3ULFA

The light state structure of the blue-light photoreceptor aureochrome1 lov
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
135
structure length
135
Chain Sequence
EDPDYSLVKALQMAQQNFVITDASLPDNPIVYASRGFLTLTGYSLDQILGRNCRFLQGPETDPRAVDKIRNAITKGVDTSVCLLNYRQDGTTFWNLFFVAGLRDSKGNIVNYVGVQSKVSEDYAKLLVNEQNIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Aureochrome1
publication title Crystal structures of Aureochrome1 LOV suggest new design strategies for optogenetics.
pubmed doi rcsb
source organism Vaucheria frigida
total genus 43
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ulfA00
4KUKA 5DJUA 4HI4A 1OTAA 2D02A 3EWKA 5DKLA 3LI9A 4LLOB 1G28A 4HJ4A 2L4RA 3E4PA 4I5SA 3FC7A 5F6AA 2A24B 1JNUA 4I39A 3F1PB 3BWLA 3RH8B 1T19A 4EETB 1TS0A 2OOLA 2JHEA 1F98A 4HIAA 1KOUA 5DKKA 1UWNX 4H6JB 5HD5A 2V1BA 5IU1A 3K3DA 4LRXC 5HDDA 2PD8A 3F1OB 3VE4A 2V0UA 1OTBA 1OJGA 1Y28A 1N9OA 3LIFA 3UE6A 3LYXA 1LSWA 3NJAA 3LIAA 4PKYA 5HDCA 2PR6A 4B9OA 3KX0X 4HHDA 4JGRA 4I3JA 4L9FA 3MR0A 1S1YA 1TS7A 5TBMB 2PYPA 3LUQA 1XJ6A 3D72A 4I3IA 2PYRA 1S67L 5KIZA 2GJ3A 1V9ZA 1GSVA 3H82A 1V9YA 4M4XA 4GS9A 1OTIA 2P7JA 4WL9A 4HH2A 4HP4A 3VE3A 5F5YA 1VB6A 1DP9A 3H7WB 2V0WA 3A0VA 5J7EA 3C2WA 3G6OA 3MQOA 1X0OA 1S1ZA 1OTDA 5EFWA 4HJ3A 2WKRA 3BY8A 3UMDA 2KDKA 2Z6CA 3UMEA 1P97A 4LRYC 3RTYA 3SW1A 3UB8A 3IBRA 4LRZE 1TS8A 3MJQA 2VLGA 1S4SA 3C8CA 1S4RA 4L9GA 5DJTA 4HJ6A 5HSQA 1UGUA 2A24A 3F1NB 5HWTA 5G4ZA 4KUOA 1ODVA 2VV8A 3F1PA 1XJ4A 4WF0A 4JGPA 4K08A 4NXBA 1D7EA 1GSWA 2QKPA 3B33A 4I3AA 2Z6DA 4H6JA 5A8BA 5HDSA 4EQ1A 3F1OA 3PHYA 4XT2B 4L9EA 2VEAA 2I9VA 4R38A 3UB9A 5HZHA 4HH3A 2EA9A 3MXQA 4NXFA 3ZQ5A 4JGOA 2PDRA 3MQQA 2L0WA 2ZBBA 1DP6A 5TBMA 2QJ5A 5AVFA 4R6LA 4LPZA 2V1AA 2WKQA 3BY9A 2QHKA 3OLOA 1OTEA 4JGQA 3A0RA 3EEHA 1NWZA 1T1BA 2HV1A 3NHQA 5J4EA 3LIDA 3ICYA 3H9WA 5HD3A 2H28A 4WUJA 2K7SA 3UB7A 2VV6A 3H7WA 3LI8A 4NXEA 1T1CA 4EERA 4GW9A 2VV7A 3HJIA 2INWA 3A0SA 3CLOA 4DJ2A 1MZUA 2QWSA 4F3LB 1S66L 4WLAA 5AVEA 3ULFA 2QJ7A 2M1CA 4F3LA 4EW7A 3IS2B 4MN6A 2PHYA 1OT9A 3GDIA 4EXOA 2R78A 4PKYG 2YKHA 5J3WA 4MN5A 3UB6A 4EEUA 4R3AA 4BBUA 3F1NA 1XJ2A 1F9IA 1LL8A 4DJ3A 1P0ZA 2BASA 4EESA 2OWHA 3NOPC 4BBVA 4KQDA 1EW0A 3LIEA 2V9AA 4E04A 4HP9A 2PR5A 5HWWA 2ZOHA 4XT2A 1LSVA 2J80A 4GHIB 1GSXA 3E4OA 2W27A 3MFXA 3NOUC 4GHIA 3NOTC 2ZOIA 4GCZA 1WA9A 3VOLA 3HJKA 2CMNA 4WN5A 2W0NA 1T1AA 5IS1A 2WKPA 1XJ3A 2KX6A 1D06A 1DRMA 2D01A 4HNBA 2L1MA 4I38A 4HY8A 3LICA 1LSXA 3CAXA 3PYPA 2PD7A 4R70A 3H82B 1N9NA 1T18A 4GS9B 3LIBA 4BBTA 4EEPA 2OWJA 5F68A 2B02A 4HQAA 4HOIA 1XFNA 1OJ5A 3K3CA 1N9LA 3FG8A 4RQ9A 3GECA 3P7NA 5G4YA 1DP8A 1OT6A 2JN7A 1BYWA 4YWZA 5I5LA 4NXGA 2YKFA 5F69A 3E4QA 3CWFA 1XFQA 1UWPX 5HWVA 3T50A 3IS2A 1TS6A 1LT0A
chains in the Genus database with same CATH superfamily
4KUKA 2JKRI 1L3LA 1HVBA 1OTAA 2D02A 2VX8A 5CHJA 2PT7A 3QP6A 4ZJ2A 3LI9A 3TOIA 3LCEA 4HJ4A 4AFIA 3OCLA 1MPLA 2VK3A 3E4PA 1K54A 2Y8HA 2A24B 1LLBA 4DXBA 3F1PB 3NECA 1ES3A 3BWLA 3RH8B 1N9BA 2WAFA 3ZHHA 1T19A 1MWUA 1PI5A 3C30A 3S7NA 1K54C 3WS1A 4HIAA 4ESPA 3TRCA 3TW8A 5KMWA 4H6JB 1TVFA 5IU1A 3K3DA 3DWZA 5HDDA 3UO9A 2PD8A 5U47A 3O3VA 3A3JA 1VHMA 3PBNA 2V0UA 1YAXA 1P9WA 3LYXA 3S7QA 4ZRRA 3S1YA 4WMCA 4HESA 3KX0X 3E98A 3L9KA 4JGRA 4NEED 2X01A 3IX3A 4OQGA 3MR0A 2OLVA 2CC1A 2PYPA 5FEFA 4UA7A 3BFDA 3KYEA 5A91A 3V3RA 2GJ3A 4ZBEA 4CQHA 3SOIA 2ZMAA 3H82A 4UQIM 1HD8A 3V5MA 1ESIA 1OTIA 3UPPA 4OPQA 1ONGA 2PAVP 4NK3A 4HH2A 4HP4A 4LGWA 1VB6A 4DKIA 1NLZA 1U60A 4IHQA 4OONA 4GB7A 2V0WA 3A0VA 3C2WA 4R0QA 4ARZA 2JKTI 3K2NA 2V8CA 3MZDA 4KZ9A 1OTDA 5DFYA 3HLDA 1K6RA 2VGKA 4HJ3A 1O07A 1QMFA 3UMDA 2XGNA 2EXBA 5EUAA 5CEBA 1STZA 1NYYA 2OAQ1 2O0YA 5FQIA 3ZG0A 1XA1A 2NUTC 2VLGA 3LO7A 4CJNA 1ES2A 1PNEA 2ZC6B 1I5QA 4OPZA 2Y4AA 2A24A 5HWTA 5G4ZA 4WEJA 3LR0A 3F1PA 5CGXA 4U3TA 4DXCA 1BT5A 1RCJA 4Y13A 4JGPA 4ZTKA 3FKWA 1D7EA 3B33A 4K0WA 3E2KA 2G2WA 2Z6DA 3ZG8B 4H6JA 2B95A 5I94A 4NKPA 1YLWA 4L9EA 2EX8A 2I9VA 3T4TA 1H8MA 2ZQ9A 4HH3A 2Z2MB 5HARA 4OVDA 2EFUA 4O7DA 5DTTA 2L0WA 2OAP1 2ZBBA 4GDNA 2QJ5A 5HAPA 5HL1A 3WRZA 3ZNYA 5FQQA 2V1AA 3G2ZA 2XH9A 3IWOA 2JBFA 3ZG7B 4EQIA 3UPOA 2ZL1A 1E3UA 4X55A 4LV3A 3LR3A 2BLSA 3AGFA 3FKVA 1TF1A 3NHQA 4X56A 1MY8A 4WZ5C 3MKEA 2H28A 4GZBA 4WUJA 2EFXA 2J7VA 5DTKA 1FCMA 1SKOB 4NXEA 1CK3A 4LFUA 4PM8A 5MC7A 2VV7A 3A0SA 4MLLA 5CECA 3VFHA 3G34A 3VSKA 3S22A 1ALQA 1F5MA 1LHYA 3GTCA 1WE4A 4DDSA 5FEGA 2KLIA 3S7OA 3IX4A 4F3LA 2Y2JA 3AGDA 3OPHA 3O87A 2ZQ7A 1XGIA 2PHYA 1OT9A 2XRNA 2Q9NA 4DE0A 3A3FA 3ZDJA 2O9CA 2XEPA 2A49A 4BBUA 3IF5A 2WGWA 4DJ3A 4BMWA 1P0ZA 2WGIA 3NOPC 2QPNA 2ZQDA 4ZJ1A 4BL3A 4BBVA 1VEUA 4KQDA 2ZQ8A 3LIEA 5EM1A 2XA7S 4E04A 2PR5A 3E0YA 4JF6A 5HWWA 4RA7A 2Y55A 1LSVA 3DAVA 1HLUP 1GSXA 3PBQA 4HBUA 2XDMA 1PZOA 3A3IA 3LGOA 4GCZA 2DRWA 4KZ8A 1WA9A 2Y2MA 4GN2A 4P6ZM 3HJKA 4U0TA 2W0NA 2QYBA 4BWIA 1KE4A 2KX6A 3GV9A 4HNBA 2HGVA 3W4QA 3GVBA 4EU0A 1PZPA 3BLMA 5GLDA 1LSXA 3KYZA 3MXRA 1MXOA 3PYPA 1TDLA 4R70A 4Y0UA 4ZJ3A 2MJ6A 1T18A 4GS9B 2P74A 1N4OA 3MFDA 1KE3A 1ACFA 4HQAA 4MCWA 1OJ5A 1SKOA 3LFVA 4YFMA 4IUHA 4OQ0A 4KQRA 2XD1A 3T4JA 4LV1A 5FATA 4NXGA 4RVAA 3JYIA 3T1SA 1BLCA 3GR2A 3HLWA 1UWPX 2HJ9C 4BLMA 2HP9A 1TS6A 5EECA 3PAGA 5DJUA 2PU4A 1CEGA 3TG9A 4HI4A 4R3JA 5A93A 3EWKA 5DKLA 2ZMVA 4GJ4A 3QP2A 4I5SA 1IYOA 1KVMA 2BG1A 3WS0A 2G2UA 1E25A 2R9XA 4E3NA 3BFGA 1EROA 2HPBA 3DBAA 4IVKA 1NRJA 4EETB 3EGDC 5CTMA 5E2GA 2JHEA 1F98A 1YKDA 1GHPA 5DKKA 1UWNX 3C4OA 4K91A 5JYOA 4LRXC 3T1XA 1M6KA 2ZQAA 4Y0OA 3SH8A 3VSLA 1OJGA 1Y28A 4WM9A 2LB9A 2Y2QA 4Z9QA 4ETZA 3NJAA 5CEDA 3TJZC 5GHZA 5CX7A 4PKYA 3T4SA 3WS2A 4HHDA 4X6TA 4I3JA 3C38A 3OBFA 1W63M 1YLJA 2X71A 1TS7A 3LUQA 1W8YA 3N7WA 4C75A 4I3IA 1S67L 5GLBA 3ITBA 2WADA 1NXYA 5GLAA 3C7UA 3IWIA 1K57A 3CZDA 3BFFA 3IHAA 3C7VA 3IQAA 4GS9A 3PR6A 4M4XA 4RX2A 1BULA 1FILA 1GA9A 1C3BA 4EUVA 2EWVA 4BD1A 2XLNA 3HREA 4MNRA 4DE2A 3BJNA 1DP9A 1QMEA 4A5RA 4ARZB 1ZC2A 4QU3A 1K57C 1XGJA 2W3GA 2ZJ9A 4QD4A 3D4FA 3VFFA 3UE1A 1X0OA 1S1ZA 4WYYA 4CLCC 1WYBA 5EFWA 5FI7A 1XA7A 1E4DA 1NZOA 1YMSA 2Z6CA 1K55C 3NDEA 5CTNA 2VJWA 4X1MA 3RJUA 3WWXA 2FZ0A 3MS6A 2HDUA 3IBRA 4G3VA 3GSGA 4LRZE 4E3IA 1TD5A 4KZ7A 4X69A 1S4SA 1S4RA 3KO6A 3IX8A 1PRQA 3M6BA 3CMZA 4UQIS 1S6RA 5DJTA 4HJ6A 3NCKA 3ZNTA 5HSQA 1UGUA 2I72A 3F1NB 4Q0IA 3PBSA 4WF0A 5HPFA 1PWCA 3OPLA 3PAEA 3T1RA 1H3QA 1L0FA 4JBFA 1FSYA 3G31A 4IUKA 1GSWA 3ZFZA 4I3AA 4FUWA 1FQGA 5F82A 3JVUA 1PI4A 2B18A 4MBFA 1YLTA 3RFBA 5AQBA 2W3DA 4QB8A 1W63Q 3BEBA 3Q07A 1NJ4A 3LY4A 5FAQA 4NXFA 3EOIA 1EI5A 1Q2QA 5F1GA 2ZLYA 4XUXA 2ZM0A 4Y2FA 1K0KA 3HLBA 4R6LA 5IHVA 1FIKA 2ZL1B 2RCXA 3N8RA 3BY9A 4CLCE 3DWKA 3OLOA 4E3LA 5A90A 4JXSA 4JGQA 3BFCA 3ZVWA 2VGLM 3FPWA 1I2WA 3DTMA 4RYEA 5AJGA 5J4EA 4JXGA 3LIDA 1PWGA 3H9WA 4P0MA 1ESUA 4N9LA 3DTIA 5HD3A 2HDRA 2K7SA 3UB7A 2VV6A 1GCEA 2XQZA 3Q1FA 1FSWA 2W1RA 2VA0A 2XD5A 3UDIA 4OP8A 3W2ZA 3HJIA 2INWA 4KQQA 5KZHA 3LR4A 3PTEA 2ZD8A 2V2FF 1FR6A 2VGJA 4WBGA 4G3KA 1W79A 4F3LB 1S66L 3ULFA 2QJ7A 3D9YA 4B93A 2WK0A 3SS5A 5GLCA 3IS2B 1BUEA 2ZC4B 4MN6A 4KZAA 3V3SA 2V20A 3GDIA 2AVXA 5EVID 1XX2A 4EXOA 2R78A 1L0GA 3U2AA 1K25A 3UDFA 1O7EA 3VV4A 3UB6A 5EOEA 2Y2PA 4EEUA 4R3AA 1ZHHB 2WGWB 4OPYA 3F1NA 1J3WA 3BLSA 1F9IA 1LL8A 3R7WA 1ERMA 2J3TD 2Z2LB 4L0LA 2BASA 1VEUB 2OWHA 3MXSA 1W7FA 3IXGA 2V9AA 1H0MA 3G30A 3M6HA 1BZAA 5TGFA 2ZOHA 4WZ4A 4IEDA 2FH5A 4E3MA 2J80A 5FAOA 2O9BA 1CF0A 1Z6FA 4GHIA 5KSCA 3NOTC 3T4KA 1VQQA 4PAUA 3EQUA 3T12B 3FYZA 3WRTA 1CQAA 4FD8A 3IH8A 2WGVA 4WEKA 4WN5A 4OOMA 3V50A 5J8XA 1NZUA 2Y2GA 2PRFA 2K2NA 1IOUA 4NETA 1XJ3A 4Z1WA 1D06A 2IWCA 2WZZA 5F83A 1XKZA 2R9WA 5LBRA 3LICA 2Y2NA 4EWFA 2PD7A 3UPNA 2UV0E 5FSRA 3HLCA 4R4SA 3C5AA 1G5UA 2OWJA 2ZC7A 4U0XA 2OLUA 5F68A 3UY6A 4OP5A 4KZ5A 1ZKJA 2B02A 2JC7A 4HOIA 5HAIA 5DF7A 4GOGA 3DW0A 2JKRM 3OOVA 5HL6A 3GECA 1DP8A 2Q9MA 2JN7A 1ZG6A 1IYQA 2WKIA 4R3BA 1LL5A 5I5LA 4P6ZS 2YKFA 1EWZA 2HF6A 5FDHA 3E4QA 4EBNA 4S2IA 1PIOA 1KGFA 4X25A 1PW8A 3T50A 3IS2A 3FZCA 1NYMA 1PYYA 3IBJA 3PXPA 2UWXA 4O01A 4OKPA 2Y79A 3HCYA 3PBTA 1YQSA 4LLOB 1SKFA 1FOFA 1G28A 2Y59A 2L4RA 5F6AA 3SS3A 4DF6A 4Y17A 4I39A 2XF3A 3OC2A 4O0PA 4R23A 4Y0TA 4EV4A 4FCFA 5GHYA 4OLGA 1KE0A 1TS0A 2H0YA 3BM6A 1OPXA 5AQ9A 4ETXA 3MSHA 4BD0A 3F1OB 3V67A 4IJGA 5EM0A 3VE4A 1OTBA 3ZYTA 1N9OA 4KG6A 1PWDA 5EPHA 5EVIB 3LIAA 1YLYA 1K6SA 3QNBA 2JE5A 3R4KA 4GDBA 4EBLA 2IA2A 2WKEA 1S1YA 4FH4A 5TBMB 1SCWA 4GNUA 5TFQA 3D72A 2PYRA 3NULA 4GD6A 5KIZA 2V8FA 1JTGA 2JKTM 1GSVA 1BTLA 1DJAA 1V9YA 4C3QA 4LV0A 1AXBA 2P7JA 4WL9A 1MBLA 4S2JA 1H5XA 4BL2A 4Y15A 1ZTUA 5J7EA 3CPTA 2C5WB 1LI9A 4S2MA 2GX5A 1Q2PA 1A0KA 3VMAA 3MQOA 2ZM2A 3A3EA 4P6BA 3T4OA 2K31A 1IFQA 4K0XA 2WKRA 2XA7M 3LR5A 3BY8A 2VZWA 3PBRA 1KGEA 1CI9A 2GDNA 3SW1A 3UB8A 2JCHA 4MMNA 3ZG9B 4FTXA 4G3WA 3C8CA 3NIAA 3VP1A 4L9GA 3CUEA 3DTEA 1JWZA 3WS5A 4LCMA 3IH9A 5CGWA 4KUOA 1ODVA 2VV8A 2XFTA 1XJ4A 1BLHA 1CJFA 3W4PA 2E8JA 5L8MA 4K08A 5CRFA 5HW3A 2QKPA 4II7A 4KG2A 3SS4A 3VP3A 1E3UD 2ZM8A 5JYPA 5A8BA 5HDSA 2ZQCA 1F2KA 1GHIA 3F1OA 5EV0A 4XT2B 1K4EA 2VEAA 2FFFB 1WYCA 4OLDA 4R38A 3UB9A 3Q81A 3JPUA 5EVIA 2W1TB 4N9KA 2XSSA 4ID4A 1RGYA 1Y54A 3MXQA 4YOFA 5FI6A 3MQQA 5HFOA 4O8GA 1DP6A 5TBMA 2WYXA 3BFEA 3KSHA 4KQOA 5EVIC 4LPZA 4LENA 2WKQA 3LEQA 3EQVA 3W4OA 5HPIA 3A0RA 3W8KA 3CI6A 4UHUA 2J3TC 2BTFP 2Y91A 5FASA 4EUZA 4Y7PA 4PM7A 1D1JA 5E2FA 3UNWA 2QZ6A 3LI8A 1G6AA 1MWSA 5E43A 5E2EA 1K56D 5FA7A 5HAQA 1FCNA 1JWVA 4GW9A 3ZCZA 5FQKA 2O9AA 2C6WB 4JXVA 4B4XA 3UE3A 4GKUA 1L0DA 3OZHA 1L0EA 4QY5A 2QWSA 4LCLA 5AVEA 2XK1A 3TE8A 5DF9A 3IWQA 3MF0A 3NBLA 5KSHA 3KSGA 4EW7A 3ISGA 1G6OA 4KZ4A 1XP4A 3BRMA 2W3FA 2HDSA 2WZXA 4PKYG 2YKHA 5J3WA 4N92A 2DNSA 4MBKA 4MN5A 3HVFA 3QP1A 3Q7VB 3R7WB 1HTZA 2E8IA 5FQJA 2XFSA 3P98A 1BSGA 2W3EA 2H10A 5FI2A 4EESA 4E3OA 1IYSA 3MBZA 4YINA 5M1AA 1EW0A 3IXBA 5DF8A 4XT2A 5L2FA 3UE0A 4GHIB 1JVJA 3E4OA 3HUMA 2W27A 5G18A 2VKSA 1KDSA 2ZOIA 4D2OA 2W1TA 1H8YA 1S0WA 4FOFA 4CPKA 4Q8IA 2O99A 4S2LA 1SDNA 3VOLA 2W3HA 2CMNA 5FAPA 3KSIA 1T1AA 3BQAA 1GA0A 1Z09A 1MKMA 3N4IA 3UN7A 4FSFA 3NC8A 2LB5A 4DMZA 5FQMA 1IKGA 4MEZA 2M7UA 1YM1A 2L1MA 2OSUA 5GL9A 3L7HA 2A2LA 3CAXA 3NI9A 5L09A 4B4ZA 3A3DA 5EE8A 2JKGA 3HLFA 2J9PA 3HUNA 5K5BA 4EEPA 3O88A 4FH2A 3FV7A 4F94A 1XFNA 1N9LA 3FG8A 4E6XA 2OV5A 1BYWA 5M18A 5GHXA 3T1QB 2Y2IA 2J3WA 3IHBA 2X02A 3QP5A 4P85A 3HLGA 2HZ5A 4OPRA 2IWDA 4DE1A 4M3KA 1LT0A 2B5RA 2HDQA 1DY6A 5DTSA 2Y2LA 4S2PA 3VP4A 1FR1A 5DFXA 3VOYA 3KYQA 5CGSA 3Q7VA 3HL9A 3OPRA 3Q7ZA 3FC7A 1TEMA 1JNUA 3MQ0A 3BQ8A 1YT4A 5TJJA 1PFLA 4QPRA 4BJPA 3P09A 3CJMA 3M2JA 1CEFA 3OCNA 3LY3A 4HBTA 3GMWA 2OOLA 4R4RA 5EOOA 5CXWA 4KZ3A 4MBHA 2FFYA 1KOUA 2Y2OA 3ITAA 2H0TA 3DTKA 4GD8A 5HD5A 2V1BA 2P9VB 2V1ZA 2EX6A 4JPMA 1RP5A 3LIFA 3UE6A 2A3UA 2G7UA 1LSWA 4CLCD 4Q0JA 3N8SA 1BLSA 2EX9A 5HDCA 2PR6A 4KG5A 4B9OA 4PM6A 4HEFA 4UA9A 4L9FA 5CHUA 3M2KA 2DCFA 4ME4A 1XPBA 1IELA 1XJ6A 2ZMFA 4IVIA 5L07A 5FDSA 4JKTA 4Y3IA 4BENA 4WZ5A 1V9ZA 3WS4A 3UDXA 2H5SA 3NY4A 2IWBA 4QHCA 1DJBA 5FL3A 3IXHA 3C4PA 1IEMA 4Y5FA 2RL3A 3SZTA 3EEAA 1SHVA 3TSGA 3CPTB 3VE3A 5F5YA 1Y4OA 3H7WB 2EXAA 3VP0A 1TDGA 3B3XA 4N1HA 3G4PA 4ZAMA 3G6OA 4X53A 4OQHA 2HP6A 4OH0A 3KSFA 5L10A 4OOLA 5D3OA 2KDKA 3UMEA 1P97A 3IF6B 2M7VA 4LRYC 2GZAA 4IBXA 1AWIA 3O86A 3RTYA 5FQ9A 2J9OA 4JF4A 4UA6A 1NLYA 1TS8A 3MJQA 3S4XA 3MZEA 2Q0OA 5E2HA 2XROA 1FCOA 4WMCD 4PPRA 3ZG5A 4BQMA 1KVLA 3SH9A 4X68A 3RXXA 1VM1A 1YSPA 4D60A 4KENB 3QNCA 3VP2A 1CI8A 4OOYA 1K56A 3ZGAB 5CERA 3UB5P 4NXBA 1LL9A 4QJGA 1KDWA 3GQZA 3MKFA 3QHYA 5EVLA 4NG2A 4C6YA 2P9VA 3T4QA 4EQ1A 3PHYA 4DRTA 4Q0HA 5DVAA 2ZC3B 3MMHA 1PW1A 1JWPA 4S2NA 3RXWA 2PBDP 5HZHA 4OQIA 1ES5A 2EA9A 3B42A 5M19A 1W8QA 3AGEA 3BYDA 2JKFA 1ZG4A 2PBYA 3ZQ5A 4JGOA 2PDRA 4X1LA 4S2NC 2PU2A 4JLFA 5TR7A 4EBPA 5AVFA 3HLEA 3I7JA 3SH7A 3HUOA 2P08A 3HBRA 5HX9A 2QHKA 1OTEA 1IYPA 1L2SA 2ZC5B 3EEHA 3V39A 1NWZA 5BOHA 1T1BA 2HV1A 1RGZA 3ICYA 4UAAA 5A92A 3CG5A 4E6WA 1VETB 3FWLA 2HP5A 5AQAA 4QWOA 1J9MA 2P04A 3H7WA 1H8ZA 1T1CA 2NUPC 4CLCB 4EERA 3GRJA 2EWWA 5IT5A 1YPRA 1I2SA 4WELA 3CLOA 4DJ2A 3FPVA 1MZUA 4WLAA 2EX2A 1XXMA 4R1GA 3IF6A 2ACGA 2M1CA 2Y2KA 4PM9A 3OPPA 4H8RA 4N1XA 1MKIA 3CITA 3U4LP 4LV2A 4QY6A 2WKHA 2Y2HA 3B47A 1KGGA 2WUQA 4GLQA 3IF6C 3P01A 2QMIA 4MN7A 1W5DA 1IKIA 4DN0A 2KOIA 1P9RA 3CUEC 3G2YA 4XUZA 1XJ2A 1LI0A 3S7PA 1GHMA 1ES4A 3O5YA 3NDGA 4KZBA 3E2LA 4PM5A 3D3OA 4XXRA 5C5KA 2VGLS 5AQ7A 4ZDXA 4HP9A 3N8LA 3IXDA 4PMAA 5CHMA 1DJCA 4JF5A 2DMWA 3G35A 1BLPA 4E3KA 3MFXA 4DE3A 3NOUC 3QP8A 4MDZA 4S2KA 3Q82A 2XR0A 1MWTA 1ERQA 4UEYA 3QP4A 5IS1A 1G68A 2WKPA 1DRMA 2D01A 4S2OA 3VOZA 4YNRA 4RX3A 1MC0A 4I38A 3BW6A 4DDYA 4HY8A 4KZ6A 1YSQA 4JXWA 1M40A 1YLPA 1K4FA 3EGXC 1NRFA 3H82B 1N9NA 5F1FA 3LIBA 3G32A 4BBTA 1VETA 3JVVA 1YMXA 5EVEA 3K3CA 4RQ9A 3CHWP 4E3JA 3IT9A 3P7NA 1YLZA 4B88A 1JTDA 5G4YA 4CLCA 1ONHA 1OT6A 3N6IA 1OMEA 1HZOA 1SDEA 4P87A 3T4LA 4YWZA 1K38A 1NY0A 1K55A 3PBOA 3ZVTA 5F69A 1SZVA 3CWFA 3MZFA 1XFQA 3BECA 4IBRA 2WAEA 2HJEA 5HWVA 2GNXA 3LEZA 2J8YA 4PHTA 1MWRA
chains in the Genus database with same CATH topology
4KUKA 2JKRI 5DJUA 3IBJA 3PXPA 4O01A 4HI4A 1OTAA 2D02A 2VX8A 2Y79A 3HCYA 3PBTA 2PT7A 3EWKA 5DKLA 5DFXA 2ZMVA 3KYQA 3LI9A 4LLOB 4GJ4A 1G28A 4HJ4A 4AFIA 3OCLA 2L4RA 3E4PA 4I5SA 3FC7A 5F6AA 2Y8HA 2A24B 1JNUA 3MQ0A 3BQ8A 4I39A 3OC2A 4O0PA 3F1PB 5TJJA 4QPRA 4BJPA 3BWLA 3RH8B 3DBAA 3OCNA 1T19A 1NRJA 4EETB 3EGDC 1TS0A 2OOLA 3C30A 3S7NA 1OPXA 2JHEA 1F98A 4HIAA 1YKDA 3TRCA 3TW8A 4ETXA 1KOUA 5DKKA 1UWNX 4H6JB 5HD5A 2V1BA 5IU1A 3K3DA 4LRXC 5HDDA 2PD8A 3F1OB 3V67A 4IJGA 3VE4A 1VHMA 3PBNA 2V0UA 1OTBA 1OJGA 1Y28A 3ZYTA 2LB9A 1N9OA 1YAXA 3LIFA 3UE6A 2G7UA 1P9WA 3LYXA 4ETZA 1LSWA 3NJAA 3LIAA 4CLCD 3TJZC 3S7QA 4Q0JA 5CX7A 4PKYA 3T4SA 4ZRRA 5HDCA 2PR6A 3R4KA 4B9OA 3KX0X 4HHDA 3E98A 4JGRA 4NEED 4I3JA 4L9FA 2IA2A 3C38A 3MR0A 3OBFA 1S1YA 1W63M 1TS7A 4ME4A 5TBMB 2PYPA 3LUQA 1XJ6A 2ZMFA 3D72A 4I3IA 2PYRA 1S67L 4Y3IA 5KIZA 2GJ3A 1V9ZA 2JKTM 1LT0A 1GSVA 4CQHA 3H82A 1V9YA 5FL3A 4UQIM 4M4XA 4GS9A 1OTIA 3PR6A 4Y5FA 2P7JA 4WL9A 4HH2A 4PHTA 4HP4A 3EEAA 4EUVA 2EWVA 3VE3A 5F5YA 1VB6A 1NLZA 3BJNA 1DP9A 3H7WB 4IHQA 4ARZB 1ZTUA 2V0WA 3A0VA 5J7EA 3C2WA 2W3GA 3G6OA 2GX5A 4ARZA 3MQOA 2JKTI 1X0OA 3K2NA 1S1ZA 1OTDA 5DFYA 4CLCC 5EFWA 2K31A 1IFQA 3T4OA 4HJ3A 2WKRA 2XA7M 3KSFA 3LR5A 3BY8A 4OOLA 2VZWA 3UMDA 2KDKA 2Z6CA 3UMEA 3PBRA 1P97A 2VJWA 2M7VA 4LRYC 2GZAA 2FZ0A 1STZA 3RTYA 3SW1A 3UB8A 3IBRA 4G3VA 2OAQ1 4LRZE 2O0YA 4MMNA 1NLYA 1TD5A 1TS8A 3MJQA 2NUTC 2VLGA 4G3WA 1S4SA 3C8CA 1S4RA 4L9GA 3CUEA 3KO6A 2XROA 4UQIS 5DJTA 4HJ6A 5HSQA 1UGUA 1YSPA 2A24A 3F1NB 4Q0IA 5HWTA 5G4ZA 4KUOA 1ODVA 2VV8A 4WEJA 3LR0A 3F1PA 1XJ4A 3PBSA 4WF0A 5HPFA 4JGPA 1H3QA 5L8MA 4K08A 4NXBA 4IUKA 1D7EA 1GSWA 2QKPA 3B33A 4II7A 4I3AA 2Z6DA 4H6JA 3T4QA 5HDSA 5A8BA 4EQ1A 4NKPA 3F1OA 3PHYA 4Q0HA 4XT2B 4L9EA 3JVUA 2VEAA 2B18A 3MMHA 2I9VA 3RFBA 3T4TA 1H8MA 4R38A 3UB9A 2W3DA 5HZHA 2W1TB 1W63Q 4HH3A 2EA9A 2XSSA 3B42A 3MXQA 4NXFA 3EOIA 3ZQ5A 4YOFA 4JGOA 2PDRA 3MQQA 4O8GA 2L0WA 2OAP1 2ZBBA 1DP6A 5TBMA 2QJ5A 3KSHA 4KQOA 4Y2FA 5AVFA 4R6LA 4LPZA 2V1AA 2P08A 2WKQA 3BY9A 4CLCE 3EQVA 2QHKA 3OLOA 1OTEA 5HPIA 4JGQA 3A0RA 3EEHA 2VGLM 3FPWA 1NWZA 3LR3A 1T1BA 3CI6A 1TF1A 2HV1A 5AJGA 3NHQA 5J4EA 2J3TC 3LIDA 3ICYA 3H9WA 5HD3A 2H28A 4WUJA 2K7SA 3UB7A 2VV6A 2P04A 3H7WA 3LI8A 2W1RA 1T1CA 4NXEA 2VA0A 2NUPC 3W2ZA 4CLCB 5MC7A 4EERA 4GW9A 2VV7A 2EWWA 2O9AA 2INWA 3A0SA 3HJIA 5IT5A 3LR4A 4WELA 3UE3A 3CLOA 4DJ2A 1F5MA 3FPVA 4G3KA 1MZUA 2QWSA 4F3LB 1S66L 4WLAA 5AVEA 3ULFA 2KLIA 3S7OA 3TE8A 5DF9A 2QJ7A 4B93A 2M1CA 4F3LA 3MF0A 5KSHA 3KSGA 4EW7A 3IS2B 1G6OA 3CITA 4MN6A 2PHYA 1OT9A 2XRNA 3GDIA 2W3FA 4EXOA 2R78A 4PKYG 3B47A 3U2AA 2YKHA 5J3WA 4GLQA 4MN5A 3VV4A 3P01A 2O9CA 3UB6A 4MN7A 4EEUA 4R3AA 1ZHHB 3R7WB 4BBUA 4DN0A 2KOIA 1P9RA 3CUEC 3F1NA 1XJ2A 1F9IA 1LL8A 4DJ3A 3R7WA 2J3TD 3S7PA 3O5YA 4BMWA 3D3OA 1P0ZA 4L0LA 2W3EA 2BASA 4EESA 2OWHA 3NOPC 5C5KA 4BBVA 4KQDA 1EW0A 3LIEA 2XA7S 2V9AA 4E04A 4HP9A 2PR5A 3E0YA 5HWWA 2ZOHA 4XT2A 1LSVA 2FH5A 2J80A 4GHIB 2DMWA 1GSXA 2O9BA 3PBQA 3E4OA 2W27A 3MFXA 3NOUC 4GHIA 2VKSA 3NOTC 3T4KA 4PAUA 2ZOIA 4MDZA 2W1TA 3EQUA 4GCZA 4FOFA 1WA9A 2O99A 4P6ZM 2W3HA 3VOLA 3HJKA 2CMNA 3KSIA 4WEKA 4WN5A 4OOMA 4UEYA 2W0NA 1T1AA 5IS1A 3BQAA 2QYBA 2K2NA 2WKPA 1MKMA 4BWIA 1IOUA 1XJ3A 2KX6A 4Z1WA 4FSFA 1D06A 1DRMA 2D01A 2LB5A 4DMZA 4HNBA 2HGVA 2M7UA 4EU0A 5LBRA 4YNRA 1MC0A 2L1MA 4I38A 3BW6A 4HY8A 3LICA 1YSQA 1LSXA 3KYZA 2A2LA 3CAXA 3PYPA 2PD7A 3EGXC 4R70A 3H82B 1N9NA 2MJ6A 1T18A 4GS9B 3LIBA 4BBTA 5K5BA 3JVVA 4EEPA 2OWJA 5F68A 2B02A 4HQAA 4HOIA 1XFNA 4MCWA 1OJ5A 3K3CA 3LFVA 1N9LA 2JKRM 3OOVA 4IUHA 3FG8A 5HL6A 4RQ9A 3GECA 3P7NA 5G4YA 4CLCA 1DP8A 1OT6A 2JN7A 1BYWA 3T4JA 3T4LA 4YWZA 2J3WA 5I5LA 4P6ZS 3PBOA 4NXGA 2YKFA 2HF6A 5F69A 3E4QA 3CWFA 1XFQA 1UWPX 2HJEA 2HJ9C 5HWVA 3T50A 3IS2A 2GNXA 1TS6A 2VGLS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUK A;  5DJU A;  4HI4 A;  1OTA A;  2D02 A;  3EWK A;  5DKL A;  3LI9 A;  4LLO B;  1G28 A;  4HJ4 A;  2L4R A;  3E4P A;  4I5S A;  3FC7 A;  5F6A A;  2A24 B;  1JNU A;  4I39 A;  3F1P B;  3BWL A;  3RH8 B;  1T19 A;  4EET B;  1TS0 A;  2OOL A;  2JHE A;  1F98 A;  4HIA A;  1KOU A;  5DKK A;  1UWN X;  4H6J B;  5HD5 A;  2V1B A;  5IU1 A;  3K3D A;  4LRX C;  5HDD A;  2PD8 A;  3F1O B;  3VE4 A;  2V0U A;  1OTB A;  1OJG A;  1Y28 A;  1N9O A;  3LIF A;  3UE6 A;  3LYX A;  1LSW A;  3NJA A;  3LIA A;  4PKY A;  5HDC A;  2PR6 A;  4B9O A;  3KX0 X;  4HHD A;  4JGR A;  4I3J A;  4L9F A;  3MR0 A;  1S1Y A;  1TS7 A;  5TBM B;  2PYP A;  3LUQ A;  1XJ6 A;  3D72 A;  4I3I A;  2PYR A;  1S67 L;  5KIZ A;  2GJ3 A;  1V9Z A;  1GSV A;  3H82 A;  1V9Y A;  4M4X A;  4GS9 A;  1OTI A;  2P7J A;  4WL9 A;  4HH2 A;  4HP4 A;  3VE3 A;  5F5Y A;  1VB6 A;  1DP9 A;  3H7W B;  2V0W A;  3A0V A;  5J7E A;  3C2W A;  3G6O A;  3MQO A;  1X0O A;  1S1Z A;  1OTD A;  5EFW A;  4HJ3 A;  2WKR A;  3BY8 A;  3UMD A;  2KDK A;  2Z6C A;  3UME A;  1P97 A;  4LRY C;  3RTY A;  3SW1 A;  3UB8 A;  3IBR A;  4LRZ E;  1TS8 A;  3MJQ A;  2VLG A;  1S4S A;  3C8C A;  1S4R A;  4L9G A;  5DJT A;  4HJ6 A;  5HSQ A;  1UGU A;  2A24 A;  3F1N B;  5HWT A;  5G4Z A;  4KUO A;  1ODV A;  2VV8 A;  3F1P A;  1XJ4 A;  4WF0 A;  4JGP A;  4K08 A;  4NXB A;  1D7E A;  1GSW A;  2QKP A;  3B33 A;  4I3A A;  2Z6D A;  4H6J A;  5A8B A;  5HDS A;  4EQ1 A;  3F1O A;  3PHY A;  4XT2 B;  4L9E A;  2VEA A;  2I9V A;  4R38 A;  3UB9 A;  5HZH A;  4HH3 A;  2EA9 A;  3MXQ A;  4NXF A;  3ZQ5 A;  4JGO A;  2PDR A;  3MQQ A;  2L0W A;  2ZBB A;  1DP6 A;  5TBM A;  2QJ5 A;  5AVF A;  4R6L A;  4LPZ A;  2V1A A;  2WKQ A;  3BY9 A;  2QHK A;  3OLO A;  1OTE A;  4JGQ A;  3A0R A;  3EEH A;  1NWZ A;  1T1B A;  2HV1 A;  3NHQ A;  5J4E A;  3LID A;  3ICY A;  3H9W A;  5HD3 A;  2H28 A;  4WUJ A;  2K7S A;  3UB7 A;  2VV6 A;  3H7W A;  3LI8 A;  4NXE A;  1T1C A;  4EER A;  4GW9 A;  2VV7 A;  3HJI A;  2INW A;  3A0S A;  3CLO A;  4DJ2 A;  1MZU A;  2QWS A;  4F3L B;  1S66 L;  4WLA A;  5AVE A;  3ULF A;  2QJ7 A;  2M1C A;  4F3L A;  4EW7 A;  3IS2 B;  4MN6 A;  2PHY A;  1OT9 A;  3GDI A;  4EXO A;  2R78 A;  4PKY G;  2YKH A;  5J3W A;  4MN5 A;  3UB6 A;  4EEU A;  4R3A A;  4BBU A;  3F1N A;  1XJ2 A;  1F9I A;  1LL8 A;  4DJ3 A;  1P0Z A;  2BAS A;  4EES A;  2OWH A;  3NOP C;  4BBV A;  4KQD A;  1EW0 A;  3LIE A;  2V9A A;  4E04 A;  4HP9 A;  2PR5 A;  5HWW A;  2ZOH A;  4XT2 A;  1LSV A;  2J80 A;  4GHI B;  1GSX A;  3E4O A;  2W27 A;  3MFX A;  3NOU C;  4GHI A;  3NOT C;  2ZOI A;  4GCZ A;  1WA9 A;  3VOL A;  3HJK A;  2CMN A;  4WN5 A;  2W0N A;  1T1A A;  5IS1 A;  2WKP A;  1XJ3 A;  2KX6 A;  1D06 A;  1DRM A;  2D01 A;  4HNB A;  2L1M A;  4I38 A;  4HY8 A;  3LIC A;  1LSX A;  3CAX A;  3PYP A;  2PD7 A;  4R70 A;  3H82 B;  1N9N A;  1T18 A;  4GS9 B;  3LIB A;  4BBT A;  4EEP A;  2OWJ A;  5F68 A;  2B02 A;  4HQA A;  4HOI A;  1XFN A;  1OJ5 A;  3K3C A;  1N9L A;  3FG8 A;  4RQ9 A;  3GEC A;  3P7N A;  5G4Y A;  1DP8 A;  1OT6 A;  2JN7 A;  1BYW A;  4YWZ A;  5I5L A;  4NXG A;  2YKF A;  5F69 A;  3E4Q A;  3CWF A;  1XFQ A;  1UWP X;  5HWV A;  3T50 A;  3IS2 A;  1TS6 A;  1LT0 A; 
#chains in the Genus database with same CATH topology
 4KUK A;  2JKR I;  1L3L A;  1HVB A;  1OTA A;  2D02 A;  2VX8 A;  5CHJ A;  2PT7 A;  3QP6 A;  4ZJ2 A;  3LI9 A;  3TOI A;  3LCE A;  4HJ4 A;  4AFI A;  3OCL A;  1MPL A;  2VK3 A;  3E4P A;  1K54 A;  2Y8H A;  2A24 B;  1LLB A;  4DXB A;  3F1P B;  3NEC A;  1ES3 A;  3BWL A;  3RH8 B;  1N9B A;  2WAF A;  3ZHH A;  1T19 A;  1MWU A;  1PI5 A;  3C30 A;  3S7N A;  1K54 C;  3WS1 A;  4HIA A;  4ESP A;  3TRC A;  3TW8 A;  5KMW A;  4H6J B;  1TVF A;  5IU1 A;  3K3D A;  3DWZ A;  5HDD A;  3UO9 A;  2PD8 A;  5U47 A;  3O3V A;  3A3J A;  1VHM A;  3PBN A;  2V0U A;  1YAX A;  1P9W A;  3LYX A;  3S7Q A;  4ZRR A;  3S1Y A;  4WMC A;  4HES A;  3KX0 X;  3E98 A;  3L9K A;  4JGR A;  4NEE D;  2X01 A;  3IX3 A;  4OQG A;  3MR0 A;  2OLV A;  2CC1 A;  2PYP A;  5FEF A;  4UA7 A;  3BFD A;  3KYE A;  5A91 A;  3V3R A;  2GJ3 A;  4ZBE A;  4CQH A;  3SOI A;  2ZMA A;  3H82 A;  4UQI M;  1HD8 A;  3V5M A;  1ESI A;  1OTI A;  3UPP A;  4OPQ A;  1ONG A;  2PAV P;  4NK3 A;  4HH2 A;  4HP4 A;  4LGW A;  1VB6 A;  4DKI A;  1NLZ A;  1U60 A;  4IHQ A;  4OON A;  4GB7 A;  2V0W A;  3A0V A;  3C2W A;  4R0Q A;  4ARZ A;  2JKT I;  3K2N A;  2V8C A;  3MZD A;  4KZ9 A;  1OTD A;  5DFY A;  3HLD A;  1K6R A;  2VGK A;  4HJ3 A;  1O07 A;  1QMF A;  3UMD A;  2XGN A;  2EXB A;  5EUA A;  5CEB A;  1STZ A;  1NYY A;  2OAQ 1;  2O0Y A;  5FQI A;  3ZG0 A;  1XA1 A;  2NUT C;  2VLG A;  3LO7 A;  4CJN A;  1ES2 A;  1PNE A;  2ZC6 B;  1I5Q A;  4OPZ A;  2Y4A A;  2A24 A;  5HWT A;  5G4Z A;  4WEJ A;  3LR0 A;  3F1P A;  5CGX A;  4U3T A;  4DXC A;  1BT5 A;  1RCJ A;  4Y13 A;  4JGP A;  4ZTK A;  3FKW A;  1D7E A;  3B33 A;  4K0W A;  3E2K A;  2G2W A;  2Z6D A;  3ZG8 B;  4H6J A;  2B95 A;  5I94 A;  4NKP A;  1YLW A;  4L9E A;  2EX8 A;  2I9V A;  3T4T A;  1H8M A;  2ZQ9 A;  4HH3 A;  2Z2M B;  5HAR A;  4OVD A;  2EFU A;  4O7D A;  5DTT A;  2L0W A;  2OAP 1;  2ZBB A;  4GDN A;  2QJ5 A;  5HAP A;  5HL1 A;  3WRZ A;  3ZNY A;  5FQQ A;  2V1A A;  3G2Z A;  2XH9 A;  3IWO A;  2JBF A;  3ZG7 B;  4EQI A;  3UPO A;  2ZL1 A;  1E3U A;  4X55 A;  4LV3 A;  3LR3 A;  2BLS A;  3AGF A;  3FKV A;  1TF1 A;  3NHQ A;  4X56 A;  1MY8 A;  4WZ5 C;  3MKE A;  2H28 A;  4GZB A;  4WUJ A;  2EFX A;  2J7V A;  5DTK A;  1FCM A;  1SKO B;  4NXE A;  1CK3 A;  4LFU A;  4PM8 A;  5MC7 A;  2VV7 A;  3A0S A;  4MLL A;  5CEC A;  3VFH A;  3G34 A;  3VSK A;  3S22 A;  1ALQ A;  1F5M A;  1LHY A;  3GTC A;  1WE4 A;  4DDS A;  5FEG A;  2KLI A;  3S7O A;  3IX4 A;  4F3L A;  2Y2J A;  3AGD A;  3OPH A;  3O87 A;  2ZQ7 A;  1XGI A;  2PHY A;  1OT9 A;  2XRN A;  2Q9N A;  4DE0 A;  3A3F A;  3ZDJ A;  2O9C A;  2XEP A;  2A49 A;  4BBU A;  3IF5 A;  2WGW A;  4DJ3 A;  4BMW A;  1P0Z A;  2WGI A;  3NOP C;  2QPN A;  2ZQD A;  4ZJ1 A;  4BL3 A;  4BBV A;  1VEU A;  4KQD A;  2ZQ8 A;  3LIE A;  5EM1 A;  2XA7 S;  4E04 A;  2PR5 A;  3E0Y A;  4JF6 A;  5HWW A;  4RA7 A;  2Y55 A;  1LSV A;  3DAV A;  1HLU P;  1GSX A;  3PBQ A;  4HBU A;  2XDM A;  1PZO A;  3A3I A;  3LGO A;  4GCZ A;  2DRW A;  4KZ8 A;  1WA9 A;  2Y2M A;  4GN2 A;  4P6Z M;  3HJK A;  4U0T A;  2W0N A;  2QYB A;  4BWI A;  1KE4 A;  2KX6 A;  3GV9 A;  4HNB A;  2HGV A;  3W4Q A;  3GVB A;  4EU0 A;  1PZP A;  3BLM A;  5GLD A;  1LSX A;  3KYZ A;  3MXR A;  1MXO A;  3PYP A;  1TDL A;  4R70 A;  4Y0U A;  4ZJ3 A;  2MJ6 A;  1T18 A;  4GS9 B;  2P74 A;  1N4O A;  3MFD A;  1KE3 A;  1ACF A;  4HQA A;  4MCW A;  1OJ5 A;  1SKO A;  3LFV A;  4YFM A;  4IUH A;  4OQ0 A;  4KQR A;  2XD1 A;  3T4J A;  4LV1 A;  5FAT A;  4NXG A;  4RVA A;  3JYI A;  3T1S A;  1BLC A;  3GR2 A;  3HLW A;  1UWP X;  2HJ9 C;  4BLM A;  2HP9 A;  1TS6 A;  5EEC A;  3PAG A;  5DJU A;  2PU4 A;  1CEG A;  3TG9 A;  4HI4 A;  4R3J A;  5A93 A;  3EWK A;  5DKL A;  2ZMV A;  4GJ4 A;  3QP2 A;  4I5S A;  1IYO A;  1KVM A;  2BG1 A;  3WS0 A;  2G2U A;  1E25 A;  2R9X A;  4E3N A;  3BFG A;  1ERO A;  2HPB A;  3DBA A;  4IVK A;  1NRJ A;  4EET B;  3EGD C;  5CTM A;  5E2G A;  2JHE A;  1F98 A;  1YKD A;  1GHP A;  5DKK A;  1UWN X;  3C4O A;  4K91 A;  5JYO A;  4LRX C;  3T1X A;  1M6K A;  2ZQA A;  4Y0O A;  3SH8 A;  3VSL A;  1OJG A;  1Y28 A;  4WM9 A;  2LB9 A;  2Y2Q A;  4Z9Q A;  4ETZ A;  3NJA A;  5CED A;  3TJZ C;  5GHZ A;  5CX7 A;  4PKY A;  3T4S A;  3WS2 A;  4HHD A;  4X6T A;  4I3J A;  3C38 A;  3OBF A;  1W63 M;  1YLJ A;  2X71 A;  1TS7 A;  3LUQ A;  1W8Y A;  3N7W A;  4C75 A;  4I3I A;  1S67 L;  5GLB A;  3ITB A;  2WAD A;  1NXY A;  5GLA A;  3C7U A;  3IWI A;  1K57 A;  3CZD A;  3BFF A;  3IHA A;  3C7V A;  3IQA A;  4GS9 A;  3PR6 A;  4M4X A;  4RX2 A;  1BUL A;  1FIL A;  1GA9 A;  1C3B A;  4EUV A;  2EWV A;  4BD1 A;  2XLN A;  3HRE A;  4MNR A;  4DE2 A;  3BJN A;  1DP9 A;  1QME A;  4A5R A;  4ARZ B;  1ZC2 A;  4QU3 A;  1K57 C;  1XGJ A;  2W3G A;  2ZJ9 A;  4QD4 A;  3D4F A;  3VFF A;  3UE1 A;  1X0O A;  1S1Z A;  4WYY A;  4CLC C;  1WYB A;  5EFW A;  5FI7 A;  1XA7 A;  1E4D A;  1NZO A;  1YMS A;  2Z6C A;  1K55 C;  3NDE A;  5CTN A;  2VJW A;  4X1M A;  3RJU A;  3WWX A;  2FZ0 A;  3MS6 A;  2HDU A;  3IBR A;  4G3V A;  3GSG A;  4LRZ E;  4E3I A;  1TD5 A;  4KZ7 A;  4X69 A;  1S4S A;  1S4R A;  3KO6 A;  3IX8 A;  1PRQ A;  3M6B A;  3CMZ A;  4UQI S;  1S6R A;  5DJT A;  4HJ6 A;  3NCK A;  3ZNT A;  5HSQ A;  1UGU A;  2I72 A;  3F1N B;  4Q0I A;  3PBS A;  4WF0 A;  5HPF A;  1PWC A;  3OPL A;  3PAE A;  3T1R A;  1H3Q A;  1L0F A;  4JBF A;  1FSY A;  3G31 A;  4IUK A;  1GSW A;  3ZFZ A;  4I3A A;  4FUW A;  1FQG A;  5F82 A;  3JVU A;  1PI4 A;  2B18 A;  4MBF A;  1YLT A;  3RFB A;  5AQB A;  2W3D A;  4QB8 A;  1W63 Q;  3BEB A;  3Q07 A;  1NJ4 A;  3LY4 A;  5FAQ A;  4NXF A;  3EOI A;  1EI5 A;  1Q2Q A;  5F1G A;  2ZLY A;  4XUX A;  2ZM0 A;  4Y2F A;  1K0K A;  3HLB A;  4R6L A;  5IHV A;  1FIK A;  2ZL1 B;  2RCX A;  3N8R A;  3BY9 A;  4CLC E;  3DWK A;  3OLO A;  4E3L A;  5A90 A;  4JXS A;  4JGQ A;  3BFC A;  3ZVW A;  2VGL M;  3FPW A;  1I2W A;  3DTM A;  4RYE A;  5AJG A;  5J4E A;  4JXG A;  3LID A;  1PWG A;  3H9W A;  4P0M A;  1ESU A;  4N9L A;  3DTI A;  5HD3 A;  2HDR A;  2K7S A;  3UB7 A;  2VV6 A;  1GCE A;  2XQZ A;  3Q1F A;  1FSW A;  2W1R A;  2VA0 A;  2XD5 A;  3UDI A;  4OP8 A;  3W2Z A;  3HJI A;  2INW A;  4KQQ A;  5KZH A;  3LR4 A;  3PTE A;  2ZD8 A;  2V2F F;  1FR6 A;  2VGJ A;  4WBG A;  4G3K A;  1W79 A;  4F3L B;  1S66 L;  3ULF A;  2QJ7 A;  3D9Y A;  4B93 A;  2WK0 A;  3SS5 A;  5GLC A;  3IS2 B;  1BUE A;  2ZC4 B;  4MN6 A;  4KZA A;  3V3S A;  2V20 A;  3GDI A;  2AVX A;  5EVI D;  1XX2 A;  4EXO A;  2R78 A;  1L0G A;  3U2A A;  1K25 A;  3UDF A;  1O7E A;  3VV4 A;  3UB6 A;  5EOE A;  2Y2P A;  4EEU A;  4R3A A;  1ZHH B;  2WGW B;  4OPY A;  3F1N A;  1J3W A;  3BLS A;  1F9I A;  1LL8 A;  3R7W A;  1ERM A;  2J3T D;  2Z2L B;  4L0L A;  2BAS A;  1VEU B;  2OWH A;  3MXS A;  1W7F A;  3IXG A;  2V9A A;  1H0M A;  3G30 A;  3M6H A;  1BZA A;  5TGF A;  2ZOH A;  4WZ4 A;  4IED A;  2FH5 A;  4E3M A;  2J80 A;  5FAO A;  2O9B A;  1CF0 A;  1Z6F A;  4GHI A;  5KSC A;  3NOT C;  3T4K A;  1VQQ A;  4PAU A;  3EQU A;  3T12 B;  3FYZ A;  3WRT A;  1CQA A;  4FD8 A;  3IH8 A;  2WGV A;  4WEK A;  4WN5 A;  4OOM A;  3V50 A;  5J8X A;  1NZU A;  2Y2G A;  2PRF A;  2K2N A;  1IOU A;  4NET A;  1XJ3 A;  4Z1W A;  1D06 A;  2IWC A;  2WZZ A;  5F83 A;  1XKZ A;  2R9W A;  5LBR A;  3LIC A;  2Y2N A;  4EWF A;  2PD7 A;  3UPN A;  2UV0 E;  5FSR A;  3HLC A;  4R4S A;  3C5A A;  1G5U A;  2OWJ A;  2ZC7 A;  4U0X A;  2OLU A;  5F68 A;  3UY6 A;  4OP5 A;  4KZ5 A;  1ZKJ A;  2B02 A;  2JC7 A;  4HOI A;  5HAI A;  5DF7 A;  4GOG A;  3DW0 A;  2JKR M;  3OOV A;  5HL6 A;  3GEC A;  1DP8 A;  2Q9M A;  2JN7 A;  1ZG6 A;  1IYQ A;  2WKI A;  4R3B A;  1LL5 A;  5I5L A;  4P6Z S;  2YKF A;  1EWZ A;  2HF6 A;  5FDH A;  3E4Q A;  4EBN A;  4S2I A;  1PIO A;  1KGF A;  4X25 A;  1PW8 A;  3T50 A;  3IS2 A;  3FZC A;  1NYM A;  1PYY A;  3IBJ A;  3PXP A;  2UWX A;  4O01 A;  4OKP A;  2Y79 A;  3HCY A;  3PBT A;  1YQS A;  4LLO B;  1SKF A;  1FOF A;  1G28 A;  2Y59 A;  2L4R A;  5F6A A;  3SS3 A;  4DF6 A;  4Y17 A;  4I39 A;  2XF3 A;  3OC2 A;  4O0P A;  4R23 A;  4Y0T A;  4EV4 A;  4FCF A;  5GHY A;  4OLG A;  1KE0 A;  1TS0 A;  2H0Y A;  3BM6 A;  1OPX A;  5AQ9 A;  4ETX A;  3MSH A;  4BD0 A;  3F1O B;  3V67 A;  4IJG A;  5EM0 A;  3VE4 A;  1OTB A;  3ZYT A;  1N9O A;  4KG6 A;  1PWD A;  5EPH A;  5EVI B;  3LIA A;  1YLY A;  1K6S A;  3QNB A;  2JE5 A;  3R4K A;  4GDB A;  4EBL A;  2IA2 A;  2WKE A;  1S1Y A;  4FH4 A;  5TBM B;  1SCW A;  4GNU A;  5TFQ A;  3D72 A;  2PYR A;  3NUL A;  4GD6 A;  5KIZ A;  2V8F A;  1JTG A;  2JKT M;  1GSV A;  1BTL A;  1DJA A;  1V9Y A;  4C3Q A;  4LV0 A;  1AXB A;  2P7J A;  4WL9 A;  1MBL A;  4S2J A;  1H5X A;  4BL2 A;  4Y15 A;  1ZTU A;  5J7E A;  3CPT A;  2C5W B;  1LI9 A;  4S2M A;  2GX5 A;  1Q2P A;  1A0K A;  3VMA A;  3MQO A;  2ZM2 A;  3A3E A;  4P6B A;  3T4O A;  2K31 A;  1IFQ A;  4K0X A;  2WKR A;  2XA7 M;  3LR5 A;  3BY8 A;  2VZW A;  3PBR A;  1KGE A;  1CI9 A;  2GDN A;  3SW1 A;  3UB8 A;  2JCH A;  4MMN A;  3ZG9 B;  4FTX A;  4G3W A;  3C8C A;  3NIA A;  3VP1 A;  4L9G A;  3CUE A;  3DTE A;  1JWZ A;  3WS5 A;  4LCM A;  3IH9 A;  5CGW A;  4KUO A;  1ODV A;  2VV8 A;  2XFT A;  1XJ4 A;  1BLH A;  1CJF A;  3W4P A;  2E8J A;  5L8M A;  4K08 A;  5CRF A;  5HW3 A;  2QKP A;  4II7 A;  4KG2 A;  3SS4 A;  3VP3 A;  1E3U D;  2ZM8 A;  5JYP A;  5A8B A;  5HDS A;  2ZQC A;  1F2K A;  1GHI A;  3F1O A;  5EV0 A;  4XT2 B;  1K4E A;  2VEA A;  2FFF B;  1WYC A;  4OLD A;  4R38 A;  3UB9 A;  3Q81 A;  3JPU A;  5EVI A;  2W1T B;  4N9K A;  2XSS A;  4ID4 A;  1RGY A;  1Y54 A;  3MXQ A;  4YOF A;  5FI6 A;  3MQQ A;  5HFO A;  4O8G A;  1DP6 A;  5TBM A;  2WYX A;  3BFE A;  3KSH A;  4KQO A;  5EVI C;  4LPZ A;  4LEN A;  2WKQ A;  3LEQ A;  3EQV A;  3W4O A;  5HPI A;  3A0R A;  3W8K A;  3CI6 A;  4UHU A;  2J3T C;  2BTF P;  2Y91 A;  5FAS A;  4EUZ A;  4Y7P A;  4PM7 A;  1D1J A;  5E2F A;  3UNW A;  2QZ6 A;  3LI8 A;  1G6A A;  1MWS A;  5E43 A;  5E2E A;  1K56 D;  5FA7 A;  5HAQ A;  1FCN A;  1JWV A;  4GW9 A;  3ZCZ A;  5FQK A;  2O9A A;  2C6W B;  4JXV A;  4B4X A;  3UE3 A;  4GKU A;  1L0D A;  3OZH A;  1L0E A;  4QY5 A;  2QWS A;  4LCL A;  5AVE A;  2XK1 A;  3TE8 A;  5DF9 A;  3IWQ A;  3MF0 A;  3NBL A;  5KSH A;  3KSG A;  4EW7 A;  3ISG A;  1G6O A;  4KZ4 A;  1XP4 A;  3BRM A;  2W3F A;  2HDS A;  2WZX A;  4PKY G;  2YKH A;  5J3W A;  4N92 A;  2DNS A;  4MBK A;  4MN5 A;  3HVF A;  3QP1 A;  3Q7V B;  3R7W B;  1HTZ A;  2E8I A;  5FQJ A;  2XFS A;  3P98 A;  1BSG A;  2W3E A;  2H10 A;  5FI2 A;  4EES A;  4E3O A;  1IYS A;  3MBZ A;  4YIN A;  5M1A A;  1EW0 A;  3IXB A;  5DF8 A;  4XT2 A;  5L2F A;  3UE0 A;  4GHI B;  1JVJ A;  3E4O A;  3HUM A;  2W27 A;  5G18 A;  2VKS A;  1KDS A;  2ZOI A;  4D2O A;  2W1T A;  1H8Y A;  1S0W A;  4FOF A;  4CPK A;  4Q8I A;  2O99 A;  4S2L A;  1SDN A;  3VOL A;  2W3H A;  2CMN A;  5FAP A;  3KSI A;  1T1A A;  3BQA A;  1GA0 A;  1Z09 A;  1MKM A;  3N4I A;  3UN7 A;  4FSF A;  3NC8 A;  2LB5 A;  4DMZ A;  5FQM A;  1IKG A;  4MEZ A;  2M7U A;  1YM1 A;  2L1M A;  2OSU A;  5GL9 A;  3L7H A;  2A2L A;  3CAX A;  3NI9 A;  5L09 A;  4B4Z A;  3A3D A;  5EE8 A;  2JKG A;  3HLF A;  2J9P A;  3HUN A;  5K5B A;  4EEP A;  3O88 A;  4FH2 A;  3FV7 A;  4F94 A;  1XFN A;  1N9L A;  3FG8 A;  4E6X A;  2OV5 A;  1BYW A;  5M18 A;  5GHX A;  3T1Q B;  2Y2I A;  2J3W A;  3IHB A;  2X02 A;  3QP5 A;  4P85 A;  3HLG A;  2HZ5 A;  4OPR A;  2IWD A;  4DE1 A;  4M3K A;  1LT0 A;  2B5R A;  2HDQ A;  1DY6 A;  5DTS A;  2Y2L A;  4S2P A;  3VP4 A;  1FR1 A;  5DFX A;  3VOY A;  3KYQ A;  5CGS A;  3Q7V A;  3HL9 A;  3OPR A;  3Q7Z A;  3FC7 A;  1TEM A;  1JNU A;  3MQ0 A;  3BQ8 A;  1YT4 A;  5TJJ A;  1PFL A;  4QPR A;  4BJP A;  3P09 A;  3CJM A;  3M2J A;  1CEF A;  3OCN A;  3LY3 A;  4HBT A;  3GMW A;  2OOL A;  4R4R A;  5EOO A;  5CXW A;  4KZ3 A;  4MBH A;  2FFY A;  1KOU A;  2Y2O A;  3ITA A;  2H0T A;  3DTK A;  4GD8 A;  5HD5 A;  2V1B A;  2P9V B;  2V1Z A;  2EX6 A;  4JPM A;  1RP5 A;  3LIF A;  3UE6 A;  2A3U A;  2G7U A;  1LSW A;  4CLC D;  4Q0J A;  3N8S A;  1BLS A;  2EX9 A;  5HDC A;  2PR6 A;  4KG5 A;  4B9O A;  4PM6 A;  4HEF A;  4UA9 A;  4L9F A;  5CHU A;  3M2K A;  2DCF A;  4ME4 A;  1XPB A;  1IEL A;  1XJ6 A;  2ZMF A;  4IVI A;  5L07 A;  5FDS A;  4JKT A;  4Y3I A;  4BEN A;  4WZ5 A;  1V9Z A;  3WS4 A;  3UDX A;  2H5S A;  3NY4 A;  2IWB A;  4QHC A;  1DJB A;  5FL3 A;  3IXH A;  3C4P A;  1IEM A;  4Y5F A;  2RL3 A;  3SZT A;  3EEA A;  1SHV A;  3TSG A;  3CPT B;  3VE3 A;  5F5Y A;  1Y4O A;  3H7W B;  2EXA A;  3VP0 A;  1TDG A;  3B3X A;  4N1H A;  3G4P A;  4ZAM A;  3G6O A;  4X53 A;  4OQH A;  2HP6 A;  4OH0 A;  3KSF A;  5L10 A;  4OOL A;  5D3O A;  2KDK A;  3UME A;  1P97 A;  3IF6 B;  2M7V A;  4LRY C;  2GZA A;  4IBX A;  1AWI A;  3O86 A;  3RTY A;  5FQ9 A;  2J9O A;  4JF4 A;  4UA6 A;  1NLY A;  1TS8 A;  3MJQ A;  3S4X A;  3MZE A;  2Q0O A;  5E2H A;  2XRO A;  1FCO A;  4WMC D;  4PPR A;  3ZG5 A;  4BQM A;  1KVL A;  3SH9 A;  4X68 A;  3RXX A;  1VM1 A;  1YSP A;  4D60 A;  4KEN B;  3QNC A;  3VP2 A;  1CI8 A;  4OOY A;  1K56 A;  3ZGA B;  5CER A;  3UB5 P;  4NXB A;  1LL9 A;  4QJG A;  1KDW A;  3GQZ A;  3MKF A;  3QHY A;  5EVL A;  4NG2 A;  4C6Y A;  2P9V A;  3T4Q A;  4EQ1 A;  3PHY A;  4DRT A;  4Q0H A;  5DVA A;  2ZC3 B;  3MMH A;  1PW1 A;  1JWP A;  4S2N A;  3RXW A;  2PBD P;  5HZH A;  4OQI A;  1ES5 A;  2EA9 A;  3B42 A;  5M19 A;  1W8Q A;  3AGE A;  3BYD A;  2JKF A;  1ZG4 A;  2PBY A;  3ZQ5 A;  4JGO A;  2PDR A;  4X1L A;  4S2N C;  2PU2 A;  4JLF A;  5TR7 A;  4EBP A;  5AVF A;  3HLE A;  3I7J A;  3SH7 A;  3HUO A;  2P08 A;  3HBR A;  5HX9 A;  2QHK A;  1OTE A;  1IYP A;  1L2S A;  2ZC5 B;  3EEH A;  3V39 A;  1NWZ A;  5BOH A;  1T1B A;  2HV1 A;  1RGZ A;  3ICY A;  4UAA A;  5A92 A;  3CG5 A;  4E6W A;  1VET B;  3FWL A;  2HP5 A;  5AQA A;  4QWO A;  1J9M A;  2P04 A;  3H7W A;  1H8Z A;  1T1C A;  2NUP C;  4CLC B;  4EER A;  3GRJ A;  2EWW A;  5IT5 A;  1YPR A;  1I2S A;  4WEL A;  3CLO A;  4DJ2 A;  3FPV A;  1MZU A;  4WLA A;  2EX2 A;  1XXM A;  4R1G A;  3IF6 A;  2ACG A;  2M1C A;  2Y2K A;  4PM9 A;  3OPP A;  4H8R A;  4N1X A;  1MKI A;  3CIT A;  3U4L P;  4LV2 A;  4QY6 A;  2WKH A;  2Y2H A;  3B47 A;  1KGG A;  2WUQ A;  4GLQ A;  3IF6 C;  3P01 A;  2QMI A;  4MN7 A;  1W5D A;  1IKI A;  4DN0 A;  2KOI A;  1P9R A;  3CUE C;  3G2Y A;  4XUZ A;  1XJ2 A;  1LI0 A;  3S7P A;  1GHM A;  1ES4 A;  3O5Y A;  3NDG A;  4KZB A;  3E2L A;  4PM5 A;  3D3O A;  4XXR A;  5C5K A;  2VGL S;  5AQ7 A;  4ZDX A;  4HP9 A;  3N8L A;  3IXD A;  4PMA A;  5CHM A;  1DJC A;  4JF5 A;  2DMW A;  3G35 A;  1BLP A;  4E3K A;  3MFX A;  4DE3 A;  3NOU C;  3QP8 A;  4MDZ A;  4S2K A;  3Q82 A;  2XR0 A;  1MWT A;  1ERQ A;  4UEY A;  3QP4 A;  5IS1 A;  1G68 A;  2WKP A;  1DRM A;  2D01 A;  4S2O A;  3VOZ A;  4YNR A;  4RX3 A;  1MC0 A;  4I38 A;  3BW6 A;  4DDY A;  4HY8 A;  4KZ6 A;  1YSQ A;  4JXW A;  1M40 A;  1YLP A;  1K4F A;  3EGX C;  1NRF A;  3H82 B;  1N9N A;  5F1F A;  3LIB A;  3G32 A;  4BBT A;  1VET A;  3JVV A;  1YMX A;  5EVE A;  3K3C A;  4RQ9 A;  3CHW P;  4E3J A;  3IT9 A;  3P7N A;  1YLZ A;  4B88 A;  1JTD A;  5G4Y A;  4CLC A;  1ONH A;  1OT6 A;  3N6I A;  1OME A;  1HZO A;  1SDE A;  4P87 A;  3T4L A;  4YWZ A;  1K38 A;  1NY0 A;  1K55 A;  3PBO A;  3ZVT A;  5F69 A;  1SZV A;  3CWF A;  3MZF A;  1XFQ A;  3BEC A;  4IBR A;  2WAE A;  2HJE A;  5HWV A;  2GNX A;  3LEZ A;  2J8Y A;  4PHT A;  1MWR A; 
#chains in the Genus database with same CATH homology
 4KUK A;  2JKR I;  5DJU A;  3IBJ A;  3PXP A;  4O01 A;  4HI4 A;  1OTA A;  2D02 A;  2VX8 A;  2Y79 A;  3HCY A;  3PBT A;  2PT7 A;  3EWK A;  5DKL A;  5DFX A;  2ZMV A;  3KYQ A;  3LI9 A;  4LLO B;  4GJ4 A;  1G28 A;  4HJ4 A;  4AFI A;  3OCL A;  2L4R A;  3E4P A;  4I5S A;  3FC7 A;  5F6A A;  2Y8H A;  2A24 B;  1JNU A;  3MQ0 A;  3BQ8 A;  4I39 A;  3OC2 A;  4O0P A;  3F1P B;  5TJJ A;  4QPR A;  4BJP A;  3BWL A;  3RH8 B;  3DBA A;  3OCN A;  1T19 A;  1NRJ A;  4EET B;  3EGD C;  1TS0 A;  2OOL A;  3C30 A;  3S7N A;  1OPX A;  2JHE A;  1F98 A;  4HIA A;  1YKD A;  3TRC A;  3TW8 A;  4ETX A;  1KOU A;  5DKK A;  1UWN X;  4H6J B;  5HD5 A;  2V1B A;  5IU1 A;  3K3D A;  4LRX C;  5HDD A;  2PD8 A;  3F1O B;  3V67 A;  4IJG A;  3VE4 A;  1VHM A;  3PBN A;  2V0U A;  1OTB A;  1OJG A;  1Y28 A;  3ZYT A;  2LB9 A;  1N9O A;  1YAX A;  3LIF A;  3UE6 A;  2G7U A;  1P9W A;  3LYX A;  4ETZ A;  1LSW A;  3NJA A;  3LIA A;  4CLC D;  3TJZ C;  3S7Q A;  4Q0J A;  5CX7 A;  4PKY A;  3T4S A;  4ZRR A;  5HDC A;  2PR6 A;  3R4K A;  4B9O A;  3KX0 X;  4HHD A;  3E98 A;  4JGR A;  4NEE D;  4I3J A;  4L9F A;  2IA2 A;  3C38 A;  3MR0 A;  3OBF A;  1S1Y A;  1W63 M;  1TS7 A;  4ME4 A;  5TBM B;  2PYP A;  3LUQ A;  1XJ6 A;  2ZMF A;  3D72 A;  4I3I A;  2PYR A;  1S67 L;  4Y3I A;  5KIZ A;  2GJ3 A;  1V9Z A;  2JKT M;  1LT0 A;  1GSV A;  4CQH A;  3H82 A;  1V9Y A;  5FL3 A;  4UQI M;  4M4X A;  4GS9 A;  1OTI A;  3PR6 A;  4Y5F A;  2P7J A;  4WL9 A;  4HH2 A;  4PHT A;  4HP4 A;  3EEA A;  4EUV A;  2EWV A;  3VE3 A;  5F5Y A;  1VB6 A;  1NLZ A;  3BJN A;  1DP9 A;  3H7W B;  4IHQ A;  4ARZ B;  1ZTU A;  2V0W A;  3A0V A;  5J7E A;  3C2W A;  2W3G A;  3G6O A;  2GX5 A;  4ARZ A;  3MQO A;  2JKT I;  1X0O A;  3K2N A;  1S1Z A;  1OTD A;  5DFY A;  4CLC C;  5EFW A;  2K31 A;  1IFQ A;  3T4O A;  4HJ3 A;  2WKR A;  2XA7 M;  3KSF A;  3LR5 A;  3BY8 A;  4OOL A;  2VZW A;  3UMD A;  2KDK A;  2Z6C A;  3UME A;  3PBR A;  1P97 A;  2VJW A;  2M7V A;  4LRY C;  2GZA A;  2FZ0 A;  1STZ A;  3RTY A;  3SW1 A;  3UB8 A;  3IBR A;  4G3V A;  2OAQ 1;  4LRZ E;  2O0Y A;  4MMN A;  1NLY A;  1TD5 A;  1TS8 A;  3MJQ A;  2NUT C;  2VLG A;  4G3W A;  1S4S A;  3C8C A;  1S4R A;  4L9G A;  3CUE A;  3KO6 A;  2XRO A;  4UQI S;  5DJT A;  4HJ6 A;  5HSQ A;  1UGU A;  1YSP A;  2A24 A;  3F1N B;  4Q0I A;  5HWT A;  5G4Z A;  4KUO A;  1ODV A;  2VV8 A;  4WEJ A;  3LR0 A;  3F1P A;  1XJ4 A;  3PBS A;  4WF0 A;  5HPF A;  4JGP A;  1H3Q A;  5L8M A;  4K08 A;  4NXB A;  4IUK A;  1D7E A;  1GSW A;  2QKP A;  3B33 A;  4II7 A;  4I3A A;  2Z6D A;  4H6J A;  3T4Q A;  5HDS A;  5A8B A;  4EQ1 A;  4NKP A;  3F1O A;  3PHY A;  4Q0H A;  4XT2 B;  4L9E A;  3JVU A;  2VEA A;  2B18 A;  3MMH A;  2I9V A;  3RFB A;  3T4T A;  1H8M A;  4R38 A;  3UB9 A;  2W3D A;  5HZH A;  2W1T B;  1W63 Q;  4HH3 A;  2EA9 A;  2XSS A;  3B42 A;  3MXQ A;  4NXF A;  3EOI A;  3ZQ5 A;  4YOF A;  4JGO A;  2PDR A;  3MQQ A;  4O8G A;  2L0W A;  2OAP 1;  2ZBB A;  1DP6 A;  5TBM A;  2QJ5 A;  3KSH A;  4KQO A;  4Y2F A;  5AVF A;  4R6L A;  4LPZ A;  2V1A A;  2P08 A;  2WKQ A;  3BY9 A;  4CLC E;  3EQV A;  2QHK A;  3OLO A;  1OTE A;  5HPI A;  4JGQ A;  3A0R A;  3EEH A;  2VGL M;  3FPW A;  1NWZ A;  3LR3 A;  1T1B A;  3CI6 A;  1TF1 A;  2HV1 A;  5AJG A;  3NHQ A;  5J4E A;  2J3T C;  3LID A;  3ICY A;  3H9W A;  5HD3 A;  2H28 A;  4WUJ A;  2K7S A;  3UB7 A;  2VV6 A;  2P04 A;  3H7W A;  3LI8 A;  2W1R A;  1T1C A;  4NXE A;  2VA0 A;  2NUP C;  3W2Z A;  4CLC B;  5MC7 A;  4EER A;  4GW9 A;  2VV7 A;  2EWW A;  2O9A A;  2INW A;  3A0S A;  3HJI A;  5IT5 A;  3LR4 A;  4WEL A;  3UE3 A;  3CLO A;  4DJ2 A;  1F5M A;  3FPV A;  4G3K A;  1MZU A;  2QWS A;  4F3L B;  1S66 L;  4WLA A;  5AVE A;  3ULF A;  2KLI A;  3S7O A;  3TE8 A;  5DF9 A;  2QJ7 A;  4B93 A;  2M1C A;  4F3L A;  3MF0 A;  5KSH A;  3KSG A;  4EW7 A;  3IS2 B;  1G6O A;  3CIT A;  4MN6 A;  2PHY A;  1OT9 A;  2XRN A;  3GDI A;  2W3F A;  4EXO A;  2R78 A;  4PKY G;  3B47 A;  3U2A A;  2YKH A;  5J3W A;  4GLQ A;  4MN5 A;  3VV4 A;  3P01 A;  2O9C A;  3UB6 A;  4MN7 A;  4EEU A;  4R3A A;  1ZHH B;  3R7W B;  4BBU A;  4DN0 A;  2KOI A;  1P9R A;  3CUE C;  3F1N A;  1XJ2 A;  1F9I A;  1LL8 A;  4DJ3 A;  3R7W A;  2J3T D;  3S7P A;  3O5Y A;  4BMW A;  3D3O A;  1P0Z A;  4L0L A;  2W3E A;  2BAS A;  4EES A;  2OWH A;  3NOP C;  5C5K A;  4BBV A;  4KQD A;  1EW0 A;  3LIE A;  2XA7 S;  2V9A A;  4E04 A;  4HP9 A;  2PR5 A;  3E0Y A;  5HWW A;  2ZOH A;  4XT2 A;  1LSV A;  2FH5 A;  2J80 A;  4GHI B;  2DMW A;  1GSX A;  2O9B A;  3PBQ A;  3E4O A;  2W27 A;  3MFX A;  3NOU C;  4GHI A;  2VKS A;  3NOT C;  3T4K A;  4PAU A;  2ZOI A;  4MDZ A;  2W1T A;  3EQU A;  4GCZ A;  4FOF A;  1WA9 A;  2O99 A;  4P6Z M;  2W3H A;  3VOL A;  3HJK A;  2CMN A;  3KSI A;  4WEK A;  4WN5 A;  4OOM A;  4UEY A;  2W0N A;  1T1A A;  5IS1 A;  3BQA A;  2QYB A;  2K2N A;  2WKP A;  1MKM A;  4BWI A;  1IOU A;  1XJ3 A;  2KX6 A;  4Z1W A;  4FSF A;  1D06 A;  1DRM A;  2D01 A;  2LB5 A;  4DMZ A;  4HNB A;  2HGV A;  2M7U A;  4EU0 A;  5LBR A;  4YNR A;  1MC0 A;  2L1M A;  4I38 A;  3BW6 A;  4HY8 A;  3LIC A;  1YSQ A;  1LSX A;  3KYZ A;  2A2L A;  3CAX A;  3PYP A;  2PD7 A;  3EGX C;  4R70 A;  3H82 B;  1N9N A;  2MJ6 A;  1T18 A;  4GS9 B;  3LIB A;  4BBT A;  5K5B A;  3JVV A;  4EEP A;  2OWJ A;  5F68 A;  2B02 A;  4HQA A;  4HOI A;  1XFN A;  4MCW A;  1OJ5 A;  3K3C A;  3LFV A;  1N9L A;  2JKR M;  3OOV A;  4IUH A;  3FG8 A;  5HL6 A;  4RQ9 A;  3GEC A;  3P7N A;  5G4Y A;  4CLC A;  1DP8 A;  1OT6 A;  2JN7 A;  1BYW A;  3T4J A;  3T4L A;  4YWZ A;  2J3W A;  5I5L A;  4P6Z S;  3PBO A;  4NXG A;  2YKF A;  2HF6 A;  5F69 A;  3E4Q A;  3CWF A;  1XFQ A;  1UWP X;  2HJE A;  2HJ9 C;  5HWV A;  3T50 A;  3IS2 A;  2GNX A;  1TS6 A;  2VGL S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...