3ULFA

The light state structure of the blue-light photoreceptor aureochrome1 lov
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
135
structure length
135
Chain Sequence
EDPDYSLVKALQMAQQNFVITDASLPDNPIVYASRGFLTLTGYSLDQILGRNCRFLQGPETDPRAVDKIRNAITKGVDTSVCLLNYRQDGTTFWNLFFVAGLRDSKGNIVNYVGVQSKVSEDYAKLLVNEQNIEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aureochrome1
publication title Crystal structures of Aureochrome1 LOV suggest new design strategies for optogenetics.
pubmed doi rcsb
source organism Vaucheria frigida
molecule tags Signaling protein
total genus 43
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3ulfA00
5J4EA 3H7WB 5F6AA 1V9ZA 1TS0A 4NXEA 3GECA 2YKHA 3MFXA 2CMNA 4L9GA 1JNUA 3CWFA 3F1PB 5TBMB 3K3DA 2W27A 1N9OA 4MN5A 2PDRA 2PR5A 3VE4A 1G28A 3LIAA 1OT6A 4LLOB 1LT0A 1MZUA 4XT2A 3LIEA 1EW0A 1LSWA 3UB8A 3K3CA 3IBRA 1T18A 4LPZA 4PKYG 2VLGA 4WLAA 2WKRA 3T50A 4K08A 2L4RA 3NOUC 3RH8B 1UWPX 2HV1A 3ICYA 4DJ3A 4HHDA 3IS2A 2R78A 5F5YA 1XFQA 4HP9A 1TS6A 2L0WA 1X0OA 2VV8A 1T19A 4GS9B 1WA9A 3H82B 3F1OB 3F1OA 1DP9A 4HJ6A 4EEUA 4EERA 4GHIA 3UB7A 3A0SA 3KX0X 4F3LB 1TS8A 4MN6A 4R6LA 3VOLA 1DP8A 5IS1A 2QJ5A 3UMEA 2ZOIA 1T1BA 2QJ7A 4WF0A 4E04A 4HH2A 4KQDA 2JHEA 3EWKA 2PD8A 5HDDA 4EW7A 3H9WA 3LI9A 3LUQA 3HJIA 4HP4A 4H6JA 2M1CA 3H7WA 4HJ3A 4JGQA 3LIDA 4EETB 5AVFA 4HI4A 2A24B 4JGOA 3CLOA 3F1PA 5TBMA 3C8CA 1VB6A 1GSXA 2P7JA 4I3AA 4HIAA 1OTEA 1OTIA 2D02A 4B9OA 2BASA 1N9NA 4JGRA 5HWVA 2EA9A 3E4QA 3BY8A 1D06A 2OOLA 2WKPA 1XJ3A 3OLOA 2ZOHA 1GSWA 4I39A 4GCZA 1OT9A 5HWTA 4L9FA 1N9LA 5DKLA 4BBUA 1KOUA 2INWA 3MJQA 2W0NA 2H28A 1P97A 2OWHA 1D7EA 2V0WA 5IU1A 1LSXA 5EFWA 4WL9A 3RTYA 3UE6A 1V9YA 3MQOA 4EEPA 2I9VA 4EQ1A 3MXQA 4KUKA 2GJ3A 3NOPC 3CAXA 1UGUA 3NJAA 3NHQA 4GS9A 3H82A 5F69A 1LSVA 1F9IA 3LYXA 4NXFA 5I5LA 1LL8A 1XJ2A 2VV6A 1GSVA 1XJ6A 1Y28A 4F3LA 1NWZA 5J7EA 2WKQA 5HDCA 5HD3A 2YKFA 2Z6CA 4HNBA 1OJGA 1BYWA 3A0RA 2QKPA 2L1MA 4YWZA 1S4RA 1OTAA 4NXBA 1XFNA 5KIZA 5DJUA 1OJ5A 4LRYC 5HWWA 2KDKA 2V9AA 3G6OA 3UB9A 2B02A 1T1AA 4R3AA 1P0ZA 3BY9A 2A24A 4WN5A 4KUOA 5G4ZA 5F68A 3SW1A 5HDSA 1S66L 1T1CA 5A8BA 4I3JA 2PYRA 5HSQA 3ZQ5A 4HY8A 3MQQA 2JN7A 3NOTC 1S67L 1DP6A 4HJ4A 4R70A 3UB6A 1F98A 2V0UA 4JGPA 4XT2B 3BWLA 3C2WA 4GW9A 4M4XA 4DJ2A 3FC7A 2KX6A 3EEHA 4HH3A 4NXGA 3GDIA 3A0VA 3F1NB 1UWNX 2VEAA 3F1NA 1TS7A 4I3IA 2PR6A 4HOIA 3IS2B 1S1YA 3MR0A 2QWSA 4R38A 1DRMA 3B33A 4EESA 4PKYA 4LRXC 3LIFA 2Z6DA 3VE3A 5AVEA 3E4PA 3PYPA 2K7SA 4LRZE 2PHYA 3ULFA 3LI8A 5HZHA 5DJTA 5G4YA 2J80A 1OTDA 4I5SA 2VV7A 1ODVA 4GHIB 4BBVA 2PYPA 1S1ZA 3D72A 2PD7A 2QHKA 5DKKA 5J3WA 4EXOA 2OWJA 4L9EA 3LICA 3LIBA 4BBTA 1OTBA 3P7NA 2ZBBA 4WUJA 3PHYA 2V1AA 4HQAA 4I38A 2V1BA 3FG8A 2D01A 3E4OA 1S4SA 1XJ4A 3HJKA 3UMDA 5HD5A 4RQ9A 4H6JB
chains in the Genus database with same CATH superfamily
3DTEA 2YKHA 1CEFA 3MFXA 2CMNA 1NYYA 2ZQCA 5TBMB 3K3DA 1FILA 1VHMA 3O5YA 5E2HA 3OPLA 3LGOA 3W4PA 1NZUA 4JF4A 3B3XA 1G28A 4PM7A 4WBGA 5AQ7A 4KZ9A 5FQ9A 1STZA 3LIEA 3UB8A 4EBPA 2H10A 1PI5A 2W3GA 1Q2PA 5U47A 2VK3A 3ZG7B 3A3FA 4LPZA 4S2PA 5M18A 4UEYA 3UB5P 3C7VA 1Y54A 2ZC5B 4FOFA 4XXRA 2KLIA 4BD1A 3FKWA 2R78A 5F5YA 1XFQA 4HP9A 4RX2A 3BFCA 1LHYA 3GR2A 2FH5A 4DDYA 4GS9B 1PI4A 1T19A 1WA9A 2DCFA 3F1OA 1MY8A 3UB7A 4HEFA 5CGSA 3Q7VA 3KSFA 5DTSA 5GLAA 4HBUA 4MN6A 3VOLA 5IS1A 2QJ5A 3AGEA 2V1ZA 4U0TA 3N6IA 1K56A 3TRCA 1H8YA 2QJ7A 3NIAA 5HDDA 1EWZA 4EW7A 3BEBA 4DMZA 3GQZA 4HP4A 4FCFA 3HLWA 5GLCA 4HJ3A 2H5SA 3OBFA 4QD4A 3T4OA 4A5RA 5AVFA 1K55C 4N9KA 2V2FF 3IXHA 4JGOA 4UQIS 4WZ5C 4LFUA 1GSXA 5F1FA 4ZJ2A 2JKTI 4EU0A 5CHUA 3T4SA 3HLGA 4CLCD 1CF0A 3N7WA 1NZOA 1YLTA 3BLMA 1N9NA 4Q0HA 4JGRA 5FASA 1XGJA 3IXBA 3MFDA 3W8KA 3ZGAB 2WKPA 5FDSA 3LR0A 3T4JA 3VP2A 3C4OA 4GCZA 1G6OA 4S2MA 4BJPA 1NLZA 3IHAA 2B5RA 5KSCA 1N9LA 1GA0A 1VEUB 2INWA 2ZMVA 5FQJA 2WGWB 2OWHA 1C3BA 1FSYA 5A92A 2RL3A 3BFDA 2ZM8A 5EFWA 4UAAA 3QNBA 1IELA 3OCLA 4GD8A 1FR6A 1K57C 1H3QA 1MPLA 2X71A 2VX8A 4CLCB 1VETB 3CJMA 3ZG5A 2PAVP 4LV0A 2EXAA 2I9VA 2O9CA 1W5DA 3MXQA 4X55A 5L2FA 3O3VA 2LB9A 3NJAA 5HAQA 1GA9A 4MNRA 5CTNA 3UNWA 3LYXA 2P08A 5LBRA 1NWZA 1P9RA 3D3OA 2QZ6A 4KZ5A 5EOOA 2X01A 5HDCA 3VP3A 2W3HA 3VV4A 4IEDA 1YT4A 3C30A 5GHYA 4X68A 1Z6FA 1GCEA 4R1GA 2C6WB 4NKPA 5DTKA 2J3TD 5JYOA 2L1MA 4IBRA 3VP4A 2AVXA 1BULA 2Y2QA 1JWPA 3CPTB 1ZTUA 5KIZA 4LRYC 3EQUA 1L3LA 4CLCE 5HWWA 4ETXA 3SH8A 3E2LA 1T1AA 4EBNA 1FSWA 2A24A 4X25A 1L2SA 4OQ0A 1WYBA 4PHTA 4WM9A 2CC1A 2XFSA 2Q9NA 4E6XA 3ZCZA 1T1CA 3DAVA 3HL9A 4LV1A 5A8BA 3FZCA 2WKEA 4B93A 1W63Q 3ZQ5A 3DTKA 4OOLA 3NOTC 5BOHA 2HP6A 4HJ4A 3UB6A 1G5UA 5CHJA 4IUHA 2IA2A 3M6BA 1N9BA 2V0UA 3MXRA 3QHYA 1KE4A 1TF1A 4IBXA 1ONHA 3ITAA 4QU3A 4Y13A 2V20A 5EUAA 4DJ2A 5FAOA 1NYMA 3EEHA 4HH3A 3MF0A 3PBSA 3S7OA 1D1JA 1TDLA 5A93A 4Y17A 1YLPA 2J3WA 1Z09A 3F1NA 4D2OA 2ZC4B 3L9KA 3Q82A 4HOIA 5HAIA 4CLCC 1IEMA 3ZDJA 1S1YA 3T4QA 2QWSA 4U3TA 5FSRA 2XROA 3SS5A 3MQ0A 3O86A 1NJ4A 3T12B 1SZVA 2EFUA 3LEQA 3QP5A 2XFTA 3DTMA 4H8RA 5L07A 5DF8A 3GV9A 5DJTA 5G4YA 3IWOA 3HVFA 1OTDA 3MBZA 1DY6A 3IF6B 1XXMA 1GHMA 2DMWA 4BLMA 2BG1A 2JE5A 3HLBA 2QHKA 3Q7VB 4IVKA 4QB8A 4Y7PA 1JTGA 1HD8A 2OLUA 3LICA 2JKTM 3VFHA 3WS1A 3WRTA 3G32A 5KZHA 4ID4A 5CEDA 4HQAA 1RP5A 3ZG8B 3FG8A 1I2SA 5C5KA 1E3UD 3RFBA 3LY3A 4YINA 1ES5A 3HJKA 4UA7A 3UMDA 4E3OA 4N1XA 4RQ9A 2JCHA 5F6AA 1G6AA 3KYQA 5TFQA 1CI9A 1KGGA 1YKDA 3UN7A 4G3VA 3TSGA 2HP5A 3MMHA 3CHWP 5FQMA 1WE4A 3T4TA 5F1GA 3VE4A 3ZVTA 2PBYA 1SKOA 1NRJA 3FV7A 2GDNA 4LLOB 1N4OA 1PWDA 4XT2A 1NY0A 3UPOA 4S2LA 5FATA 2EX9A 2O0YA 4MEZA 2XK1A 2ZC3B 1T18A 3NBLA 3T4LA 4OKPA 3PR6A 4K08A 4MMNA 1GHPA 1IFQA 1UWPX 2HV1A 4BWIA 3ICYA 1IYOA 2R9XA 4YNRA 1U60A 4R3BA 3K2NA 1TEMA 4AFIA 3ZNTA 3UE0A 5M19A 2OAP1 1PW1A 1K6RA 3OPRA 4ZAMA 1RGZA 5CEBA 3G35A 1X0OA 2QMIA 3CMZA 1W8YA 2HPBA 1L0EA 2XRNA 3SH7A 4EEUA 4U0XA 2P04A 1I2WA 3KX0X 5EPHA 1K38A 1SHVA 2H0YA 1L0GA 3TOIA 1TS8A 4ARZB 1EI5A 1ES3A 3PXPA 3UMEA 2ZOIA 3HUOA 4S2IA 3B42A 3HREA 5CERA 1LLBA 3MS6A 2W1TA 4HH2A 4K0WA 4KQDA 4QJGA 3EWKA 2PU2A 2IWBA 3H9WA 3GTCA 4ETZA 5HW3A 3LUQA 4ZDXA 1E25A 2M1CA 3H7WA 1L0DA 4PM8A 3JYIA 2JKGA 3LIDA 5HPFA 3M2KA 5DFXA 1YSPA 3IBJA 3L7HA 2A24B 1J9MA 3F1PA 2ZL1B 3RJUA 4WEKA 2VGLM 1FOFA 1K54C 1LI9A 3NECA 3MZDA 1OMEA 2D02A 4R0QA 2BASA 2EA9A 3FPWA 3PAGA 4RX3A 3NY4A 4O0PA 4DRTA 3PBOA 3PBRA 3IHBA 3FYZA 4I39A 1EROA 4OONA 3DWKA 2VJWA 3UO9A 4L9FA 4KQOA 5DKLA 4BBUA 1KOUA 2MJ6A 4FSFA 5CECA 2W0NA 2H28A 2E8IA 1D7EA 5IU1A 1LSXA 4KG5A 4N92A 4WL9A 5CRFA 3CZDA 4Q0IA 5IHVA 2XF3A 2WUQA 3MQOA 4WYYA 2KOIA 3DTIA 1W63M 2XDMA 5K5BA 5TR7A 2P9VA 3CAXA 3NHQA 2HDQA 5CGXA 1SDNA 5F69A 4R3JA 3UE3A 4CPKA 4MDZA 5I5LA 3UDIA 2VV6A 3VSLA 4F3LA 2EWWA 2ZMFA 4P6ZS 4FD8A 4XUXA 3ZFZA 3P09A 1OJGA 4DKIA 1PRQA 3G2YA 5I94A 4EUZA 2HF6A 3LCEA 5CTMA 2QYBA 1XA1A 3CUEA 2HJ9C 4YWZA 1OTAA 3M2JA 4E6WA 2P74A 1PWGA 5EV0A 3JVVA 2Y2OA 3Q07A 2BTFP 2FZ0A 3UB9A 2FFFB 4R3AA 1P0ZA 3KO6A 2G2WA 3HUMA 3EQVA 1A0KA 2R9WA 1S66L 4RYEA 1H8ZA 1HLUP 4I3JA 3RXWA 4D60A 2JKFA 5E2EA 3BRMA 3QP8A 1E3UA 3HLDA 3GMWA 4E3NA 3BW6A 5FI6A 1F98A 1SKOB 5KMWA 4XT2B 3TW8A 1FR1A 2OSUA 3MZFA 1GHIA 5FEFA 3LR5A 3FC7A 4KZBA 4NXGA 3VMAA 1S6RA 2XA7S 5HX9A 3KSIA 3S7NA 2WAFA 4OOYA 2WGVA 2VEAA 1TS7A 4I3IA 1P9WA 2PR6A 4Q8IA 5KSHA 1DJAA 2VKSA 3IT9A 2Y91A 4R4SA 1YMXA 4EESA 4NK3A 4PKYA 4LRXC 3LIFA 4KZ7A 3P01A 1KVMA 1ESUA 5GL9A 5AVEA 4K0XA 4DN0A 4LRZE 3BYDA 4I5SA 1ODVA 2PYPA 3D72A 3U4LP 5L09A 1H5XA 3MSHA 4BBTA 2JBFA 2J9OA 2M7UA 1F5MA 3MZEA 2V8CA 3PHYA 1CK3A 4Y0OA 4PM5A 2XQZA 4QWOA 1MKMA 1JVJA 1XGIA 2V1BA 5EM0A 3KYZA 2IWDA 2ZQDA 3O87A 3E4OA 3HUNA 3VOZA 3LFVA 1XJ4A 2W3EA 4EWFA 3IX3A 4JXVA 4KZ4A 5IT5A 1QMEA 2LB5A 4P87A 1PFLA 4UHUA 3VOYA 2HZ5A 1ZKJA 2ZC6B 3H7WB 4NXEA 3G2ZA 2C5WB 1YMSA 4X1MA 3Q1FA 3BJNA 5F82A 3D9YA 4BD0A 3CWFA 3F1PB 3P98A 1ERMA 4MN5A 1O07A 4GNUA 2Y2MA 4QHCA 2HJEA 3NCKA 2PDRA 4GB7A 1DJBA 1KVLA 4N1HA 5GLDA 1PNEA 5HL6A 5AQ9A 4OPRA 4UQIM 1QMFA 1MZUA 2WGIA 5EVID 4BQMA 4MBHA 4X6TA 3LO7A 4MBKA 2PRFA 1MBLA 4BL2A 2Q9MA 5HPIA 2DRWA 2VLGA 4WLAA 2WKRA 3T50A 1NXYA 3PTEA 2HDSA 3NOUC 3V67A 4O7DA 3UDXA 2HDUA 1XX2A 3AGDA 3ITBA 3FWLA 4DJ3A 4KENB 3IS2A 4PPRA 3R4KA 1TS6A 4FTXA 1PIOA 5FEGA 4OPQA 2P9VB 2UWXA 3UDFA 2VV8A 2XA7M 1KE3A 3F1OB 5EVEA 3DW0A 4EERA 4GHIA 3A0SA 4WMCD 4DF6A 4F3LB 3G4PA 3ZG9B 3DWZA 2EX6A 4R6LA 1RCJA 2X02A 1YLYA 4Z1WA 3IWQA 4RVAA 1BLHA 1T1BA 5FAPA 4LV3A 2Y2IA 2WZZA 4JLFA 4WELA 4WF0A 4E04A 2JHEA 2VZWA 5DF7A 1TD5A 4OH0A 3NI9A 3LI9A 3N8LA 5DTTA 1TDGA 3OOVA 1ZG6A 4P6BA 3PBQA 4BMWA 4JGQA 2J7VA 4EETB 4II7A 3RXXA 2VGJA 1W7FA 4HI4A 4JPMA 4PAUA 4XUZA 3UPNA 1FQGA 1BLCA 4KQQA 3EGXC 1YLWA 4H6JB 4PM6A 4I3AA 4HIAA 1OTEA 1KE0A 1TVFA 3OPHA 2J3TC 3KYEA 3EGDC 4B9OA 4S2OA 2ZD8A 5E43A 3DBAA 1K0KA 5HWVA 3E4QA 3NDGA 3BY8A 1D06A 3HLEA 3Q7ZA 3LR3A 1FCOA 2RCXA 1BZAA 5FI7A 4QY6A 1GSWA 1MC0A 1K4FA 2H0TA 4KG6A 3HCYA 5FI2A 2Y2LA 1OT9A 1ALQA 5HWTA 5DF9A 1IYPA 2FFYA 5FA7A 3IQAA 2EXBA 4E3KA 3MXSA 2E8JA 2ZC7A 1MXOA 3IXDA 1P97A 3A3IA 2V0WA 1KGEA 4X69A 5JYPA 1XP4A 1NLYA 2K2NA 4ME4A 5HARA 3RTYA 4O8GA 3UE6A 4E3IA 2Y2NA 5GHXA 4GZBA 1W8QA 4KUKA 3HBRA 4KZ6A 2GJ3A 5F83A 3A3DA 3A3EA 3H82A 2ZMAA 1LSVA 1LL8A 4Y3IA 1XJ2A 4N9LA 4KZ3A 1XJ6A 3EOIA 3N4IA 1YQSA 4EBLA 2Y8HA 3QP6A 5HD3A 2K31A 4OLGA 2Z6CA 3VP0A 3SZTA 5E2GA 5AQAA 5AQBA 4EUVA 4FH2A 4NETA 3ISGA 3UPPA 1LI0A 4YOFA 3A0RA 5D3OA 2QKPA 5CX7A 2EWVA 3T1RA 5DFYA 1RGYA 4QPRA 1S4RA 3GSGA 3IX8A 5DJUA 2XD5A 3MKEA 3CUEC 1XKZA 4OQGA 4G3WA 4DE2A 1FCMA 3IWIA 2Y79A 5CXWA 4PMAA 3BLSA 4KUOA 5G4ZA 1JTDA 5F68A 3A3JA 3UY6A 5HDSA 4BENA 4CQHA 4JXSA 4Z9QA 5EVLA 2JC7A 1K4EA 3AGFA 2Q0OA 3IH9A 2JN7A 1AWIA 1S67L 3QP1A 2B95A 3Q81A 1CJFA 2Y4AA 1XA7A 4GKUA 4KZ8A 3T4KA 5FQQA 2UV0E 4LGWA 2Y59A 3WS0A 4YFMA 1J3WA 4K91A 1ESIA 1CI8A 4JF5A 3V3RA 2OLVA 1L0FA 3GDIA 3TE8A 2XR0A 4DXCA 5HAPA 2Y2PA 4DXBA 3V3SA 3F1NB 1M6KA 4WZ4A 3BQAA 2Y2JA 4QY5A 2A49A 5EVIA 2W3DA 3IS2B 4O01A 2WAEA 1DRMA 3B33A 5EECA 3N8SA 3C38A 1HTZA 4EQIA 4OVDA 3VE3A 5CGWA 3E4PA 2ZQ7A 2PT7A 1NRFA 2PHYA 3ULFA 5HZHA 2XSSA 2J80A 2GZAA 4BL3A 2VV7A 5HL1A 4JKTA 4GHIB 3QNCA 4BBVA 1S1ZA 3IF6A 2I72A 4OQHA 3TG9A 5EE8A 1CEGA 5J3WA 4S2NA 2OWJA 2WADA 4EXOA 4L9EA 1KDWA 3LIBA 1ZG4A 3P7NA 1BUEA 2JKRI 2Y2GA 1YSQA 4G3KA 4C75A 2VA0A 4DE3A 1F2KA 4FUWA 1S4SA 3EEAA 2ZLYA 5AJGA 2XGNA 4WMCA 5A91A 4UA9A 1AXBA 5J4EA 1W79A 1V9ZA 1TS0A 3C5AA 3GECA 4IUKA 4OP5A 1PYYA 1SCWA 4ZJ3A 4L9GA 4C3QA 4Y5FA 1HVBA 1JNUA 1KGFA 2W27A 1H0MA 3VP1A 1N9OA 4P0MA 1K54A 3R7WA 1Q2QA 4MN7A 2PR5A 4GOGA 1WYCA 5GLBA 1E4DA 1VQQA 2GNXA 3LIAA 1OT6A 2OV5A 1SDEA 1LT0A 3CG5A 2M7VA 3BQ8A 3W4OA 1EW0A 1LSWA 3K3CA 3IBRA 1MWSA 5FQIA 4OOMA 4LENA 4PKYG 5HFOA 4X53A 2EX2A 3HLFA 3NC8A 4OPZA 2L4RA 1BLPA 3RH8B 1IYQA 3HLCA 4MBFA 3UE1A 4HHDA 4MCWA 4B88A 3V39A 3JPUA 2OAQ1 5DVAA 3VSKA 1PZOA 4Y0UA 2V8FA 2L0WA 3H82B 3FKVA 1DP9A 3LY4A 1ES2A 1YAXA 2VGKA 2WKHA 4B4ZA 4HJ6A 5EM1A 4OLDA 4ZBEA 4OQIA 2IWCA 1KDSA 4ARZA 3B47A 3QP2A 1DP8A 4B4XA 2O99A 1ONGA 2WZXA 3WS4A 2W1TB 3E0YA 2XD1A 3IXGA 2XH9A 1IOUA 1XPBA 2PD8A 3E2KA 2GX5A 4P6ZM 1ES4A 3G31A 4ZTKA 2WYXA 1BTLA 2G2UA 3HJIA 4H6JA 1IYSA 5A90A 5M1AA 1K55A 1ERQA 4JBFA 4WZ5A 4DDSA 3IH8A 2EX8A 4R23A 1MWTA 2PU4A 3CLOA 5TBMA 4E3LA 3BFGA 4OP8A 3C8CA 1VB6A 4S2KA 2ZL1A 2P7JA 3S4XA 3W2ZA 2DNSA 1OTIA 1MWRA 2OOLA 1XJ3A 4DE0A 1MWUA 1O7EA 2J8YA 3OLOA 4Y15A 2ZOHA 4ESPA 3S1YA 2B18A 3GVBA 1YLJA 2XEPA 1PW8A 4S2JA 3V50A 4JF6A 2G7UA 4UA6A 3BFFA 3BM6A 2BLSA 3MJQA 3U2AA 1G68A 3M6HA 4Q0JA 2QPNA 4MLLA 4GJ4A 3WS5A 1K57A 1V9YA 5FDHA 3ZYTA 4EEPA 1FCNA 1IKGA 1FIKA 3T1SA 2JKRM 4EQ1A 4Y2FA 5EVIB 3W4QA 3NOPC 3FPVA 4GDBA 1Y4OA 2ACGA 1K56D 1UGUA 4GS9A 2ZQ8A 3G30A 1K25A 4E3JA 1F9IA 1M40A 4NXFA 3S22A 2WKIA 3VFFA 3PBTA 4ZJ1A 1GSVA 4L0LA 1Y28A 4FH4A 2Z2LB 4OPYA 5J7EA 3I7JA 2WKQA 5FL3A 2YKFA 3S7PA 4HNBA 5J8XA 1IKIA 2NUPC 1JWZA 2PBDP 4WEJA 3BFEA 1PZPA 1BYWA 4CJNA 2Y2KA 1HZOA 3C4PA 4X56A 3NULA 4GDNA 1OPXA 3MKFA 2A3UA 4IVIA 5G18A 1ZC2A 3N8RA 3OPPA 1LL9A 3ZHHA 4KG2A 4NXBA 1XFNA 2ZQ9A 1OJ5A 3SH9A 4Y0TA 4HESA 4IHQA 3D4FA 4LCMA 3WS2A 2KDKA 4GD6A 2V9AA 2VGLS 3G6OA 2B02A 4ZRRA 3S7QA 3BY9A 4WN5A 2ZJ9A 1BLSA 1H8MA 3SW1A 1S0WA 3GRJA 3JVUA 3E98A 4C6YA 1BT5A 1BSGA 2ZQAA 4PM9A 2PYRA 3T1QB 5HSQA 2XLNA 4HY8A 3R7WB 3MQQA 1PWCA 2HP9A 3PAEA 2W1RA 2HDRA 1DP6A 1ACFA 3IF5A 4GLQA 3CITA 4GN2A 4R70A 4R4RA 3BECA 3T1XA 2O9BA 4JGPA 4X1LA 3OC2A 2Z2MB 1VEUA 1YPRA 1YLZA 3BWLA 5TGFA 3PBNA 5TJJA 5FQKA 3C7UA 2Y55A 2WGWA 3C2WA 4P85A 4GW9A 4M4XA 2KX6A 4KZAA 3SS3A 4JXWA 3G34A 4IJGA 3ZVWA 2Y2HA 3A0VA 3SS4A 3LR4A 2O9AA 1SKFA 4CLCA 1CQAA 5L10A 4NEED 1VETA 1UWNX 4E3MA 4HBTA 4RA7A 4DE1A 3OCNA 3CI6A 1K6SA 5GHZA 3MR0A 5EVIC 4R38A 1MKIA 3KSGA 4F94A 2Z6DA 5L8MA 3ZNYA 5MC7A 1DJCA 3OZHA 3WRZA 3O88A 3QP4A 3PYPA 2K7SA 1VM1A 3WWXA 1ZHHB 4EV4A 3IX4A 3LI8A 2W3FA 4LV2A 3V5MA 1I5QA 2J9PA 2PD7A 5EOEA 3TJZC 5DKKA 1LL5A 4NG2A 4M3KA 3IF6C 3KSHA 1OTBA 2EFXA 2ZM0A 2ZBBA 3CPTA 4WUJA 4S2NC 2HGVA 1YM1A 2A2LA 2V1AA 5E2FA 3ZG0A 3LEZA 2WK0A 4I38A 2D01A 4KQRA 3NDEA 1JWVA 2NUTC 4LCLA 5FAQA 5HD5A 3SOIA 5CHMA 2ZM2A 4JXGA
chains in the Genus database with same CATH topology
5J4EA 3H7WB 5F6AA 1V9ZA 1TS0A 4NXEA 3GECA 2YKHA 3KYQA 4IUKA 3MFXA 2CMNA 1YKDA 4L9GA 3BJNA 4G3VA 4Y5FA 1JNUA 3CWFA 3F1PB 5TBMB 3K3DA 2W27A 1VHMA 3MMHA 3O5YA 1N9OA 4MN5A 3R7WA 2HJEA 4MN7A 2PDRA 2PR5A 3T4TA 5HL6A 3VE4A 1G28A 2GNXA 3LIAA 1OT6A 4UQIM 1NRJA 4LLOB 1LT0A 2M7VA 1MZUA 1STZA 4XT2A 3BQ8A 2O0YA 3LIEA 1EW0A 1LSWA 3UB8A 3K3CA 2W3GA 3IBRA 5HPIA 4OOMA 1T18A 4LPZA 3T4LA 4PKYG 2VLGA 4WLAA 2WKRA 3T50A 3PR6A 4K08A 4UEYA 4MMNA 2L4RA 3NOUC 1IFQA 3V67A 3RH8B 1UWPX 2HV1A 4BWIA 3ICYA 4YNRA 4FOFA 3K2NA 4AFIA 4DJ3A 4HHDA 2KLIA 4MCWA 3IS2A 2OAP1 2R78A 5F5YA 1XFQA 2OAQ1 3R4KA 4HP9A 1TS6A 2FH5A 2L0WA 1X0OA 2VV8A 1T19A 4GS9B 2XA7M 1WA9A 3H82B 3F1OB 3F1OA 1DP9A 1YAXA 2XRNA 4HJ6A 4EEUA 4EERA 4GHIA 3UB7A 3A0SA 2P04A 3KX0X 4F3LB 1TS8A 4ARZB 3KSFA 4ARZA 3B47A 4MN6A 4R6LA 3PXPA 3VOLA 1DP8A 4Z1WA 2O99A 2QJ5A 3UMEA 5IS1A 2ZOIA 1T1BA 3B42A 2W1TB 3E0YA 4WELA 3TRCA 2QJ7A 2W1TA 4WF0A 4E04A 4HH2A 4KQDA 2JHEA 3EWKA 1IOUA 2PD8A 2VZWA 5HDDA 2GX5A 4P6ZM 1TD5A 4EW7A 3H9WA 4ETZA 3LI9A 3LUQA 3HJIA 4DMZA 3OOVA 4HP4A 4H6JA 2M1CA 3H7WA 4HJ3A 3PBQA 4BMWA 3OBFA 4JGQA 3LIDA 3T4OA 5HPFA 4EETB 5DFXA 4II7A 5AVFA 1YSPA 3IBJA 4HI4A 2A24B 4PAUA 4JGOA 3CLOA 3F1PA 4UQIS 5TBMA 3C8CA 1VB6A 1GSXA 3EGXC 2P7JA 4WEKA 3W2ZA 4I3AA 2VGLM 4HIAA 1OTEA 2JKTI 1OTIA 4EU0A 2J3TC 3EGDC 2D02A 3T4SA 4B9OA 4CLCD 3DBAA 2BASA 1N9NA 4Q0HA 4JGRA 5HWVA 2EA9A 3E4QA 3BY8A 1D06A 2OOLA 3FPWA 3LR3A 2WKPA 1XJ3A 3OLOA 2ZOHA 4O0PA 3PBOA 3PBRA 1GSWA 1MC0A 3LR0A 3T4JA 3HCYA 2B18A 4I39A 4GCZA 1G6OA 1OT9A 5HWTA 5DF9A 4BJPA 1NLZA 2VJWA 4L9FA 1N9LA 2G7UA 4KQOA 5DKLA 4BBUA 1KOUA 2MJ6A 2INWA 4FSFA 3MJQA 2W0NA 3U2AA 2H28A 2ZMVA 1P97A 2OWHA 4Q0JA 1D7EA 2V0WA 4GJ4A 5IU1A 1LSXA 5EFWA 1NLYA 2K2NA 4ME4A 4WL9A 3OCLA 1H3QA 3RTYA 4Q0IA 4O8GA 3UE6A 1V9YA 2VX8A 3MQOA 3ZYTA 4CLCB 4EEPA 2KOIA 1W63M 2JKRM 5K5BA 2I9VA 4EQ1A 2O9CA 3MXQA 4KUKA 2GJ3A 4Y2FA 3NOPC 3FPVA 2LB9A 3CAXA 1UGUA 3NJAA 3NHQA 4GS9A 3H82A 5F69A 1LSVA 3UE3A 1F9IA 3LYXA 4MDZA 4NXFA 5I5LA 1LL8A 4Y3IA 1XJ2A 3PBTA 2VV6A 2P08A 5LBRA 1GSVA 4L0LA 1XJ6A 3EOIA 1Y28A 4F3LA 1NWZA 1P9RA 2EWWA 3D3OA 5J7EA 2Y8HA 2WKQA 5FL3A 5HDCA 5HD3A 2ZMFA 2K31A 2YKFA 2W3HA 2Z6CA 3VV4A 4P6ZS 3S7PA 4HNBA 2NUPC 1OJGA 4WEJA 1BYWA 3C30A 4EUVA 2HF6A 4NKPA 4YOFA 1OPXA 3A0RA 2J3TD 2QKPA 5CX7A 2L1MA 2EWVA 5DFYA 2QYBA 4YWZA 3CUEA 1S4RA 2HJ9C 4QPRA 1OTAA 4NXBA 1XFNA 1ZTUA 5KIZA 5DJUA 1OJ5A 4LRYC 3CUEC 3EQUA 4IHQA 4CLCE 3JVVA 5HWWA 4ETXA 2KDKA 2V9AA 2VGLS 3G6OA 2FZ0A 3UB9A 2B02A 4G3WA 2Y79A 1T1AA 4R3AA 4ZRRA 1P0ZA 3S7QA 3BY9A 2A24A 3KO6A 4WN5A 4KUOA 5G4ZA 5F68A 1H8MA 3EQVA 3SW1A 5HDSA 4PHTA 1S66L 3JVUA 4CQHA 3E98A 1T1CA 5A8BA 4I3JA 4B93A 2PYRA 1W63Q 5HSQA 3ZQ5A 4HY8A 3R7WB 3MQQA 2JN7A 4OOLA 3NOTC 1S67L 2W1RA 1DP6A 4GLQA 3BW6A 4HJ4A 3CITA 4R70A 3UB6A 4IUHA 2IA2A 1F98A 2V0UA 2O9BA 4JGPA 3OC2A 3T4KA 4XT2B 1TF1A 3TW8A 3BWLA 3PBNA 5TJJA 3C2WA 4GW9A 4M4XA 4DJ2A 3LR5A 3FC7A 2KX6A 3EEHA 4HH3A 4NXGA 3GDIA 3TE8A 4IJGA 3A0VA 2XA7S 3KSIA 3LR4A 3MF0A 3S7NA 2O9AA 3PBSA 3S7OA 4CLCA 4NEED 3F1NB 2J3WA 1UWNX 2VEAA 3F1NA 1TS7A 4I3IA 1P9WA 2PR6A 3BQAA 4CLCC 4HOIA 5KSHA 2W3DA 3IS2B 3OCNA 3CI6A 1S1YA 2VKSA 4O01A 3T4QA 3MR0A 2QWSA 2XROA 4R38A 3MQ0A 3KSGA 1DRMA 3B33A 4EESA 4PKYA 4LRXC 3C38A 3LIFA 2Z6DA 5L8MA 3P01A 5MC7A 3VE3A 5AVEA 3E4PA 4DN0A 3PYPA 2K7SA 2PT7A 4LRZE 1ZHHB 2PHYA 3ULFA 3LI8A 5HZHA 2XSSA 5DJTA 5G4YA 2J80A 2GZAA 1OTDA 4I5SA 2W3FA 2VV7A 1ODVA 4GHIB 4BBVA 2PYPA 2DMWA 1S1ZA 3D72A 2PD7A 2QHKA 3TJZC 5DKKA 5J3WA 4EXOA 2OWJA 4L9EA 3LICA 3LIBA 3KSHA 4BBTA 2JKTM 1OTBA 3P7NA 2ZBBA 2M7UA 2JKRI 1F5MA 4WUJA 2HGVA 3PHYA 1YSQA 2A2LA 2V1AA 4G3KA 4HQAA 1MKMA 2VA0A 4I38A 2V1BA 3FG8A 3KYZA 2D01A 3E4OA 5C5KA 1S4SA 3EEAA 3LFVA 1XJ4A 3RFBA 2W3EA 2NUTC 5AJGA 3HJKA 5IT5A 3UMDA 2LB5A 5HD5A 4RQ9A 4H6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J4E A;  3H7W B;  5F6A A;  1V9Z A;  1TS0 A;  4NXE A;  3GEC A;  2YKH A;  3MFX A;  2CMN A;  4L9G A;  1JNU A;  3CWF A;  3F1P B;  5TBM B;  3K3D A;  2W27 A;  1N9O A;  4MN5 A;  2PDR A;  2PR5 A;  3VE4 A;  1G28 A;  3LIA A;  1OT6 A;  4LLO B;  1LT0 A;  1MZU A;  4XT2 A;  3LIE A;  1EW0 A;  1LSW A;  3UB8 A;  3K3C A;  3IBR A;  1T18 A;  4LPZ A;  4PKY G;  2VLG A;  4WLA A;  2WKR A;  3T50 A;  4K08 A;  2L4R A;  3NOU C;  3RH8 B;  1UWP X;  2HV1 A;  3ICY A;  4DJ3 A;  4HHD A;  3IS2 A;  2R78 A;  5F5Y A;  1XFQ A;  4HP9 A;  1TS6 A;  2L0W A;  1X0O A;  2VV8 A;  1T19 A;  4GS9 B;  1WA9 A;  3H82 B;  3F1O B;  3F1O A;  1DP9 A;  4HJ6 A;  4EEU A;  4EER A;  4GHI A;  3UB7 A;  3A0S A;  3KX0 X;  4F3L B;  1TS8 A;  4MN6 A;  4R6L A;  3VOL A;  1DP8 A;  5IS1 A;  2QJ5 A;  3UME A;  2ZOI A;  1T1B A;  2QJ7 A;  4WF0 A;  4E04 A;  4HH2 A;  4KQD A;  2JHE A;  3EWK A;  2PD8 A;  5HDD A;  4EW7 A;  3H9W A;  3LI9 A;  3LUQ A;  3HJI A;  4HP4 A;  4H6J A;  2M1C A;  3H7W A;  4HJ3 A;  4JGQ A;  3LID A;  4EET B;  5AVF A;  4HI4 A;  2A24 B;  4JGO A;  3CLO A;  3F1P A;  5TBM A;  3C8C A;  1VB6 A;  1GSX A;  2P7J A;  4I3A A;  4HIA A;  1OTE A;  1OTI A;  2D02 A;  4B9O A;  2BAS A;  1N9N A;  4JGR A;  5HWV A;  2EA9 A;  3E4Q A;  3BY8 A;  1D06 A;  2OOL A;  2WKP A;  1XJ3 A;  3OLO A;  2ZOH A;  1GSW A;  4I39 A;  4GCZ A;  1OT9 A;  5HWT A;  4L9F A;  1N9L A;  5DKL A;  4BBU A;  1KOU A;  2INW A;  3MJQ A;  2W0N A;  2H28 A;  1P97 A;  2OWH A;  1D7E A;  2V0W A;  5IU1 A;  1LSX A;  5EFW A;  4WL9 A;  3RTY A;  3UE6 A;  1V9Y A;  3MQO A;  4EEP A;  2I9V A;  4EQ1 A;  3MXQ A;  4KUK A;  2GJ3 A;  3NOP C;  3CAX A;  1UGU A;  3NJA A;  3NHQ A;  4GS9 A;  3H82 A;  5F69 A;  1LSV A;  1F9I A;  3LYX A;  4NXF A;  5I5L A;  1LL8 A;  1XJ2 A;  2VV6 A;  1GSV A;  1XJ6 A;  1Y28 A;  4F3L A;  1NWZ A;  5J7E A;  2WKQ A;  5HDC A;  5HD3 A;  2YKF A;  2Z6C A;  4HNB A;  1OJG A;  1BYW A;  3A0R A;  2QKP A;  2L1M A;  4YWZ A;  1S4R A;  1OTA A;  4NXB A;  1XFN A;  5KIZ A;  5DJU A;  1OJ5 A;  4LRY C;  5HWW A;  2KDK A;  2V9A A;  3G6O A;  3UB9 A;  2B02 A;  1T1A A;  4R3A A;  1P0Z A;  3BY9 A;  2A24 A;  4WN5 A;  4KUO A;  5G4Z A;  5F68 A;  3SW1 A;  5HDS A;  1S66 L;  1T1C A;  5A8B A;  4I3J A;  2PYR A;  5HSQ A;  3ZQ5 A;  4HY8 A;  3MQQ A;  2JN7 A;  3NOT C;  1S67 L;  1DP6 A;  4HJ4 A;  4R70 A;  3UB6 A;  1F98 A;  2V0U A;  4JGP A;  4XT2 B;  3BWL A;  3C2W A;  4GW9 A;  4M4X A;  4DJ2 A;  3FC7 A;  2KX6 A;  3EEH A;  4HH3 A;  4NXG A;  3GDI A;  3A0V A;  3F1N B;  1UWN X;  2VEA A;  3F1N A;  1TS7 A;  4I3I A;  2PR6 A;  4HOI A;  3IS2 B;  1S1Y A;  3MR0 A;  2QWS A;  4R38 A;  1DRM A;  3B33 A;  4EES A;  4PKY A;  4LRX C;  3LIF A;  2Z6D A;  3VE3 A;  5AVE A;  3E4P A;  3PYP A;  2K7S A;  4LRZ E;  2PHY A;  3ULF A;  3LI8 A;  5HZH A;  5DJT A;  5G4Y A;  2J80 A;  1OTD A;  4I5S A;  2VV7 A;  1ODV A;  4GHI B;  4BBV A;  2PYP A;  1S1Z A;  3D72 A;  2PD7 A;  2QHK A;  5DKK A;  5J3W A;  4EXO A;  2OWJ A;  4L9E A;  3LIC A;  3LIB A;  4BBT A;  1OTB A;  3P7N A;  2ZBB A;  4WUJ A;  3PHY A;  2V1A A;  4HQA A;  4I38 A;  2V1B A;  3FG8 A;  2D01 A;  3E4O A;  1S4S A;  1XJ4 A;  3HJK A;  3UMD A;  5HD5 A;  4RQ9 A;  4H6J B; 
#chains in the Genus database with same CATH topology
 3DTE A;  2YKH A;  1CEF A;  3MFX A;  2CMN A;  1NYY A;  2ZQC A;  5TBM B;  3K3D A;  1FIL A;  1VHM A;  3O5Y A;  5E2H A;  3OPL A;  3LGO A;  3W4P A;  1NZU A;  4JF4 A;  3B3X A;  1G28 A;  4PM7 A;  4WBG A;  5AQ7 A;  4KZ9 A;  5FQ9 A;  1STZ A;  3LIE A;  3UB8 A;  4EBP A;  2H10 A;  1PI5 A;  2W3G A;  1Q2P A;  5U47 A;  2VK3 A;  3ZG7 B;  3A3F A;  4LPZ A;  4S2P A;  5M18 A;  4UEY A;  3UB5 P;  3C7V A;  1Y54 A;  2ZC5 B;  4FOF A;  4XXR A;  2KLI A;  4BD1 A;  3FKW A;  2R78 A;  5F5Y A;  1XFQ A;  4HP9 A;  4RX2 A;  3BFC A;  1LHY A;  3GR2 A;  2FH5 A;  4DDY A;  4GS9 B;  1PI4 A;  1T19 A;  1WA9 A;  2DCF A;  3F1O A;  1MY8 A;  3UB7 A;  4HEF A;  5CGS A;  3Q7V A;  3KSF A;  5DTS A;  5GLA A;  4HBU A;  4MN6 A;  3VOL A;  5IS1 A;  2QJ5 A;  3AGE A;  2V1Z A;  4U0T A;  3N6I A;  1K56 A;  3TRC A;  1H8Y A;  2QJ7 A;  3NIA A;  5HDD A;  1EWZ A;  4EW7 A;  3BEB A;  4DMZ A;  3GQZ A;  4HP4 A;  4FCF A;  3HLW A;  5GLC A;  4HJ3 A;  2H5S A;  3OBF A;  4QD4 A;  3T4O A;  4A5R A;  5AVF A;  1K55 C;  4N9K A;  2V2F F;  3IXH A;  4JGO A;  4UQI S;  4WZ5 C;  4LFU A;  1GSX A;  5F1F A;  4ZJ2 A;  2JKT I;  4EU0 A;  5CHU A;  3T4S A;  3HLG A;  4CLC D;  1CF0 A;  3N7W A;  1NZO A;  1YLT A;  3BLM A;  1N9N A;  4Q0H A;  4JGR A;  5FAS A;  1XGJ A;  3IXB A;  3MFD A;  3W8K A;  3ZGA B;  2WKP A;  5FDS A;  3LR0 A;  3T4J A;  3VP2 A;  3C4O A;  4GCZ A;  1G6O A;  4S2M A;  4BJP A;  1NLZ A;  3IHA A;  2B5R A;  5KSC A;  1N9L A;  1GA0 A;  1VEU B;  2INW A;  2ZMV A;  5FQJ A;  2WGW B;  2OWH A;  1C3B A;  1FSY A;  5A92 A;  2RL3 A;  3BFD A;  2ZM8 A;  5EFW A;  4UAA A;  3QNB A;  1IEL A;  3OCL A;  4GD8 A;  1FR6 A;  1K57 C;  1H3Q A;  1MPL A;  2X71 A;  2VX8 A;  4CLC B;  1VET B;  3CJM A;  3ZG5 A;  2PAV P;  4LV0 A;  2EXA A;  2I9V A;  2O9C A;  1W5D A;  3MXQ A;  4X55 A;  5L2F A;  3O3V A;  2LB9 A;  3NJA A;  5HAQ A;  1GA9 A;  4MNR A;  5CTN A;  3UNW A;  3LYX A;  2P08 A;  5LBR A;  1NWZ A;  1P9R A;  3D3O A;  2QZ6 A;  4KZ5 A;  5EOO A;  2X01 A;  5HDC A;  3VP3 A;  2W3H A;  3VV4 A;  4IED A;  1YT4 A;  3C30 A;  5GHY A;  4X68 A;  1Z6F A;  1GCE A;  4R1G A;  2C6W B;  4NKP A;  5DTK A;  2J3T D;  5JYO A;  2L1M A;  4IBR A;  3VP4 A;  2AVX A;  1BUL A;  2Y2Q A;  1JWP A;  3CPT B;  1ZTU A;  5KIZ A;  4LRY C;  3EQU A;  1L3L A;  4CLC E;  5HWW A;  4ETX A;  3SH8 A;  3E2L A;  1T1A A;  4EBN A;  1FSW A;  2A24 A;  4X25 A;  1L2S A;  4OQ0 A;  1WYB A;  4PHT A;  4WM9 A;  2CC1 A;  2XFS A;  2Q9N A;  4E6X A;  3ZCZ A;  1T1C A;  3DAV A;  3HL9 A;  4LV1 A;  5A8B A;  3FZC A;  2WKE A;  4B93 A;  1W63 Q;  3ZQ5 A;  3DTK A;  4OOL A;  3NOT C;  5BOH A;  2HP6 A;  4HJ4 A;  3UB6 A;  1G5U A;  5CHJ A;  4IUH A;  2IA2 A;  3M6B A;  1N9B A;  2V0U A;  3MXR A;  3QHY A;  1KE4 A;  1TF1 A;  4IBX A;  1ONH A;  3ITA A;  4QU3 A;  4Y13 A;  2V20 A;  5EUA A;  4DJ2 A;  5FAO A;  1NYM A;  3EEH A;  4HH3 A;  3MF0 A;  3PBS A;  3S7O A;  1D1J A;  1TDL A;  5A93 A;  4Y17 A;  1YLP A;  2J3W A;  1Z09 A;  3F1N A;  4D2O A;  2ZC4 B;  3L9K A;  3Q82 A;  4HOI A;  5HAI A;  4CLC C;  1IEM A;  3ZDJ A;  1S1Y A;  3T4Q A;  2QWS A;  4U3T A;  5FSR A;  2XRO A;  3SS5 A;  3MQ0 A;  3O86 A;  1NJ4 A;  3T12 B;  1SZV A;  2EFU A;  3LEQ A;  3QP5 A;  2XFT A;  3DTM A;  4H8R A;  5L07 A;  5DF8 A;  3GV9 A;  5DJT A;  5G4Y A;  3IWO A;  3HVF A;  1OTD A;  3MBZ A;  1DY6 A;  3IF6 B;  1XXM A;  1GHM A;  2DMW A;  4BLM A;  2BG1 A;  2JE5 A;  3HLB A;  2QHK A;  3Q7V B;  4IVK A;  4QB8 A;  4Y7P A;  1JTG A;  1HD8 A;  2OLU A;  3LIC A;  2JKT M;  3VFH A;  3WS1 A;  3WRT A;  3G32 A;  5KZH A;  4ID4 A;  5CED A;  4HQA A;  1RP5 A;  3ZG8 B;  3FG8 A;  1I2S A;  5C5K A;  1E3U D;  3RFB A;  3LY3 A;  4YIN A;  1ES5 A;  3HJK A;  4UA7 A;  3UMD A;  4E3O A;  4N1X A;  4RQ9 A;  2JCH A;  5F6A A;  1G6A A;  3KYQ A;  5TFQ A;  1CI9 A;  1KGG A;  1YKD A;  3UN7 A;  4G3V A;  3TSG A;  2HP5 A;  3MMH A;  3CHW P;  5FQM A;  1WE4 A;  3T4T A;  5F1G A;  3VE4 A;  3ZVT A;  2PBY A;  1SKO A;  1NRJ A;  3FV7 A;  2GDN A;  4LLO B;  1N4O A;  1PWD A;  4XT2 A;  1NY0 A;  3UPO A;  4S2L A;  5FAT A;  2EX9 A;  2O0Y A;  4MEZ A;  2XK1 A;  2ZC3 B;  1T18 A;  3NBL A;  3T4L A;  4OKP A;  3PR6 A;  4K08 A;  4MMN A;  1GHP A;  1IFQ A;  1UWP X;  2HV1 A;  4BWI A;  3ICY A;  1IYO A;  2R9X A;  4YNR A;  1U60 A;  4R3B A;  3K2N A;  1TEM A;  4AFI A;  3ZNT A;  3UE0 A;  5M19 A;  2OAP 1;  1PW1 A;  1K6R A;  3OPR A;  4ZAM A;  1RGZ A;  5CEB A;  3G35 A;  1X0O A;  2QMI A;  3CMZ A;  1W8Y A;  2HPB A;  1L0E A;  2XRN A;  3SH7 A;  4EEU A;  4U0X A;  2P04 A;  1I2W A;  3KX0 X;  5EPH A;  1K38 A;  1SHV A;  2H0Y A;  1L0G A;  3TOI A;  1TS8 A;  4ARZ B;  1EI5 A;  1ES3 A;  3PXP A;  3UME A;  2ZOI A;  3HUO A;  4S2I A;  3B42 A;  3HRE A;  5CER A;  1LLB A;  3MS6 A;  2W1T A;  4HH2 A;  4K0W A;  4KQD A;  4QJG A;  3EWK A;  2PU2 A;  2IWB A;  3H9W A;  3GTC A;  4ETZ A;  5HW3 A;  3LUQ A;  4ZDX A;  1E25 A;  2M1C A;  3H7W A;  1L0D A;  4PM8 A;  3JYI A;  2JKG A;  3LID A;  5HPF A;  3M2K A;  5DFX A;  1YSP A;  3IBJ A;  3L7H A;  2A24 B;  1J9M A;  3F1P A;  2ZL1 B;  3RJU A;  4WEK A;  2VGL M;  1FOF A;  1K54 C;  1LI9 A;  3NEC A;  3MZD A;  1OME A;  2D02 A;  4R0Q A;  2BAS A;  2EA9 A;  3FPW A;  3PAG A;  4RX3 A;  3NY4 A;  4O0P A;  4DRT A;  3PBO A;  3PBR A;  3IHB A;  3FYZ A;  4I39 A;  1ERO A;  4OON A;  3DWK A;  2VJW A;  3UO9 A;  4L9F A;  4KQO A;  5DKL A;  4BBU A;  1KOU A;  2MJ6 A;  4FSF A;  5CEC A;  2W0N A;  2H28 A;  2E8I A;  1D7E A;  5IU1 A;  1LSX A;  4KG5 A;  4N92 A;  4WL9 A;  5CRF A;  3CZD A;  4Q0I A;  5IHV A;  2XF3 A;  2WUQ A;  3MQO A;  4WYY A;  2KOI A;  3DTI A;  1W63 M;  2XDM A;  5K5B A;  5TR7 A;  2P9V A;  3CAX A;  3NHQ A;  2HDQ A;  5CGX A;  1SDN A;  5F69 A;  4R3J A;  3UE3 A;  4CPK A;  4MDZ A;  5I5L A;  3UDI A;  2VV6 A;  3VSL A;  4F3L A;  2EWW A;  2ZMF A;  4P6Z S;  4FD8 A;  4XUX A;  3ZFZ A;  3P09 A;  1OJG A;  4DKI A;  1PRQ A;  3G2Y A;  5I94 A;  4EUZ A;  2HF6 A;  3LCE A;  5CTM A;  2QYB A;  1XA1 A;  3CUE A;  2HJ9 C;  4YWZ A;  1OTA A;  3M2J A;  4E6W A;  2P74 A;  1PWG A;  5EV0 A;  3JVV A;  2Y2O A;  3Q07 A;  2BTF P;  2FZ0 A;  3UB9 A;  2FFF B;  4R3A A;  1P0Z A;  3KO6 A;  2G2W A;  3HUM A;  3EQV A;  1A0K A;  2R9W A;  1S66 L;  4RYE A;  1H8Z A;  1HLU P;  4I3J A;  3RXW A;  4D60 A;  2JKF A;  5E2E A;  3BRM A;  3QP8 A;  1E3U A;  3HLD A;  3GMW A;  4E3N A;  3BW6 A;  5FI6 A;  1F98 A;  1SKO B;  5KMW A;  4XT2 B;  3TW8 A;  1FR1 A;  2OSU A;  3MZF A;  1GHI A;  5FEF A;  3LR5 A;  3FC7 A;  4KZB A;  4NXG A;  3VMA A;  1S6R A;  2XA7 S;  5HX9 A;  3KSI A;  3S7N A;  2WAF A;  4OOY A;  2WGV A;  2VEA A;  1TS7 A;  4I3I A;  1P9W A;  2PR6 A;  4Q8I A;  5KSH A;  1DJA A;  2VKS A;  3IT9 A;  2Y91 A;  4R4S A;  1YMX A;  4EES A;  4NK3 A;  4PKY A;  4LRX C;  3LIF A;  4KZ7 A;  3P01 A;  1KVM A;  1ESU A;  5GL9 A;  5AVE A;  4K0X A;  4DN0 A;  4LRZ E;  3BYD A;  4I5S A;  1ODV A;  2PYP A;  3D72 A;  3U4L P;  5L09 A;  1H5X A;  3MSH A;  4BBT A;  2JBF A;  2J9O A;  2M7U A;  1F5M A;  3MZE A;  2V8C A;  3PHY A;  1CK3 A;  4Y0O A;  4PM5 A;  2XQZ A;  4QWO A;  1MKM A;  1JVJ A;  1XGI A;  2V1B A;  5EM0 A;  3KYZ A;  2IWD A;  2ZQD A;  3O87 A;  3E4O A;  3HUN A;  3VOZ A;  3LFV A;  1XJ4 A;  2W3E A;  4EWF A;  3IX3 A;  4JXV A;  4KZ4 A;  5IT5 A;  1QME A;  2LB5 A;  4P87 A;  1PFL A;  4UHU A;  3VOY A;  2HZ5 A;  1ZKJ A;  2ZC6 B;  3H7W B;  4NXE A;  3G2Z A;  2C5W B;  1YMS A;  4X1M A;  3Q1F A;  3BJN A;  5F82 A;  3D9Y A;  4BD0 A;  3CWF A;  3F1P B;  3P98 A;  1ERM A;  4MN5 A;  1O07 A;  4GNU A;  2Y2M A;  4QHC A;  2HJE A;  3NCK A;  2PDR A;  4GB7 A;  1DJB A;  1KVL A;  4N1H A;  5GLD A;  1PNE A;  5HL6 A;  5AQ9 A;  4OPR A;  4UQI M;  1QMF A;  1MZU A;  2WGI A;  5EVI D;  4BQM A;  4MBH A;  4X6T A;  3LO7 A;  4MBK A;  2PRF A;  1MBL A;  4BL2 A;  2Q9M A;  5HPI A;  2DRW A;  2VLG A;  4WLA A;  2WKR A;  3T50 A;  1NXY A;  3PTE A;  2HDS A;  3NOU C;  3V67 A;  4O7D A;  3UDX A;  2HDU A;  1XX2 A;  3AGD A;  3ITB A;  3FWL A;  4DJ3 A;  4KEN B;  3IS2 A;  4PPR A;  3R4K A;  1TS6 A;  4FTX A;  1PIO A;  5FEG A;  4OPQ A;  2P9V B;  2UWX A;  3UDF A;  2VV8 A;  2XA7 M;  1KE3 A;  3F1O B;  5EVE A;  3DW0 A;  4EER A;  4GHI A;  3A0S A;  4WMC D;  4DF6 A;  4F3L B;  3G4P A;  3ZG9 B;  3DWZ A;  2EX6 A;  4R6L A;  1RCJ A;  2X02 A;  1YLY A;  4Z1W A;  3IWQ A;  4RVA A;  1BLH A;  1T1B A;  5FAP A;  4LV3 A;  2Y2I A;  2WZZ A;  4JLF A;  4WEL A;  4WF0 A;  4E04 A;  2JHE A;  2VZW A;  5DF7 A;  1TD5 A;  4OH0 A;  3NI9 A;  3LI9 A;  3N8L A;  5DTT A;  1TDG A;  3OOV A;  1ZG6 A;  4P6B A;  3PBQ A;  4BMW A;  4JGQ A;  2J7V A;  4EET B;  4II7 A;  3RXX A;  2VGJ A;  1W7F A;  4HI4 A;  4JPM A;  4PAU A;  4XUZ A;  3UPN A;  1FQG A;  1BLC A;  4KQQ A;  3EGX C;  1YLW A;  4H6J B;  4PM6 A;  4I3A A;  4HIA A;  1OTE A;  1KE0 A;  1TVF A;  3OPH A;  2J3T C;  3KYE A;  3EGD C;  4B9O A;  4S2O A;  2ZD8 A;  5E43 A;  3DBA A;  1K0K A;  5HWV A;  3E4Q A;  3NDG A;  3BY8 A;  1D06 A;  3HLE A;  3Q7Z A;  3LR3 A;  1FCO A;  2RCX A;  1BZA A;  5FI7 A;  4QY6 A;  1GSW A;  1MC0 A;  1K4F A;  2H0T A;  4KG6 A;  3HCY A;  5FI2 A;  2Y2L A;  1OT9 A;  1ALQ A;  5HWT A;  5DF9 A;  1IYP A;  2FFY A;  5FA7 A;  3IQA A;  2EXB A;  4E3K A;  3MXS A;  2E8J A;  2ZC7 A;  1MXO A;  3IXD A;  1P97 A;  3A3I A;  2V0W A;  1KGE A;  4X69 A;  5JYP A;  1XP4 A;  1NLY A;  2K2N A;  4ME4 A;  5HAR A;  3RTY A;  4O8G A;  3UE6 A;  4E3I A;  2Y2N A;  5GHX A;  4GZB A;  1W8Q A;  4KUK A;  3HBR A;  4KZ6 A;  2GJ3 A;  5F83 A;  3A3D A;  3A3E A;  3H82 A;  2ZMA A;  1LSV A;  1LL8 A;  4Y3I A;  1XJ2 A;  4N9L A;  4KZ3 A;  1XJ6 A;  3EOI A;  3N4I A;  1YQS A;  4EBL A;  2Y8H A;  3QP6 A;  5HD3 A;  2K31 A;  4OLG A;  2Z6C A;  3VP0 A;  3SZT A;  5E2G A;  5AQA A;  5AQB A;  4EUV A;  4FH2 A;  4NET A;  3ISG A;  3UPP A;  1LI0 A;  4YOF A;  3A0R A;  5D3O A;  2QKP A;  5CX7 A;  2EWV A;  3T1R A;  5DFY A;  1RGY A;  4QPR A;  1S4R A;  3GSG A;  3IX8 A;  5DJU A;  2XD5 A;  3MKE A;  3CUE C;  1XKZ A;  4OQG A;  4G3W A;  4DE2 A;  1FCM A;  3IWI A;  2Y79 A;  5CXW A;  4PMA A;  3BLS A;  4KUO A;  5G4Z A;  1JTD A;  5F68 A;  3A3J A;  3UY6 A;  5HDS A;  4BEN A;  4CQH A;  4JXS A;  4Z9Q A;  5EVL A;  2JC7 A;  1K4E A;  3AGF A;  2Q0O A;  3IH9 A;  2JN7 A;  1AWI A;  1S67 L;  3QP1 A;  2B95 A;  3Q81 A;  1CJF A;  2Y4A A;  1XA7 A;  4GKU A;  4KZ8 A;  3T4K A;  5FQQ A;  2UV0 E;  4LGW A;  2Y59 A;  3WS0 A;  4YFM A;  1J3W A;  4K91 A;  1ESI A;  1CI8 A;  4JF5 A;  3V3R A;  2OLV A;  1L0F A;  3GDI A;  3TE8 A;  2XR0 A;  4DXC A;  5HAP A;  2Y2P A;  4DXB A;  3V3S A;  3F1N B;  1M6K A;  4WZ4 A;  3BQA A;  2Y2J A;  4QY5 A;  2A49 A;  5EVI A;  2W3D A;  3IS2 B;  4O01 A;  2WAE A;  1DRM A;  3B33 A;  5EEC A;  3N8S A;  3C38 A;  1HTZ A;  4EQI A;  4OVD A;  3VE3 A;  5CGW A;  3E4P A;  2ZQ7 A;  2PT7 A;  1NRF A;  2PHY A;  3ULF A;  5HZH A;  2XSS A;  2J80 A;  2GZA A;  4BL3 A;  2VV7 A;  5HL1 A;  4JKT A;  4GHI B;  3QNC A;  4BBV A;  1S1Z A;  3IF6 A;  2I72 A;  4OQH A;  3TG9 A;  5EE8 A;  1CEG A;  5J3W A;  4S2N A;  2OWJ A;  2WAD A;  4EXO A;  4L9E A;  1KDW A;  3LIB A;  1ZG4 A;  3P7N A;  1BUE A;  2JKR I;  2Y2G A;  1YSQ A;  4G3K A;  4C75 A;  2VA0 A;  4DE3 A;  1F2K A;  4FUW A;  1S4S A;  3EEA A;  2ZLY A;  5AJG A;  2XGN A;  4WMC A;  5A91 A;  4UA9 A;  1AXB A;  5J4E A;  1W79 A;  1V9Z A;  1TS0 A;  3C5A A;  3GEC A;  4IUK A;  4OP5 A;  1PYY A;  1SCW A;  4ZJ3 A;  4L9G A;  4C3Q A;  4Y5F A;  1HVB A;  1JNU A;  1KGF A;  2W27 A;  1H0M A;  3VP1 A;  1N9O A;  4P0M A;  1K54 A;  3R7W A;  1Q2Q A;  4MN7 A;  2PR5 A;  4GOG A;  1WYC A;  5GLB A;  1E4D A;  1VQQ A;  2GNX A;  3LIA A;  1OT6 A;  2OV5 A;  1SDE A;  1LT0 A;  3CG5 A;  2M7V A;  3BQ8 A;  3W4O A;  1EW0 A;  1LSW A;  3K3C A;  3IBR A;  1MWS A;  5FQI A;  4OOM A;  4LEN A;  4PKY G;  5HFO A;  4X53 A;  2EX2 A;  3HLF A;  3NC8 A;  4OPZ A;  2L4R A;  1BLP A;  3RH8 B;  1IYQ A;  3HLC A;  4MBF A;  3UE1 A;  4HHD A;  4MCW A;  4B88 A;  3V39 A;  3JPU A;  2OAQ 1;  5DVA A;  3VSK A;  1PZO A;  4Y0U A;  2V8F A;  2L0W A;  3H82 B;  3FKV A;  1DP9 A;  3LY4 A;  1ES2 A;  1YAX A;  2VGK A;  2WKH A;  4B4Z A;  4HJ6 A;  5EM1 A;  4OLD A;  4ZBE A;  4OQI A;  2IWC A;  1KDS A;  4ARZ A;  3B47 A;  3QP2 A;  1DP8 A;  4B4X A;  2O99 A;  1ONG A;  2WZX A;  3WS4 A;  2W1T B;  3E0Y A;  2XD1 A;  3IXG A;  2XH9 A;  1IOU A;  1XPB A;  2PD8 A;  3E2K A;  2GX5 A;  4P6Z M;  1ES4 A;  3G31 A;  4ZTK A;  2WYX A;  1BTL A;  2G2U A;  3HJI A;  4H6J A;  1IYS A;  5A90 A;  5M1A A;  1K55 A;  1ERQ A;  4JBF A;  4WZ5 A;  4DDS A;  3IH8 A;  2EX8 A;  4R23 A;  1MWT A;  2PU4 A;  3CLO A;  5TBM A;  4E3L A;  3BFG A;  4OP8 A;  3C8C A;  1VB6 A;  4S2K A;  2ZL1 A;  2P7J A;  3S4X A;  3W2Z A;  2DNS A;  1OTI A;  1MWR A;  2OOL A;  1XJ3 A;  4DE0 A;  1MWU A;  1O7E A;  2J8Y A;  3OLO A;  4Y15 A;  2ZOH A;  4ESP A;  3S1Y A;  2B18 A;  3GVB A;  1YLJ A;  2XEP A;  1PW8 A;  4S2J A;  3V50 A;  4JF6 A;  2G7U A;  4UA6 A;  3BFF A;  3BM6 A;  2BLS A;  3MJQ A;  3U2A A;  1G68 A;  3M6H A;  4Q0J A;  2QPN A;  4MLL A;  4GJ4 A;  3WS5 A;  1K57 A;  1V9Y A;  5FDH A;  3ZYT A;  4EEP A;  1FCN A;  1IKG A;  1FIK A;  3T1S A;  2JKR M;  4EQ1 A;  4Y2F A;  5EVI B;  3W4Q A;  3NOP C;  3FPV A;  4GDB A;  1Y4O A;  2ACG A;  1K56 D;  1UGU A;  4GS9 A;  2ZQ8 A;  3G30 A;  1K25 A;  4E3J A;  1F9I A;  1M40 A;  4NXF A;  3S22 A;  2WKI A;  3VFF A;  3PBT A;  4ZJ1 A;  1GSV A;  4L0L A;  1Y28 A;  4FH4 A;  2Z2L B;  4OPY A;  5J7E A;  3I7J A;  2WKQ A;  5FL3 A;  2YKF A;  3S7P A;  4HNB A;  5J8X A;  1IKI A;  2NUP C;  1JWZ A;  2PBD P;  4WEJ A;  3BFE A;  1PZP A;  1BYW A;  4CJN A;  2Y2K A;  1HZO A;  3C4P A;  4X56 A;  3NUL A;  4GDN A;  1OPX A;  3MKF A;  2A3U A;  4IVI A;  5G18 A;  1ZC2 A;  3N8R A;  3OPP A;  1LL9 A;  3ZHH A;  4KG2 A;  4NXB A;  1XFN A;  2ZQ9 A;  1OJ5 A;  3SH9 A;  4Y0T A;  4HES A;  4IHQ A;  3D4F A;  4LCM A;  3WS2 A;  2KDK A;  4GD6 A;  2V9A A;  2VGL S;  3G6O A;  2B02 A;  4ZRR A;  3S7Q A;  3BY9 A;  4WN5 A;  2ZJ9 A;  1BLS A;  1H8M A;  3SW1 A;  1S0W A;  3GRJ A;  3JVU A;  3E98 A;  4C6Y A;  1BT5 A;  1BSG A;  2ZQA A;  4PM9 A;  2PYR A;  3T1Q B;  5HSQ A;  2XLN A;  4HY8 A;  3R7W B;  3MQQ A;  1PWC A;  2HP9 A;  3PAE A;  2W1R A;  2HDR A;  1DP6 A;  1ACF A;  3IF5 A;  4GLQ A;  3CIT A;  4GN2 A;  4R70 A;  4R4R A;  3BEC A;  3T1X A;  2O9B A;  4JGP A;  4X1L A;  3OC2 A;  2Z2M B;  1VEU A;  1YPR A;  1YLZ A;  3BWL A;  5TGF A;  3PBN A;  5TJJ A;  5FQK A;  3C7U A;  2Y55 A;  2WGW A;  3C2W A;  4P85 A;  4GW9 A;  4M4X A;  2KX6 A;  4KZA A;  3SS3 A;  4JXW A;  3G34 A;  4IJG A;  3ZVW A;  2Y2H A;  3A0V A;  3SS4 A;  3LR4 A;  2O9A A;  1SKF A;  4CLC A;  1CQA A;  5L10 A;  4NEE D;  1VET A;  1UWN X;  4E3M A;  4HBT A;  4RA7 A;  4DE1 A;  3OCN A;  3CI6 A;  1K6S A;  5GHZ A;  3MR0 A;  5EVI C;  4R38 A;  1MKI A;  3KSG A;  4F94 A;  2Z6D A;  5L8M A;  3ZNY A;  5MC7 A;  1DJC A;  3OZH A;  3WRZ A;  3O88 A;  3QP4 A;  3PYP A;  2K7S A;  1VM1 A;  3WWX A;  1ZHH B;  4EV4 A;  3IX4 A;  3LI8 A;  2W3F A;  4LV2 A;  3V5M A;  1I5Q A;  2J9P A;  2PD7 A;  5EOE A;  3TJZ C;  5DKK A;  1LL5 A;  4NG2 A;  4M3K A;  3IF6 C;  3KSH A;  1OTB A;  2EFX A;  2ZM0 A;  2ZBB A;  3CPT A;  4WUJ A;  4S2N C;  2HGV A;  1YM1 A;  2A2L A;  2V1A A;  5E2F A;  3ZG0 A;  3LEZ A;  2WK0 A;  4I38 A;  2D01 A;  4KQR A;  3NDE A;  1JWV A;  2NUT C;  4LCL A;  5FAQ A;  5HD5 A;  3SOI A;  5CHM A;  2ZM2 A;  4JXG A; 
#chains in the Genus database with same CATH homology
 5J4E A;  3H7W B;  5F6A A;  1V9Z A;  1TS0 A;  4NXE A;  3GEC A;  2YKH A;  3KYQ A;  4IUK A;  3MFX A;  2CMN A;  1YKD A;  4L9G A;  3BJN A;  4G3V A;  4Y5F A;  1JNU A;  3CWF A;  3F1P B;  5TBM B;  3K3D A;  2W27 A;  1VHM A;  3MMH A;  3O5Y A;  1N9O A;  4MN5 A;  3R7W A;  2HJE A;  4MN7 A;  2PDR A;  2PR5 A;  3T4T A;  5HL6 A;  3VE4 A;  1G28 A;  2GNX A;  3LIA A;  1OT6 A;  4UQI M;  1NRJ A;  4LLO B;  1LT0 A;  2M7V A;  1MZU A;  1STZ A;  4XT2 A;  3BQ8 A;  2O0Y A;  3LIE A;  1EW0 A;  1LSW A;  3UB8 A;  3K3C A;  2W3G A;  3IBR A;  5HPI A;  4OOM A;  1T18 A;  4LPZ A;  3T4L A;  4PKY G;  2VLG A;  4WLA A;  2WKR A;  3T50 A;  3PR6 A;  4K08 A;  4UEY A;  4MMN A;  2L4R A;  3NOU C;  1IFQ A;  3V67 A;  3RH8 B;  1UWP X;  2HV1 A;  4BWI A;  3ICY A;  4YNR A;  4FOF A;  3K2N A;  4AFI A;  4DJ3 A;  4HHD A;  2KLI A;  4MCW A;  3IS2 A;  2OAP 1;  2R78 A;  5F5Y A;  1XFQ A;  2OAQ 1;  3R4K A;  4HP9 A;  1TS6 A;  2FH5 A;  2L0W A;  1X0O A;  2VV8 A;  1T19 A;  4GS9 B;  2XA7 M;  1WA9 A;  3H82 B;  3F1O B;  3F1O A;  1DP9 A;  1YAX A;  2XRN A;  4HJ6 A;  4EEU A;  4EER A;  4GHI A;  3UB7 A;  3A0S A;  2P04 A;  3KX0 X;  4F3L B;  1TS8 A;  4ARZ B;  3KSF A;  4ARZ A;  3B47 A;  4MN6 A;  4R6L A;  3PXP A;  3VOL A;  1DP8 A;  4Z1W A;  2O99 A;  2QJ5 A;  3UME A;  5IS1 A;  2ZOI A;  1T1B A;  3B42 A;  2W1T B;  3E0Y A;  4WEL A;  3TRC A;  2QJ7 A;  2W1T A;  4WF0 A;  4E04 A;  4HH2 A;  4KQD A;  2JHE A;  3EWK A;  1IOU A;  2PD8 A;  2VZW A;  5HDD A;  2GX5 A;  4P6Z M;  1TD5 A;  4EW7 A;  3H9W A;  4ETZ A;  3LI9 A;  3LUQ A;  3HJI A;  4DMZ A;  3OOV A;  4HP4 A;  4H6J A;  2M1C A;  3H7W A;  4HJ3 A;  3PBQ A;  4BMW A;  3OBF A;  4JGQ A;  3LID A;  3T4O A;  5HPF A;  4EET B;  5DFX A;  4II7 A;  5AVF A;  1YSP A;  3IBJ A;  4HI4 A;  2A24 B;  4PAU A;  4JGO A;  3CLO A;  3F1P A;  4UQI S;  5TBM A;  3C8C A;  1VB6 A;  1GSX A;  3EGX C;  2P7J A;  4WEK A;  3W2Z A;  4I3A A;  2VGL M;  4HIA A;  1OTE A;  2JKT I;  1OTI A;  4EU0 A;  2J3T C;  3EGD C;  2D02 A;  3T4S A;  4B9O A;  4CLC D;  3DBA A;  2BAS A;  1N9N A;  4Q0H A;  4JGR A;  5HWV A;  2EA9 A;  3E4Q A;  3BY8 A;  1D06 A;  2OOL A;  3FPW A;  3LR3 A;  2WKP A;  1XJ3 A;  3OLO A;  2ZOH A;  4O0P A;  3PBO A;  3PBR A;  1GSW A;  1MC0 A;  3LR0 A;  3T4J A;  3HCY A;  2B18 A;  4I39 A;  4GCZ A;  1G6O A;  1OT9 A;  5HWT A;  5DF9 A;  4BJP A;  1NLZ A;  2VJW A;  4L9F A;  1N9L A;  2G7U A;  4KQO A;  5DKL A;  4BBU A;  1KOU A;  2MJ6 A;  2INW A;  4FSF A;  3MJQ A;  2W0N A;  3U2A A;  2H28 A;  2ZMV A;  1P97 A;  2OWH A;  4Q0J A;  1D7E A;  2V0W A;  4GJ4 A;  5IU1 A;  1LSX A;  5EFW A;  1NLY A;  2K2N A;  4ME4 A;  4WL9 A;  3OCL A;  1H3Q A;  3RTY A;  4Q0I A;  4O8G A;  3UE6 A;  1V9Y A;  2VX8 A;  3MQO A;  3ZYT A;  4CLC B;  4EEP A;  2KOI A;  1W63 M;  2JKR M;  5K5B A;  2I9V A;  4EQ1 A;  2O9C A;  3MXQ A;  4KUK A;  2GJ3 A;  4Y2F A;  3NOP C;  3FPV A;  2LB9 A;  3CAX A;  1UGU A;  3NJA A;  3NHQ A;  4GS9 A;  3H82 A;  5F69 A;  1LSV A;  3UE3 A;  1F9I A;  3LYX A;  4MDZ A;  4NXF A;  5I5L A;  1LL8 A;  4Y3I A;  1XJ2 A;  3PBT A;  2VV6 A;  2P08 A;  5LBR A;  1GSV A;  4L0L A;  1XJ6 A;  3EOI A;  1Y28 A;  4F3L A;  1NWZ A;  1P9R A;  2EWW A;  3D3O A;  5J7E A;  2Y8H A;  2WKQ A;  5FL3 A;  5HDC A;  5HD3 A;  2ZMF A;  2K31 A;  2YKF A;  2W3H A;  2Z6C A;  3VV4 A;  4P6Z S;  3S7P A;  4HNB A;  2NUP C;  1OJG A;  4WEJ A;  1BYW A;  3C30 A;  4EUV A;  2HF6 A;  4NKP A;  4YOF A;  1OPX A;  3A0R A;  2J3T D;  2QKP A;  5CX7 A;  2L1M A;  2EWV A;  5DFY A;  2QYB A;  4YWZ A;  3CUE A;  1S4R A;  2HJ9 C;  4QPR A;  1OTA A;  4NXB A;  1XFN A;  1ZTU A;  5KIZ A;  5DJU A;  1OJ5 A;  4LRY C;  3CUE C;  3EQU A;  4IHQ A;  4CLC E;  3JVV A;  5HWW A;  4ETX A;  2KDK A;  2V9A A;  2VGL S;  3G6O A;  2FZ0 A;  3UB9 A;  2B02 A;  4G3W A;  2Y79 A;  1T1A A;  4R3A A;  4ZRR A;  1P0Z A;  3S7Q A;  3BY9 A;  2A24 A;  3KO6 A;  4WN5 A;  4KUO A;  5G4Z A;  5F68 A;  1H8M A;  3EQV A;  3SW1 A;  5HDS A;  4PHT A;  1S66 L;  3JVU A;  4CQH A;  3E98 A;  1T1C A;  5A8B A;  4I3J A;  4B93 A;  2PYR A;  1W63 Q;  5HSQ A;  3ZQ5 A;  4HY8 A;  3R7W B;  3MQQ A;  2JN7 A;  4OOL A;  3NOT C;  1S67 L;  2W1R A;  1DP6 A;  4GLQ A;  3BW6 A;  4HJ4 A;  3CIT A;  4R70 A;  3UB6 A;  4IUH A;  2IA2 A;  1F98 A;  2V0U A;  2O9B A;  4JGP A;  3OC2 A;  3T4K A;  4XT2 B;  1TF1 A;  3TW8 A;  3BWL A;  3PBN A;  5TJJ A;  3C2W A;  4GW9 A;  4M4X A;  4DJ2 A;  3LR5 A;  3FC7 A;  2KX6 A;  3EEH A;  4HH3 A;  4NXG A;  3GDI A;  3TE8 A;  4IJG A;  3A0V A;  2XA7 S;  3KSI A;  3LR4 A;  3MF0 A;  3S7N A;  2O9A A;  3PBS A;  3S7O A;  4CLC A;  4NEE D;  3F1N B;  2J3W A;  1UWN X;  2VEA A;  3F1N A;  1TS7 A;  4I3I A;  1P9W A;  2PR6 A;  3BQA A;  4CLC C;  4HOI A;  5KSH A;  2W3D A;  3IS2 B;  3OCN A;  3CI6 A;  1S1Y A;  2VKS A;  4O01 A;  3T4Q A;  3MR0 A;  2QWS A;  2XRO A;  4R38 A;  3MQ0 A;  3KSG A;  1DRM A;  3B33 A;  4EES A;  4PKY A;  4LRX C;  3C38 A;  3LIF A;  2Z6D A;  5L8M A;  3P01 A;  5MC7 A;  3VE3 A;  5AVE A;  3E4P A;  4DN0 A;  3PYP A;  2K7S A;  2PT7 A;  4LRZ E;  1ZHH B;  2PHY A;  3ULF A;  3LI8 A;  5HZH A;  2XSS A;  5DJT A;  5G4Y A;  2J80 A;  2GZA A;  1OTD A;  4I5S A;  2W3F A;  2VV7 A;  1ODV A;  4GHI B;  4BBV A;  2PYP A;  2DMW A;  1S1Z A;  3D72 A;  2PD7 A;  2QHK A;  3TJZ C;  5DKK A;  5J3W A;  4EXO A;  2OWJ A;  4L9E A;  3LIC A;  3LIB A;  3KSH A;  4BBT A;  2JKT M;  1OTB A;  3P7N A;  2ZBB A;  2M7U A;  2JKR I;  1F5M A;  4WUJ A;  2HGV A;  3PHY A;  1YSQ A;  2A2L A;  2V1A A;  4G3K A;  4HQA A;  1MKM A;  2VA0 A;  4I38 A;  2V1B A;  3FG8 A;  3KYZ A;  2D01 A;  3E4O A;  5C5K A;  1S4S A;  3EEA A;  3LFV A;  1XJ4 A;  3RFB A;  2W3E A;  2NUT C;  5AJG A;  3HJK A;  5IT5 A;  3UMD A;  2LB5 A;  5HD5 A;  4RQ9 A;  4H6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...