6 A;  1GHM A;  3C4P A;  2DRW A;  3G32 A;  3Q81 A;  4EBL A;  3M2K A;  3M6H A;  2BLS A;  2OLV A;  1E4D A;  2Y2O A;  4R0Q A;  1LI0 A;  1CEF A;  2ZC5 B;  2R9W A;  2V1Z A;  5HFO A;  1ESI A;  3QHY A;  5FAS A;  1NXY A;  3RXX A;  4MNR A;  5BOH A;  4Y0O A;  2G2U A;  2ZQD A;  4B88 A;  5F1F A;  3GTC A;  5EPH A;  3UE0 A;  3VP1 A;  4OQI A;  3VOY A;  3ZG0 A;  2WKE A;  3HUO A;  3MZD A;  1SHV A;  4MBK A;  1RCJ A;  1N4O A;  1YM1 A;  3GSG A;  1LLB A;  3ZFZ A;  4EV4 A;  3MFD A;  3W4Q A;  3AGD A;  3WS5 A;  3EQU A;  1BLS A;  2ZMA A;  4R4S A;  2ZC4 B;  5DTS A;  3IF5 A;  4C3Q A;  2XLN A;  3TG9 A;  5FAO A;  5FQK A;  1XXM A;  1K57 A;  5HAI A;  2ZM2 A;  4OH0 A;  4OLD A;  4DE2 A;  4LV0 A;  2R9X A;  2GDN A;  5HW3 A;  4WEJ A;  1U60 A;  4R3J A;  2QMI A;  4JXW A;  1YLZ A;  4QB8 A;  1ERM A;  5M18 A;  1L0D A;  4ZDX A;  1AXB A;  5AQ7 A;  1Q2Q A;  3G2Y A;  3HLW A;  3SS5 A;  3UPP A;  1FR1 A;  5CGX A;  3Q7V A;  1PIO A;  4BL2 A;  3WRT A;  1KGE A;  3GRJ A;  1E3U D;  4K91 A;  4KZ8 A;  5DF9 A;  4DE1 A;  4OPZ A;  1O07 A;  3SOI A;  1N9B A;  1K55 A;  3ISG A;  4KG6 A;  3VFH A;  3MBZ A;  2EX8 A;  4R1G A;  3O87 A;  4QJG A;  4KG5 A;  5HX9 A;  3DWZ A;  1HVB A;  3ZG9 B;  3HLB A;  3Q7Z A;  4JLF A;  4ZBE A;  5GLA A;  3IWQ A;  4OON A;  4RYE A;  4E6X A;  5A92 A;  1YLY A;  3DTM A;  1PI4 A;  4GNU A;  2ZQA A;  3O88 A;  4S2I A;  3W4O A;  2ZJ9 A;  3PBR A;  4ID4 A;  4U3T A;  4OOM A;  4E3O A;  4GDN A;  2Y2K A;  2XH9 A;  2ZC7 A;  3O3V A;  1SKF A;  3S1Y A;  4OQ0 A;  5I94 A;  5E2E A;  1BZA A;  4U0T A;  2Y4A A;  2HP5 A;  2XD5 A;  1ES4 A;  3NIA A;  2QPN A;  2Q9M A;  3OCL A;  5E2H A;  3PAE A;  1K55 C;  1PWC A;  3C7V A;  4S2J A;  3BYD A;  3GVB A;  3WS1 A;  1Z6F A;  2WK0 A;  3FZC A;  3NI9 A;  4QY6 A;  5EOE A;  1WYC A;  3OZH A;  2EXB A;  4OQH A;  4GB7 A;  5EOO A;  1LL9 A;  5HAQ A;  4OP8 A;  1FCM A;  1NYM A;  1SDN A;  3LY4 A;  5GHZ A;  4DKI A;  1VQQ A;  3BEC A;  4KZ5 A;  4S2M A;  3NDG A;  5U47 A;  3RJU A;  5F82 A;  1KE3 A;  5FAT A;  4NET A;  5KMW A;  3VP0 A;  4OP5 A;  1ZG4 A;  4BLM A;  1ES5 A;  3B3X A;  1IYP A;  2X01 A;  2XGN A;  2V2F F;  4PMA A;  1I5Q A;  1KGF A;  3N8R A;  2WGV A;  3WRZ A;  1XA1 A;  3WWX A;  4KZ7 A;  3V3S A;  4B4X A;  5CGW A;  3HLF A;  1YQS A;  3HRE A;  3FYZ A;  4WZ5 A;  3RXW A;  1FCO A;  4WEL A;  1JTD A;  4WM9 A;  3BFF A;  4UHU A;  1ES3 A;  3W8K A;  2JBF A;  1JTG A;  2Y55 A;  3N7W A;  3O86 A;  5DF7 A;  2RL3 A;  3IF6 B;  3LO7 A;  1KDS A;  2EFX A;  2WUQ A;  3PBO A;  5DVA A;  1S6R A;  2Y2M A;  4KZB A;  2I72 A;  1PZO A;  1H5X A;  4LCM A;  3UNW A;  4N9L A;  5FI2 A;  2Y2G A;  5E2G A;  1OME A;  2HP9 A; 
#chains in the Genus database with same CATH topology
 4PM5 A;  3IX8 A;  1RGY A;  4RVA A;  3BFE A;  2XF3 A;  5DTK A;  3PYP A;  2QZ6 A;  3MR0 A;  5DF8 A;  3LGO A;  5CEC A;  3E4P A;  3WS2 A;  3FWL A;  3IXB A;  4D2O A;  5IHV A;  5TR7 A;  3GR2 A;  2A24 B;  1K4E A;  2DCF A;  1IEM A;  2PHY A;  2OSU A;  2V20 A;  5F6A A;  1KVL A;  3NJA A;  4GN2 A;  3O5Y A;  5DKL A;  3OPP A;  2L0W A;  4GD8 A;  3VE3 A;  1K4F A;  4BJP A;  3VSK A;  2ZQC A;  5TBM B;  2JKF A;  3IX4 A;  3EQV A;  4XT2 B;  2FH5 A;  4IVI A;  3C38 A;  3NHQ A;  4X56 A;  2P74 A;  4HP4 A;  5A91 A;  1C3B A;  1NLZ A;  4ESP A;  3H82 B;  1K57 C;  1MXO A;  1LSX A;  4N9K A;  4E3M A;  3VSL A;  4M4X A;  2VGL M;  5JYO A;  5EV0 A;  4GCZ A;  3E2K A;  3IWI A;  1I2S A;  3NC8 A;  3CUE A;  3E4Q A;  4X1L A;  5HAP A;  4Y7P A;  4HBT A;  5J7E A;  4JGR A;  4OOL A;  1ZKJ A;  5FI6 A;  4C6Y A;  2Z6C A;  4DRT A;  2QHK A;  3MFX A;  2IWD A;  2HJ9 C;  4ARZ B;  1TF1 A;  2Y2P A;  4BL3 A;  5E43 A;  4LV1 A;  4MDZ A;  2AVX A;  3CUE C;  4F94 A;  4K0W A;  3EWK A;  3ZYT A;  2W1T A;  2XA7 M;  1W8Y A;  3QP8 A;  4HEF A;  3VP3 A;  2PU2 A;  4N92 A;  2I9V A;  1HTZ A;  2IA2 A;  2OAP 1;  3BWL A;  3M2J A;  3NY4 A;  1L0E A;  4X68 A;  3GEC A;  5J8X A;  4WUJ A;  3UE6 A;  1MPL A;  3G4P A;  4R4R A;  1IYS A;  2ZQ8 A;  4DMZ A;  5EUA A;  1XGI A;  2Y2Q A;  2P9V B;  1BT5 A;  3UDF A;  4CLC B;  3G2Z A;  5CX7 A;  5GHY A;  2J9O A;  4NK3 A;  2VV6 A;  3UDI A;  5D3O A;  3B33 A;  4P6B A;  5DFY A;  4QD4 A;  2EWV A;  3PHY A;  2WAF A;  1CI8 A;  2J80 A;  4GOG A;  2OV5 A;  2XRO A;  1LI9 A;  2ZD8 A;  4O0P A;  4KZ4 A;  3RFB A;  3UO9 A;  3RTY A;  5FQ9 A;  4EUV A;  3HLG A;  2K7S A;  4M3K A;  1ZC2 A;  4D60 A;  3Q7V B;  3UE3 A;  1J9M A;  1MKM A;  3S7O A;  5KSH A;  4XUZ A;  3MXR A;  2WKQ A;  1K56 A;  2E8I A;  2XRN A;  5HD5 A;  1KDW A;  4ETX A;  2VK3 A;  1JWZ A;  4CPK A;  4JGQ A;  3BY8 A;  3KX0 X;  2K2N A;  2EX9 A;  4I3A A;  3PBS A;  1G6A A;  3NOP C;  4EBN A;  3CPT A;  1KE0 A;  4ZJ2 A;  2W3E A;  2Y79 A;  2WGW A;  4I3I A;  4QWO A;  4EBP A;  4GJ4 A;  1G68 A;  4PKY A;  3IXH A;  3VV4 A;  1XX2 A;  2EXA A;  3LI8 A;  1HZO A;  4ZAM A;  3Q82 A;  4JPM A;  1W8Q A;  5GLD A;  3ZVW A;  1OJ5 A;  3GMW A;  5CED A;  3IWO A;  3PBT A;  3MKE A;  3IHB A;  2Z2L B;  3FG8 A;  1GSX A;  4JF4 A;  2WKH A;  4H6J B;  2O9A A;  3A3F A;  2WAD A;  1BTL A;  1Y28 A;  3ZDJ A;  4KEN B;  1XA7 A;  1NJ4 A;  1S66 L;  3LCE A;  1VHM A;  4O7D A;  2X02 A;  3JYI A;  1NYY A;  2WKR A;  4HJ4 A;  1NY0 A;  3AGE A;  3ZG8 B;  1RGZ A;  1GSW A;  1W7F A;  2B95 A;  5F83 A;  3PBQ A;  1V9Z A;  2W3G A;  1PZP A;  3QP4 A;  3C4P A;  1G5U A;  3Q81 A;  5HDC A;  4R0Q A;  1LI0 A;  4EU0 A;  1ESI A;  2GX5 A;  4MNR A;  5F1F A;  2G2U A;  3GTC A;  4Q0I A;  5EPH A;  4OQI A;  3T1X A;  2QWS A;  3ZG0 A;  1SHV A;  3TE8 A;  1YM1 A;  4LRX C;  5EM1 A;  1ZTU A;  1T19 A;  3MFD A;  3WS5 A;  4PHT A;  3MF0 A;  4R4S A;  5LBR A;  5DTS A;  2Q0O A;  4LV0 A;  4JXW A;  5HSQ A;  1ERM A;  5M18 A;  1AXB A;  3HLW A;  3UPP A;  5HPF A;  1WA9 A;  4DE1 A;  1K0K A;  1O07 A;  3MQQ A;  1TD5 A;  3MBZ A;  1S4S A;  4KG5 A;  5HX9 A;  3HLB A;  3LR4 A;  2P08 A;  3Q7Z A;  5GLA A;  3IWQ A;  4E6X A;  3DTM A;  3E4O A;  3ZFZ A;  4S2I A;  3C30 A;  4OOM A;  4GDN A;  2Y2K A;  5I94 A;  4OQ0 A;  1VEU B;  4FUW A;  3T4J A;  1BZA A;  3CHW P;  3NIA A;  2Q9M A;  5E2H A;  3PAE A;  3S7P A;  3C7V A;  3LFV A;  2OAQ 1;  3FZC A;  3S7N A;  3NI9 A;  4QY6 A;  1P9R A;  4X25 A;  2EXB A;  5EOO A;  1SDN A;  1VQQ A;  3BEC A;  4KZ5 A;  3NDG A;  3T4T A;  1KE3 A;  4MN6 A;  5FAT A;  4OP5 A;  4GHI B;  5HDS A;  3B3X A;  2XGN A;  3HJI A;  3WWX A;  3H7W A;  1JNU A;  2H28 A;  1FCO A;  1JTD A;  4WN5 A;  5AJG A;  5L07 A;  2O0Y A;  5DF7 A;  2JBF A;  2EFX A;  2WUQ A;  4WL9 A;  1S6R A;  4KZB A;  4LCM A;  4R70 A;  4KUK A;  4LRZ E;  1FIK A;  1GSV A;  4E3J A;  1P9W A;  3Q07 A;  4Y2F A;  5FSR A;  4LGW A;  4I38 A;  1XPB A;  3A0V A;  2HDQ A;  1JVJ A;  3ZGA B;  2V0W A;  5EVL A;  3ZNY A;  3S7Q A;  2GNX A;  2PD7 A;  1BUE A;  4HOI A;  1K38 A;  1K56 D;  5EVI A;  3VOZ A;  1YKD A;  2FFF B;  2HPB A;  5GHX A;  2OWH A;  4KG2 A;  4HQA A;  1XKZ A;  4B93 A;  4HBU A;  4MMN A;  3P01 A;  5DFX A;  1QME A;  5CTN A;  4ME4 A;  3IXD A;  3A0S A;  1W63 Q;  3IS2 A;  3MZE A;  1PW8 A;  2VJW A;  1NRF A;  2VV8 A;  2W0N A;  2WZX A;  4JXV A;  4E3I A;  1DJC A;  3V39 A;  1QMF A;  5EVI C;  5HDD A;  2ZQ7 A;  4ZTK A;  5FA7 A;  3GDI A;  2XD1 A;  1KE4 A;  2P04 A;  4U0X A;  2O9B A;  3WS0 A;  2C5W B;  5JYP A;  2J3W A;  4KZ3 A;  2M7V A;  4FH4 A;  3EGX C;  3VFF A;  3BFG A;  2ZOH A;  4KQR A;  4ZJ1 A;  1E3U A;  4KUO A;  4P87 A;  4EXO A;  4RA7 A;  1NRJ A;  1XJ2 A;  1GHP A;  3HVF A;  2QJ5 A;  1FSW A;  2Y2L A;  4GS9 A;  1ESU A;  5IS1 A;  5GL9 A;  3N6I A;  1BLC A;  3U2A A;  3LYX A;  3OCN A;  4PM9 A;  3F1P A;  3R7W A;  5IU1 A;  4NG2 A;  3K2N A;  5EEC A;  3UB5 P;  5TGF A;  4LCL A;  3FPV A;  5GLB A;  2ZQ9 A;  1H0M A;  3CMZ A;  3OPL A;  2XSS A;  1H8Y A;  4DJ3 A;  3PAG A;  2Y2H A;  5FAQ A;  1N9N A;  3W4P A;  3LR0 A;  2XQZ A;  3BW6 A;  1WYB A;  2A2L A;  1K6S A;  3CIT A;  4JBF A;  3S22 A;  1XP4 A;  3IF6 A;  5J3W A;  3NCK A;  5HL1 A;  2O99 A;  3B47 A;  3QP2 A;  1SKO A;  2OOL A;  5CEB A;  1TEM A;  1OTD A;  4N1X A;  4OPQ A;  2Y59 A;  3CJM A;  3MQ0 A;  4HHD A;  1LL8 A;  3IF6 C;  4UA6 A;  1LL5 A;  1TVF A;  3E98 A;  1JWV A;  3UPN A;  1ALQ A;  1IKG A;  1K54 A;  4BBT A;  3V5M A;  1G6O A;  4WMC D;  1TS7 A;  5HZH A;  3CAX A;  1PWD A;  2XK1 A;  4P6Z S;  1FSY A;  1I2W A;  3MKF A;  2NUP C;  4OLG A;  1K54 C;  1CJF A;  2ZL1 A;  5A93 A;  1MKI A;  2Y2I A;  5AQ9 A;  1MZU A;  5M19 A;  3D3O A;  3F1N A;  4H8R A;  5CHJ A;  1HLU P;  2W27 A;  1YSQ A;  4EW7 A;  3HUN A;  3ZCZ A;  4OVD A;  4QHC A;  4EQ1 A;  1L2S A;  1TS6 A;  3PBN A;  2PU4 A;  3UE1 A;  4S2P A;  1EWZ A;  4LFU A;  1BLH A;  4BQM A;  2G2W A;  3OPH A;  4DE0 A;  2JC7 A;  1YMX A;  5EE8 A;  3QP6 A;  1MWS A;  3VMA A;  3UMD A;  4MEZ A;  2ZM0 A;  3LIB A;  1PNE A;  1L3L A;  2EWW A;  2WYX A;  1XJ6 A;  3D72 A;  4K0X A;  5HD3 A;  3TJZ C;  3DAV A;  2EX2 A;  4NXF A;  3DTK A;  2JKR M;  3G6O A;  5FEG A;  4HNB A;  3BRM A;  4RX2 A;  2PR5 A;  4S2O A;  4WBG A;  5EVI D;  4BD0 A;  2VLG A;  4WEK A;  1F98 A;  3U4L P;  1Y4O A;  4Z1W A;  1GHM A;  3JVU A;  3P7N A;  2DRW A;  1J3W A;  3G32 A;  3M6H A;  1VET B;  2BLS A;  2OLV A;  2Y2O A;  3TW8 A;  1F5M A;  3JVV A;  2ZC5 B;  2R9W A;  5L8M A;  1NXY A;  3RXX A;  5BOH A;  3IS2 B;  4B88 A;  4BBV A;  2BTF P;  3F1O B;  3VP1 A;  3VOY A;  4GW9 A;  4MBK A;  3MZD A;  4NXB A;  1N4O A;  3MQO A;  3EQU A;  1CF0 A;  1F2K A;  1T1A A;  2ZC4 B;  3K3C A;  4C3Q A;  1G28 A;  5FAO A;  5FQK A;  3OOV A;  2VZW A;  2R9X A;  5HW3 A;  4WEJ A;  1U60 A;  4R3J A;  2QMI A;  1T18 A;  5DJT A;  4ZDX A;  2KDK A;  3WRT A;  1E3U D;  3MXQ A;  4KZ8 A;  4Y15 A;  3SOI A;  1XFN A;  4IJG A;  4JGO A;  2EX8 A;  2VX8 A;  1HVB A;  3ZG9 B;  1DRM A;  4JLF A;  4I5S A;  5A92 A;  3O88 A;  4E3O A;  2ZJ9 A;  3PBR A;  3R4K A;  2XH9 A;  3O3V A;  3T1R A;  1SKF A;  5E2E A;  1S67 L;  3T4O A;  2HP5 A;  2QPN A;  1EW0 A;  4Q0J A;  4EET B;  1AWI A;  3F1P B;  3WS1 A;  1Z6F A;  2WK0 A;  5HWV A;  4HH2 A;  3OZH A;  3LI9 A;  5L09 A;  4YWZ A;  4GB7 A;  5HAQ A;  1LL9 A;  4OP8 A;  1FCM A;  2JN7 A;  2PBD P;  3RJU A;  5U47 A;  3T1S A;  5MC7 A;  4NET A;  1ES5 A;  3FC7 A;  4LRY C;  4PMA A;  2L1M A;  1I5Q A;  1KGF A;  3LIF A;  4AFI A;  4HY8 A;  2M1C A;  4K08 A;  4WZ5 A;  2KLI A;  3BFF A;  4BWI A;  3IF6 B;  5DVA A;  2Y2M A;  1PZO A;  2I72 A;  1H5X A;  5E2G A;  2HP9 A;  5F5Y A;  1H3Q A;  2VGL S;  4EUZ A;  3BLS A;  3MZF A;  4WZ5 C;  4XXR A;  1K6R A;  2JE5 A;  3LIA A;  3SZT A;  1BSG A;  2VKS A;  1W79 A;  1YMS A;  3HBR A;  1MC0 A;  4JXG A;  2WAE A;  4DDS A;  3UDX A;  5A90 A;  4B4Z A;  4L0L A;  4GKU A;  2HDS A;  3UB8 A;  1GA0 A;  3MJQ A;  1Y54 A;  1IYO A;  3ULF A;  4ETZ A;  2YKH A;  2VA0 A;  3IT9 A;  2WKP A;  4S2N A;  4X6T A;  3G35 A;  3UB9 A;  2XA7 S;  2M7U A;  1IKI A;  1DJB A;  4OOY A;  2ZC6 B;  2B18 A;  4IED A;  4HI4 A;  2ZBB A;  2VEA A;  4LV2 A;  2IWB A;  2EFU A;  2ZL1 B;  2EX6 A;  4E3K A;  4S2N C;  4II7 A;  5TBM A;  3SS3 A;  4QPR A;  3F1N B;  4XT2 A;  4MN5 A;  1D1J A;  4X55 A;  3OPR A;  4IVK A;  4HES A;  4GDB A;  1L0F A;  4C75 A;  1MWR A;  1BUL A;  2JHE A;  4IHQ A;  1XJ3 A;  2W1T B;  2XFT A;  4Q8I A;  2XEP A;  3PXP A;  3DW0 A;  3ZHH A;  3NOT C;  2IWC A;  1GHI A;  1FQG A;  3QP5 A;  1KGG A;  2JKR I;  4O8G A;  1OTI A;  3SH8 A;  1DJA A;  1MWU A;  1UWP X;  2V1B A;  2H5S A;  2W3H A;  1W63 M;  2J7V A;  2YKF A;  3E0Y A;  1M6K A;  5FQM A;  2X71 A;  4E04 A;  4E3L A;  3EEH A;  1GCE A;  5E2F A;  1MWT A;  2UWX A;  5FQQ A;  3G30 A;  5CXW A;  5HL6 A;  4ARZ A;  4OKP A;  4JGP A;  3WS4 A;  2Y2N A;  4DJ2 A;  3HLD A;  2O9C A;  3NDE A;  2JKT M;  1UWN X;  2A3U A;  3A3J A;  4GLQ A;  5AVF A;  1D06 A;  4KQO A;  5TFQ A;  5FQI A;  2XDM A;  1H8M A;  3UY6 A;  4UAA A;  3AGF A;  1BLP A;  2LB9 A;  1PWG A;  4L9F A;  1DP6 A;  1X0O A;  4UA7 A;  3G34 A;  1P0Z A;  3CG5 A;  2DNS A;  2HDU A;  5HAR A;  3KSI A;  5EFW A;  1YLP A;  3GQZ A;  1YLT A;  5F69 A;  1FCN A;  2P9V A;  4HP9 A;  4CLC A;  3BEB A;  4E6W A;  3UN7 A;  3MS6 A;  2NUT C;  3KYZ A;  1SDE A;  1O7E A;  2W3D A;  4LLO B;  3BM6 A;  3UME A;  2XR0 A;  4B9O A;  4WF0 A;  5KZH A;  5G4Z A;  4YIN A;  3CPT B;  3T4Q A;  3VE4 A;  4KZ6 A;  2WGW B;  2J3T D;  3LID A;  3BFC A;  1ACF A;  1PYY A;  4CLC C;  4PM7 A;  4MBF A;  1OT9 A;  1ERQ A;  3CZD A;  1DP9 A;  1D7E A;  4PAU A;  2A49 A;  1UGU A;  3V67 A;  2Q9N A;  3IQA A;  1HD8 A;  4EER A;  3LR3 A;  4N1H A;  3W2Z A;  2FZ0 A;  4JF5 A;  1L0G A;  2D02 A;  3HLE A;  2HV1 A;  3BLM A;  4P85 A;  5IT5 A;  5J4E A;  4KZA A;  3C8C A;  4F3L A;  3IXG A;  3V3R A;  3FKV A;  4I39 A;  2HDR A;  2FFY A;  2ZLY A;  3MXS A;  1NZO A;  2GZA A;  3FKW A;  1LSV A;  1PI5 A;  3HUM A;  4Y17 A;  4P0M A;  1YT4 A;  1XJ4 A;  3SH7 A;  1M40 A;  4LEN A;  5FL3 A;  2Y91 A;  4L9G A;  3G31 A;  1KVM A;  5DKK A;  4RQ9 A;  2Z2M B;  4Z9Q A;  5KIZ A;  1ONG A;  4L9E A;  1OT6 A;  3A3I A;  3P98 A;  5L10 A;  2QJ7 A;  2PYP A;  4HJ3 A;  3QP1 A;  2E8J A;  1NZU A;  4PPR A;  3IHA A;  4OPY A;  5FAP A;  4QU3 A;  1FR6 A;  3HLC A;  4A5R A;  4H6J A;  1Z09 A;  5CGS A;  2V0U A;  4DXC A;  3JPU A;  1BYW A;  5M1A A;  2C6W B;  1IOU A;  4EEU A;  4EWF A;  1GA9 A;  4ZRR A;  2P7J A;  2GJ3 A;  2J9P A;  1STZ A;  1CEF A;  2V1Z A;  5A8B A;  3QHY A;  1OTA A;  4Y0O A;  3HJK A;  1LLB A;  4EV4 A;  3W4Q A;  3AGD A;  3CWF A;  2ZMA A;  3IF5 A;  2XLN A;  3TG9 A;  1TS8 A;  1XXM A;  1K57 A;  5HAI A;  2ZM2 A;  4DE2 A;  2GDN A;  1YLZ A;  2Z6D A;  5AVE A;  1Q2Q A;  3G2Y A;  3SS5 A;  2DMW A;  4BL2 A;  3KSF A;  4EES A;  4K91 A;  5DF9 A;  4OPZ A;  4NKP A;  1ODV A;  4R1G A;  4QJG A;  3O87 A;  3DWZ A;  4ZBE A;  4RYE A;  4CLC E;  3A0R A;  1YLY A;  1PI4 A;  4GNU A;  2ZQA A;  3W4O A;  4ID4 A;  3C2W A;  4U3T A;  2W1R A;  2ZC7 A;  2V8F A;  3T4L A;  2Y4A A;  1ES4 A;  1PWC A;  3EGD C;  3H7W B;  3D9Y A;  2LB5 A;  2JKT I;  4NXE A;  3T4K A;  3B42 A;  5EOE A;  5HWT A;  1NYM A;  3LY4 A;  3CLO A;  4S2M A;  1VEU A;  1S1Y A;  3VOL A;  1IYP A;  2X01 A;  3IBR A;  2V2F F;  4YNR A;  3NOU C;  2WGV A;  4R38 A;  3WRZ A;  3V3S A;  4B4X A;  2HGV A;  3HLF A;  1YQS A;  3HRE A;  2ZMF A;  3RXW A;  4WEL A;  2G7U A;  2ACG A;  4WM9 A;  4UHU A;  1ES3 A;  4UEY A;  3W8K A;  3N7W A;  1JTG A;  2PD8 A;  3O86 A;  3LIE A;  4GHI A;  3PBO A;  2K31 A;  3UNW A;  4N9L A;  5EVI B;  1T1C A;  2RCX A;  1ZG6 A;  4X53 A;  4LV3 A;  4Y0U A;  1JWP A;  2V8C A;  1LSW A;  4RX3 A;  3FV7 A;  3LUQ A;  4DN0 A;  3V50 A;  1P97 A;  4CLC D;  4DF6 A;  4G3V A;  4JKT A;  3UPO A;  3T1Q B;  1RP5 A;  1K25 A;  1VB6 A;  4UQI S;  2KX6 A;  2HZ5 A;  5FDH A;  1PRQ A;  2Y2J A;  2B5R A;  5G18 A;  3MSH A;  4DXB A;  3BFD A;  5TJJ A;  1TDL A;  3SW1 A;  3T50 A;  1MY8 A;  2XFS A;  2D01 A;  5L2F A;  4GZB A;  3KSG A;  3L9K A;  3N8S A;  3KSH A;  5CRF A;  3TRC A;  1V9Y A;  1ONH A;  5FEF A;  1LT0 A;  4FCF A;  3SS4 A;  4Q0H A;  4HJ6 A;  4S2L A;  5G4Y A;  4DE3 A;  4KZ9 A;  4F3L B;  5K5B A;  4IUK A;  4YFM A;  2HP6 A;  4GS9 B;  4PM8 A;  3PTE A;  3N8L A;  2BAS A;  2PDR A;  2PR6 A;  3IX3 A;  3BJN A;  4G3W A;  1OTB A;  2HJE A;  5DJU A;  1ES2 A;  3C4O A;  5AQA A;  2L4R A;  4O01 A;  4EQI A;  4WYY A;  1OTE A;  3H9W A;  3R7W B;  2H0T A;  3ZG7 B;  3NBL A;  2J3T C;  3TOI A;  1PW1 A;  3DTE A;  2BG1 A;  3Q1F A;  3ICY A;  4WZ4 A;  1CEG A;  4S2K A;  4I3J A;  3BY9 A;  1IYQ A;  3N4I A;  1E25 A;  1EI5 A;  3VP4 A;  4HIA A;  2H0Y A;  4Y5F A;  4JF6 A;  1OPX A;  2J8Y A;  1LHY A;  1OJG A;  5FDS A;  2WGI A;  3LY3 A;  3DTI A;  1YPR A;  3S4X A;  5I5L A;  3DWK A;  4KQQ A;  2OWJ A;  2VGK A;  2PBY A;  4YOF A;  5CER A;  1NLY A;  1SKO B;  3LEZ A;  4CJN A;  3BQA A;  5EVE A;  2UV0 E;  3HL9 A;  5F1G A;  1YLJ A;  3ZG5 A;  1MBL A;  3M6B A;  2R78 A;  4OQG A;  4PKY G;  3E2L A;  3SH9 A;  1S0W A;  2PT7 A;  1VM1 A;  5AQB A;  2QYB A;  2HF6 A;  1SZV A;  3K3D A;  5FQJ A;  3C7U A;  3OBF A;  2OLU A;  3ZNT A;  1YLW A;  4FTX A;  3VP2 A;  4FSF A;  1KOU A;  2EA9 A;  3IH8 A;  2A24 A;  1A0K A;  3EOI A;  1SCW A;  3BQ8 A;  3L7H A;  2ZM8 A;  4QY5 A;  1ZHH B;  4PM6 A;  4R23 A;  4G3K A;  2VGJ A;  4IUH A;  2H10 A;  3ITB A;  3EEA A;  4X69 A;  2V9A A;  4R3B A;  1TS0 A;  4IBR A;  3ZVT A;  2Y8H A;  4FH2 A;  5DTT A;  5EM0 A;  3QNC A;  1H8Z A;  4KQD A;  3D4F A;  5FI7 A;  3ITA A;  1CI9 A;  2ZC3 B;  5KSC A;  4BEN A;  3H82 A;  4XUX A;  3IH9 A;  4BD1 A;  2WKI A;  5CHM A;  4MN7 A;  3OLO A;  1ERO A;  1IFQ A;  1YAX A;  4WMC A;  5CTM A;  3IBJ A;  2CC1 A;  3KO6 A;  3NEC A;  4MBH A;  4MLL A;  3MMH A;  4E3N A;  1W5D A;  4GD6 A;  1TDG A;  2CMN A;  2QKP A;  5CHU A;  1CK3 A;  4Y0T A;  4HH3 A;  3OC2 A;  1N9L A;  3DBA A;  3A3D A;  3KYQ A;  4BMW A;  3A3E A;  3KYE A;  1IEL A;  1Q2P A;  2WZZ A;  4ZJ3 A;  4P6Z M;  1WE4 A;  3C5A A;  4FD8 A;  1FOF A;  4JXS A;  1N9O A;  3GV9 A;  1XGJ A;  2JCH A;  3NUL A;  3I7J A;  4IBX A;  4DDY A;  2B02 A;  3TSG A;  5HPI A;  4EEP A;  4UA9 A;  3QNB A;  1S1Z A;  3T4S A;  5GLC A;  4CQH A;  4OPR A;  1DY6 A;  4EBL A;  3M2K A;  3LR5 A;  1E4D A;  5HFO A;  4R6L A;  5FAS A;  3PR6 A;  2ZQD A;  3UE0 A;  2ZOI A;  2WKE A;  3HUO A;  5C5K A;  1RCJ A;  3GSG A;  1BLS A;  3RH8 B;  3UB6 A;  1VET A;  4OLD A;  4OH0 A;  3LEQ A;  2KOI A;  1YSP A;  4QB8 A;  1L0D A;  1XFQ A;  5AQ7 A;  3F1O A;  1FR1 A;  5CGX A;  3Q7V A;  1PIO A;  2VV7 A;  1KGE A;  3GRJ A;  1N9B A;  1K55 A;  3ISG A;  4KG6 A;  3VFH A;  2PRF A;  4OON A;  1T1B A;  2PYR A;  4NXG A;  2W3F A;  4WLA A;  3CI6 A;  3S1Y A;  1DP8 A;  3HCY A;  4FOF A;  4U0T A;  5F68 A;  2XD5 A;  1OME A;  4NEE D;  5HWW A;  3OCL A;  1K55 C;  4S2J A;  3BYD A;  3GVB A;  3LIC A;  3UB7 A;  3ZQ5 A;  4X1M A;  1WYC A;  1CQA A;  4OQH A;  5GHZ A;  4UQI M;  4DKI A;  5F82 A;  5KMW A;  3VP0 A;  1ZG4 A;  4BLM A;  1FIL A;  3N8R A;  1NWZ A;  1XA1 A;  4KZ7 A;  4BBU A;  5CGW A;  4LPZ A;  1PFL A;  3FYZ A;  4R3A A;  3T12 B;  2PAV P;  2MJ6 A;  2JKG A;  2INW A;  2Y55 A;  2ZMV A;  4Y13 A;  2RL3 A;  1F9I A;  1S4R A;  4MCW A;  3LO7 A;  1KDS A;  4Y3I A;  3FPW A;  5FI2 A;  2V1A A;  2Y2G A;  3P09 A; 
#chains in the Genus database with same CATH homology
 2RCX A;  4PM5 A;  4E3J A;  3Q07 A;  5FSR A;  1ZG6 A;  1RGY A;  4RVA A;  4X53 A;  4LV3 A;  4EUZ A;  3BFE A;  3BLS A;  1XPB A;  2XF3 A;  3MZF A;  4WZ5 C;  4Y0U A;  1JWP A;  4XXR A;  5DTK A;  1K6R A;  2QZ6 A;  2JE5 A;  4RX3 A;  5DF8 A;  3FV7 A;  5CEC A;  2HDQ A;  3V50 A;  1JVJ A;  3WS2 A;  4DF6 A;  1BSG A;  3FWL A;  3IXB A;  4D2O A;  3ZGA B;  5EVL A;  5IHV A;  1W79 A;  3ZNY A;  4JKT A;  5TR7 A;  1YMS A;  3HBR A;  3GR2 A;  4JXG A;  3UPO A;  2WAE A;  4DDS A;  1BUE A;  1K4E A;  2DCF A;  3UDX A;  1K38 A;  1K56 D;  1RP5 A;  5A90 A;  1IEM A;  1K25 A;  5EVI A;  3VOZ A;  2FFF B;  2HPB A;  5GHX A;  4L0L A;  4B4Z A;  4GKU A;  2OSU A;  2V20 A;  2HDS A;  4KG2 A;  1KVL A;  1GA0 A;  5FDH A;  4GN2 A;  5EVI B;  1Y54 A;  3OPP A;  1XKZ A;  2Y2J A;  2B5R A;  1IYO A;  4GD8 A;  5G18 A;  1K4F A;  4DXB A;  3IT9 A;  4HBU A;  4BJP A;  4S2N A;  3BFD A;  3VSK A;  4X6T A;  1QME A;  1TDL A;  2ZQC A;  5CTN A;  3IXD A;  1MY8 A;  2XFS A;  3G35 A;  3MZE A;  1PW8 A;  5L2F A;  1NRF A;  4GZB A;  1IKI A;  2WZX A;  3EQV A;  3N8S A;  4JXV A;  4E3I A;  1DJB A;  1DJC A;  3V39 A;  5CRF A;  1QMF A;  5EVI C;  4OOY A;  2ZC6 B;  2ZQ7 A;  4ZTK A;  5FA7 A;  1ONH A;  4IVI A;  4X56 A;  4IED A;  2P74 A;  2XD1 A;  5A91 A;  1C3B A;  4FCF A;  4LV2 A;  3SS4 A;  2IWB A;  1KE4 A;  1K57 C;  2EFU A;  4U0X A;  1MXO A;  2EX6 A;  4E3K A;  4S2L A;  4S2N C;  4N9K A;  3WS0 A;  2C5W B;  4DE3 A;  4E3M A;  5JYP A;  3VSL A;  4KZ9 A;  4YFM A;  4KZ3 A;  5JYO A;  4FH4 A;  2HP6 A;  3SS3 A;  3BFG A;  3VFF A;  4PM8 A;  3PTE A;  4KQR A;  3N8L A;  3E2K A;  3IWI A;  1I2S A;  4ZJ1 A;  4X55 A;  1E3U A;  3OPR A;  4IVK A;  4HES A;  4GDB A;  1L0F A;  5AQA A;  3NC8 A;  1ES2 A;  3C4O A;  4P87 A;  4C75 A;  1MWR A;  1BUL A;  4RA7 A;  5HAP A;  4EQI A;  4WYY A;  4Y7P A;  4HBT A;  2H0T A;  1GHP A;  3NBL A;  3ZG7 B;  4OOL A;  3HVF A;  3TOI A;  1ZKJ A;  5FI6 A;  1PW1 A;  4C6Y A;  4DRT A;  2XFT A;  2BG1 A;  3Q1F A;  1FSW A;  4Q8I A;  2Y2L A;  4WZ4 A;  1CEG A;  2IWD A;  1ESU A;  2XEP A;  4S2K A;  3DW0 A;  3ZHH A;  5GL9 A;  2IWC A;  1IYQ A;  1GHI A;  2Y2P A;  1FQG A;  3P09 A;  1KGG A;  4BL3 A;  5E43 A;  4LV1 A;  3N4I A;  1E25 A;  3N6I A;  1BLC A;  4F94 A;  1EI5 A;  3SH8 A;  3VP4 A;  1DJA A;  4K0W A;  3OCN A;  1MWU A;  4PM9 A;  2H0Y A;  2H5S A;  4JF6 A;  1W8Y A;  2J7V A;  5FQM A;  1M6K A;  2X71 A;  4HEF A;  3VP3 A;  4E3L A;  2J8Y A;  2PU2 A;  1GCE A;  5E2F A;  4N92 A;  5EEC A;  1MWT A;  2UWX A;  5FQQ A;  1HTZ A;  4LCL A;  3M2J A;  5TGF A;  3NY4 A;  1LHY A;  5GLB A;  3G30 A;  1L0E A;  2ZQ9 A;  2WGI A;  3CMZ A;  3OPL A;  4X68 A;  5CXW A;  1H8Y A;  3LY3 A;  3PAG A;  3S4X A;  4OKP A;  3WS4 A;  2Y2N A;  3DWK A;  4KQQ A;  2Y2H A;  5FAQ A;  5J8X A;  3HLD A;  3NDE A;  2VGK A;  2PBY A;  1MPL A;  3W4P A;  2A3U A;  3A3J A;  3G4P A;  5CER A;  4R4R A;  3LEZ A;  1IYS A;  2XQZ A;  4CJN A;  2ZQ8 A;  1WYB A;  5EUA A;  1XGI A;  3HL9 A;  4KQO A;  5F1G A;  1K6S A;  2Y2Q A;  2P9V B;  1YLJ A;  3ZG5 A;  1MBL A;  1BT5 A;  3M6B A;  4JBF A;  5TFQ A;  3UDF A;  3G2Z A;  5FQI A;  3S22 A;  2XDM A;  4OQG A;  3UY6 A;  4UAA A;  3AGF A;  1BLP A;  3E2L A;  3SH9 A;  1S0W A;  1XP4 A;  3IF6 A;  1PWG A;  5GHY A;  3NCK A;  2J9O A;  4UA7 A;  3G34 A;  5HL1 A;  1VM1 A;  4NK3 A;  3UDI A;  5D3O A;  5AQB A;  4P6B A;  4QD4 A;  3CG5 A;  2WAF A;  1CI8 A;  5FQJ A;  5CEB A;  4GOG A;  2DNS A;  2HDU A;  2OV5 A;  1LI9 A;  5HAR A;  2ZD8 A;  1TEM A;  1YLP A;  3C7U A;  4N1X A;  4OPQ A;  2OLU A;  4KZ4 A;  3ZNT A;  3GQZ A;  1YLW A;  1YLT A;  3UO9 A;  1FCN A;  2P9V A;  2Y59 A;  5FQ9 A;  3CJM A;  3HLG A;  3BEB A;  3VP2 A;  4E6W A;  3UN7 A;  4M3K A;  4FSF A;  1ZC2 A;  3IF6 C;  3Q7V B;  1SDE A;  3UE3 A;  1O7E A;  3IH8 A;  1J9M A;  5KSH A;  3BM6 A;  4XUZ A;  2XR0 A;  3MXR A;  4UA6 A;  5KZH A;  4YIN A;  1SCW A;  1K56 A;  2E8I A;  1LL5 A;  1KDW A;  2ZM8 A;  4KZ6 A;  4QY5 A;  1TVF A;  4PM6 A;  4R23 A;  1JWV A;  3UPN A;  2WGW B;  1ALQ A;  1IKG A;  1JWZ A;  1K54 A;  2VGJ A;  4CPK A;  2H10 A;  3BFC A;  3ITB A;  1PYY A;  2EX9 A;  4PM7 A;  4X69 A;  3V5M A;  4MBF A;  4R3B A;  4IBR A;  1ERQ A;  3CZD A;  4WMC D;  3ZVT A;  2A49 A;  3PBS A;  2Q9N A;  1G6A A;  3IQA A;  4FH2 A;  5DTT A;  1HD8 A;  1PWD A;  2XK1 A;  4EBN A;  3QNC A;  1H8Z A;  3D4F A;  5FI7 A;  1FSY A;  1KE0 A;  3ITA A;  1CI9 A;  1I2W A;  4N1H A;  4ZJ2 A;  2ZC3 B;  3MKF A;  4JF5 A;  4OLG A;  2WGW A;  5KSC A;  1L0G A;  1K54 C;  3HLE A;  4BEN A;  4XUX A;  5A93 A;  1MKI A;  3BLM A;  4P85 A;  3IH9 A;  4BD1 A;  2WKI A;  4KZA A;  2Y2I A;  3IXG A;  3V3R A;  5CHM A;  5AQ9 A;  4EBP A;  3FKV A;  1G68 A;  1ERO A;  3IXH A;  4WMC A;  5M19 A;  5CTM A;  2HDR A;  2FFY A;  1XX2 A;  2ZLY A;  2EXA A;  4H8R A;  3MXS A;  5CHJ A;  1NZO A;  2CC1 A;  3FKW A;  1PI5 A;  3HUM A;  4MBH A;  4P0M A;  1HZO A;  4MLL A;  3Q82 A;  4JPM A;  4ZAM A;  1W8Q A;  3HUN A;  5GLD A;  4E3N A;  1YT4 A;  3SH7 A;  3ZCZ A;  1M40 A;  4LEN A;  4OVD A;  1W5D A;  4QHC A;  3ZVW A;  1L2S A;  3PBN A;  2PU4 A;  2Y91 A;  3GMW A;  5CED A;  3UE1 A;  3IWO A;  3PBT A;  4S2P A;  3MKE A;  3G31 A;  1EWZ A;  3IHB A;  1BLH A;  1KVM A;  4GD6 A;  2G2W A;  2Z2L B;  1TDG A;  3OPH A;  4BQM A;  2Z2M B;  4Z9Q A;  4JF4 A;  2WKH A;  5CHU A;  1ONG A;  1CK3 A;  4Y0T A;  3A3F A;  3OC2 A;  2WAD A;  2JC7 A;  4DE0 A;  1YMX A;  1BTL A;  3A3I A;  3ZDJ A;  4KEN B;  1XA7 A;  3A3D A;  3P98 A;  5EE8 A;  1MWS A;  1NJ4 A;  3VMA A;  4MEZ A;  2ZM0 A;  3A3E A;  3LCE A;  1IEL A;  4O7D A;  1Q2P A;  1NZU A;  2WYX A;  2WZZ A;  2X02 A;  3JYI A;  4PPR A;  4ZJ3 A;  3IHA A;  4OPY A;  1NYY A;  4K0X A;  1WE4 A;  3C5A A;  4FD8 A;  1FOF A;  4JXS A;  5FAP A;  4QU3 A;  1NY0 A;  1FR6 A;  3GV9 A;  1XGJ A;  2EX2 A;  3HLC A;  3AGE A;  2JCH A;  3ZG8 B;  3I7J A;  1RGZ A;  4IBX A;  4A5R A;  4DDY A;  5CGS A;  1W7F A;  3BRM A;  4RX2 A;  3TSG A;  4DXC A;  5M1A A;  4S2O A;  3PBQ A;  4WBG A;  5EVI D;  5F83 A;  4BD0 A;  2C6W B;  1PZP A;  4UA9 A;  4WEK A;  4EWF A;  3QNB A;  1GA9 A;  5GLC A;  4OPR A;  2J9P A;  1DY6 A;  1GHM A;  3C4P A;  2DRW A;  3G32 A;  3Q81 A;  4EBL A;  3M2K A;  3M6H A;  2BLS A;  2OLV A;  1E4D A;  2Y2O A;  4R0Q A;  1LI0 A;  1CEF A;  2ZC5 B;  2R9W A;  2V1Z A;  5HFO A;  1ESI A;  3QHY A;  5FAS A;  1NXY A;  3RXX A;  4MNR A;  5BOH A;  4Y0O A;  2G2U A;  2ZQD A;  4B88 A;  5F1F A;  3GTC A;  5EPH A;  3UE0 A;  3VP1 A;  4OQI A;  3VOY A;  3ZG0 A;  2WKE A;  3HUO A;  3MZD A;  1SHV A;  4MBK A;  1RCJ A;  1N4O A;  1YM1 A;  3GSG A;  1LLB A;  3ZFZ A;  4EV4 A;  3MFD A;  3W4Q A;  3AGD A;  3WS5 A;  3EQU A;  1BLS A;  2ZMA A;  4R4S A;  2ZC4 B;  5DTS A;  3IF5 A;  4C3Q A;  2XLN A;  3TG9 A;  5FAO A;  5FQK A;  1XXM A;  1K57 A;  5HAI A;  2ZM2 A;  4OH0 A;  4OLD A;  4DE2 A;  4LV0 A;  2R9X A;  2GDN A;  5HW3 A;  4WEJ A;  1U60 A;  4R3J A;  2QMI A;  4JXW A;  1YLZ A;  4QB8 A;  1ERM A;  5M18 A;  1L0D A;  4ZDX A;  1AXB A;  5AQ7 A;  1Q2Q A;  3G2Y A;  3HLW A;  3SS5 A;  3UPP A;  1FR1 A;  5CGX A;  3Q7V A;  1PIO A;  4BL2 A;  3WRT A;  1KGE A;  3GRJ A;  1E3U D;  4K91 A;  4KZ8 A;  5DF9 A;  4DE1 A;  4OPZ A;  1O07 A;  3SOI A;  1N9B A;  1K55 A;  3ISG A;  4KG6 A;  3VFH A;  3MBZ A;  2EX8 A;  4R1G A;  3O87 A;  4QJG A;  4KG5 A;  5HX9 A;  3DWZ A;  1HVB A;  3ZG9 B;  3HLB A;  3Q7Z A;  4JLF A;  4ZBE A;  5GLA A;  3IWQ A;  4OON A;  4RYE A;  4E6X A;  5A92 A;  1YLY A;  3DTM A;  1PI4 A;  4GNU A;  2ZQA A;  3O88 A;  4S2I A;  3W4O A;  2ZJ9 A;  3PBR A;  4ID4 A;  4U3T A;  4OOM A;  4E3O A;  4GDN A;  2Y2K A;  2XH9 A;  2ZC7 A;  3O3V A;  1SKF A;  3S1Y A;  4OQ0 A;  5I94 A;  5E2E A;  1BZA A;  4U0T A;  2Y4A A;  2HP5 A;  2XD5 A;  1ES4 A;  3NIA A;  2QPN A;  2Q9M A;  3OCL A;  5E2H A;  3PAE A;  1K55 C;  1PWC A;  3C7V A;  4S2J A;  3BYD A;  3GVB A;  3WS1 A;  1Z6F A;  2WK0 A;  3FZC A;  3NI9 A;  4QY6 A;  5EOE A;  1WYC A;  3OZH A;  2EXB A;  4OQH A;  4GB7 A;  5EOO A;  1LL9 A;  5HAQ A;  4OP8 A;  1FCM A;  1NYM A;  1SDN A;  3LY4 A;  5GHZ A;  4DKI A;  1VQQ A;  3BEC A;  4KZ5 A;  4S2M A;  3NDG A;  5U47 A;  3RJU A;  5F82 A;  1KE3 A;  5FAT A;  4NET A;  5KMW A;  3VP0 A;  4OP5 A;  1ZG4 A;  4BLM A;  1ES5 A;  3B3X A;  1IYP A;  2X01 A;  2XGN A;  2V2F F;  4PMA A;  1I5Q A;  1KGF A;  3N8R A;  2WGV A;  3WRZ A;  1XA1 A;  3WWX A;  4KZ7 A;  3V3S A;  4B4X A;  5CGW A;  3HLF A;  1YQS A;  3HRE A;  3FYZ A;  4WZ5 A;  3RXW A;  1FCO A;  4WEL A;  1JTD A;  4WM9 A;  3BFF A;  4UHU A;  1ES3 A;  3W8K A;  2JBF A;  1JTG A;  2Y55 A;  3N7W A;  3O86 A;  5DF7 A;  2RL3 A;  3IF6 B;  3LO7 A;  1KDS A;  2EFX A;  2WUQ A;  3PBO A;  5DVA A;  1S6R A;  2Y2M A;  4KZB A;  2I72 A;  1PZO A;  1H5X A;  4LCM A;  3UNW A;  4N9L A;  5FI2 A;  2Y2G A;  5E2G A;  1OME A;  2HP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...