3ULFA

The light state structure of the blue-light photoreceptor aureochrome1 lov
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
135
structure length
135
Chain Sequence
EDPDYSLVKALQMAQQNFVITDASLPDNPIVYASRGFLTLTGYSLDQILGRNCRFLQGPETDPRAVDKIRNAITKGVDTSVCLLNYRQDGTTFWNLFFVAGLRDSKGNIVNYVGVQSKVSEDYAKLLVNEQNIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Aureochrome1 LOV suggest new design strategies for optogenetics.
pubmed doi rcsb
source organism Vaucheria frigida
molecule tags Signaling protein
molecule keywords Aureochrome1
total genus 43
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ulfA00
3H7WA 4I3AA 2L0WA 1T18A 1V9ZA 1T1CA 3LIFA 3BWLA 2WKRA 5TBMB 4I3IA 4L9FA 1OTEA 5EFWA 5G4ZA 5HDCA 1XJ3A 5A8BA 4GCZA 2QKPA 5AVFA 3H82A 3MXQA 2M1CA 4GS9A 4L9EA 5DJTA 1OTDA 1DP9A 1XJ4A 4EESA 1JNUA 5IS1A 2INWA 3GECA 3A0SA 1UWNX 1BYWA 1UGUA 3HJIA 4HH2A 4H6JA 3UB8A 4WUJA 2H28A 3ULFA 2KX6A 1T1BA 1TS8A 3F1OB 3HJKA 4JGQA 4LRYC 3D72A 3MQQA 4LPZA 4NXBA 5HD3A 5HDSA 1S4RA 2PHYA 1G28A 1DP6A 1T19A 3FC7A 5J4EA 4NXFA 3E4OA 3F1PA 4EXOA 2V1AA 1ODVA 4NXEA 5F5YA 3LIBA 5F69A 4YWZA 2I9VA 5HDDA 4HP9A 1N9NA 1TS6A 4EETB 4HH3A 3EEHA 1EW0A 1N9LA 1OTIA 4EQ1A 4RQ9A 4KUOA 3FG8A 4HY8A 3UMEA 3UMDA 2QWSA 4EEPA 3CWFA 1F9IA 3UE6A 3BY9A 4GW9A 3CAXA 5F6AA 2YKFA 4F3LB 2VLGA 3OLOA 3C2WA 4F3LA 2BASA 5AVEA 2A24A 5J3WA 5HWTA 4LRZE 4XT2A 2A24B 4JGOA 5HZHA 1LSVA 4HJ4A 2YKHA 3A0VA 4PKYG 1OTAA 4XT2B 2WKQA 2Z6CA 3IS2A 2PD7A 5DKKA 2Z6DA 5DJUA 4HHDA 1OTBA 2PD8A 3RH8B 3C8CA 4HQAA 4WN5A 4EW7A 4JGPA 3MJQA 4HJ3A 3B33A 2J80A 3E4PA 3H9WA 4GHIA 2R78A 3LIEA 1XFQA 4WF0A 1Y28A 2PDRA 2ZBBA 5IU1A 2PYPA 4LRXC 2CMNA 1S1YA 2WKPA 2GJ3A 2L4RA 2VV7A 3KX0X 1UWPX 4HNBA 1TS0A 3A0RA 3LYXA 3P7NA 2K7SA 3LIDA 2HV1A 3EWKA 4H6JB 2JN7A 2ZOHA 2PYRA 3F1OA 2PR6A 4HP4A 3ICYA 4R3AA 2V0UA 3GDIA 3LI8A 4PKYA 4WL9A 4WLAA 1V9YA 2VEAA 3LI9A 3VOLA 1XFNA 1GSXA 5TBMA 4MN5A 4BBTA 1S66L 3CLOA 1S1ZA 1S4SA 3IBRA 2W27A 1LL8A 3E4QA 3NHQA 2D01A 3K3DA 4E04A 3ZQ5A 3PHYA 2P7JA 3H7WB 4I3JA 1LSXA 2ZOIA 4R70A 5J7EA 3NJAA 1WA9A 5HWVA 2OWHA 4GS9B 2OWJA 4I5SA 3H82B 4DJ2A 4BBUA 4I39A 3MQOA 4GHIB 2B02A 1DRMA 5G4YA 1LT0A 4LLOB 3UB7A 1T1AA 1F98A 3F1NA 4KQDA 4KUKA 4HIAA 1P97A 3UB6A 5HWWA 3MFXA 3K3CA 2QJ7A 4R38A 3SW1A 4NXGA 5HSQA 3LICA 1GSWA 1OJ5A 2VV6A 1XJ6A 2D02A 3NOUC 3PYPA 3RTYA 3UB9A 3VE4A 1N9OA 1OT6A 1X0OA 2V1BA 4I38A 2VV8A 3NOPC 2EA9A 4M4XA 4JGRA 4K08A 2L1MA 2V9AA 3BY8A 4DJ3A 1S67L 1D7EA 2QHKA 3IS2B 3LUQA 4L9GA 5DKLA 3VE3A 1P0ZA 2OOLA 2JHEA 5F68A 1XJ2A 5HD5A 3T50A 3MR0A 1DP8A 1TS7A 4MN6A 4BBVA 3LIAA 1D06A 5I5LA 5KIZA 1VB6A 2V0WA 4B9OA 2KDKA 1KOUA 4EERA 1OJGA 4EEUA 2PR5A 3F1NB 1LSWA 1MZUA 3G6OA 1GSVA 2W0NA 4HI4A 4HOIA 4R6LA 2QJ5A 1OT9A 3F1PB 1NWZA 3NOTC 4HJ6A
chains in the Genus database with same CATH superfamily
3VP3A 3G30A 1HVBA 3E2LA 5EFWA 3MXQA 2J3TC 1D1JA 3Q82A 3A0SA 1K55A 3GV9A 1T1BA 4FSFA 4EXOA 2ZD8A 3MBZA 1MWSA 1YSPA 2E8JA 2A2LA 2HGVA 3S1YA 3MF0A 3BECA 1HTZA 5M19A 3IWOA 2W3HA 3BRMA 1PZOA 5KZHA 3RXXA 1ONHA 3HL9A 2YKHA 5E2EA 4L0LA 2VJWA 5DJUA 5K5BA 3Q7VB 2GZAA 1PRQA 3C4OA 2P74A 3IWIA 3EGDC 5L10A 4JBFA 2FFFB 4GD6A 1BUEA 2PYRA 3GDIA 4EQIA 3IQAA 3VOLA 1U60A 2D01A 2QPNA 3SZTA 3IHAA 3GSGA 4EUZA 4NETA 2DNSA 2XK1A 3MQOA 4N9LA 3VMAA 4Q0JA 1XA1A 5FL3A 3BW6A 4NXGA 3GVBA 1H8YA 4CQHA 1OT6A 4DJ3A 2L1MA 3MXSA 5FDSA 3BM6A 5CGWA 5E2GA 3VOYA 3BFGA 2JHEA 5F68A 2EFUA 3P98A 4G3WA 5DVAA 2ZMVA 1YT4A 1YSQA 1LSWA 1MZUA 2O9AA 4M3KA 4F94A 1K4FA 1NWZA 2WUQA 4P6BA 4MBFA 1T1CA 2J8YA 5EVLA 1FQGA 4WM9A 1JNUA 4GKUA 3HJIA 3UE1A 3ULFA 4DN0A 1GHIA 4UHUA 1J3WA 4AFIA 4LRYC 4ZJ1A 2FH5A 3EOIA 2V1AA 3QNCA 1EI5A 5J8XA 3UE6A 3IX8A 3C2WA 2BASA 3G32A 2XD5A 4KZ5A 5LBRA 1K54C 2DRWA 4ARZA 3GTCA 2J80A 5KMWA 3O5YA 2GX5A 2GJ3A 4X69A 4R38A 1K38A 3V5MA 4DF6A 2V20A 3CG5A 3LI8A 4WL9A 1S6RA 1YLYA 3HLDA 1W8YA 1WYBA 3CUEC 3FZCA 5CGXA 1BLHA 3LGOA 2HDUA 3B3XA 3IXBA 5M1AA 3UB6A 3IXGA 1LI0A 2IWDA 1N9OA 3PAGA 2VV8A 1E25A 1K55C 2Q0OA 4O7DA 3R7WA 3WRTA 5DKLA 2OOLA 5FAOA 3WS1A 3T50A 1TS7A 3IWQA 3G2ZA 5CTMA 4ETXA 4LGWA 3WRZA 4QJGA 3KYQA 1MKIA 3U2AA 2QJ5A 1LL9A 4WZ5C 1OT9A 2W1RA 4PHTA 4KZ9A 4R4RA 4L9EA 3ZNTA 5CEDA 1RP5A 3MSHA 4WUJA 3HBRA 5I94A 2ZQ7A 3PBOA 1MC0A 1G28A 5HX9A 5F69A 2XRNA 1NXYA 2G7UA 1N9NA 1FCOA 1Q2QA 1CF0A 5FEGA 4S2NA 1F9IA 4Y13A 3N8RA 1NLYA 3LR5A 3GMWA 5J3WA 3ZG0A 4UAAA 4PKYG 4QB8A 4JXWA 4JGPA 2XFTA 1NRFA 4GHIA 3C7UA 1S1YA 3QHYA 2BG1A 2JN7A 4E3OA 3CHWP 5TGFA 3ICYA 4BBTA 3A3IA 2J9PA 5TBMA 3SS5A 4JKTA 4YINA 2WYXA 5EE8A 2VGLS 3PHYA 5KSCA 3U4LP 3H7WB 1LSXA 5KSHA 5E2FA 4DJ2A 3HCYA 2B02A 4N1HA 1F98A 4G3KA 4OPYA 1VM1A 1CI9A 4IVIA 2WZZA 3HUMA 4R0QA 3EEAA 5G18A 2ZC7A 2QHKA 3NDGA 3V39A 1HLUP 4JXSA 1XJ2A 3MR0A 5CEBA 1IELA 5BOHA 1SZVA 2PR5A 5MC7A 2PU2A 5FQIA 4R3JA 3LIFA 4GCZA 3IT9A 4FUWA 2IWBA 4E3IA 3LR3A 5CTNA 3AGFA 2QYBA 4NXBA 3D9YA 3PR6A 2PHYA 1I2WA 1F5MA 2OLVA 3Q7VA 3RXWA 2H10A 1N9LA 3UMEA 2EWWA 4OOMA 4YNRA 2YKFA 4F3LB 5CHUA 1N4OA 3WS2A 3A0VA 2Q9MA 2Z6CA 3DTMA 3UN7A 3M6HA 2HDQA 3Q7ZA 1IYSA 4WLAA 1XPBA 4OQHA 4ETZA 3LI9A 4DE1A 5DF9A 1K56D 3P01A 2XH9A 4LENA 3A3JA 5EM1A 2ZL1A 3MZFA 1NYMA 4X55A 3C5AA 4C75A 2P9VB 3T1RA 4NEED 4PM5A 1KVLA 5GLCA 2PBDP 5A90A 1KVMA 4MNRA 4BMWA 4L9GA 1DJBA 4IVKA 2M7UA 5CX7A 4P6ZS 3VP4A 2KDKA 1KOUA 4B93A 2ZC6B 3CUEA 3NI9A 1MWTA 4Y5FA 4QU3A 1GSVA 4EBPA 4MMNA 4Y0TA 3E98A 2L0WA 1V9ZA 5TBMB 2VK3A 3NC8A 3B47A 1G5UA 4OP8A 3N8LA 3S4XA 1OTDA 1A0KA 1XJ4A 1BSGA 1FCNA 4BD1A 4R23A 1W5DA 1HD8A 2Y79A 3NCKA 4KQRA 4E6XA 5HDSA 2WZXA 3N7WA 4ARZB 1YLTA 1TS6A 1XKZA 4JXVA 3EEHA 1TDGA 5HAQA 1CK3A 3G4PA 1K25A 3VOZA 4XT2A 4Y2FA 1P9WA 1LSVA 3BQAA 1S0WA 1NY0A 1Z09A 2O9CA 2Z6DA 5HW3A 4B88A 3MJQA 5E43A 2Y91A 2O0YA 4IJGA 3AGDA 2Y55A 3OOVA 4S2LA 3F1OA 2X02A 3V3SA 2J7VA 4PKYA 5C5KA 3CLOA 1YPRA 2CC1A 3ZQ5A 4GDNA 4ZRRA 3NJAA 3DW0A 4I5SA 4I39A 1LT0A 3HLCA 5GL9A 3VV4A 2V1ZA 4K08A 2V9AA 4JF4A 3IS2B 5GLBA 2VGJA 4E3LA 2V0WA 3BLMA 1OJGA 2ZMAA 4DKIA 3FKWA 4ESPA 3CITA 3VFHA 1L0GA 3WS4A 1Y54A 4WEKA 1K4EA 2IA2A 2M1CA 1NRJA 4WZ4A 3QP5A 3GECA 3HLFA 2Y8HA 1ZTUA 1JWZA 4MDZA 4OPZA 3UB8A 2Z2LB 3ISGA 1L0EA 4Y0UA 1T19A 4YWZA 4PAUA 1F2KA 4CLCA 2DMWA 4NKPA 4OH0A 2X71A 2JKGA 3VP1A 5CGSA 1PZPA 1PFLA 1ONGA 2XD1A 2XROA 4Q0HA 1FSYA 4EW7A 2Y2KA 2Y2PA 3RH8B 2G2UA 5IU1A 3BFDA 2E8IA 1JWPA 4DE3A 3LFVA 3LIDA 4OKPA 3IHBA 5AQ7A 3C30A 2W27A 1XXMA 1ALQA 2K31A 3O88A 1BTLA 5CXWA 3WWXA 4GS9B 3H82B 3UB7A 1T1AA 1K54A 3VSKA 1P97A 2B18A 3K3CA 3MFXA 3RTYA 5HPIA 4UA6A 1KGGA 2EXAA 2WKHA 1XP4A 4KENB 4OP5A 3VE3A 5EV0A 5F83A 1VB6A 4HBTA 5KIZA 4HESA 4IBRA 1SDNA 1SKOB 2WADA 4ZBEA 4CLCB 2UV0E 1JTDA 1YKDA 4WELA 1NYYA 1XJ3A 5M18A 4GS9A 1ZC2A 1DP9A 1YAXA 2XSSA 1PWGA 2Y2GA 4FH4A 2H28A 3T1XA 1L3LA 4LPZA 5HL1A 2V2FF 1ES3A 3SS4A 3QP4A 3ZNYA 2W3EA 3LIBA 3FV7A 4OQ0A 4RVAA 2XA7M 3T4TA 4OQGA 3T4JA 4EQ1A 3IXDA 4D2OA 5IHVA 4GW9A 1FIKA 1G68A 1ESIA 4KG6A 2A24A 1IKIA 3KYZA 1NZOA 5FAQA 2ZQ8A 4WMCD 3SH8A 4K0WA 3SOIA 3ZYTA 4HHDA 1H8MA 4U3TA 1DJAA 3UB5P 3H9WA 2PDRA 4CLCC 2WKIA 3HUNA 4Y15A 4HP4A 1RGYA 2V0UA 1SCWA 3VP0A 1GA0A 1LL8A 3NHQA 3W4OA 4E04A 2ACGA 2ZOIA 3W2ZA 3T12B 3T1QB 4EU0A 2EXBA 3E0YA 2OLUA 3BQ8A 1KDSA 4PM6A 1O7EA 5HL6A 5TFQA 3UB9A 1X0OA 1KE4A 2HF6A 3R7WB 3NOPC 2EA9A 4KG2A 3JVVA 1E3UD 2PBYA 5FDHA 4S2JA 5CHMA 4S2IA 1XX2A 2Y2OA 4R6LA 2EX2A 3PBQA 3O87A 4DMZA 3UDIA 3MS6A 3CMZA 3A3DA 4PPRA 3L9KA 5L8MA 1BYWA 4PM8A 4E6WA 3BEBA 5AQBA 2GDNA 3ZVTA 2ZC3B 4JGQA 4RX3A 3MQQA 4DDYA 4X1MA 1STZA 4IUHA 1DP6A 4JXGA 5J4EA 4KQOA 1DJCA 2HDSA 5HDDA 3TG9A 1BZAA 4A5RA 1VHMA 4H8RA 3CWFA 3BY9A 3NULA 2VA0A 2VLGA 4OLGA 4KG5A 5EOEA 1TD5A 1I2SA 3MKFA 4G3VA 2JKRM 3P09A 1J9MA 1YM1A 2CMNA 4N1XA 3EWKA 1RGZA 3PBRA 1KE0A 2ZQAA 1WE4A 4MBHA 1JVJA 3E4QA 1QMEA 4KZ3A 3QP2A 1MKMA 4BBUA 3OC2A 3A3EA 2QJ7A 5FEFA 2XR0A 1XJ6A 4FOFA 3C7VA 1D7EA 1ESUA 5FQJA 2HZ5A 1MXOA 3MXRA 3T4OA 5EECA 3V67A 3DWKA 4HOIA 3H7WA 4I3IA 4R1GA 5A8BA 1YLPA 2RL3A 2VKSA 2IWCA 1LLBA 5FQKA 2XEPA 3ZG8B 5L2FA 3WS0A 4EWFA 1O07A 1QMFA 4Q0IA 1FR6A 3BFCA 4BJPA 4ZTKA 3E4OA 5F5YA 2LB9A 2C5WB 1EW0A 2JCHA 3Q07A 2QWSA 4UA7A 3JVUA 3OLOA 5FATA 3LCEA 1W7FA 3SH9A 1KGFA 2JKTI 2WKQA 5EVIA 3WS5A 4MEZA 3V3RA 4HJ3A 5DF8A 2A3UA 1TEMA 4PM9A 3QP1A 2HPBA 4EBNA 1TDLA 2WKPA 3EQVA 2VV7A 5FSRA 4EUVA 2PR6A 1Q2PA 4MN5A 1VQQA 5FA7A 2H5SA 4I3JA 2Y2HA 5TJJA 1BLSA 4XUXA 2VGLM 2OV5A 3BFFA 4XUZA 3SW1A 4NG2A 2ZM0A 3LICA 1GSWA 2VV6A 3LY3A 3HLWA 3NECA 1ZG6A 3QP6A 3CI6A 2PRFA 3RJUA 2ZMFA 4EEUA 2VGKA 1NJ4A 2KOIA 2G2WA 3IF6A 1GHMA 2J9OA 2ZL1B 4L9FA 3PTEA 5DJTA 1L0FA 4LV2A 5IS1A 1SHVA 3HLBA 4QWOA 3N6IA 3DBAA 1PI5A 4OLDA 4RX2A 2WK0A 3PBNA 4LCLA 1IYPA 1ZKJA 2Y2IA 2I72A 5DFXA 1CEFA 2Y2NA 4OOYA 4ZDXA 3BYDA 1W8QA 4CLCE 2WGWA 5F6AA 2WKEA 5HZHA 5A93A 1ES2A 4O8GA 5FAPA 3KSGA 1CQAA 4HEFA 3ZHHA 4X68A 3UDFA 4YFMA 3JYIA 1PW1A 3P7NA 4QHCA 4B9OA 3T4LA 2PAVP 3DTKA 5AQAA 4Y7PA 1S4SA 3IBRA 2HP9A 4DRTA 1KGEA 2P7JA 5DTKA 4R70A 4LFUA 2V8CA 4PMAA 2ZM8A 4K91A 4XXRA 2Y2LA 1P9RA 1TF1A 4LLOB 5EVID 4KQQA 5HSQA 4KZ7A 3GRJA 2V1BA 3TJZC 3MFDA 2MJ6A 4Z9QA 3UO9A 4E3NA 4X53A 1I5QA 3KO6A 1YLZA 4CLCD 3FKVA 1GCEA 3ZVWA 3O86A 5JYPA 3NY4A 1HZOA 3OPRA 5G4ZA 4GD8A 1G6OA 3CJMA 4EESA 4FD8A 4H6JA 2Y2QA 3ZGAB 1BLPA 1PYYA 5FI6A 4NXFA 1ODVA 4HP9A 3EGXC 1E4DA 2W1TA 1OTIA 4RQ9A 2WAEA 1PNEA 4X56A 2J3WA 3L7HA 1SKOA 5EOOA 5AVEA 4XT2B 2W3DA 3UY6A 5GHYA 1TVFA 1OTBA 3AGEA 2PYPA 4S2KA 3DTEA 1YMXA 1TS0A 4HNBA 2JKTM 5AQ9A 2ZQ9A 3LO7A 5FI2A 5J7EA 5TR7A 1FSWA 1M40A 5GHXA 3QNBA 4WZ5A 4OVDA 3W8KA 3NDEA 3G2YA 3PYPA 3NOUC 2P08A 3LUQA 2WGIA 3A3FA 4CPKA 3BFEA 4KZ4A 4MN6A 4BBVA 5DFYA 2VZWA 3KSIA 5D3OA 3T1SA 3UPPA 4ME4A 1K6RA 5CERA 3SH7A 2Y2MA 5DF7A 2ZM2A 3G6OA 3TW8A 3BJNA 2W3GA 4BL2A 4QY5A 3FWLA 3MQ0A 2WKRA 5L09A 4S2NC 1EROA 2QKPA 3H82A 4UA9A 1W79A 3E2KA 2J3TD 1XGJA 3ITAA 2KX6A 3LEZA 5CECA 3FYZA 4JF6A 4Y3IA 3UE0A 4EBLA 4RA7A 3FC7A 3CPTA 4C6YA 4R3BA 2HP5A 3MZDA 1NLZA 1E3UA 4E3MA 4E3KA 2QZ6A 2A49A 4B4XA 3HUOA 3IS2A 2XDMA 3DTIA 3OCNA 4GDBA 3O3VA 4HQAA 4BD0A 2V8FA 3B33A 5F1GA 2W1TB 1PI4A 3TE8A 3KYEA 4PM7A 1UWPX 4H6JB 3LYXA 5HARA 1H5XA 2HV1A 2ZOHA 4P85A 4R3AA 1K56A 4Z1WA 1DY6A 3M2KA 2HP6A 1LL5A 4UQIM 4O0PA 2NUPC 2OWHA 2OWJA 3T4SA 3UE3A 2KLIA 5GLAA 1FOFA 1IFQA 1K0KA 4HIAA 2XA7S 3B42A 4O01A 2EFXA 3VE4A 1RCJA 3MMHA 3UNWA 4LV1A 4D60A 1S67L 5GHZA 4OOLA 5HD5A 5EM0A 4QPRA 3KSFA 2M7VA 1GA9A 2W0NA 2R9WA 2WAFA 4X1LA 3IX4A 2FFYA 4DE0A 1T18A 2B5RA 4KZ6A 5FQMA 1MWRA 3C4PA 1GHPA 1H3QA 3HVFA 4LV3A 2RCXA 1PW8A 4K0XA 4UEYA 3F1PA 1IYOA 1CI8A 3TOIA 4X25A 3IF6B 5E2HA 4HH3A 4EEPA 4WBGA 3OPPA 2H0TA 3DAVA 2PU4A 1CEGA 4HJ4A 3C38A 3G35A 4ZJ2A 2W3FA 2PD8A 2Z2MB 3K2NA 4ZJ3A 3ITBA 3LIEA 5EPHA 2L4RA 4GOGA 3A0RA 5U47A 1OPXA 3MKEA 2VEAA 1S1ZA 3IF6C 1G6AA 2OAP1 3N4IA 3PAEA 3M6BA 4DXBA 3HLEA 2ZJ9A 3F1NA 4KQDA 3PXPA 2WGVA 3HREA 3T4KA 4WMCA 3ZG5A 5HFOA 2OAQ1 4M4XA 4DDSA 3BY8A 2O9BA 5HAIA 1BT5A 2K2NA 3KSHA 1DP8A 1N9BA 1XA7A 2JKFA 1D06A 4WEJA 4LV0A 5FASA 4JF5A 4DXCA 4S2PA 3F1NB 3S7NA 2EX8A 3D4FA 3N8SA 4S2MA 4KZ8A 2ZQCA 4WYYA 2ZC4B 4GLQA 1Y4OA 1MBLA 3D3OA 1UWNX 3VP2A 3LR4A 3ZDJA 3IXHA 1L0DA 5F82A 2JC7A 2GNXA 1H8ZA 2AVXA 2HJ9C 4UQIS 4BWIA 2BTFP 3JPUA 2Y4AA 1SDEA 4X6TA 2JKRI 4KUOA 3FG8A 4HY8A 4IUKA 3I7JA 5HWTA 3OBFA 5L07A 4JGOA 3T4QA 4MLLA 3CPTB 4WN5A 1ES5A 1LHYA 1VETB 5AJGA 5DTTA 1KDWA 3S7OA 1XFQA 1VEUA 1Y28A 2ZBBA 5CHJA 4JLFA 5HAPA 3MZEA 4MBKA 1ERQA 4P6ZM 1S66L 4MCWA 2VX8A 5EUAA 1K57C 3QP8A 4R4SA 3SS3A 1PWDA 3TRCA 2ZC5B 1DRMA 2ZLYA 5EVIB 2NUTC 1OJ5A 5IT5A 2D02A 3OPHA 1L2SA 2C6WB 3IX3A 2DCFA 1P0ZA 2P04A 2OSUA 3PBSA 1IOUA 1Z6FA 4FTXA 4GN2A 4ZAMA 3RFBA 3S7QA 4DE2A 2XQZA 5A91A 4HI4A 3UPOA 3IF5A 4P0MA 3NOTC 2JBFA 4U0XA 1JWVA 3BWLA 1OTEA 2B95A 5HDCA 4GJ4A 4P87A 5JYOA 4GZBA 1FCMA 1PIOA 2X01A 2INWA 2BLSA 1YMSA 1YLWA 4U0TA 4C3QA 2LB5A 4E3JA 3OCLA 1AWIA 3F1OB 4IHQA 3HJKA 3IH8A 3FPVA 1S4RA 1VETA 2Y59A 5F1FA 2I9VA 3Q1FA 4FCFA 1VEUB 4S2OA 4EV4A 4EETB 4BQMA 2JE5A 3Q81A 4RYEA 2WGWB 3G31A 3NIAA 3S7PA 3CAXA 2A24B 1YQSA 1KE3A 4QY6A 1OTAA 5EVEA 3NBLA 4OONA 5DKKA 4MN7A 3W4QA 3R4KA 2R78A 4WF0A 4OPQA 4N9KA 3HLGA 4LRXC 2K7SA 3ZFZA 3LR0A 1XFNA 1GSXA 3CZDA 3TSGA 2QMIA 2HDRA 1ES4A 2XGNA 1MY8A 4BENA 3ZG9B 4GHIB 5EVIC 4KUKA 4IBXA 1W63Q 3UPNA 1AXBA 1H0MA 4Y0OA 4I38A 4IEDA 3EQUA 5HPFA 1W63M 1PWCA 5I5LA 5CRFA 4N92A 4NK3A 1IEMA 2R9XA 4EERA 3V50A 2UWXA 4YOFA 5A92A 4II7A 2EWVA 4GNUA 3F1PB 4I3AA 1K57A 3M2JA 4ID4A 5AVFA 1BULA 4GB7A 3FPWA 1MPLA 2ZQDA 1ACFA 1UGUA 4HH2A 3VSLA 4Y17A 3IBJA 1CJFA 1LI9A 3IH9A 1TS8A 2O99A 2XF3A 3ZCZA 3W4PA 5HD3A 3D72A 3OPLA 3GR2A 4NXEA 3LEQA 1EWZA 3UMDA 1C3BA 4F3LA 5DTSA 2XFSA 4LRZE 4CJNA 2P9VA 2EX6A 1FILA 2PD7A 4JPMA 1ZG4A 3C8CA 2PT7A 5FI7A 1BLCA 1IKGA 3E4PA 4KZBA 4Q8IA 3S22A 3PBTA 1OMEA 3KX0X 1ERMA 5HWVA 1ZHHB 1SKFA 4FH2A 3ZG7B 4B4ZA 4BL3A 1XGIA 1V9YA 4OPRA 2FZ0A 2HJEA 3UDXA 1M6KA 3K3DA 1MWUA 4LCMA 3LY4A 3DWZA 3GQZA 1WA9A 5G4YA 2Y2JA 2EX9A 1YLJA 5HWWA 3OZHA 4QD4A 5FQ9A 1FR1A 2XLNA 3BLSA 1JTGA 4JGRA 1NZUA 1K6SA 2H0YA 4HBUA 3LIAA 2Q9NA 5FQQA 1WYCA 1IYQA 5GLDA 4OQIA 4KZAA 3G34A 3VFFA 4BLMA 4HJ6A
chains in the Genus database with same CATH topology
3H7WA 2L0WA 1T18A 1V9ZA 5TBMB 4I3IA 5EFWA 5A8BA 3B47A 3MXQA 2VKSA 1OTDA 1XJ4A 2J3TC 3A0SA 1H3QA 1T1BA 4Q0IA 2Y79A 5HDSA 4FSFA 4UEYA 4BJPA 3E4OA 3F1PA 4EXOA 5F5YA 4ARZB 2LB9A 1YSPA 2A2LA 2HGVA 1TS6A 4HH3A 3EEHA 1EW0A 3MF0A 4EEPA 2QWSA 2W3HA 3JVUA 3OLOA 4XT2A 4Y2FA 1P9WA 1LSVA 3BQAA 4HJ4A 2YKHA 2JKTI 2WKQA 2O9CA 4L0LA 2Z6DA 3C38A 2VJWA 5DJUA 5K5BA 2W3FA 2PD8A 2GZAA 3K2NA 3MJQA 4HJ3A 3EGDC 2O0YA 3LIEA 4IJGA 2WKPA 3EQVA 2L4RA 2VV7A 3OOVA 3A0RA 1OPXA 3F1OA 2PYRA 4EUVA 2PR6A 3GDIA 4PKYA 2VEAA 3VOLA 5C5KA 4MN5A 3CLOA 1S1ZA 2D01A 3ZQ5A 2OAP1 4I3JA 4ZRRA 3NJAA 5TJJA 4I5SA 2VGLM 4I39A 3MQOA 1LT0A 3F1NA 4KQDA 4Q0JA 3SW1A 3PXPA 5FL3A 3BW6A 4NXGA 3T4KA 3LICA 1GSWA 2VV6A 4CQHA 1OT6A 3VV4A 2OAQ1 4K08A 4M4XA 2L1MA 2V9AA 3BY8A 4DJ3A 2O9BA 3IS2B 2K2NA 3KSHA 2JHEA 5F68A 1DP8A 1D06A 4WEJA 2V0WA 3CI6A 4G3WA 2ZMVA 2ZMFA 1OJGA 4EEUA 1YSQA 3F1NB 1LSWA 1MZUA 2O9AA 3S7NA 2KOIA 3CITA 1NWZA 1T1CA 4L9FA 4WEKA 2IA2A 5DJTA 2M1CA 1NRJA 4GLQA 5IS1A 1JNUA 3GECA 2Y8HA 1ZTUA 3D3OA 1UWNX 3HJIA 4MDZA 3UB8A 3LR4A 3ULFA 4DN0A 3DBAA 2GNXA 4AFIA 4LRYC 2FH5A 2HJ9C 1T19A 3PBNA 3EOIA 2V1AA 4YWZA 4PAUA 4UQIS 4CLCA 4BWIA 2DMWA 4NKPA 5DFXA 2JKRI 4KUOA 3FG8A 4HY8A 4IUKA 3UE6A 4CLCE 5F6AA 3C2WA 2BASA 5HWTA 3OBFA 4JGOA 5HZHA 5LBRA 2XROA 3T4QA 4O8GA 4Q0HA 3KSGA 4ARZA 4EW7A 3RH8B 4WN5A 5AJGA 2J80A 3O5YA 3S7OA 1XFQA 5IU1A 1Y28A 2ZBBA 2GX5A 2GJ3A 3P7NA 4R38A 3LIDA 3LFVA 3T4LA 4B9OA 3LI8A 4WL9A 3C30A 4P6ZM 1S66L 1S4SA 3IBRA 2W27A 4MCWA 2VX8A 2K31A 2P7JA 4R70A 3CUEC 4GS9B 3TRCA 3H82B 1DRMA 1P9RA 1TF1A 4LLOB 3UB7A 1T1AA 1P97A 3UB6A 2B18A 3K3CA 3MFXA 2NUTC 5HSQA 3RTYA 1OJ5A 5IT5A 2D02A 5HPIA 1N9OA 2V1BA 3TJZC 2VV8A 2MJ6A 3R7WA 5DKLA 3VE3A 1P0ZA 2OOLA 3T50A 2P04A 1TS7A 3PBSA 1IOUA 5KIZA 1VB6A 3KO6A 3RFBA 3S7QA 4ETXA 4CLCD 3KYQA 3U2AA 4CLCB 4HI4A 2QJ5A 1OT9A 2W1RA 3NOTC 1YKDA 4WELA 3BWLA 4PHTA 1OTEA 5G4ZA 5HDCA 1XJ3A 4GJ4A 4GS9A 4L9EA 1G6OA 1DP9A 4EESA 1YAXA 2INWA 2XSSA 4H6JA 4WUJA 2H28A 2LB5A 3OCLA 3F1OB 4IHQA 3HJKA 4LPZA 3PBOA 3FPVA 1MC0A 1S4RA 1G28A 4NXFA 2W3EA 1ODVA 5F69A 3LIBA 2I9VA 2XRNA 2G7UA 4HP9A 1N9NA 2XA7M 3EGXC 4EETB 2W1TA 3T4TA 3T4JA 1OTIA 4EQ1A 4RQ9A 3S7PA 1F9IA 2J3WA 4GW9A 1NLYA 3CAXA 3LR5A 5AVEA 2A24A 5J3WA 2A24B 3KYZA 4PKYG 1OTAA 4XT2B 2W3DA 5DKKA 3ZYTA 4MN7A 4HHDA 1H8MA 1OTBA 4JGPA 3R4KA 3H9WA 4GHIA 2R78A 4WF0A 2PDRA 2PYPA 4LRXC 4CLCC 1S1YA 1TS0A 4HNBA 2K7SA 2JN7A 4HP4A 3ICYA 2JKTM 2V0UA 3LR0A 4BBTA 1XFNA 1GSXA 5TBMA 1LL8A 3NHQA 4E04A 2VGLS 3PHYA 3H7WB 1LSXA 2ZOIA 3W2ZA 5J7EA 5KSHA 4EU0A 3E0YA 4DJ2A 3HCYA 3BQ8A 4GHIB 2B02A 1F98A 4G3KA 4KUKA 5HL6A 1W63Q 3PYPA 3NOUC 3UB9A 4I38A 1X0OA 2HF6A 3R7WB 2P08A 3EEAA 3NOPC 2EA9A 3LUQA 2QHKA 3EQUA 5HPFA 1W63M 3JVVA 1XJ2A 3MR0A 4MN6A 4BBVA 5DFYA 2VZWA 3KSIA 5I5LA 4ME4A 4EERA 2PR5A 3G6OA 4YOFA 3BJNA 3TW8A 4R6LA 5MC7A 2W3GA 4II7A 2EWVA 3F1PB 3PBQA 4I3AA 3LIFA 3MQ0A 2WKRA 4DMZA 4GCZA 2QKPA 5AVFA 3H82A 3FPWA 1BYWA 1UGUA 2J3TD 4HH2A 5L8MA 3IBJA 3LR3A 2KX6A 1TS8A 2O99A 2QYBA 4Y3IA 4JGQA 5HD3A 3D72A 3MQQA 4NXBA 3PR6A 1STZA 2PHYA 3FC7A 4IUHA 1DP6A 1F5MA 5J4EA 4NXEA 4KQOA 5HDDA 1N9LA 3UMDA 3UMEA 1VHMA 2EWWA 1NLZA 4OOMA 3CWFA 4YNRA 3BY9A 2YKFA 2VA0A 2VLGA 4F3LB 4F3LA 4LRZE 3A0VA 2Z6CA 3IS2A 2PD7A 1TD5A 3OCNA 3C8CA 4HQAA 2PT7A 4G3VA 2JKRM 3B33A 2W1TB 3TE8A 3E4PA 2CMNA 3PBTA 3KX0X 1UWPX 4H6JB 3LYXA 5HWVA 1ZHHB 2HV1A 3EWKA 2ZOHA 4R3AA 4WLAA 3PBRA 4Z1WA 4ETZA 1V9YA 3LI9A 2FZ0A 2HJEA 5DF9A 3P01A 3E4QA 3K3DA 4UQIM 4O0PA 1WA9A 2NUPC 2OWHA 2OWJA 1MKMA 4BBUA 3OC2A 5G4YA 3T4SA 3UE3A 2KLIA 1IFQA 4HIAA 2XA7S 5HWWA 2QJ7A 3B42A 4NEED 4O01A 1XJ6A 3VE4A 4FOFA 3MMHA 4JGRA 4BMWA 1S67L 1D7EA 4L9GA 2M7UA 5CX7A 4P6ZS 4OOLA 5HD5A 3LIAA 4QPRA 2KDKA 3KSFA 1KOUA 4B93A 3CUEA 3T4OA 2M7VA 3V67A 4Y5FA 1GSVA 2W0NA 4HOIA 4MMNA 3E98A 4HJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7W A;  4I3A A;  2L0W A;  1T18 A;  1V9Z A;  1T1C A;  3LIF A;  3BWL A;  2WKR A;  5TBM B;  4I3I A;  4L9F A;  1OTE A;  5EFW A;  5G4Z A;  5HDC A;  1XJ3 A;  5A8B A;  4GCZ A;  2QKP A;  5AVF A;  3H82 A;  3MXQ A;  2M1C A;  4GS9 A;  4L9E A;  5DJT A;  1OTD A;  1DP9 A;  1XJ4 A;  4EES A;  1JNU A;  5IS1 A;  2INW A;  3GEC A;  3A0S A;  1UWN X;  1BYW A;  1UGU A;  3HJI A;  4HH2 A;  4H6J A;  3UB8 A;  4WUJ A;  2H28 A;  3ULF A;  2KX6 A;  1T1B A;  1TS8 A;  3F1O B;  3HJK A;  4JGQ A;  4LRY C;  3D72 A;  3MQQ A;  4LPZ A;  4NXB A;  5HD3 A;  5HDS A;  1S4R A;  2PHY A;  1G28 A;  1DP6 A;  1T19 A;  3FC7 A;  5J4E A;  4NXF A;  3E4O A;  3F1P A;  4EXO A;  2V1A A;  1ODV A;  4NXE A;  5F5Y A;  3LIB A;  5F69 A;  4YWZ A;  2I9V A;  5HDD A;  4HP9 A;  1N9N A;  1TS6 A;  4EET B;  4HH3 A;  3EEH A;  1EW0 A;  1N9L A;  1OTI A;  4EQ1 A;  4RQ9 A;  4KUO A;  3FG8 A;  4HY8 A;  3UME A;  3UMD A;  2QWS A;  4EEP A;  3CWF A;  1F9I A;  3UE6 A;  3BY9 A;  4GW9 A;  3CAX A;  5F6A A;  2YKF A;  4F3L B;  2VLG A;  3OLO A;  3C2W A;  4F3L A;  2BAS A;  5AVE A;  2A24 A;  5J3W A;  5HWT A;  4LRZ E;  4XT2 A;  2A24 B;  4JGO A;  5HZH A;  1LSV A;  4HJ4 A;  2YKH A;  3A0V A;  4PKY G;  1OTA A;  4XT2 B;  2WKQ A;  2Z6C A;  3IS2 A;  2PD7 A;  5DKK A;  2Z6D A;  5DJU A;  4HHD A;  1OTB A;  2PD8 A;  3RH8 B;  3C8C A;  4HQA A;  4WN5 A;  4EW7 A;  4JGP A;  3MJQ A;  4HJ3 A;  3B33 A;  2J80 A;  3E4P A;  3H9W A;  4GHI A;  2R78 A;  3LIE A;  1XFQ A;  4WF0 A;  1Y28 A;  2PDR A;  2ZBB A;  5IU1 A;  2PYP A;  4LRX C;  2CMN A;  1S1Y A;  2WKP A;  2GJ3 A;  2L4R A;  2VV7 A;  3KX0 X;  1UWP X;  4HNB A;  1TS0 A;  3A0R A;  3LYX A;  3P7N A;  2K7S A;  3LID A;  2HV1 A;  3EWK A;  4H6J B;  2JN7 A;  2ZOH A;  2PYR A;  3F1O A;  2PR6 A;  4HP4 A;  3ICY A;  4R3A A;  2V0U A;  3GDI A;  3LI8 A;  4PKY A;  4WL9 A;  4WLA A;  1V9Y A;  2VEA A;  3LI9 A;  3VOL A;  1XFN A;  1GSX A;  5TBM A;  4MN5 A;  4BBT A;  1S66 L;  3CLO A;  1S1Z A;  1S4S A;  3IBR A;  2W27 A;  1LL8 A;  3E4Q A;  3NHQ A;  2D01 A;  3K3D A;  4E04 A;  3ZQ5 A;  3PHY A;  2P7J A;  3H7W B;  4I3J A;  1LSX A;  2ZOI A;  4R70 A;  5J7E A;  3NJA A;  1WA9 A;  5HWV A;  2OWH A;  4GS9 B;  2OWJ A;  4I5S A;  3H82 B;  4DJ2 A;  4BBU A;  4I39 A;  3MQO A;  4GHI B;  2B02 A;  1DRM A;  5G4Y A;  1LT0 A;  4LLO B;  3UB7 A;  1T1A A;  1F98 A;  3F1N A;  4KQD A;  4KUK A;  4HIA A;  1P97 A;  3UB6 A;  5HWW A;  3MFX A;  3K3C A;  2QJ7 A;  4R38 A;  3SW1 A;  4NXG A;  5HSQ A;  3LIC A;  1GSW A;  1OJ5 A;  2VV6 A;  1XJ6 A;  2D02 A;  3NOU C;  3PYP A;  3RTY A;  3UB9 A;  3VE4 A;  1N9O A;  1OT6 A;  1X0O A;  2V1B A;  4I38 A;  2VV8 A;  3NOP C;  2EA9 A;  4M4X A;  4JGR A;  4K08 A;  2L1M A;  2V9A A;  3BY8 A;  4DJ3 A;  1S67 L;  1D7E A;  2QHK A;  3IS2 B;  3LUQ A;  4L9G A;  5DKL A;  3VE3 A;  1P0Z A;  2OOL A;  2JHE A;  5F68 A;  1XJ2 A;  5HD5 A;  3T50 A;  3MR0 A;  1DP8 A;  1TS7 A;  4MN6 A;  4BBV A;  3LIA A;  1D06 A;  5I5L A;  5KIZ A;  1VB6 A;  2V0W A;  4B9O A;  2KDK A;  1KOU A;  4EER A;  1OJG A;  4EEU A;  2PR5 A;  3F1N B;  1LSW A;  1MZU A;  3G6O A;  1GSV A;  2W0N A;  4HI4 A;  4HOI A;  4R6L A;  2QJ5 A;  1OT9 A;  3F1P B;  1NWZ A;  3NOT C;  4HJ6 A; 
#chains in the Genus database with same CATH topology
 3VP3 A;  3G30 A;  1HVB A;  3E2L A;  5EFW A;  3MXQ A;  2J3T C;  1D1J A;  3Q82 A;  3A0S A;  1K55 A;  3GV9 A;  1T1B A;  4FSF A;  4EXO A;  2ZD8 A;  3MBZ A;  1MWS A;  1YSP A;  2E8J A;  2A2L A;  2HGV A;  3S1Y A;  3MF0 A;  3BEC A;  1HTZ A;  5M19 A;  3IWO A;  2W3H A;  3BRM A;  1PZO A;  5KZH A;  3RXX A;  1ONH A;  3HL9 A;  2YKH A;  5E2E A;  4L0L A;  2VJW A;  5DJU A;  5K5B A;  3Q7V B;  2GZA A;  1PRQ A;  3C4O A;  2P74 A;  3IWI A;  3EGD C;  5L10 A;  4JBF A;  2FFF B;  4GD6 A;  1BUE A;  2PYR A;  3GDI A;  4EQI A;  3IQA A;  3VOL A;  1U60 A;  2D01 A;  2QPN A;  3SZT A;  3IHA A;  3GSG A;  4EUZ A;  4NET A;  2DNS A;  2XK1 A;  3MQO A;  4N9L A;  3VMA A;  4Q0J A;  1XA1 A;  5FL3 A;  3BW6 A;  4NXG A;  3GVB A;  1H8Y A;  4CQH A;  1OT6 A;  4DJ3 A;  2L1M A;  3MXS A;  5FDS A;  3BM6 A;  5CGW A;  5E2G A;  3VOY A;  3BFG A;  2JHE A;  5F68 A;  2EFU A;  3P98 A;  4G3W A;  5DVA A;  2ZMV A;  1YT4 A;  1YSQ A;  1LSW A;  1MZU A;  2O9A A;  4M3K A;  4F94 A;  1K4F A;  1NWZ A;  2WUQ A;  4P6B A;  4MBF A;  1T1C A;  2J8Y A;  5EVL A;  1FQG A;  4WM9 A;  1JNU A;  4GKU A;  3HJI A;  3UE1 A;  3ULF A;  4DN0 A;  1GHI A;  4UHU A;  1J3W A;  4AFI A;  4LRY C;  4ZJ1 A;  2FH5 A;  3EOI A;  2V1A A;  3QNC A;  1EI5 A;  5J8X A;  3UE6 A;  3IX8 A;  3C2W A;  2BAS A;  3G32 A;  2XD5 A;  4KZ5 A;  5LBR A;  1K54 C;  2DRW A;  4ARZ A;  3GTC A;  2J80 A;  5KMW A;  3O5Y A;  2GX5 A;  2GJ3 A;  4X69 A;  4R38 A;  1K38 A;  3V5M A;  4DF6 A;  2V20 A;  3CG5 A;  3LI8 A;  4WL9 A;  1S6R A;  1YLY A;  3HLD A;  1W8Y A;  1WYB A;  3CUE C;  3FZC A;  5CGX A;  1BLH A;  3LGO A;  2HDU A;  3B3X A;  3IXB A;  5M1A A;  3UB6 A;  3IXG A;  1LI0 A;  2IWD A;  1N9O A;  3PAG A;  2VV8 A;  1E25 A;  1K55 C;  2Q0O A;  4O7D A;  3R7W A;  3WRT A;  5DKL A;  2OOL A;  5FAO A;  3WS1 A;  3T50 A;  1TS7 A;  3IWQ A;  3G2Z A;  5CTM A;  4ETX A;  4LGW A;  3WRZ A;  4QJG A;  3KYQ A;  1MKI A;  3U2A A;  2QJ5 A;  1LL9 A;  4WZ5 C;  1OT9 A;  2W1R A;  4PHT A;  4KZ9 A;  4R4R A;  4L9E A;  3ZNT A;  5CED A;  1RP5 A;  3MSH A;  4WUJ A;  3HBR A;  5I94 A;  2ZQ7 A;  3PBO A;  1MC0 A;  1G28 A;  5HX9 A;  5F69 A;  2XRN A;  1NXY A;  2G7U A;  1N9N A;  1FCO A;  1Q2Q A;  1CF0 A;  5FEG A;  4S2N A;  1F9I A;  4Y13 A;  3N8R A;  1NLY A;  3LR5 A;  3GMW A;  5J3W A;  3ZG0 A;  4UAA A;  4PKY G;  4QB8 A;  4JXW A;  4JGP A;  2XFT A;  1NRF A;  4GHI A;  3C7U A;  1S1Y A;  3QHY A;  2BG1 A;  2JN7 A;  4E3O A;  3CHW P;  5TGF A;  3ICY A;  4BBT A;  3A3I A;  2J9P A;  5TBM A;  3SS5 A;  4JKT A;  4YIN A;  2WYX A;  5EE8 A;  2VGL S;  3PHY A;  5KSC A;  3U4L P;  3H7W B;  1LSX A;  5KSH A;  5E2F A;  4DJ2 A;  3HCY A;  2B02 A;  4N1H A;  1F98 A;  4G3K A;  4OPY A;  1VM1 A;  1CI9 A;  4IVI A;  2WZZ A;  3HUM A;  4R0Q A;  3EEA A;  5G18 A;  2ZC7 A;  2QHK A;  3NDG A;  3V39 A;  1HLU P;  4JXS A;  1XJ2 A;  3MR0 A;  5CEB A;  1IEL A;  5BOH A;  1SZV A;  2PR5 A;  5MC7 A;  2PU2 A;  5FQI A;  4R3J A;  3LIF A;  4GCZ A;  3IT9 A;  4FUW A;  2IWB A;  4E3I A;  3LR3 A;  5CTN A;  3AGF A;  2QYB A;  4NXB A;  3D9Y A;  3PR6 A;  2PHY A;  1I2W A;  1F5M A;  2OLV A;  3Q7V A;  3RXW A;  2H10 A;  1N9L A;  3UME A;  2EWW A;  4OOM A;  4YNR A;  2YKF A;  4F3L B;  5CHU A;  1N4O A;  3WS2 A;  3A0V A;  2Q9M A;  2Z6C A;  3DTM A;  3UN7 A;  3M6H A;  2HDQ A;  3Q7Z A;  1IYS A;  4WLA A;  1XPB A;  4OQH A;  4ETZ A;  3LI9 A;  4DE1 A;  5DF9 A;  1K56 D;  3P01 A;  2XH9 A;  4LEN A;  3A3J A;  5EM1 A;  2ZL1 A;  3MZF A;  1NYM A;  4X55 A;  3C5A A;  4C75 A;  2P9V B;  3T1R A;  4NEE D;  4PM5 A;  1KVL A;  5GLC A;  2PBD P;  5A90 A;  1KVM A;  4MNR A;  4BMW A;  4L9G A;  1DJB A;  4IVK A;  2M7U A;  5CX7 A;  4P6Z S;  3VP4 A;  2KDK A;  1KOU A;  4B93 A;  2ZC6 B;  3CUE A;  3NI9 A;  1MWT A;  4Y5F A;  4QU3 A;  1GSV A;  4EBP A;  4MMN A;  4Y0T A;  3E98 A;  2L0W A;  1V9Z A;  5TBM B;  2VK3 A;  3NC8 A;  3B47 A;  1G5U A;  4OP8 A;  3N8L A;  3S4X A;  1OTD A;  1A0K A;  1XJ4 A;  1BSG A;  1FCN A;  4BD1 A;  4R23 A;  1W5D A;  1HD8 A;  2Y79 A;  3NCK A;  4KQR A;  4E6X A;  5HDS A;  2WZX A;  3N7W A;  4ARZ B;  1YLT A;  1TS6 A;  1XKZ A;  4JXV A;  3EEH A;  1TDG A;  5HAQ A;  1CK3 A;  3G4P A;  1K25 A;  3VOZ A;  4XT2 A;  4Y2F A;  1P9W A;  1LSV A;  3BQA A;  1S0W A;  1NY0 A;  1Z09 A;  2O9C A;  2Z6D A;  5HW3 A;  4B88 A;  3MJQ A;  5E43 A;  2Y91 A;  2O0Y A;  4IJG A;  3AGD A;  2Y55 A;  3OOV A;  4S2L A;  3F1O A;  2X02 A;  3V3S A;  2J7V A;  4PKY A;  5C5K A;  3CLO A;  1YPR A;  2CC1 A;  3ZQ5 A;  4GDN A;  4ZRR A;  3NJA A;  3DW0 A;  4I5S A;  4I39 A;  1LT0 A;  3HLC A;  5GL9 A;  3VV4 A;  2V1Z A;  4K08 A;  2V9A A;  4JF4 A;  3IS2 B;  5GLB A;  2VGJ A;  4E3L A;  2V0W A;  3BLM A;  1OJG A;  2ZMA A;  4DKI A;  3FKW A;  4ESP A;  3CIT A;  3VFH A;  1L0G A;  3WS4 A;  1Y54 A;  4WEK A;  1K4E A;  2IA2 A;  2M1C A;  1NRJ A;  4WZ4 A;  3QP5 A;  3GEC A;  3HLF A;  2Y8H A;  1ZTU A;  1JWZ A;  4MDZ A;  4OPZ A;  3UB8 A;  2Z2L B;  3ISG A;  1L0E A;  4Y0U A;  1T19 A;  4YWZ A;  4PAU A;  1F2K A;  4CLC A;  2DMW A;  4NKP A;  4OH0 A;  2X71 A;  2JKG A;  3VP1 A;  5CGS A;  1PZP A;  1PFL A;  1ONG A;  2XD1 A;  2XRO A;  4Q0H A;  1FSY A;  4EW7 A;  2Y2K A;  2Y2P A;  3RH8 B;  2G2U A;  5IU1 A;  3BFD A;  2E8I A;  1JWP A;  4DE3 A;  3LFV A;  3LID A;  4OKP A;  3IHB A;  5AQ7 A;  3C30 A;  2W27 A;  1XXM A;  1ALQ A;  2K31 A;  3O88 A;  1BTL A;  5CXW A;  3WWX A;  4GS9 B;  3H82 B;  3UB7 A;  1T1A A;  1K54 A;  3VSK A;  1P97 A;  2B18 A;  3K3C A;  3MFX A;  3RTY A;  5HPI A;  4UA6 A;  1KGG A;  2EXA A;  2WKH A;  1XP4 A;  4KEN B;  4OP5 A;  3VE3 A;  5EV0 A;  5F83 A;  1VB6 A;  4HBT A;  5KIZ A;  4HES A;  4IBR A;  1SDN A;  1SKO B;  2WAD A;  4ZBE A;  4CLC B;  2UV0 E;  1JTD A;  1YKD A;  4WEL A;  1NYY A;  1XJ3 A;  5M18 A;  4GS9 A;  1ZC2 A;  1DP9 A;  1YAX A;  2XSS A;  1PWG A;  2Y2G A;  4FH4 A;  2H28 A;  3T1X A;  1L3L A;  4LPZ A;  5HL1 A;  2V2F F;  1ES3 A;  3SS4 A;  3QP4 A;  3ZNY A;  2W3E A;  3LIB A;  3FV7 A;  4OQ0 A;  4RVA A;  2XA7 M;  3T4T A;  4OQG A;  3T4J A;  4EQ1 A;  3IXD A;  4D2O A;  5IHV A;  4GW9 A;  1FIK A;  1G68 A;  1ESI A;  4KG6 A;  2A24 A;  1IKI A;  3KYZ A;  1NZO A;  5FAQ A;  2ZQ8 A;  4WMC D;  3SH8 A;  4K0W A;  3SOI A;  3ZYT A;  4HHD A;  1H8M A;  4U3T A;  1DJA A;  3UB5 P;  3H9W A;  2PDR A;  4CLC C;  2WKI A;  3HUN A;  4Y15 A;  4HP4 A;  1RGY A;  2V0U A;  1SCW A;  3VP0 A;  1GA0 A;  1LL8 A;  3NHQ A;  3W4O A;  4E04 A;  2ACG A;  2ZOI A;  3W2Z A;  3T12 B;  3T1Q B;  4EU0 A;  2EXB A;  3E0Y A;  2OLU A;  3BQ8 A;  1KDS A;  4PM6 A;  1O7E A;  5HL6 A;  5TFQ A;  3UB9 A;  1X0O A;  1KE4 A;  2HF6 A;  3R7W B;  3NOP C;  2EA9 A;  4KG2 A;  3JVV A;  1E3U D;  2PBY A;  5FDH A;  4S2J A;  5CHM A;  4S2I A;  1XX2 A;  2Y2O A;  4R6L A;  2EX2 A;  3PBQ A;  3O87 A;  4DMZ A;  3UDI A;  3MS6 A;  3CMZ A;  3A3D A;  4PPR A;  3L9K A;  5L8M A;  1BYW A;  4PM8 A;  4E6W A;  3BEB A;  5AQB A;  2GDN A;  3ZVT A;  2ZC3 B;  4JGQ A;  4RX3 A;  3MQQ A;  4DDY A;  4X1M A;  1STZ A;  4IUH A;  1DP6 A;  4JXG A;  5J4E A;  4KQO A;  1DJC A;  2HDS A;  5HDD A;  3TG9 A;  1BZA A;  4A5R A;  1VHM A;  4H8R A;  3CWF A;  3BY9 A;  3NUL A;  2VA0 A;  2VLG A;  4OLG A;  4KG5 A;  5EOE A;  1TD5 A;  1I2S A;  3MKF A;  4G3V A;  2JKR M;  3P09 A;  1J9M A;  1YM1 A;  2CMN A;  4N1X A;  3EWK A;  1RGZ A;  3PBR A;  1KE0 A;  2ZQA A;  1WE4 A;  4MBH A;  1JVJ A;  3E4Q A;  1QME A;  4KZ3 A;  3QP2 A;  1MKM A;  4BBU A;  3OC2 A;  3A3E A;  2QJ7 A;  5FEF A;  2XR0 A;  1XJ6 A;  4FOF A;  3C7V A;  1D7E A;  1ESU A;  5FQJ A;  2HZ5 A;  1MXO A;  3MXR A;  3T4O A;  5EEC A;  3V67 A;  3DWK A;  4HOI A;  3H7W A;  4I3I A;  4R1G A;  5A8B A;  1YLP A;  2RL3 A;  2VKS A;  2IWC A;  1LLB A;  5FQK A;  2XEP A;  3ZG8 B;  5L2F A;  3WS0 A;  4EWF A;  1O07 A;  1QMF A;  4Q0I A;  1FR6 A;  3BFC A;  4BJP A;  4ZTK A;  3E4O A;  5F5Y A;  2LB9 A;  2C5W B;  1EW0 A;  2JCH A;  3Q07 A;  2QWS A;  4UA7 A;  3JVU A;  3OLO A;  5FAT A;  3LCE A;  1W7F A;  3SH9 A;  1KGF A;  2JKT I;  2WKQ A;  5EVI A;  3WS5 A;  4MEZ A;  3V3R A;  4HJ3 A;  5DF8 A;  2A3U A;  1TEM A;  4PM9 A;  3QP1 A;  2HPB A;  4EBN A;  1TDL A;  2WKP A;  3EQV A;  2VV7 A;  5FSR A;  4EUV A;  2PR6 A;  1Q2P A;  4MN5 A;  1VQQ A;  5FA7 A;  2H5S A;  4I3J A;  2Y2H A;  5TJJ A;  1BLS A;  4XUX A;  2VGL M;  2OV5 A;  3BFF A;  4XUZ A;  3SW1 A;  4NG2 A;  2ZM0 A;  3LIC A;  1GSW A;  2VV6 A;  3LY3 A;  3HLW A;  3NEC A;  1ZG6 A;  3QP6 A;  3CI6 A;  2PRF A;  3RJU A;  2ZMF A;  4EEU A;  2VGK A;  1NJ4 A;  2KOI A;  2G2W A;  3IF6 A;  1GHM A;  2J9O A;  2ZL1 B;  4L9F A;  3PTE A;  5DJT A;  1L0F A;  4LV2 A;  5IS1 A;  1SHV A;  3HLB A;  4QWO A;  3N6I A;  3DBA A;  1PI5 A;  4OLD A;  4RX2 A;  2WK0 A;  3PBN A;  4LCL A;  1IYP A;  1ZKJ A;  2Y2I A;  2I72 A;  5DFX A;  1CEF A;  2Y2N A;  4OOY A;  4ZDX A;  3BYD A;  1W8Q A;  4CLC E;  2WGW A;  5F6A A;  2WKE A;  5HZH A;  5A93 A;  1ES2 A;  4O8G A;  5FAP A;  3KSG A;  1CQA A;  4HEF A;  3ZHH A;  4X68 A;  3UDF A;  4YFM A;  3JYI A;  1PW1 A;  3P7N A;  4QHC A;  4B9O A;  3T4L A;  2PAV P;  3DTK A;  5AQA A;  4Y7P A;  1S4S A;  3IBR A;  2HP9 A;  4DRT A;  1KGE A;  2P7J A;  5DTK A;  4R70 A;  4LFU A;  2V8C A;  4PMA A;  2ZM8 A;  4K91 A;  4XXR A;  2Y2L A;  1P9R A;  1TF1 A;  4LLO B;  5EVI D;  4KQQ A;  5HSQ A;  4KZ7 A;  3GRJ A;  2V1B A;  3TJZ C;  3MFD A;  2MJ6 A;  4Z9Q A;  3UO9 A;  4E3N A;  4X53 A;  1I5Q A;  3KO6 A;  1YLZ A;  4CLC D;  3FKV A;  1GCE A;  3ZVW A;  3O86 A;  5JYP A;  3NY4 A;  1HZO A;  3OPR A;  5G4Z A;  4GD8 A;  1G6O A;  3CJM A;  4EES A;  4FD8 A;  4H6J A;  2Y2Q A;  3ZGA B;  1BLP A;  1PYY A;  5FI6 A;  4NXF A;  1ODV A;  4HP9 A;  3EGX C;  1E4D A;  2W1T A;  1OTI A;  4RQ9 A;  2WAE A;  1PNE A;  4X56 A;  2J3W A;  3L7H A;  1SKO A;  5EOO A;  5AVE A;  4XT2 B;  2W3D A;  3UY6 A;  5GHY A;  1TVF A;  1OTB A;  3AGE A;  2PYP A;  4S2K A;  3DTE A;  1YMX A;  1TS0 A;  4HNB A;  2JKT M;  5AQ9 A;  2ZQ9 A;  3LO7 A;  5FI2 A;  5J7E A;  5TR7 A;  1FSW A;  1M40 A;  5GHX A;  3QNB A;  4WZ5 A;  4OVD A;  3W8K A;  3NDE A;  3G2Y A;  3PYP A;  3NOU C;  2P08 A;  3LUQ A;  2WGI A;  3A3F A;  4CPK A;  3BFE A;  4KZ4 A;  4MN6 A;  4BBV A;  5DFY A;  2VZW A;  3KSI A;  5D3O A;  3T1S A;  3UPP A;  4ME4 A;  1K6R A;  5CER A;  3SH7 A;  2Y2M A;  5DF7 A;  2ZM2 A;  3G6O A;  3TW8 A;  3BJN A;  2W3G A;  4BL2 A;  4QY5 A;  3FWL A;  3MQ0 A;  2WKR A;  5L09 A;  4S2N C;  1ERO A;  2QKP A;  3H82 A;  4UA9 A;  1W79 A;  3E2K A;  2J3T D;  1XGJ A;  3ITA A;  2KX6 A;  3LEZ A;  5CEC A;  3FYZ A;  4JF6 A;  4Y3I A;  3UE0 A;  4EBL A;  4RA7 A;  3FC7 A;  3CPT A;  4C6Y A;  4R3B A;  2HP5 A;  3MZD A;  1NLZ A;  1E3U A;  4E3M A;  4E3K A;  2QZ6 A;  2A49 A;  4B4X A;  3HUO A;  3IS2 A;  2XDM A;  3DTI A;  3OCN A;  4GDB A;  3O3V A;  4HQA A;  4BD0 A;  2V8F A;  3B33 A;  5F1G A;  2W1T B;  1PI4 A;  3TE8 A;  3KYE A;  4PM7 A;  1UWP X;  4H6J B;  3LYX A;  5HAR A;  1H5X A;  2HV1 A;  2ZOH A;  4P85 A;  4R3A A;  1K56 A;  4Z1W A;  1DY6 A;  3M2K A;  2HP6 A;  1LL5 A;  4UQI M;  4O0P A;  2NUP C;  2OWH A;  2OWJ A;  3T4S A;  3UE3 A;  2KLI A;  5GLA A;  1FOF A;  1IFQ A;  1K0K A;  4HIA A;  2XA7 S;  3B42 A;  4O01 A;  2EFX A;  3VE4 A;  1RCJ A;  3MMH A;  3UNW A;  4LV1 A;  4D60 A;  1S67 L;  5GHZ A;  4OOL A;  5HD5 A;  5EM0 A;  4QPR A;  3KSF A;  2M7V A;  1GA9 A;  2W0N A;  2R9W A;  2WAF A;  4X1L A;  3IX4 A;  2FFY A;  4DE0 A;  1T18 A;  2B5R A;  4KZ6 A;  5FQM A;  1MWR A;  3C4P A;  1GHP A;  1H3Q A;  3HVF A;  4LV3 A;  2RCX A;  1PW8 A;  4K0X A;  4UEY A;  3F1P A;  1IYO A;  1CI8 A;  3TOI A;  4X25 A;  3IF6 B;  5E2H A;  4HH3 A;  4EEP A;  4WBG A;  3OPP A;  2H0T A;  3DAV A;  2PU4 A;  1CEG A;  4HJ4 A;  3C38 A;  3G35 A;  4ZJ2 A;  2W3F A;  2PD8 A;  2Z2M B;  3K2N A;  4ZJ3 A;  3ITB A;  3LIE A;  5EPH A;  2L4R A;  4GOG A;  3A0R A;  5U47 A;  1OPX A;  3MKE A;  2VEA A;  1S1Z A;  3IF6 C;  1G6A A;  2OAP 1;  3N4I A;  3PAE A;  3M6B A;  4DXB A;  3HLE A;  2ZJ9 A;  3F1N A;  4KQD A;  3PXP A;  2WGV A;  3HRE A;  3T4K A;  4WMC A;  3ZG5 A;  5HFO A;  2OAQ 1;  4M4X A;  4DDS A;  3BY8 A;  2O9B A;  5HAI A;  1BT5 A;  2K2N A;  3KSH A;  1DP8 A;  1N9B A;  1XA7 A;  2JKF A;  1D06 A;  4WEJ A;  4LV0 A;  5FAS A;  4JF5 A;  4DXC A;  4S2P A;  3F1N B;  3S7N A;  2EX8 A;  3D4F A;  3N8S A;  4S2M A;  4KZ8 A;  2ZQC A;  4WYY A;  2ZC4 B;  4GLQ A;  1Y4O A;  1MBL A;  3D3O A;  1UWN X;  3VP2 A;  3LR4 A;  3ZDJ A;  3IXH A;  1L0D A;  5F82 A;  2JC7 A;  2GNX A;  1H8Z A;  2AVX A;  2HJ9 C;  4UQI S;  4BWI A;  2BTF P;  3JPU A;  2Y4A A;  1SDE A;  4X6T A;  2JKR I;  4KUO A;  3FG8 A;  4HY8 A;  4IUK A;  3I7J A;  5HWT A;  3OBF A;  5L07 A;  4JGO A;  3T4Q A;  4MLL A;  3CPT B;  4WN5 A;  1ES5 A;  1LHY A;  1VET B;  5AJG A;  5DTT A;  1KDW A;  3S7O A;  1XFQ A;  1VEU A;  1Y28 A;  2ZBB A;  5CHJ A;  4JLF A;  5HAP A;  3MZE A;  4MBK A;  1ERQ A;  4P6Z M;  1S66 L;  4MCW A;  2VX8 A;  5EUA A;  1K57 C;  3QP8 A;  4R4S A;  3SS3 A;  1PWD A;  3TRC A;  2ZC5 B;  1DRM A;  2ZLY A;  5EVI B;  2NUT C;  1OJ5 A;  5IT5 A;  2D02 A;  3OPH A;  1L2S A;  2C6W B;  3IX3 A;  2DCF A;  1P0Z A;  2P04 A;  2OSU A;  3PBS A;  1IOU A;  1Z6F A;  4FTX A;  4GN2 A;  4ZAM A;  3RFB A;  3S7Q A;  4DE2 A;  2XQZ A;  5A91 A;  4HI4 A;  3UPO A;  3IF5 A;  4P0M A;  3NOT C;  2JBF A;  4U0X A;  1JWV A;  3BWL A;  1OTE A;  2B95 A;  5HDC A;  4GJ4 A;  4P87 A;  5JYO A;  4GZB A;  1FCM A;  1PIO A;  2X01 A;  2INW A;  2BLS A;  1YMS A;  1YLW A;  4U0T A;  4C3Q A;  2LB5 A;  4E3J A;  3OCL A;  1AWI A;  3F1O B;  4IHQ A;  3HJK A;  3IH8 A;  3FPV A;  1S4R A;  1VET A;  2Y59 A;  5F1F A;  2I9V A;  3Q1F A;  4FCF A;  1VEU B;  4S2O A;  4EV4 A;  4EET B;  4BQM A;  2JE5 A;  3Q81 A;  4RYE A;  2WGW B;  3G31 A;  3NIA A;  3S7P A;  3CAX A;  2A24 B;  1YQS A;  1KE3 A;  4QY6 A;  1OTA A;  5EVE A;  3NBL A;  4OON A;  5DKK A;  4MN7 A;  3W4Q A;  3R4K A;  2R78 A;  4WF0 A;  4OPQ A;  4N9K A;  3HLG A;  4LRX C;  2K7S A;  3ZFZ A;  3LR0 A;  1XFN A;  1GSX A;  3CZD A;  3TSG A;  2QMI A;  2HDR A;  1ES4 A;  2XGN A;  1MY8 A;  4BEN A;  3ZG9 B;  4GHI B;  5EVI C;  4KUK A;  4IBX A;  1W63 Q;  3UPN A;  1AXB A;  1H0M A;  4Y0O A;  4I38 A;  4IED A;  3EQU A;  5HPF A;  1W63 M;  1PWC A;  5I5L A;  5CRF A;  4N92 A;  4NK3 A;  1IEM A;  2R9X A;  4EER A;  3V50 A;  2UWX A;  4YOF A;  5A92 A;  4II7 A;  2EWV A;  4GNU A;  3F1P B;  4I3A A;  1K57 A;  3M2J A;  4ID4 A;  5AVF A;  1BUL A;  4GB7 A;  3FPW A;  1MPL A;  2ZQD A;  1ACF A;  1UGU A;  4HH2 A;  3VSL A;  4Y17 A;  3IBJ A;  1CJF A;  1LI9 A;  3IH9 A;  1TS8 A;  2O99 A;  2XF3 A;  3ZCZ A;  3W4P A;  5HD3 A;  3D72 A;  3OPL A;  3GR2 A;  4NXE A;  3LEQ A;  1EWZ A;  3UMD A;  1C3B A;  4F3L A;  5DTS A;  2XFS A;  4LRZ E;  4CJN A;  2P9V A;  2EX6 A;  1FIL A;  2PD7 A;  4JPM A;  1ZG4 A;  3C8C A;  2PT7 A;  5FI7 A;  1BLC A;  1IKG A;  3E4P A;  4KZB A;  4Q8I A;  3S22 A;  3PBT A;  1OME A;  3KX0 X;  1ERM A;  5HWV A;  1ZHH B;  1SKF A;  4FH2 A;  3ZG7 B;  4B4Z A;  4BL3 A;  1XGI A;  1V9Y A;  4OPR A;  2FZ0 A;  2HJE A;  3UDX A;  1M6K A;  3K3D A;  1MWU A;  4LCM A;  3LY4 A;  3DWZ A;  3GQZ A;  1WA9 A;  5G4Y A;  2Y2J A;  2EX9 A;  1YLJ A;  5HWW A;  3OZH A;  4QD4 A;  5FQ9 A;  1FR1 A;  2XLN A;  3BLS A;  1JTG A;  4JGR A;  1NZU A;  1K6S A;  2H0Y A;  4HBU A;  3LIA A;  2Q9N A;  5FQQ A;  1WYC A;  1IYQ A;  5GLD A;  4OQI A;  4KZA A;  3G34 A;  3VFF A;  4BLM A;  4HJ6 A; 
#chains in the Genus database with same CATH homology
 3H7W A;  2L0W A;  1T18 A;  1V9Z A;  5TBM B;  4I3I A;  5EFW A;  5A8B A;  3B47 A;  3MXQ A;  2VKS A;  1OTD A;  1XJ4 A;  2J3T C;  3A0S A;  1H3Q A;  1T1B A;  4Q0I A;  2Y79 A;  5HDS A;  4FSF A;  4UEY A;  4BJP A;  3E4O A;  3F1P A;  4EXO A;  5F5Y A;  4ARZ B;  2LB9 A;  1YSP A;  2A2L A;  2HGV A;  1TS6 A;  4HH3 A;  3EEH A;  1EW0 A;  3MF0 A;  4EEP A;  2QWS A;  2W3H A;  3JVU A;  3OLO A;  4XT2 A;  4Y2F A;  1P9W A;  1LSV A;  3BQA A;  4HJ4 A;  2YKH A;  2JKT I;  2WKQ A;  2O9C A;  4L0L A;  2Z6D A;  3C38 A;  2VJW A;  5DJU A;  5K5B A;  2W3F A;  2PD8 A;  2GZA A;  3K2N A;  3MJQ A;  4HJ3 A;  3EGD C;  2O0Y A;  3LIE A;  4IJG A;  2WKP A;  3EQV A;  2L4R A;  2VV7 A;  3OOV A;  3A0R A;  1OPX A;  3F1O A;  2PYR A;  4EUV A;  2PR6 A;  3GDI A;  4PKY A;  2VEA A;  3VOL A;  5C5K A;  4MN5 A;  3CLO A;  1S1Z A;  2D01 A;  3ZQ5 A;  2OAP 1;  4I3J A;  4ZRR A;  3NJA A;  5TJJ A;  4I5S A;  2VGL M;  4I39 A;  3MQO A;  1LT0 A;  3F1N A;  4KQD A;  4Q0J A;  3SW1 A;  3PXP A;  5FL3 A;  3BW6 A;  4NXG A;  3T4K A;  3LIC A;  1GSW A;  2VV6 A;  4CQH A;  1OT6 A;  3VV4 A;  2OAQ 1;  4K08 A;  4M4X A;  2L1M A;  2V9A A;  3BY8 A;  4DJ3 A;  2O9B A;  3IS2 B;  2K2N A;  3KSH A;  2JHE A;  5F68 A;  1DP8 A;  1D06 A;  4WEJ A;  2V0W A;  3CI6 A;  4G3W A;  2ZMV A;  2ZMF A;  1OJG A;  4EEU A;  1YSQ A;  3F1N B;  1LSW A;  1MZU A;  2O9A A;  3S7N A;  2KOI A;  3CIT A;  1NWZ A;  1T1C A;  4L9F A;  4WEK A;  2IA2 A;  5DJT A;  2M1C A;  1NRJ A;  4GLQ A;  5IS1 A;  1JNU A;  3GEC A;  2Y8H A;  1ZTU A;  3D3O A;  1UWN X;  3HJI A;  4MDZ A;  3UB8 A;  3LR4 A;  3ULF A;  4DN0 A;  3DBA A;  2GNX A;  4AFI A;  4LRY C;  2FH5 A;  2HJ9 C;  1T19 A;  3PBN A;  3EOI A;  2V1A A;  4YWZ A;  4PAU A;  4UQI S;  4CLC A;  4BWI A;  2DMW A;  4NKP A;  5DFX A;  2JKR I;  4KUO A;  3FG8 A;  4HY8 A;  4IUK A;  3UE6 A;  4CLC E;  5F6A A;  3C2W A;  2BAS A;  5HWT A;  3OBF A;  4JGO A;  5HZH A;  5LBR A;  2XRO A;  3T4Q A;  4O8G A;  4Q0H A;  3KSG A;  4ARZ A;  4EW7 A;  3RH8 B;  4WN5 A;  5AJG A;  2J80 A;  3O5Y A;  3S7O A;  1XFQ A;  5IU1 A;  1Y28 A;  2ZBB A;  2GX5 A;  2GJ3 A;  3P7N A;  4R38 A;  3LID A;  3LFV A;  3T4L A;  4B9O A;  3LI8 A;  4WL9 A;  3C30 A;  4P6Z M;  1S66 L;  1S4S A;  3IBR A;  2W27 A;  4MCW A;  2VX8 A;  2K31 A;  2P7J A;  4R70 A;  3CUE C;  4GS9 B;  3TRC A;  3H82 B;  1DRM A;  1P9R A;  1TF1 A;  4LLO B;  3UB7 A;  1T1A A;  1P97 A;  3UB6 A;  2B18 A;  3K3C A;  3MFX A;  2NUT C;  5HSQ A;  3RTY A;  1OJ5 A;  5IT5 A;  2D02 A;  5HPI A;  1N9O A;  2V1B A;  3TJZ C;  2VV8 A;  2MJ6 A;  3R7W A;  5DKL A;  3VE3 A;  1P0Z A;  2OOL A;  3T50 A;  2P04 A;  1TS7 A;  3PBS A;  1IOU A;  5KIZ A;  1VB6 A;  3KO6 A;  3RFB A;  3S7Q A;  4ETX A;  4CLC D;  3KYQ A;  3U2A A;  4CLC B;  4HI4 A;  2QJ5 A;  1OT9 A;  2W1R A;  3NOT C;  1YKD A;  4WEL A;  3BWL A;  4PHT A;  1OTE A;  5G4Z A;  5HDC A;  1XJ3 A;  4GJ4 A;  4GS9 A;  4L9E A;  1G6O A;  1DP9 A;  4EES A;  1YAX A;  2INW A;  2XSS A;  4H6J A;  4WUJ A;  2H28 A;  2LB5 A;  3OCL A;  3F1O B;  4IHQ A;  3HJK A;  4LPZ A;  3PBO A;  3FPV A;  1MC0 A;  1S4R A;  1G28 A;  4NXF A;  2W3E A;  1ODV A;  5F69 A;  3LIB A;  2I9V A;  2XRN A;  2G7U A;  4HP9 A;  1N9N A;  2XA7 M;  3EGX C;  4EET B;  2W1T A;  3T4T A;  3T4J A;  1OTI A;  4EQ1 A;  4RQ9 A;  3S7P A;  1F9I A;  2J3W A;  4GW9 A;  1NLY A;  3CAX A;  3LR5 A;  5AVE A;  2A24 A;  5J3W A;  2A24 B;  3KYZ A;  4PKY G;  1OTA A;  4XT2 B;  2W3D A;  5DKK A;  3ZYT A;  4MN7 A;  4HHD A;  1H8M A;  1OTB A;  4JGP A;  3R4K A;  3H9W A;  4GHI A;  2R78 A;  4WF0 A;  2PDR A;  2PYP A;  4LRX C;  4CLC C;  1S1Y A;  1TS0 A;  4HNB A;  2K7S A;  2JN7 A;  4HP4 A;  3ICY A;  2JKT M;  2V0U A;  3LR0 A;  4BBT A;  1XFN A;  1GSX A;  5TBM A;  1LL8 A;  3NHQ A;  4E04 A;  2VGL S;  3PHY A;  3H7W B;  1LSX A;  2ZOI A;  3W2Z A;  5J7E A;  5KSH A;  4EU0 A;  3E0Y A;  4DJ2 A;  3HCY A;  3BQ8 A;  4GHI B;  2B02 A;  1F98 A;  4G3K A;  4KUK A;  5HL6 A;  1W63 Q;  3PYP A;  3NOU C;  3UB9 A;  4I38 A;  1X0O A;  2HF6 A;  3R7W B;  2P08 A;  3EEA A;  3NOP C;  2EA9 A;  3LUQ A;  2QHK A;  3EQU A;  5HPF A;  1W63 M;  3JVV A;  1XJ2 A;  3MR0 A;  4MN6 A;  4BBV A;  5DFY A;  2VZW A;  3KSI A;  5I5L A;  4ME4 A;  4EER A;  2PR5 A;  3G6O A;  4YOF A;  3BJN A;  3TW8 A;  4R6L A;  5MC7 A;  2W3G A;  4II7 A;  2EWV A;  3F1P B;  3PBQ A;  4I3A A;  3LIF A;  3MQ0 A;  2WKR A;  4DMZ A;  4GCZ A;  2QKP A;  5AVF A;  3H82 A;  3FPW A;  1BYW A;  1UGU A;  2J3T D;  4HH2 A;  5L8M A;  3IBJ A;  3LR3 A;  2KX6 A;  1TS8 A;  2O99 A;  2QYB A;  4Y3I A;  4JGQ A;  5HD3 A;  3D72 A;  3MQQ A;  4NXB A;  3PR6 A;  1STZ A;  2PHY A;  3FC7 A;  4IUH A;  1DP6 A;  1F5M A;  5J4E A;  4NXE A;  4KQO A;  5HDD A;  1N9L A;  3UMD A;  3UME A;  1VHM A;  2EWW A;  1NLZ A;  4OOM A;  3CWF A;  4YNR A;  3BY9 A;  2YKF A;  2VA0 A;  2VLG A;  4F3L B;  4F3L A;  4LRZ E;  3A0V A;  2Z6C A;  3IS2 A;  2PD7 A;  1TD5 A;  3OCN A;  3C8C A;  4HQA A;  2PT7 A;  4G3V A;  2JKR M;  3B33 A;  2W1T B;  3TE8 A;  3E4P A;  2CMN A;  3PBT A;  3KX0 X;  1UWP X;  4H6J B;  3LYX A;  5HWV A;  1ZHH B;  2HV1 A;  3EWK A;  2ZOH A;  4R3A A;  4WLA A;  3PBR A;  4Z1W A;  4ETZ A;  1V9Y A;  3LI9 A;  2FZ0 A;  2HJE A;  5DF9 A;  3P01 A;  3E4Q A;  3K3D A;  4UQI M;  4O0P A;  1WA9 A;  2NUP C;  2OWH A;  2OWJ A;  1MKM A;  4BBU A;  3OC2 A;  5G4Y A;  3T4S A;  3UE3 A;  2KLI A;  1IFQ A;  4HIA A;  2XA7 S;  5HWW A;  2QJ7 A;  3B42 A;  4NEE D;  4O01 A;  1XJ6 A;  3VE4 A;  4FOF A;  3MMH A;  4JGR A;  4BMW A;  1S67 L;  1D7E A;  4L9G A;  2M7U A;  5CX7 A;  4P6Z S;  4OOL A;  5HD5 A;  3LIA A;  4QPR A;  2KDK A;  3KSF A;  1KOU A;  4B93 A;  3CUE A;  3T4O A;  2M7V A;  3V67 A;  4Y5F A;  1GSV A;  2W0N A;  4HOI A;  4MMN A;  3E98 A;  4HJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...