3ULFA

The light state structure of the blue-light photoreceptor aureochrome1 lov
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
135
structure length
135
Chain Sequence
EDPDYSLVKALQMAQQNFVITDASLPDNPIVYASRGFLTLTGYSLDQILGRNCRFLQGPETDPRAVDKIRNAITKGVDTSVCLLNYRQDGTTFWNLFFVAGLRDSKGNIVNYVGVQSKVSEDYAKLLVNEQNIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of Aureochrome1 LOV suggest new design strategies for optogenetics.
pubmed doi rcsb
source organism Vaucheria frigida
molecule tags Signaling protein
molecule keywords Aureochrome1
total genus 43
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ulfA00
2KDKA 3A0SA 3H82B 4JGPA 1GSXA 2A24B 5DJTA 3H7WA 1EW0A 2HV1A 3F1NB 4HY8A 2GJ3A 4I3JA 4NXEA 2VV6A 2PD8A 5HD5A 5A8BA 1D06A 3UE6A 4EETB 4EQ1A 3PHYA 3LIDA 3VOLA 3ZQ5A 1N9NA 4RQ9A 1XFNA 2EA9A 3E4OA 3RH8B 3H82A 2L4RA 3EWKA 5DKLA 3UB6A 1OTBA 4K08A 2OOLA 2Z6DA 2V9AA 3HJIA 1DP8A 4DJ3A 1S4RA 2PR6A 1BYWA 1G28A 2D01A 3MQOA 4GW9A 1OT6A 1VB6A 1LT0A 2V1BA 3MFXA 1MZUA 3K3DA 2R78A 1UWNX 2PR5A 1GSWA 1JNUA 5HZHA 5KIZA 3E4PA 4WN5A 4EEUA 3MQQA 4JGRA 5HD3A 2W27A 1V9ZA 4HOIA 3IS2A 4L9EA 3H9WA 2QWSA 2PYRA 5F69A 3HJKA 1TS7A 5IU1A 2P7JA 3BY9A 2D02A 3LIBA 3NHQA 4LLOB 4HH3A 5TBMB 1T1BA 2M1CA 4LRZE 3UB9A 3K3CA 1KOUA 3FG8A 4E04A 1P0ZA 4L9FA 4BBTA 1LSVA 3E4QA 4H6JB 2PYPA 3IS2B 1LSXA 1OJGA 5HDSA 1OTAA 3VE3A 4EW7A 4R3AA 1XFQA 3KX0X 3LYXA 2QKPA 2VEAA 3GECA 2ZBBA 1GSVA 1TS8A 4NXBA 5AVFA 2VV7A 3B33A 1T1AA 5AVEA 4R6LA 3UMEA 1DP9A 3EEHA 5G4YA 4HJ4A 5I5LA 1Y28A 5J4EA 4HI4A 3NOUC 1DP6A 4JGQA 1OTIA 2OWJA 2YKFA 4PKYA 5EFWA 3CLOA 4LPZA 1TS6A 1XJ3A 2VV8A 2PDRA 4KUKA 4MN5A 3T50A 4B9OA 4DJ2A 5HWVA 4WL9A 1TS0A 3G6OA 3GDIA 2PD7A 3UB7A 1OTEA 3A0RA 2V0WA 4XT2B 1F98A 1S1YA 4GS9B 3F1OB 3LICA 5IS1A 2V0UA 3C8CA 3LIAA 5DJUA 5HDDA 3OLOA 1OJ5A 5F68A 2INWA 4R38A 5F6AA 2JHEA 2OWHA 2ZOHA 4NXFA 3H7WB 4F3LA 2H28A 3F1NA 4LRYC 4GS9A 3F1OA 5HWWA 4KUOA 2V1AA 3D72A 4I3AA 2WKRA 3LI9A 1NWZA 5HDCA 1X0OA 4LRXC 1S1ZA 1T1CA 1F9IA 2L0WA 3VE4A 1N9OA 4I39A 4HJ6A 2WKQA 3CWFA 4EESA 3PYPA 2J80A 1UWPX 2YKHA 3LIFA 4M4XA 1XJ6A 1XJ4A 5J3WA 3IBRA 3UMDA 4HHDA 4HIAA 1S66L 3ICYA 4MN6A 4PKYG 1D7EA 1ODVA 3LUQA 1DRMA 5F5YA 5TBMA 4HQAA 2K7SA 3NOTC 3P7NA 2JN7A 2ZOIA 1OT9A 2QHKA 4WF0A 1T18A 1T19A 3C2WA 3FC7A 4H6JA 4NXGA 5G4ZA 2WKPA 3ULFA 4EEPA 4F3LB 4GHIA 5DKKA 4EXOA 3BY8A 3MJQA 3NOPC 4HJ3A 4I38A 1LL8A 4I5SA 4R70A 3MXQA 5HWTA 3UB8A 1P97A 1N9LA 1S67L 3CAXA 1XJ2A 3F1PB 2Z6CA 3LIEA 4JGOA 4L9GA 4YWZA 5HSQA 2PHYA 4GHIB 3RTYA 4KQDA 3A0VA 3SW1A 2BASA 1V9YA 3MR0A 3BWLA 1LSWA 2CMNA 1OTDA 2I9VA 2KX6A 2QJ7A 2W0NA 3NJAA 4GCZA 1UGUA 3F1PA 3LI8A 4I3IA 2A24A 4HP9A 1S4SA 4WLAA 4XT2A 4WUJA 4HH2A 2L1MA 4BBUA 1WA9A 2QJ5A 4HNBA 5J7EA 2B02A 4HP4A 4EERA 2VLGA 4BBVA
chains in the Genus database with same CATH superfamily
3Q82A 4H8RA 3UE1A 2V8FA 3HLCA 4S2MA 4EBLA 4EBNA 4EBPA 2GZAA 3KYEA 4JLFA 3UE6A 1ONHA 3ZQ5A 4RVAA 2X71A 4OH0A 1FCNA 4DN0A 1G6OA 1OTBA 4GLQA 1ERMA 2ZQDA 1OMEA 3G35A 4M3KA 2PR5A 3EQVA 2Q9MA 3MQQA 5AQ7A 2QMIA 2GX5A 4L9EA 2PYRA 2HF6A 1T1BA 2M1CA 4H6JB 3MMHA 3W4PA 2ZQ9A 2VGLS 1GSVA 5JYPA 3EEHA 4OKPA 3WRZA 1TDGA 1PYYA 4Q0IA 4LENA 3LEZA 4OONA 2Z2MB 3O86A 1S1YA 4E3LA 4E3MA 1PI4A 1GHMA 4X6TA 1Q2QA 4NXFA 1ONGA 4EV4A 1S6RA 4I3AA 5KSCA 4LRXC 1NXYA 5CEDA 2L0WA 3U4LP 4CLCB 2V8CA 3PYPA 5GHZA 3LIFA 4B9OA 1JVJA 1E3UD 4X68A 1W5DA 3DTIA 3G31A 3NOPC 3MJQA 1H5XA 3BLSA 1LHYA 1IELA 5FAOA 1ES3A 2FH5A 2EXAA 1ZTUA 4KQDA 1W7FA 1ZG4A 2H0YA 5FQJA 4X1LA 3NJAA 3FKWA 1O07A 3S7OA 3N4IA 2Y91A 2OV5A 3O88A 1KE4A 4HY8A 1TD5A 4QD4A 3ZYTA 4Y13A 3KSHA 3PBOA 2Z6DA 2G7UA 4KG6A 1VB6A 4P6ZS 4S2OA 1XA7A 3NDEA 3BECA 3E0YA 4G3WA 3H9WA 5IU1A 1W79A 2ZL1A 3CZDA 1HZOA 5HDSA 2CC1A 1M6KA 4QJGA 4E04A 5CGWA 4R6LA 2HZ5A 1YSPA 4MDZA 5EFWA 3IHBA 3MQ0A 2IWBA 4A5RA 5L10A 4PM8A 5AQAA 5IHVA 5DTTA 3F1OB 5HAIA 1PWGA 5DJUA 3W8KA 5EVIB 1RGYA 4R38A 4R3BA 4WBGA 4CJNA 4YOFA 4Y0TA 5CEBA 4QY5A 2J3TC 1G5UA 3LGOA 3VE4A 5J3WA 3A3FA 3HREA 1EWZA 2HGVA 4NETA 4HBTA 4FSFA 2PRFA 5EM1A 2C5WB 1ERQA 3FWLA 3MXSA 1T19A 3C2WA 3ULFA 2J7VA 1PZOA 1W63Q 4WELA 4LV0A 1BUEA 1CJFA 2BLSA 4N1XA 5EOOA 2ZM8A 3B42A 2J3TD 5C5KA 2ZQCA 4WLAA 1BSGA 4UAAA 4EERA 1GCEA 3MZEA 4DMZA 2M7VA 3OPRA 3H7WA 2HV1A 3T1XA 3M2KA 4Q8IA 3E4OA 5EVLA 3KSIA 1ZC2A 3HJIA 3IX3A 5HAQA 4MBHA 2XFSA 2XK1A 4ZDXA 3E4PA 1MY8A 2W27A 3OPPA 4XXRA 4LFUA 5HX9A 3C7UA 2P7JA 1K55C 2BG1A 3GQZA 4WEJA 2HJ9C 4F3LA 2FFFB 3SH9A 2A49A 1MKIA 3KX0X 3AGEA 1TVFA 3B33A 1T1AA 5AVEA 5CTMA 4DJ2A 5E43A 3OZHA 5EVIA 2PBYA 4GZBA 3LICA 3VV4A 3JPUA 5HL1A 1OJ5A 1ZHHB 2ZOHA 1ACFA 3VP4A 2Y2MA 4QB8A 4UQIS 3VFHA 2ZD8A 2JKTI 3ZDJA 2WKQA 4N9LA 3ZGAB 4M4XA 5F83A 4KZAA 5LBRA 4KG2A 4NXGA 1K6RA 3BW6A 1NZUA 2R9XA 4I5SA 4OOYA 4RA7A 3RXWA 1YLTA 3T12B 2XROA 5M1AA 1V9YA 1OTDA 3BFEA 1SKOB 4PMAA 4XT2A 4ARZA 5K5BA 3FPVA 3R7WA 1ES2A 3KO6A 1YLJA 3T4QA 3H82B 1FSYA 3VSKA 5DFXA 4B4XA 4KG5A 4EETB 3PHYA 4EWFA 4GJ4A 4S2JA 5DKLA 3HUOA 5EECA 1LT0A 2KOIA 5FI7A 4KZ5A 3CG5A 4E3KA 4Q0JA 1IKIA 4HEFA 2J9OA 4LLOB 4GB7A 2Y2GA 5CHJA 5AJGA 3VE3A 3IS2B 1I2SA 1EROA 4HI4A 4JPMA 4P85A 4PKYA 4QHCA 3PAEA 4Z1WA 3JVVA 2IWCA 2ZC6B 2JKFA 4GS9B 1WYBA 4L0LA 5HDDA 4ID4A 4QWOA 3N7WA 1K55A 3F1OA 2HDRA 1GHIA 3LI9A 1GA0A 4E6WA 3V3SA 3GV9A 4K0WA 2ZMVA 3VP1A 2ZQ8A 4BJPA 3LEQA 3GRJA 3CI6A 3IQAA 3A3EA 1F2KA 3ZCZA 4IUHA 3P7NA 1PWDA 4LV1A 2XSSA 3WS5A 2MJ6A 5EVIC 3T4JA 3F1PB 2Z6CA 5KMWA 2XD5A 4GHIB 3SH7A 5DVAA 3C30A 1MXOA 2Y2JA 2CMNA 3MKFA 4BMWA 1S0WA 4E6XA 4WUJA 3BEBA 1KDWA 5J7EA 1AWIA 4R4RA 5DJTA 1I2WA 3UE0A 3T1RA 2VV6A 5HD5A 3FZCA 1XFNA 3RH8B 1SZVA 5A91A 5L09A 4KZ9A 4WM9A 1K0KA 3ZNTA 1ES5A 3HLWA 5HZHA 4LCLA 3JVUA 2I72A 4HOIA 3VP3A 1K57C 2QYBA 4DKIA 4HBUA 3NHQA 2HDSA 2FFYA 1JWZA 3M6HA 4OQGA 3HUMA 4BD1A 3IWOA 3S7QA 5AVFA 4DXBA 2VV7A 4MBKA 1YSQA 3WS4A 4X56A 5TFQA 4MN5A 1XJ3A 1JWPA 3P09A 3G6OA 3GDIA 1FQGA 5GHYA 1JTGA 4EU0A 4HESA 1YPRA 4GD8A 4DXCA 1YMXA 3N6IA 2HDUA 5IT5A 3OCLA 2DNSA 1PRQA 3A3IA 1IKGA 1UWPX 1XJ4A 4N9KA 4ZJ2A 5HPIA 2JN7A 1OT9A 2Y2LA 4F3LB 4EEPA 2C6WB 3C5AA 2H10A 2ZMFA 2XGNA 1ALQA 3T4OA 2J9PA 4P6BA 5JYOA 3S7PA 2VGLM 4Y3IA 2O99A 2I9VA 3T1QB 3P98A 2E8IA 4UHUA 5D3OA 1H3QA 3QP4A 2B02A 1YLPA 4HP4A 5CERA 1NYYA 5FQQA 1EW0A 2FZ0A 3G34A 3SH8A 2L4RA 4O01A 2WGWA 3GMWA 4GW9A 4JKTA 2R78A 5KIZA 5FI6A 3WS1A 4PM5A 3W2ZA 4BD0A 3HJKA 5FDHA 3LR5A 5TBMB 1XP4A 2HP9A 3S7NA 2Q0OA 1P0ZA 2Y2OA 1OTAA 3TG9A 4R4SA 4D2OA 2HJEA 4X69A 5A92A 4S2NC 2W3FA 2OWJA 4JF4A 1TS6A 3BFDA 4B4ZA 3ZFZA 1D1JA 3BFGA 3NULA 1BLPA 1YLWA 1DJCA 3BYDA 4JXGA 3LY3A 3VOZA 3IX8A 5KSHA 1K56A 4DE1A 1MPLA 1N9OA 2RCXA 4YNRA 3E2LA 1ODVA 3IBJA 1L0FA 1W63M 2QHKA 5F1GA 3W4QA 3ZNYA 2VJWA 1GHPA 1CEFA 1P9WA 3Q7VB 5A93A 3G2YA 1A0KA 2VA0A 1L0EA 2ZM2A 4WMCD 1W8QA 3G2ZA 4X53A 5EOEA 5BOHA 2JCHA 4BBVA 4GDNA 5GHXA 4WMCA 3C7VA 2WGWB 5F1FA 3VOLA 5J8XA 2ZMAA 1G6AA 4DJ3A 1XKZA 4Y5FA 2ZC5B 4C3QA 4MLLA 4KZ4A 2EFUA 2WAFA 4MMNA 1MWTA 4X55A 4WEKA 2GDNA 4R3AA 3LYXA 2VEAA 3GECA 3UMEA 2KLIA 3EQUA 5EE8A 3UO9A 2W3HA 1DP9A 4FUWA 5I5LA 2PU4A 3FPWA 3T4KA 2XA7M 1E25A 3IXGA 2Y8HA 4LCMA 4WL9A 3UB7A 2PD7A 3A0RA 3HLFA 3DW0A 3TE8A 4KQOA 1K57A 2INWA 4BL2A 4ZJ1A 2H28A 2EFXA 1XX2A 2Y55A 3VOYA 1IEMA 4II7A 3PAGA 4HIAA 2VK3A 5FAPA 5TBMA 2Y59A 1DY6A 2ZOIA 1IOUA 1PFLA 1KVMA 3BY8A 1K6SA 2V20A 5L2FA 2EX9A 3CMZA 3S4XA 1MBLA 1LSWA 3BQ8A 3IXHA 2A24A 3GSGA 1WA9A 2KDKA 4JGPA 1TEMA 3N8RA 4I3JA 3F1NB 2ZC7A 4EUZA 4UA6A 5DF8A 1YLZA 3IH8A 2OOLA 4K0XA 1OT6A 3HUNA 3O87A 1UWNX 2B18A 5EV0A 1VEUB 5HD3A 4JBFA 2EWWA 4MCWA 3V39A 3WS0A 2D02A 3DTEA 1ESUA 1PW8A 1RGZA 2PYPA 3CJMA 1QMEA 2WYXA 4UQIM 1NLZA 1TS8A 2VGJA 4E3JA 3E98A 5MC7A 2P04A 3CLOA 3K2NA 5DF9A 1NZOA 3T4SA 3DAVA 4ETXA 5AQBA 3LR3A 3MXRA 4XT2B 4ARZB 3OOVA 4B93A 3O3VA 2V0UA 3LIAA 4CPKA 4R23A 1XA1A 3HL9A 1XGJA 2IWDA 3PBSA 1G68A 1N9BA 3ISGA 4HJ6A 1K38A 3DWZA 2YKHA 3T4LA 4S2NA 4CQHA 3V50A 2VZWA 4PKYG 5F5YA 3NOTC 4BWIA 5G4ZA 3PBRA 4GHIA 5KZHA 2XD1A 1P97A 3JYIA 1IYOA 2WKHA 3UY6A 3KYQA 1PNEA 3SW1A 1YQSA 1EI5A 2BASA 2W1TB 2K31A 2ACGA 2W0NA 5HARA 3LI8A 5CGSA 4NEED 5FEFA 2Y79A 3MZDA 4OP8A 4Y7PA 1IYQA 2JE5A 4KZ7A 4UA7A 2O9AA 1CK3A 1MZUA 1JNUA 3D9YA 5I94A 3EEAA 4DF6A 1P9RA 3FG8A 1K25A 1DP6A 2YKFA 3WRTA 2WAEA 2WKIA 4EUVA 4DE3A 2DCFA 3WWXA 4QPRA 3LCEA 1SHVA 2OWHA 3Q7ZA 1KGEA 4KZ8A 5HWWA 4LGWA 1YMSA 4I39A 3ITBA 3BLMA 1RP5A 4HHDA 1DJBA 4JF5A 5FQMA 3EOIA 1MWRA 2NUPC 5FL3A 3HLGA 4GKUA 4BQMA 3M6BA 5E2EA 2ZL1B 3M2JA 3UB8A 3CAXA 4JGOA 4MBFA 2PHYA 2P74A 4JXVA 3QNBA 3MR0A 4WYYA 3ZVWA 1UGUA 3F1PA 3TRCA 4HP9A 1S4SA 2L1MA 2W3EA 2OAP1 3GR2A 4C75A 3RXXA 1GSXA 1SKOA 3HLBA 3UE3A 2WZZA 3OC2A 4K08A 3KSGA 1DP8A 1PIOA 2A3UA 1G28A 3U2AA 1GSWA 3NECA 5L07A 4RX3A 2XR0A 2QWSA 5FSRA 3OCNA 5M19A 4NKPA 1LSVA 4GD6A 1TF1A 4NXBA 3PXPA 5CRFA 3IXBA 2WKEA 5G4YA 1QMFA 3MSHA 3QHYA 4KUKA 1TS0A 3LY4A 3IWQA 5M18A 3OPHA 3IX4A 1FIKA 3C4PA 3ZVTA 2WUQA 1H0MA 1OPXA 5F68A 4S2PA 1KDSA 1PW1A 1F9IA 1CQAA 1NLYA 4MN7A 3N8SA 3IBRA 1Y4OA 5U47A 3CPTB 3FC7A 1H8ZA 4EXOA 4XUZA 1F5MA 3T1SA 3VP2A 4BENA 5FQKA 4L9GA 3ZG0A 4GCZA 3NY4A 4BLMA 2XEPA 3L7HA 4X1MA 4E3IA 3LR4A 2Y2KA 2PAVP 1J9MA 2V1ZA 4OOMA 1JTDA 3IF6B 3IH9A 4IHQA 3HCYA 2XQZA 5FI2A 3KYZA 1N9NA 2XDMA 1S4RA 4RYEA 4JXWA 1AXBA 4IUKA 4BL3A 5GLCA 3N8LA 4EEUA 4JGRA 3IS2A 4ME4A 1O7EA 1TS7A 3BY9A 5AQ9A 5GLBA 4HH3A 5FAQA 3G32A 2P08A 1C3BA 3MZFA 4BBTA 4IVIA 1LSXA 4EW7A 1MWSA 2QKPA 2ZBBA 4JF6A 2R9WA 1PZPA 1YKDA 1KE0A 3HLDA 2ZQAA 3NC8A 3NOUC 2W1RA 4JGQA 2PDRA 3T50A 4CLCE 1JWVA 2Q9NA 1BZAA 5HW3A 2J3WA 4KZBA 2M7UA 1YLYA 1F98A 2WGIA 4P87A 3ZG5A 3CUEC 1H8YA 1L3LA 3OLOA 1HD8A 1XPBA 4LRYC 3BFFA 1SDNA 5TR7A 2HP6A 1BLHA 1LI0A 3D72A 3P01A 5HDCA 1E3UA 3DTMA 1VQQA 3C38A 4E3NA 4EESA 1XJ6A 1YAXA 3CUEA 4Y15A 3G4PA 5FATA 1DRMA 2LB9A 4KENB 1FCOA 2B95A 2X02A 2XA7S 2ZQ7A 3HBRA 1VHMA 5DKKA 3UDFA 3MXQA 3LO7A 3RTYA 1L2SA 4OP5A 2Y4AA 2Z2LB 2QJ7A 1BLSA 1Z6FA 4JXSA 4PM7A 1K4EA 4N1HA 2GJ3A 2Y2NA 5GL9A 4UA9A 1K4FA 2Y2QA 2ZLYA 3EWKA 3D4FA 1LL9A 1ES4A 1M40A 4DRTA 4NK3A 1XGIA 5G18A 3FYZA 1V9ZA 2DMWA 3PTEA 5FA7A 5F69A 3UB9A 3K3CA 3UDIA 4L9FA 3Q81A 3E4QA 4ESPA 3UPOA 1XFQA 3W4OA 1FR1A 1BLCA 4D60A 2EX6A 3NCKA 3FKVA 4CLCC 3UNWA 1K54A 3EGXC 1HVBA 4KZ6A 4S2KA 5HAPA 4ZAMA 4Y2FA 3GVBA 4FH4A 1KGGA 2V0WA 1HTZA 3C8CA 4DDYA 3V3RA 5F6AA 2JHEA 2JKGA 4OQIA 3F1NA 4CLCA 5EVID 2WKRA 2EWVA 1VETA 2J8YA 2ZJ9A 2VGKA 1H8MA 1D7EA 2V2FF 4GDBA 2ZC4B 4WF0A 4FTXA 3BM6A 2DRWA 4IVKA 5CTNA 2WZXA 2XFTA 1N9LA 5L8MA 4MEZA 3MS6A 3A0VA 1MWUA 1Q2PA 4OQ0A 2PBDP 2JKTM 3QNCA 4GNUA 5FDSA 3SZTA 1IYSA 4HNBA 3ZG8B 3ZG9B 5TJJA 1NRFA 3IF5A 4OPZA 3PBNA 5DFYA 2EA9A 2V9AA 2PR6A 4G3KA 1CI9A 2GNXA 3A3JA 2G2UA 1VM1A 4ZTKA 2PU2A 1CEGA 3IF6C 4PM6A 4OLGA 4B88A 4U0XA 2B5RA 2G2WA 2IA2A 3VP0A 1OJGA 3V5MA 5HL6A 2Y2IA 4R3JA 4X25A 5DF7A 1XXMA 4N92A 1OTIA 3L9KA 2VV8A 5HWVA 3OBFA 5FEGA 3NI9A 4F94A 5IS1A 1LLBA 3CHWP 4XUXA 5FQ9A 3BJNA 5TGFA 4KZ3A 4IJGA 3H7WB 4Y0OA 4R1GA 4OVDA 4KUOA 4OLDA 5CX7A 2XF3A 2ZM0A 3UPPA 1S1ZA 1CI8A 3GTCA 2WADA 3UMDA 4Z9QA 1S66L 5DTSA 2JKRI 4S2IA 1K54C 3E2KA 2WKPA 4KQQA 1FILA 4I38A 2W3DA 2OLVA 1CF0A 4FD8A 4YWZA 1N4OA 5DTKA 3BWLA 3O5YA 5CGXA 5CXWA 2LB5A 2WK0A 4O0PA 3WS2A 3NIAA 2VLGA 3B47A 3A0SA 2A24B 4NXEA 4QU3A 3TOIA 4K91A 4RX2A 4EQ1A 3DWKA 3LIDA 4FH2A 1IFQA 1ZKJA 1L0DA 4DE2A 3VMAA 2XRNA 4WN5A 4YINA 3VFFA 1IYPA 1J3WA 2AVXA 2H0TA 1VEUA 4WZ5A 3IWIA 1WYCA 4Y0UA 1BULA 1NRJA 5HFOA 1Y28A 1GA9A 3G30A 1I5QA 4P6ZM 3PBTA 3RFBA 4DDSA 1KVLA 2JC7A 3NDGA 4UEYA 3EGDC 3LR0A 4IBRA 2ZC3B 2P9VB 2V1AA 1SDEA 3BFCA 5E2FA 4E3OA 1T1CA 3CPTA 4PM9A 3QP6A 2VKSA 3ICYA 4MN6A 3QP1A 4KQRA 3S1YA 4EQIA 3UN7A 5CHMA 2QZ6A 2OSUA 1DJAA 2WGVA 2EXBA 3BRMA 3I7JA 4ETZA 1XJ2A 3LIEA 5HSQA 4NG2A 3D3OA 4PAUA 3MBZA 1PI5A 4LV2A 4YFMA 4I3IA 4WZ4A 4BBUA 1RCJA 3HVFA 4OPQA 2JKRM 4DE0A 2PD8A 3OPLA 5A8BA 3PR6A 2HDQA 4ZBEA 3H82A 3UPNA 1BYWA 3LFVA 3IHAA 3UDXA 3K3DA 5E2GA 2OAQ1 4U0TA 2O9CA 2EX2A 3AGDA 3IT9A 4LRZE 4PPRA 4MNRA 1KOUA 5GLAA 1NYMA 1SKFA 3ZHHA 3Q07A 4GOGA 2A2LA 1E4DA 1MKMA 5J4EA 3FV7A 4LV3A 4O7DA 3SS5A 4LPZA 3R7WB 2O9BA 1KE3A 4O8GA 2Y2HA 2H5SA 2K2NA 3V67A 1FR6A 2O0YA 3IF6A 3TJZC 5CECA 1FOFA 1NJ4A 4OPYA 1BT5A 4GS9A 1NWZA 1TDLA 2X01A 1ZG6A 5HPFA 3ITAA 3AGFA 3CITA 3Q1FA 3B3XA 5FQIA 4CLCD 1MC0A 3DBAA 3R4KA 3LUQA 5EM0A 4HQAA 1K56D 2K7SA 4FCFA 1FCMA 1KGFA 5EUAA 3A3DA 1ESIA 4H6JA 2W3GA 1LL8A 4R70A 3PBQA 1S67L 2HPBA 3KSFA 2KX6A 3BQAA 3Q7VA 2E8JA 2HP5A 2UWXA 3S22A 1YM1A 4IEDA 4IBXA 4U3TA 4ZRRA 3MF0A 1PWCA 5EPHA 5EVEA 3HLEA 1D06A 4RQ9A 4R0QA 5FASA 3UB6A 4AFIA 4OQHA 2P9VA 5CHUA 2D01A 3MQOA 3TSGA 1YT4A 2V1BA 2Y2PA 1WE4A 3MFXA 4Q0HA 3C4OA 2RL3A 3SS4A 1FSWA 3SS3A 3ZG7B 3MKEA 3IXDA 4QY6A 3LIBA 1LI9A 3VSLA 2OLUA 3RJUA 4ZJ3A 5A90A 2BTFP 1U60A 2XLNA 5E2HA 4HJ4A 4P0MA 2W1TA 5F82A 3UB5P 1OTEA 2JBFA 1BTLA 4C6YA 3QP5A 4OPRA 3QP2A 2XH9A 4OOLA 3DTKA 1VETB 3T4TA 4WZ5C 3TW8A 1X0OA 1NY0A 1HLUP 4G3VA 4FOFA 2EX8A 1W8YA 3QP8A 3CWFA 2J80A 1Z09A 3NBLA 1T18A 2PT7A 4S2LA 1STZA 1L0GA 3MFDA 4HJ3A 2NUTC 5HWTA 4GN2A 2UV0E 5GLDA 2QPNA 1LL5A 1Y54A 1SCWA 4Y17A 4HH2A 2VX8A 2QJ5A 3SOIA 4PHTA
chains in the Genus database with same CATH topology
5DJTA 5TJJA 2VV6A 5HD5A 2GZAA 3UE6A 3PBNA 5DFYA 3ZQ5A 1XFNA 2EA9A 3RH8B 4DN0A 1G6OA 1OTBA 4GLQA 2V9AA 2PR6A 4G3KA 2O9AA 2GNXA 1MZUA 5HZHA 2PR5A 3EQVA 1JNUA 3JVUA 3MQQA 4HOIA 2GX5A 4L9EA 2PYRA 3EEAA 2QYBA 1P9RA 3NHQA 2HF6A 1T1BA 2M1CA 3FG8A 4H6JB 2IA2A 3MMHA 1OJGA 5HL6A 2VGLS 3S7QA 1GSVA 5AVFA 2VV7A 3EEHA 1YSQA 1DP6A 1OTIA 2YKFA 4Q0IA 4MN5A 1XJ3A 2VV8A 5HWVA 3OBFA 3G6OA 3GDIA 4EUVA 1S1YA 5IS1A 4QPRA 3BJNA 4EU0A 4IJGA 2OWHA 4NXFA 3H7WB 5HWWA 4KUOA 4I3AA 5CX7A 4LRXC 1S1ZA 5IT5A 3OCLA 2L0WA 4I39A 4CLCB 3PYPA 3LIFA 1UWPX 4B9OA 3UMDA 1XJ4A 4HHDA 1S66L 5HPIA 2JKRI 3EOIA 2JN7A 1OT9A 4F3LB 4EEPA 2WKPA 2NUPC 5FL3A 2ZMFA 3NOPC 3MJQA 4I38A 2W3DA 3UB8A 3CAXA 3T4OA 2FH5A 4JGOA 4YWZA 2PHYA 1ZTUA 4KQDA 3S7PA 2VGLM 4Y3IA 2O99A 3MR0A 3BWLA 3NJAA 2I9VA 3O5YA 1UGUA 3F1PA 3TRCA 3S7OA 4HP9A 1S4SA 1H3QA 2L1MA 2LB5A 4O0PA 2B02A 4HP4A 2VLGA 2W3EA 2OAP1 3B47A 3A0SA 1GSXA 2A24B 4HY8A 1EW0A 1TD5A 4NXEA 3UE3A 4EQ1A 2FZ0A 3LIDA 3ZYTA 3KSHA 1IFQA 2L4RA 3PBOA 4O01A 3OC2A 4K08A 2Z6DA 3KSGA 2G7UA 1DP8A 1G28A 3U2AA 4GW9A 1VB6A 4P6ZS 2R78A 5KIZA 1GSWA 2XRNA 4WN5A 3W2ZA 3E0YA 4G3WA 3H9WA 2QWSA 3HJKA 5IU1A 3LR5A 5TBMB 3S7NA 3OCNA 1P0ZA 4NKPA 1LSVA 1TF1A 5HDSA 1OTAA 4E04A 4NXBA 3PXPA 4R6LA 1NRJA 5G4YA 2HJEA 1YSPA 1Y28A 4MDZA 2W3FA 2OWJA 5EFWA 1TS6A 3MQ0A 4KUKA 1TS0A 4P6ZM 3PBTA 3RFBA 3F1OB 5DJUA 4UEYA 3EGDC 1OPXA 5F68A 4R38A 3LR0A 4YOFA 5KSHA 2V1AA 2J3TC 1T1CA 1F9IA 1NLYA 3VE4A 1N9OA 4MN7A 5J3WA 2HGVA 3IBRA 2VKSA 4YNRA 3ICYA 4FSFA 4MN6A 1ODVA 3IBJA 1W63M 2QHKA 1T19A 3C2WA 3FC7A 3ULFA 1W63Q 2VJWA 4WELA 4EXOA 1F5MA 4ETZA 1P9WA 1XJ2A 3LIEA 4L9GA 5HSQA 2VA0A 3D3OA 3B42A 4PAUA 2J3TD 4GCZA 4I3IA 5C5KA 4WLAA 3LR4A 4BBUA 4EERA 4OOMA 4BBVA 4DMZA 2M7VA 2JKRM 3H7WA 2HV1A 4IHQA 3HCYA 2PD8A 3KYZA 5A8BA 3PR6A 3VOLA 1N9NA 3E4OA 3H82A 3KSIA 3HJIA 4DJ3A 1S4RA 1BYWA 3LFVA 4IUKA 4Y5FA 3K3DA 2OAQ1 3E4PA 4EEUA 2O9CA 4JGRA 2W27A 3IS2A 4ME4A 1TS7A 2P7JA 3BY9A 4HH3A 4LRZE 4MMNA 1KOUA 4WEJA 2HJ9C 2P08A 4BBTA 4F3LA 4WEKA 1LSXA 4EW7A 4R3AA 3KX0X 3LYXA 2QKPA 2VEAA 3GECA 2ZBBA 3UMEA 2A2LA 2KLIA 1T1AA 3B33A 3EQUA 2W3HA 1DP9A 5AVEA 5I5LA 1MKMA 1YKDA 5J4EA 3FPWA 3NOUC 2W1RA 4JGQA 4LPZA 4DJ2A 3T4KA 2PDRA 3T50A 3R7WB 4CLCE 2XA7M 2O9BA 2Y8HA 4WL9A 3UB7A 2PD7A 3A0RA 2J3WA 4O8GA 2M7UA 1F98A 3LICA 3VV4A 3TE8A 2K2NA 4KQOA 3V67A 3CUEC 2O0YA 3OLOA 1OJ5A 1ZHHB 2INWA 3TJZC 2ZOHA 2H28A 4LRYC 4GS9A 3D72A 3P01A 1NWZA 5HDCA 4UQIS 5HPFA 3CITA 2JKTI 2WKQA 3C38A 4EESA 4II7A 4M4XA 1XJ6A 1YAXA 3CUEA 5LBRA 4CLCD 1MC0A 3DBAA 4HIAA 3R4KA 5TBMA 3LUQA 1DRMA 2LB9A 4HQAA 2K7SA 2ZOIA 4H6JA 4NXGA 2XA7S 2W3GA 1IOUA 3BW6A 1VHMA 5DKKA 3BY8A 1LL8A 4I5SA 4R70A 3MXQA 3PBQA 1S67L 3RTYA 2XROA 3KSFA 1V9YA 1LSWA 2KX6A 1OTDA 3BQAA 2QJ7A 3BQ8A 2A24A 5K5BA 4XT2A 4ARZA 3FPVA 1WA9A 3KO6A 3R7WA 4ZRRA 3MF0A 3T4QA 2KDKA 4JGPA 3H82B 5DFXA 4I3JA 3F1NB 2GJ3A 1D06A 4EETB 3PHYA 4RQ9A 4GJ4A 5DKLA 3EWKA 3UB6A 4AFIA 2OOLA 2D01A 3MQOA 1OT6A 1LT0A 2V1BA 2KOIA 3MFXA 4Q0HA 1UWNX 2B18A 4Q0JA 5HD3A 1V9ZA 2DMWA 5F69A 2EWWA 4MCWA 2D02A 3LIBA 4LLOB 3UB9A 3K3CA 5AJGA 4L9FA 3E4QA 3VE3A 2PYPA 3IS2B 1XFQA 4UQIM 1NLZA 1TS8A 3E98A 5MC7A 4HJ4A 2P04A 4HI4A 4PKYA 4CLCC 3CLOA 3K2NA 4Z1WA 5DF9A 3EGXC 3JVVA 2W1TA 3T4SA 4ETXA 3LR3A 1OTEA 4Y2FA 2V0WA 4XT2B 4ARZB 4GS9B 3OOVA 4B93A 2V0UA 3C8CA 3LIAA 4L0LA 5HDDA 4OOLA 5F6AA 2JHEA 3T4TA 3F1NA 4CLCA 3F1OA 2WKRA 2EWVA 3LI9A 3TW8A 1X0OA 3PBSA 4G3VA 4FOFA 2ZMVA 4HJ6A 3CWFA 2J80A 2YKHA 3T4LA 4BJPA 4CQHA 1H8MA 2VZWA 3CI6A 1D7EA 4PKYG 5F5YA 4IUHA 3NOTC 4BWIA 3P7NA 4WF0A 1T18A 2PT7A 5G4ZA 1STZA 2XSSA 3PBRA 4GHIA 2MJ6A 4HJ3A 2NUTC 5HWTA 1P97A 1N9LA 5L8MA 3T4JA 3F1PB 2Z6CA 3KYQA 4GHIB 3SW1A 3A0VA 3C30A 2BASA 2W1TB 2CMNA 2K31A 2W0NA 4BMWA 3LI8A 2JKTM 4NEED 4WUJA 4HH2A 2VX8A 2QJ5A 4HNBA 5J7EA 4PHTA 2Y79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDK A;  3A0S A;  3H82 B;  4JGP A;  1GSX A;  2A24 B;  5DJT A;  3H7W A;  1EW0 A;  2HV1 A;  3F1N B;  4HY8 A;  2GJ3 A;  4I3J A;  4NXE A;  2VV6 A;  2PD8 A;  5HD5 A;  5A8B A;  1D06 A;  3UE6 A;  4EET B;  4EQ1 A;  3PHY A;  3LID A;  3VOL A;  3ZQ5 A;  1N9N A;  4RQ9 A;  1XFN A;  2EA9 A;  3E4O A;  3RH8 B;  3H82 A;  2L4R A;  3EWK A;  5DKL A;  3UB6 A;  1OTB A;  4K08 A;  2OOL A;  2Z6D A;  2V9A A;  3HJI A;  1DP8 A;  4DJ3 A;  1S4R A;  2PR6 A;  1BYW A;  1G28 A;  2D01 A;  3MQO A;  4GW9 A;  1OT6 A;  1VB6 A;  1LT0 A;  2V1B A;  3MFX A;  1MZU A;  3K3D A;  2R78 A;  1UWN X;  2PR5 A;  1GSW A;  1JNU A;  5HZH A;  5KIZ A;  3E4P A;  4WN5 A;  4EEU A;  3MQQ A;  4JGR A;  5HD3 A;  2W27 A;  1V9Z A;  4HOI A;  3IS2 A;  4L9E A;  3H9W A;  2QWS A;  2PYR A;  5F69 A;  3HJK A;  1TS7 A;  5IU1 A;  2P7J A;  3BY9 A;  2D02 A;  3LIB A;  3NHQ A;  4LLO B;  4HH3 A;  5TBM B;  1T1B A;  2M1C A;  4LRZ E;  3UB9 A;  3K3C A;  1KOU A;  3FG8 A;  4E04 A;  1P0Z A;  4L9F A;  4BBT A;  1LSV A;  3E4Q A;  4H6J B;  2PYP A;  3IS2 B;  1LSX A;  1OJG A;  5HDS A;  1OTA A;  3VE3 A;  4EW7 A;  4R3A A;  1XFQ A;  3KX0 X;  3LYX A;  2QKP A;  2VEA A;  3GEC A;  2ZBB A;  1GSV A;  1TS8 A;  4NXB A;  5AVF A;  2VV7 A;  3B33 A;  1T1A A;  5AVE A;  4R6L A;  3UME A;  1DP9 A;  3EEH A;  5G4Y A;  4HJ4 A;  5I5L A;  1Y28 A;  5J4E A;  4HI4 A;  3NOU C;  1DP6 A;  4JGQ A;  1OTI A;  2OWJ A;  2YKF A;  4PKY A;  5EFW A;  3CLO A;  4LPZ A;  1TS6 A;  1XJ3 A;  2VV8 A;  2PDR A;  4KUK A;  4MN5 A;  3T50 A;  4B9O A;  4DJ2 A;  5HWV A;  4WL9 A;  1TS0 A;  3G6O A;  3GDI A;  2PD7 A;  3UB7 A;  1OTE A;  3A0R A;  2V0W A;  4XT2 B;  1F98 A;  1S1Y A;  4GS9 B;  3F1O B;  3LIC A;  5IS1 A;  2V0U A;  3C8C A;  3LIA A;  5DJU A;  5HDD A;  3OLO A;  1OJ5 A;  5F68 A;  2INW A;  4R38 A;  5F6A A;  2JHE A;  2OWH A;  2ZOH A;  4NXF A;  3H7W B;  4F3L A;  2H28 A;  3F1N A;  4LRY C;  4GS9 A;  3F1O A;  5HWW A;  4KUO A;  2V1A A;  3D72 A;  4I3A A;  2WKR A;  3LI9 A;  1NWZ A;  5HDC A;  1X0O A;  4LRX C;  1S1Z A;  1T1C A;  1F9I A;  2L0W A;  3VE4 A;  1N9O A;  4I39 A;  4HJ6 A;  2WKQ A;  3CWF A;  4EES A;  3PYP A;  2J80 A;  1UWP X;  2YKH A;  3LIF A;  4M4X A;  1XJ6 A;  1XJ4 A;  5J3W A;  3IBR A;  3UMD A;  4HHD A;  4HIA A;  1S66 L;  3ICY A;  4MN6 A;  4PKY G;  1D7E A;  1ODV A;  3LUQ A;  1DRM A;  5F5Y A;  5TBM A;  4HQA A;  2K7S A;  3NOT C;  3P7N A;  2JN7 A;  2ZOI A;  1OT9 A;  2QHK A;  4WF0 A;  1T18 A;  1T19 A;  3C2W A;  3FC7 A;  4H6J A;  4NXG A;  5G4Z A;  2WKP A;  3ULF A;  4EEP A;  4F3L B;  4GHI A;  5DKK A;  4EXO A;  3BY8 A;  3MJQ A;  3NOP C;  4HJ3 A;  4I38 A;  1LL8 A;  4I5S A;  4R70 A;  3MXQ A;  5HWT A;  3UB8 A;  1P97 A;  1N9L A;  1S67 L;  3CAX A;  1XJ2 A;  3F1P B;  2Z6C A;  3LIE A;  4JGO A;  4L9G A;  4YWZ A;  5HSQ A;  2PHY A;  4GHI B;  3RTY A;  4KQD A;  3A0V A;  3SW1 A;  2BAS A;  1V9Y A;  3MR0 A;  3BWL A;  1LSW A;  2CMN A;  1OTD A;  2I9V A;  2KX6 A;  2QJ7 A;  2W0N A;  3NJA A;  4GCZ A;  1UGU A;  3F1P A;  3LI8 A;  4I3I A;  2A24 A;  4HP9 A;  1S4S A;  4WLA A;  4XT2 A;  4WUJ A;  4HH2 A;  2L1M A;  4BBU A;  1WA9 A;  2QJ5 A;  4HNB A;  5J7E A;  2B02 A;  4HP4 A;  4EER A;  2VLG A;  4BBV A; 
#chains in the Genus database with same CATH topology
 3Q82 A;  4H8R A;  3UE1 A;  2V8F A;  3HLC A;  4S2M A;  4EBL A;  4EBN A;  4EBP A;  2GZA A;  3KYE A;  4JLF A;  3UE6 A;  1ONH A;  3ZQ5 A;  4RVA A;  2X71 A;  4OH0 A;  1FCN A;  4DN0 A;  1G6O A;  1OTB A;  4GLQ A;  1ERM A;  2ZQD A;  1OME A;  3G35 A;  4M3K A;  2PR5 A;  3EQV A;  2Q9M A;  3MQQ A;  5AQ7 A;  2QMI A;  2GX5 A;  4L9E A;  2PYR A;  2HF6 A;  1T1B A;  2M1C A;  4H6J B;  3MMH A;  3W4P A;  2ZQ9 A;  2VGL S;  1GSV A;  5JYP A;  3EEH A;  4OKP A;  3WRZ A;  1TDG A;  1PYY A;  4Q0I A;  4LEN A;  3LEZ A;  4OON A;  2Z2M B;  3O86 A;  1S1Y A;  4E3L A;  4E3M A;  1PI4 A;  1GHM A;  4X6T A;  1Q2Q A;  4NXF A;  1ONG A;  4EV4 A;  1S6R A;  4I3A A;  5KSC A;  4LRX C;  1NXY A;  5CED A;  2L0W A;  3U4L P;  4CLC B;  2V8C A;  3PYP A;  5GHZ A;  3LIF A;  4B9O A;  1JVJ A;  1E3U D;  4X68 A;  1W5D A;  3DTI A;  3G31 A;  3NOP C;  3MJQ A;  1H5X A;  3BLS A;  1LHY A;  1IEL A;  5FAO A;  1ES3 A;  2FH5 A;  2EXA A;  1ZTU A;  4KQD A;  1W7F A;  1ZG4 A;  2H0Y A;  5FQJ A;  4X1L A;  3NJA A;  3FKW A;  1O07 A;  3S7O A;  3N4I A;  2Y91 A;  2OV5 A;  3O88 A;  1KE4 A;  4HY8 A;  1TD5 A;  4QD4 A;  3ZYT A;  4Y13 A;  3KSH A;  3PBO A;  2Z6D A;  2G7U A;  4KG6 A;  1VB6 A;  4P6Z S;  4S2O A;  1XA7 A;  3NDE A;  3BEC A;  3E0Y A;  4G3W A;  3H9W A;  5IU1 A;  1W79 A;  2ZL1 A;  3CZD A;  1HZO A;  5HDS A;  2CC1 A;  1M6K A;  4QJG A;  4E04 A;  5CGW A;  4R6L A;  2HZ5 A;  1YSP A;  4MDZ A;  5EFW A;  3IHB A;  3MQ0 A;  2IWB A;  4A5R A;  5L10 A;  4PM8 A;  5AQA A;  5IHV A;  5DTT A;  3F1O B;  5HAI A;  1PWG A;  5DJU A;  3W8K A;  5EVI B;  1RGY A;  4R38 A;  4R3B A;  4WBG A;  4CJN A;  4YOF A;  4Y0T A;  5CEB A;  4QY5 A;  2J3T C;  1G5U A;  3LGO A;  3VE4 A;  5J3W A;  3A3F A;  3HRE A;  1EWZ A;  2HGV A;  4NET A;  4HBT A;  4FSF A;  2PRF A;  5EM1 A;  2C5W B;  1ERQ A;  3FWL A;  3MXS A;  1T19 A;  3C2W A;  3ULF A;  2J7V A;  1PZO A;  1W63 Q;  4WEL A;  4LV0 A;  1BUE A;  1CJF A;  2BLS A;  4N1X A;  5EOO A;  2ZM8 A;  3B42 A;  2J3T D;  5C5K A;  2ZQC A;  4WLA A;  1BSG A;  4UAA A;  4EER A;  1GCE A;  3MZE A;  4DMZ A;  2M7V A;  3OPR A;  3H7W A;  2HV1 A;  3T1X A;  3M2K A;  4Q8I A;  3E4O A;  5EVL A;  3KSI A;  1ZC2 A;  3HJI A;  3IX3 A;  5HAQ A;  4MBH A;  2XFS A;  2XK1 A;  4ZDX A;  3E4P A;  1MY8 A;  2W27 A;  3OPP A;  4XXR A;  4LFU A;  5HX9 A;  3C7U A;  2P7J A;  1K55 C;  2BG1 A;  3GQZ A;  4WEJ A;  2HJ9 C;  4F3L A;  2FFF B;  3SH9 A;  2A49 A;  1MKI A;  3KX0 X;  3AGE A;  1TVF A;  3B33 A;  1T1A A;  5AVE A;  5CTM A;  4DJ2 A;  5E43 A;  3OZH A;  5EVI A;  2PBY A;  4GZB A;  3LIC A;  3VV4 A;  3JPU A;  5HL1 A;  1OJ5 A;  1ZHH B;  2ZOH A;  1ACF A;  3VP4 A;  2Y2M A;  4QB8 A;  4UQI S;  3VFH A;  2ZD8 A;  2JKT I;  3ZDJ A;  2WKQ A;  4N9L A;  3ZGA B;  4M4X A;  5F83 A;  4KZA A;  5LBR A;  4KG2 A;  4NXG A;  1K6R A;  3BW6 A;  1NZU A;  2R9X A;  4I5S A;  4OOY A;  4RA7 A;  3RXW A;  1YLT A;  3T12 B;  2XRO A;  5M1A A;  1V9Y A;  1OTD A;  3BFE A;  1SKO B;  4PMA A;  4XT2 A;  4ARZ A;  5K5B A;  3FPV A;  3R7W A;  1ES2 A;  3KO6 A;  1YLJ A;  3T4Q A;  3H82 B;  1FSY A;  3VSK A;  5DFX A;  4B4X A;  4KG5 A;  4EET B;  3PHY A;  4EWF A;  4GJ4 A;  4S2J A;  5DKL A;  3HUO A;  5EEC A;  1LT0 A;  2KOI A;  5FI7 A;  4KZ5 A;  3CG5 A;  4E3K A;  4Q0J A;  1IKI A;  4HEF A;  2J9O A;  4LLO B;  4GB7 A;  2Y2G A;  5CHJ A;  5AJG A;  3VE3 A;  3IS2 B;  1I2S A;  1ERO A;  4HI4 A;  4JPM A;  4P85 A;  4PKY A;  4QHC A;  3PAE A;  4Z1W A;  3JVV A;  2IWC A;  2ZC6 B;  2JKF A;  4GS9 B;  1WYB A;  4L0L A;  5HDD A;  4ID4 A;  4QWO A;  3N7W A;  1K55 A;  3F1O A;  2HDR A;  1GHI A;  3LI9 A;  1GA0 A;  4E6W A;  3V3S A;  3GV9 A;  4K0W A;  2ZMV A;  3VP1 A;  2ZQ8 A;  4BJP A;  3LEQ A;  3GRJ A;  3CI6 A;  3IQA A;  3A3E A;  1F2K A;  3ZCZ A;  4IUH A;  3P7N A;  1PWD A;  4LV1 A;  2XSS A;  3WS5 A;  2MJ6 A;  5EVI C;  3T4J A;  3F1P B;  2Z6C A;  5KMW A;  2XD5 A;  4GHI B;  3SH7 A;  5DVA A;  3C30 A;  1MXO A;  2Y2J A;  2CMN A;  3MKF A;  4BMW A;  1S0W A;  4E6X A;  4WUJ A;  3BEB A;  1KDW A;  5J7E A;  1AWI A;  4R4R A;  5DJT A;  1I2W A;  3UE0 A;  3T1R A;  2VV6 A;  5HD5 A;  3FZC A;  1XFN A;  3RH8 B;  1SZV A;  5A91 A;  5L09 A;  4KZ9 A;  4WM9 A;  1K0K A;  3ZNT A;  1ES5 A;  3HLW A;  5HZH A;  4LCL A;  3JVU A;  2I72 A;  4HOI A;  3VP3 A;  1K57 C;  2QYB A;  4DKI A;  4HBU A;  3NHQ A;  2HDS A;  2FFY A;  1JWZ A;  3M6H A;  4OQG A;  3HUM A;  4BD1 A;  3IWO A;  3S7Q A;  5AVF A;  4DXB A;  2VV7 A;  4MBK A;  1YSQ A;  3WS4 A;  4X56 A;  5TFQ A;  4MN5 A;  1XJ3 A;  1JWP A;  3P09 A;  3G6O A;  3GDI A;  1FQG A;  5GHY A;  1JTG A;  4EU0 A;  4HES A;  1YPR A;  4GD8 A;  4DXC A;  1YMX A;  3N6I A;  2HDU A;  5IT5 A;  3OCL A;  2DNS A;  1PRQ A;  3A3I A;  1IKG A;  1UWP X;  1XJ4 A;  4N9K A;  4ZJ2 A;  5HPI A;  2JN7 A;  1OT9 A;  2Y2L A;  4F3L B;  4EEP A;  2C6W B;  3C5A A;  2H10 A;  2ZMF A;  2XGN A;  1ALQ A;  3T4O A;  2J9P A;  4P6B A;  5JYO A;  3S7P A;  2VGL M;  4Y3I A;  2O99 A;  2I9V A;  3T1Q B;  3P98 A;  2E8I A;  4UHU A;  5D3O A;  1H3Q A;  3QP4 A;  2B02 A;  1YLP A;  4HP4 A;  5CER A;  1NYY A;  5FQQ A;  1EW0 A;  2FZ0 A;  3G34 A;  3SH8 A;  2L4R A;  4O01 A;  2WGW A;  3GMW A;  4GW9 A;  4JKT A;  2R78 A;  5KIZ A;  5FI6 A;  3WS1 A;  4PM5 A;  3W2Z A;  4BD0 A;  3HJK A;  5FDH A;  3LR5 A;  5TBM B;  1XP4 A;  2HP9 A;  3S7N A;  2Q0O A;  1P0Z A;  2Y2O A;  1OTA A;  3TG9 A;  4R4S A;  4D2O A;  2HJE A;  4X69 A;  5A92 A;  4S2N C;  2W3F A;  2OWJ A;  4JF4 A;  1TS6 A;  3BFD A;  4B4Z A;  3ZFZ A;  1D1J A;  3BFG A;  3NUL A;  1BLP A;  1YLW A;  1DJC A;  3BYD A;  4JXG A;  3LY3 A;  3VOZ A;  3IX8 A;  5KSH A;  1K56 A;  4DE1 A;  1MPL A;  1N9O A;  2RCX A;  4YNR A;  3E2L A;  1ODV A;  3IBJ A;  1L0F A;  1W63 M;  2QHK A;  5F1G A;  3W4Q A;  3ZNY A;  2VJW A;  1GHP A;  1CEF A;  1P9W A;  3Q7V B;  5A93 A;  3G2Y A;  1A0K A;  2VA0 A;  1L0E A;  2ZM2 A;  4WMC D;  1W8Q A;  3G2Z A;  4X53 A;  5EOE A;  5BOH A;  2JCH A;  4BBV A;  4GDN A;  5GHX A;  4WMC A;  3C7V A;  2WGW B;  5F1F A;  3VOL A;  5J8X A;  2ZMA A;  1G6A A;  4DJ3 A;  1XKZ A;  4Y5F A;  2ZC5 B;  4C3Q A;  4MLL A;  4KZ4 A;  2EFU A;  2WAF A;  4MMN A;  1MWT A;  4X55 A;  4WEK A;  2GDN A;  4R3A A;  3LYX A;  2VEA A;  3GEC A;  3UME A;  2KLI A;  3EQU A;  5EE8 A;  3UO9 A;  2W3H A;  1DP9 A;  4FUW A;  5I5L A;  2PU4 A;  3FPW A;  3T4K A;  2XA7 M;  1E25 A;  3IXG A;  2Y8H A;  4LCM A;  4WL9 A;  3UB7 A;  2PD7 A;  3A0R A;  3HLF A;  3DW0 A;  3TE8 A;  4KQO A;  1K57 A;  2INW A;  4BL2 A;  4ZJ1 A;  2H28 A;  2EFX A;  1XX2 A;  2Y55 A;  3VOY A;  1IEM A;  4II7 A;  3PAG A;  4HIA A;  2VK3 A;  5FAP A;  5TBM A;  2Y59 A;  1DY6 A;  2ZOI A;  1IOU A;  1PFL A;  1KVM A;  3BY8 A;  1K6S A;  2V20 A;  5L2F A;  2EX9 A;  3CMZ A;  3S4X A;  1MBL A;  1LSW A;  3BQ8 A;  3IXH A;  2A24 A;  3GSG A;  1WA9 A;  2KDK A;  4JGP A;  1TEM A;  3N8R A;  4I3J A;  3F1N B;  2ZC7 A;  4EUZ A;  4UA6 A;  5DF8 A;  1YLZ A;  3IH8 A;  2OOL A;  4K0X A;  1OT6 A;  3HUN A;  3O87 A;  1UWN X;  2B18 A;  5EV0 A;  1VEU B;  5HD3 A;  4JBF A;  2EWW A;  4MCW A;  3V39 A;  3WS0 A;  2D02 A;  3DTE A;  1ESU A;  1PW8 A;  1RGZ A;  2PYP A;  3CJM A;  1QME A;  2WYX A;  4UQI M;  1NLZ A;  1TS8 A;  2VGJ A;  4E3J A;  3E98 A;  5MC7 A;  2P04 A;  3CLO A;  3K2N A;  5DF9 A;  1NZO A;  3T4S A;  3DAV A;  4ETX A;  5AQB A;  3LR3 A;  3MXR A;  4XT2 B;  4ARZ B;  3OOV A;  4B93 A;  3O3V A;  2V0U A;  3LIA A;  4CPK A;  4R23 A;  1XA1 A;  3HL9 A;  1XGJ A;  2IWD A;  3PBS A;  1G68 A;  1N9B A;  3ISG A;  4HJ6 A;  1K38 A;  3DWZ A;  2YKH A;  3T4L A;  4S2N A;  4CQH A;  3V50 A;  2VZW A;  4PKY G;  5F5Y A;  3NOT C;  4BWI A;  5G4Z A;  3PBR A;  4GHI A;  5KZH A;  2XD1 A;  1P97 A;  3JYI A;  1IYO A;  2WKH A;  3UY6 A;  3KYQ A;  1PNE A;  3SW1 A;  1YQS A;  1EI5 A;  2BAS A;  2W1T B;  2K31 A;  2ACG A;  2W0N A;  5HAR A;  3LI8 A;  5CGS A;  4NEE D;  5FEF A;  2Y79 A;  3MZD A;  4OP8 A;  4Y7P A;  1IYQ A;  2JE5 A;  4KZ7 A;  4UA7 A;  2O9A A;  1CK3 A;  1MZU A;  1JNU A;  3D9Y A;  5I94 A;  3EEA A;  4DF6 A;  1P9R A;  3FG8 A;  1K25 A;  1DP6 A;  2YKF A;  3WRT A;  2WAE A;  2WKI A;  4EUV A;  4DE3 A;  2DCF A;  3WWX A;  4QPR A;  3LCE A;  1SHV A;  2OWH A;  3Q7Z A;  1KGE A;  4KZ8 A;  5HWW A;  4LGW A;  1YMS A;  4I39 A;  3ITB A;  3BLM A;  1RP5 A;  4HHD A;  1DJB A;  4JF5 A;  5FQM A;  3EOI A;  1MWR A;  2NUP C;  5FL3 A;  3HLG A;  4GKU A;  4BQM A;  3M6B A;  5E2E A;  2ZL1 B;  3M2J A;  3UB8 A;  3CAX A;  4JGO A;  4MBF A;  2PHY A;  2P74 A;  4JXV A;  3QNB A;  3MR0 A;  4WYY A;  3ZVW A;  1UGU A;  3F1P A;  3TRC A;  4HP9 A;  1S4S A;  2L1M A;  2W3E A;  2OAP 1;  3GR2 A;  4C75 A;  3RXX A;  1GSX A;  1SKO A;  3HLB A;  3UE3 A;  2WZZ A;  3OC2 A;  4K08 A;  3KSG A;  1DP8 A;  1PIO A;  2A3U A;  1G28 A;  3U2A A;  1GSW A;  3NEC A;  5L07 A;  4RX3 A;  2XR0 A;  2QWS A;  5FSR A;  3OCN A;  5M19 A;  4NKP A;  1LSV A;  4GD6 A;  1TF1 A;  4NXB A;  3PXP A;  5CRF A;  3IXB A;  2WKE A;  5G4Y A;  1QMF A;  3MSH A;  3QHY A;  4KUK A;  1TS0 A;  3LY4 A;  3IWQ A;  5M18 A;  3OPH A;  3IX4 A;  1FIK A;  3C4P A;  3ZVT A;  2WUQ A;  1H0M A;  1OPX A;  5F68 A;  4S2P A;  1KDS A;  1PW1 A;  1F9I A;  1CQA A;  1NLY A;  4MN7 A;  3N8S A;  3IBR A;  1Y4O A;  5U47 A;  3CPT B;  3FC7 A;  1H8Z A;  4EXO A;  4XUZ A;  1F5M A;  3T1S A;  3VP2 A;  4BEN A;  5FQK A;  4L9G A;  3ZG0 A;  4GCZ A;  3NY4 A;  4BLM A;  2XEP A;  3L7H A;  4X1M A;  4E3I A;  3LR4 A;  2Y2K A;  2PAV P;  1J9M A;  2V1Z A;  4OOM A;  1JTD A;  3IF6 B;  3IH9 A;  4IHQ A;  3HCY A;  2XQZ A;  5FI2 A;  3KYZ A;  1N9N A;  2XDM A;  1S4R A;  4RYE A;  4JXW A;  1AXB A;  4IUK A;  4BL3 A;  5GLC A;  3N8L A;  4EEU A;  4JGR A;  3IS2 A;  4ME4 A;  1O7E A;  1TS7 A;  3BY9 A;  5AQ9 A;  5GLB A;  4HH3 A;  5FAQ A;  3G32 A;  2P08 A;  1C3B A;  3MZF A;  4BBT A;  4IVI A;  1LSX A;  4EW7 A;  1MWS A;  2QKP A;  2ZBB A;  4JF6 A;  2R9W A;  1PZP A;  1YKD A;  1KE0 A;  3HLD A;  2ZQA A;  3NC8 A;  3NOU C;  2W1R A;  4JGQ A;  2PDR A;  3T50 A;  4CLC E;  1JWV A;  2Q9N A;  1BZA A;  5HW3 A;  2J3W A;  4KZB A;  2M7U A;  1YLY A;  1F98 A;  2WGI A;  4P87 A;  3ZG5 A;  3CUE C;  1H8Y A;  1L3L A;  3OLO A;  1HD8 A;  1XPB A;  4LRY C;  3BFF A;  1SDN A;  5TR7 A;  2HP6 A;  1BLH A;  1LI0 A;  3D72 A;  3P01 A;  5HDC A;  1E3U A;  3DTM A;  1VQQ A;  3C38 A;  4E3N A;  4EES A;  1XJ6 A;  1YAX A;  3CUE A;  4Y15 A;  3G4P A;  5FAT A;  1DRM A;  2LB9 A;  4KEN B;  1FCO A;  2B95 A;  2X02 A;  2XA7 S;  2ZQ7 A;  3HBR A;  1VHM A;  5DKK A;  3UDF A;  3MXQ A;  3LO7 A;  3RTY A;  1L2S A;  4OP5 A;  2Y4A A;  2Z2L B;  2QJ7 A;  1BLS A;  1Z6F A;  4JXS A;  4PM7 A;  1K4E A;  4N1H A;  2GJ3 A;  2Y2N A;  5GL9 A;  4UA9 A;  1K4F A;  2Y2Q A;  2ZLY A;  3EWK A;  3D4F A;  1LL9 A;  1ES4 A;  1M40 A;  4DRT A;  4NK3 A;  1XGI A;  5G18 A;  3FYZ A;  1V9Z A;  2DMW A;  3PTE A;  5FA7 A;  5F69 A;  3UB9 A;  3K3C A;  3UDI A;  4L9F A;  3Q81 A;  3E4Q A;  4ESP A;  3UPO A;  1XFQ A;  3W4O A;  1FR1 A;  1BLC A;  4D60 A;  2EX6 A;  3NCK A;  3FKV A;  4CLC C;  3UNW A;  1K54 A;  3EGX C;  1HVB A;  4KZ6 A;  4S2K A;  5HAP A;  4ZAM A;  4Y2F A;  3GVB A;  4FH4 A;  1KGG A;  2V0W A;  1HTZ A;  3C8C A;  4DDY A;  3V3R A;  5F6A A;  2JHE A;  2JKG A;  4OQI A;  3F1N A;  4CLC A;  5EVI D;  2WKR A;  2EWV A;  1VET A;  2J8Y A;  2ZJ9 A;  2VGK A;  1H8M A;  1D7E A;  2V2F F;  4GDB A;  2ZC4 B;  4WF0 A;  4FTX A;  3BM6 A;  2DRW A;  4IVK A;  5CTN A;  2WZX A;  2XFT A;  1N9L A;  5L8M A;  4MEZ A;  3MS6 A;  3A0V A;  1MWU A;  1Q2P A;  4OQ0 A;  2PBD P;  2JKT M;  3QNC A;  4GNU A;  5FDS A;  3SZT A;  1IYS A;  4HNB A;  3ZG8 B;  3ZG9 B;  5TJJ A;  1NRF A;  3IF5 A;  4OPZ A;  3PBN A;  5DFY A;  2EA9 A;  2V9A A;  2PR6 A;  4G3K A;  1CI9 A;  2GNX A;  3A3J A;  2G2U A;  1VM1 A;  4ZTK A;  2PU2 A;  1CEG A;  3IF6 C;  4PM6 A;  4OLG A;  4B88 A;  4U0X A;  2B5R A;  2G2W A;  2IA2 A;  3VP0 A;  1OJG A;  3V5M A;  5HL6 A;  2Y2I A;  4R3J A;  4X25 A;  5DF7 A;  1XXM A;  4N92 A;  1OTI A;  3L9K A;  2VV8 A;  5HWV A;  3OBF A;  5FEG A;  3NI9 A;  4F94 A;  5IS1 A;  1LLB A;  3CHW P;  4XUX A;  5FQ9 A;  3BJN A;  5TGF A;  4KZ3 A;  4IJG A;  3H7W B;  4Y0O A;  4R1G A;  4OVD A;  4KUO A;  4OLD A;  5CX7 A;  2XF3 A;  2ZM0 A;  3UPP A;  1S1Z A;  1CI8 A;  3GTC A;  2WAD A;  3UMD A;  4Z9Q A;  1S66 L;  5DTS A;  2JKR I;  4S2I A;  1K54 C;  3E2K A;  2WKP A;  4KQQ A;  1FIL A;  4I38 A;  2W3D A;  2OLV A;  1CF0 A;  4FD8 A;  4YWZ A;  1N4O A;  5DTK A;  3BWL A;  3O5Y A;  5CGX A;  5CXW A;  2LB5 A;  2WK0 A;  4O0P A;  3WS2 A;  3NIA A;  2VLG A;  3B47 A;  3A0S A;  2A24 B;  4NXE A;  4QU3 A;  3TOI A;  4K91 A;  4RX2 A;  4EQ1 A;  3DWK A;  3LID A;  4FH2 A;  1IFQ A;  1ZKJ A;  1L0D A;  4DE2 A;  3VMA A;  2XRN A;  4WN5 A;  4YIN A;  3VFF A;  1IYP A;  1J3W A;  2AVX A;  2H0T A;  1VEU A;  4WZ5 A;  3IWI A;  1WYC A;  4Y0U A;  1BUL A;  1NRJ A;  5HFO A;  1Y28 A;  1GA9 A;  3G30 A;  1I5Q A;  4P6Z M;  3PBT A;  3RFB A;  4DDS A;  1KVL A;  2JC7 A;  3NDG A;  4UEY A;  3EGD C;  3LR0 A;  4IBR A;  2ZC3 B;  2P9V B;  2V1A A;  1SDE A;  3BFC A;  5E2F A;  4E3O A;  1T1C A;  3CPT A;  4PM9 A;  3QP6 A;  2VKS A;  3ICY A;  4MN6 A;  3QP1 A;  4KQR A;  3S1Y A;  4EQI A;  3UN7 A;  5CHM A;  2QZ6 A;  2OSU A;  1DJA A;  2WGV A;  2EXB A;  3BRM A;  3I7J A;  4ETZ A;  1XJ2 A;  3LIE A;  5HSQ A;  4NG2 A;  3D3O A;  4PAU A;  3MBZ A;  1PI5 A;  4LV2 A;  4YFM A;  4I3I A;  4WZ4 A;  4BBU A;  1RCJ A;  3HVF A;  4OPQ A;  2JKR M;  4DE0 A;  2PD8 A;  3OPL A;  5A8B A;  3PR6 A;  2HDQ A;  4ZBE A;  3H82 A;  3UPN A;  1BYW A;  3LFV A;  3IHA A;  3UDX A;  3K3D A;  5E2G A;  2OAQ 1;  4U0T A;  2O9C A;  2EX2 A;  3AGD A;  3IT9 A;  4LRZ E;  4PPR A;  4MNR A;  1KOU A;  5GLA A;  1NYM A;  1SKF A;  3ZHH A;  3Q07 A;  4GOG A;  2A2L A;  1E4D A;  1MKM A;  5J4E A;  3FV7 A;  4LV3 A;  4O7D A;  3SS5 A;  4LPZ A;  3R7W B;  2O9B A;  1KE3 A;  4O8G A;  2Y2H A;  2H5S A;  2K2N A;  3V67 A;  1FR6 A;  2O0Y A;  3IF6 A;  3TJZ C;  5CEC A;  1FOF A;  1NJ4 A;  4OPY A;  1BT5 A;  4GS9 A;  1NWZ A;  1TDL A;  2X01 A;  1ZG6 A;  5HPF A;  3ITA A;  3AGF A;  3CIT A;  3Q1F A;  3B3X A;  5FQI A;  4CLC D;  1MC0 A;  3DBA A;  3R4K A;  3LUQ A;  5EM0 A;  4HQA A;  1K56 D;  2K7S A;  4FCF A;  1FCM A;  1KGF A;  5EUA A;  3A3D A;  1ESI A;  4H6J A;  2W3G A;  1LL8 A;  4R70 A;  3PBQ A;  1S67 L;  2HPB A;  3KSF A;  2KX6 A;  3BQA A;  3Q7V A;  2E8J A;  2HP5 A;  2UWX A;  3S22 A;  1YM1 A;  4IED A;  4IBX A;  4U3T A;  4ZRR A;  3MF0 A;  1PWC A;  5EPH A;  5EVE A;  3HLE A;  1D06 A;  4RQ9 A;  4R0Q A;  5FAS A;  3UB6 A;  4AFI A;  4OQH A;  2P9V A;  5CHU A;  2D01 A;  3MQO A;  3TSG A;  1YT4 A;  2V1B A;  2Y2P A;  1WE4 A;  3MFX A;  4Q0H A;  3C4O A;  2RL3 A;  3SS4 A;  1FSW A;  3SS3 A;  3ZG7 B;  3MKE A;  3IXD A;  4QY6 A;  3LIB A;  1LI9 A;  3VSL A;  2OLU A;  3RJU A;  4ZJ3 A;  5A90 A;  2BTF P;  1U60 A;  2XLN A;  5E2H A;  4HJ4 A;  4P0M A;  2W1T A;  5F82 A;  3UB5 P;  1OTE A;  2JBF A;  1BTL A;  4C6Y A;  3QP5 A;  4OPR A;  3QP2 A;  2XH9 A;  4OOL A;  3DTK A;  1VET B;  3T4T A;  4WZ5 C;  3TW8 A;  1X0O A;  1NY0 A;  1HLU P;  4G3V A;  4FOF A;  2EX8 A;  1W8Y A;  3QP8 A;  3CWF A;  2J80 A;  1Z09 A;  3NBL A;  1T18 A;  2PT7 A;  4S2L A;  1STZ A;  1L0G A;  3MFD A;  4HJ3 A;  2NUT C;  5HWT A;  4GN2 A;  2UV0 E;  5GLD A;  2QPN A;  1LL5 A;  1Y54 A;  1SCW A;  4Y17 A;  4HH2 A;  2VX8 A;  2QJ5 A;  3SOI A;  4PHT A; 
#chains in the Genus database with same CATH homology
 5DJT A;  5TJJ A;  2VV6 A;  5HD5 A;  2GZA A;  3UE6 A;  3PBN A;  5DFY A;  3ZQ5 A;  1XFN A;  2EA9 A;  3RH8 B;  4DN0 A;  1G6O A;  1OTB A;  4GLQ A;  2V9A A;  2PR6 A;  4G3K A;  2O9A A;  2GNX A;  1MZU A;  5HZH A;  2PR5 A;  3EQV A;  1JNU A;  3JVU A;  3MQQ A;  4HOI A;  2GX5 A;  4L9E A;  2PYR A;  3EEA A;  2QYB A;  1P9R A;  3NHQ A;  2HF6 A;  1T1B A;  2M1C A;  3FG8 A;  4H6J B;  2IA2 A;  3MMH A;  1OJG A;  5HL6 A;  2VGL S;  3S7Q A;  1GSV A;  5AVF A;  2VV7 A;  3EEH A;  1YSQ A;  1DP6 A;  1OTI A;  2YKF A;  4Q0I A;  4MN5 A;  1XJ3 A;  2VV8 A;  5HWV A;  3OBF A;  3G6O A;  3GDI A;  4EUV A;  1S1Y A;  5IS1 A;  4QPR A;  3BJN A;  4EU0 A;  4IJG A;  2OWH A;  4NXF A;  3H7W B;  5HWW A;  4KUO A;  4I3A A;  5CX7 A;  4LRX C;  1S1Z A;  5IT5 A;  3OCL A;  2L0W A;  4I39 A;  4CLC B;  3PYP A;  3LIF A;  1UWP X;  4B9O A;  3UMD A;  1XJ4 A;  4HHD A;  1S66 L;  5HPI A;  2JKR I;  3EOI A;  2JN7 A;  1OT9 A;  4F3L B;  4EEP A;  2WKP A;  2NUP C;  5FL3 A;  2ZMF A;  3NOP C;  3MJQ A;  4I38 A;  2W3D A;  3UB8 A;  3CAX A;  3T4O A;  2FH5 A;  4JGO A;  4YWZ A;  2PHY A;  1ZTU A;  4KQD A;  3S7P A;  2VGL M;  4Y3I A;  2O99 A;  3MR0 A;  3BWL A;  3NJA A;  2I9V A;  3O5Y A;  1UGU A;  3F1P A;  3TRC A;  3S7O A;  4HP9 A;  1S4S A;  1H3Q A;  2L1M A;  2LB5 A;  4O0P A;  2B02 A;  4HP4 A;  2VLG A;  2W3E A;  2OAP 1;  3B47 A;  3A0S A;  1GSX A;  2A24 B;  4HY8 A;  1EW0 A;  1TD5 A;  4NXE A;  3UE3 A;  4EQ1 A;  2FZ0 A;  3LID A;  3ZYT A;  3KSH A;  1IFQ A;  2L4R A;  3PBO A;  4O01 A;  3OC2 A;  4K08 A;  2Z6D A;  3KSG A;  2G7U A;  1DP8 A;  1G28 A;  3U2A A;  4GW9 A;  1VB6 A;  4P6Z S;  2R78 A;  5KIZ A;  1GSW A;  2XRN A;  4WN5 A;  3W2Z A;  3E0Y A;  4G3W A;  3H9W A;  2QWS A;  3HJK A;  5IU1 A;  3LR5 A;  5TBM B;  3S7N A;  3OCN A;  1P0Z A;  4NKP A;  1LSV A;  1TF1 A;  5HDS A;  1OTA A;  4E04 A;  4NXB A;  3PXP A;  4R6L A;  1NRJ A;  5G4Y A;  2HJE A;  1YSP A;  1Y28 A;  4MDZ A;  2W3F A;  2OWJ A;  5EFW A;  1TS6 A;  3MQ0 A;  4KUK A;  1TS0 A;  4P6Z M;  3PBT A;  3RFB A;  3F1O B;  5DJU A;  4UEY A;  3EGD C;  1OPX A;  5F68 A;  4R38 A;  3LR0 A;  4YOF A;  5KSH A;  2V1A A;  2J3T C;  1T1C A;  1F9I A;  1NLY A;  3VE4 A;  1N9O A;  4MN7 A;  5J3W A;  2HGV A;  3IBR A;  2VKS A;  4YNR A;  3ICY A;  4FSF A;  4MN6 A;  1ODV A;  3IBJ A;  1W63 M;  2QHK A;  1T19 A;  3C2W A;  3FC7 A;  3ULF A;  1W63 Q;  2VJW A;  4WEL A;  4EXO A;  1F5M A;  4ETZ A;  1P9W A;  1XJ2 A;  3LIE A;  4L9G A;  5HSQ A;  2VA0 A;  3D3O A;  3B42 A;  4PAU A;  2J3T D;  4GCZ A;  4I3I A;  5C5K A;  4WLA A;  3LR4 A;  4BBU A;  4EER A;  4OOM A;  4BBV A;  4DMZ A;  2M7V A;  2JKR M;  3H7W A;  2HV1 A;  4IHQ A;  3HCY A;  2PD8 A;  3KYZ A;  5A8B A;  3PR6 A;  3VOL A;  1N9N A;  3E4O A;  3H82 A;  3KSI A;  3HJI A;  4DJ3 A;  1S4R A;  1BYW A;  3LFV A;  4IUK A;  4Y5F A;  3K3D A;  2OAQ 1;  3E4P A;  4EEU A;  2O9C A;  4JGR A;  2W27 A;  3IS2 A;  4ME4 A;  1TS7 A;  2P7J A;  3BY9 A;  4HH3 A;  4LRZ E;  4MMN A;  1KOU A;  4WEJ A;  2HJ9 C;  2P08 A;  4BBT A;  4F3L A;  4WEK A;  1LSX A;  4EW7 A;  4R3A A;  3KX0 X;  3LYX A;  2QKP A;  2VEA A;  3GEC A;  2ZBB A;  3UME A;  2A2L A;  2KLI A;  1T1A A;  3B33 A;  3EQU A;  2W3H A;  1DP9 A;  5AVE A;  5I5L A;  1MKM A;  1YKD A;  5J4E A;  3FPW A;  3NOU C;  2W1R A;  4JGQ A;  4LPZ A;  4DJ2 A;  3T4K A;  2PDR A;  3T50 A;  3R7W B;  4CLC E;  2XA7 M;  2O9B A;  2Y8H A;  4WL9 A;  3UB7 A;  2PD7 A;  3A0R A;  2J3W A;  4O8G A;  2M7U A;  1F98 A;  3LIC A;  3VV4 A;  3TE8 A;  2K2N A;  4KQO A;  3V67 A;  3CUE C;  2O0Y A;  3OLO A;  1OJ5 A;  1ZHH B;  2INW A;  3TJZ C;  2ZOH A;  2H28 A;  4LRY C;  4GS9 A;  3D72 A;  3P01 A;  1NWZ A;  5HDC A;  4UQI S;  5HPF A;  3CIT A;  2JKT I;  2WKQ A;  3C38 A;  4EES A;  4II7 A;  4M4X A;  1XJ6 A;  1YAX A;  3CUE A;  5LBR A;  4CLC D;  1MC0 A;  3DBA A;  4HIA A;  3R4K A;  5TBM A;  3LUQ A;  1DRM A;  2LB9 A;  4HQA A;  2K7S A;  2ZOI A;  4H6J A;  4NXG A;  2XA7 S;  2W3G A;  1IOU A;  3BW6 A;  1VHM A;  5DKK A;  3BY8 A;  1LL8 A;  4I5S A;  4R70 A;  3MXQ A;  3PBQ A;  1S67 L;  3RTY A;  2XRO A;  3KSF A;  1V9Y A;  1LSW A;  2KX6 A;  1OTD A;  3BQA A;  2QJ7 A;  3BQ8 A;  2A24 A;  5K5B A;  4XT2 A;  4ARZ A;  3FPV A;  1WA9 A;  3KO6 A;  3R7W A;  4ZRR A;  3MF0 A;  3T4Q A;  2KDK A;  4JGP A;  3H82 B;  5DFX A;  4I3J A;  3F1N B;  2GJ3 A;  1D06 A;  4EET B;  3PHY A;  4RQ9 A;  4GJ4 A;  5DKL A;  3EWK A;  3UB6 A;  4AFI A;  2OOL A;  2D01 A;  3MQO A;  1OT6 A;  1LT0 A;  2V1B A;  2KOI A;  3MFX A;  4Q0H A;  1UWN X;  2B18 A;  4Q0J A;  5HD3 A;  1V9Z A;  2DMW A;  5F69 A;  2EWW A;  4MCW A;  2D02 A;  3LIB A;  4LLO B;  3UB9 A;  3K3C A;  5AJG A;  4L9F A;  3E4Q A;  3VE3 A;  2PYP A;  3IS2 B;  1XFQ A;  4UQI M;  1NLZ A;  1TS8 A;  3E98 A;  5MC7 A;  4HJ4 A;  2P04 A;  4HI4 A;  4PKY A;  4CLC C;  3CLO A;  3K2N A;  4Z1W A;  5DF9 A;  3EGX C;  3JVV A;  2W1T A;  3T4S A;  4ETX A;  3LR3 A;  1OTE A;  4Y2F A;  2V0W A;  4XT2 B;  4ARZ B;  4GS9 B;  3OOV A;  4B93 A;  2V0U A;  3C8C A;  3LIA A;  4L0L A;  5HDD A;  4OOL A;  5F6A A;  2JHE A;  3T4T A;  3F1N A;  4CLC A;  3F1O A;  2WKR A;  2EWV A;  3LI9 A;  3TW8 A;  1X0O A;  3PBS A;  4G3V A;  4FOF A;  2ZMV A;  4HJ6 A;  3CWF A;  2J80 A;  2YKH A;  3T4L A;  4BJP A;  4CQH A;  1H8M A;  2VZW A;  3CI6 A;  1D7E A;  4PKY G;  5F5Y A;  4IUH A;  3NOT C;  4BWI A;  3P7N A;  4WF0 A;  1T18 A;  2PT7 A;  5G4Z A;  1STZ A;  2XSS A;  3PBR A;  4GHI A;  2MJ6 A;  4HJ3 A;  2NUT C;  5HWT A;  1P97 A;  1N9L A;  5L8M A;  3T4J A;  3F1P B;  2Z6C A;  3KYQ A;  4GHI B;  3SW1 A;  3A0V A;  3C30 A;  2BAS A;  2W1T B;  2CMN A;  2K31 A;  2W0N A;  4BMW A;  3LI8 A;  2JKT M;  4NEE D;  4WUJ A;  4HH2 A;  2VX8 A;  2QJ5 A;  4HNB A;  5J7E A;  4PHT A;  2Y79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...