3ULFA

The light state structure of the blue-light photoreceptor aureochrome1 lov
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
135
structure length
135
Chain Sequence
EDPDYSLVKALQMAQQNFVITDASLPDNPIVYASRGFLTLTGYSLDQILGRNCRFLQGPETDPRAVDKIRNAITKGVDTSVCLLNYRQDGTTFWNLFFVAGLRDSKGNIVNYVGVQSKVSEDYAKLLVNEQNIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aureochrome1
publication title Crystal structures of Aureochrome1 LOV suggest new design strategies for optogenetics.
pubmed doi rcsb
source organism Vaucheria frigida
molecule tags Signaling protein
total genus 43
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ulfA00
3ZQ5A 2A24A 2WKQA 2YKHA 3LICA 4H6JB 1S4RA 2INWA 2VLGA 4R3AA 1TS7A 5AVEA 3RTYA 3LI9A 1Y28A 5EFWA 2PR5A 3H7WA 4WF0A 4EW7A 1UWNX 1TS6A 4PKYG 3C8CA 3MJQA 2PYPA 4XT2B 4B9OA 2PR6A 3F1PA 4HP4A 2M1CA 3ICYA 5J3WA 3RH8B 2P7JA 5DKKA 3E4PA 3LIBA 1LSXA 1OJGA 4R38A 5DJUA 1DRMA 2KX6A 4H6JA 1F9IA 4GS9B 5A8BA 2D01A 1TS8A 2ZBBA 4LPZA 1DP8A 4F3LB 1T1CA 1OTBA 4HQAA 1GSVA 1XFQA 1V9ZA 1OTDA 4KUOA 4HJ3A 2YKFA 4KUKA 1T1BA 1P0ZA 4LRZE 3B33A 2GJ3A 1LL8A 3LIEA 5F69A 4NXGA 3A0SA 3LIDA 4EEUA 2KDKA 1DP6A 5KIZA 3E4QA 2VEAA 3G6OA 1LT0A 4I38A 2VV7A 1T1AA 1OTIA 3BWLA 1D06A 3D72A 1XJ4A 2ZOHA 3PHYA 3NJAA 2L1MA 2Z6DA 4LLOB 3P7NA 4HH3A 2R78A 1T19A 2QKPA 2Z6CA 3MQOA 1XFNA 2K7SA 4YWZA 4I3JA 5HWTA 5HDSA 3LIFA 4DJ3A 2V1BA 3VE4A 4WN5A 1T18A 1TS0A 4EERA 3NHQA 1LSVA 1OTEA 1UGUA 3F1OA 4GHIB 1N9NA 4MN6A 4L9GA 5AVFA 1EW0A 5J4EA 4HOIA 3EWKA 3LI8A 4GCZA 4DJ2A 5HDCA 3HJIA 2PHYA 4EEPA 3MQQA 2JHEA 4HJ6A 4HHDA 1OT6A 3MFXA 1MZUA 3NOTC 5F68A 4JGQA 3PYPA 3UB6A 2L4RA 3IS2B 3UB9A 4BBTA 2QWSA 4MN5A 2H28A 4I39A 3NOUC 3SW1A 2EA9A 5F6AA 4HP9A 4L9FA 4XT2A 3VOLA 4HH2A 4EQ1A 2D02A 3BY9A 1XJ2A 3FG8A 4E04A 2OWJA 4I3IA 5HD3A 2OWHA 3K3DA 4L9EA 3UMDA 3EEHA 3H9WA 1BYWA 5HSQA 1S1ZA 4EESA 3LUQA 1S1YA 5I5LA 4GS9A 5J7EA 4I3AA 3IS2A 3FC7A 3BY8A 2L0WA 1XJ3A 2V0WA 2VV8A 4F3LA 1P97A 2WKPA 2ZOIA 3K3CA 5G4YA 3A0VA 2QJ5A 3CWFA 4R6LA 3H7WB 1GSXA 2J80A 5DJTA 2WKRA 4HIAA 3F1PB 1N9OA 2V0UA 2PD7A 4BBUA 1GSWA 4I5SA 4NXEA 4JGPA 2W0NA 3GECA 4LRXC 1DP9A 3UE6A 1X0OA 2QHKA 3F1NB 5HZHA 3IBRA 3CLOA 2OOLA 5IU1A 2W27A 1ODVA 5HDDA 4RQ9A 4HNBA 5TBMB 4JGRA 4M4XA 2PDRA 4KQDA 4NXBA 4BBVA 2B02A 1VB6A 4PKYA 2VV6A 1LSWA 4GHIA 4GW9A 2I9VA 2V1AA 1KOUA 3UB8A 5G4ZA 4WUJA 3NOPC 3F1NA 3CAXA 2PYRA 2PD8A 1XJ6A 3C2WA 3H82B 3LYXA 5HD5A 2JN7A 2HV1A 3GDIA 2BASA 4EETB 1NWZA 1V9YA 3MXQA 4WL9A 1OT9A 1G28A 2V9AA 4HJ4A 1F98A 1D7EA 3LIAA 5TBMA 1S4SA 5F5YA 1UWPX 4HY8A 4NXFA 2A24B 2QJ7A 4JGOA 3UB7A 1S66L 4WLAA 1N9LA 1WA9A 2CMNA 3MR0A 4R70A 3ULFA 3T50A 5HWWA 4HI4A 3A0RA 3UMEA 3KX0X 3H82A 3F1OB 4LRYC 4EXOA 1S67L 5IS1A 5HWVA 3E4OA 4K08A 3HJKA 5DKLA 3VE3A 1JNUA 1OJ5A 1OTAA 3OLOA
chains in the Genus database with same CATH superfamily
2ZJ9A 3ZQ5A 3OCNA 2A24A 1FR1A 3UDIA 3HLGA 4RYEA 1MXOA 5TR7A 3ZG8B 3TW8A 1ES3A 1BSGA 2W3HA 4HEFA 3N8RA 3FKWA 1BULA 1CK3A 3VMAA 4OQIA 3NI9A 3EGXC 4G3WA 1NLYA 4IUHA 4LV1A 2PU2A 3N6IA 2JE5A 1UWNX 1CJFA 4PKYG 3K2NA 3V3RA 2PYPA 2DMWA 1RCJA 4EQIA 1ONHA 2PR6A 2IWBA 5FQIA 3Q7VB 4K91A 4P6ZS 1GA0A 2P7JA 1NLZA 3E4PA 4NETA 5CX7A 1OJGA 4XXRA 1KDWA 1GHIA 2OV5A 5A8BA 3MXRA 4OQHA 1QMEA 2ZLYA 2V2FF 3SS5A 4LPZA 1O7EA 2Y2NA 3NY4A 4UHUA 1MY8A 2WKEA 2X71A 4HQAA 4KZ8A 2IWCA 1Y4OA 4P85A 1OTDA 4GN2A 5EVIA 3ZDJA 1S6RA 1P0ZA 3VP0A 5CEBA 4ESPA 1Q2QA 2EXAA 4NXGA 4E6XA 3UDFA 4OPYA 4X68A 3LIDA 1YAXA 4EEUA 1JWZA 4OP8A 1EI5A 4KZ9A 3BM6A 1DY6A 1VM1A 3DTMA 4JKTA 4WBGA 3Q81A 4MBHA 4DE3A 3BWLA 2GDNA 4CQHA 3P98A 3D72A 3OC2A 1LL9A 2QZ6A 4E3NA 2HPBA 2Y79A 3SH7A 4C6YA 3M6BA 3PAEA 5MC7A 1K4FA 3AGEA 4E3IA 1T19A 3ITAA 3IWIA 5FAPA 4FH4A 1IEMA 5A92A 1O07A 4XUZA 1J3WA 3ZCZA 4JXVA 3VFHA 3HLFA 1XFNA 4C75A 4I3JA 5HWTA 3LIFA 3VE4A 3VV4A 4S2OA 1YLPA 1LSVA 1OTEA 1UGUA 3S1YA 4GZBA 2ZMVA 3L9KA 3GTCA 4MN6A 5AVFA 4P6BA 3QHYA 2Y2JA 4X6TA 1GCEA 3MQ0A 1CI9A 4U0TA 5EOOA 3HJIA 4QJGA 1W63M 4BWIA 2HDSA 3TRCA 2PHYA 3E2LA 4ME4A 4X53A 3WS0A 4HJ6A 4HHDA 3VSKA 1MZUA 2FZ0A 5F68A 4CLCB 4MN7A 3PYPA 4G3KA 4QB8A 5FASA 3IXBA 4G3VA 4FH2A 2QWSA 2J9OA 1M40A 2H28A 1W63Q 4I39A 4PM6A 2A49A 1L0GA 5F6AA 1PZPA 1VEUA 4XT2A 4HH2A 1BLHA 4JXWA 5TJJA 1XJ2A 3E98A 4MLLA 5CGWA 4E04A 2OWJA 2ZQCA 4Y2FA 4GDBA 3K3DA 4L9EA 3A3JA 4GJ4A 5GHZA 3FWLA 1BZAA 4E3LA 1S1YA 3FPVA 4GS9A 3IWQA 3ZYTA 4Y7PA 3IS2A 3FC7A 2JCHA 3O5YA 4MNRA 3A3FA 4UAAA 3B3XA 1U60A 1XJ3A 2C5WB 4S2NC 1NY0A 3CMZA 4EBPA 2XQZA 3K3CA 2ZOIA 5G4YA 5EE8A 3QP2A 1PNEA 3QP1A 3OOVA 2Y2PA 1IOUA 4QD4A 5BOHA 4Y0OA 4L0LA 4WMCD 1TDLA 4NEED 2OAP1 2ZL1A 4BBUA 1GSWA 3ZG5A 2PU4A 1W79A 1YMXA 1MC0A 3UE6A 2Q0OA 2MJ6A 3G35A 3PBRA 4WZ5A 3ZG9B 3IX8A 2WZXA 5FEGA 5HZHA 2OOLA 4BQMA 3UDXA 4XUXA 4EBLA 1ES5A 2X01A 5TBMB 5HL6A 4HESA 1N4OA 1AXBA 2FH5A 2ZQAA 5EVIB 3G32A 4PMAA 1I5QA 4PKYA 4Z1WA 3BW6A 1WYCA 5TFQA 4E3MA 4DDSA 2Y2LA 5L07A 3B42A 3N4IA 4GW9A 3UE1A 2V1AA 3I7JA 3UB8A 4QWOA 5G4ZA 2V1ZA 1ZG4A 3BECA 1IFQA 1J9MA 2PD8A 1XJ6A 2HP6A 1IYSA 3DBAA 3NBLA 2BASA 2H0TA 3WRZA 4AFIA 4OP5A 2PT7A 4R3BA 1G28A 4B88A 4ZTKA 2V9AA 4HJ4A 2ZMFA 1S4SA 5EPHA 5F5YA 5EM0A 1UWPX 5KSCA 1AWIA 3MF0A 3HBRA 4NXFA 3HUNA 4CJNA 5CHJA 5HAIA 3ZNYA 1XA7A 4MBFA 1S66L 3NCKA 2KOIA 4KQQA 3QP4A 3LR5A 3KYQA 3UPNA 3ULFA 3T50A 1PZOA 2ZC3B 3MKFA 1VETA 3G30A 3A0RA 4DXBA 3KX0X 2HDQA 2XD1A 2W3EA 2HDRA 3HUOA 5IS1A 5CECA 1K55C 1FILA 2PBYA 3LY3A 3VOZA 5DKLA 1XPBA 1JNUA 4N1HA 1OJ5A 3C4OA 4ID4A 4NG2A 3FV7A 2VJWA 3A3DA 2WKQA 2YKHA 4OLDA 1BT5A 3EEAA 3KYEA 4IBXA 3LICA 5DTSA 2VLGA 2INWA 4R3AA 4LV3A 4JLFA 5AVEA 3N8LA 5EVLA 5HW3A 1IKGA 2RCXA 5C5KA 1PI4A 3RTYA 3PBSA 1DJBA 4IVKA 2Y2KA 3LI9A 5EFWA 2PR5A 4KG5A 2JBFA 1EWZA 1JTDA 4WF0A 2WK0A 3HLBA 3FYZA 5E2GA 1PW8A 3GV9A 2Y2OA 5E2HA 2W3GA 3NDEA 1VEUB 4XT2B 1IYOA 1K6SA 3G4PA 3F1PA 3LEQA 5HFOA 2M1CA 3ICYA 4QY5A 1G6OA 3TG9A 4R38A 1NRJA 1KE0A 1LI0A 2KX6A 4H6JA 1F9IA 4D60A 1KVLA 5GHYA 4GS9B 2V20A 2XSSA 3T4OA 3SZTA 4GKUA 2ZBBA 3WWXA 2ZC5B 5DF9A 2Y4AA 5F1FA 3T12B 2EWVA 1Q2PA 3PR6A 4JF6A 3RXWA 3MMHA 4IUKA 3MKEA 4KQRA 1T1BA 5DTKA 1YLTA 1LL8A 3LIEA 4EUVA 1BUEA 3OPHA 2OAQ1 1Y54A 5GLAA 4OLGA 2ZC4B 3G6OA 2WGWB 2EX2A 3GQZA 3KSHA 1SDNA 3SOIA 5FEFA 1OTIA 2H5SA 1YT4A 4N1XA 3NJAA 4OQ0A 3W8KA 1DJAA 4LLOB 4ARZB 2W1TA 2ZM2A 5EVIC 3O88A 5GLCA 1EROA 4FSFA 2R78A 2Z2MB 4H8RA 1FQGA 4U3TA 4LV2A 4WM9A 3PBQA 3VP2A 3BFEA 1IYQA 3NULA 2JKGA 1L0EA 5HDSA 4PAUA 1LI9A 4QPRA 4WN5A 4MMNA 1K54C 3QP5A 1PIOA 1ACFA 3GMWA 2K31A 1N9NA 3IXDA 4X1MA 4L9GA 1EW0A 4HOIA 1K38A 4OOLA 2XROA 5L10A 3EWKA 5HDCA 2PRFA 1JWPA 1PW1A 3MQQA 1FSWA 5DFYA 1KE4A 1OT6A 3MFXA 5J8XA 4P87A 4R1GA 2XFTA 3UB6A 4PM5A 3UB9A 2J9PA 4RVAA 1CF0A 3D4FA 1SKOA 5FAOA 1YSPA 3O87A 1ZHHB 4DE1A 4MN5A 3NECA 3LR0A 5M1AA 4PM8A 3ZNTA 3ISGA 4GD6A 5FQ9A 4HP9A 5FQMA 3VOLA 4EQ1A 2ZC7A 2OLUA 4I3IA 1IELA 2OWHA 2O9CA 3EGDC 2Y2HA 4ZRRA 4DRTA 4R4SA 2VX8A 3H9WA 5FL3A 3BRMA 3T4KA 4Y17A 3UY6A 3IF6A 1YLYA 1SCWA 3E2KA 4DXCA 4EBNA 1CI8A 5J7EA 2FFYA 3BY8A 1ESIA 5KMWA 4Q0JA 2ACGA 3OPRA 3CHWP 4WMCA 2Y55A 2J3TD 3BEBA 3ZG7B 2P04A 3OBFA 2GX5A 5F82A 2CC1A 4F3LA 1P97A 1PFLA 4ZJ2A 2G2WA 5D3OA 4MDZA 3IXGA 3CUEC 4IHQA 3CWFA 4FUWA 4R6LA 1CEFA 4QU3A 1D1JA 1FCNA 1W8YA 3V50A 1GSXA 1WYBA 1YKDA 2HJ9C 5AQBA 1BTLA 1FCOA 2AVXA 1H8YA 5E43A 2ZC6B 3IF5A 5AQ9A 4HIAA 3F1PB 4ZDXA 1K0KA 1RGZA 1C3BA 3C38A 3TOIA 5HAPA 1H5XA 1ZC2A 4I5SA 4NXEA 3IT9A 1LHYA 5K5BA 4JGPA 3QNCA 5CGSA 4NKPA 4LRXC 3GRJA 3SS3A 1PWGA 4ETZA 4GLQA 2QHKA 4BENA 4ZAMA 4JXGA 3F1NB 3IBRA 2P9VB 3V39A 2EX6A 2XDMA 3CPTA 4K0XA 4HNBA 4JGRA 4M4XA 3DTIA 5FQJA 3BQAA 3S7OA 3KSGA 1PWDA 4IVIA 4Y3IA 1E4DA 1VB6A 4FTXA 3MZDA 4X1LA 4WEJA 1MWSA 2WZZA 3LCEA 4E3OA 1E25A 3NIAA 5CXWA 2JKRM 2M7UA 4X25A 3CAXA 3C2WA 3LYXA 1K56D 4YFMA 5GLBA 2JN7A 2HV1A 3GDIA 1V9YA 2VGKA 2HJEA 3MXQA 4S2KA 4WL9A 1ES2A 2OLVA 1HZOA 4FCFA 3T1SA 2HP9A 3LR3A 4HY8A 4BD0A 2W1TB 3RFBA 2A24B 3IX4A 2QJ7A 3D9YA 5FAQA 1XXMA 4LENA 1K25A 2DRWA 2O9AA 3HLEA 3VP1A 2K2NA 2EFUA 2JC7A 5JYOA 4HI4A 4DMZA 1Z09A 3H82A 1HVBA 3UE3A 4LRYC 4EXOA 1S67L 5HWVA 3E4OA 5AQAA 3HJKA 4UA6A 1BLPA 1Z6FA 4QHCA 5CTMA 3IXHA 3QP8A 4HBUA 4KZBA 2Q9NA 3BQ8A 2Y2QA 1S4RA 4E3KA 3TE8A 3W4PA 4A5RA 4E6WA 1TD5A 5EUAA 3LO7A 1ERQA 1H3QA 3MBZA 4EW7A 2XF3A 3C8CA 3PBNA 1NZOA 2PAVP 3BFDA 5FATA 4BJPA 4B9OA 3IX3A 1JTGA 4LV0A 4IJGA 3N7WA 4UA7A 1XA1A 3RXXA 4PM9A 3RH8B 1KGFA 5DKKA 3LIBA 3PBTA 2DCFA 3VP4A 2XRNA 2GNXA 1DRMA 1QMFA 3IF6B 3EOIA 2D01A 4N9LA 5L09A 3EQUA 4Q0HA 1LLBA 4S2PA 3ZGAB 4KZ3A 3C5AA 4DE2A 1TS8A 3DWKA 3GR2A 1N9BA 3FZCA 3KO6A 4F3LB 3TJZC 1T1CA 1OTBA 2XA7M 1XFQA 4OVDA 3ZVTA 3C4PA 3KSFA 3Q7VA 4KUOA 4KUKA 3DAVA 4PPRA 1TF1A 3BFFA 3B33A 2O0YA 3A0SA 4ZBEA 1KDSA 1H0MA 2HP5A 3U4LP 1DP6A 5KIZA 3E4QA 4NK3A 2ZQ9A 3R7WA 3HLDA 1LT0A 3N8SA 3DTKA 1XX2A 2VV7A 2E8IA 2XGNA 4R23A 5TGFA 5M18A 5DTTA 2BG1A 3VSLA 3LR4A 1A0KA 3T4SA 2ZOHA 3PHYA 2I72A 1ZKJA 1SDEA 4WYYA 4EU0A 2Z6DA 4CLCC 1IYPA 1PYYA 5AQ7A 2XD5A 1XP4A 3P7NA 4GDNA 3PAGA 2ZM0A 1ZG6A 2QKPA 5KZHA 3DW0A 2Z6CA 3BLMA 4RA7A 3G31A 3Q1FA 2BLSA 3CPTB 3UE0A 5AJGA 1H8MA 3UO9A 2K7SA 4YWZA 4S2JA 3ZHHA 3HCYA 2WKHA 3ITBA 4DJ3A 2DNSA 5GL9A 1K57C 1YQSA 4EERA 3NHQA 4BL2A 4OOYA 2O99A 4KG6A 1MPLA 5HPIA 5M19A 3AGFA 5J4EA 3Q07A 3BFCA 1KVMA 2FFFB 3M2KA 4R0QA 3T4TA 4OPZA 4S2IA 5HARA 2JKFA 4KZ5A 3OCLA 1MWUA 4UQIM 3WS5A 1S0WA 2WUQA 3T4QA 5FDHA 4JGQA 2L4RA 3IS2B 3DTEA 2GZAA 4WEKA 4DN0A 3D3OA 3NOUC 3HLWA 2EWWA 3SW1A 1MWRA 4L9FA 2WADA 2D02A 1YPRA 3BY9A 4MBKA 4DF6A 3FG8A 4E3JA 1E3UD 4Q0IA 3HLCA 2VKSA 1YM1A 2JKTI 1KE3A 3UMDA 3EEHA 4B4XA 5DVAA 1NRFA 1ZTUA 4II7A 2OSUA 1YLZA 1BYWA 5HSQA 1S1ZA 2M7VA 4EESA 2WGVA 3GVBA 1K55A 4N9KA 4C3QA 2P74A 4O8GA 4I3AA 3IH8A 3T1XA 4O01A 2L0WA 2ZL1B 4OQGA 4B4ZA 5EECA 1G68A 2P08A 5FQKA 2BTFP 2W3DA 3MXSA 4LGWA 1HLUP 2WYXA 3A0VA 4CLCE 2QJ5A 3CG5A 4Y5FA 3T1QB 1GA9A 2ZMAA 3WS2A 1PRQA 4N92A 1NZUA 2B18A 2J80A 2ZM8A 5DJTA 3FPWA 1XKZA 2WKRA 2HZ5A 2VGJA 3M6HA 3P01A 3SS4A 4O0PA 3OPLA 2PD7A 2ZQ7A 3A3IA 2HF6A 1I2SA 4OKPA 2W0NA 2XH9A 3GECA 4IEDA 4S2MA 5CGXA 4P0MA 5E2FA 1PWCA 4OH0A 3VFFA 5HAQA 2XA7S 1L3LA 3W2ZA 2HDUA 3E0YA 5IU1A 2W27A 5F83A 1K56A 5HDDA 3O3VA 1H8ZA 4B93A 2H0YA 2R9WA 5GLDA 2V8CA 5EVEA 4KQDA 4NXBA 1FOFA 1JWVA 4BBVA 2B02A 1IKIA 1YLJA 2VV6A 4R4RA 1MWTA 4RX2A 2QYBA 2Y59A 1LSWA 3OPPA 4DKIA 2EX8A 4GHIA 1F5MA 4LCMA 1KOUA 3CZDA 3R7WB 5G18A 5DFXA 2PYRA 3UPOA 1VETB 2A3UA 3WS4A 1ERMA 3S7PA 1NYMA 5HD5A 1NWZA 1WE4A 2LB9A 4X69A 2Y2GA 1F98A 1MKIA 3LIAA 5TBMA 5FI2A 3IBJA 2VA0A 3MS6A 3CI6A 1ESUA 5FDSA 3V67A 4OOMA 3BYDA 4JGOA 4X56A 3UB7A 1DJCA 4WLAA 2WAFA 1N9LA 3MR0A 5IHVA 1ES4A 2Y2MA 4R70A 1MBLA 3C30A 5HWWA 1P9RA 5FSRA 3ZG0A 1VQQA 3IHBA 2UWXA 2XFSA 1CQAA 3UMEA 5L2FA 4WZ4A 1K54A 2Z2LB 4CLCD 4F94A 4OPQA 1NJ4A 2Y2IA 4K08A 4UQIS 4EV4A 2VGLM 3VE3A 4R3JA 5L8MA 3OLOA 5EM1A 4BD1A 3R4KA 4H6JB 3VP3A 1TS7A 2H10A 3ZVWA 3CJMA 1Y28A 5FA7A 3G2YA 3H7WA 3JVVA 3KSIA 3T4JA 1TS6A 2JKRI 3MJQA 5GHXA 1FSYA 4CPKA 1PI5A 4BLMA 2WKIA 1YSQA 2B95A 4HP4A 5J3WA 2Y8HA 2ZQDA 1LSXA 2QMIA 1ALQA 2EFXA 5DJUA 2IA2A 2R9XA 4BMWA 5EOEA 5I94A 4WZ5C 2Q9MA 5KSHA 5A93A 2WAEA 4FD8A 3W4OA 1YLWA 1I2WA 1DP8A 1W7FA 3LY4A 1GHMA 2ZD8A 3CUEA 1GSVA 1STZA 1V9ZA 4HJ3A 2YKFA 4LCLA 4S2LA 3O86A 4LRZE 3NDGA 2GJ3A 3V5MA 2C6WB 5F69A 3KYZA 2VZWA 3RJUA 2KDKA 3IHAA 3LGOA 3V3SA 2VEAA 3PXPA 4OPRA 4I38A 5DF8A 3UPPA 3T4LA 1XGIA 3Q82A 1T1AA 2XR0A 1D06A 5CTNA 1XJ4A 1NYYA 4DE0A 5FI6A 5JYPA 3WRTA 1L2SA 1L0FA 4YOFA 2G2UA 2L1MA 5EVID 4O7DA 1GHPA 5IT5A 2XK1A 3LFVA 4HH3A 2J7VA 4KZ4A 4Q8IA 4JPMA 5FQQA 2PBDP 4GD8A 4JF5A 2X02A 3MQOA 4WELA 1SZVA 2NUPC 2WGWA 4OONA 2V1BA 3A3EA 1ONGA 1SKOB 1T18A 1TS0A 2HGVA 4BL3A 3OZHA 3VOYA 4KZAA 4PM7A 4KQOA 3F1OA 4GHIB 2KLIA 4Y13A 1G6AA 3MSHA 4EWFA 3HVFA 2B5RA 3LI8A 4ARZA 4GCZA 4DJ2A 4JF4A 5CRFA 1E3UA 4EEPA 1CEGA 3L7HA 3IWOA 2JHEA 3NOTC 3HREA 4KENB 3GSGA 1RP5A 4BBTA 4U0XA 2O9BA 4JXSA 1SHVA 4GNUA 5E2EA 1YMSA 2XEPA 4EUZA 4S2NA 3S7NA 2EA9A 3DWZA 5HL1A 4GOGA 3S7QA 1HTZA 5HX9A 5U47A 3T1RA 1FR6A 3ZFZA 5HD3A 4ZJ3A 2VGLS 3NC8A 5CHMA 4Y0TA 3P09A 3JVUA 1FCMA 1OPXA 4QY6A 2IWDA 3LUQA 4P6ZM 5I5LA 1LL5A 3UB5P 3Q7ZA 3G34A 1BLSA 3PBOA 4X55A 3WS1A 5CHUA 2V0WA 2VV8A 4JBFA 2J3TC 3BLSA 2ZQ8A 5EV0A 4GB7A 2WKPA 4Y15A 3W4QA 3S4XA 1SKFA 4PHTA 3H7WB 2XLNA 2G7UA 1W8QA 5CERA 5A91A 2VK3A 2WGIA 2E8JA 3C7VA 3SH8A 4HBTA 4D2OA 2RL3A 3S22A 1N9OA 1K4EA 1JVJA 3UN7A 1BLCA 3UNWA 5F1GA 2V0UA 1TEMA 1OMEA 3LEZA 2Y91A 1F2KA 1G5UA 3MFDA 3M2JA 1MKMA 3SH9A 3TSGA 4YNRA 1DP9A 3JPUA 2QPNA 1X0OA 3G2ZA 3AGDA 4UA9A 2V8FA 4KG2A 3CLOA 4RX3A 2LB5A 1ODVA 1XGJA 3EQVA 3IH9A 4RQ9A 4MCWA 5LBRA 5HPFA 2PDRA 4LFUA 4Y0UA 1M6KA 2UV0E 4MEZA 5DF7A 3QP6A 4IBRA 5FI7A 3MZFA 1FIKA 2I9VA 4FOFA 2J3WA 2NUTC 4WUJA 3NOPC 3F1NA 1NXYA 3B47A 3HL9A 4DDYA 3H82B 5CEDA 4ETXA 1K6RA 3C7UA 2P9VA 3IQAA 4EETB 3CITA 2J8YA 2W3FA 1OT9A 3MZEA 4CLCA 3PTEA 1D7EA 1P9WA 1HD8A 1L0DA 3JYIA 1KGEA 1TVFA 2A2LA 1KGGA 1RGYA 4KZ6A 4M3KA 2EX9A 4ZJ1A 1WA9A 2CMNA 1K57A 4K0WA 4KZ7A 2EXBA 1TDGA 3FKVA 2W1RA 3F1OB 1W5DA 1VHMA 3BFGA 2JKTM 3QNBA 3IF6C 4YINA 4Z9QA 3HUMA 5A90A 3BJNA 4UEYA 1OTAA 3U2AA
chains in the Genus database with same CATH topology
3ZQ5A 3OCNA 2VJWA 2A24A 2WKQA 2YKHA 3EEAA 3R4KA 3LICA 3BQ8A 4H6JB 3TW8A 2W3HA 1S4RA 2INWA 2VLGA 4R3AA 1TS7A 5AVEA 3TE8A 5C5KA 3RTYA 3EGXC 1TD5A 3PBSA 4G3WA 1NLYA 4IUHA 3LI9A 1Y28A 5EFWA 1H3QA 2PR5A 3H7WA 3JVVA 4WF0A 3KSIA 3T4JA 4EW7A 1UWNX 1TS6A 4PKYG 3C8CA 3K2NA 2JKRI 3MJQA 3PBNA 2PYPA 2W3GA 2DMWA 4XT2B 4BJPA 4B9OA 1YSQA 4IJGA 2PR6A 3F1PA 4HP4A 2M1CA 3ICYA 2Y8HA 5J3WA 4P6ZS 1G6OA 3RH8B 2P7JA 1NLZA 5DKKA 3E4PA 5CX7A 3LIBA 3PBTA 1LSXA 1OJGA 4R38A 5DJUA 1NRJA 2XRNA 2IA2A 2GNXA 1DRMA 2KX6A 4H6JA 1F9IA 3EOIA 4GS9B 4BMWA 5A8BA 2D01A 2XSSA 3EQUA 4Q0HA 5KSHA 3T4OA 1TS8A 2ZBBA 4LPZA 5DF9A 2EWVA 1DP8A 3KO6A 4F3LB 3TJZC 1T1CA 1OTBA 2XA7M 3CUEA 3PR6A 4HQAA 1GSVA 1STZA 1V9ZA 1XFQA 3KSFA 1OTDA 4KUOA 3MMHA 4HJ3A 4IUKA 2YKFA 4KUKA 1T1BA 1TF1A 1P0ZA 4LRZE 3B33A 2GJ3A 1LL8A 2O0YA 3LIEA 5F69A 4NXGA 3A0SA 3KYZA 4EUVA 2OAQ1 2VZWA 3LIDA 1YAXA 4EEUA 2KDKA 1DP6A 5KIZA 3E4QA 2VEAA 3G6OA 3PXPA 3R7WA 1LT0A 4I38A 3T4LA 3KSHA 2VV7A 1T1AA 1OTIA 3BWLA 4CQHA 1D06A 3LR4A 3D72A 3OC2A 1XJ4A 3T4SA 2ZOHA 3PHYA 2Y79A 4YOFA 3NJAA 2L1MA 4EU0A 2Z6DA 4CLCC 5MC7A 5IT5A 3LFVA 4LLOB 4ARZB 2W1TA 3P7NA 4FSFA 4HH3A 2R78A 1T19A 2QKPA 2Z6CA 3PBQA 3MQOA 5AJGA 1H8MA 4WELA 1XFNA 2K7SA 2NUPC 4YWZA 4I3JA 5HWTA 3HCYA 3LIFA 5HDSA 4DJ3A 2V1BA 3VE4A 4PAUA 3VV4A 4QPRA 4WN5A 1T18A 1TS0A 2HGVA 4EERA 4MMNA 3NHQA 1LSVA 1OTEA 1UGUA 2O99A 4KQOA 2ZMVA 3F1OA 2K31A 4GHIB 5HPIA 2KLIA 1N9NA 4MN6A 4L9GA 5AVFA 1EW0A 5J4EA 4HOIA 3MQ0A 4OOLA 3T4TA 2XROA 3EWKA 3LI8A 4ARZA 4GCZA 4DJ2A 5HDCA 3HJIA 1W63M 4BWIA 3TRCA 2PHYA 4EEPA 3MQQA 3OCLA 5DFYA 4ME4A 2JHEA 4HJ6A 4UQIM 4HHDA 1OT6A 3MFXA 3T4QA 1MZUA 2FZ0A 3NOTC 5F68A 4CLCB 4MN7A 4JGQA 3PYPA 3UB6A 2L4RA 3IS2B 4G3KA 2GZAA 3UB9A 4WEKA 4BBTA 4G3VA 4DN0A 2O9BA 3D3OA 2QWSA 1YSPA 1ZHHB 4MN5A 2H28A 1W63Q 3LR0A 4I39A 3S7NA 3NOUC 2EWWA 3SW1A 2EA9A 5F6AA 4HP9A 4L9FA 4XT2A 3VOLA 4HH2A 4EQ1A 2D02A 3S7QA 3BY9A 5TJJA 1XJ2A 3FG8A 3E98A 4E04A 2OWJA 4Q0IA 2VKSA 4I3IA 4Y2FA 5HD3A 2JKTI 2OWHA 3K3DA 4L9EA 2O9CA 2VGLS 3EGDC 4ZRRA 3UMDA 3EEHA 2VX8A 3H9WA 1ZTUA 4II7A 5FL3A 3JVUA 3T4KA 1BYWA 5HSQA 1OPXA 4GJ4A 1S1ZA 2M7VA 4EESA 3LUQA 4P6ZM 1S1YA 3FPVA 4GS9A 5I5LA 3ZYTA 4O8GA 5J7EA 4I3AA 3IS2A 3FC7A 3BY8A 4Q0JA 3O5YA 3PBOA 4O01A 2L0WA 2J3TD 1XJ3A 2P08A 2V0WA 2P04A 2VV8A 3OBFA 2GX5A 2W3DA 2J3TC 4F3LA 1P97A 2WKPA 2ZOIA 3K3CA 5G4YA 3A0VA 4MDZA 4CLCE 3CUEC 2QJ5A 4IHQA 3CWFA 4R6LA 4Y5FA 4PHTA 3H7WB 2G7UA 1GSXA 1YKDA 3OOVA 2HJ9C 2B18A 1IOUA 2J80A 5DJTA 3FPWA 2WKRA 4L0LA 4HIAA 3F1PB 1N9OA 3P01A 4NEED 3C38A 2OAP1 4O0PA 2V0UA 2PD7A 4BBUA 1GSWA 4I5SA 4NXEA 5K5BA 2HF6A 4JGPA 2W0NA 3GECA 4LRXC 4NKPA 1MKMA 4YNRA 1DP9A 1MC0A 3UE6A 2MJ6A 1X0OA 4ETZA 3PBRA 4GLQA 2QHKA 2XA7S 3F1NB 5HZHA 3IBRA 3CLOA 3W2ZA 2OOLA 3E0YA 5IU1A 2LB5A 2W27A 1ODVA 3EQVA 5HDDA 4RQ9A 4MCWA 5LBRA 4HNBA 4B93A 5TBMB 4JGRA 4M4XA 5HL6A 5HPFA 2PDRA 2FH5A 4KQDA 4NXBA 3BQAA 3S7OA 3KSGA 4Y3IA 4BBVA 2B02A 1VB6A 4PKYA 4Z1WA 3BW6A 2VV6A 4WEJA 2QYBA 1LSWA 3B42A 4GHIA 1F5MA 4GW9A 2I9VA 2V1AA 1KOUA 4FOFA 3UB8A 2J3WA 2NUTC 2JKRM 5G4ZA 3R7WB 2M7UA 4WUJA 5L8MA 5DFXA 3NOPC 1IFQA 3F1NA 3CAXA 2PYRA 2PD8A 3B47A 1XJ6A 3S7PA 3C2WA 3DBAA 3H82B 3LYXA 5HD5A 2JN7A 2HV1A 4ETXA 3GDIA 2BASA 4EETB 1NWZA 1V9YA 2HJEA 3MXQA 3CITA 4AFIA 2LB9A 4WL9A 2W3FA 3U2AA 2PT7A 1OT9A 1G28A 2V9AA 4HJ4A 1F98A 1D7EA 1P9WA 2ZMFA 3LIAA 5TBMA 4CLCA 3LR3A 1S4SA 3IBJA 5F5YA 1UWPX 4HY8A 2VA0A 3MF0A 2W1TB 3CI6A 4NXFA 3RFBA 2A2LA 3V67A 2A24B 4OOMA 2QJ7A 4JGOA 3UB7A 1S66L 4WLAA 2KOIA 1N9LA 1WA9A 2CMNA 2O9AA 3MR0A 3LR5A 4R70A 3KYQA 3C30A 2K2NA 3ULFA 3T50A 5HWWA 1P9RA 4HI4A 4DMZA 3A0RA 3UMEA 3KX0X 3H82A 2W3EA 4CLCD 2W1RA 3UE3A 3F1OB 1VHMA 4LRYC 4EXOA 2JKTM 1S67L 5IS1A 5HWVA 3E4OA 4K08A 3HJKA 4UQIS 5DKLA 2VGLM 3VE3A 3BJNA 1JNUA 1OJ5A 4UEYA 1OTAA 3OLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ5 A;  2A24 A;  2WKQ A;  2YKH A;  3LIC A;  4H6J B;  1S4R A;  2INW A;  2VLG A;  4R3A A;  1TS7 A;  5AVE A;  3RTY A;  3LI9 A;  1Y28 A;  5EFW A;  2PR5 A;  3H7W A;  4WF0 A;  4EW7 A;  1UWN X;  1TS6 A;  4PKY G;  3C8C A;  3MJQ A;  2PYP A;  4XT2 B;  4B9O A;  2PR6 A;  3F1P A;  4HP4 A;  2M1C A;  3ICY A;  5J3W A;  3RH8 B;  2P7J A;  5DKK A;  3E4P A;  3LIB A;  1LSX A;  1OJG A;  4R38 A;  5DJU A;  1DRM A;  2KX6 A;  4H6J A;  1F9I A;  4GS9 B;  5A8B A;  2D01 A;  1TS8 A;  2ZBB A;  4LPZ A;  1DP8 A;  4F3L B;  1T1C A;  1OTB A;  4HQA A;  1GSV A;  1XFQ A;  1V9Z A;  1OTD A;  4KUO A;  4HJ3 A;  2YKF A;  4KUK A;  1T1B A;  1P0Z A;  4LRZ E;  3B33 A;  2GJ3 A;  1LL8 A;  3LIE A;  5F69 A;  4NXG A;  3A0S A;  3LID A;  4EEU A;  2KDK A;  1DP6 A;  5KIZ A;  3E4Q A;  2VEA A;  3G6O A;  1LT0 A;  4I38 A;  2VV7 A;  1T1A A;  1OTI A;  3BWL A;  1D06 A;  3D72 A;  1XJ4 A;  2ZOH A;  3PHY A;  3NJA A;  2L1M A;  2Z6D A;  4LLO B;  3P7N A;  4HH3 A;  2R78 A;  1T19 A;  2QKP A;  2Z6C A;  3MQO A;  1XFN A;  2K7S A;  4YWZ A;  4I3J A;  5HWT A;  5HDS A;  3LIF A;  4DJ3 A;  2V1B A;  3VE4 A;  4WN5 A;  1T18 A;  1TS0 A;  4EER A;  3NHQ A;  1LSV A;  1OTE A;  1UGU A;  3F1O A;  4GHI B;  1N9N A;  4MN6 A;  4L9G A;  5AVF A;  1EW0 A;  5J4E A;  4HOI A;  3EWK A;  3LI8 A;  4GCZ A;  4DJ2 A;  5HDC A;  3HJI A;  2PHY A;  4EEP A;  3MQQ A;  2JHE A;  4HJ6 A;  4HHD A;  1OT6 A;  3MFX A;  1MZU A;  3NOT C;  5F68 A;  4JGQ A;  3PYP A;  3UB6 A;  2L4R A;  3IS2 B;  3UB9 A;  4BBT A;  2QWS A;  4MN5 A;  2H28 A;  4I39 A;  3NOU C;  3SW1 A;  2EA9 A;  5F6A A;  4HP9 A;  4L9F A;  4XT2 A;  3VOL A;  4HH2 A;  4EQ1 A;  2D02 A;  3BY9 A;  1XJ2 A;  3FG8 A;  4E04 A;  2OWJ A;  4I3I A;  5HD3 A;  2OWH A;  3K3D A;  4L9E A;  3UMD A;  3EEH A;  3H9W A;  1BYW A;  5HSQ A;  1S1Z A;  4EES A;  3LUQ A;  1S1Y A;  5I5L A;  4GS9 A;  5J7E A;  4I3A A;  3IS2 A;  3FC7 A;  3BY8 A;  2L0W A;  1XJ3 A;  2V0W A;  2VV8 A;  4F3L A;  1P97 A;  2WKP A;  2ZOI A;  3K3C A;  5G4Y A;  3A0V A;  2QJ5 A;  3CWF A;  4R6L A;  3H7W B;  1GSX A;  2J80 A;  5DJT A;  2WKR A;  4HIA A;  3F1P B;  1N9O A;  2V0U A;  2PD7 A;  4BBU A;  1GSW A;  4I5S A;  4NXE A;  4JGP A;  2W0N A;  3GEC A;  4LRX C;  1DP9 A;  3UE6 A;  1X0O A;  2QHK A;  3F1N B;  5HZH A;  3IBR A;  3CLO A;  2OOL A;  5IU1 A;  2W27 A;  1ODV A;  5HDD A;  4RQ9 A;  4HNB A;  5TBM B;  4JGR A;  4M4X A;  2PDR A;  4KQD A;  4NXB A;  4BBV A;  2B02 A;  1VB6 A;  4PKY A;  2VV6 A;  1LSW A;  4GHI A;  4GW9 A;  2I9V A;  2V1A A;  1KOU A;  3UB8 A;  5G4Z A;  4WUJ A;  3NOP C;  3F1N A;  3CAX A;  2PYR A;  2PD8 A;  1XJ6 A;  3C2W A;  3H82 B;  3LYX A;  5HD5 A;  2JN7 A;  2HV1 A;  3GDI A;  2BAS A;  4EET B;  1NWZ A;  1V9Y A;  3MXQ A;  4WL9 A;  1OT9 A;  1G28 A;  2V9A A;  4HJ4 A;  1F98 A;  1D7E A;  3LIA A;  5TBM A;  1S4S A;  5F5Y A;  1UWP X;  4HY8 A;  4NXF A;  2A24 B;  2QJ7 A;  4JGO A;  3UB7 A;  1S66 L;  4WLA A;  1N9L A;  1WA9 A;  2CMN A;  3MR0 A;  4R70 A;  3ULF A;  3T50 A;  5HWW A;  4HI4 A;  3A0R A;  3UME A;  3KX0 X;  3H82 A;  3F1O B;  4LRY C;  4EXO A;  1S67 L;  5IS1 A;  5HWV A;  3E4O A;  4K08 A;  3HJK A;  5DKL A;  3VE3 A;  1JNU A;  1OJ5 A;  1OTA A;  3OLO A; 
#chains in the Genus database with same CATH topology
 2ZJ9 A;  3ZQ5 A;  3OCN A;  2A24 A;  1FR1 A;  3UDI A;  3HLG A;  4RYE A;  1MXO A;  5TR7 A;  3ZG8 B;  3TW8 A;  1ES3 A;  1BSG A;  2W3H A;  4HEF A;  3N8R A;  3FKW A;  1BUL A;  1CK3 A;  3VMA A;  4OQI A;  3NI9 A;  3EGX C;  4G3W A;  1NLY A;  4IUH A;  4LV1 A;  2PU2 A;  3N6I A;  2JE5 A;  1UWN X;  1CJF A;  4PKY G;  3K2N A;  3V3R A;  2PYP A;  2DMW A;  1RCJ A;  4EQI A;  1ONH A;  2PR6 A;  2IWB A;  5FQI A;  3Q7V B;  4K91 A;  4P6Z S;  1GA0 A;  2P7J A;  1NLZ A;  3E4P A;  4NET A;  5CX7 A;  1OJG A;  4XXR A;  1KDW A;  1GHI A;  2OV5 A;  5A8B A;  3MXR A;  4OQH A;  1QME A;  2ZLY A;  2V2F F;  3SS5 A;  4LPZ A;  1O7E A;  2Y2N A;  3NY4 A;  4UHU A;  1MY8 A;  2WKE A;  2X71 A;  4HQA A;  4KZ8 A;  2IWC A;  1Y4O A;  4P85 A;  1OTD A;  4GN2 A;  5EVI A;  3ZDJ A;  1S6R A;  1P0Z A;  3VP0 A;  5CEB A;  4ESP A;  1Q2Q A;  2EXA A;  4NXG A;  4E6X A;  3UDF A;  4OPY A;  4X68 A;  3LID A;  1YAX A;  4EEU A;  1JWZ A;  4OP8 A;  1EI5 A;  4KZ9 A;  3BM6 A;  1DY6 A;  1VM1 A;  3DTM A;  4JKT A;  4WBG A;  3Q81 A;  4MBH A;  4DE3 A;  3BWL A;  2GDN A;  4CQH A;  3P98 A;  3D72 A;  3OC2 A;  1LL9 A;  2QZ6 A;  4E3N A;  2HPB A;  2Y79 A;  3SH7 A;  4C6Y A;  3M6B A;  3PAE A;  5MC7 A;  1K4F A;  3AGE A;  4E3I A;  1T19 A;  3ITA A;  3IWI A;  5FAP A;  4FH4 A;  1IEM A;  5A92 A;  1O07 A;  4XUZ A;  1J3W A;  3ZCZ A;  4JXV A;  3VFH A;  3HLF A;  1XFN A;  4C75 A;  4I3J A;  5HWT A;  3LIF A;  3VE4 A;  3VV4 A;  4S2O A;  1YLP A;  1LSV A;  1OTE A;  1UGU A;  3S1Y A;  4GZB A;  2ZMV A;  3L9K A;  3GTC A;  4MN6 A;  5AVF A;  4P6B A;  3QHY A;  2Y2J A;  4X6T A;  1GCE A;  3MQ0 A;  1CI9 A;  4U0T A;  5EOO A;  3HJI A;  4QJG A;  1W63 M;  4BWI A;  2HDS A;  3TRC A;  2PHY A;  3E2L A;  4ME4 A;  4X53 A;  3WS0 A;  4HJ6 A;  4HHD A;  3VSK A;  1MZU A;  2FZ0 A;  5F68 A;  4CLC B;  4MN7 A;  3PYP A;  4G3K A;  4QB8 A;  5FAS A;  3IXB A;  4G3V A;  4FH2 A;  2QWS A;  2J9O A;  1M40 A;  2H28 A;  1W63 Q;  4I39 A;  4PM6 A;  2A49 A;  1L0G A;  5F6A A;  1PZP A;  1VEU A;  4XT2 A;  4HH2 A;  1BLH A;  4JXW A;  5TJJ A;  1XJ2 A;  3E98 A;  4MLL A;  5CGW A;  4E04 A;  2OWJ A;  2ZQC A;  4Y2F A;  4GDB A;  3K3D A;  4L9E A;  3A3J A;  4GJ4 A;  5GHZ A;  3FWL A;  1BZA A;  4E3L A;  1S1Y A;  3FPV A;  4GS9 A;  3IWQ A;  3ZYT A;  4Y7P A;  3IS2 A;  3FC7 A;  2JCH A;  3O5Y A;  4MNR A;  3A3F A;  4UAA A;  3B3X A;  1U60 A;  1XJ3 A;  2C5W B;  4S2N C;  1NY0 A;  3CMZ A;  4EBP A;  2XQZ A;  3K3C A;  2ZOI A;  5G4Y A;  5EE8 A;  3QP2 A;  1PNE A;  3QP1 A;  3OOV A;  2Y2P A;  1IOU A;  4QD4 A;  5BOH A;  4Y0O A;  4L0L A;  4WMC D;  1TDL A;  4NEE D;  2OAP 1;  2ZL1 A;  4BBU A;  1GSW A;  3ZG5 A;  2PU4 A;  1W79 A;  1YMX A;  1MC0 A;  3UE6 A;  2Q0O A;  2MJ6 A;  3G35 A;  3PBR A;  4WZ5 A;  3ZG9 B;  3IX8 A;  2WZX A;  5FEG A;  5HZH A;  2OOL A;  4BQM A;  3UDX A;  4XUX A;  4EBL A;  1ES5 A;  2X01 A;  5TBM B;  5HL6 A;  4HES A;  1N4O A;  1AXB A;  2FH5 A;  2ZQA A;  5EVI B;  3G32 A;  4PMA A;  1I5Q A;  4PKY A;  4Z1W A;  3BW6 A;  1WYC A;  5TFQ A;  4E3M A;  4DDS A;  2Y2L A;  5L07 A;  3B42 A;  3N4I A;  4GW9 A;  3UE1 A;  2V1A A;  3I7J A;  3UB8 A;  4QWO A;  5G4Z A;  2V1Z A;  1ZG4 A;  3BEC A;  1IFQ A;  1J9M A;  2PD8 A;  1XJ6 A;  2HP6 A;  1IYS A;  3DBA A;  3NBL A;  2BAS A;  2H0T A;  3WRZ A;  4AFI A;  4OP5 A;  2PT7 A;  4R3B A;  1G28 A;  4B88 A;  4ZTK A;  2V9A A;  4HJ4 A;  2ZMF A;  1S4S A;  5EPH A;  5F5Y A;  5EM0 A;  1UWP X;  5KSC A;  1AWI A;  3MF0 A;  3HBR A;  4NXF A;  3HUN A;  4CJN A;  5CHJ A;  5HAI A;  3ZNY A;  1XA7 A;  4MBF A;  1S66 L;  3NCK A;  2KOI A;  4KQQ A;  3QP4 A;  3LR5 A;  3KYQ A;  3UPN A;  3ULF A;  3T50 A;  1PZO A;  2ZC3 B;  3MKF A;  1VET A;  3G30 A;  3A0R A;  4DXB A;  3KX0 X;  2HDQ A;  2XD1 A;  2W3E A;  2HDR A;  3HUO A;  5IS1 A;  5CEC A;  1K55 C;  1FIL A;  2PBY A;  3LY3 A;  3VOZ A;  5DKL A;  1XPB A;  1JNU A;  4N1H A;  1OJ5 A;  3C4O A;  4ID4 A;  4NG2 A;  3FV7 A;  2VJW A;  3A3D A;  2WKQ A;  2YKH A;  4OLD A;  1BT5 A;  3EEA A;  3KYE A;  4IBX A;  3LIC A;  5DTS A;  2VLG A;  2INW A;  4R3A A;  4LV3 A;  4JLF A;  5AVE A;  3N8L A;  5EVL A;  5HW3 A;  1IKG A;  2RCX A;  5C5K A;  1PI4 A;  3RTY A;  3PBS A;  1DJB A;  4IVK A;  2Y2K A;  3LI9 A;  5EFW A;  2PR5 A;  4KG5 A;  2JBF A;  1EWZ A;  1JTD A;  4WF0 A;  2WK0 A;  3HLB A;  3FYZ A;  5E2G A;  1PW8 A;  3GV9 A;  2Y2O A;  5E2H A;  2W3G A;  3NDE A;  1VEU B;  4XT2 B;  1IYO A;  1K6S A;  3G4P A;  3F1P A;  3LEQ A;  5HFO A;  2M1C A;  3ICY A;  4QY5 A;  1G6O A;  3TG9 A;  4R38 A;  1NRJ A;  1KE0 A;  1LI0 A;  2KX6 A;  4H6J A;  1F9I A;  4D60 A;  1KVL A;  5GHY A;  4GS9 B;  2V20 A;  2XSS A;  3T4O A;  3SZT A;  4GKU A;  2ZBB A;  3WWX A;  2ZC5 B;  5DF9 A;  2Y4A A;  5F1F A;  3T12 B;  2EWV A;  1Q2P A;  3PR6 A;  4JF6 A;  3RXW A;  3MMH A;  4IUK A;  3MKE A;  4KQR A;  1T1B A;  5DTK A;  1YLT A;  1LL8 A;  3LIE A;  4EUV A;  1BUE A;  3OPH A;  2OAQ 1;  1Y54 A;  5GLA A;  4OLG A;  2ZC4 B;  3G6O A;  2WGW B;  2EX2 A;  3GQZ A;  3KSH A;  1SDN A;  3SOI A;  5FEF A;  1OTI A;  2H5S A;  1YT4 A;  4N1X A;  3NJA A;  4OQ0 A;  3W8K A;  1DJA A;  4LLO B;  4ARZ B;  2W1T A;  2ZM2 A;  5EVI C;  3O88 A;  5GLC A;  1ERO A;  4FSF A;  2R78 A;  2Z2M B;  4H8R A;  1FQG A;  4U3T A;  4LV2 A;  4WM9 A;  3PBQ A;  3VP2 A;  3BFE A;  1IYQ A;  3NUL A;  2JKG A;  1L0E A;  5HDS A;  4PAU A;  1LI9 A;  4QPR A;  4WN5 A;  4MMN A;  1K54 C;  3QP5 A;  1PIO A;  1ACF A;  3GMW A;  2K31 A;  1N9N A;  3IXD A;  4X1M A;  4L9G A;  1EW0 A;  4HOI A;  1K38 A;  4OOL A;  2XRO A;  5L10 A;  3EWK A;  5HDC A;  2PRF A;  1JWP A;  1PW1 A;  3MQQ A;  1FSW A;  5DFY A;  1KE4 A;  1OT6 A;  3MFX A;  5J8X A;  4P87 A;  4R1G A;  2XFT A;  3UB6 A;  4PM5 A;  3UB9 A;  2J9P A;  4RVA A;  1CF0 A;  3D4F A;  1SKO A;  5FAO A;  1YSP A;  3O87 A;  1ZHH B;  4DE1 A;  4MN5 A;  3NEC A;  3LR0 A;  5M1A A;  4PM8 A;  3ZNT A;  3ISG A;  4GD6 A;  5FQ9 A;  4HP9 A;  5FQM A;  3VOL A;  4EQ1 A;  2ZC7 A;  2OLU A;  4I3I A;  1IEL A;  2OWH A;  2O9C A;  3EGD C;  2Y2H A;  4ZRR A;  4DRT A;  4R4S A;  2VX8 A;  3H9W A;  5FL3 A;  3BRM A;  3T4K A;  4Y17 A;  3UY6 A;  3IF6 A;  1YLY A;  1SCW A;  3E2K A;  4DXC A;  4EBN A;  1CI8 A;  5J7E A;  2FFY A;  3BY8 A;  1ESI A;  5KMW A;  4Q0J A;  2ACG A;  3OPR A;  3CHW P;  4WMC A;  2Y55 A;  2J3T D;  3BEB A;  3ZG7 B;  2P04 A;  3OBF A;  2GX5 A;  5F82 A;  2CC1 A;  4F3L A;  1P97 A;  1PFL A;  4ZJ2 A;  2G2W A;  5D3O A;  4MDZ A;  3IXG A;  3CUE C;  4IHQ A;  3CWF A;  4FUW A;  4R6L A;  1CEF A;  4QU3 A;  1D1J A;  1FCN A;  1W8Y A;  3V50 A;  1GSX A;  1WYB A;  1YKD A;  2HJ9 C;  5AQB A;  1BTL A;  1FCO A;  2AVX A;  1H8Y A;  5E43 A;  2ZC6 B;  3IF5 A;  5AQ9 A;  4HIA A;  3F1P B;  4ZDX A;  1K0K A;  1RGZ A;  1C3B A;  3C38 A;  3TOI A;  5HAP A;  1H5X A;  1ZC2 A;  4I5S A;  4NXE A;  3IT9 A;  1LHY A;  5K5B A;  4JGP A;  3QNC A;  5CGS A;  4NKP A;  4LRX C;  3GRJ A;  3SS3 A;  1PWG A;  4ETZ A;  4GLQ A;  2QHK A;  4BEN A;  4ZAM A;  4JXG A;  3F1N B;  3IBR A;  2P9V B;  3V39 A;  2EX6 A;  2XDM A;  3CPT A;  4K0X A;  4HNB A;  4JGR A;  4M4X A;  3DTI A;  5FQJ A;  3BQA A;  3S7O A;  3KSG A;  1PWD A;  4IVI A;  4Y3I A;  1E4D A;  1VB6 A;  4FTX A;  3MZD A;  4X1L A;  4WEJ A;  1MWS A;  2WZZ A;  3LCE A;  4E3O A;  1E25 A;  3NIA A;  5CXW A;  2JKR M;  2M7U A;  4X25 A;  3CAX A;  3C2W A;  3LYX A;  1K56 D;  4YFM A;  5GLB A;  2JN7 A;  2HV1 A;  3GDI A;  1V9Y A;  2VGK A;  2HJE A;  3MXQ A;  4S2K A;  4WL9 A;  1ES2 A;  2OLV A;  1HZO A;  4FCF A;  3T1S A;  2HP9 A;  3LR3 A;  4HY8 A;  4BD0 A;  2W1T B;  3RFB A;  2A24 B;  3IX4 A;  2QJ7 A;  3D9Y A;  5FAQ A;  1XXM A;  4LEN A;  1K25 A;  2DRW A;  2O9A A;  3HLE A;  3VP1 A;  2K2N A;  2EFU A;  2JC7 A;  5JYO A;  4HI4 A;  4DMZ A;  1Z09 A;  3H82 A;  1HVB A;  3UE3 A;  4LRY C;  4EXO A;  1S67 L;  5HWV A;  3E4O A;  5AQA A;  3HJK A;  4UA6 A;  1BLP A;  1Z6F A;  4QHC A;  5CTM A;  3IXH A;  3QP8 A;  4HBU A;  4KZB A;  2Q9N A;  3BQ8 A;  2Y2Q A;  1S4R A;  4E3K A;  3TE8 A;  3W4P A;  4A5R A;  4E6W A;  1TD5 A;  5EUA A;  3LO7 A;  1ERQ A;  1H3Q A;  3MBZ A;  4EW7 A;  2XF3 A;  3C8C A;  3PBN A;  1NZO A;  2PAV P;  3BFD A;  5FAT A;  4BJP A;  4B9O A;  3IX3 A;  1JTG A;  4LV0 A;  4IJG A;  3N7W A;  4UA7 A;  1XA1 A;  3RXX A;  4PM9 A;  3RH8 B;  1KGF A;  5DKK A;  3LIB A;  3PBT A;  2DCF A;  3VP4 A;  2XRN A;  2GNX A;  1DRM A;  1QMF A;  3IF6 B;  3EOI A;  2D01 A;  4N9L A;  5L09 A;  3EQU A;  4Q0H A;  1LLB A;  4S2P A;  3ZGA B;  4KZ3 A;  3C5A A;  4DE2 A;  1TS8 A;  3DWK A;  3GR2 A;  1N9B A;  3FZC A;  3KO6 A;  4F3L B;  3TJZ C;  1T1C A;  1OTB A;  2XA7 M;  1XFQ A;  4OVD A;  3ZVT A;  3C4P A;  3KSF A;  3Q7V A;  4KUO A;  4KUK A;  3DAV A;  4PPR A;  1TF1 A;  3BFF A;  3B33 A;  2O0Y A;  3A0S A;  4ZBE A;  1KDS A;  1H0M A;  2HP5 A;  3U4L P;  1DP6 A;  5KIZ A;  3E4Q A;  4NK3 A;  2ZQ9 A;  3R7W A;  3HLD A;  1LT0 A;  3N8S A;  3DTK A;  1XX2 A;  2VV7 A;  2E8I A;  2XGN A;  4R23 A;  5TGF A;  5M18 A;  5DTT A;  2BG1 A;  3VSL A;  3LR4 A;  1A0K A;  3T4S A;  2ZOH A;  3PHY A;  2I72 A;  1ZKJ A;  1SDE A;  4WYY A;  4EU0 A;  2Z6D A;  4CLC C;  1IYP A;  1PYY A;  5AQ7 A;  2XD5 A;  1XP4 A;  3P7N A;  4GDN A;  3PAG A;  2ZM0 A;  1ZG6 A;  2QKP A;  5KZH A;  3DW0 A;  2Z6C A;  3BLM A;  4RA7 A;  3G31 A;  3Q1F A;  2BLS A;  3CPT B;  3UE0 A;  5AJG A;  1H8M A;  3UO9 A;  2K7S A;  4YWZ A;  4S2J A;  3ZHH A;  3HCY A;  2WKH A;  3ITB A;  4DJ3 A;  2DNS A;  5GL9 A;  1K57 C;  1YQS A;  4EER A;  3NHQ A;  4BL2 A;  4OOY A;  2O99 A;  4KG6 A;  1MPL A;  5HPI A;  5M19 A;  3AGF A;  5J4E A;  3Q07 A;  3BFC A;  1KVM A;  2FFF B;  3M2K A;  4R0Q A;  3T4T A;  4OPZ A;  4S2I A;  5HAR A;  2JKF A;  4KZ5 A;  3OCL A;  1MWU A;  4UQI M;  3WS5 A;  1S0W A;  2WUQ A;  3T4Q A;  5FDH A;  4JGQ A;  2L4R A;  3IS2 B;  3DTE A;  2GZA A;  4WEK A;  4DN0 A;  3D3O A;  3NOU C;  3HLW A;  2EWW A;  3SW1 A;  1MWR A;  4L9F A;  2WAD A;  2D02 A;  1YPR A;  3BY9 A;  4MBK A;  4DF6 A;  3FG8 A;  4E3J A;  1E3U D;  4Q0I A;  3HLC A;  2VKS A;  1YM1 A;  2JKT I;  1KE3 A;  3UMD A;  3EEH A;  4B4X A;  5DVA A;  1NRF A;  1ZTU A;  4II7 A;  2OSU A;  1YLZ A;  1BYW A;  5HSQ A;  1S1Z A;  2M7V A;  4EES A;  2WGV A;  3GVB A;  1K55 A;  4N9K A;  4C3Q A;  2P74 A;  4O8G A;  4I3A A;  3IH8 A;  3T1X A;  4O01 A;  2L0W A;  2ZL1 B;  4OQG A;  4B4Z A;  5EEC A;  1G68 A;  2P08 A;  5FQK A;  2BTF P;  2W3D A;  3MXS A;  4LGW A;  1HLU P;  2WYX A;  3A0V A;  4CLC E;  2QJ5 A;  3CG5 A;  4Y5F A;  3T1Q B;  1GA9 A;  2ZMA A;  3WS2 A;  1PRQ A;  4N92 A;  1NZU A;  2B18 A;  2J80 A;  2ZM8 A;  5DJT A;  3FPW A;  1XKZ A;  2WKR A;  2HZ5 A;  2VGJ A;  3M6H A;  3P01 A;  3SS4 A;  4O0P A;  3OPL A;  2PD7 A;  2ZQ7 A;  3A3I A;  2HF6 A;  1I2S A;  4OKP A;  2W0N A;  2XH9 A;  3GEC A;  4IED A;  4S2M A;  5CGX A;  4P0M A;  5E2F A;  1PWC A;  4OH0 A;  3VFF A;  5HAQ A;  2XA7 S;  1L3L A;  3W2Z A;  2HDU A;  3E0Y A;  5IU1 A;  2W27 A;  5F83 A;  1K56 A;  5HDD A;  3O3V A;  1H8Z A;  4B93 A;  2H0Y A;  2R9W A;  5GLD A;  2V8C A;  5EVE A;  4KQD A;  4NXB A;  1FOF A;  1JWV A;  4BBV A;  2B02 A;  1IKI A;  1YLJ A;  2VV6 A;  4R4R A;  1MWT A;  4RX2 A;  2QYB A;  2Y59 A;  1LSW A;  3OPP A;  4DKI A;  2EX8 A;  4GHI A;  1F5M A;  4LCM A;  1KOU A;  3CZD A;  3R7W B;  5G18 A;  5DFX A;  2PYR A;  3UPO A;  1VET B;  2A3U A;  3WS4 A;  1ERM A;  3S7P A;  1NYM A;  5HD5 A;  1NWZ A;  1WE4 A;  2LB9 A;  4X69 A;  2Y2G A;  1F98 A;  1MKI A;  3LIA A;  5TBM A;  5FI2 A;  3IBJ A;  2VA0 A;  3MS6 A;  3CI6 A;  1ESU A;  5FDS A;  3V67 A;  4OOM A;  3BYD A;  4JGO A;  4X56 A;  3UB7 A;  1DJC A;  4WLA A;  2WAF A;  1N9L A;  3MR0 A;  5IHV A;  1ES4 A;  2Y2M A;  4R70 A;  1MBL A;  3C30 A;  5HWW A;  1P9R A;  5FSR A;  3ZG0 A;  1VQQ A;  3IHB A;  2UWX A;  2XFS A;  1CQA A;  3UME A;  5L2F A;  4WZ4 A;  1K54 A;  2Z2L B;  4CLC D;  4F94 A;  4OPQ A;  1NJ4 A;  2Y2I A;  4K08 A;  4UQI S;  4EV4 A;  2VGL M;  3VE3 A;  4R3J A;  5L8M A;  3OLO A;  5EM1 A;  4BD1 A;  3R4K A;  4H6J B;  3VP3 A;  1TS7 A;  2H10 A;  3ZVW A;  3CJM A;  1Y28 A;  5FA7 A;  3G2Y A;  3H7W A;  3JVV A;  3KSI A;  3T4J A;  1TS6 A;  2JKR I;  3MJQ A;  5GHX A;  1FSY A;  4CPK A;  1PI5 A;  4BLM A;  2WKI A;  1YSQ A;  2B95 A;  4HP4 A;  5J3W A;  2Y8H A;  2ZQD A;  1LSX A;  2QMI A;  1ALQ A;  2EFX A;  5DJU A;  2IA2 A;  2R9X A;  4BMW A;  5EOE A;  5I94 A;  4WZ5 C;  2Q9M A;  5KSH A;  5A93 A;  2WAE A;  4FD8 A;  3W4O A;  1YLW A;  1I2W A;  1DP8 A;  1W7F A;  3LY4 A;  1GHM A;  2ZD8 A;  3CUE A;  1GSV A;  1STZ A;  1V9Z A;  4HJ3 A;  2YKF A;  4LCL A;  4S2L A;  3O86 A;  4LRZ E;  3NDG A;  2GJ3 A;  3V5M A;  2C6W B;  5F69 A;  3KYZ A;  2VZW A;  3RJU A;  2KDK A;  3IHA A;  3LGO A;  3V3S A;  2VEA A;  3PXP A;  4OPR A;  4I38 A;  5DF8 A;  3UPP A;  3T4L A;  1XGI A;  3Q82 A;  1T1A A;  2XR0 A;  1D06 A;  5CTN A;  1XJ4 A;  1NYY A;  4DE0 A;  5FI6 A;  5JYP A;  3WRT A;  1L2S A;  1L0F A;  4YOF A;  2G2U A;  2L1M A;  5EVI D;  4O7D A;  1GHP A;  5IT5 A;  2XK1 A;  3LFV A;  4HH3 A;  2J7V A;  4KZ4 A;  4Q8I A;  4JPM A;  5FQQ A;  2PBD P;  4GD8 A;  4JF5 A;  2X02 A;  3MQO A;  4WEL A;  1SZV A;  2NUP C;  2WGW A;  4OON A;  2V1B A;  3A3E A;  1ONG A;  1SKO B;  1T18 A;  1TS0 A;  2HGV A;  4BL3 A;  3OZH A;  3VOY A;  4KZA A;  4PM7 A;  4KQO A;  3F1O A;  4GHI B;  2KLI A;  4Y13 A;  1G6A A;  3MSH A;  4EWF A;  3HVF A;  2B5R A;  3LI8 A;  4ARZ A;  4GCZ A;  4DJ2 A;  4JF4 A;  5CRF A;  1E3U A;  4EEP A;  1CEG A;  3L7H A;  3IWO A;  2JHE A;  3NOT C;  3HRE A;  4KEN B;  3GSG A;  1RP5 A;  4BBT A;  4U0X A;  2O9B A;  4JXS A;  1SHV A;  4GNU A;  5E2E A;  1YMS A;  2XEP A;  4EUZ A;  4S2N A;  3S7N A;  2EA9 A;  3DWZ A;  5HL1 A;  4GOG A;  3S7Q A;  1HTZ A;  5HX9 A;  5U47 A;  3T1R A;  1FR6 A;  3ZFZ A;  5HD3 A;  4ZJ3 A;  2VGL S;  3NC8 A;  5CHM A;  4Y0T A;  3P09 A;  3JVU A;  1FCM A;  1OPX A;  4QY6 A;  2IWD A;  3LUQ A;  4P6Z M;  5I5L A;  1LL5 A;  3UB5 P;  3Q7Z A;  3G34 A;  1BLS A;  3PBO A;  4X55 A;  3WS1 A;  5CHU A;  2V0W A;  2VV8 A;  4JBF A;  2J3T C;  3BLS A;  2ZQ8 A;  5EV0 A;  4GB7 A;  2WKP A;  4Y15 A;  3W4Q A;  3S4X A;  1SKF A;  4PHT A;  3H7W B;  2XLN A;  2G7U A;  1W8Q A;  5CER A;  5A91 A;  2VK3 A;  2WGI A;  2E8J A;  3C7V A;  3SH8 A;  4HBT A;  4D2O A;  2RL3 A;  3S22 A;  1N9O A;  1K4E A;  1JVJ A;  3UN7 A;  1BLC A;  3UNW A;  5F1G A;  2V0U A;  1TEM A;  1OME A;  3LEZ A;  2Y91 A;  1F2K A;  1G5U A;  3MFD A;  3M2J A;  1MKM A;  3SH9 A;  3TSG A;  4YNR A;  1DP9 A;  3JPU A;  2QPN A;  1X0O A;  3G2Z A;  3AGD A;  4UA9 A;  2V8F A;  4KG2 A;  3CLO A;  4RX3 A;  2LB5 A;  1ODV A;  1XGJ A;  3EQV A;  3IH9 A;  4RQ9 A;  4MCW A;  5LBR A;  5HPF A;  2PDR A;  4LFU A;  4Y0U A;  1M6K A;  2UV0 E;  4MEZ A;  5DF7 A;  3QP6 A;  4IBR A;  5FI7 A;  3MZF A;  1FIK A;  2I9V A;  4FOF A;  2J3W A;  2NUT C;  4WUJ A;  3NOP C;  3F1N A;  1NXY A;  3B47 A;  3HL9 A;  4DDY A;  3H82 B;  5CED A;  4ETX A;  1K6R A;  3C7U A;  2P9V A;  3IQA A;  4EET B;  3CIT A;  2J8Y A;  2W3F A;  1OT9 A;  3MZE A;  4CLC A;  3PTE A;  1D7E A;  1P9W A;  1HD8 A;  1L0D A;  3JYI A;  1KGE A;  1TVF A;  2A2L A;  1KGG A;  1RGY A;  4KZ6 A;  4M3K A;  2EX9 A;  4ZJ1 A;  1WA9 A;  2CMN A;  1K57 A;  4K0W A;  4KZ7 A;  2EXB A;  1TDG A;  3FKV A;  2W1R A;  3F1O B;  1W5D A;  1VHM A;  3BFG A;  2JKT M;  3QNB A;  3IF6 C;  4YIN A;  4Z9Q A;  3HUM A;  5A90 A;  3BJN A;  4UEY A;  1OTA A;  3U2A A; 
#chains in the Genus database with same CATH homology
 3ZQ5 A;  3OCN A;  2VJW A;  2A24 A;  2WKQ A;  2YKH A;  3EEA A;  3R4K A;  3LIC A;  3BQ8 A;  4H6J B;  3TW8 A;  2W3H A;  1S4R A;  2INW A;  2VLG A;  4R3A A;  1TS7 A;  5AVE A;  3TE8 A;  5C5K A;  3RTY A;  3EGX C;  1TD5 A;  3PBS A;  4G3W A;  1NLY A;  4IUH A;  3LI9 A;  1Y28 A;  5EFW A;  1H3Q A;  2PR5 A;  3H7W A;  3JVV A;  4WF0 A;  3KSI A;  3T4J A;  4EW7 A;  1UWN X;  1TS6 A;  4PKY G;  3C8C A;  3K2N A;  2JKR I;  3MJQ A;  3PBN A;  2PYP A;  2W3G A;  2DMW A;  4XT2 B;  4BJP A;  4B9O A;  1YSQ A;  4IJG A;  2PR6 A;  3F1P A;  4HP4 A;  2M1C A;  3ICY A;  2Y8H A;  5J3W A;  4P6Z S;  1G6O A;  3RH8 B;  2P7J A;  1NLZ A;  5DKK A;  3E4P A;  5CX7 A;  3LIB A;  3PBT A;  1LSX A;  1OJG A;  4R38 A;  5DJU A;  1NRJ A;  2XRN A;  2IA2 A;  2GNX A;  1DRM A;  2KX6 A;  4H6J A;  1F9I A;  3EOI A;  4GS9 B;  4BMW A;  5A8B A;  2D01 A;  2XSS A;  3EQU A;  4Q0H A;  5KSH A;  3T4O A;  1TS8 A;  2ZBB A;  4LPZ A;  5DF9 A;  2EWV A;  1DP8 A;  3KO6 A;  4F3L B;  3TJZ C;  1T1C A;  1OTB A;  2XA7 M;  3CUE A;  3PR6 A;  4HQA A;  1GSV A;  1STZ A;  1V9Z A;  1XFQ A;  3KSF A;  1OTD A;  4KUO A;  3MMH A;  4HJ3 A;  4IUK A;  2YKF A;  4KUK A;  1T1B A;  1TF1 A;  1P0Z A;  4LRZ E;  3B33 A;  2GJ3 A;  1LL8 A;  2O0Y A;  3LIE A;  5F69 A;  4NXG A;  3A0S A;  3KYZ A;  4EUV A;  2OAQ 1;  2VZW A;  3LID A;  1YAX A;  4EEU A;  2KDK A;  1DP6 A;  5KIZ A;  3E4Q A;  2VEA A;  3G6O A;  3PXP A;  3R7W A;  1LT0 A;  4I38 A;  3T4L A;  3KSH A;  2VV7 A;  1T1A A;  1OTI A;  3BWL A;  4CQH A;  1D06 A;  3LR4 A;  3D72 A;  3OC2 A;  1XJ4 A;  3T4S A;  2ZOH A;  3PHY A;  2Y79 A;  4YOF A;  3NJA A;  2L1M A;  4EU0 A;  2Z6D A;  4CLC C;  5MC7 A;  5IT5 A;  3LFV A;  4LLO B;  4ARZ B;  2W1T A;  3P7N A;  4FSF A;  4HH3 A;  2R78 A;  1T19 A;  2QKP A;  2Z6C A;  3PBQ A;  3MQO A;  5AJG A;  1H8M A;  4WEL A;  1XFN A;  2K7S A;  2NUP C;  4YWZ A;  4I3J A;  5HWT A;  3HCY A;  3LIF A;  5HDS A;  4DJ3 A;  2V1B A;  3VE4 A;  4PAU A;  3VV4 A;  4QPR A;  4WN5 A;  1T18 A;  1TS0 A;  2HGV A;  4EER A;  4MMN A;  3NHQ A;  1LSV A;  1OTE A;  1UGU A;  2O99 A;  4KQO A;  2ZMV A;  3F1O A;  2K31 A;  4GHI B;  5HPI A;  2KLI A;  1N9N A;  4MN6 A;  4L9G A;  5AVF A;  1EW0 A;  5J4E A;  4HOI A;  3MQ0 A;  4OOL A;  3T4T A;  2XRO A;  3EWK A;  3LI8 A;  4ARZ A;  4GCZ A;  4DJ2 A;  5HDC A;  3HJI A;  1W63 M;  4BWI A;  3TRC A;  2PHY A;  4EEP A;  3MQQ A;  3OCL A;  5DFY A;  4ME4 A;  2JHE A;  4HJ6 A;  4UQI M;  4HHD A;  1OT6 A;  3MFX A;  3T4Q A;  1MZU A;  2FZ0 A;  3NOT C;  5F68 A;  4CLC B;  4MN7 A;  4JGQ A;  3PYP A;  3UB6 A;  2L4R A;  3IS2 B;  4G3K A;  2GZA A;  3UB9 A;  4WEK A;  4BBT A;  4G3V A;  4DN0 A;  2O9B A;  3D3O A;  2QWS A;  1YSP A;  1ZHH B;  4MN5 A;  2H28 A;  1W63 Q;  3LR0 A;  4I39 A;  3S7N A;  3NOU C;  2EWW A;  3SW1 A;  2EA9 A;  5F6A A;  4HP9 A;  4L9F A;  4XT2 A;  3VOL A;  4HH2 A;  4EQ1 A;  2D02 A;  3S7Q A;  3BY9 A;  5TJJ A;  1XJ2 A;  3FG8 A;  3E98 A;  4E04 A;  2OWJ A;  4Q0I A;  2VKS A;  4I3I A;  4Y2F A;  5HD3 A;  2JKT I;  2OWH A;  3K3D A;  4L9E A;  2O9C A;  2VGL S;  3EGD C;  4ZRR A;  3UMD A;  3EEH A;  2VX8 A;  3H9W A;  1ZTU A;  4II7 A;  5FL3 A;  3JVU A;  3T4K A;  1BYW A;  5HSQ A;  1OPX A;  4GJ4 A;  1S1Z A;  2M7V A;  4EES A;  3LUQ A;  4P6Z M;  1S1Y A;  3FPV A;  4GS9 A;  5I5L A;  3ZYT A;  4O8G A;  5J7E A;  4I3A A;  3IS2 A;  3FC7 A;  3BY8 A;  4Q0J A;  3O5Y A;  3PBO A;  4O01 A;  2L0W A;  2J3T D;  1XJ3 A;  2P08 A;  2V0W A;  2P04 A;  2VV8 A;  3OBF A;  2GX5 A;  2W3D A;  2J3T C;  4F3L A;  1P97 A;  2WKP A;  2ZOI A;  3K3C A;  5G4Y A;  3A0V A;  4MDZ A;  4CLC E;  3CUE C;  2QJ5 A;  4IHQ A;  3CWF A;  4R6L A;  4Y5F A;  4PHT A;  3H7W B;  2G7U A;  1GSX A;  1YKD A;  3OOV A;  2HJ9 C;  2B18 A;  1IOU A;  2J80 A;  5DJT A;  3FPW A;  2WKR A;  4L0L A;  4HIA A;  3F1P B;  1N9O A;  3P01 A;  4NEE D;  3C38 A;  2OAP 1;  4O0P A;  2V0U A;  2PD7 A;  4BBU A;  1GSW A;  4I5S A;  4NXE A;  5K5B A;  2HF6 A;  4JGP A;  2W0N A;  3GEC A;  4LRX C;  4NKP A;  1MKM A;  4YNR A;  1DP9 A;  1MC0 A;  3UE6 A;  2MJ6 A;  1X0O A;  4ETZ A;  3PBR A;  4GLQ A;  2QHK A;  2XA7 S;  3F1N B;  5HZH A;  3IBR A;  3CLO A;  3W2Z A;  2OOL A;  3E0Y A;  5IU1 A;  2LB5 A;  2W27 A;  1ODV A;  3EQV A;  5HDD A;  4RQ9 A;  4MCW A;  5LBR A;  4HNB A;  4B93 A;  5TBM B;  4JGR A;  4M4X A;  5HL6 A;  5HPF A;  2PDR A;  2FH5 A;  4KQD A;  4NXB A;  3BQA A;  3S7O A;  3KSG A;  4Y3I A;  4BBV A;  2B02 A;  1VB6 A;  4PKY A;  4Z1W A;  3BW6 A;  2VV6 A;  4WEJ A;  2QYB A;  1LSW A;  3B42 A;  4GHI A;  1F5M A;  4GW9 A;  2I9V A;  2V1A A;  1KOU A;  4FOF A;  3UB8 A;  2J3W A;  2NUT C;  2JKR M;  5G4Z A;  3R7W B;  2M7U A;  4WUJ A;  5L8M A;  5DFX A;  3NOP C;  1IFQ A;  3F1N A;  3CAX A;  2PYR A;  2PD8 A;  3B47 A;  1XJ6 A;  3S7P A;  3C2W A;  3DBA A;  3H82 B;  3LYX A;  5HD5 A;  2JN7 A;  2HV1 A;  4ETX A;  3GDI A;  2BAS A;  4EET B;  1NWZ A;  1V9Y A;  2HJE A;  3MXQ A;  3CIT A;  4AFI A;  2LB9 A;  4WL9 A;  2W3F A;  3U2A A;  2PT7 A;  1OT9 A;  1G28 A;  2V9A A;  4HJ4 A;  1F98 A;  1D7E A;  1P9W A;  2ZMF A;  3LIA A;  5TBM A;  4CLC A;  3LR3 A;  1S4S A;  3IBJ A;  5F5Y A;  1UWP X;  4HY8 A;  2VA0 A;  3MF0 A;  2W1T B;  3CI6 A;  4NXF A;  3RFB A;  2A2L A;  3V67 A;  2A24 B;  4OOM A;  2QJ7 A;  4JGO A;  3UB7 A;  1S66 L;  4WLA A;  2KOI A;  1N9L A;  1WA9 A;  2CMN A;  2O9A A;  3MR0 A;  3LR5 A;  4R70 A;  3KYQ A;  3C30 A;  2K2N A;  3ULF A;  3T50 A;  5HWW A;  1P9R A;  4HI4 A;  4DMZ A;  3A0R A;  3UME A;  3KX0 X;  3H82 A;  2W3E A;  4CLC D;  2W1R A;  3UE3 A;  3F1O B;  1VHM A;  4LRY C;  4EXO A;  2JKT M;  1S67 L;  5IS1 A;  5HWV A;  3E4O A;  4K08 A;  3HJK A;  4UQI S;  5DKL A;  2VGL M;  3VE3 A;  3BJN A;  1JNU A;  1OJ5 A;  4UEY A;  1OTA A;  3OLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...